data_5XS0
# 
_entry.id   5XS0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5XS0         
WWPDB D_1300004063 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5XS0 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Saotome, M.'    1 ? 
'Saito, K.'      2 ? 
'Yasuda, T.'     3 ? 
'Sugiyama, S.'   4 ? 
'Kurumizaka, H.' 5 ? 
'Kagawa, W.'     6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            iScience 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2589-0042 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            3 
_citation.language                  ? 
_citation.page_first                50 
_citation.page_last                 62 
_citation.title                     'Structural Basis of Homology-Directed DNA Repair Mediated by RAD52' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.isci.2018.04.005 
_citation.pdbx_database_id_PubMed   30428330 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Saotome, M.'    1 ? 
primary 'Saito, K.'      2 ? 
primary 'Yasuda, T.'     3 ? 
primary 'Ohtomo, H.'     4 ? 
primary 'Sugiyama, S.'   5 ? 
primary 'Nishimura, Y.'  6 ? 
primary 'Kurumizaka, H.' 7 ? 
primary 'Kagawa, W.'     8 ? 
# 
_cell.entry_id           5XS0 
_cell.length_a           100.224 
_cell.length_b           164.408 
_cell.length_c           166.087 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.19 
_cell.angle_gamma        90.00 
_cell.Z_PDB              44 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5XS0 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA repair protein RAD52 homolog'               23713.785 22 ? ? 'UNP residues 1-212' ? 
2 polymer syn 
;ssDNA (5'-D(*CP*CP*CP*CP*CP*C)-3')
;
1690.133  1  ? ? ?                    ? 
3 polymer syn 
;ssDNA (5'-D(*CP*CP*CP*CP*CP*CP*CP*C)-3')
;
2268.497  1  ? ? ?                    ? 
4 polymer syn 
;ssDNA (5'-D(*CP*CP*CP*CP*CP*CP*CP*CP*CP*C)-3')
;
2846.861  1  ? ? ?                    ? 
5 polymer syn 
;ssDNA (5'-D(*CP*CP*CP*CP*CP*CP*CP*CP*C)-3')
;
2557.679  1  ? ? ?                    ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANE
MFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRS
FGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
;GSHMSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANE
MFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRS
FGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V ? 
2 polydeoxyribonucleotide no no '(DC)(DC)(DC)(DC)(DC)(DC)' CCCCCC W                                           ? 
3 polydeoxyribonucleotide no no '(DC)(DC)(DC)(DC)(DC)(DC)(DC)(DC)' CCCCCCCC X                                           ? 
4 polydeoxyribonucleotide no no '(DC)(DC)(DC)(DC)(DC)(DC)(DC)(DC)(DC)(DC)' CCCCCCCCCC Y                                           
? 
5 polydeoxyribonucleotide no no '(DC)(DC)(DC)(DC)(DC)(DC)(DC)(DC)(DC)' CCCCCCCCC Z                                           ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   GLY n 
1 7   THR n 
1 8   GLU n 
1 9   GLU n 
1 10  ALA n 
1 11  ILE n 
1 12  LEU n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  ASP n 
1 17  SER n 
1 18  HIS n 
1 19  PRO n 
1 20  ALA n 
1 21  ALA n 
1 22  GLY n 
1 23  GLY n 
1 24  GLY n 
1 25  SER n 
1 26  VAL n 
1 27  LEU n 
1 28  CYS n 
1 29  PHE n 
1 30  GLY n 
1 31  GLN n 
1 32  CYS n 
1 33  GLN n 
1 34  TYR n 
1 35  THR n 
1 36  ALA n 
1 37  GLU n 
1 38  GLU n 
1 39  TYR n 
1 40  GLN n 
1 41  ALA n 
1 42  ILE n 
1 43  GLN n 
1 44  LYS n 
1 45  ALA n 
1 46  LEU n 
1 47  ARG n 
1 48  GLN n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  TYR n 
1 55  ILE n 
1 56  SER n 
1 57  SER n 
1 58  ARG n 
1 59  MET n 
1 60  ALA n 
1 61  GLY n 
1 62  GLY n 
1 63  GLY n 
1 64  GLN n 
1 65  LYS n 
1 66  VAL n 
1 67  CYS n 
1 68  TYR n 
1 69  ILE n 
1 70  GLU n 
1 71  GLY n 
1 72  HIS n 
1 73  ARG n 
1 74  VAL n 
1 75  ILE n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ASN n 
1 80  GLU n 
1 81  MET n 
1 82  PHE n 
1 83  GLY n 
1 84  TYR n 
1 85  ASN n 
1 86  GLY n 
1 87  TRP n 
1 88  ALA n 
1 89  HIS n 
1 90  SER n 
1 91  ILE n 
1 92  THR n 
1 93  GLN n 
1 94  GLN n 
1 95  ASN n 
1 96  VAL n 
1 97  ASP n 
1 98  PHE n 
1 99  VAL n 
1 100 ASP n 
1 101 LEU n 
1 102 ASN n 
1 103 ASN n 
1 104 GLY n 
1 105 LYS n 
1 106 PHE n 
1 107 TYR n 
1 108 VAL n 
1 109 GLY n 
1 110 VAL n 
1 111 CYS n 
1 112 ALA n 
1 113 PHE n 
1 114 VAL n 
1 115 ARG n 
1 116 VAL n 
1 117 GLN n 
1 118 LEU n 
1 119 LYS n 
1 120 ASP n 
1 121 GLY n 
1 122 SER n 
1 123 TYR n 
1 124 HIS n 
1 125 GLU n 
1 126 ASP n 
1 127 VAL n 
1 128 GLY n 
1 129 TYR n 
1 130 GLY n 
1 131 VAL n 
1 132 SER n 
1 133 GLU n 
1 134 GLY n 
1 135 LEU n 
1 136 LYS n 
1 137 SER n 
1 138 LYS n 
1 139 ALA n 
1 140 LEU n 
1 141 SER n 
1 142 LEU n 
1 143 GLU n 
1 144 LYS n 
1 145 ALA n 
1 146 ARG n 
1 147 LYS n 
1 148 GLU n 
1 149 ALA n 
1 150 VAL n 
1 151 THR n 
1 152 ASP n 
1 153 GLY n 
1 154 LEU n 
1 155 LYS n 
1 156 ARG n 
1 157 ALA n 
1 158 LEU n 
1 159 ARG n 
1 160 SER n 
1 161 PHE n 
1 162 GLY n 
1 163 ASN n 
1 164 ALA n 
1 165 LEU n 
1 166 GLY n 
1 167 ASN n 
1 168 CYS n 
1 169 ILE n 
1 170 LEU n 
1 171 ASP n 
1 172 LYS n 
1 173 ASP n 
1 174 TYR n 
1 175 LEU n 
1 176 ARG n 
1 177 SER n 
1 178 LEU n 
1 179 ASN n 
1 180 LYS n 
1 181 LEU n 
1 182 PRO n 
1 183 ARG n 
1 184 GLN n 
1 185 LEU n 
1 186 PRO n 
1 187 LEU n 
1 188 GLU n 
1 189 VAL n 
1 190 ASP n 
1 191 LEU n 
1 192 THR n 
1 193 LYS n 
1 194 ALA n 
1 195 LYS n 
1 196 ARG n 
1 197 GLN n 
1 198 ASP n 
1 199 LEU n 
1 200 GLU n 
1 201 PRO n 
1 202 SER n 
1 203 VAL n 
1 204 GLU n 
1 205 GLU n 
1 206 ALA n 
1 207 ARG n 
1 208 TYR n 
1 209 ASN n 
1 210 SER n 
1 211 CYS n 
1 212 ARG n 
1 213 PRO n 
1 214 ASN n 
1 215 MET n 
2 1   DC  n 
2 2   DC  n 
2 3   DC  n 
2 4   DC  n 
2 5   DC  n 
2 6   DC  n 
3 1   DC  n 
3 2   DC  n 
3 3   DC  n 
3 4   DC  n 
3 5   DC  n 
3 6   DC  n 
3 7   DC  n 
3 8   DC  n 
4 1   DC  n 
4 2   DC  n 
4 3   DC  n 
4 4   DC  n 
4 5   DC  n 
4 6   DC  n 
4 7   DC  n 
4 8   DC  n 
4 9   DC  n 
4 10  DC  n 
5 1   DC  n 
5 2   DC  n 
5 3   DC  n 
5 4   DC  n 
5 5   DC  n 
5 6   DC  n 
5 7   DC  n 
5 8   DC  n 
5 9   DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   215 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 RAD52 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM109(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 6  'synthetic construct' ? 32630 ? 
3 1 sample 1 8  'synthetic construct' ? 32630 ? 
4 1 sample 1 10 'synthetic construct' ? 32630 ? 
5 1 sample 1 9  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RAD52_HUMAN P43351 ? 1 
;MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFG
YNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGN
ALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
1 
2 PDB 5XS0        5XS0   ? 2 ? 1 
3 PDB 5XS0        5XS0   ? 3 ? 1 
4 PDB 5XS0        5XS0   ? 4 ? 1 
5 PDB 5XS0        5XS0   ? 5 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5XS0 A 4 ? 215 ? P43351 1 ? 212 ? 1 212 
2  1 5XS0 B 4 ? 215 ? P43351 1 ? 212 ? 1 212 
3  1 5XS0 C 4 ? 215 ? P43351 1 ? 212 ? 1 212 
4  1 5XS0 D 4 ? 215 ? P43351 1 ? 212 ? 1 212 
5  1 5XS0 E 4 ? 215 ? P43351 1 ? 212 ? 1 212 
6  1 5XS0 F 4 ? 215 ? P43351 1 ? 212 ? 1 212 
7  1 5XS0 G 4 ? 215 ? P43351 1 ? 212 ? 1 212 
8  1 5XS0 H 4 ? 215 ? P43351 1 ? 212 ? 1 212 
9  1 5XS0 I 4 ? 215 ? P43351 1 ? 212 ? 1 212 
10 1 5XS0 J 4 ? 215 ? P43351 1 ? 212 ? 1 212 
11 1 5XS0 K 4 ? 215 ? P43351 1 ? 212 ? 1 212 
12 1 5XS0 L 4 ? 215 ? P43351 1 ? 212 ? 1 212 
13 1 5XS0 M 4 ? 215 ? P43351 1 ? 212 ? 1 212 
14 1 5XS0 N 4 ? 215 ? P43351 1 ? 212 ? 1 212 
15 1 5XS0 O 4 ? 215 ? P43351 1 ? 212 ? 1 212 
16 1 5XS0 P 4 ? 215 ? P43351 1 ? 212 ? 1 212 
17 1 5XS0 Q 4 ? 215 ? P43351 1 ? 212 ? 1 212 
18 1 5XS0 R 4 ? 215 ? P43351 1 ? 212 ? 1 212 
19 1 5XS0 S 4 ? 215 ? P43351 1 ? 212 ? 1 212 
20 1 5XS0 T 4 ? 215 ? P43351 1 ? 212 ? 1 212 
21 1 5XS0 U 4 ? 215 ? P43351 1 ? 212 ? 1 212 
22 1 5XS0 V 4 ? 215 ? P43351 1 ? 212 ? 1 212 
23 2 5XS0 W 1 ? 6   ? 5XS0   1 ? 6   ? 1 6   
24 3 5XS0 X 1 ? 8   ? 5XS0   1 ? 8   ? 1 8   
25 4 5XS0 Y 1 ? 10  ? 5XS0   1 ? 10  ? 1 10  
26 5 5XS0 Z 1 ? 9   ? 5XS0   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5XS0 GLY A 1 ? UNP P43351 ? ? 'expression tag' -2 1  
1  5XS0 SER A 2 ? UNP P43351 ? ? 'expression tag' -1 2  
1  5XS0 HIS A 3 ? UNP P43351 ? ? 'expression tag' 0  3  
2  5XS0 GLY B 1 ? UNP P43351 ? ? 'expression tag' -2 4  
2  5XS0 SER B 2 ? UNP P43351 ? ? 'expression tag' -1 5  
2  5XS0 HIS B 3 ? UNP P43351 ? ? 'expression tag' 0  6  
3  5XS0 GLY C 1 ? UNP P43351 ? ? 'expression tag' -2 7  
3  5XS0 SER C 2 ? UNP P43351 ? ? 'expression tag' -1 8  
3  5XS0 HIS C 3 ? UNP P43351 ? ? 'expression tag' 0  9  
4  5XS0 GLY D 1 ? UNP P43351 ? ? 'expression tag' -2 10 
4  5XS0 SER D 2 ? UNP P43351 ? ? 'expression tag' -1 11 
4  5XS0 HIS D 3 ? UNP P43351 ? ? 'expression tag' 0  12 
5  5XS0 GLY E 1 ? UNP P43351 ? ? 'expression tag' -2 13 
5  5XS0 SER E 2 ? UNP P43351 ? ? 'expression tag' -1 14 
5  5XS0 HIS E 3 ? UNP P43351 ? ? 'expression tag' 0  15 
6  5XS0 GLY F 1 ? UNP P43351 ? ? 'expression tag' -2 16 
6  5XS0 SER F 2 ? UNP P43351 ? ? 'expression tag' -1 17 
6  5XS0 HIS F 3 ? UNP P43351 ? ? 'expression tag' 0  18 
7  5XS0 GLY G 1 ? UNP P43351 ? ? 'expression tag' -2 19 
7  5XS0 SER G 2 ? UNP P43351 ? ? 'expression tag' -1 20 
7  5XS0 HIS G 3 ? UNP P43351 ? ? 'expression tag' 0  21 
8  5XS0 GLY H 1 ? UNP P43351 ? ? 'expression tag' -2 22 
8  5XS0 SER H 2 ? UNP P43351 ? ? 'expression tag' -1 23 
8  5XS0 HIS H 3 ? UNP P43351 ? ? 'expression tag' 0  24 
9  5XS0 GLY I 1 ? UNP P43351 ? ? 'expression tag' -2 25 
9  5XS0 SER I 2 ? UNP P43351 ? ? 'expression tag' -1 26 
9  5XS0 HIS I 3 ? UNP P43351 ? ? 'expression tag' 0  27 
10 5XS0 GLY J 1 ? UNP P43351 ? ? 'expression tag' -2 28 
10 5XS0 SER J 2 ? UNP P43351 ? ? 'expression tag' -1 29 
10 5XS0 HIS J 3 ? UNP P43351 ? ? 'expression tag' 0  30 
11 5XS0 GLY K 1 ? UNP P43351 ? ? 'expression tag' -2 31 
11 5XS0 SER K 2 ? UNP P43351 ? ? 'expression tag' -1 32 
11 5XS0 HIS K 3 ? UNP P43351 ? ? 'expression tag' 0  33 
12 5XS0 GLY L 1 ? UNP P43351 ? ? 'expression tag' -2 34 
12 5XS0 SER L 2 ? UNP P43351 ? ? 'expression tag' -1 35 
12 5XS0 HIS L 3 ? UNP P43351 ? ? 'expression tag' 0  36 
13 5XS0 GLY M 1 ? UNP P43351 ? ? 'expression tag' -2 37 
13 5XS0 SER M 2 ? UNP P43351 ? ? 'expression tag' -1 38 
13 5XS0 HIS M 3 ? UNP P43351 ? ? 'expression tag' 0  39 
14 5XS0 GLY N 1 ? UNP P43351 ? ? 'expression tag' -2 40 
14 5XS0 SER N 2 ? UNP P43351 ? ? 'expression tag' -1 41 
14 5XS0 HIS N 3 ? UNP P43351 ? ? 'expression tag' 0  42 
15 5XS0 GLY O 1 ? UNP P43351 ? ? 'expression tag' -2 43 
15 5XS0 SER O 2 ? UNP P43351 ? ? 'expression tag' -1 44 
15 5XS0 HIS O 3 ? UNP P43351 ? ? 'expression tag' 0  45 
16 5XS0 GLY P 1 ? UNP P43351 ? ? 'expression tag' -2 46 
16 5XS0 SER P 2 ? UNP P43351 ? ? 'expression tag' -1 47 
16 5XS0 HIS P 3 ? UNP P43351 ? ? 'expression tag' 0  48 
17 5XS0 GLY Q 1 ? UNP P43351 ? ? 'expression tag' -2 49 
17 5XS0 SER Q 2 ? UNP P43351 ? ? 'expression tag' -1 50 
17 5XS0 HIS Q 3 ? UNP P43351 ? ? 'expression tag' 0  51 
18 5XS0 GLY R 1 ? UNP P43351 ? ? 'expression tag' -2 52 
18 5XS0 SER R 2 ? UNP P43351 ? ? 'expression tag' -1 53 
18 5XS0 HIS R 3 ? UNP P43351 ? ? 'expression tag' 0  54 
19 5XS0 GLY S 1 ? UNP P43351 ? ? 'expression tag' -2 55 
19 5XS0 SER S 2 ? UNP P43351 ? ? 'expression tag' -1 56 
19 5XS0 HIS S 3 ? UNP P43351 ? ? 'expression tag' 0  57 
20 5XS0 GLY T 1 ? UNP P43351 ? ? 'expression tag' -2 58 
20 5XS0 SER T 2 ? UNP P43351 ? ? 'expression tag' -1 59 
20 5XS0 HIS T 3 ? UNP P43351 ? ? 'expression tag' 0  60 
21 5XS0 GLY U 1 ? UNP P43351 ? ? 'expression tag' -2 61 
21 5XS0 SER U 2 ? UNP P43351 ? ? 'expression tag' -1 62 
21 5XS0 HIS U 3 ? UNP P43351 ? ? 'expression tag' 0  63 
22 5XS0 GLY V 1 ? UNP P43351 ? ? 'expression tag' -2 64 
22 5XS0 SER V 2 ? UNP P43351 ? ? 'expression tag' -1 65 
22 5XS0 HIS V 3 ? UNP P43351 ? ? 'expression tag' 0  66 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'   121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5XS0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.59 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.55 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            285 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'lithium citrate, PEG 3,350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-03-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'NUMERICAL LINK TYPE SI(111) DOUBLE CRYSTAL MONOCHROMATOR' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            91 
_reflns.entry_id                         5XS0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.0 
_reflns.d_resolution_low                 48.63 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       107806 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       0.0 
_reflns.observed_criterion_sigma_I       0.0 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.083 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.00 
_reflns_shell.d_res_low                   3.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5281 
_reflns_shell.percent_possible_all        98.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.8 
_reflns_shell.pdbx_Rsym_value             0.686 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.733 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5XS0 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     107485 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.529 
_refine.ls_d_res_high                            3.000 
_refine.ls_percent_reflns_obs                    99.90 
_refine.ls_R_factor_obs                          0.2225 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2210 
_refine.ls_R_factor_R_free                       0.2506 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.83 
_refine.ls_number_reflns_R_free                  5188 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1KN0 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.39 
_refine.pdbx_overall_phase_error                 28.34 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31852 
_refine_hist.pdbx_number_atoms_nucleic_acid   615 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               32467 
_refine_hist.d_res_high                       3.000 
_refine_hist.d_res_low                        48.529 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 33055 'X-RAY DIFFRACTION' ? 
f_angle_d          0.571  ? ? 44554 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.608 ? ? 19898 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 4720  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 5803  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.0000 3.0341  3403 0.3136 98.00  0.3525 . . 156 . . 
'X-RAY DIFFRACTION' . 3.0341 3.0698  3390 0.3042 100.00 0.3310 . . 152 . . 
'X-RAY DIFFRACTION' . 3.0698 3.1072  3357 0.3029 100.00 0.3516 . . 206 . . 
'X-RAY DIFFRACTION' . 3.1072 3.1466  3401 0.2956 100.00 0.3369 . . 199 . . 
'X-RAY DIFFRACTION' . 3.1466 3.1879  3374 0.2945 100.00 0.3325 . . 150 . . 
'X-RAY DIFFRACTION' . 3.1879 3.2316  3460 0.2900 100.00 0.3051 . . 155 . . 
'X-RAY DIFFRACTION' . 3.2316 3.2778  3407 0.2771 100.00 0.3157 . . 130 . . 
'X-RAY DIFFRACTION' . 3.2778 3.3267  3421 0.2759 100.00 0.3596 . . 156 . . 
'X-RAY DIFFRACTION' . 3.3267 3.3787  3392 0.2668 100.00 0.2749 . . 183 . . 
'X-RAY DIFFRACTION' . 3.3787 3.4340  3399 0.2568 100.00 0.2972 . . 187 . . 
'X-RAY DIFFRACTION' . 3.4340 3.4932  3399 0.2565 100.00 0.2972 . . 171 . . 
'X-RAY DIFFRACTION' . 3.4932 3.5567  3392 0.2481 100.00 0.3057 . . 157 . . 
'X-RAY DIFFRACTION' . 3.5567 3.6251  3418 0.2570 100.00 0.3073 . . 185 . . 
'X-RAY DIFFRACTION' . 3.6251 3.6991  3388 0.2527 100.00 0.2946 . . 194 . . 
'X-RAY DIFFRACTION' . 3.6991 3.7795  3415 0.2366 100.00 0.2772 . . 139 . . 
'X-RAY DIFFRACTION' . 3.7795 3.8674  3448 0.2378 100.00 0.2784 . . 153 . . 
'X-RAY DIFFRACTION' . 3.8674 3.9641  3382 0.2241 100.00 0.2818 . . 171 . . 
'X-RAY DIFFRACTION' . 3.9641 4.0712  3353 0.2422 100.00 0.2786 . . 207 . . 
'X-RAY DIFFRACTION' . 4.0712 4.1909  3468 0.2144 100.00 0.2439 . . 162 . . 
'X-RAY DIFFRACTION' . 4.1909 4.3261  3396 0.1975 100.00 0.2186 . . 178 . . 
'X-RAY DIFFRACTION' . 4.3261 4.4806  3427 0.1935 100.00 0.2452 . . 146 . . 
'X-RAY DIFFRACTION' . 4.4806 4.6599  3378 0.1826 100.00 0.2061 . . 194 . . 
'X-RAY DIFFRACTION' . 4.6599 4.8718  3429 0.1815 100.00 0.2129 . . 159 . . 
'X-RAY DIFFRACTION' . 4.8718 5.1284  3412 0.1923 100.00 0.2142 . . 176 . . 
'X-RAY DIFFRACTION' . 5.1284 5.4493  3383 0.1911 100.00 0.2192 . . 206 . . 
'X-RAY DIFFRACTION' . 5.4493 5.8693  3435 0.1946 100.00 0.1933 . . 188 . . 
'X-RAY DIFFRACTION' . 5.8693 6.4588  3454 0.2196 100.00 0.2510 . . 147 . . 
'X-RAY DIFFRACTION' . 6.4588 7.3906  3362 0.1911 100.00 0.2273 . . 227 . . 
'X-RAY DIFFRACTION' . 7.3906 9.3006  3463 0.1837 100.00 0.1984 . . 183 . . 
'X-RAY DIFFRACTION' . 9.3006 48.5357 3491 0.1987 100.00 0.2141 . . 171 . . 
# 
_struct.entry_id                     5XS0 
_struct.title                        'Structure of a ssDNA bound to the outer DNA binding site of RAD52' 
_struct.pdbx_descriptor              'DNA repair protein RAD52 homolog/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5XS0 
_struct_keywords.text            'Protein-DNA complex, ssDNA annealing protein, DNA repair protein, RECOMBINATION' 
_struct_keywords.pdbx_keywords   RECOMBINATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 1 ? 
M N N 1 ? 
N N N 1 ? 
O N N 1 ? 
P N N 1 ? 
Q N N 1 ? 
R N N 1 ? 
S N N 1 ? 
T N N 1 ? 
U N N 1 ? 
V N N 1 ? 
W N N 2 ? 
X N N 3 ? 
Y N N 4 ? 
Z N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A 35  ? GLN A 48  ? THR A 32  GLN A 45  1 ? 14 
HELX_P HELX_P2   AA2 GLU A 70  ? GLY A 83  ? GLU A 67  GLY A 80  1 ? 14 
HELX_P HELX_P3   AA3 SER A 137 ? SER A 160 ? SER A 134 SER A 157 1 ? 24 
HELX_P HELX_P4   AA4 PHE A 161 ? LEU A 170 ? PHE A 158 LEU A 167 5 ? 10 
HELX_P HELX_P5   AA5 ASP A 171 ? LYS A 180 ? ASP A 168 LYS A 177 1 ? 10 
HELX_P HELX_P6   AA6 ASP A 190 ? ALA A 194 ? ASP A 187 ALA A 191 5 ? 5  
HELX_P HELX_P7   AA7 GLU A 200 ? ASN A 209 ? GLU A 197 ASN A 206 1 ? 10 
HELX_P HELX_P8   AA8 THR B 35  ? GLN B 48  ? THR B 32  GLN B 45  1 ? 14 
HELX_P HELX_P9   AA9 GLU B 70  ? GLY B 83  ? GLU B 67  GLY B 80  1 ? 14 
HELX_P HELX_P10  AB1 SER B 137 ? SER B 160 ? SER B 134 SER B 157 1 ? 24 
HELX_P HELX_P11  AB2 PHE B 161 ? GLY B 166 ? PHE B 158 GLY B 163 5 ? 6  
HELX_P HELX_P12  AB3 ASN B 167 ? LEU B 170 ? ASN B 164 LEU B 167 5 ? 4  
HELX_P HELX_P13  AB4 ASP B 171 ? LYS B 180 ? ASP B 168 LYS B 177 1 ? 10 
HELX_P HELX_P14  AB5 ASP B 190 ? ALA B 194 ? ASP B 187 ALA B 191 5 ? 5  
HELX_P HELX_P15  AB6 GLU B 200 ? ASN B 209 ? GLU B 197 ASN B 206 1 ? 10 
HELX_P HELX_P16  AB7 THR C 35  ? ARG C 47  ? THR C 32  ARG C 44  1 ? 13 
HELX_P HELX_P17  AB8 GLU C 70  ? GLY C 83  ? GLU C 67  GLY C 80  1 ? 14 
HELX_P HELX_P18  AB9 SER C 137 ? SER C 160 ? SER C 134 SER C 157 1 ? 24 
HELX_P HELX_P19  AC1 PHE C 161 ? GLY C 166 ? PHE C 158 GLY C 163 5 ? 6  
HELX_P HELX_P20  AC2 ASN C 167 ? LEU C 170 ? ASN C 164 LEU C 167 5 ? 4  
HELX_P HELX_P21  AC3 ASP C 171 ? LYS C 180 ? ASP C 168 LYS C 177 1 ? 10 
HELX_P HELX_P22  AC4 GLU C 200 ? ASN C 209 ? GLU C 197 ASN C 206 1 ? 10 
HELX_P HELX_P23  AC5 THR D 35  ? GLN D 48  ? THR D 32  GLN D 45  1 ? 14 
HELX_P HELX_P24  AC6 GLU D 70  ? GLY D 83  ? GLU D 67  GLY D 80  1 ? 14 
HELX_P HELX_P25  AC7 SER D 137 ? SER D 160 ? SER D 134 SER D 157 1 ? 24 
HELX_P HELX_P26  AC8 PHE D 161 ? GLY D 166 ? PHE D 158 GLY D 163 5 ? 6  
HELX_P HELX_P27  AC9 ASN D 167 ? LEU D 170 ? ASN D 164 LEU D 167 5 ? 4  
HELX_P HELX_P28  AD1 ASP D 171 ? LYS D 180 ? ASP D 168 LYS D 177 1 ? 10 
HELX_P HELX_P29  AD2 ASP D 190 ? ALA D 194 ? ASP D 187 ALA D 191 5 ? 5  
HELX_P HELX_P30  AD3 GLU D 200 ? ASN D 209 ? GLU D 197 ASN D 206 1 ? 10 
HELX_P HELX_P31  AD4 THR E 35  ? GLN E 48  ? THR E 32  GLN E 45  1 ? 14 
HELX_P HELX_P32  AD5 GLU E 70  ? GLY E 83  ? GLU E 67  GLY E 80  1 ? 14 
HELX_P HELX_P33  AD6 SER E 137 ? SER E 160 ? SER E 134 SER E 157 1 ? 24 
HELX_P HELX_P34  AD7 PHE E 161 ? LEU E 170 ? PHE E 158 LEU E 167 5 ? 10 
HELX_P HELX_P35  AD8 ASP E 171 ? LYS E 180 ? ASP E 168 LYS E 177 1 ? 10 
HELX_P HELX_P36  AD9 ASP E 190 ? ALA E 194 ? ASP E 187 ALA E 191 5 ? 5  
HELX_P HELX_P37  AE1 GLU E 200 ? ASN E 209 ? GLU E 197 ASN E 206 1 ? 10 
HELX_P HELX_P38  AE2 THR F 35  ? GLN F 48  ? THR F 32  GLN F 45  1 ? 14 
HELX_P HELX_P39  AE3 GLU F 70  ? GLY F 83  ? GLU F 67  GLY F 80  1 ? 14 
HELX_P HELX_P40  AE4 SER F 137 ? SER F 160 ? SER F 134 SER F 157 1 ? 24 
HELX_P HELX_P41  AE5 PHE F 161 ? LEU F 170 ? PHE F 158 LEU F 167 5 ? 10 
HELX_P HELX_P42  AE6 ASP F 171 ? LYS F 180 ? ASP F 168 LYS F 177 1 ? 10 
HELX_P HELX_P43  AE7 ASP F 190 ? ALA F 194 ? ASP F 187 ALA F 191 5 ? 5  
HELX_P HELX_P44  AE8 GLU F 200 ? ASN F 209 ? GLU F 197 ASN F 206 1 ? 10 
HELX_P HELX_P45  AE9 THR G 35  ? GLN G 48  ? THR G 32  GLN G 45  1 ? 14 
HELX_P HELX_P46  AF1 GLU G 70  ? GLY G 83  ? GLU G 67  GLY G 80  1 ? 14 
HELX_P HELX_P47  AF2 SER G 137 ? SER G 160 ? SER G 134 SER G 157 1 ? 24 
HELX_P HELX_P48  AF3 PHE G 161 ? LEU G 170 ? PHE G 158 LEU G 167 5 ? 10 
HELX_P HELX_P49  AF4 ASP G 171 ? LYS G 180 ? ASP G 168 LYS G 177 1 ? 10 
HELX_P HELX_P50  AF5 ASP G 190 ? ALA G 194 ? ASP G 187 ALA G 191 5 ? 5  
HELX_P HELX_P51  AF6 GLU G 200 ? ASN G 209 ? GLU G 197 ASN G 206 1 ? 10 
HELX_P HELX_P52  AF7 THR H 35  ? GLN H 48  ? THR H 32  GLN H 45  1 ? 14 
HELX_P HELX_P53  AF8 GLU H 70  ? GLY H 83  ? GLU H 67  GLY H 80  1 ? 14 
HELX_P HELX_P54  AF9 SER H 137 ? SER H 160 ? SER H 134 SER H 157 1 ? 24 
HELX_P HELX_P55  AG1 PHE H 161 ? LEU H 170 ? PHE H 158 LEU H 167 5 ? 10 
HELX_P HELX_P56  AG2 ASP H 171 ? LYS H 180 ? ASP H 168 LYS H 177 1 ? 10 
HELX_P HELX_P57  AG3 ASP H 190 ? ALA H 194 ? ASP H 187 ALA H 191 5 ? 5  
HELX_P HELX_P58  AG4 GLU H 200 ? ASN H 209 ? GLU H 197 ASN H 206 1 ? 10 
HELX_P HELX_P59  AG5 THR I 35  ? LEU I 46  ? THR I 32  LEU I 43  1 ? 12 
HELX_P HELX_P60  AG6 GLU I 70  ? GLY I 83  ? GLU I 67  GLY I 80  1 ? 14 
HELX_P HELX_P61  AG7 SER I 137 ? SER I 160 ? SER I 134 SER I 157 1 ? 24 
HELX_P HELX_P62  AG8 PHE I 161 ? LEU I 170 ? PHE I 158 LEU I 167 5 ? 10 
HELX_P HELX_P63  AG9 ASP I 171 ? LYS I 180 ? ASP I 168 LYS I 177 1 ? 10 
HELX_P HELX_P64  AH1 ASP I 190 ? ALA I 194 ? ASP I 187 ALA I 191 5 ? 5  
HELX_P HELX_P65  AH2 GLU I 200 ? ASN I 209 ? GLU I 197 ASN I 206 1 ? 10 
HELX_P HELX_P66  AH3 THR J 35  ? ARG J 47  ? THR J 32  ARG J 44  1 ? 13 
HELX_P HELX_P67  AH4 GLU J 70  ? GLY J 83  ? GLU J 67  GLY J 80  1 ? 14 
HELX_P HELX_P68  AH5 SER J 137 ? SER J 160 ? SER J 134 SER J 157 1 ? 24 
HELX_P HELX_P69  AH6 PHE J 161 ? GLY J 166 ? PHE J 158 GLY J 163 5 ? 6  
HELX_P HELX_P70  AH7 ASN J 167 ? LEU J 170 ? ASN J 164 LEU J 167 5 ? 4  
HELX_P HELX_P71  AH8 ASP J 171 ? LYS J 180 ? ASP J 168 LYS J 177 1 ? 10 
HELX_P HELX_P72  AH9 ASP J 190 ? ALA J 194 ? ASP J 187 ALA J 191 5 ? 5  
HELX_P HELX_P73  AI1 GLU J 200 ? ASN J 209 ? GLU J 197 ASN J 206 1 ? 10 
HELX_P HELX_P74  AI2 THR K 35  ? LEU K 46  ? THR K 32  LEU K 43  1 ? 12 
HELX_P HELX_P75  AI3 GLU K 70  ? GLY K 83  ? GLU K 67  GLY K 80  1 ? 14 
HELX_P HELX_P76  AI4 SER K 137 ? SER K 160 ? SER K 134 SER K 157 1 ? 24 
HELX_P HELX_P77  AI5 PHE K 161 ? GLY K 166 ? PHE K 158 GLY K 163 5 ? 6  
HELX_P HELX_P78  AI6 ASN K 167 ? LEU K 170 ? ASN K 164 LEU K 167 5 ? 4  
HELX_P HELX_P79  AI7 ASP K 171 ? LYS K 180 ? ASP K 168 LYS K 177 1 ? 10 
HELX_P HELX_P80  AI8 ASP K 190 ? ALA K 194 ? ASP K 187 ALA K 191 5 ? 5  
HELX_P HELX_P81  AI9 GLU K 200 ? ASN K 209 ? GLU K 197 ASN K 206 1 ? 10 
HELX_P HELX_P82  AJ1 THR L 35  ? ARG L 47  ? THR L 32  ARG L 44  1 ? 13 
HELX_P HELX_P83  AJ2 GLU L 70  ? GLY L 83  ? GLU L 67  GLY L 80  1 ? 14 
HELX_P HELX_P84  AJ3 SER L 137 ? SER L 160 ? SER L 134 SER L 157 1 ? 24 
HELX_P HELX_P85  AJ4 PHE L 161 ? GLY L 166 ? PHE L 158 GLY L 163 5 ? 6  
HELX_P HELX_P86  AJ5 ASN L 167 ? LEU L 170 ? ASN L 164 LEU L 167 5 ? 4  
HELX_P HELX_P87  AJ6 ASP L 171 ? LYS L 180 ? ASP L 168 LYS L 177 1 ? 10 
HELX_P HELX_P88  AJ7 ASP L 190 ? ALA L 194 ? ASP L 187 ALA L 191 5 ? 5  
HELX_P HELX_P89  AJ8 GLU L 200 ? ASN L 209 ? GLU L 197 ASN L 206 1 ? 10 
HELX_P HELX_P90  AJ9 THR M 35  ? GLN M 48  ? THR M 32  GLN M 45  1 ? 14 
HELX_P HELX_P91  AK1 GLU M 70  ? GLY M 83  ? GLU M 67  GLY M 80  1 ? 14 
HELX_P HELX_P92  AK2 SER M 137 ? SER M 160 ? SER M 134 SER M 157 1 ? 24 
HELX_P HELX_P93  AK3 PHE M 161 ? GLY M 166 ? PHE M 158 GLY M 163 5 ? 6  
HELX_P HELX_P94  AK4 ASN M 167 ? LEU M 170 ? ASN M 164 LEU M 167 5 ? 4  
HELX_P HELX_P95  AK5 ASP M 171 ? LYS M 180 ? ASP M 168 LYS M 177 1 ? 10 
HELX_P HELX_P96  AK6 ASP M 190 ? ALA M 194 ? ASP M 187 ALA M 191 5 ? 5  
HELX_P HELX_P97  AK7 GLU M 200 ? ASN M 209 ? GLU M 197 ASN M 206 1 ? 10 
HELX_P HELX_P98  AK8 THR N 35  ? GLN N 48  ? THR N 32  GLN N 45  1 ? 14 
HELX_P HELX_P99  AK9 GLU N 70  ? GLY N 83  ? GLU N 67  GLY N 80  1 ? 14 
HELX_P HELX_P100 AL1 SER N 137 ? SER N 160 ? SER N 134 SER N 157 1 ? 24 
HELX_P HELX_P101 AL2 PHE N 161 ? LEU N 170 ? PHE N 158 LEU N 167 5 ? 10 
HELX_P HELX_P102 AL3 ASP N 171 ? LYS N 180 ? ASP N 168 LYS N 177 1 ? 10 
HELX_P HELX_P103 AL4 ASP N 190 ? ALA N 194 ? ASP N 187 ALA N 191 5 ? 5  
HELX_P HELX_P104 AL5 GLU N 200 ? CYS N 211 ? GLU N 197 CYS N 208 1 ? 12 
HELX_P HELX_P105 AL6 THR O 35  ? GLN O 48  ? THR O 32  GLN O 45  1 ? 14 
HELX_P HELX_P106 AL7 GLU O 70  ? GLY O 83  ? GLU O 67  GLY O 80  1 ? 14 
HELX_P HELX_P107 AL8 SER O 137 ? SER O 160 ? SER O 134 SER O 157 1 ? 24 
HELX_P HELX_P108 AL9 PHE O 161 ? GLY O 166 ? PHE O 158 GLY O 163 5 ? 6  
HELX_P HELX_P109 AM1 ASN O 167 ? LEU O 170 ? ASN O 164 LEU O 167 5 ? 4  
HELX_P HELX_P110 AM2 ASP O 171 ? LYS O 180 ? ASP O 168 LYS O 177 1 ? 10 
HELX_P HELX_P111 AM3 ASP O 190 ? ALA O 194 ? ASP O 187 ALA O 191 5 ? 5  
HELX_P HELX_P112 AM4 GLU O 200 ? ASN O 209 ? GLU O 197 ASN O 206 1 ? 10 
HELX_P HELX_P113 AM5 THR P 35  ? GLN P 48  ? THR P 32  GLN P 45  1 ? 14 
HELX_P HELX_P114 AM6 GLU P 70  ? GLY P 83  ? GLU P 67  GLY P 80  1 ? 14 
HELX_P HELX_P115 AM7 SER P 137 ? SER P 160 ? SER P 134 SER P 157 1 ? 24 
HELX_P HELX_P116 AM8 PHE P 161 ? LEU P 170 ? PHE P 158 LEU P 167 5 ? 10 
HELX_P HELX_P117 AM9 ASP P 171 ? LYS P 180 ? ASP P 168 LYS P 177 1 ? 10 
HELX_P HELX_P118 AN1 ASP P 190 ? ALA P 194 ? ASP P 187 ALA P 191 5 ? 5  
HELX_P HELX_P119 AN2 GLU P 200 ? ASN P 209 ? GLU P 197 ASN P 206 1 ? 10 
HELX_P HELX_P120 AN3 THR Q 35  ? LEU Q 46  ? THR Q 32  LEU Q 43  1 ? 12 
HELX_P HELX_P121 AN4 GLU Q 70  ? GLY Q 83  ? GLU Q 67  GLY Q 80  1 ? 14 
HELX_P HELX_P122 AN5 SER Q 137 ? SER Q 160 ? SER Q 134 SER Q 157 1 ? 24 
HELX_P HELX_P123 AN6 PHE Q 161 ? LEU Q 170 ? PHE Q 158 LEU Q 167 5 ? 10 
HELX_P HELX_P124 AN7 ASP Q 171 ? LYS Q 180 ? ASP Q 168 LYS Q 177 1 ? 10 
HELX_P HELX_P125 AN8 ASP Q 190 ? ALA Q 194 ? ASP Q 187 ALA Q 191 5 ? 5  
HELX_P HELX_P126 AN9 GLU Q 200 ? ASN Q 209 ? GLU Q 197 ASN Q 206 1 ? 10 
HELX_P HELX_P127 AO1 THR R 35  ? GLN R 48  ? THR R 32  GLN R 45  1 ? 14 
HELX_P HELX_P128 AO2 GLU R 70  ? GLY R 83  ? GLU R 67  GLY R 80  1 ? 14 
HELX_P HELX_P129 AO3 SER R 137 ? SER R 160 ? SER R 134 SER R 157 1 ? 24 
HELX_P HELX_P130 AO4 PHE R 161 ? GLY R 166 ? PHE R 158 GLY R 163 5 ? 6  
HELX_P HELX_P131 AO5 ASN R 167 ? LEU R 170 ? ASN R 164 LEU R 167 5 ? 4  
HELX_P HELX_P132 AO6 ASP R 171 ? LYS R 180 ? ASP R 168 LYS R 177 1 ? 10 
HELX_P HELX_P133 AO7 ASP R 190 ? ALA R 194 ? ASP R 187 ALA R 191 5 ? 5  
HELX_P HELX_P134 AO8 GLU R 200 ? ASN R 209 ? GLU R 197 ASN R 206 1 ? 10 
HELX_P HELX_P135 AO9 THR S 35  ? ARG S 47  ? THR S 32  ARG S 44  1 ? 13 
HELX_P HELX_P136 AP1 GLU S 70  ? GLY S 83  ? GLU S 67  GLY S 80  1 ? 14 
HELX_P HELX_P137 AP2 SER S 137 ? SER S 160 ? SER S 134 SER S 157 1 ? 24 
HELX_P HELX_P138 AP3 PHE S 161 ? LEU S 170 ? PHE S 158 LEU S 167 5 ? 10 
HELX_P HELX_P139 AP4 ASP S 171 ? LYS S 180 ? ASP S 168 LYS S 177 1 ? 10 
HELX_P HELX_P140 AP5 ASP S 190 ? ALA S 194 ? ASP S 187 ALA S 191 5 ? 5  
HELX_P HELX_P141 AP6 GLU S 200 ? ASN S 209 ? GLU S 197 ASN S 206 1 ? 10 
HELX_P HELX_P142 AP7 THR T 35  ? GLN T 48  ? THR T 32  GLN T 45  1 ? 14 
HELX_P HELX_P143 AP8 GLU T 70  ? GLY T 83  ? GLU T 67  GLY T 80  1 ? 14 
HELX_P HELX_P144 AP9 SER T 137 ? SER T 160 ? SER T 134 SER T 157 1 ? 24 
HELX_P HELX_P145 AQ1 PHE T 161 ? LEU T 170 ? PHE T 158 LEU T 167 5 ? 10 
HELX_P HELX_P146 AQ2 ASP T 171 ? LYS T 180 ? ASP T 168 LYS T 177 1 ? 10 
HELX_P HELX_P147 AQ3 ASP T 190 ? ALA T 194 ? ASP T 187 ALA T 191 5 ? 5  
HELX_P HELX_P148 AQ4 GLU T 200 ? ASN T 209 ? GLU T 197 ASN T 206 1 ? 10 
HELX_P HELX_P149 AQ5 THR U 35  ? GLN U 48  ? THR U 32  GLN U 45  1 ? 14 
HELX_P HELX_P150 AQ6 GLU U 70  ? GLY U 83  ? GLU U 67  GLY U 80  1 ? 14 
HELX_P HELX_P151 AQ7 SER U 137 ? SER U 160 ? SER U 134 SER U 157 1 ? 24 
HELX_P HELX_P152 AQ8 PHE U 161 ? GLY U 166 ? PHE U 158 GLY U 163 5 ? 6  
HELX_P HELX_P153 AQ9 ASN U 167 ? LEU U 170 ? ASN U 164 LEU U 167 5 ? 4  
HELX_P HELX_P154 AR1 ASP U 171 ? LYS U 180 ? ASP U 168 LYS U 177 1 ? 10 
HELX_P HELX_P155 AR2 ASP U 190 ? ALA U 194 ? ASP U 187 ALA U 191 5 ? 5  
HELX_P HELX_P156 AR3 GLU U 200 ? ASN U 209 ? GLU U 197 ASN U 206 1 ? 10 
HELX_P HELX_P157 AR4 THR V 35  ? GLN V 48  ? THR V 32  GLN V 45  1 ? 14 
HELX_P HELX_P158 AR5 GLU V 70  ? GLY V 83  ? GLU V 67  GLY V 80  1 ? 14 
HELX_P HELX_P159 AR6 SER V 137 ? SER V 160 ? SER V 134 SER V 157 1 ? 24 
HELX_P HELX_P160 AR7 PHE V 161 ? LEU V 170 ? PHE V 158 LEU V 167 5 ? 10 
HELX_P HELX_P161 AR8 ASP V 171 ? LYS V 180 ? ASP V 168 LYS V 177 1 ? 10 
HELX_P HELX_P162 AR9 ASP V 190 ? ALA V 194 ? ASP V 187 ALA V 191 5 ? 5  
HELX_P HELX_P163 AS1 GLU V 200 ? ASN V 209 ? GLU V 197 ASN V 206 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 3 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 3 ? 
AC5 ? 2 ? 
AC6 ? 3 ? 
AC7 ? 2 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 3 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
AE8 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 55  ? MET A 59  ? ILE A 52  MET A 56  
AA1 2 LYS A 65  ? ILE A 69  ? LYS A 62  ILE A 66  
AA2 1 TRP A 87  ? ASN A 102 ? TRP A 84  ASN A 99  
AA2 2 LYS A 105 ? LEU A 118 ? LYS A 102 LEU A 115 
AA2 3 TYR A 123 ? LEU A 135 ? TYR A 120 LEU A 132 
AA3 1 ILE B 55  ? SER B 57  ? ILE B 52  SER B 54  
AA3 2 CYS B 67  ? ILE B 69  ? CYS B 64  ILE B 66  
AA4 1 TRP B 87  ? ASN B 102 ? TRP B 84  ASN B 99  
AA4 2 LYS B 105 ? LEU B 118 ? LYS B 102 LEU B 115 
AA4 3 TYR B 123 ? LEU B 135 ? TYR B 120 LEU B 132 
AA5 1 ILE C 55  ? MET C 59  ? ILE C 52  MET C 56  
AA5 2 LYS C 65  ? ILE C 69  ? LYS C 62  ILE C 66  
AA6 1 TRP C 87  ? ASN C 102 ? TRP C 84  ASN C 99  
AA6 2 LYS C 105 ? LEU C 118 ? LYS C 102 LEU C 115 
AA6 3 TYR C 123 ? LEU C 135 ? TYR C 120 LEU C 132 
AA7 1 ILE D 55  ? MET D 59  ? ILE D 52  MET D 56  
AA7 2 LYS D 65  ? ILE D 69  ? LYS D 62  ILE D 66  
AA8 1 TRP D 87  ? ASN D 102 ? TRP D 84  ASN D 99  
AA8 2 LYS D 105 ? LEU D 118 ? LYS D 102 LEU D 115 
AA8 3 TYR D 123 ? LEU D 135 ? TYR D 120 LEU D 132 
AA9 1 ILE E 55  ? MET E 59  ? ILE E 52  MET E 56  
AA9 2 LYS E 65  ? ILE E 69  ? LYS E 62  ILE E 66  
AB1 1 TRP E 87  ? ASN E 102 ? TRP E 84  ASN E 99  
AB1 2 LYS E 105 ? LEU E 118 ? LYS E 102 LEU E 115 
AB1 3 TYR E 123 ? LEU E 135 ? TYR E 120 LEU E 132 
AB2 1 ILE F 55  ? MET F 59  ? ILE F 52  MET F 56  
AB2 2 LYS F 65  ? ILE F 69  ? LYS F 62  ILE F 66  
AB3 1 TRP F 87  ? ASN F 102 ? TRP F 84  ASN F 99  
AB3 2 LYS F 105 ? LEU F 118 ? LYS F 102 LEU F 115 
AB3 3 TYR F 123 ? GLU F 133 ? TYR F 120 GLU F 130 
AB4 1 ILE G 55  ? MET G 59  ? ILE G 52  MET G 56  
AB4 2 LYS G 65  ? ILE G 69  ? LYS G 62  ILE G 66  
AB5 1 TRP G 87  ? ASN G 102 ? TRP G 84  ASN G 99  
AB5 2 LYS G 105 ? LEU G 118 ? LYS G 102 LEU G 115 
AB5 3 TYR G 123 ? LEU G 135 ? TYR G 120 LEU G 132 
AB6 1 ILE H 55  ? MET H 59  ? ILE H 52  MET H 56  
AB6 2 LYS H 65  ? ILE H 69  ? LYS H 62  ILE H 66  
AB7 1 TRP H 87  ? ASN H 102 ? TRP H 84  ASN H 99  
AB7 2 LYS H 105 ? LEU H 118 ? LYS H 102 LEU H 115 
AB7 3 TYR H 123 ? LEU H 135 ? TYR H 120 LEU H 132 
AB8 1 ILE I 55  ? MET I 59  ? ILE I 52  MET I 56  
AB8 2 LYS I 65  ? ILE I 69  ? LYS I 62  ILE I 66  
AB9 1 TRP I 87  ? ASN I 102 ? TRP I 84  ASN I 99  
AB9 2 LYS I 105 ? LEU I 118 ? LYS I 102 LEU I 115 
AB9 3 TYR I 123 ? GLU I 133 ? TYR I 120 GLU I 130 
AC1 1 ILE J 55  ? MET J 59  ? ILE J 52  MET J 56  
AC1 2 LYS J 65  ? ILE J 69  ? LYS J 62  ILE J 66  
AC2 1 TRP J 87  ? ASN J 102 ? TRP J 84  ASN J 99  
AC2 2 LYS J 105 ? LEU J 118 ? LYS J 102 LEU J 115 
AC2 3 TYR J 123 ? LEU J 135 ? TYR J 120 LEU J 132 
AC3 1 ILE K 55  ? MET K 59  ? ILE K 52  MET K 56  
AC3 2 LYS K 65  ? ILE K 69  ? LYS K 62  ILE K 66  
AC4 1 TRP K 87  ? ASN K 102 ? TRP K 84  ASN K 99  
AC4 2 LYS K 105 ? LEU K 118 ? LYS K 102 LEU K 115 
AC4 3 TYR K 123 ? LEU K 135 ? TYR K 120 LEU K 132 
AC5 1 ILE L 55  ? MET L 59  ? ILE L 52  MET L 56  
AC5 2 LYS L 65  ? ILE L 69  ? LYS L 62  ILE L 66  
AC6 1 TRP L 87  ? ASN L 102 ? TRP L 84  ASN L 99  
AC6 2 LYS L 105 ? LEU L 118 ? LYS L 102 LEU L 115 
AC6 3 TYR L 123 ? LEU L 135 ? TYR L 120 LEU L 132 
AC7 1 ILE M 55  ? SER M 57  ? ILE M 52  SER M 54  
AC7 2 CYS M 67  ? ILE M 69  ? CYS M 64  ILE M 66  
AC8 1 TRP M 87  ? ASN M 102 ? TRP M 84  ASN M 99  
AC8 2 LYS M 105 ? LEU M 118 ? LYS M 102 LEU M 115 
AC8 3 TYR M 123 ? LEU M 135 ? TYR M 120 LEU M 132 
AC9 1 ILE N 55  ? MET N 59  ? ILE N 52  MET N 56  
AC9 2 LYS N 65  ? ILE N 69  ? LYS N 62  ILE N 66  
AD1 1 TRP N 87  ? ASN N 102 ? TRP N 84  ASN N 99  
AD1 2 LYS N 105 ? LEU N 118 ? LYS N 102 LEU N 115 
AD1 3 TYR N 123 ? LEU N 135 ? TYR N 120 LEU N 132 
AD2 1 ILE O 55  ? MET O 59  ? ILE O 52  MET O 56  
AD2 2 LYS O 65  ? ILE O 69  ? LYS O 62  ILE O 66  
AD3 1 TRP O 87  ? ASN O 102 ? TRP O 84  ASN O 99  
AD3 2 LYS O 105 ? LEU O 118 ? LYS O 102 LEU O 115 
AD3 3 TYR O 123 ? LEU O 135 ? TYR O 120 LEU O 132 
AD4 1 ILE P 55  ? MET P 59  ? ILE P 52  MET P 56  
AD4 2 LYS P 65  ? ILE P 69  ? LYS P 62  ILE P 66  
AD5 1 TRP P 87  ? ASN P 102 ? TRP P 84  ASN P 99  
AD5 2 LYS P 105 ? LEU P 118 ? LYS P 102 LEU P 115 
AD5 3 TYR P 123 ? GLU P 133 ? TYR P 120 GLU P 130 
AD6 1 ILE Q 55  ? MET Q 59  ? ILE Q 52  MET Q 56  
AD6 2 LYS Q 65  ? ILE Q 69  ? LYS Q 62  ILE Q 66  
AD7 1 TRP Q 87  ? ASN Q 102 ? TRP Q 84  ASN Q 99  
AD7 2 LYS Q 105 ? LEU Q 118 ? LYS Q 102 LEU Q 115 
AD7 3 TYR Q 123 ? LEU Q 135 ? TYR Q 120 LEU Q 132 
AD8 1 ILE R 55  ? MET R 59  ? ILE R 52  MET R 56  
AD8 2 LYS R 65  ? ILE R 69  ? LYS R 62  ILE R 66  
AD9 1 TRP R 87  ? ASN R 102 ? TRP R 84  ASN R 99  
AD9 2 LYS R 105 ? LEU R 118 ? LYS R 102 LEU R 115 
AD9 3 TYR R 123 ? GLU R 133 ? TYR R 120 GLU R 130 
AE1 1 ILE S 55  ? MET S 59  ? ILE S 52  MET S 56  
AE1 2 LYS S 65  ? ILE S 69  ? LYS S 62  ILE S 66  
AE2 1 TRP S 87  ? ASN S 102 ? TRP S 84  ASN S 99  
AE2 2 LYS S 105 ? LEU S 118 ? LYS S 102 LEU S 115 
AE2 3 TYR S 123 ? LEU S 135 ? TYR S 120 LEU S 132 
AE3 1 ILE T 55  ? MET T 59  ? ILE T 52  MET T 56  
AE3 2 LYS T 65  ? ILE T 69  ? LYS T 62  ILE T 66  
AE4 1 TRP T 87  ? ASN T 102 ? TRP T 84  ASN T 99  
AE4 2 LYS T 105 ? LEU T 118 ? LYS T 102 LEU T 115 
AE4 3 TYR T 123 ? GLU T 133 ? TYR T 120 GLU T 130 
AE5 1 ILE U 55  ? MET U 59  ? ILE U 52  MET U 56  
AE5 2 LYS U 65  ? ILE U 69  ? LYS U 62  ILE U 66  
AE6 1 TRP U 87  ? ASN U 102 ? TRP U 84  ASN U 99  
AE6 2 LYS U 105 ? LEU U 118 ? LYS U 102 LEU U 115 
AE6 3 TYR U 123 ? LEU U 135 ? TYR U 120 LEU U 132 
AE7 1 ILE V 55  ? MET V 59  ? ILE V 52  MET V 56  
AE7 2 LYS V 65  ? ILE V 69  ? LYS V 62  ILE V 66  
AE8 1 TRP V 87  ? ASN V 102 ? TRP V 84  ASN V 99  
AE8 2 LYS V 105 ? LEU V 118 ? LYS V 102 LEU V 115 
AE8 3 TYR V 123 ? LEU V 135 ? TYR V 120 LEU V 132 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 56  ? N SER A 53  O TYR A 68  ? O TYR A 65  
AA2 1 2 N ASN A 102 ? N ASN A 99  O LYS A 105 ? O LYS A 102 
AA2 2 3 N PHE A 106 ? N PHE A 103 O LEU A 135 ? O LEU A 132 
AA3 1 2 N SER B 56  ? N SER B 53  O TYR B 68  ? O TYR B 65  
AA4 1 2 N ALA B 88  ? N ALA B 85  O GLN B 117 ? O GLN B 114 
AA4 2 3 N VAL B 116 ? N VAL B 113 O HIS B 124 ? O HIS B 121 
AA5 1 2 N SER C 56  ? N SER C 53  O TYR C 68  ? O TYR C 65  
AA6 1 2 N ALA C 88  ? N ALA C 85  O GLN C 117 ? O GLN C 114 
AA6 2 3 N PHE C 106 ? N PHE C 103 O LEU C 135 ? O LEU C 132 
AA7 1 2 N SER D 56  ? N SER D 53  O TYR D 68  ? O TYR D 65  
AA8 1 2 N ALA D 88  ? N ALA D 85  O GLN D 117 ? O GLN D 114 
AA8 2 3 N PHE D 106 ? N PHE D 103 O LEU D 135 ? O LEU D 132 
AA9 1 2 N SER E 56  ? N SER E 53  O TYR E 68  ? O TYR E 65  
AB1 1 2 N ALA E 88  ? N ALA E 85  O GLN E 117 ? O GLN E 114 
AB1 2 3 N PHE E 106 ? N PHE E 103 O LEU E 135 ? O LEU E 132 
AB2 1 2 N SER F 56  ? N SER F 53  O TYR F 68  ? O TYR F 65  
AB3 1 2 N ALA F 88  ? N ALA F 85  O GLN F 117 ? O GLN F 114 
AB3 2 3 N ALA F 112 ? N ALA F 109 O GLY F 128 ? O GLY F 125 
AB4 1 2 N SER G 56  ? N SER G 53  O TYR G 68  ? O TYR G 65  
AB5 1 2 N ALA G 88  ? N ALA G 85  O GLN G 117 ? O GLN G 114 
AB5 2 3 N PHE G 106 ? N PHE G 103 O LEU G 135 ? O LEU G 132 
AB6 1 2 N SER H 56  ? N SER H 53  O TYR H 68  ? O TYR H 65  
AB7 1 2 N ALA H 88  ? N ALA H 85  O GLN H 117 ? O GLN H 114 
AB7 2 3 N VAL H 116 ? N VAL H 113 O HIS H 124 ? O HIS H 121 
AB8 1 2 N SER I 56  ? N SER I 53  O TYR I 68  ? O TYR I 65  
AB9 1 2 N ALA I 88  ? N ALA I 85  O GLN I 117 ? O GLN I 114 
AB9 2 3 N VAL I 116 ? N VAL I 113 O HIS I 124 ? O HIS I 121 
AC1 1 2 N ARG J 58  ? N ARG J 55  O VAL J 66  ? O VAL J 63  
AC2 1 2 N ALA J 88  ? N ALA J 85  O GLN J 117 ? O GLN J 114 
AC2 2 3 N VAL J 116 ? N VAL J 113 O HIS J 124 ? O HIS J 121 
AC3 1 2 N SER K 56  ? N SER K 53  O TYR K 68  ? O TYR K 65  
AC4 1 2 N ALA K 88  ? N ALA K 85  O GLN K 117 ? O GLN K 114 
AC4 2 3 N PHE K 106 ? N PHE K 103 O LEU K 135 ? O LEU K 132 
AC5 1 2 N SER L 56  ? N SER L 53  O TYR L 68  ? O TYR L 65  
AC6 1 2 N ALA L 88  ? N ALA L 85  O GLN L 117 ? O GLN L 114 
AC6 2 3 N ALA L 112 ? N ALA L 109 O GLY L 128 ? O GLY L 125 
AC7 1 2 N SER M 56  ? N SER M 53  O TYR M 68  ? O TYR M 65  
AC8 1 2 N ASN M 102 ? N ASN M 99  O LYS M 105 ? O LYS M 102 
AC8 2 3 N ALA M 112 ? N ALA M 109 O GLY M 128 ? O GLY M 125 
AC9 1 2 N SER N 56  ? N SER N 53  O TYR N 68  ? O TYR N 65  
AD1 1 2 N ALA N 88  ? N ALA N 85  O GLN N 117 ? O GLN N 114 
AD1 2 3 N PHE N 106 ? N PHE N 103 O LEU N 135 ? O LEU N 132 
AD2 1 2 N SER O 56  ? N SER O 53  O TYR O 68  ? O TYR O 65  
AD3 1 2 N ALA O 88  ? N ALA O 85  O GLN O 117 ? O GLN O 114 
AD3 2 3 N ALA O 112 ? N ALA O 109 O GLY O 128 ? O GLY O 125 
AD4 1 2 N SER P 56  ? N SER P 53  O TYR P 68  ? O TYR P 65  
AD5 1 2 N ALA P 88  ? N ALA P 85  O GLN P 117 ? O GLN P 114 
AD5 2 3 N ALA P 112 ? N ALA P 109 O GLY P 128 ? O GLY P 125 
AD6 1 2 N SER Q 56  ? N SER Q 53  O TYR Q 68  ? O TYR Q 65  
AD7 1 2 N ALA Q 88  ? N ALA Q 85  O GLN Q 117 ? O GLN Q 114 
AD7 2 3 N PHE Q 106 ? N PHE Q 103 O LEU Q 135 ? O LEU Q 132 
AD8 1 2 N SER R 56  ? N SER R 53  O TYR R 68  ? O TYR R 65  
AD9 1 2 N ALA R 88  ? N ALA R 85  O GLN R 117 ? O GLN R 114 
AD9 2 3 N ALA R 112 ? N ALA R 109 O GLY R 128 ? O GLY R 125 
AE1 1 2 N SER S 56  ? N SER S 53  O TYR S 68  ? O TYR S 65  
AE2 1 2 N ALA S 88  ? N ALA S 85  O GLN S 117 ? O GLN S 114 
AE2 2 3 N VAL S 116 ? N VAL S 113 O HIS S 124 ? O HIS S 121 
AE3 1 2 N SER T 56  ? N SER T 53  O TYR T 68  ? O TYR T 65  
AE4 1 2 N ALA T 88  ? N ALA T 85  O GLN T 117 ? O GLN T 114 
AE4 2 3 N ALA T 112 ? N ALA T 109 O GLY T 128 ? O GLY T 125 
AE5 1 2 N SER U 56  ? N SER U 53  O TYR U 68  ? O TYR U 65  
AE6 1 2 N ASN U 102 ? N ASN U 99  O LYS U 105 ? O LYS U 102 
AE6 2 3 N ALA U 112 ? N ALA U 109 O GLY U 128 ? O GLY U 125 
AE7 1 2 N SER V 56  ? N SER V 53  O TYR V 68  ? O TYR V 65  
AE8 1 2 N ALA V 88  ? N ALA V 85  O GLN V 117 ? O GLN V 114 
AE8 2 3 N PHE V 106 ? N PHE V 103 O LEU V 135 ? O LEU V 132 
# 
_atom_sites.entry_id                    5XS0 
_atom_sites.fract_transf_matrix[1][1]   0.009978 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000034 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006082 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006021 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . CYS A 1 28  ? 6.320   -59.240  -102.102 1.00 89.10  ? 25  CYS A N     1 
ATOM 2     C CA    . CYS A 1 28  ? 7.498   -58.719  -102.789 1.00 91.19  ? 25  CYS A CA    1 
ATOM 3     C C     . CYS A 1 28  ? 8.360   -59.853  -103.340 1.00 89.39  ? 25  CYS A C     1 
ATOM 4     O O     . CYS A 1 28  ? 7.861   -60.946  -103.612 1.00 82.26  ? 25  CYS A O     1 
ATOM 5     C CB    . CYS A 1 28  ? 8.321   -57.834  -101.850 1.00 79.10  ? 25  CYS A CB    1 
ATOM 6     S SG    . CYS A 1 28  ? 8.997   -58.679  -100.406 1.00 84.23  ? 25  CYS A SG    1 
ATOM 7     N N     . PHE A 1 29  ? 9.658   -59.595  -103.494 1.00 79.31  ? 26  PHE A N     1 
ATOM 8     C CA    . PHE A 1 29  ? 10.564  -60.605  -104.020 1.00 68.24  ? 26  PHE A CA    1 
ATOM 9     C C     . PHE A 1 29  ? 10.870  -61.624  -102.934 1.00 73.08  ? 26  PHE A C     1 
ATOM 10    O O     . PHE A 1 29  ? 11.046  -61.272  -101.765 1.00 79.02  ? 26  PHE A O     1 
ATOM 11    C CB    . PHE A 1 29  ? 11.857  -59.961  -104.519 1.00 61.85  ? 26  PHE A CB    1 
ATOM 12    C CG    . PHE A 1 29  ? 12.666  -60.845  -105.418 1.00 63.52  ? 26  PHE A CG    1 
ATOM 13    C CD1   . PHE A 1 29  ? 12.293  -61.031  -106.737 1.00 54.92  ? 26  PHE A CD1   1 
ATOM 14    C CD2   . PHE A 1 29  ? 13.804  -61.480  -104.951 1.00 55.10  ? 26  PHE A CD2   1 
ATOM 15    C CE1   . PHE A 1 29  ? 13.033  -61.840  -107.572 1.00 56.59  ? 26  PHE A CE1   1 
ATOM 16    C CE2   . PHE A 1 29  ? 14.549  -62.291  -105.784 1.00 54.05  ? 26  PHE A CE2   1 
ATOM 17    C CZ    . PHE A 1 29  ? 14.162  -62.473  -107.095 1.00 59.05  ? 26  PHE A CZ    1 
ATOM 18    N N     . GLY A 1 30  ? 10.934  -62.895  -103.325 1.00 69.37  ? 27  GLY A N     1 
ATOM 19    C CA    . GLY A 1 30  ? 11.032  -63.963  -102.359 1.00 68.02  ? 27  GLY A CA    1 
ATOM 20    C C     . GLY A 1 30  ? 9.710   -64.362  -101.745 1.00 67.31  ? 27  GLY A C     1 
ATOM 21    O O     . GLY A 1 30  ? 9.666   -65.344  -100.994 1.00 69.86  ? 27  GLY A O     1 
ATOM 22    N N     . GLN A 1 31  ? 8.638   -63.620  -102.021 1.00 79.94  ? 28  GLN A N     1 
ATOM 23    C CA    . GLN A 1 31  ? 7.304   -63.917  -101.518 1.00 78.86  ? 28  GLN A CA    1 
ATOM 24    C C     . GLN A 1 31  ? 6.357   -64.441  -102.581 1.00 79.02  ? 28  GLN A C     1 
ATOM 25    O O     . GLN A 1 31  ? 5.456   -65.217  -102.255 1.00 80.03  ? 28  GLN A O     1 
ATOM 26    C CB    . GLN A 1 31  ? 6.672   -62.665  -100.897 1.00 85.52  ? 28  GLN A CB    1 
ATOM 27    C CG    . GLN A 1 31  ? 7.593   -61.848  -100.014 1.00 89.32  ? 28  GLN A CG    1 
ATOM 28    C CD    . GLN A 1 31  ? 7.546   -62.281  -98.564  1.00 94.50  ? 28  GLN A CD    1 
ATOM 29    O OE1   . GLN A 1 31  ? 7.324   -63.452  -98.259  1.00 107.95 ? 28  GLN A OE1   1 
ATOM 30    N NE2   . GLN A 1 31  ? 7.744   -61.331  -97.657  1.00 86.07  ? 28  GLN A NE2   1 
ATOM 31    N N     . CYS A 1 32  ? 6.524   -64.020  -103.834 1.00 79.10  ? 29  CYS A N     1 
ATOM 32    C CA    . CYS A 1 32  ? 5.611   -64.431  -104.891 1.00 80.49  ? 29  CYS A CA    1 
ATOM 33    C C     . CYS A 1 32  ? 5.598   -65.945  -105.030 1.00 76.78  ? 29  CYS A C     1 
ATOM 34    O O     . CYS A 1 32  ? 6.649   -66.586  -105.057 1.00 78.68  ? 29  CYS A O     1 
ATOM 35    C CB    . CYS A 1 32  ? 6.019   -63.787  -106.216 1.00 74.28  ? 29  CYS A CB    1 
ATOM 36    S SG    . CYS A 1 32  ? 5.893   -61.987  -106.238 1.00 94.39  ? 29  CYS A SG    1 
ATOM 37    N N     . GLN A 1 33  ? 4.404   -66.518  -105.112 1.00 74.75  ? 30  GLN A N     1 
ATOM 38    C CA    . GLN A 1 33  ? 4.255   -67.937  -105.390 1.00 76.13  ? 30  GLN A CA    1 
ATOM 39    C C     . GLN A 1 33  ? 3.865   -68.099  -106.850 1.00 78.15  ? 30  GLN A C     1 
ATOM 40    O O     . GLN A 1 33  ? 2.973   -67.397  -107.339 1.00 86.90  ? 30  GLN A O     1 
ATOM 41    C CB    . GLN A 1 33  ? 3.208   -68.573  -104.477 1.00 67.50  ? 30  GLN A CB    1 
ATOM 42    C CG    . GLN A 1 33  ? 3.773   -69.060  -103.161 1.00 92.81  ? 30  GLN A CG    1 
ATOM 43    C CD    . GLN A 1 33  ? 2.719   -69.707  -102.288 1.00 117.98 ? 30  GLN A CD    1 
ATOM 44    O OE1   . GLN A 1 33  ? 2.021   -70.629  -102.716 1.00 112.37 ? 30  GLN A OE1   1 
ATOM 45    N NE2   . GLN A 1 33  ? 2.599   -69.229  -101.053 1.00 113.82 ? 30  GLN A NE2   1 
ATOM 46    N N     . TYR A 1 34  ? 4.522   -69.026  -107.538 1.00 69.07  ? 31  TYR A N     1 
ATOM 47    C CA    . TYR A 1 34  ? 4.263   -69.208  -108.958 1.00 68.36  ? 31  TYR A CA    1 
ATOM 48    C C     . TYR A 1 34  ? 2.839   -69.705  -109.167 1.00 71.95  ? 31  TYR A C     1 
ATOM 49    O O     . TYR A 1 34  ? 2.398   -70.657  -108.515 1.00 74.16  ? 31  TYR A O     1 
ATOM 50    C CB    . TYR A 1 34  ? 5.276   -70.181  -109.565 1.00 63.72  ? 31  TYR A CB    1 
ATOM 51    C CG    . TYR A 1 34  ? 6.552   -69.504  -110.022 1.00 64.07  ? 31  TYR A CG    1 
ATOM 52    C CD1   . TYR A 1 34  ? 6.547   -68.642  -111.111 1.00 71.64  ? 31  TYR A CD1   1 
ATOM 53    C CD2   . TYR A 1 34  ? 7.754   -69.709  -109.357 1.00 59.32  ? 31  TYR A CD2   1 
ATOM 54    C CE1   . TYR A 1 34  ? 7.702   -68.011  -111.534 1.00 71.03  ? 31  TYR A CE1   1 
ATOM 55    C CE2   . TYR A 1 34  ? 8.919   -69.078  -109.773 1.00 63.64  ? 31  TYR A CE2   1 
ATOM 56    C CZ    . TYR A 1 34  ? 8.884   -68.229  -110.863 1.00 70.07  ? 31  TYR A CZ    1 
ATOM 57    O OH    . TYR A 1 34  ? 10.030  -67.594  -111.290 1.00 59.99  ? 31  TYR A OH    1 
ATOM 58    N N     . THR A 1 35  ? 2.119   -69.053  -110.074 1.00 79.13  ? 32  THR A N     1 
ATOM 59    C CA    . THR A 1 35  ? 0.797   -69.526  -110.446 1.00 64.28  ? 32  THR A CA    1 
ATOM 60    C C     . THR A 1 35  ? 0.926   -70.771  -111.313 1.00 73.01  ? 32  THR A C     1 
ATOM 61    O O     . THR A 1 35  ? 1.964   -71.018  -111.932 1.00 74.77  ? 32  THR A O     1 
ATOM 62    C CB    . THR A 1 35  ? 0.022   -68.445  -111.199 1.00 65.05  ? 32  THR A CB    1 
ATOM 63    O OG1   . THR A 1 35  ? 0.812   -67.956  -112.290 1.00 83.87  ? 32  THR A OG1   1 
ATOM 64    C CG2   . THR A 1 35  ? -0.320  -67.294  -110.274 1.00 76.45  ? 32  THR A CG2   1 
ATOM 65    N N     . ALA A 1 36  ? -0.142  -71.571  -111.337 1.00 72.65  ? 33  ALA A N     1 
ATOM 66    C CA    . ALA A 1 36  ? -0.100  -72.834  -112.069 1.00 78.92  ? 33  ALA A CA    1 
ATOM 67    C C     . ALA A 1 36  ? 0.289   -72.622  -113.527 1.00 81.80  ? 33  ALA A C     1 
ATOM 68    O O     . ALA A 1 36  ? 1.135   -73.346  -114.066 1.00 81.57  ? 33  ALA A O     1 
ATOM 69    C CB    . ALA A 1 36  ? -1.452  -73.538  -111.971 1.00 84.70  ? 33  ALA A CB    1 
ATOM 70    N N     . GLU A 1 37  ? -0.298  -71.611  -114.169 1.00 85.35  ? 34  GLU A N     1 
ATOM 71    C CA    . GLU A 1 37  ? -0.004  -71.350  -115.574 1.00 88.16  ? 34  GLU A CA    1 
ATOM 72    C C     . GLU A 1 37  ? 1.459   -70.980  -115.754 1.00 79.78  ? 34  GLU A C     1 
ATOM 73    O O     . GLU A 1 37  ? 2.138   -71.495  -116.650 1.00 74.36  ? 34  GLU A O     1 
ATOM 74    C CB    . GLU A 1 37  ? -0.899  -70.229  -116.101 1.00 90.47  ? 34  GLU A CB    1 
ATOM 75    C CG    . GLU A 1 37  ? -2.356  -70.325  -115.685 1.00 108.85 ? 34  GLU A CG    1 
ATOM 76    C CD    . GLU A 1 37  ? -2.651  -69.489  -114.450 1.00 114.29 ? 34  GLU A CD    1 
ATOM 77    O OE1   . GLU A 1 37  ? -2.130  -68.355  -114.363 1.00 111.54 ? 34  GLU A OE1   1 
ATOM 78    O OE2   . GLU A 1 37  ? -3.412  -69.957  -113.575 1.00 108.67 ? 34  GLU A OE2   1 
ATOM 79    N N     . GLU A 1 38  ? 1.965   -70.090  -114.898 1.00 74.24  ? 35  GLU A N     1 
ATOM 80    C CA    . GLU A 1 38  ? 3.347   -69.650  -115.028 1.00 68.31  ? 35  GLU A CA    1 
ATOM 81    C C     . GLU A 1 38  ? 4.321   -70.769  -114.684 1.00 59.10  ? 35  GLU A C     1 
ATOM 82    O O     . GLU A 1 38  ? 5.336   -70.945  -115.372 1.00 59.05  ? 35  GLU A O     1 
ATOM 83    C CB    . GLU A 1 38  ? 3.587   -68.426  -114.149 1.00 65.47  ? 35  GLU A CB    1 
ATOM 84    C CG    . GLU A 1 38  ? 4.968   -67.834  -114.300 1.00 63.69  ? 35  GLU A CG    1 
ATOM 85    C CD    . GLU A 1 38  ? 5.141   -66.572  -113.488 1.00 73.84  ? 35  GLU A CD    1 
ATOM 86    O OE1   . GLU A 1 38  ? 6.159   -65.875  -113.685 1.00 66.44  ? 35  GLU A OE1   1 
ATOM 87    O OE2   . GLU A 1 38  ? 4.253   -66.273  -112.660 1.00 76.83  ? 35  GLU A OE2   1 
ATOM 88    N N     . TYR A 1 39  ? 4.031   -71.544  -113.632 1.00 63.23  ? 36  TYR A N     1 
ATOM 89    C CA    . TYR A 1 39  ? 4.880   -72.690  -113.321 1.00 62.73  ? 36  TYR A CA    1 
ATOM 90    C C     . TYR A 1 39  ? 4.961   -73.643  -114.504 1.00 69.06  ? 36  TYR A C     1 
ATOM 91    O O     . TYR A 1 39  ? 6.048   -74.088  -114.879 1.00 69.43  ? 36  TYR A O     1 
ATOM 92    C CB    . TYR A 1 39  ? 4.384   -73.451  -112.090 1.00 63.85  ? 36  TYR A CB    1 
ATOM 93    C CG    . TYR A 1 39  ? 4.915   -74.871  -112.113 1.00 67.89  ? 36  TYR A CG    1 
ATOM 94    C CD1   . TYR A 1 39  ? 6.255   -75.132  -111.859 1.00 63.09  ? 36  TYR A CD1   1 
ATOM 95    C CD2   . TYR A 1 39  ? 4.093   -75.942  -112.447 1.00 76.10  ? 36  TYR A CD2   1 
ATOM 96    C CE1   . TYR A 1 39  ? 6.758   -76.418  -111.911 1.00 67.88  ? 36  TYR A CE1   1 
ATOM 97    C CE2   . TYR A 1 39  ? 4.589   -77.233  -112.501 1.00 81.70  ? 36  TYR A CE2   1 
ATOM 98    C CZ    . TYR A 1 39  ? 5.921   -77.464  -112.231 1.00 79.16  ? 36  TYR A CZ    1 
ATOM 99    O OH    . TYR A 1 39  ? 6.417   -78.746  -112.285 1.00 86.45  ? 36  TYR A OH    1 
ATOM 100   N N     . GLN A 1 40  ? 3.809   -73.998  -115.081 1.00 69.81  ? 37  GLN A N     1 
ATOM 101   C CA    . GLN A 1 40  ? 3.798   -74.974  -116.167 1.00 63.71  ? 37  GLN A CA    1 
ATOM 102   C C     . GLN A 1 40  ? 4.520   -74.437  -117.396 1.00 67.38  ? 37  GLN A C     1 
ATOM 103   O O     . GLN A 1 40  ? 5.313   -75.156  -118.024 1.00 66.05  ? 37  GLN A O     1 
ATOM 104   C CB    . GLN A 1 40  ? 2.354   -75.350  -116.500 1.00 72.51  ? 37  GLN A CB    1 
ATOM 105   C CG    . GLN A 1 40  ? 2.139   -75.830  -117.921 1.00 86.07  ? 37  GLN A CG    1 
ATOM 106   C CD    . GLN A 1 40  ? 0.920   -75.194  -118.563 1.00 91.78  ? 37  GLN A CD    1 
ATOM 107   O OE1   . GLN A 1 40  ? -0.189  -75.721  -118.475 1.00 93.12  ? 37  GLN A OE1   1 
ATOM 108   N NE2   . GLN A 1 40  ? 1.121   -74.051  -119.210 1.00 86.81  ? 37  GLN A NE2   1 
ATOM 109   N N     . ALA A 1 41  ? 4.264   -73.174  -117.747 1.00 57.84  ? 38  ALA A N     1 
ATOM 110   C CA    . ALA A 1 41  ? 4.965   -72.549  -118.862 1.00 58.02  ? 38  ALA A CA    1 
ATOM 111   C C     . ALA A 1 41  ? 6.476   -72.606  -118.667 1.00 61.13  ? 38  ALA A C     1 
ATOM 112   O O     . ALA A 1 41  ? 7.214   -73.016  -119.570 1.00 67.23  ? 38  ALA A O     1 
ATOM 113   C CB    . ALA A 1 41  ? 4.491   -71.106  -119.031 1.00 59.78  ? 38  ALA A CB    1 
ATOM 114   N N     . ILE A 1 42  ? 6.957   -72.212  -117.482 1.00 63.28  ? 39  ILE A N     1 
ATOM 115   C CA    . ILE A 1 42  ? 8.400   -72.171  -117.253 1.00 62.61  ? 39  ILE A CA    1 
ATOM 116   C C     . ILE A 1 42  ? 8.979   -73.583  -117.226 1.00 63.98  ? 39  ILE A C     1 
ATOM 117   O O     . ILE A 1 42  ? 10.066  -73.834  -117.759 1.00 55.32  ? 39  ILE A O     1 
ATOM 118   C CB    . ILE A 1 42  ? 8.719   -71.401  -115.957 1.00 60.12  ? 39  ILE A CB    1 
ATOM 119   C CG1   . ILE A 1 42  ? 8.475   -69.904  -116.143 1.00 52.51  ? 39  ILE A CG1   1 
ATOM 120   C CG2   . ILE A 1 42  ? 10.166  -71.614  -115.548 1.00 62.01  ? 39  ILE A CG2   1 
ATOM 121   C CD1   . ILE A 1 42  ? 8.592   -69.109  -114.859 1.00 69.27  ? 39  ILE A CD1   1 
ATOM 122   N N     . GLN A 1 43  ? 8.277   -74.518  -116.582 1.00 57.91  ? 40  GLN A N     1 
ATOM 123   C CA    . GLN A 1 43  ? 8.736   -75.900  -116.516 1.00 60.63  ? 40  GLN A CA    1 
ATOM 124   C C     . GLN A 1 43  ? 8.910   -76.489  -117.911 1.00 69.38  ? 40  GLN A C     1 
ATOM 125   O O     . GLN A 1 43  ? 9.907   -77.167  -118.183 1.00 68.43  ? 40  GLN A O     1 
ATOM 126   C CB    . GLN A 1 43  ? 7.743   -76.730  -115.698 1.00 67.49  ? 40  GLN A CB    1 
ATOM 127   C CG    . GLN A 1 43  ? 8.044   -78.217  -115.632 1.00 72.40  ? 40  GLN A CG    1 
ATOM 128   C CD    . GLN A 1 43  ? 9.218   -78.516  -114.722 1.00 61.93  ? 40  GLN A CD    1 
ATOM 129   O OE1   . GLN A 1 43  ? 9.503   -77.760  -113.795 1.00 55.40  ? 40  GLN A OE1   1 
ATOM 130   N NE2   . GLN A 1 43  ? 9.897   -79.626  -114.975 1.00 73.13  ? 40  GLN A NE2   1 
ATOM 131   N N     . LYS A 1 44  ? 7.949   -76.246  -118.809 1.00 70.79  ? 41  LYS A N     1 
ATOM 132   C CA    . LYS A 1 44  ? 8.107   -76.712  -120.186 1.00 64.79  ? 41  LYS A CA    1 
ATOM 133   C C     . LYS A 1 44  ? 9.238   -75.976  -120.896 1.00 64.12  ? 41  LYS A C     1 
ATOM 134   O O     . LYS A 1 44  ? 10.070  -76.601  -121.565 1.00 67.20  ? 41  LYS A O     1 
ATOM 135   C CB    . LYS A 1 44  ? 6.799   -76.570  -120.968 1.00 71.29  ? 41  LYS A CB    1 
ATOM 136   C CG    . LYS A 1 44  ? 5.756   -77.625  -120.637 1.00 85.25  ? 41  LYS A CG    1 
ATOM 137   C CD    . LYS A 1 44  ? 4.541   -77.487  -121.539 1.00 80.94  ? 41  LYS A CD    1 
ATOM 138   C CE    . LYS A 1 44  ? 3.432   -78.431  -121.127 1.00 95.70  ? 41  LYS A CE    1 
ATOM 139   N NZ    . LYS A 1 44  ? 3.782   -79.842  -121.452 1.00 102.32 ? 41  LYS A NZ    1 
ATOM 140   N N     . ALA A 1 45  ? 9.280   -74.645  -120.770 1.00 54.22  ? 42  ALA A N     1 
ATOM 141   C CA    . ALA A 1 45  ? 10.254  -73.849  -121.509 1.00 50.04  ? 42  ALA A CA    1 
ATOM 142   C C     . ALA A 1 45  ? 11.688  -74.192  -121.132 1.00 59.36  ? 42  ALA A C     1 
ATOM 143   O O     . ALA A 1 45  ? 12.573  -74.158  -121.993 1.00 63.50  ? 42  ALA A O     1 
ATOM 144   C CB    . ALA A 1 45  ? 9.992   -72.362  -121.274 1.00 53.75  ? 42  ALA A CB    1 
ATOM 145   N N     . LEU A 1 46  ? 11.940  -74.524  -119.865 1.00 69.28  ? 43  LEU A N     1 
ATOM 146   C CA    . LEU A 1 46  ? 13.301  -74.822  -119.435 1.00 61.79  ? 43  LEU A CA    1 
ATOM 147   C C     . LEU A 1 46  ? 13.820  -76.133  -120.005 1.00 65.80  ? 43  LEU A C     1 
ATOM 148   O O     . LEU A 1 46  ? 15.037  -76.348  -120.010 1.00 71.78  ? 43  LEU A O     1 
ATOM 149   C CB    . LEU A 1 46  ? 13.380  -74.844  -117.908 1.00 66.37  ? 43  LEU A CB    1 
ATOM 150   C CG    . LEU A 1 46  ? 13.437  -73.457  -117.260 1.00 58.61  ? 43  LEU A CG    1 
ATOM 151   C CD1   . LEU A 1 46  ? 13.287  -73.557  -115.760 1.00 55.27  ? 43  LEU A CD1   1 
ATOM 152   C CD2   . LEU A 1 46  ? 14.727  -72.728  -117.620 1.00 64.86  ? 43  LEU A CD2   1 
ATOM 153   N N     . ARG A 1 47  ? 12.934  -77.014  -120.479 1.00 62.01  ? 44  ARG A N     1 
ATOM 154   C CA    . ARG A 1 47  ? 13.390  -78.275  -121.054 1.00 58.80  ? 44  ARG A CA    1 
ATOM 155   C C     . ARG A 1 47  ? 14.074  -78.077  -122.402 1.00 60.98  ? 44  ARG A C     1 
ATOM 156   O O     . ARG A 1 47  ? 14.902  -78.908  -122.794 1.00 60.45  ? 44  ARG A O     1 
ATOM 157   C CB    . ARG A 1 47  ? 12.224  -79.253  -121.187 1.00 52.38  ? 44  ARG A CB    1 
ATOM 158   C CG    . ARG A 1 47  ? 11.937  -80.042  -119.922 1.00 56.74  ? 44  ARG A CG    1 
ATOM 159   C CD    . ARG A 1 47  ? 10.828  -81.054  -120.150 1.00 58.34  ? 44  ARG A CD    1 
ATOM 160   N NE    . ARG A 1 47  ? 9.497   -80.483  -119.971 1.00 72.08  ? 44  ARG A NE    1 
ATOM 161   C CZ    . ARG A 1 47  ? 8.725   -80.715  -118.913 1.00 69.02  ? 44  ARG A CZ    1 
ATOM 162   N NH1   . ARG A 1 47  ? 9.152   -81.511  -117.942 1.00 62.17  ? 44  ARG A NH1   1 
ATOM 163   N NH2   . ARG A 1 47  ? 7.524   -80.157  -118.829 1.00 69.81  ? 44  ARG A NH2   1 
ATOM 164   N N     . GLN A 1 48  ? 13.720  -77.018  -123.135 1.00 54.41  ? 45  GLN A N     1 
ATOM 165   C CA    . GLN A 1 48  ? 14.290  -76.776  -124.459 1.00 62.03  ? 45  GLN A CA    1 
ATOM 166   C C     . GLN A 1 48  ? 15.811  -76.776  -124.424 1.00 64.89  ? 45  GLN A C     1 
ATOM 167   O O     . GLN A 1 48  ? 16.425  -76.148  -123.557 1.00 69.32  ? 45  GLN A O     1 
ATOM 168   C CB    . GLN A 1 48  ? 13.798  -75.432  -125.017 1.00 65.94  ? 45  GLN A CB    1 
ATOM 169   C CG    . GLN A 1 48  ? 12.285  -75.308  -125.234 1.00 65.60  ? 45  GLN A CG    1 
ATOM 170   C CD    . GLN A 1 48  ? 11.855  -73.886  -125.594 1.00 71.04  ? 45  GLN A CD    1 
ATOM 171   O OE1   . GLN A 1 48  ? 11.561  -73.574  -126.750 1.00 77.69  ? 45  GLN A OE1   1 
ATOM 172   N NE2   . GLN A 1 48  ? 11.812  -73.021  -124.591 1.00 73.59  ? 45  GLN A NE2   1 
ATOM 173   N N     . ARG A 1 49  ? 16.416  -77.510  -125.357 1.00 57.62  ? 46  ARG A N     1 
ATOM 174   C CA    . ARG A 1 49  ? 17.830  -77.313  -125.622 1.00 63.89  ? 46  ARG A CA    1 
ATOM 175   C C     . ARG A 1 49  ? 18.019  -76.096  -126.523 1.00 68.40  ? 46  ARG A C     1 
ATOM 176   O O     . ARG A 1 49  ? 17.099  -75.653  -127.217 1.00 67.43  ? 46  ARG A O     1 
ATOM 177   C CB    . ARG A 1 49  ? 18.470  -78.555  -126.247 1.00 73.05  ? 46  ARG A CB    1 
ATOM 178   C CG    . ARG A 1 49  ? 18.481  -79.783  -125.344 1.00 73.08  ? 46  ARG A CG    1 
ATOM 179   C CD    . ARG A 1 49  ? 19.195  -80.939  -126.023 1.00 79.24  ? 46  ARG A CD    1 
ATOM 180   N NE    . ARG A 1 49  ? 19.525  -82.024  -125.101 1.00 93.90  ? 46  ARG A NE    1 
ATOM 181   C CZ    . ARG A 1 49  ? 18.729  -83.051  -124.827 1.00 98.72  ? 46  ARG A CZ    1 
ATOM 182   N NH1   . ARG A 1 49  ? 17.541  -83.145  -125.408 1.00 83.91  ? 46  ARG A NH1   1 
ATOM 183   N NH2   . ARG A 1 49  ? 19.123  -83.986  -123.972 1.00 97.06  ? 46  ARG A NH2   1 
ATOM 184   N N     . LEU A 1 50  ? 19.234  -75.559  -126.509 1.00 72.55  ? 47  LEU A N     1 
ATOM 185   C CA    . LEU A 1 50  ? 19.532  -74.308  -127.193 1.00 73.47  ? 47  LEU A CA    1 
ATOM 186   C C     . LEU A 1 50  ? 20.022  -74.550  -128.616 1.00 75.56  ? 47  LEU A C     1 
ATOM 187   O O     . LEU A 1 50  ? 20.783  -75.487  -128.875 1.00 69.44  ? 47  LEU A O     1 
ATOM 188   C CB    . LEU A 1 50  ? 20.575  -73.518  -126.402 1.00 63.89  ? 47  LEU A CB    1 
ATOM 189   C CG    . LEU A 1 50  ? 20.068  -73.008  -125.049 1.00 57.28  ? 47  LEU A CG    1 
ATOM 190   C CD1   . LEU A 1 50  ? 21.163  -72.268  -124.298 1.00 64.30  ? 47  LEU A CD1   1 
ATOM 191   C CD2   . LEU A 1 50  ? 18.802  -72.169  -125.169 1.00 54.01  ? 47  LEU A CD2   1 
ATOM 192   N N     . GLY A 1 51  ? 19.573  -73.697  -129.538 1.00 78.58  ? 48  GLY A N     1 
ATOM 193   C CA    . GLY A 1 51  ? 20.047  -73.711  -130.902 1.00 79.26  ? 48  GLY A CA    1 
ATOM 194   C C     . GLY A 1 51  ? 21.472  -73.206  -131.043 1.00 85.48  ? 48  GLY A C     1 
ATOM 195   O O     . GLY A 1 51  ? 22.083  -72.719  -130.086 1.00 83.94  ? 48  GLY A O     1 
ATOM 196   N N     . PRO A 1 52  ? 22.032  -73.317  -132.253 1.00 86.16  ? 49  PRO A N     1 
ATOM 197   C CA    . PRO A 1 52  ? 23.430  -72.900  -132.466 1.00 84.27  ? 49  PRO A CA    1 
ATOM 198   C C     . PRO A 1 52  ? 23.667  -71.401  -132.325 1.00 81.17  ? 49  PRO A C     1 
ATOM 199   O O     . PRO A 1 52  ? 24.832  -70.991  -132.237 1.00 86.09  ? 49  PRO A O     1 
ATOM 200   C CB    . PRO A 1 52  ? 23.730  -73.368  -133.899 1.00 82.98  ? 49  PRO A CB    1 
ATOM 201   C CG    . PRO A 1 52  ? 22.622  -74.309  -134.263 1.00 91.86  ? 49  PRO A CG    1 
ATOM 202   C CD    . PRO A 1 52  ? 21.430  -73.906  -133.459 1.00 81.78  ? 49  PRO A CD    1 
ATOM 203   N N     . GLU A 1 53  ? 22.614  -70.577  -132.292 1.00 75.67  ? 50  GLU A N     1 
ATOM 204   C CA    . GLU A 1 53  ? 22.801  -69.135  -132.149 1.00 81.78  ? 50  GLU A CA    1 
ATOM 205   C C     . GLU A 1 53  ? 23.450  -68.774  -130.821 1.00 83.65  ? 50  GLU A C     1 
ATOM 206   O O     . GLU A 1 53  ? 24.127  -67.744  -130.720 1.00 87.96  ? 50  GLU A O     1 
ATOM 207   C CB    . GLU A 1 53  ? 21.461  -68.407  -132.278 1.00 79.47  ? 50  GLU A CB    1 
ATOM 208   C CG    . GLU A 1 53  ? 20.746  -68.636  -133.593 1.00 92.71  ? 50  GLU A CG    1 
ATOM 209   C CD    . GLU A 1 53  ? 19.849  -69.857  -133.584 1.00 90.91  ? 50  GLU A CD    1 
ATOM 210   O OE1   . GLU A 1 53  ? 20.163  -70.840  -132.880 1.00 81.70  ? 50  GLU A OE1   1 
ATOM 211   O OE2   . GLU A 1 53  ? 18.835  -69.838  -134.310 1.00 96.17  ? 50  GLU A OE2   1 
ATOM 212   N N     . TYR A 1 54  ? 23.256  -69.606  -129.800 1.00 75.81  ? 51  TYR A N     1 
ATOM 213   C CA    . TYR A 1 54  ? 23.715  -69.322  -128.447 1.00 73.55  ? 51  TYR A CA    1 
ATOM 214   C C     . TYR A 1 54  ? 25.133  -69.807  -128.189 1.00 75.25  ? 51  TYR A C     1 
ATOM 215   O O     . TYR A 1 54  ? 25.864  -69.182  -127.410 1.00 76.92  ? 51  TYR A O     1 
ATOM 216   C CB    . TYR A 1 54  ? 22.757  -69.973  -127.448 1.00 68.46  ? 51  TYR A CB    1 
ATOM 217   C CG    . TYR A 1 54  ? 21.383  -69.349  -127.455 1.00 74.79  ? 51  TYR A CG    1 
ATOM 218   C CD1   . TYR A 1 54  ? 21.225  -67.970  -127.457 1.00 80.32  ? 51  TYR A CD1   1 
ATOM 219   C CD2   . TYR A 1 54  ? 20.243  -70.137  -127.511 1.00 70.69  ? 51  TYR A CD2   1 
ATOM 220   C CE1   . TYR A 1 54  ? 19.969  -67.394  -127.472 1.00 73.25  ? 51  TYR A CE1   1 
ATOM 221   C CE2   . TYR A 1 54  ? 18.982  -69.571  -127.531 1.00 64.55  ? 51  TYR A CE2   1 
ATOM 222   C CZ    . TYR A 1 54  ? 18.852  -68.201  -127.511 1.00 67.43  ? 51  TYR A CZ    1 
ATOM 223   O OH    . TYR A 1 54  ? 17.598  -67.641  -127.530 1.00 74.21  ? 51  TYR A OH    1 
ATOM 224   N N     . ILE A 1 55  ? 25.529  -70.906  -128.818 1.00 71.36  ? 52  ILE A N     1 
ATOM 225   C CA    . ILE A 1 55  ? 26.787  -71.575  -128.507 1.00 71.14  ? 52  ILE A CA    1 
ATOM 226   C C     . ILE A 1 55  ? 27.940  -70.896  -129.230 1.00 68.36  ? 52  ILE A C     1 
ATOM 227   O O     . ILE A 1 55  ? 27.823  -70.499  -130.397 1.00 89.95  ? 52  ILE A O     1 
ATOM 228   C CB    . ILE A 1 55  ? 26.707  -73.066  -128.877 1.00 74.68  ? 52  ILE A CB    1 
ATOM 229   C CG1   . ILE A 1 55  ? 25.387  -73.670  -128.396 1.00 75.45  ? 52  ILE A CG1   1 
ATOM 230   C CG2   . ILE A 1 55  ? 27.881  -73.827  -128.278 1.00 73.12  ? 52  ILE A CG2   1 
ATOM 231   C CD1   . ILE A 1 55  ? 25.154  -73.524  -126.910 1.00 70.96  ? 52  ILE A CD1   1 
ATOM 232   N N     . SER A 1 56  ? 29.063  -70.763  -128.530 1.00 65.69  ? 53  SER A N     1 
ATOM 233   C CA    . SER A 1 56  ? 30.316  -70.295  -129.094 1.00 75.18  ? 53  SER A CA    1 
ATOM 234   C C     . SER A 1 56  ? 31.376  -71.328  -128.742 1.00 75.84  ? 53  SER A C     1 
ATOM 235   O O     . SER A 1 56  ? 31.157  -72.206  -127.902 1.00 79.49  ? 53  SER A O     1 
ATOM 236   C CB    . SER A 1 56  ? 30.700  -68.908  -128.558 1.00 75.26  ? 53  SER A CB    1 
ATOM 237   O OG    . SER A 1 56  ? 29.606  -68.009  -128.620 1.00 79.12  ? 53  SER A OG    1 
ATOM 238   N N     . SER A 1 57  ? 32.550  -71.199  -129.351 1.00 80.98  ? 54  SER A N     1 
ATOM 239   C CA    . SER A 1 57  ? 33.583  -72.203  -129.159 1.00 87.37  ? 54  SER A CA    1 
ATOM 240   C C     . SER A 1 57  ? 34.952  -71.552  -129.242 1.00 96.25  ? 54  SER A C     1 
ATOM 241   O O     . SER A 1 57  ? 35.132  -70.530  -129.910 1.00 101.27 ? 54  SER A O     1 
ATOM 242   C CB    . SER A 1 57  ? 33.460  -73.332  -130.191 1.00 88.21  ? 54  SER A CB    1 
ATOM 243   O OG    . SER A 1 57  ? 33.841  -72.899  -131.485 1.00 101.13 ? 54  SER A OG    1 
ATOM 244   N N     . ARG A 1 58  ? 35.914  -72.153  -128.544 1.00 96.25  ? 55  ARG A N     1 
ATOM 245   C CA    . ARG A 1 58  ? 37.302  -71.717  -128.605 1.00 105.77 ? 55  ARG A CA    1 
ATOM 246   C C     . ARG A 1 58  ? 38.195  -72.947  -128.691 1.00 115.33 ? 55  ARG A C     1 
ATOM 247   O O     . ARG A 1 58  ? 37.723  -74.091  -128.671 1.00 112.23 ? 55  ARG A O     1 
ATOM 248   C CB    . ARG A 1 58  ? 37.716  -70.889  -127.381 1.00 115.12 ? 55  ARG A CB    1 
ATOM 249   C CG    . ARG A 1 58  ? 37.858  -71.723  -126.111 1.00 119.08 ? 55  ARG A CG    1 
ATOM 250   C CD    . ARG A 1 58  ? 38.419  -70.926  -124.942 1.00 109.11 ? 55  ARG A CD    1 
ATOM 251   N NE    . ARG A 1 58  ? 38.271  -71.657  -123.687 1.00 116.04 ? 55  ARG A NE    1 
ATOM 252   C CZ    . ARG A 1 58  ? 37.238  -71.534  -122.863 1.00 123.15 ? 55  ARG A CZ    1 
ATOM 253   N NH1   . ARG A 1 58  ? 36.338  -70.582  -123.065 1.00 114.11 ? 55  ARG A NH1   1 
ATOM 254   N NH2   . ARG A 1 58  ? 37.183  -72.262  -121.757 1.00 120.41 ? 55  ARG A NH2   1 
ATOM 255   N N     . MET A 1 59  ? 39.500  -72.696  -128.758 1.00 129.33 ? 56  MET A N     1 
ATOM 256   C CA    . MET A 1 59  ? 40.521  -73.732  -128.763 1.00 135.60 ? 56  MET A CA    1 
ATOM 257   C C     . MET A 1 59  ? 41.233  -73.725  -127.416 1.00 133.04 ? 56  MET A C     1 
ATOM 258   O O     . MET A 1 59  ? 41.608  -72.663  -126.909 1.00 123.85 ? 56  MET A O     1 
ATOM 259   C CB    . MET A 1 59  ? 41.536  -73.507  -129.888 1.00 134.80 ? 56  MET A CB    1 
ATOM 260   C CG    . MET A 1 59  ? 40.964  -73.633  -131.291 1.00 132.34 ? 56  MET A CG    1 
ATOM 261   S SD    . MET A 1 59  ? 40.140  -75.207  -131.605 1.00 139.71 ? 56  MET A SD    1 
ATOM 262   C CE    . MET A 1 59  ? 38.765  -74.683  -132.633 1.00 122.23 ? 56  MET A CE    1 
ATOM 263   N N     . ALA A 1 60  ? 41.416  -74.906  -126.838 1.00 134.07 ? 57  ALA A N     1 
ATOM 264   C CA    . ALA A 1 60  ? 42.039  -75.004  -125.529 1.00 140.25 ? 57  ALA A CA    1 
ATOM 265   C C     . ALA A 1 60  ? 43.562  -74.980  -125.652 1.00 149.34 ? 57  ALA A C     1 
ATOM 266   O O     . ALA A 1 60  ? 44.127  -74.975  -126.748 1.00 148.24 ? 57  ALA A O     1 
ATOM 267   C CB    . ALA A 1 60  ? 41.574  -76.269  -124.810 1.00 138.84 ? 57  ALA A CB    1 
ATOM 268   N N     . GLY A 1 61  ? 44.227  -74.963  -124.496 1.00 144.28 ? 58  GLY A N     1 
ATOM 269   C CA    . GLY A 1 61  ? 45.680  -74.987  -124.453 1.00 150.35 ? 58  GLY A CA    1 
ATOM 270   C C     . GLY A 1 61  ? 46.299  -76.235  -125.045 1.00 154.58 ? 58  GLY A C     1 
ATOM 271   O O     . GLY A 1 61  ? 47.513  -76.249  -125.286 1.00 143.33 ? 58  GLY A O     1 
ATOM 272   N N     . GLY A 1 62  ? 45.503  -77.275  -125.283 1.00 160.28 ? 59  GLY A N     1 
ATOM 273   C CA    . GLY A 1 62  ? 45.991  -78.497  -125.889 1.00 157.83 ? 59  GLY A CA    1 
ATOM 274   C C     . GLY A 1 62  ? 45.347  -78.794  -127.229 1.00 150.26 ? 59  GLY A C     1 
ATOM 275   O O     . GLY A 1 62  ? 45.286  -79.952  -127.653 1.00 147.61 ? 59  GLY A O     1 
ATOM 276   N N     . GLY A 1 63  ? 44.856  -77.754  -127.900 1.00 142.95 ? 60  GLY A N     1 
ATOM 277   C CA    . GLY A 1 63  ? 44.292  -77.894  -129.229 1.00 141.51 ? 60  GLY A CA    1 
ATOM 278   C C     . GLY A 1 63  ? 43.036  -78.738  -129.292 1.00 140.85 ? 60  GLY A C     1 
ATOM 279   O O     . GLY A 1 63  ? 43.016  -79.784  -129.948 1.00 128.98 ? 60  GLY A O     1 
ATOM 280   N N     . GLN A 1 64  ? 41.978  -78.294  -128.616 1.00 144.28 ? 61  GLN A N     1 
ATOM 281   C CA    . GLN A 1 64  ? 40.701  -78.991  -128.631 1.00 133.19 ? 61  GLN A CA    1 
ATOM 282   C C     . GLN A 1 64  ? 39.576  -77.974  -128.505 1.00 125.53 ? 61  GLN A C     1 
ATOM 283   O O     . GLN A 1 64  ? 39.771  -76.855  -128.023 1.00 122.22 ? 61  GLN A O     1 
ATOM 284   C CB    . GLN A 1 64  ? 40.620  -80.049  -127.518 1.00 127.41 ? 61  GLN A CB    1 
ATOM 285   C CG    . GLN A 1 64  ? 41.088  -79.569  -126.154 1.00 138.65 ? 61  GLN A CG    1 
ATOM 286   C CD    . GLN A 1 64  ? 41.543  -80.705  -125.254 1.00 140.80 ? 61  GLN A CD    1 
ATOM 287   O OE1   . GLN A 1 64  ? 41.372  -81.880  -125.581 1.00 138.68 ? 61  GLN A OE1   1 
ATOM 288   N NE2   . GLN A 1 64  ? 42.136  -80.358  -124.117 1.00 131.25 ? 61  GLN A NE2   1 
ATOM 289   N N     . LYS A 1 65  ? 38.390  -78.376  -128.953 1.00 114.32 ? 62  LYS A N     1 
ATOM 290   C CA    . LYS A 1 65  ? 37.239  -77.486  -129.022 1.00 104.91 ? 62  LYS A CA    1 
ATOM 291   C C     . LYS A 1 65  ? 36.541  -77.416  -127.671 1.00 102.90 ? 62  LYS A C     1 
ATOM 292   O O     . LYS A 1 65  ? 36.239  -78.452  -127.069 1.00 100.01 ? 62  LYS A O     1 
ATOM 293   C CB    . LYS A 1 65  ? 36.262  -77.967  -130.096 1.00 100.16 ? 62  LYS A CB    1 
ATOM 294   C CG    . LYS A 1 65  ? 35.065  -77.060  -130.305 1.00 97.38  ? 62  LYS A CG    1 
ATOM 295   C CD    . LYS A 1 65  ? 34.207  -77.550  -131.458 1.00 94.21  ? 62  LYS A CD    1 
ATOM 296   C CE    . LYS A 1 65  ? 33.095  -76.565  -131.773 1.00 96.35  ? 62  LYS A CE    1 
ATOM 297   N NZ    . LYS A 1 65  ? 32.294  -76.987  -132.954 1.00 106.89 ? 62  LYS A NZ    1 
ATOM 298   N N     . VAL A 1 66  ? 36.285  -76.198  -127.197 1.00 102.92 ? 63  VAL A N     1 
ATOM 299   C CA    . VAL A 1 66  ? 35.548  -75.982  -125.955 1.00 99.38  ? 63  VAL A CA    1 
ATOM 300   C C     . VAL A 1 66  ? 34.348  -75.097  -126.265 1.00 92.49  ? 63  VAL A C     1 
ATOM 301   O O     . VAL A 1 66  ? 34.509  -73.984  -126.779 1.00 94.11  ? 63  VAL A O     1 
ATOM 302   C CB    . VAL A 1 66  ? 36.430  -75.347  -124.867 1.00 100.13 ? 63  VAL A CB    1 
ATOM 303   C CG1   . VAL A 1 66  ? 35.592  -74.985  -123.651 1.00 94.20  ? 63  VAL A CG1   1 
ATOM 304   C CG2   . VAL A 1 66  ? 37.557  -76.292  -124.476 1.00 102.28 ? 63  VAL A CG2   1 
ATOM 305   N N     . CYS A 1 67  ? 33.151  -75.595  -125.958 1.00 84.14  ? 64  CYS A N     1 
ATOM 306   C CA    . CYS A 1 67  ? 31.911  -74.858  -126.154 1.00 81.24  ? 64  CYS A CA    1 
ATOM 307   C C     . CYS A 1 67  ? 31.536  -74.073  -124.901 1.00 80.98  ? 64  CYS A C     1 
ATOM 308   O O     . CYS A 1 67  ? 31.921  -74.418  -123.781 1.00 81.38  ? 64  CYS A O     1 
ATOM 309   C CB    . CYS A 1 67  ? 30.771  -75.802  -126.539 1.00 81.59  ? 64  CYS A CB    1 
ATOM 310   S SG    . CYS A 1 67  ? 31.006  -76.649  -128.117 1.00 80.03  ? 64  CYS A SG    1 
ATOM 311   N N     . TYR A 1 68  ? 30.755  -73.014  -125.106 1.00 75.95  ? 65  TYR A N     1 
ATOM 312   C CA    . TYR A 1 68  ? 30.308  -72.174  -123.999 1.00 66.57  ? 65  TYR A CA    1 
ATOM 313   C C     . TYR A 1 68  ? 29.193  -71.256  -124.479 1.00 63.09  ? 65  TYR A C     1 
ATOM 314   O O     . TYR A 1 68  ? 28.939  -71.136  -125.681 1.00 72.93  ? 65  TYR A O     1 
ATOM 315   C CB    . TYR A 1 68  ? 31.469  -71.365  -123.403 1.00 60.70  ? 65  TYR A CB    1 
ATOM 316   C CG    . TYR A 1 68  ? 32.019  -70.285  -124.306 1.00 71.96  ? 65  TYR A CG    1 
ATOM 317   C CD1   . TYR A 1 68  ? 32.922  -70.589  -125.319 1.00 90.35  ? 65  TYR A CD1   1 
ATOM 318   C CD2   . TYR A 1 68  ? 31.654  -68.959  -124.130 1.00 65.75  ? 65  TYR A CD2   1 
ATOM 319   C CE1   . TYR A 1 68  ? 33.432  -69.600  -126.141 1.00 86.39  ? 65  TYR A CE1   1 
ATOM 320   C CE2   . TYR A 1 68  ? 32.158  -67.966  -124.945 1.00 82.75  ? 65  TYR A CE2   1 
ATOM 321   C CZ    . TYR A 1 68  ? 33.045  -68.289  -125.948 1.00 83.60  ? 65  TYR A CZ    1 
ATOM 322   O OH    . TYR A 1 68  ? 33.544  -67.294  -126.757 1.00 89.29  ? 65  TYR A OH    1 
ATOM 323   N N     . ILE A 1 69  ? 28.485  -70.659  -123.520 1.00 69.49  ? 66  ILE A N     1 
ATOM 324   C CA    . ILE A 1 69  ? 27.471  -69.643  -123.788 1.00 67.55  ? 66  ILE A CA    1 
ATOM 325   C C     . ILE A 1 69  ? 27.984  -68.306  -123.272 1.00 67.92  ? 66  ILE A C     1 
ATOM 326   O O     . ILE A 1 69  ? 28.423  -68.209  -122.120 1.00 74.66  ? 66  ILE A O     1 
ATOM 327   C CB    . ILE A 1 69  ? 26.124  -69.999  -123.138 1.00 57.53  ? 66  ILE A CB    1 
ATOM 328   C CG1   . ILE A 1 69  ? 25.753  -71.449  -123.442 1.00 72.79  ? 66  ILE A CG1   1 
ATOM 329   C CG2   . ILE A 1 69  ? 25.031  -69.064  -123.636 1.00 57.13  ? 66  ILE A CG2   1 
ATOM 330   C CD1   . ILE A 1 69  ? 24.464  -71.895  -122.794 1.00 65.52  ? 66  ILE A CD1   1 
ATOM 331   N N     . GLU A 1 70  ? 27.920  -67.278  -124.115 1.00 63.10  ? 67  GLU A N     1 
ATOM 332   C CA    . GLU A 1 70  ? 28.396  -65.960  -123.716 1.00 66.31  ? 67  GLU A CA    1 
ATOM 333   C C     . GLU A 1 70  ? 27.467  -65.346  -122.669 1.00 75.17  ? 67  GLU A C     1 
ATOM 334   O O     . GLU A 1 70  ? 26.265  -65.626  -122.631 1.00 70.95  ? 67  GLU A O     1 
ATOM 335   C CB    . GLU A 1 70  ? 28.531  -65.054  -124.941 1.00 74.23  ? 67  GLU A CB    1 
ATOM 336   C CG    . GLU A 1 70  ? 29.580  -65.570  -125.933 1.00 85.73  ? 67  GLU A CG    1 
ATOM 337   C CD    . GLU A 1 70  ? 29.930  -64.584  -127.036 1.00 93.99  ? 67  GLU A CD    1 
ATOM 338   O OE1   . GLU A 1 70  ? 31.127  -64.244  -127.169 1.00 101.58 ? 67  GLU A OE1   1 
ATOM 339   O OE2   . GLU A 1 70  ? 29.016  -64.157  -127.773 1.00 92.77  ? 67  GLU A OE2   1 
ATOM 340   N N     . GLY A 1 71  ? 28.056  -64.514  -121.802 1.00 68.29  ? 68  GLY A N     1 
ATOM 341   C CA    . GLY A 1 71  ? 27.329  -63.983  -120.654 1.00 55.32  ? 68  GLY A CA    1 
ATOM 342   C C     . GLY A 1 71  ? 26.028  -63.290  -121.011 1.00 63.34  ? 68  GLY A C     1 
ATOM 343   O O     . GLY A 1 71  ? 24.975  -63.580  -120.432 1.00 61.70  ? 68  GLY A O     1 
ATOM 344   N N     . HIS A 1 72  ? 26.084  -62.342  -121.954 1.00 62.85  ? 69  HIS A N     1 
ATOM 345   C CA    . HIS A 1 72  ? 24.897  -61.561  -122.292 1.00 63.37  ? 69  HIS A CA    1 
ATOM 346   C C     . HIS A 1 72  ? 23.760  -62.450  -122.776 1.00 67.39  ? 69  HIS A C     1 
ATOM 347   O O     . HIS A 1 72  ? 22.585  -62.161  -122.508 1.00 66.19  ? 69  HIS A O     1 
ATOM 348   C CB    . HIS A 1 72  ? 25.243  -60.515  -123.354 1.00 70.99  ? 69  HIS A CB    1 
ATOM 349   C CG    . HIS A 1 72  ? 25.537  -61.090  -124.705 1.00 78.85  ? 69  HIS A CG    1 
ATOM 350   N ND1   . HIS A 1 72  ? 26.765  -61.620  -125.036 1.00 79.69  ? 69  HIS A ND1   1 
ATOM 351   C CD2   . HIS A 1 72  ? 24.765  -61.212  -125.810 1.00 72.26  ? 69  HIS A CD2   1 
ATOM 352   C CE1   . HIS A 1 72  ? 26.737  -62.045  -126.286 1.00 76.24  ? 69  HIS A CE1   1 
ATOM 353   N NE2   . HIS A 1 72  ? 25.534  -61.811  -126.778 1.00 76.53  ? 69  HIS A NE2   1 
ATOM 354   N N     . ARG A 1 73  ? 24.091  -63.556  -123.444 1.00 65.88  ? 70  ARG A N     1 
ATOM 355   C CA    . ARG A 1 73  ? 23.062  -64.493  -123.873 1.00 72.43  ? 70  ARG A CA    1 
ATOM 356   C C     . ARG A 1 73  ? 22.361  -65.112  -122.673 1.00 63.51  ? 70  ARG A C     1 
ATOM 357   O O     . ARG A 1 73  ? 21.132  -65.230  -122.658 1.00 57.21  ? 70  ARG A O     1 
ATOM 358   C CB    . ARG A 1 73  ? 23.676  -65.579  -124.756 1.00 76.28  ? 70  ARG A CB    1 
ATOM 359   C CG    . ARG A 1 73  ? 24.393  -65.044  -125.984 1.00 78.50  ? 70  ARG A CG    1 
ATOM 360   C CD    . ARG A 1 73  ? 23.674  -65.402  -127.276 1.00 80.49  ? 70  ARG A CD    1 
ATOM 361   N NE    . ARG A 1 73  ? 24.261  -64.716  -128.425 1.00 84.67  ? 70  ARG A NE    1 
ATOM 362   C CZ    . ARG A 1 73  ? 25.419  -65.049  -128.989 1.00 88.90  ? 70  ARG A CZ    1 
ATOM 363   N NH1   . ARG A 1 73  ? 26.127  -66.069  -128.517 1.00 91.71  ? 70  ARG A NH1   1 
ATOM 364   N NH2   . ARG A 1 73  ? 25.873  -64.360  -130.029 1.00 82.71  ? 70  ARG A NH2   1 
ATOM 365   N N     . VAL A 1 74  ? 23.125  -65.488  -121.645 1.00 63.87  ? 71  VAL A N     1 
ATOM 366   C CA    . VAL A 1 74  ? 22.529  -66.089  -120.456 1.00 62.73  ? 71  VAL A CA    1 
ATOM 367   C C     . VAL A 1 74  ? 21.682  -65.070  -119.703 1.00 59.66  ? 71  VAL A C     1 
ATOM 368   O O     . VAL A 1 74  ? 20.600  -65.396  -119.194 1.00 52.40  ? 71  VAL A O     1 
ATOM 369   C CB    . VAL A 1 74  ? 23.627  -66.688  -119.559 1.00 51.59  ? 71  VAL A CB    1 
ATOM 370   C CG1   . VAL A 1 74  ? 23.010  -67.414  -118.378 1.00 54.73  ? 71  VAL A CG1   1 
ATOM 371   C CG2   . VAL A 1 74  ? 24.505  -67.630  -120.358 1.00 63.18  ? 71  VAL A CG2   1 
ATOM 372   N N     . ILE A 1 75  ? 22.156  -63.822  -119.620 1.00 56.39  ? 72  ILE A N     1 
ATOM 373   C CA    . ILE A 1 75  ? 21.386  -62.780  -118.941 1.00 53.53  ? 72  ILE A CA    1 
ATOM 374   C C     . ILE A 1 75  ? 20.046  -62.567  -119.638 1.00 57.03  ? 72  ILE A C     1 
ATOM 375   O O     . ILE A 1 75  ? 18.993  -62.495  -118.990 1.00 56.84  ? 72  ILE A O     1 
ATOM 376   C CB    . ILE A 1 75  ? 22.198  -61.475  -118.854 1.00 57.86  ? 72  ILE A CB    1 
ATOM 377   C CG1   . ILE A 1 75  ? 23.361  -61.638  -117.872 1.00 62.99  ? 72  ILE A CG1   1 
ATOM 378   C CG2   . ILE A 1 75  ? 21.313  -60.321  -118.415 1.00 50.00  ? 72  ILE A CG2   1 
ATOM 379   C CD1   . ILE A 1 75  ? 24.245  -60.407  -117.748 1.00 74.75  ? 72  ILE A CD1   1 
ATOM 380   N N     . ASN A 1 76  ? 20.064  -62.459  -120.970 1.00 72.62  ? 73  ASN A N     1 
ATOM 381   C CA    . ASN A 1 76  ? 18.817  -62.255  -121.705 1.00 66.27  ? 73  ASN A CA    1 
ATOM 382   C C     . ASN A 1 76  ? 17.908  -63.477  -121.615 1.00 58.10  ? 73  ASN A C     1 
ATOM 383   O O     . ASN A 1 76  ? 16.683  -63.341  -121.481 1.00 51.14  ? 73  ASN A O     1 
ATOM 384   C CB    . ASN A 1 76  ? 19.128  -61.908  -123.161 1.00 59.68  ? 73  ASN A CB    1 
ATOM 385   C CG    . ASN A 1 76  ? 19.618  -60.482  -123.322 1.00 72.93  ? 73  ASN A CG    1 
ATOM 386   O OD1   . ASN A 1 76  ? 19.196  -59.583  -122.589 1.00 80.49  ? 73  ASN A OD1   1 
ATOM 387   N ND2   . ASN A 1 76  ? 20.515  -60.265  -124.281 1.00 72.93  ? 73  ASN A ND2   1 
ATOM 388   N N     . LEU A 1 77  ? 18.489  -64.680  -121.677 1.00 49.77  ? 74  LEU A N     1 
ATOM 389   C CA    . LEU A 1 77  ? 17.713  -65.903  -121.501 1.00 55.70  ? 74  LEU A CA    1 
ATOM 390   C C     . LEU A 1 77  ? 16.976  -65.901  -120.168 1.00 70.60  ? 74  LEU A C     1 
ATOM 391   O O     . LEU A 1 77  ? 15.781  -66.205  -120.105 1.00 68.36  ? 74  LEU A O     1 
ATOM 392   C CB    . LEU A 1 77  ? 18.631  -67.123  -121.591 1.00 55.93  ? 74  LEU A CB    1 
ATOM 393   C CG    . LEU A 1 77  ? 19.056  -67.615  -122.974 1.00 64.98  ? 74  LEU A CG    1 
ATOM 394   C CD1   . LEU A 1 77  ? 20.204  -68.613  -122.860 1.00 61.13  ? 74  LEU A CD1   1 
ATOM 395   C CD2   . LEU A 1 77  ? 17.875  -68.226  -123.703 1.00 62.24  ? 74  LEU A CD2   1 
ATOM 396   N N     . ALA A 1 78  ? 17.681  -65.548  -119.090 1.00 72.07  ? 75  ALA A N     1 
ATOM 397   C CA    . ALA A 1 78  ? 17.059  -65.549  -117.770 1.00 59.45  ? 75  ALA A CA    1 
ATOM 398   C C     . ALA A 1 78  ? 16.004  -64.457  -117.655 1.00 54.33  ? 75  ALA A C     1 
ATOM 399   O O     . ALA A 1 78  ? 14.931  -64.679  -117.076 1.00 54.16  ? 75  ALA A O     1 
ATOM 400   C CB    . ALA A 1 78  ? 18.125  -65.382  -116.689 1.00 56.51  ? 75  ALA A CB    1 
ATOM 401   N N     . ASN A 1 79  ? 16.287  -63.273  -118.205 1.00 54.10  ? 76  ASN A N     1 
ATOM 402   C CA    . ASN A 1 79  ? 15.305  -62.196  -118.172 1.00 56.80  ? 76  ASN A CA    1 
ATOM 403   C C     . ASN A 1 79  ? 14.032  -62.585  -118.909 1.00 68.67  ? 76  ASN A C     1 
ATOM 404   O O     . ASN A 1 79  ? 12.936  -62.172  -118.514 1.00 67.98  ? 76  ASN A O     1 
ATOM 405   C CB    . ASN A 1 79  ? 15.900  -60.920  -118.769 1.00 54.07  ? 76  ASN A CB    1 
ATOM 406   C CG    . ASN A 1 79  ? 16.797  -60.180  -117.792 1.00 58.68  ? 76  ASN A CG    1 
ATOM 407   O OD1   . ASN A 1 79  ? 16.475  -60.050  -116.611 1.00 61.10  ? 76  ASN A OD1   1 
ATOM 408   N ND2   . ASN A 1 79  ? 17.933  -59.696  -118.283 1.00 67.01  ? 76  ASN A ND2   1 
ATOM 409   N N     . GLU A 1 80  ? 14.150  -63.374  -119.980 1.00 62.60  ? 77  GLU A N     1 
ATOM 410   C CA    . GLU A 1 80  ? 12.951  -63.808  -120.691 1.00 64.26  ? 77  GLU A CA    1 
ATOM 411   C C     . GLU A 1 80  ? 12.249  -64.962  -119.981 1.00 63.22  ? 77  GLU A C     1 
ATOM 412   O O     . GLU A 1 80  ? 11.017  -65.054  -120.018 1.00 60.83  ? 77  GLU A O     1 
ATOM 413   C CB    . GLU A 1 80  ? 13.300  -64.198  -122.127 1.00 73.33  ? 77  GLU A CB    1 
ATOM 414   C CG    . GLU A 1 80  ? 13.752  -63.025  -122.978 1.00 74.62  ? 77  GLU A CG    1 
ATOM 415   C CD    . GLU A 1 80  ? 12.734  -61.898  -123.025 1.00 73.37  ? 77  GLU A CD    1 
ATOM 416   O OE1   . GLU A 1 80  ? 11.518  -62.169  -122.921 1.00 74.36  ? 77  GLU A OE1   1 
ATOM 417   O OE2   . GLU A 1 80  ? 13.155  -60.730  -123.157 1.00 64.20  ? 77  GLU A OE2   1 
ATOM 418   N N     . MET A 1 81  ? 13.012  -65.859  -119.351 1.00 67.13  ? 78  MET A N     1 
ATOM 419   C CA    . MET A 1 81  ? 12.405  -67.011  -118.690 1.00 59.90  ? 78  MET A CA    1 
ATOM 420   C C     . MET A 1 81  ? 11.639  -66.607  -117.437 1.00 61.13  ? 78  MET A C     1 
ATOM 421   O O     . MET A 1 81  ? 10.537  -67.110  -117.191 1.00 62.42  ? 78  MET A O     1 
ATOM 422   C CB    . MET A 1 81  ? 13.471  -68.051  -118.344 1.00 45.05  ? 78  MET A CB    1 
ATOM 423   C CG    . MET A 1 81  ? 13.906  -68.914  -119.514 1.00 74.30  ? 78  MET A CG    1 
ATOM 424   S SD    . MET A 1 81  ? 12.639  -70.087  -120.048 1.00 76.38  ? 78  MET A SD    1 
ATOM 425   C CE    . MET A 1 81  ? 11.820  -70.463  -118.500 1.00 55.27  ? 78  MET A CE    1 
ATOM 426   N N     . PHE A 1 82  ? 12.203  -65.711  -116.627 1.00 61.58  ? 79  PHE A N     1 
ATOM 427   C CA    . PHE A 1 82  ? 11.600  -65.370  -115.346 1.00 57.13  ? 79  PHE A CA    1 
ATOM 428   C C     . PHE A 1 82  ? 11.086  -63.944  -115.279 1.00 55.75  ? 79  PHE A C     1 
ATOM 429   O O     . PHE A 1 82  ? 10.391  -63.603  -114.316 1.00 57.75  ? 79  PHE A O     1 
ATOM 430   C CB    . PHE A 1 82  ? 12.602  -65.569  -114.199 1.00 54.68  ? 79  PHE A CB    1 
ATOM 431   C CG    . PHE A 1 82  ? 13.297  -66.896  -114.215 1.00 44.92  ? 79  PHE A CG    1 
ATOM 432   C CD1   . PHE A 1 82  ? 12.630  -68.048  -113.839 1.00 48.25  ? 79  PHE A CD1   1 
ATOM 433   C CD2   . PHE A 1 82  ? 14.631  -66.984  -114.572 1.00 39.46  ? 79  PHE A CD2   1 
ATOM 434   C CE1   . PHE A 1 82  ? 13.274  -69.268  -113.841 1.00 39.96  ? 79  PHE A CE1   1 
ATOM 435   C CE2   . PHE A 1 82  ? 15.279  -68.197  -114.574 1.00 44.10  ? 79  PHE A CE2   1 
ATOM 436   C CZ    . PHE A 1 82  ? 14.601  -69.343  -114.209 1.00 43.73  ? 79  PHE A CZ    1 
ATOM 437   N N     . GLY A 1 83  ? 11.402  -63.115  -116.256 1.00 47.39  ? 80  GLY A N     1 
ATOM 438   C CA    . GLY A 1 83  ? 11.093  -61.706  -116.106 1.00 59.73  ? 80  GLY A CA    1 
ATOM 439   C C     . GLY A 1 83  ? 12.260  -60.947  -115.513 1.00 64.91  ? 80  GLY A C     1 
ATOM 440   O O     . GLY A 1 83  ? 13.092  -61.489  -114.787 1.00 67.65  ? 80  GLY A O     1 
ATOM 441   N N     . TYR A 1 84  ? 12.338  -59.659  -115.857 1.00 61.59  ? 81  TYR A N     1 
ATOM 442   C CA    . TYR A 1 84  ? 13.402  -58.822  -115.315 1.00 59.54  ? 81  TYR A CA    1 
ATOM 443   C C     . TYR A 1 84  ? 13.386  -58.783  -113.793 1.00 62.98  ? 81  TYR A C     1 
ATOM 444   O O     . TYR A 1 84  ? 14.421  -58.507  -113.178 1.00 64.52  ? 81  TYR A O     1 
ATOM 445   C CB    . TYR A 1 84  ? 13.300  -57.397  -115.856 1.00 60.85  ? 81  TYR A CB    1 
ATOM 446   C CG    . TYR A 1 84  ? 12.161  -56.604  -115.264 1.00 60.03  ? 81  TYR A CG    1 
ATOM 447   C CD1   . TYR A 1 84  ? 10.850  -56.802  -115.676 1.00 60.80  ? 81  TYR A CD1   1 
ATOM 448   C CD2   . TYR A 1 84  ? 12.399  -55.671  -114.264 1.00 53.25  ? 81  TYR A CD2   1 
ATOM 449   C CE1   . TYR A 1 84  ? 9.814   -56.074  -115.120 1.00 48.41  ? 81  TYR A CE1   1 
ATOM 450   C CE2   . TYR A 1 84  ? 11.374  -54.947  -113.703 1.00 59.60  ? 81  TYR A CE2   1 
ATOM 451   C CZ    . TYR A 1 84  ? 10.083  -55.149  -114.132 1.00 56.58  ? 81  TYR A CZ    1 
ATOM 452   O OH    . TYR A 1 84  ? 9.065   -54.417  -113.567 1.00 58.38  ? 81  TYR A OH    1 
ATOM 453   N N     . ASN A 1 85  ? 12.232  -59.041  -113.175 1.00 53.79  ? 82  ASN A N     1 
ATOM 454   C CA    . ASN A 1 85  ? 12.080  -58.994  -111.726 1.00 59.47  ? 82  ASN A CA    1 
ATOM 455   C C     . ASN A 1 85  ? 11.716  -60.355  -111.143 1.00 59.06  ? 82  ASN A C     1 
ATOM 456   O O     . ASN A 1 85  ? 11.178  -60.429  -110.033 1.00 56.86  ? 82  ASN A O     1 
ATOM 457   C CB    . ASN A 1 85  ? 11.032  -57.952  -111.334 1.00 54.02  ? 82  ASN A CB    1 
ATOM 458   C CG    . ASN A 1 85  ? 9.612   -58.401  -111.640 1.00 61.20  ? 82  ASN A CG    1 
ATOM 459   O OD1   . ASN A 1 85  ? 9.368   -59.131  -112.605 1.00 61.93  ? 82  ASN A OD1   1 
ATOM 460   N ND2   . ASN A 1 85  ? 8.666   -57.956  -110.820 1.00 57.77  ? 82  ASN A ND2   1 
ATOM 461   N N     . GLY A 1 86  ? 12.011  -61.432  -111.860 1.00 54.78  ? 83  GLY A N     1 
ATOM 462   C CA    . GLY A 1 86  ? 11.654  -62.756  -111.400 1.00 54.46  ? 83  GLY A CA    1 
ATOM 463   C C     . GLY A 1 86  ? 12.873  -63.567  -111.026 1.00 53.16  ? 83  GLY A C     1 
ATOM 464   O O     . GLY A 1 86  ? 12.755  -64.652  -110.448 1.00 59.88  ? 83  GLY A O     1 
ATOM 465   N N     . TRP A 1 87  ? 14.054  -63.052  -111.356 1.00 51.50  ? 84  TRP A N     1 
ATOM 466   C CA    . TRP A 1 87  ? 15.308  -63.663  -110.949 1.00 50.27  ? 84  TRP A CA    1 
ATOM 467   C C     . TRP A 1 87  ? 16.249  -62.588  -110.422 1.00 40.16  ? 84  TRP A C     1 
ATOM 468   O O     . TRP A 1 87  ? 16.153  -61.412  -110.780 1.00 45.36  ? 84  TRP A O     1 
ATOM 469   C CB    . TRP A 1 87  ? 15.974  -64.427  -112.104 1.00 42.73  ? 84  TRP A CB    1 
ATOM 470   C CG    . TRP A 1 87  ? 16.607  -63.543  -113.137 1.00 44.12  ? 84  TRP A CG    1 
ATOM 471   C CD1   . TRP A 1 87  ? 15.970  -62.763  -114.055 1.00 41.91  ? 84  TRP A CD1   1 
ATOM 472   C CD2   . TRP A 1 87  ? 18.011  -63.340  -113.344 1.00 45.26  ? 84  TRP A CD2   1 
ATOM 473   N NE1   . TRP A 1 87  ? 16.890  -62.093  -114.826 1.00 51.35  ? 84  TRP A NE1   1 
ATOM 474   C CE2   . TRP A 1 87  ? 18.150  -62.430  -114.407 1.00 44.52  ? 84  TRP A CE2   1 
ATOM 475   C CE3   . TRP A 1 87  ? 19.163  -63.843  -112.734 1.00 41.37  ? 84  TRP A CE3   1 
ATOM 476   C CZ2   . TRP A 1 87  ? 19.394  -62.012  -114.873 1.00 49.90  ? 84  TRP A CZ2   1 
ATOM 477   C CZ3   . TRP A 1 87  ? 20.397  -63.428  -113.201 1.00 40.60  ? 84  TRP A CZ3   1 
ATOM 478   C CH2   . TRP A 1 87  ? 20.502  -62.521  -114.258 1.00 49.12  ? 84  TRP A CH2   1 
ATOM 479   N N     . ALA A 1 88  ? 17.165  -63.018  -109.561 1.00 46.43  ? 85  ALA A N     1 
ATOM 480   C CA    . ALA A 1 88  ? 18.135  -62.141  -108.928 1.00 46.59  ? 85  ALA A CA    1 
ATOM 481   C C     . ALA A 1 88  ? 19.396  -62.951  -108.685 1.00 40.02  ? 85  ALA A C     1 
ATOM 482   O O     . ALA A 1 88  ? 19.352  -64.179  -108.628 1.00 40.61  ? 85  ALA A O     1 
ATOM 483   C CB    . ALA A 1 88  ? 17.597  -61.563  -107.613 1.00 38.30  ? 85  ALA A CB    1 
ATOM 484   N N     . HIS A 1 89  ? 20.532  -62.271  -108.564 1.00 31.12  ? 86  HIS A N     1 
ATOM 485   C CA    . HIS A 1 89  ? 21.748  -62.975  -108.182 1.00 39.29  ? 86  HIS A CA    1 
ATOM 486   C C     . HIS A 1 89  ? 22.608  -62.084  -107.302 1.00 41.78  ? 86  HIS A C     1 
ATOM 487   O O     . HIS A 1 89  ? 22.555  -60.853  -107.386 1.00 45.85  ? 86  HIS A O     1 
ATOM 488   C CB    . HIS A 1 89  ? 22.551  -63.458  -109.400 1.00 43.63  ? 86  HIS A CB    1 
ATOM 489   C CG    . HIS A 1 89  ? 23.366  -62.390  -110.056 1.00 45.46  ? 86  HIS A CG    1 
ATOM 490   N ND1   . HIS A 1 89  ? 22.808  -61.243  -110.576 1.00 41.91  ? 86  HIS A ND1   1 
ATOM 491   C CD2   . HIS A 1 89  ? 24.697  -62.299  -110.286 1.00 42.42  ? 86  HIS A CD2   1 
ATOM 492   C CE1   . HIS A 1 89  ? 23.760  -60.487  -111.092 1.00 47.04  ? 86  HIS A CE1   1 
ATOM 493   N NE2   . HIS A 1 89  ? 24.916  -61.106  -110.931 1.00 53.33  ? 86  HIS A NE2   1 
ATOM 494   N N     . SER A 1 90  ? 23.413  -62.729  -106.463 1.00 39.61  ? 87  SER A N     1 
ATOM 495   C CA    . SER A 1 90  ? 24.269  -62.030  -105.520 1.00 36.74  ? 87  SER A CA    1 
ATOM 496   C C     . SER A 1 90  ? 25.596  -62.766  -105.405 1.00 35.97  ? 87  SER A C     1 
ATOM 497   O O     . SER A 1 90  ? 25.695  -63.965  -105.682 1.00 35.15  ? 87  SER A O     1 
ATOM 498   C CB    . SER A 1 90  ? 23.598  -61.895  -104.143 1.00 42.12  ? 87  SER A CB    1 
ATOM 499   O OG    . SER A 1 90  ? 23.185  -63.151  -103.627 1.00 45.00  ? 87  SER A OG    1 
ATOM 500   N N     . ILE A 1 91  ? 26.628  -62.025  -105.016 1.00 32.03  ? 88  ILE A N     1 
ATOM 501   C CA    . ILE A 1 91  ? 27.959  -62.581  -104.806 1.00 42.04  ? 88  ILE A CA    1 
ATOM 502   C C     . ILE A 1 91  ? 28.083  -62.885  -103.316 1.00 45.71  ? 88  ILE A C     1 
ATOM 503   O O     . ILE A 1 91  ? 28.246  -61.977  -102.498 1.00 47.15  ? 88  ILE A O     1 
ATOM 504   C CB    . ILE A 1 91  ? 29.055  -61.625  -105.285 1.00 39.21  ? 88  ILE A CB    1 
ATOM 505   C CG1   . ILE A 1 91  ? 28.844  -61.273  -106.759 1.00 31.56  ? 88  ILE A CG1   1 
ATOM 506   C CG2   . ILE A 1 91  ? 30.424  -62.245  -105.081 1.00 37.49  ? 88  ILE A CG2   1 
ATOM 507   C CD1   . ILE A 1 91  ? 29.731  -60.152  -107.236 1.00 40.36  ? 88  ILE A CD1   1 
ATOM 508   N N     . THR A 1 92  ? 27.999  -64.169  -102.959 1.00 41.35  ? 89  THR A N     1 
ATOM 509   C CA    . THR A 1 92  ? 28.136  -64.562  -101.561 1.00 47.58  ? 89  THR A CA    1 
ATOM 510   C C     . THR A 1 92  ? 29.537  -64.256  -101.054 1.00 45.41  ? 89  THR A C     1 
ATOM 511   O O     . THR A 1 92  ? 29.709  -63.724  -99.951  1.00 49.80  ? 89  THR A O     1 
ATOM 512   C CB    . THR A 1 92  ? 27.819  -66.052  -101.400 1.00 38.32  ? 89  THR A CB    1 
ATOM 513   O OG1   . THR A 1 92  ? 26.487  -66.312  -101.859 1.00 39.32  ? 89  THR A OG1   1 
ATOM 514   C CG2   . THR A 1 92  ? 27.953  -66.492  -99.938  1.00 46.78  ? 89  THR A CG2   1 
ATOM 515   N N     . GLN A 1 93  ? 30.552  -64.599  -101.843 1.00 48.37  ? 90  GLN A N     1 
ATOM 516   C CA    . GLN A 1 93  ? 31.923  -64.311  -101.463 1.00 49.48  ? 90  GLN A CA    1 
ATOM 517   C C     . GLN A 1 93  ? 32.784  -64.433  -102.711 1.00 53.07  ? 90  GLN A C     1 
ATOM 518   O O     . GLN A 1 93  ? 32.544  -65.304  -103.553 1.00 52.30  ? 90  GLN A O     1 
ATOM 519   C CB    . GLN A 1 93  ? 32.408  -65.270  -100.371 1.00 50.93  ? 90  GLN A CB    1 
ATOM 520   C CG    . GLN A 1 93  ? 33.511  -64.699  -99.516  1.00 58.56  ? 90  GLN A CG    1 
ATOM 521   C CD    . GLN A 1 93  ? 34.082  -65.694  -98.533  1.00 62.36  ? 90  GLN A CD    1 
ATOM 522   O OE1   . GLN A 1 93  ? 34.369  -66.841  -98.885  1.00 48.94  ? 90  GLN A OE1   1 
ATOM 523   N NE2   . GLN A 1 93  ? 34.153  -65.289  -97.265  1.00 78.17  ? 90  GLN A NE2   1 
ATOM 524   N N     . GLN A 1 94  ? 33.754  -63.536  -102.841 1.00 46.81  ? 91  GLN A N     1 
ATOM 525   C CA    . GLN A 1 94  ? 34.804  -63.645  -103.842 1.00 34.61  ? 91  GLN A CA    1 
ATOM 526   C C     . GLN A 1 94  ? 36.138  -63.695  -103.117 1.00 39.63  ? 91  GLN A C     1 
ATOM 527   O O     . GLN A 1 94  ? 36.398  -62.875  -102.230 1.00 51.84  ? 91  GLN A O     1 
ATOM 528   C CB    . GLN A 1 94  ? 34.783  -62.477  -104.833 1.00 32.78  ? 91  GLN A CB    1 
ATOM 529   C CG    . GLN A 1 94  ? 36.108  -62.286  -105.567 1.00 45.95  ? 91  GLN A CG    1 
ATOM 530   C CD    . GLN A 1 94  ? 35.966  -61.540  -106.879 1.00 45.09  ? 91  GLN A CD    1 
ATOM 531   O OE1   . GLN A 1 94  ? 36.486  -60.437  -107.034 1.00 48.99  ? 91  GLN A OE1   1 
ATOM 532   N NE2   . GLN A 1 94  ? 35.280  -62.149  -107.837 1.00 43.28  ? 91  GLN A NE2   1 
ATOM 533   N N     . ASN A 1 95  ? 36.968  -64.667  -103.480 1.00 42.71  ? 92  ASN A N     1 
ATOM 534   C CA    . ASN A 1 95  ? 38.240  -64.908  -102.813 1.00 53.48  ? 92  ASN A CA    1 
ATOM 535   C C     . ASN A 1 95  ? 39.317  -65.021  -103.877 1.00 49.58  ? 92  ASN A C     1 
ATOM 536   O O     . ASN A 1 95  ? 39.246  -65.895  -104.747 1.00 51.72  ? 92  ASN A O     1 
ATOM 537   C CB    . ASN A 1 95  ? 38.175  -66.183  -101.965 1.00 50.87  ? 92  ASN A CB    1 
ATOM 538   C CG    . ASN A 1 95  ? 39.469  -66.467  -101.228 1.00 66.71  ? 92  ASN A CG    1 
ATOM 539   O OD1   . ASN A 1 95  ? 40.237  -65.554  -100.919 1.00 85.50  ? 92  ASN A OD1   1 
ATOM 540   N ND2   . ASN A 1 95  ? 39.720  -67.742  -100.947 1.00 78.71  ? 92  ASN A ND2   1 
ATOM 541   N N     . VAL A 1 96  ? 40.323  -64.157  -103.795 1.00 42.84  ? 93  VAL A N     1 
ATOM 542   C CA    . VAL A 1 96  ? 41.449  -64.216  -104.717 1.00 42.96  ? 93  VAL A CA    1 
ATOM 543   C C     . VAL A 1 96  ? 42.344  -65.364  -104.267 1.00 48.21  ? 93  VAL A C     1 
ATOM 544   O O     . VAL A 1 96  ? 42.927  -65.317  -103.182 1.00 58.50  ? 93  VAL A O     1 
ATOM 545   C CB    . VAL A 1 96  ? 42.219  -62.892  -104.752 1.00 44.32  ? 93  VAL A CB    1 
ATOM 546   C CG1   . VAL A 1 96  ? 43.444  -63.021  -105.633 1.00 50.04  ? 93  VAL A CG1   1 
ATOM 547   C CG2   . VAL A 1 96  ? 41.320  -61.767  -105.236 1.00 38.39  ? 93  VAL A CG2   1 
ATOM 548   N N     . ASP A 1 97  ? 42.444  -66.406  -105.095 1.00 50.44  ? 94  ASP A N     1 
ATOM 549   C CA    . ASP A 1 97  ? 43.241  -67.560  -104.697 1.00 50.13  ? 94  ASP A CA    1 
ATOM 550   C C     . ASP A 1 97  ? 44.725  -67.233  -104.725 1.00 53.72  ? 94  ASP A C     1 
ATOM 551   O O     . ASP A 1 97  ? 45.460  -67.596  -103.799 1.00 48.60  ? 94  ASP A O     1 
ATOM 552   C CB    . ASP A 1 97  ? 42.934  -68.763  -105.589 1.00 47.19  ? 94  ASP A CB    1 
ATOM 553   C CG    . ASP A 1 97  ? 41.656  -69.475  -105.189 1.00 52.64  ? 94  ASP A CG    1 
ATOM 554   O OD1   . ASP A 1 97  ? 41.205  -69.289  -104.038 1.00 53.53  ? 94  ASP A OD1   1 
ATOM 555   O OD2   . ASP A 1 97  ? 41.112  -70.237  -106.014 1.00 60.45  ? 94  ASP A OD2   1 
ATOM 556   N N     . PHE A 1 98  ? 45.190  -66.550  -105.771 1.00 57.61  ? 95  PHE A N     1 
ATOM 557   C CA    . PHE A 1 98  ? 46.608  -66.217  -105.807 1.00 53.36  ? 95  PHE A CA    1 
ATOM 558   C C     . PHE A 1 98  ? 46.861  -65.129  -106.835 1.00 47.37  ? 95  PHE A C     1 
ATOM 559   O O     . PHE A 1 98  ? 46.115  -64.984  -107.809 1.00 56.86  ? 95  PHE A O     1 
ATOM 560   C CB    . PHE A 1 98  ? 47.487  -67.436  -106.119 1.00 50.71  ? 95  PHE A CB    1 
ATOM 561   C CG    . PHE A 1 98  ? 47.243  -68.031  -107.470 1.00 56.78  ? 95  PHE A CG    1 
ATOM 562   C CD1   . PHE A 1 98  ? 48.037  -67.675  -108.548 1.00 63.94  ? 95  PHE A CD1   1 
ATOM 563   C CD2   . PHE A 1 98  ? 46.232  -68.952  -107.665 1.00 54.27  ? 95  PHE A CD2   1 
ATOM 564   C CE1   . PHE A 1 98  ? 47.822  -68.219  -109.795 1.00 60.35  ? 95  PHE A CE1   1 
ATOM 565   C CE2   . PHE A 1 98  ? 46.014  -69.501  -108.911 1.00 66.63  ? 95  PHE A CE2   1 
ATOM 566   C CZ    . PHE A 1 98  ? 46.812  -69.133  -109.976 1.00 66.35  ? 95  PHE A CZ    1 
ATOM 567   N N     . VAL A 1 99  ? 47.940  -64.383  -106.600 1.00 48.49  ? 96  VAL A N     1 
ATOM 568   C CA    . VAL A 1 99  ? 48.515  -63.430  -107.541 1.00 52.38  ? 96  VAL A CA    1 
ATOM 569   C C     . VAL A 1 99  ? 50.025  -63.625  -107.478 1.00 51.59  ? 96  VAL A C     1 
ATOM 570   O O     . VAL A 1 99  ? 50.665  -63.210  -106.505 1.00 47.00  ? 96  VAL A O     1 
ATOM 571   C CB    . VAL A 1 99  ? 48.145  -61.979  -107.206 1.00 42.47  ? 96  VAL A CB    1 
ATOM 572   C CG1   . VAL A 1 99  ? 48.873  -61.027  -108.132 1.00 50.90  ? 96  VAL A CG1   1 
ATOM 573   C CG2   . VAL A 1 99  ? 46.642  -61.779  -107.291 1.00 51.00  ? 96  VAL A CG2   1 
ATOM 574   N N     . ASP A 1 100 ? 50.595  -64.252  -108.501 1.00 61.14  ? 97  ASP A N     1 
ATOM 575   C CA    . ASP A 1 100 ? 52.015  -64.561  -108.540 1.00 64.65  ? 97  ASP A CA    1 
ATOM 576   C C     . ASP A 1 100 ? 52.702  -63.772  -109.645 1.00 65.96  ? 97  ASP A C     1 
ATOM 577   O O     . ASP A 1 100 ? 52.116  -63.506  -110.698 1.00 64.88  ? 97  ASP A O     1 
ATOM 578   C CB    . ASP A 1 100 ? 52.245  -66.057  -108.770 1.00 71.90  ? 97  ASP A CB    1 
ATOM 579   C CG    . ASP A 1 100 ? 51.775  -66.904  -107.609 1.00 77.22  ? 97  ASP A CG    1 
ATOM 580   O OD1   . ASP A 1 100 ? 52.029  -66.513  -106.450 1.00 79.26  ? 97  ASP A OD1   1 
ATOM 581   O OD2   . ASP A 1 100 ? 51.149  -67.956  -107.856 1.00 74.59  ? 97  ASP A OD2   1 
ATOM 582   N N     . LEU A 1 101 ? 53.964  -63.426  -109.404 1.00 63.90  ? 98  LEU A N     1 
ATOM 583   C CA    . LEU A 1 101 ? 54.775  -62.667  -110.350 1.00 58.57  ? 98  LEU A CA    1 
ATOM 584   C C     . LEU A 1 101 ? 55.954  -63.544  -110.746 1.00 63.36  ? 98  LEU A C     1 
ATOM 585   O O     . LEU A 1 101 ? 56.805  -63.865  -109.909 1.00 68.71  ? 98  LEU A O     1 
ATOM 586   C CB    . LEU A 1 101 ? 55.249  -61.345  -109.749 1.00 54.76  ? 98  LEU A CB    1 
ATOM 587   C CG    . LEU A 1 101 ? 56.163  -60.507  -110.647 1.00 56.66  ? 98  LEU A CG    1 
ATOM 588   C CD1   . LEU A 1 101 ? 55.499  -60.219  -111.986 1.00 68.21  ? 98  LEU A CD1   1 
ATOM 589   C CD2   . LEU A 1 101 ? 56.550  -59.214  -109.954 1.00 52.33  ? 98  LEU A CD2   1 
ATOM 590   N N     . ASN A 1 102 ? 55.990  -63.949  -112.011 1.00 70.02  ? 99  ASN A N     1 
ATOM 591   C CA    . ASN A 1 102 ? 57.059  -64.783  -112.544 1.00 75.87  ? 99  ASN A CA    1 
ATOM 592   C C     . ASN A 1 102 ? 57.733  -64.031  -113.680 1.00 84.15  ? 99  ASN A C     1 
ATOM 593   O O     . ASN A 1 102 ? 57.143  -63.863  -114.754 1.00 84.15  ? 99  ASN A O     1 
ATOM 594   C CB    . ASN A 1 102 ? 56.519  -66.130  -113.020 1.00 76.99  ? 99  ASN A CB    1 
ATOM 595   C CG    . ASN A 1 102 ? 56.332  -67.113  -111.885 1.00 94.04  ? 99  ASN A CG    1 
ATOM 596   O OD1   . ASN A 1 102 ? 57.178  -67.217  -110.995 1.00 109.06 ? 99  ASN A OD1   1 
ATOM 597   N ND2   . ASN A 1 102 ? 55.222  -67.844  -111.908 1.00 88.50  ? 99  ASN A ND2   1 
ATOM 598   N N     . ASN A 1 103 ? 58.965  -63.588  -113.432 1.00 90.09  ? 100 ASN A N     1 
ATOM 599   C CA    . ASN A 1 103 ? 59.794  -62.842  -114.383 1.00 99.84  ? 100 ASN A CA    1 
ATOM 600   C C     . ASN A 1 103 ? 58.958  -61.895  -115.245 1.00 93.00  ? 100 ASN A C     1 
ATOM 601   O O     . ASN A 1 103 ? 58.933  -61.975  -116.474 1.00 83.07  ? 100 ASN A O     1 
ATOM 602   C CB    . ASN A 1 103 ? 60.652  -63.774  -115.246 1.00 97.97  ? 100 ASN A CB    1 
ATOM 603   C CG    . ASN A 1 103 ? 59.860  -64.891  -115.898 1.00 95.56  ? 100 ASN A CG    1 
ATOM 604   O OD1   . ASN A 1 103 ? 59.278  -65.743  -115.227 1.00 94.85  ? 100 ASN A OD1   1 
ATOM 605   N ND2   . ASN A 1 103 ? 59.809  -64.870  -117.218 1.00 111.92 ? 100 ASN A ND2   1 
ATOM 606   N N     . GLY A 1 104 ? 58.250  -60.997  -114.564 1.00 85.86  ? 101 GLY A N     1 
ATOM 607   C CA    . GLY A 1 104 ? 57.546  -59.912  -115.213 1.00 81.63  ? 101 GLY A CA    1 
ATOM 608   C C     . GLY A 1 104 ? 56.136  -60.217  -115.671 1.00 81.48  ? 101 GLY A C     1 
ATOM 609   O O     . GLY A 1 104 ? 55.475  -59.322  -116.213 1.00 81.36  ? 101 GLY A O     1 
ATOM 610   N N     . LYS A 1 105 ? 55.647  -61.437  -115.469 1.00 80.29  ? 102 LYS A N     1 
ATOM 611   C CA    . LYS A 1 105 ? 54.295  -61.812  -115.859 1.00 77.92  ? 102 LYS A CA    1 
ATOM 612   C C     . LYS A 1 105 ? 53.473  -62.149  -114.624 1.00 76.22  ? 102 LYS A C     1 
ATOM 613   O O     . LYS A 1 105 ? 53.988  -62.716  -113.657 1.00 69.80  ? 102 LYS A O     1 
ATOM 614   C CB    . LYS A 1 105 ? 54.311  -63.006  -116.813 1.00 82.59  ? 102 LYS A CB    1 
ATOM 615   C CG    . LYS A 1 105 ? 55.048  -62.742  -118.107 1.00 85.75  ? 102 LYS A CG    1 
ATOM 616   C CD    . LYS A 1 105 ? 55.039  -63.966  -118.990 1.00 95.60  ? 102 LYS A CD    1 
ATOM 617   C CE    . LYS A 1 105 ? 56.174  -64.897  -118.611 1.00 102.74 ? 102 LYS A CE    1 
ATOM 618   N NZ    . LYS A 1 105 ? 57.481  -64.212  -118.801 1.00 102.51 ? 102 LYS A NZ    1 
ATOM 619   N N     . PHE A 1 106 ? 52.193  -61.795  -114.656 1.00 73.33  ? 103 PHE A N     1 
ATOM 620   C CA    . PHE A 1 106 ? 51.303  -61.997  -113.525 1.00 70.03  ? 103 PHE A CA    1 
ATOM 621   C C     . PHE A 1 106 ? 50.364  -63.159  -113.804 1.00 66.95  ? 103 PHE A C     1 
ATOM 622   O O     . PHE A 1 106 ? 49.799  -63.270  -114.896 1.00 68.64  ? 103 PHE A O     1 
ATOM 623   C CB    . PHE A 1 106 ? 50.488  -60.738  -113.226 1.00 59.90  ? 103 PHE A CB    1 
ATOM 624   C CG    . PHE A 1 106 ? 51.270  -59.664  -112.540 1.00 64.15  ? 103 PHE A CG    1 
ATOM 625   C CD1   . PHE A 1 106 ? 51.641  -59.799  -111.213 1.00 53.71  ? 103 PHE A CD1   1 
ATOM 626   C CD2   . PHE A 1 106 ? 51.654  -58.527  -113.227 1.00 67.22  ? 103 PHE A CD2   1 
ATOM 627   C CE1   . PHE A 1 106 ? 52.367  -58.812  -110.584 1.00 49.29  ? 103 PHE A CE1   1 
ATOM 628   C CE2   . PHE A 1 106 ? 52.380  -57.538  -112.604 1.00 67.37  ? 103 PHE A CE2   1 
ATOM 629   C CZ    . PHE A 1 106 ? 52.737  -57.679  -111.280 1.00 63.76  ? 103 PHE A CZ    1 
ATOM 630   N N     . TYR A 1 107 ? 50.193  -64.013  -112.801 1.00 63.69  ? 104 TYR A N     1 
ATOM 631   C CA    . TYR A 1 107 ? 49.322  -65.175  -112.894 1.00 64.38  ? 104 TYR A CA    1 
ATOM 632   C C     . TYR A 1 107 ? 48.372  -65.112  -111.711 1.00 66.31  ? 104 TYR A C     1 
ATOM 633   O O     . TYR A 1 107 ? 48.806  -65.196  -110.557 1.00 61.89  ? 104 TYR A O     1 
ATOM 634   C CB    . TYR A 1 107 ? 50.110  -66.495  -112.904 1.00 65.60  ? 104 TYR A CB    1 
ATOM 635   C CG    . TYR A 1 107 ? 51.156  -66.616  -114.002 1.00 78.25  ? 104 TYR A CG    1 
ATOM 636   C CD1   . TYR A 1 107 ? 52.219  -65.726  -114.089 1.00 79.36  ? 104 TYR A CD1   1 
ATOM 637   C CD2   . TYR A 1 107 ? 51.054  -67.603  -114.973 1.00 79.55  ? 104 TYR A CD2   1 
ATOM 638   C CE1   . TYR A 1 107 ? 53.160  -65.825  -115.091 1.00 86.00  ? 104 TYR A CE1   1 
ATOM 639   C CE2   . TYR A 1 107 ? 51.993  -67.711  -115.987 1.00 87.92  ? 104 TYR A CE2   1 
ATOM 640   C CZ    . TYR A 1 107 ? 53.045  -66.817  -116.040 1.00 93.97  ? 104 TYR A CZ    1 
ATOM 641   O OH    . TYR A 1 107 ? 53.984  -66.914  -117.043 1.00 93.48  ? 104 TYR A OH    1 
ATOM 642   N N     . VAL A 1 108 ? 47.086  -64.957  -111.997 1.00 61.00  ? 105 VAL A N     1 
ATOM 643   C CA    . VAL A 1 108 ? 46.087  -64.648  -110.986 1.00 54.42  ? 105 VAL A CA    1 
ATOM 644   C C     . VAL A 1 108 ? 44.962  -65.660  -111.107 1.00 55.00  ? 105 VAL A C     1 
ATOM 645   O O     . VAL A 1 108 ? 44.434  -65.883  -112.204 1.00 50.04  ? 105 VAL A O     1 
ATOM 646   C CB    . VAL A 1 108 ? 45.535  -63.218  -111.140 1.00 53.74  ? 105 VAL A CB    1 
ATOM 647   C CG1   . VAL A 1 108 ? 44.421  -62.975  -110.138 1.00 49.58  ? 105 VAL A CG1   1 
ATOM 648   C CG2   . VAL A 1 108 ? 46.642  -62.190  -110.973 1.00 54.60  ? 105 VAL A CG2   1 
ATOM 649   N N     . GLY A 1 109 ? 44.599  -66.260  -109.979 1.00 62.04  ? 106 GLY A N     1 
ATOM 650   C CA    . GLY A 1 109 ? 43.422  -67.098  -109.904 1.00 59.70  ? 106 GLY A CA    1 
ATOM 651   C C     . GLY A 1 109 ? 42.465  -66.587  -108.850 1.00 53.71  ? 106 GLY A C     1 
ATOM 652   O O     . GLY A 1 109 ? 42.875  -66.340  -107.704 1.00 54.76  ? 106 GLY A O     1 
ATOM 653   N N     . VAL A 1 110 ? 41.189  -66.452  -109.220 1.00 43.18  ? 107 VAL A N     1 
ATOM 654   C CA    . VAL A 1 110 ? 40.159  -65.885  -108.351 1.00 46.84  ? 107 VAL A CA    1 
ATOM 655   C C     . VAL A 1 110 ? 38.911  -66.756  -108.440 1.00 50.72  ? 107 VAL A C     1 
ATOM 656   O O     . VAL A 1 110 ? 38.454  -67.082  -109.538 1.00 42.98  ? 107 VAL A O     1 
ATOM 657   C CB    . VAL A 1 110 ? 39.817  -64.429  -108.734 1.00 45.05  ? 107 VAL A CB    1 
ATOM 658   C CG1   . VAL A 1 110 ? 38.585  -63.956  -107.974 1.00 46.76  ? 107 VAL A CG1   1 
ATOM 659   C CG2   . VAL A 1 110 ? 40.997  -63.502  -108.461 1.00 50.46  ? 107 VAL A CG2   1 
ATOM 660   N N     . CYS A 1 111 ? 38.357  -67.140  -107.293 1.00 56.45  ? 108 CYS A N     1 
ATOM 661   C CA    . CYS A 1 111 ? 37.100  -67.874  -107.258 1.00 50.51  ? 108 CYS A CA    1 
ATOM 662   C C     . CYS A 1 111 ? 35.980  -66.977  -106.750 1.00 40.24  ? 108 CYS A C     1 
ATOM 663   O O     . CYS A 1 111 ? 36.209  -66.062  -105.955 1.00 47.43  ? 108 CYS A O     1 
ATOM 664   C CB    . CYS A 1 111 ? 37.196  -69.109  -106.360 1.00 51.60  ? 108 CYS A CB    1 
ATOM 665   S SG    . CYS A 1 111 ? 37.310  -68.726  -104.606 1.00 59.10  ? 108 CYS A SG    1 
ATOM 666   N N     . ALA A 1 112 ? 34.758  -67.259  -107.201 1.00 39.93  ? 109 ALA A N     1 
ATOM 667   C CA    . ALA A 1 112 ? 33.582  -66.526  -106.760 1.00 41.00  ? 109 ALA A CA    1 
ATOM 668   C C     . ALA A 1 112 ? 32.436  -67.499  -106.537 1.00 48.46  ? 109 ALA A C     1 
ATOM 669   O O     . ALA A 1 112 ? 32.322  -68.515  -107.222 1.00 51.97  ? 109 ALA A O     1 
ATOM 670   C CB    . ALA A 1 112 ? 33.166  -65.451  -107.768 1.00 39.83  ? 109 ALA A CB    1 
ATOM 671   N N     . PHE A 1 113 ? 31.603  -67.191  -105.552 1.00 49.42  ? 110 PHE A N     1 
ATOM 672   C CA    . PHE A 1 113 ? 30.439  -68.002  -105.210 1.00 43.95  ? 110 PHE A CA    1 
ATOM 673   C C     . PHE A 1 113 ? 29.214  -67.139  -105.492 1.00 47.24  ? 110 PHE A C     1 
ATOM 674   O O     . PHE A 1 113 ? 28.996  -66.124  -104.824 1.00 45.74  ? 110 PHE A O     1 
ATOM 675   C CB    . PHE A 1 113 ? 30.481  -68.457  -103.749 1.00 42.64  ? 110 PHE A CB    1 
ATOM 676   C CG    . PHE A 1 113 ? 31.652  -69.340  -103.421 1.00 44.80  ? 110 PHE A CG    1 
ATOM 677   C CD1   . PHE A 1 113 ? 32.946  -68.857  -103.516 1.00 48.23  ? 110 PHE A CD1   1 
ATOM 678   C CD2   . PHE A 1 113 ? 31.462  -70.634  -102.978 1.00 52.22  ? 110 PHE A CD2   1 
ATOM 679   C CE1   . PHE A 1 113 ? 34.026  -69.648  -103.228 1.00 47.95  ? 110 PHE A CE1   1 
ATOM 680   C CE2   . PHE A 1 113 ? 32.556  -71.447  -102.662 1.00 58.12  ? 110 PHE A CE2   1 
ATOM 681   C CZ    . PHE A 1 113 ? 33.843  -70.943  -102.790 1.00 58.13  ? 110 PHE A CZ    1 
ATOM 682   N N     . VAL A 1 114 ? 28.447  -67.508  -106.515 1.00 43.01  ? 111 VAL A N     1 
ATOM 683   C CA    . VAL A 1 114 ? 27.301  -66.721  -106.958 1.00 40.97  ? 111 VAL A CA    1 
ATOM 684   C C     . VAL A 1 114 ? 26.034  -67.494  -106.631 1.00 40.67  ? 111 VAL A C     1 
ATOM 685   O O     . VAL A 1 114 ? 25.946  -68.700  -106.901 1.00 39.81  ? 111 VAL A O     1 
ATOM 686   C CB    . VAL A 1 114 ? 27.380  -66.396  -108.459 1.00 35.57  ? 111 VAL A CB    1 
ATOM 687   C CG1   . VAL A 1 114 ? 26.167  -65.587  -108.885 1.00 35.56  ? 111 VAL A CG1   1 
ATOM 688   C CG2   . VAL A 1 114 ? 28.671  -65.653  -108.767 1.00 30.56  ? 111 VAL A CG2   1 
ATOM 689   N N     . ARG A 1 115 ? 25.058  -66.797  -106.050 1.00 41.41  ? 112 ARG A N     1 
ATOM 690   C CA    . ARG A 1 115 ? 23.778  -67.379  -105.669 1.00 44.55  ? 112 ARG A CA    1 
ATOM 691   C C     . ARG A 1 115 ? 22.661  -66.669  -106.418 1.00 45.77  ? 112 ARG A C     1 
ATOM 692   O O     . ARG A 1 115 ? 22.461  -65.462  -106.245 1.00 42.59  ? 112 ARG A O     1 
ATOM 693   C CB    . ARG A 1 115 ? 23.538  -67.271  -104.162 1.00 45.30  ? 112 ARG A CB    1 
ATOM 694   C CG    . ARG A 1 115 ? 22.107  -67.616  -103.767 1.00 48.64  ? 112 ARG A CG    1 
ATOM 695   C CD    . ARG A 1 115 ? 21.849  -67.436  -102.279 1.00 56.27  ? 112 ARG A CD    1 
ATOM 696   N NE    . ARG A 1 115 ? 20.464  -67.042  -102.021 1.00 61.11  ? 112 ARG A NE    1 
ATOM 697   C CZ    . ARG A 1 115 ? 19.728  -67.504  -101.014 1.00 68.99  ? 112 ARG A CZ    1 
ATOM 698   N NH1   . ARG A 1 115 ? 20.242  -68.388  -100.167 1.00 61.64  ? 112 ARG A NH1   1 
ATOM 699   N NH2   . ARG A 1 115 ? 18.476  -67.089  -100.856 1.00 59.24  ? 112 ARG A NH2   1 
ATOM 700   N N     . VAL A 1 116 ? 21.963  -67.411  -107.265 1.00 44.88  ? 113 VAL A N     1 
ATOM 701   C CA    . VAL A 1 116 ? 20.788  -66.932  -107.982 1.00 45.59  ? 113 VAL A CA    1 
ATOM 702   C C     . VAL A 1 116 ? 19.547  -67.338  -107.200 1.00 44.51  ? 113 VAL A C     1 
ATOM 703   O O     . VAL A 1 116 ? 19.474  -68.445  -106.662 1.00 41.74  ? 113 VAL A O     1 
ATOM 704   C CB    . VAL A 1 116 ? 20.757  -67.496  -109.414 1.00 44.69  ? 113 VAL A CB    1 
ATOM 705   C CG1   . VAL A 1 116 ? 19.486  -67.076  -110.127 1.00 48.51  ? 113 VAL A CG1   1 
ATOM 706   C CG2   . VAL A 1 116 ? 21.983  -67.042  -110.181 1.00 43.99  ? 113 VAL A CG2   1 
ATOM 707   N N     . GLN A 1 117 ? 18.569  -66.441  -107.131 1.00 39.50  ? 114 GLN A N     1 
ATOM 708   C CA    . GLN A 1 117 ? 17.305  -66.692  -106.457 1.00 46.07  ? 114 GLN A CA    1 
ATOM 709   C C     . GLN A 1 117 ? 16.155  -66.304  -107.372 1.00 47.85  ? 114 GLN A C     1 
ATOM 710   O O     . GLN A 1 117 ? 16.233  -65.309  -108.095 1.00 48.84  ? 114 GLN A O     1 
ATOM 711   C CB    . GLN A 1 117 ? 17.195  -65.903  -105.153 1.00 45.11  ? 114 GLN A CB    1 
ATOM 712   C CG    . GLN A 1 117 ? 15.980  -66.267  -104.317 1.00 46.78  ? 114 GLN A CG    1 
ATOM 713   C CD    . GLN A 1 117 ? 15.778  -65.321  -103.154 1.00 44.15  ? 114 GLN A CD    1 
ATOM 714   O OE1   . GLN A 1 117 ? 16.738  -64.873  -102.528 1.00 50.70  ? 114 GLN A OE1   1 
ATOM 715   N NE2   . GLN A 1 117 ? 14.522  -65.011  -102.858 1.00 44.57  ? 114 GLN A NE2   1 
ATOM 716   N N     . LEU A 1 118 ? 15.086  -67.090  -107.340 1.00 47.26  ? 115 LEU A N     1 
ATOM 717   C CA    . LEU A 1 118 ? 13.880  -66.761  -108.082 1.00 50.56  ? 115 LEU A CA    1 
ATOM 718   C C     . LEU A 1 118 ? 12.900  -66.026  -107.174 1.00 52.08  ? 115 LEU A C     1 
ATOM 719   O O     . LEU A 1 118 ? 13.052  -65.986  -105.951 1.00 56.72  ? 115 LEU A O     1 
ATOM 720   C CB    . LEU A 1 118 ? 13.241  -68.021  -108.670 1.00 52.63  ? 115 LEU A CB    1 
ATOM 721   C CG    . LEU A 1 118 ? 14.112  -68.817  -109.645 1.00 52.87  ? 115 LEU A CG    1 
ATOM 722   C CD1   . LEU A 1 118 ? 13.338  -69.996  -110.200 1.00 59.71  ? 115 LEU A CD1   1 
ATOM 723   C CD2   . LEU A 1 118 ? 14.623  -67.924  -110.768 1.00 41.64  ? 115 LEU A CD2   1 
ATOM 724   N N     . LYS A 1 119 ? 11.874  -65.443  -107.792 1.00 56.78  ? 116 LYS A N     1 
ATOM 725   C CA    . LYS A 1 119 ? 10.916  -64.628  -107.056 1.00 56.80  ? 116 LYS A CA    1 
ATOM 726   C C     . LYS A 1 119 ? 10.076  -65.432  -106.072 1.00 57.96  ? 116 LYS A C     1 
ATOM 727   O O     . LYS A 1 119 ? 9.314   -64.830  -105.305 1.00 60.91  ? 116 LYS A O     1 
ATOM 728   C CB    . LYS A 1 119 ? 10.019  -63.872  -108.039 1.00 62.22  ? 116 LYS A CB    1 
ATOM 729   C CG    . LYS A 1 119 ? 9.091   -64.745  -108.873 1.00 61.64  ? 116 LYS A CG    1 
ATOM 730   C CD    . LYS A 1 119 ? 8.148   -63.870  -109.684 1.00 70.40  ? 116 LYS A CD    1 
ATOM 731   C CE    . LYS A 1 119 ? 7.396   -64.661  -110.734 1.00 71.82  ? 116 LYS A CE    1 
ATOM 732   N NZ    . LYS A 1 119 ? 6.570   -63.766  -111.595 1.00 73.79  ? 116 LYS A NZ    1 
ATOM 733   N N     . ASP A 1 120 ? 10.199  -66.758  -106.060 1.00 51.80  ? 117 ASP A N     1 
ATOM 734   C CA    . ASP A 1 120 ? 9.495   -67.597  -105.103 1.00 55.87  ? 117 ASP A CA    1 
ATOM 735   C C     . ASP A 1 120 ? 10.395  -68.077  -103.975 1.00 61.36  ? 117 ASP A C     1 
ATOM 736   O O     . ASP A 1 120 ? 9.956   -68.877  -103.143 1.00 64.12  ? 117 ASP A O     1 
ATOM 737   C CB    . ASP A 1 120 ? 8.863   -68.797  -105.812 1.00 53.83  ? 117 ASP A CB    1 
ATOM 738   C CG    . ASP A 1 120 ? 9.879   -69.855  -106.191 1.00 59.65  ? 117 ASP A CG    1 
ATOM 739   O OD1   . ASP A 1 120 ? 11.002  -69.488  -106.594 1.00 60.71  ? 117 ASP A OD1   1 
ATOM 740   O OD2   . ASP A 1 120 ? 9.556   -71.057  -106.074 1.00 58.06  ? 117 ASP A OD2   1 
ATOM 741   N N     . GLY A 1 121 ? 11.642  -67.613  -103.929 1.00 56.48  ? 118 GLY A N     1 
ATOM 742   C CA    . GLY A 1 121 ? 12.587  -68.032  -102.925 1.00 46.56  ? 118 GLY A CA    1 
ATOM 743   C C     . GLY A 1 121 ? 13.508  -69.149  -103.365 1.00 57.29  ? 118 GLY A C     1 
ATOM 744   O O     . GLY A 1 121 ? 14.522  -69.393  -102.699 1.00 65.91  ? 118 GLY A O     1 
ATOM 745   N N     . SER A 1 122 ? 13.167  -69.848  -104.449 1.00 56.57  ? 119 SER A N     1 
ATOM 746   C CA    . SER A 1 122 ? 14.042  -70.879  -104.989 1.00 49.69  ? 119 SER A CA    1 
ATOM 747   C C     . SER A 1 122 ? 15.403  -70.284  -105.334 1.00 46.93  ? 119 SER A C     1 
ATOM 748   O O     . SER A 1 122 ? 15.500  -69.155  -105.821 1.00 45.25  ? 119 SER A O     1 
ATOM 749   C CB    . SER A 1 122 ? 13.409  -71.514  -106.229 1.00 55.81  ? 119 SER A CB    1 
ATOM 750   O OG    . SER A 1 122 ? 14.251  -72.503  -106.794 1.00 82.15  ? 119 SER A OG    1 
ATOM 751   N N     . TYR A 1 123 ? 16.460  -71.051  -105.079 1.00 47.28  ? 120 TYR A N     1 
ATOM 752   C CA    . TYR A 1 123 ? 17.818  -70.546  -105.227 1.00 50.64  ? 120 TYR A CA    1 
ATOM 753   C C     . TYR A 1 123 ? 18.744  -71.659  -105.695 1.00 44.41  ? 120 TYR A C     1 
ATOM 754   O O     . TYR A 1 123 ? 18.484  -72.843  -105.473 1.00 40.30  ? 120 TYR A O     1 
ATOM 755   C CB    . TYR A 1 123 ? 18.328  -69.935  -103.911 1.00 44.58  ? 120 TYR A CB    1 
ATOM 756   C CG    . TYR A 1 123 ? 18.307  -70.888  -102.730 1.00 41.39  ? 120 TYR A CG    1 
ATOM 757   C CD1   . TYR A 1 123 ? 17.151  -71.060  -101.976 1.00 39.89  ? 120 TYR A CD1   1 
ATOM 758   C CD2   . TYR A 1 123 ? 19.439  -71.606  -102.363 1.00 50.35  ? 120 TYR A CD2   1 
ATOM 759   C CE1   . TYR A 1 123 ? 17.120  -71.925  -100.897 1.00 47.72  ? 120 TYR A CE1   1 
ATOM 760   C CE2   . TYR A 1 123 ? 19.417  -72.477  -101.279 1.00 42.73  ? 120 TYR A CE2   1 
ATOM 761   C CZ    . TYR A 1 123 ? 18.254  -72.631  -100.551 1.00 41.88  ? 120 TYR A CZ    1 
ATOM 762   O OH    . TYR A 1 123 ? 18.218  -73.492  -99.476  1.00 48.28  ? 120 TYR A OH    1 
ATOM 763   N N     . HIS A 1 124 ? 19.824  -71.257  -106.357 1.00 42.62  ? 121 HIS A N     1 
ATOM 764   C CA    . HIS A 1 124 ? 20.921  -72.144  -106.714 1.00 43.94  ? 121 HIS A CA    1 
ATOM 765   C C     . HIS A 1 124 ? 22.218  -71.364  -106.597 1.00 51.56  ? 121 HIS A C     1 
ATOM 766   O O     . HIS A 1 124 ? 22.329  -70.261  -107.136 1.00 55.89  ? 121 HIS A O     1 
ATOM 767   C CB    . HIS A 1 124 ? 20.772  -72.704  -108.133 1.00 47.63  ? 121 HIS A CB    1 
ATOM 768   C CG    . HIS A 1 124 ? 19.703  -73.743  -108.269 1.00 44.49  ? 121 HIS A CG    1 
ATOM 769   N ND1   . HIS A 1 124 ? 19.641  -74.865  -107.470 1.00 51.90  ? 121 HIS A ND1   1 
ATOM 770   C CD2   . HIS A 1 124 ? 18.662  -73.834  -109.127 1.00 47.53  ? 121 HIS A CD2   1 
ATOM 771   C CE1   . HIS A 1 124 ? 18.599  -75.596  -107.823 1.00 52.11  ? 121 HIS A CE1   1 
ATOM 772   N NE2   . HIS A 1 124 ? 17.989  -74.994  -108.827 1.00 48.45  ? 121 HIS A NE2   1 
ATOM 773   N N     . GLU A 1 125 ? 23.196  -71.936  -105.906 1.00 43.98  ? 122 GLU A N     1 
ATOM 774   C CA    . GLU A 1 125 ? 24.483  -71.296  -105.690 1.00 45.81  ? 122 GLU A CA    1 
ATOM 775   C C     . GLU A 1 125 ? 25.567  -72.184  -106.278 1.00 47.01  ? 122 GLU A C     1 
ATOM 776   O O     . GLU A 1 125 ? 25.534  -73.408  -106.111 1.00 51.62  ? 122 GLU A O     1 
ATOM 777   C CB    . GLU A 1 125 ? 24.737  -71.059  -104.194 1.00 45.56  ? 122 GLU A CB    1 
ATOM 778   C CG    . GLU A 1 125 ? 26.086  -70.436  -103.876 1.00 49.60  ? 122 GLU A CG    1 
ATOM 779   C CD    . GLU A 1 125 ? 26.273  -70.165  -102.395 1.00 52.10  ? 122 GLU A CD    1 
ATOM 780   O OE1   . GLU A 1 125 ? 25.560  -70.788  -101.581 1.00 58.09  ? 122 GLU A OE1   1 
ATOM 781   O OE2   . GLU A 1 125 ? 27.140  -69.337  -102.045 1.00 53.25  ? 122 GLU A OE2   1 
ATOM 782   N N     . ASP A 1 126 ? 26.520  -71.570  -106.977 1.00 39.46  ? 123 ASP A N     1 
ATOM 783   C CA    . ASP A 1 126 ? 27.596  -72.328  -107.601 1.00 49.58  ? 123 ASP A CA    1 
ATOM 784   C C     . ASP A 1 126 ? 28.867  -71.488  -107.597 1.00 50.45  ? 123 ASP A C     1 
ATOM 785   O O     . ASP A 1 126 ? 28.881  -70.341  -107.140 1.00 52.38  ? 123 ASP A O     1 
ATOM 786   C CB    . ASP A 1 126 ? 27.217  -72.770  -109.018 1.00 58.58  ? 123 ASP A CB    1 
ATOM 787   C CG    . ASP A 1 126 ? 27.737  -74.157  -109.354 1.00 61.51  ? 123 ASP A CG    1 
ATOM 788   O OD1   . ASP A 1 126 ? 28.962  -74.378  -109.255 1.00 51.25  ? 123 ASP A OD1   1 
ATOM 789   O OD2   . ASP A 1 126 ? 26.921  -75.027  -109.728 1.00 67.57  ? 123 ASP A OD2   1 
ATOM 790   N N     . VAL A 1 127 ? 29.949  -72.085  -108.087 1.00 45.82  ? 124 VAL A N     1 
ATOM 791   C CA    . VAL A 1 127 ? 31.267  -71.464  -108.084 1.00 49.70  ? 124 VAL A CA    1 
ATOM 792   C C     . VAL A 1 127 ? 31.657  -71.110  -109.512 1.00 53.11  ? 124 VAL A C     1 
ATOM 793   O O     . VAL A 1 127 ? 31.479  -71.917  -110.431 1.00 49.67  ? 124 VAL A O     1 
ATOM 794   C CB    . VAL A 1 127 ? 32.309  -72.407  -107.446 1.00 48.25  ? 124 VAL A CB    1 
ATOM 795   C CG1   . VAL A 1 127 ? 33.737  -72.075  -107.919 1.00 63.84  ? 124 VAL A CG1   1 
ATOM 796   C CG2   . VAL A 1 127 ? 32.180  -72.410  -105.918 1.00 68.73  ? 124 VAL A CG2   1 
ATOM 797   N N     . GLY A 1 128 ? 32.201  -69.908  -109.693 1.00 42.18  ? 125 GLY A N     1 
ATOM 798   C CA    . GLY A 1 128 ? 32.861  -69.534  -110.927 1.00 44.35  ? 125 GLY A CA    1 
ATOM 799   C C     . GLY A 1 128 ? 34.329  -69.257  -110.700 1.00 51.13  ? 125 GLY A C     1 
ATOM 800   O O     . GLY A 1 128 ? 34.729  -68.936  -109.575 1.00 55.93  ? 125 GLY A O     1 
ATOM 801   N N     . TYR A 1 129 ? 35.146  -69.376  -111.748 1.00 50.35  ? 126 TYR A N     1 
ATOM 802   C CA    . TYR A 1 129 ? 36.566  -69.081  -111.628 1.00 45.32  ? 126 TYR A CA    1 
ATOM 803   C C     . TYR A 1 129 ? 37.012  -68.093  -112.689 1.00 45.45  ? 126 TYR A C     1 
ATOM 804   O O     . TYR A 1 129 ? 36.415  -67.998  -113.759 1.00 54.94  ? 126 TYR A O     1 
ATOM 805   C CB    . TYR A 1 129 ? 37.425  -70.348  -111.740 1.00 42.01  ? 126 TYR A CB    1 
ATOM 806   C CG    . TYR A 1 129 ? 38.645  -70.317  -110.849 1.00 36.25  ? 126 TYR A CG    1 
ATOM 807   C CD1   . TYR A 1 129 ? 38.525  -70.366  -109.466 1.00 46.46  ? 126 TYR A CD1   1 
ATOM 808   C CD2   . TYR A 1 129 ? 39.915  -70.174  -111.389 1.00 46.21  ? 126 TYR A CD2   1 
ATOM 809   C CE1   . TYR A 1 129 ? 39.646  -70.325  -108.655 1.00 47.01  ? 126 TYR A CE1   1 
ATOM 810   C CE2   . TYR A 1 129 ? 41.034  -70.125  -110.590 1.00 54.86  ? 126 TYR A CE2   1 
ATOM 811   C CZ    . TYR A 1 129 ? 40.898  -70.198  -109.227 1.00 49.76  ? 126 TYR A CZ    1 
ATOM 812   O OH    . TYR A 1 129 ? 42.035  -70.149  -108.454 1.00 43.36  ? 126 TYR A OH    1 
ATOM 813   N N     . GLY A 1 130 ? 38.069  -67.358  -112.360 1.00 44.13  ? 127 GLY A N     1 
ATOM 814   C CA    . GLY A 1 130 ? 38.666  -66.378  -113.235 1.00 42.35  ? 127 GLY A CA    1 
ATOM 815   C C     . GLY A 1 130 ? 40.174  -66.525  -113.218 1.00 56.69  ? 127 GLY A C     1 
ATOM 816   O O     . GLY A 1 130 ? 40.794  -66.622  -112.150 1.00 53.08  ? 127 GLY A O     1 
ATOM 817   N N     . VAL A 1 131 ? 40.768  -66.546  -114.410 1.00 59.46  ? 128 VAL A N     1 
ATOM 818   C CA    . VAL A 1 131 ? 42.175  -66.857  -114.618 1.00 51.97  ? 128 VAL A CA    1 
ATOM 819   C C     . VAL A 1 131 ? 42.805  -65.734  -115.429 1.00 55.87  ? 128 VAL A C     1 
ATOM 820   O O     . VAL A 1 131 ? 42.175  -65.187  -116.341 1.00 58.50  ? 128 VAL A O     1 
ATOM 821   C CB    . VAL A 1 131 ? 42.329  -68.210  -115.350 1.00 44.32  ? 128 VAL A CB    1 
ATOM 822   C CG1   . VAL A 1 131 ? 43.793  -68.550  -115.560 1.00 51.39  ? 128 VAL A CG1   1 
ATOM 823   C CG2   . VAL A 1 131 ? 41.620  -69.320  -114.584 1.00 58.76  ? 128 VAL A CG2   1 
ATOM 824   N N     . SER A 1 132 ? 44.049  -65.392  -115.102 1.00 55.32  ? 129 SER A N     1 
ATOM 825   C CA    . SER A 1 132 ? 44.806  -64.460  -115.937 1.00 49.90  ? 129 SER A CA    1 
ATOM 826   C C     . SER A 1 132 ? 46.279  -64.831  -115.855 1.00 65.61  ? 129 SER A C     1 
ATOM 827   O O     . SER A 1 132 ? 46.914  -64.591  -114.829 1.00 62.26  ? 129 SER A O     1 
ATOM 828   C CB    . SER A 1 132 ? 44.580  -63.015  -115.500 1.00 51.43  ? 129 SER A CB    1 
ATOM 829   O OG    . SER A 1 132 ? 45.527  -62.155  -116.115 1.00 50.42  ? 129 SER A OG    1 
ATOM 830   N N     . GLU A 1 133 ? 46.822  -65.398  -116.929 1.00 71.67  ? 130 GLU A N     1 
ATOM 831   C CA    . GLU A 1 133 ? 48.215  -65.818  -116.977 1.00 68.95  ? 130 GLU A CA    1 
ATOM 832   C C     . GLU A 1 133 ? 48.926  -65.111  -118.121 1.00 69.73  ? 130 GLU A C     1 
ATOM 833   O O     . GLU A 1 133 ? 48.418  -65.077  -119.247 1.00 67.38  ? 130 GLU A O     1 
ATOM 834   C CB    . GLU A 1 133 ? 48.326  -67.328  -117.166 1.00 77.61  ? 130 GLU A CB    1 
ATOM 835   C CG    . GLU A 1 133 ? 47.272  -68.139  -116.462 1.00 73.58  ? 130 GLU A CG    1 
ATOM 836   C CD    . GLU A 1 133 ? 47.594  -69.618  -116.422 1.00 77.33  ? 130 GLU A CD    1 
ATOM 837   O OE1   . GLU A 1 133 ? 48.789  -69.965  -116.327 1.00 79.22  ? 130 GLU A OE1   1 
ATOM 838   O OE2   . GLU A 1 133 ? 46.652  -70.429  -116.536 1.00 73.38  ? 130 GLU A OE2   1 
ATOM 839   N N     . GLY A 1 134 ? 50.087  -64.537  -117.823 1.00 72.93  ? 131 GLY A N     1 
ATOM 840   C CA    . GLY A 1 134 ? 50.976  -63.990  -118.822 1.00 78.59  ? 131 GLY A CA    1 
ATOM 841   C C     . GLY A 1 134 ? 51.032  -62.480  -118.865 1.00 69.12  ? 131 GLY A C     1 
ATOM 842   O O     . GLY A 1 134 ? 52.044  -61.927  -119.316 1.00 78.09  ? 131 GLY A O     1 
ATOM 843   N N     . LEU A 1 135 ? 49.993  -61.796  -118.390 1.00 64.72  ? 132 LEU A N     1 
ATOM 844   C CA    . LEU A 1 135 ? 49.936  -60.347  -118.518 1.00 66.38  ? 132 LEU A CA    1 
ATOM 845   C C     . LEU A 1 135 ? 50.983  -59.660  -117.649 1.00 67.54  ? 132 LEU A C     1 
ATOM 846   O O     . LEU A 1 135 ? 51.314  -60.116  -116.550 1.00 71.00  ? 132 LEU A O     1 
ATOM 847   C CB    . LEU A 1 135 ? 48.551  -59.827  -118.145 1.00 59.78  ? 132 LEU A CB    1 
ATOM 848   C CG    . LEU A 1 135 ? 47.428  -60.078  -119.145 1.00 63.28  ? 132 LEU A CG    1 
ATOM 849   C CD1   . LEU A 1 135 ? 46.128  -59.498  -118.617 1.00 60.28  ? 132 LEU A CD1   1 
ATOM 850   C CD2   . LEU A 1 135 ? 47.785  -59.487  -120.496 1.00 79.27  ? 132 LEU A CD2   1 
ATOM 851   N N     . LYS A 1 136 ? 51.488  -58.529  -118.149 1.00 69.43  ? 133 LYS A N     1 
ATOM 852   C CA    . LYS A 1 136 ? 52.473  -57.743  -117.421 1.00 72.89  ? 133 LYS A CA    1 
ATOM 853   C C     . LYS A 1 136 ? 51.844  -56.725  -116.479 1.00 70.67  ? 133 LYS A C     1 
ATOM 854   O O     . LYS A 1 136 ? 52.521  -56.263  -115.553 1.00 62.26  ? 133 LYS A O     1 
ATOM 855   C CB    . LYS A 1 136 ? 53.394  -57.004  -118.404 1.00 87.16  ? 133 LYS A CB    1 
ATOM 856   C CG    . LYS A 1 136 ? 54.178  -57.900  -119.365 1.00 93.06  ? 133 LYS A CG    1 
ATOM 857   C CD    . LYS A 1 136 ? 54.930  -57.073  -120.405 1.00 91.04  ? 133 LYS A CD    1 
ATOM 858   C CE    . LYS A 1 136 ? 56.231  -56.510  -119.836 1.00 101.94 ? 133 LYS A CE    1 
ATOM 859   N NZ    . LYS A 1 136 ? 57.197  -57.573  -119.436 1.00 97.94  ? 133 LYS A NZ    1 
ATOM 860   N N     . SER A 1 137 ? 50.576  -56.371  -116.688 1.00 71.45  ? 134 SER A N     1 
ATOM 861   C CA    . SER A 1 137 ? 49.878  -55.411  -115.839 1.00 71.88  ? 134 SER A CA    1 
ATOM 862   C C     . SER A 1 137 ? 49.104  -56.157  -114.757 1.00 70.41  ? 134 SER A C     1 
ATOM 863   O O     . SER A 1 137 ? 48.185  -56.925  -115.062 1.00 65.97  ? 134 SER A O     1 
ATOM 864   C CB    . SER A 1 137 ? 48.939  -54.534  -116.670 1.00 73.91  ? 134 SER A CB    1 
ATOM 865   O OG    . SER A 1 137 ? 48.109  -53.741  -115.836 1.00 86.35  ? 134 SER A OG    1 
ATOM 866   N N     . LYS A 1 138 ? 49.479  -55.934  -113.494 1.00 68.01  ? 135 LYS A N     1 
ATOM 867   C CA    . LYS A 1 138 ? 48.761  -56.563  -112.389 1.00 60.90  ? 135 LYS A CA    1 
ATOM 868   C C     . LYS A 1 138 ? 47.300  -56.128  -112.344 1.00 61.25  ? 135 LYS A C     1 
ATOM 869   O O     . LYS A 1 138 ? 46.409  -56.947  -112.083 1.00 61.94  ? 135 LYS A O     1 
ATOM 870   C CB    . LYS A 1 138 ? 49.453  -56.252  -111.062 1.00 56.52  ? 135 LYS A CB    1 
ATOM 871   C CG    . LYS A 1 138 ? 48.814  -56.941  -109.861 1.00 62.58  ? 135 LYS A CG    1 
ATOM 872   C CD    . LYS A 1 138 ? 49.844  -57.227  -108.784 1.00 65.29  ? 135 LYS A CD    1 
ATOM 873   C CE    . LYS A 1 138 ? 50.363  -55.935  -108.177 1.00 70.35  ? 135 LYS A CE    1 
ATOM 874   N NZ    . LYS A 1 138 ? 51.317  -56.167  -107.054 1.00 59.87  ? 135 LYS A NZ    1 
ATOM 875   N N     . ALA A 1 139 ? 47.033  -54.841  -112.582 1.00 49.03  ? 136 ALA A N     1 
ATOM 876   C CA    . ALA A 1 139 ? 45.671  -54.331  -112.450 1.00 55.24  ? 136 ALA A CA    1 
ATOM 877   C C     . ALA A 1 139 ? 44.718  -55.000  -113.434 1.00 54.55  ? 136 ALA A C     1 
ATOM 878   O O     . ALA A 1 139 ? 43.621  -55.430  -113.057 1.00 56.17  ? 136 ALA A O     1 
ATOM 879   C CB    . ALA A 1 139 ? 45.664  -52.815  -112.643 1.00 66.02  ? 136 ALA A CB    1 
ATOM 880   N N     . LEU A 1 140 ? 45.127  -55.117  -114.701 1.00 66.94  ? 137 LEU A N     1 
ATOM 881   C CA    . LEU A 1 140 ? 44.252  -55.742  -115.688 1.00 65.78  ? 137 LEU A CA    1 
ATOM 882   C C     . LEU A 1 140 ? 44.113  -57.235  -115.437 1.00 59.99  ? 137 LEU A C     1 
ATOM 883   O O     . LEU A 1 140 ? 43.038  -57.801  -115.666 1.00 51.74  ? 137 LEU A O     1 
ATOM 884   C CB    . LEU A 1 140 ? 44.759  -55.478  -117.107 1.00 67.29  ? 137 LEU A CB    1 
ATOM 885   C CG    . LEU A 1 140 ? 44.089  -54.317  -117.851 1.00 87.26  ? 137 LEU A CG    1 
ATOM 886   C CD1   . LEU A 1 140 ? 44.232  -53.002  -117.082 1.00 80.23  ? 137 LEU A CD1   1 
ATOM 887   C CD2   . LEU A 1 140 ? 44.632  -54.194  -119.268 1.00 69.97  ? 137 LEU A CD2   1 
ATOM 888   N N     . SER A 1 141 ? 45.176  -57.883  -114.955 1.00 54.85  ? 138 SER A N     1 
ATOM 889   C CA    . SER A 1 141 ? 45.076  -59.289  -114.583 1.00 48.87  ? 138 SER A CA    1 
ATOM 890   C C     . SER A 1 141 ? 44.012  -59.484  -113.511 1.00 55.42  ? 138 SER A C     1 
ATOM 891   O O     . SER A 1 141 ? 43.138  -60.352  -113.632 1.00 54.07  ? 138 SER A O     1 
ATOM 892   C CB    . SER A 1 141 ? 46.432  -59.804  -114.093 1.00 48.41  ? 138 SER A CB    1 
ATOM 893   O OG    . SER A 1 141 ? 47.417  -59.741  -115.109 1.00 60.22  ? 138 SER A OG    1 
ATOM 894   N N     . LEU A 1 142 ? 44.068  -58.669  -112.452 1.00 58.35  ? 139 LEU A N     1 
ATOM 895   C CA    . LEU A 1 142 ? 43.086  -58.776  -111.376 1.00 50.26  ? 139 LEU A CA    1 
ATOM 896   C C     . LEU A 1 142 ? 41.673  -58.469  -111.864 1.00 46.01  ? 139 LEU A C     1 
ATOM 897   O O     . LEU A 1 142 ? 40.726  -59.178  -111.511 1.00 42.63  ? 139 LEU A O     1 
ATOM 898   C CB    . LEU A 1 142 ? 43.469  -57.852  -110.220 1.00 48.01  ? 139 LEU A CB    1 
ATOM 899   C CG    . LEU A 1 142 ? 44.511  -58.416  -109.252 1.00 48.71  ? 139 LEU A CG    1 
ATOM 900   C CD1   . LEU A 1 142 ? 45.067  -57.327  -108.348 1.00 51.12  ? 139 LEU A CD1   1 
ATOM 901   C CD2   . LEU A 1 142 ? 43.911  -59.547  -108.429 1.00 34.67  ? 139 LEU A CD2   1 
ATOM 902   N N     . GLU A 1 143 ? 41.509  -57.416  -112.671 1.00 45.81  ? 140 GLU A N     1 
ATOM 903   C CA    . GLU A 1 143 ? 40.181  -57.084  -113.189 1.00 44.62  ? 140 GLU A CA    1 
ATOM 904   C C     . GLU A 1 143 ? 39.611  -58.239  -114.002 1.00 46.83  ? 140 GLU A C     1 
ATOM 905   O O     . GLU A 1 143 ? 38.458  -58.649  -113.803 1.00 49.46  ? 140 GLU A O     1 
ATOM 906   C CB    . GLU A 1 143 ? 40.244  -55.821  -114.047 1.00 47.14  ? 140 GLU A CB    1 
ATOM 907   C CG    . GLU A 1 143 ? 39.015  -55.620  -114.923 1.00 50.35  ? 140 GLU A CG    1 
ATOM 908   C CD    . GLU A 1 143 ? 39.103  -54.362  -115.765 1.00 54.58  ? 140 GLU A CD    1 
ATOM 909   O OE1   . GLU A 1 143 ? 40.234  -53.991  -116.143 1.00 73.88  ? 140 GLU A OE1   1 
ATOM 910   O OE2   . GLU A 1 143 ? 38.050  -53.757  -116.065 1.00 63.51  ? 140 GLU A OE2   1 
ATOM 911   N N     . LYS A 1 144 ? 40.421  -58.785  -114.913 1.00 46.09  ? 141 LYS A N     1 
ATOM 912   C CA    . LYS A 1 144 ? 39.978  -59.895  -115.747 1.00 48.85  ? 141 LYS A CA    1 
ATOM 913   C C     . LYS A 1 144 ? 39.590  -61.088  -114.891 1.00 49.26  ? 141 LYS A C     1 
ATOM 914   O O     . LYS A 1 144 ? 38.516  -61.672  -115.073 1.00 45.51  ? 141 LYS A O     1 
ATOM 915   C CB    . LYS A 1 144 ? 41.087  -60.275  -116.733 1.00 56.05  ? 141 LYS A CB    1 
ATOM 916   C CG    . LYS A 1 144 ? 40.677  -61.234  -117.853 1.00 59.48  ? 141 LYS A CG    1 
ATOM 917   C CD    . LYS A 1 144 ? 41.888  -62.032  -118.353 1.00 71.53  ? 141 LYS A CD    1 
ATOM 918   C CE    . LYS A 1 144 ? 41.542  -62.934  -119.535 1.00 79.22  ? 141 LYS A CE    1 
ATOM 919   N NZ    . LYS A 1 144 ? 42.444  -64.120  -119.658 1.00 74.96  ? 141 LYS A NZ    1 
ATOM 920   N N     . ALA A 1 145 ? 40.433  -61.434  -113.915 1.00 47.40  ? 142 ALA A N     1 
ATOM 921   C CA    . ALA A 1 145 ? 40.174  -62.630  -113.126 1.00 45.42  ? 142 ALA A CA    1 
ATOM 922   C C     . ALA A 1 145 ? 38.920  -62.472  -112.274 1.00 51.71  ? 142 ALA A C     1 
ATOM 923   O O     . ALA A 1 145 ? 38.070  -63.368  -112.247 1.00 51.56  ? 142 ALA A O     1 
ATOM 924   C CB    . ALA A 1 145 ? 41.384  -62.955  -112.252 1.00 48.18  ? 142 ALA A CB    1 
ATOM 925   N N     . ARG A 1 146 ? 38.755  -61.319  -111.622 1.00 43.39  ? 143 ARG A N     1 
ATOM 926   C CA    . ARG A 1 146 ? 37.591  -61.107  -110.765 1.00 46.01  ? 143 ARG A CA    1 
ATOM 927   C C     . ARG A 1 146 ? 36.298  -61.097  -111.576 1.00 46.83  ? 143 ARG A C     1 
ATOM 928   O O     . ARG A 1 146 ? 35.331  -61.802  -111.241 1.00 48.96  ? 143 ARG A O     1 
ATOM 929   C CB    . ARG A 1 146 ? 37.752  -59.797  -109.993 1.00 49.82  ? 143 ARG A CB    1 
ATOM 930   C CG    . ARG A 1 146 ? 38.964  -59.769  -109.071 1.00 57.83  ? 143 ARG A CG    1 
ATOM 931   C CD    . ARG A 1 146 ? 38.927  -58.582  -108.119 1.00 45.66  ? 143 ARG A CD    1 
ATOM 932   N NE    . ARG A 1 146 ? 38.475  -58.953  -106.782 1.00 53.19  ? 143 ARG A NE    1 
ATOM 933   C CZ    . ARG A 1 146 ? 39.261  -58.969  -105.710 1.00 44.17  ? 143 ARG A CZ    1 
ATOM 934   N NH1   . ARG A 1 146 ? 40.536  -58.624  -105.817 1.00 47.02  ? 143 ARG A NH1   1 
ATOM 935   N NH2   . ARG A 1 146 ? 38.770  -59.321  -104.531 1.00 54.45  ? 143 ARG A NH2   1 
ATOM 936   N N     . LYS A 1 147 ? 36.261  -60.297  -112.648 1.00 43.50  ? 144 LYS A N     1 
ATOM 937   C CA    . LYS A 1 147 ? 35.044  -60.206  -113.445 1.00 39.96  ? 144 LYS A CA    1 
ATOM 938   C C     . LYS A 1 147 ? 34.695  -61.548  -114.076 1.00 47.85  ? 144 LYS A C     1 
ATOM 939   O O     . LYS A 1 147 ? 33.522  -61.952  -114.083 1.00 44.74  ? 144 LYS A O     1 
ATOM 940   C CB    . LYS A 1 147 ? 35.198  -59.125  -114.513 1.00 46.12  ? 144 LYS A CB    1 
ATOM 941   C CG    . LYS A 1 147 ? 35.190  -57.723  -113.936 1.00 50.95  ? 144 LYS A CG    1 
ATOM 942   C CD    . LYS A 1 147 ? 35.417  -56.669  -115.003 1.00 48.74  ? 144 LYS A CD    1 
ATOM 943   C CE    . LYS A 1 147 ? 35.363  -55.276  -114.397 1.00 42.90  ? 144 LYS A CE    1 
ATOM 944   N NZ    . LYS A 1 147 ? 35.446  -54.213  -115.433 1.00 53.39  ? 144 LYS A NZ    1 
ATOM 945   N N     . GLU A 1 148 ? 35.694  -62.249  -114.626 1.00 49.24  ? 145 GLU A N     1 
ATOM 946   C CA    . GLU A 1 148 ? 35.438  -63.562  -115.202 1.00 50.63  ? 145 GLU A CA    1 
ATOM 947   C C     . GLU A 1 148 ? 34.922  -64.535  -114.152 1.00 44.04  ? 145 GLU A C     1 
ATOM 948   O O     . GLU A 1 148 ? 34.004  -65.311  -114.424 1.00 46.09  ? 145 GLU A O     1 
ATOM 949   C CB    . GLU A 1 148 ? 36.701  -64.109  -115.870 1.00 59.32  ? 145 GLU A CB    1 
ATOM 950   C CG    . GLU A 1 148 ? 36.818  -63.748  -117.343 1.00 59.57  ? 145 GLU A CG    1 
ATOM 951   C CD    . GLU A 1 148 ? 38.086  -64.280  -117.982 1.00 74.23  ? 145 GLU A CD    1 
ATOM 952   O OE1   . GLU A 1 148 ? 38.583  -65.340  -117.542 1.00 66.00  ? 145 GLU A OE1   1 
ATOM 953   O OE2   . GLU A 1 148 ? 38.572  -63.647  -118.943 1.00 63.53  ? 145 GLU A OE2   1 
ATOM 954   N N     . ALA A 1 149 ? 35.510  -64.521  -112.952 1.00 54.47  ? 146 ALA A N     1 
ATOM 955   C CA    . ALA A 1 149 ? 35.037  -65.402  -111.889 1.00 50.26  ? 146 ALA A CA    1 
ATOM 956   C C     . ALA A 1 149 ? 33.565  -65.158  -111.591 1.00 45.06  ? 146 ALA A C     1 
ATOM 957   O O     . ALA A 1 149 ? 32.773  -66.105  -111.493 1.00 40.62  ? 146 ALA A O     1 
ATOM 958   C CB    . ALA A 1 149 ? 35.881  -65.202  -110.629 1.00 48.61  ? 146 ALA A CB    1 
ATOM 959   N N     . VAL A 1 150 ? 33.174  -63.888  -111.466 1.00 41.70  ? 147 VAL A N     1 
ATOM 960   C CA    . VAL A 1 150 ? 31.790  -63.576  -111.116 1.00 36.67  ? 147 VAL A CA    1 
ATOM 961   C C     . VAL A 1 150 ? 30.840  -63.998  -112.237 1.00 44.88  ? 147 VAL A C     1 
ATOM 962   O O     . VAL A 1 150 ? 29.799  -64.622  -111.990 1.00 43.61  ? 147 VAL A O     1 
ATOM 963   C CB    . VAL A 1 150 ? 31.646  -62.083  -110.773 1.00 47.82  ? 147 VAL A CB    1 
ATOM 964   C CG1   . VAL A 1 150 ? 30.178  -61.666  -110.795 1.00 30.86  ? 147 VAL A CG1   1 
ATOM 965   C CG2   . VAL A 1 150 ? 32.276  -61.794  -109.412 1.00 47.07  ? 147 VAL A CG2   1 
ATOM 966   N N     . THR A 1 151 ? 31.179  -63.659  -113.484 1.00 50.56  ? 148 THR A N     1 
ATOM 967   C CA    . THR A 1 151 ? 30.305  -64.015  -114.600 1.00 43.73  ? 148 THR A CA    1 
ATOM 968   C C     . THR A 1 151 ? 30.193  -65.530  -114.753 1.00 50.13  ? 148 THR A C     1 
ATOM 969   O O     . THR A 1 151 ? 29.101  -66.062  -115.002 1.00 48.42  ? 148 THR A O     1 
ATOM 970   C CB    . THR A 1 151 ? 30.812  -63.369  -115.890 1.00 48.46  ? 148 THR A CB    1 
ATOM 971   O OG1   . THR A 1 151 ? 30.724  -61.944  -115.769 1.00 53.16  ? 148 THR A OG1   1 
ATOM 972   C CG2   . THR A 1 151 ? 29.971  -63.812  -117.078 1.00 39.94  ? 148 THR A CG2   1 
ATOM 973   N N     . ASP A 1 152 ? 31.319  -66.240  -114.635 1.00 44.45  ? 149 ASP A N     1 
ATOM 974   C CA    . ASP A 1 152 ? 31.314  -67.697  -114.697 1.00 46.57  ? 149 ASP A CA    1 
ATOM 975   C C     . ASP A 1 152 ? 30.440  -68.292  -113.600 1.00 53.79  ? 149 ASP A C     1 
ATOM 976   O O     . ASP A 1 152 ? 29.695  -69.249  -113.843 1.00 53.08  ? 149 ASP A O     1 
ATOM 977   C CB    . ASP A 1 152 ? 32.747  -68.220  -114.597 1.00 47.41  ? 149 ASP A CB    1 
ATOM 978   C CG    . ASP A 1 152 ? 32.859  -69.693  -114.928 1.00 56.64  ? 149 ASP A CG    1 
ATOM 979   O OD1   . ASP A 1 152 ? 32.406  -70.093  -116.022 1.00 62.00  ? 149 ASP A OD1   1 
ATOM 980   O OD2   . ASP A 1 152 ? 33.416  -70.447  -114.104 1.00 52.19  ? 149 ASP A OD2   1 
ATOM 981   N N     . GLY A 1 153 ? 30.540  -67.759  -112.379 1.00 46.51  ? 150 GLY A N     1 
ATOM 982   C CA    . GLY A 1 153 ? 29.689  -68.240  -111.304 1.00 37.91  ? 150 GLY A CA    1 
ATOM 983   C C     . GLY A 1 153 ? 28.219  -68.005  -111.586 1.00 43.83  ? 150 GLY A C     1 
ATOM 984   O O     . GLY A 1 153 ? 27.377  -68.854  -111.289 1.00 45.77  ? 150 GLY A O     1 
ATOM 985   N N     . LEU A 1 154 ? 27.896  -66.859  -112.189 1.00 41.25  ? 151 LEU A N     1 
ATOM 986   C CA    . LEU A 1 154 ? 26.506  -66.589  -112.542 1.00 45.84  ? 151 LEU A CA    1 
ATOM 987   C C     . LEU A 1 154 ? 26.003  -67.584  -113.579 1.00 52.24  ? 151 LEU A C     1 
ATOM 988   O O     . LEU A 1 154 ? 24.896  -68.128  -113.449 1.00 51.30  ? 151 LEU A O     1 
ATOM 989   C CB    . LEU A 1 154 ? 26.370  -65.158  -113.064 1.00 42.59  ? 151 LEU A CB    1 
ATOM 990   C CG    . LEU A 1 154 ? 24.992  -64.771  -113.602 1.00 39.46  ? 151 LEU A CG    1 
ATOM 991   C CD1   . LEU A 1 154 ? 23.901  -65.056  -112.583 1.00 48.72  ? 151 LEU A CD1   1 
ATOM 992   C CD2   . LEU A 1 154 ? 24.979  -63.311  -114.011 1.00 46.78  ? 151 LEU A CD2   1 
ATOM 993   N N     . LYS A 1 155 ? 26.816  -67.853  -114.604 1.00 46.90  ? 152 LYS A N     1 
ATOM 994   C CA    . LYS A 1 155 ? 26.423  -68.823  -115.622 1.00 45.52  ? 152 LYS A CA    1 
ATOM 995   C C     . LYS A 1 155 ? 26.237  -70.211  -115.024 1.00 51.64  ? 152 LYS A C     1 
ATOM 996   O O     . LYS A 1 155 ? 25.241  -70.887  -115.305 1.00 51.00  ? 152 LYS A O     1 
ATOM 997   C CB    . LYS A 1 155 ? 27.454  -68.859  -116.750 1.00 46.04  ? 152 LYS A CB    1 
ATOM 998   C CG    . LYS A 1 155 ? 27.480  -67.596  -117.592 1.00 54.18  ? 152 LYS A CG    1 
ATOM 999   C CD    . LYS A 1 155 ? 28.291  -67.779  -118.868 1.00 50.48  ? 152 LYS A CD    1 
ATOM 1000  C CE    . LYS A 1 155 ? 29.756  -68.055  -118.578 1.00 56.06  ? 152 LYS A CE    1 
ATOM 1001  N NZ    . LYS A 1 155 ? 30.548  -68.164  -119.835 1.00 70.69  ? 152 LYS A NZ    1 
ATOM 1002  N N     . ARG A 1 156 ? 27.171  -70.645  -114.175 1.00 49.59  ? 153 ARG A N     1 
ATOM 1003  C CA    . ARG A 1 156 ? 27.081  -71.988  -113.609 1.00 53.07  ? 153 ARG A CA    1 
ATOM 1004  C C     . ARG A 1 156 ? 25.947  -72.107  -112.598 1.00 54.87  ? 153 ARG A C     1 
ATOM 1005  O O     . ARG A 1 156 ? 25.381  -73.194  -112.433 1.00 52.68  ? 153 ARG A O     1 
ATOM 1006  C CB    . ARG A 1 156 ? 28.412  -72.389  -112.971 1.00 51.65  ? 153 ARG A CB    1 
ATOM 1007  C CG    . ARG A 1 156 ? 29.527  -72.645  -113.974 1.00 61.07  ? 153 ARG A CG    1 
ATOM 1008  C CD    . ARG A 1 156 ? 30.875  -72.803  -113.291 1.00 55.85  ? 153 ARG A CD    1 
ATOM 1009  N NE    . ARG A 1 156 ? 30.837  -73.783  -112.206 1.00 59.14  ? 153 ARG A NE    1 
ATOM 1010  C CZ    . ARG A 1 156 ? 30.991  -75.095  -112.364 1.00 63.83  ? 153 ARG A CZ    1 
ATOM 1011  N NH1   . ARG A 1 156 ? 31.192  -75.602  -113.573 1.00 70.78  ? 153 ARG A NH1   1 
ATOM 1012  N NH2   . ARG A 1 156 ? 30.942  -75.902  -111.311 1.00 51.30  ? 153 ARG A NH2   1 
ATOM 1013  N N     . ALA A 1 157 ? 25.600  -71.014  -111.915 1.00 62.13  ? 154 ALA A N     1 
ATOM 1014  C CA    . ALA A 1 157 ? 24.457  -71.046  -111.012 1.00 56.76  ? 154 ALA A CA    1 
ATOM 1015  C C     . ALA A 1 157 ? 23.150  -71.116  -111.788 1.00 55.76  ? 154 ALA A C     1 
ATOM 1016  O O     . ALA A 1 157 ? 22.232  -71.848  -111.402 1.00 49.07  ? 154 ALA A O     1 
ATOM 1017  C CB    . ALA A 1 157 ? 24.480  -69.824  -110.096 1.00 44.25  ? 154 ALA A CB    1 
ATOM 1018  N N     . LEU A 1 158 ? 23.050  -70.366  -112.890 1.00 59.25  ? 155 LEU A N     1 
ATOM 1019  C CA    . LEU A 1 158 ? 21.838  -70.410  -113.702 1.00 49.50  ? 155 LEU A CA    1 
ATOM 1020  C C     . LEU A 1 158 ? 21.710  -71.730  -114.451 1.00 57.05  ? 155 LEU A C     1 
ATOM 1021  O O     . LEU A 1 158 ? 20.595  -72.148  -114.783 1.00 53.66  ? 155 LEU A O     1 
ATOM 1022  C CB    . LEU A 1 158 ? 21.819  -69.239  -114.681 1.00 54.13  ? 155 LEU A CB    1 
ATOM 1023  C CG    . LEU A 1 158 ? 21.358  -67.910  -114.088 1.00 49.28  ? 155 LEU A CG    1 
ATOM 1024  C CD1   . LEU A 1 158 ? 21.521  -66.784  -115.094 1.00 38.45  ? 155 LEU A CD1   1 
ATOM 1025  C CD2   . LEU A 1 158 ? 19.911  -68.017  -113.634 1.00 40.85  ? 155 LEU A CD2   1 
ATOM 1026  N N     . ARG A 1 159 ? 22.841  -72.380  -114.740 1.00 60.31  ? 156 ARG A N     1 
ATOM 1027  C CA    . ARG A 1 159 ? 22.839  -73.681  -115.403 1.00 53.66  ? 156 ARG A CA    1 
ATOM 1028  C C     . ARG A 1 159 ? 21.909  -74.677  -114.716 1.00 50.66  ? 156 ARG A C     1 
ATOM 1029  O O     . ARG A 1 159 ? 21.268  -75.500  -115.379 1.00 55.79  ? 156 ARG A O     1 
ATOM 1030  C CB    . ARG A 1 159 ? 24.271  -74.220  -115.440 1.00 60.29  ? 156 ARG A CB    1 
ATOM 1031  C CG    . ARG A 1 159 ? 24.427  -75.646  -115.927 1.00 70.52  ? 156 ARG A CG    1 
ATOM 1032  C CD    . ARG A 1 159 ? 25.820  -76.165  -115.593 1.00 75.86  ? 156 ARG A CD    1 
ATOM 1033  N NE    . ARG A 1 159 ? 26.862  -75.385  -116.254 1.00 78.07  ? 156 ARG A NE    1 
ATOM 1034  C CZ    . ARG A 1 159 ? 28.163  -75.520  -116.021 1.00 81.37  ? 156 ARG A CZ    1 
ATOM 1035  N NH1   . ARG A 1 159 ? 28.594  -76.411  -115.136 1.00 70.46  ? 156 ARG A NH1   1 
ATOM 1036  N NH2   . ARG A 1 159 ? 29.036  -74.760  -116.670 1.00 73.03  ? 156 ARG A NH2   1 
ATOM 1037  N N     . SER A 1 160 ? 21.819  -74.618  -113.389 1.00 57.19  ? 157 SER A N     1 
ATOM 1038  C CA    . SER A 1 160 ? 21.102  -75.637  -112.629 1.00 60.84  ? 157 SER A CA    1 
ATOM 1039  C C     . SER A 1 160 ? 19.584  -75.574  -112.798 1.00 55.20  ? 157 SER A C     1 
ATOM 1040  O O     . SER A 1 160 ? 18.890  -76.441  -112.255 1.00 51.95  ? 157 SER A O     1 
ATOM 1041  C CB    . SER A 1 160 ? 21.466  -75.529  -111.147 1.00 49.74  ? 157 SER A CB    1 
ATOM 1042  O OG    . SER A 1 160 ? 22.865  -75.645  -110.957 1.00 72.51  ? 157 SER A OG    1 
ATOM 1043  N N     . PHE A 1 161 ? 19.046  -74.598  -113.530 1.00 56.26  ? 158 PHE A N     1 
ATOM 1044  C CA    . PHE A 1 161 ? 17.601  -74.496  -113.698 1.00 58.35  ? 158 PHE A CA    1 
ATOM 1045  C C     . PHE A 1 161 ? 17.057  -75.297  -114.874 1.00 68.61  ? 158 PHE A C     1 
ATOM 1046  O O     . PHE A 1 161 ? 15.845  -75.536  -114.928 1.00 62.83  ? 158 PHE A O     1 
ATOM 1047  C CB    . PHE A 1 161 ? 17.187  -73.029  -113.859 1.00 56.62  ? 158 PHE A CB    1 
ATOM 1048  C CG    . PHE A 1 161 ? 17.190  -72.250  -112.572 1.00 57.11  ? 158 PHE A CG    1 
ATOM 1049  C CD1   . PHE A 1 161 ? 16.295  -72.556  -111.559 1.00 50.78  ? 158 PHE A CD1   1 
ATOM 1050  C CD2   . PHE A 1 161 ? 18.087  -71.215  -112.372 1.00 64.92  ? 158 PHE A CD2   1 
ATOM 1051  C CE1   . PHE A 1 161 ? 16.295  -71.843  -110.376 1.00 53.77  ? 158 PHE A CE1   1 
ATOM 1052  C CE2   . PHE A 1 161 ? 18.091  -70.501  -111.191 1.00 53.65  ? 158 PHE A CE2   1 
ATOM 1053  C CZ    . PHE A 1 161 ? 17.194  -70.816  -110.193 1.00 52.21  ? 158 PHE A CZ    1 
ATOM 1054  N N     . GLY A 1 162 ? 17.899  -75.716  -115.805 1.00 65.29  ? 159 GLY A N     1 
ATOM 1055  C CA    . GLY A 1 162 ? 17.445  -76.547  -116.903 1.00 63.04  ? 159 GLY A CA    1 
ATOM 1056  C C     . GLY A 1 162 ? 18.266  -76.303  -118.152 1.00 68.25  ? 159 GLY A C     1 
ATOM 1057  O O     . GLY A 1 162 ? 19.190  -75.492  -118.175 1.00 64.82  ? 159 GLY A O     1 
ATOM 1058  N N     . ASN A 1 163 ? 17.903  -77.043  -119.203 1.00 71.77  ? 160 ASN A N     1 
ATOM 1059  C CA    . ASN A 1 163 ? 18.630  -76.959  -120.466 1.00 61.01  ? 160 ASN A CA    1 
ATOM 1060  C C     . ASN A 1 163 ? 18.540  -75.564  -121.073 1.00 58.86  ? 160 ASN A C     1 
ATOM 1061  O O     . ASN A 1 163 ? 19.520  -75.063  -121.636 1.00 67.08  ? 160 ASN A O     1 
ATOM 1062  C CB    . ASN A 1 163 ? 18.103  -78.007  -121.445 1.00 62.25  ? 160 ASN A CB    1 
ATOM 1063  C CG    . ASN A 1 163 ? 18.166  -79.413  -120.882 1.00 71.09  ? 160 ASN A CG    1 
ATOM 1064  O OD1   . ASN A 1 163 ? 19.229  -80.034  -120.847 1.00 75.37  ? 160 ASN A OD1   1 
ATOM 1065  N ND2   . ASN A 1 163 ? 17.024  -79.921  -120.432 1.00 71.11  ? 160 ASN A ND2   1 
ATOM 1066  N N     . ALA A 1 164 ? 17.371  -74.925  -120.979 1.00 53.13  ? 161 ALA A N     1 
ATOM 1067  C CA    . ALA A 1 164 ? 17.183  -73.631  -121.628 1.00 62.59  ? 161 ALA A CA    1 
ATOM 1068  C C     . ALA A 1 164 ? 18.132  -72.574  -121.080 1.00 58.71  ? 161 ALA A C     1 
ATOM 1069  O O     . ALA A 1 164 ? 18.446  -71.605  -121.779 1.00 61.11  ? 161 ALA A O     1 
ATOM 1070  C CB    . ALA A 1 164 ? 15.735  -73.170  -121.476 1.00 60.79  ? 161 ALA A CB    1 
ATOM 1071  N N     . LEU A 1 165 ? 18.587  -72.729  -119.836 1.00 63.42  ? 162 LEU A N     1 
ATOM 1072  C CA    . LEU A 1 165 ? 19.524  -71.793  -119.231 1.00 60.45  ? 162 LEU A CA    1 
ATOM 1073  C C     . LEU A 1 165 ? 20.962  -72.304  -119.218 1.00 65.20  ? 162 LEU A C     1 
ATOM 1074  O O     . LEU A 1 165 ? 21.830  -71.653  -118.627 1.00 64.84  ? 162 LEU A O     1 
ATOM 1075  C CB    . LEU A 1 165 ? 19.080  -71.437  -117.813 1.00 55.35  ? 162 LEU A CB    1 
ATOM 1076  C CG    . LEU A 1 165 ? 17.970  -70.390  -117.768 1.00 56.28  ? 162 LEU A CG    1 
ATOM 1077  C CD1   . LEU A 1 165 ? 17.512  -70.157  -116.341 1.00 57.37  ? 162 LEU A CD1   1 
ATOM 1078  C CD2   . LEU A 1 165 ? 18.442  -69.095  -118.422 1.00 72.49  ? 162 LEU A CD2   1 
ATOM 1079  N N     . GLY A 1 166 ? 21.239  -73.439  -119.857 1.00 57.50  ? 163 GLY A N     1 
ATOM 1080  C CA    . GLY A 1 166 ? 22.615  -73.828  -120.095 1.00 52.13  ? 163 GLY A CA    1 
ATOM 1081  C C     . GLY A 1 166 ? 23.049  -75.218  -119.674 1.00 63.60  ? 163 GLY A C     1 
ATOM 1082  O O     . GLY A 1 166 ? 24.234  -75.540  -119.792 1.00 69.66  ? 163 GLY A O     1 
ATOM 1083  N N     . ASN A 1 167 ? 22.133  -76.055  -119.183 1.00 59.97  ? 164 ASN A N     1 
ATOM 1084  C CA    . ASN A 1 167 ? 22.544  -77.386  -118.745 1.00 64.52  ? 164 ASN A CA    1 
ATOM 1085  C C     . ASN A 1 167 ? 22.917  -78.278  -119.928 1.00 74.74  ? 164 ASN A C     1 
ATOM 1086  O O     . ASN A 1 167 ? 23.862  -79.078  -119.835 1.00 70.89  ? 164 ASN A O     1 
ATOM 1087  C CB    . ASN A 1 167 ? 21.432  -78.029  -117.916 1.00 58.16  ? 164 ASN A CB    1 
ATOM 1088  C CG    . ASN A 1 167 ? 21.934  -79.173  -117.062 1.00 63.66  ? 164 ASN A CG    1 
ATOM 1089  O OD1   . ASN A 1 167 ? 23.139  -79.382  -116.939 1.00 71.47  ? 164 ASN A OD1   1 
ATOM 1090  N ND2   . ASN A 1 167 ? 21.014  -79.909  -116.453 1.00 61.21  ? 164 ASN A ND2   1 
ATOM 1091  N N     . CYS A 1 168 ? 22.239  -78.101  -121.066 1.00 77.35  ? 165 CYS A N     1 
ATOM 1092  C CA    . CYS A 1 168 ? 22.437  -78.973  -122.218 1.00 74.49  ? 165 CYS A CA    1 
ATOM 1093  C C     . CYS A 1 168 ? 23.862  -78.918  -122.749 1.00 77.18  ? 165 CYS A C     1 
ATOM 1094  O O     . CYS A 1 168 ? 24.298  -79.865  -123.413 1.00 77.92  ? 165 CYS A O     1 
ATOM 1095  C CB    . CYS A 1 168 ? 21.445  -78.607  -123.323 1.00 72.72  ? 165 CYS A CB    1 
ATOM 1096  S SG    . CYS A 1 168 ? 21.513  -76.871  -123.840 1.00 65.30  ? 165 CYS A SG    1 
ATOM 1097  N N     . ILE A 1 169 ? 24.592  -77.833  -122.477 1.00 78.71  ? 166 ILE A N     1 
ATOM 1098  C CA    . ILE A 1 169 ? 25.971  -77.713  -122.934 1.00 76.59  ? 166 ILE A CA    1 
ATOM 1099  C C     . ILE A 1 169 ? 26.844  -78.846  -122.407 1.00 74.61  ? 166 ILE A C     1 
ATOM 1100  O O     . ILE A 1 169 ? 27.919  -79.101  -122.961 1.00 72.94  ? 166 ILE A O     1 
ATOM 1101  C CB    . ILE A 1 169 ? 26.551  -76.338  -122.531 1.00 78.26  ? 166 ILE A CB    1 
ATOM 1102  C CG1   . ILE A 1 169 ? 27.721  -75.957  -123.440 1.00 80.57  ? 166 ILE A CG1   1 
ATOM 1103  C CG2   . ILE A 1 169 ? 27.006  -76.344  -121.083 1.00 79.35  ? 166 ILE A CG2   1 
ATOM 1104  C CD1   . ILE A 1 169 ? 27.332  -75.746  -124.881 1.00 87.38  ? 166 ILE A CD1   1 
ATOM 1105  N N     . LEU A 1 170 ? 26.419  -79.539  -121.345 1.00 70.40  ? 167 LEU A N     1 
ATOM 1106  C CA    . LEU A 1 170 ? 27.247  -80.618  -120.817 1.00 74.80  ? 167 LEU A CA    1 
ATOM 1107  C C     . LEU A 1 170 ? 26.958  -81.974  -121.452 1.00 82.97  ? 167 LEU A C     1 
ATOM 1108  O O     . LEU A 1 170 ? 27.700  -82.929  -121.193 1.00 89.37  ? 167 LEU A O     1 
ATOM 1109  C CB    . LEU A 1 170 ? 27.102  -80.713  -119.292 1.00 87.71  ? 167 LEU A CB    1 
ATOM 1110  C CG    . LEU A 1 170 ? 27.547  -79.475  -118.504 1.00 77.59  ? 167 LEU A CG    1 
ATOM 1111  C CD1   . LEU A 1 170 ? 27.091  -79.542  -117.052 1.00 83.12  ? 167 LEU A CD1   1 
ATOM 1112  C CD2   . LEU A 1 170 ? 29.060  -79.293  -118.583 1.00 60.95  ? 167 LEU A CD2   1 
ATOM 1113  N N     . ASP A 1 171 ? 25.918  -82.086  -122.277 1.00 87.86  ? 168 ASP A N     1 
ATOM 1114  C CA    . ASP A 1 171 ? 25.566  -83.363  -122.891 1.00 85.57  ? 168 ASP A CA    1 
ATOM 1115  C C     . ASP A 1 171 ? 26.405  -83.559  -124.150 1.00 85.78  ? 168 ASP A C     1 
ATOM 1116  O O     . ASP A 1 171 ? 26.314  -82.767  -125.094 1.00 92.98  ? 168 ASP A O     1 
ATOM 1117  C CB    . ASP A 1 171 ? 24.074  -83.418  -123.213 1.00 83.13  ? 168 ASP A CB    1 
ATOM 1118  C CG    . ASP A 1 171 ? 23.590  -84.831  -123.511 1.00 91.93  ? 168 ASP A CG    1 
ATOM 1119  O OD1   . ASP A 1 171 ? 24.414  -85.769  -123.458 1.00 91.00  ? 168 ASP A OD1   1 
ATOM 1120  O OD2   . ASP A 1 171 ? 22.384  -85.005  -123.792 1.00 90.59  ? 168 ASP A OD2   1 
ATOM 1121  N N     . LYS A 1 172 ? 27.238  -84.604  -124.152 1.00 76.88  ? 169 LYS A N     1 
ATOM 1122  C CA    . LYS A 1 172 ? 28.123  -84.858  -125.287 1.00 92.62  ? 169 LYS A CA    1 
ATOM 1123  C C     . LYS A 1 172 ? 27.337  -85.169  -126.556 1.00 91.80  ? 169 LYS A C     1 
ATOM 1124  O O     . LYS A 1 172 ? 27.773  -84.829  -127.667 1.00 97.21  ? 169 LYS A O     1 
ATOM 1125  C CB    . LYS A 1 172 ? 29.056  -86.018  -124.945 1.00 98.51  ? 169 LYS A CB    1 
ATOM 1126  C CG    . LYS A 1 172 ? 29.802  -85.836  -123.633 1.00 90.72  ? 169 LYS A CG    1 
ATOM 1127  C CD    . LYS A 1 172 ? 30.551  -87.103  -123.245 1.00 101.95 ? 169 LYS A CD    1 
ATOM 1128  C CE    . LYS A 1 172 ? 31.172  -86.988  -121.856 1.00 105.69 ? 169 LYS A CE    1 
ATOM 1129  N NZ    . LYS A 1 172 ? 31.827  -88.262  -121.440 1.00 98.26  ? 169 LYS A NZ    1 
ATOM 1130  N N     . ASP A 1 173 ? 26.167  -85.791  -126.408 1.00 81.35  ? 170 ASP A N     1 
ATOM 1131  C CA    . ASP A 1 173 ? 25.319  -86.070  -127.560 1.00 91.73  ? 170 ASP A CA    1 
ATOM 1132  C C     . ASP A 1 173 ? 24.765  -84.781  -128.148 1.00 94.23  ? 170 ASP A C     1 
ATOM 1133  O O     . ASP A 1 173 ? 24.662  -84.642  -129.373 1.00 105.84 ? 170 ASP A O     1 
ATOM 1134  C CB    . ASP A 1 173 ? 24.189  -87.015  -127.156 1.00 94.19  ? 170 ASP A CB    1 
ATOM 1135  C CG    . ASP A 1 173 ? 24.699  -88.282  -126.496 1.00 102.46 ? 170 ASP A CG    1 
ATOM 1136  O OD1   . ASP A 1 173 ? 25.765  -88.788  -126.908 1.00 104.88 ? 170 ASP A OD1   1 
ATOM 1137  O OD2   . ASP A 1 173 ? 24.030  -88.771  -125.561 1.00 95.48  ? 170 ASP A OD2   1 
ATOM 1138  N N     . TYR A 1 174 ? 24.387  -83.833  -127.287 1.00 85.71  ? 171 TYR A N     1 
ATOM 1139  C CA    . TYR A 1 174 ? 23.944  -82.527  -127.760 1.00 85.01  ? 171 TYR A CA    1 
ATOM 1140  C C     . TYR A 1 174 ? 25.049  -81.820  -128.534 1.00 88.47  ? 171 TYR A C     1 
ATOM 1141  O O     . TYR A 1 174 ? 24.791  -81.182  -129.561 1.00 91.17  ? 171 TYR A O     1 
ATOM 1142  C CB    . TYR A 1 174 ? 23.488  -81.687  -126.568 1.00 82.08  ? 171 TYR A CB    1 
ATOM 1143  C CG    . TYR A 1 174 ? 23.272  -80.220  -126.847 1.00 77.15  ? 171 TYR A CG    1 
ATOM 1144  C CD1   . TYR A 1 174 ? 22.107  -79.774  -127.455 1.00 78.72  ? 171 TYR A CD1   1 
ATOM 1145  C CD2   . TYR A 1 174 ? 24.225  -79.278  -126.488 1.00 74.34  ? 171 TYR A CD2   1 
ATOM 1146  C CE1   . TYR A 1 174 ? 21.897  -78.433  -127.704 1.00 76.67  ? 171 TYR A CE1   1 
ATOM 1147  C CE2   . TYR A 1 174 ? 24.026  -77.933  -126.733 1.00 72.38  ? 171 TYR A CE2   1 
ATOM 1148  C CZ    . TYR A 1 174 ? 22.860  -77.516  -127.342 1.00 71.23  ? 171 TYR A CZ    1 
ATOM 1149  O OH    . TYR A 1 174 ? 22.660  -76.176  -127.589 1.00 53.62  ? 171 TYR A OH    1 
ATOM 1150  N N     . LEU A 1 175 ? 26.299  -81.974  -128.092 1.00 85.42  ? 172 LEU A N     1 
ATOM 1151  C CA    . LEU A 1 175 ? 27.413  -81.349  -128.800 1.00 91.65  ? 172 LEU A CA    1 
ATOM 1152  C C     . LEU A 1 175 ? 27.625  -81.994  -130.164 1.00 95.79  ? 172 LEU A C     1 
ATOM 1153  O O     . LEU A 1 175 ? 27.840  -81.295  -131.168 1.00 96.88  ? 172 LEU A O     1 
ATOM 1154  C CB    . LEU A 1 175 ? 28.686  -81.443  -127.959 1.00 87.97  ? 172 LEU A CB    1 
ATOM 1155  C CG    . LEU A 1 175 ? 28.734  -80.612  -126.675 1.00 83.02  ? 172 LEU A CG    1 
ATOM 1156  C CD1   . LEU A 1 175 ? 30.087  -80.772  -125.991 1.00 85.15  ? 172 LEU A CD1   1 
ATOM 1157  C CD2   . LEU A 1 175 ? 28.437  -79.149  -126.961 1.00 76.77  ? 172 LEU A CD2   1 
ATOM 1158  N N     . ARG A 1 176 ? 27.554  -83.328  -130.222 1.00 96.59  ? 173 ARG A N     1 
ATOM 1159  C CA    . ARG A 1 176 ? 27.685  -84.017  -131.502 1.00 100.06 ? 173 ARG A CA    1 
ATOM 1160  C C     . ARG A 1 176 ? 26.584  -83.592  -132.466 1.00 94.61  ? 173 ARG A C     1 
ATOM 1161  O O     . ARG A 1 176 ? 26.850  -83.268  -133.629 1.00 96.60  ? 173 ARG A O     1 
ATOM 1162  C CB    . ARG A 1 176 ? 27.617  -85.529  -131.300 1.00 100.63 ? 173 ARG A CB    1 
ATOM 1163  C CG    . ARG A 1 176 ? 28.780  -86.184  -130.589 1.00 104.57 ? 173 ARG A CG    1 
ATOM 1164  C CD    . ARG A 1 176 ? 28.672  -87.702  -130.733 1.00 111.60 ? 173 ARG A CD    1 
ATOM 1165  N NE    . ARG A 1 176 ? 27.475  -88.238  -130.083 1.00 114.98 ? 173 ARG A NE    1 
ATOM 1166  C CZ    . ARG A 1 176 ? 26.332  -88.512  -130.713 1.00 119.96 ? 173 ARG A CZ    1 
ATOM 1167  N NH1   . ARG A 1 176 ? 26.221  -88.309  -132.021 1.00 109.05 ? 173 ARG A NH1   1 
ATOM 1168  N NH2   . ARG A 1 176 ? 25.298  -88.992  -130.035 1.00 120.39 ? 173 ARG A NH2   1 
ATOM 1169  N N     . SER A 1 177 ? 25.333  -83.595  -131.996 1.00 88.80  ? 174 SER A N     1 
ATOM 1170  C CA    . SER A 1 177 ? 24.216  -83.165  -132.830 1.00 82.97  ? 174 SER A CA    1 
ATOM 1171  C C     . SER A 1 177 ? 24.289  -81.688  -133.187 1.00 90.71  ? 174 SER A C     1 
ATOM 1172  O O     . SER A 1 177 ? 23.647  -81.264  -134.154 1.00 100.09 ? 174 SER A O     1 
ATOM 1173  C CB    . SER A 1 177 ? 22.894  -83.463  -132.123 1.00 81.12  ? 174 SER A CB    1 
ATOM 1174  O OG    . SER A 1 177 ? 22.721  -84.860  -131.950 1.00 92.87  ? 174 SER A OG    1 
ATOM 1175  N N     . LEU A 1 178 ? 25.062  -80.898  -132.442 1.00 91.48  ? 175 LEU A N     1 
ATOM 1176  C CA    . LEU A 1 178 ? 25.240  -79.499  -132.806 1.00 94.17  ? 175 LEU A CA    1 
ATOM 1177  C C     . LEU A 1 178 ? 26.285  -79.333  -133.900 1.00 95.40  ? 175 LEU A C     1 
ATOM 1178  O O     . LEU A 1 178 ? 26.126  -78.485  -134.785 1.00 100.83 ? 175 LEU A O     1 
ATOM 1179  C CB    . LEU A 1 178 ? 25.639  -78.681  -131.578 1.00 91.14  ? 175 LEU A CB    1 
ATOM 1180  C CG    . LEU A 1 178 ? 24.545  -77.835  -130.937 1.00 82.44  ? 175 LEU A CG    1 
ATOM 1181  C CD1   . LEU A 1 178 ? 25.154  -76.945  -129.878 1.00 83.23  ? 175 LEU A CD1   1 
ATOM 1182  C CD2   . LEU A 1 178 ? 23.857  -77.003  -132.003 1.00 85.09  ? 175 LEU A CD2   1 
ATOM 1183  N N     . ASN A 1 179 ? 27.341  -80.152  -133.871 1.00 88.95  ? 176 ASN A N     1 
ATOM 1184  C CA    . ASN A 1 179 ? 28.375  -80.046  -134.900 1.00 97.54  ? 176 ASN A CA    1 
ATOM 1185  C C     . ASN A 1 179 ? 27.857  -80.449  -136.275 1.00 106.80 ? 176 ASN A C     1 
ATOM 1186  O O     . ASN A 1 179 ? 28.282  -79.877  -137.287 1.00 97.54  ? 176 ASN A O     1 
ATOM 1187  C CB    . ASN A 1 179 ? 29.592  -80.892  -134.525 1.00 93.02  ? 176 ASN A CB    1 
ATOM 1188  C CG    . ASN A 1 179 ? 30.438  -80.247  -133.451 1.00 112.81 ? 176 ASN A CG    1 
ATOM 1189  O OD1   . ASN A 1 179 ? 31.014  -79.181  -133.664 1.00 111.39 ? 176 ASN A OD1   1 
ATOM 1190  N ND2   . ASN A 1 179 ? 30.517  -80.885  -132.287 1.00 119.72 ? 176 ASN A ND2   1 
ATOM 1191  N N     . LYS A 1 180 ? 26.953  -81.428  -136.338 1.00 99.39  ? 177 LYS A N     1 
ATOM 1192  C CA    . LYS A 1 180 ? 26.393  -81.859  -137.614 1.00 99.53  ? 177 LYS A CA    1 
ATOM 1193  C C     . LYS A 1 180 ? 25.521  -80.799  -138.278 1.00 109.97 ? 177 LYS A C     1 
ATOM 1194  O O     . LYS A 1 180 ? 25.117  -80.991  -139.430 1.00 118.35 ? 177 LYS A O     1 
ATOM 1195  C CB    . LYS A 1 180 ? 25.582  -83.141  -137.426 1.00 88.49  ? 177 LYS A CB    1 
ATOM 1196  C CG    . LYS A 1 180 ? 26.376  -84.305  -136.864 1.00 93.52  ? 177 LYS A CG    1 
ATOM 1197  C CD    . LYS A 1 180 ? 25.483  -85.516  -136.641 1.00 92.33  ? 177 LYS A CD    1 
ATOM 1198  C CE    . LYS A 1 180 ? 26.256  -86.652  -135.997 1.00 98.44  ? 177 LYS A CE    1 
ATOM 1199  N NZ    . LYS A 1 180 ? 25.383  -87.825  -135.730 1.00 106.68 ? 177 LYS A NZ    1 
ATOM 1200  N N     . LEU A 1 181 ? 25.221  -79.698  -137.589 1.00 102.38 ? 178 LEU A N     1 
ATOM 1201  C CA    . LEU A 1 181 ? 24.384  -78.647  -138.143 1.00 107.85 ? 178 LEU A CA    1 
ATOM 1202  C C     . LEU A 1 181 ? 25.203  -77.680  -138.999 1.00 119.18 ? 178 LEU A C     1 
ATOM 1203  O O     . LEU A 1 181 ? 26.387  -77.456  -138.738 1.00 111.56 ? 178 LEU A O     1 
ATOM 1204  C CB    . LEU A 1 181 ? 23.695  -77.878  -137.020 1.00 97.65  ? 178 LEU A CB    1 
ATOM 1205  C CG    . LEU A 1 181 ? 22.497  -78.590  -136.392 1.00 96.57  ? 178 LEU A CG    1 
ATOM 1206  C CD1   . LEU A 1 181 ? 21.990  -77.775  -135.225 1.00 89.78  ? 178 LEU A CD1   1 
ATOM 1207  C CD2   . LEU A 1 181 ? 21.389  -78.806  -137.413 1.00 94.62  ? 178 LEU A CD2   1 
ATOM 1208  N N     . PRO A 1 182 ? 24.584  -77.099  -140.027 1.00 124.12 ? 179 PRO A N     1 
ATOM 1209  C CA    . PRO A 1 182 ? 25.294  -76.136  -140.884 1.00 118.72 ? 179 PRO A CA    1 
ATOM 1210  C C     . PRO A 1 182 ? 25.693  -74.882  -140.119 1.00 117.15 ? 179 PRO A C     1 
ATOM 1211  O O     . PRO A 1 182 ? 24.877  -74.275  -139.420 1.00 122.58 ? 179 PRO A O     1 
ATOM 1212  C CB    . PRO A 1 182 ? 24.274  -75.817  -141.985 1.00 114.80 ? 179 PRO A CB    1 
ATOM 1213  C CG    . PRO A 1 182 ? 23.266  -76.917  -141.926 1.00 121.92 ? 179 PRO A CG    1 
ATOM 1214  C CD    . PRO A 1 182 ? 23.221  -77.375  -140.508 1.00 112.69 ? 179 PRO A CD    1 
ATOM 1215  N N     . ARG A 1 183 ? 26.966  -74.507  -140.245 1.00 111.41 ? 180 ARG A N     1 
ATOM 1216  C CA    . ARG A 1 183 ? 27.479  -73.286  -139.634 1.00 120.26 ? 180 ARG A CA    1 
ATOM 1217  C C     . ARG A 1 183 ? 26.820  -72.050  -140.237 1.00 128.84 ? 180 ARG A C     1 
ATOM 1218  O O     . ARG A 1 183 ? 27.132  -71.654  -141.366 1.00 130.45 ? 180 ARG A O     1 
ATOM 1219  C CB    . ARG A 1 183 ? 29.001  -73.210  -139.790 1.00 110.21 ? 180 ARG A CB    1 
ATOM 1220  C CG    . ARG A 1 183 ? 29.663  -72.081  -139.010 1.00 123.92 ? 180 ARG A CG    1 
ATOM 1221  C CD    . ARG A 1 183 ? 29.337  -72.101  -137.533 1.00 136.73 ? 180 ARG A CD    1 
ATOM 1222  N NE    . ARG A 1 183 ? 29.961  -70.978  -136.835 1.00 151.22 ? 180 ARG A NE    1 
ATOM 1223  C CZ    . ARG A 1 183 ? 29.598  -70.547  -135.631 1.00 147.03 ? 180 ARG A CZ    1 
ATOM 1224  N NH1   . ARG A 1 183 ? 28.607  -71.142  -134.980 1.00 134.33 ? 180 ARG A NH1   1 
ATOM 1225  N NH2   . ARG A 1 183 ? 30.221  -69.511  -135.080 1.00 146.54 ? 180 ARG A NH2   1 
ATOM 1226  N N     . GLN A 1 184 ? 25.904  -71.438  -139.490 1.00 130.19 ? 181 GLN A N     1 
ATOM 1227  C CA    . GLN A 1 184 ? 25.177  -70.273  -139.971 1.00 129.38 ? 181 GLN A CA    1 
ATOM 1228  C C     . GLN A 1 184 ? 26.023  -69.013  -139.837 1.00 131.66 ? 181 GLN A C     1 
ATOM 1229  O O     . GLN A 1 184 ? 26.887  -68.905  -138.963 1.00 131.09 ? 181 GLN A O     1 
ATOM 1230  C CB    . GLN A 1 184 ? 23.867  -70.088  -139.207 1.00 126.72 ? 181 GLN A CB    1 
ATOM 1231  C CG    . GLN A 1 184 ? 24.027  -69.986  -137.702 1.00 127.59 ? 181 GLN A CG    1 
ATOM 1232  C CD    . GLN A 1 184 ? 22.740  -69.577  -137.016 1.00 114.13 ? 181 GLN A CD    1 
ATOM 1233  O OE1   . GLN A 1 184 ? 22.765  -69.026  -135.915 1.00 112.73 ? 181 GLN A OE1   1 
ATOM 1234  N NE2   . GLN A 1 184 ? 21.607  -69.815  -137.677 1.00 104.53 ? 181 GLN A NE2   1 
ATOM 1235  N N     . LEU A 1 185 ? 25.777  -68.065  -140.729 1.00 128.11 ? 182 LEU A N     1 
ATOM 1236  C CA    . LEU A 1 185 ? 26.529  -66.826  -140.677 1.00 133.56 ? 182 LEU A CA    1 
ATOM 1237  C C     . LEU A 1 185 ? 26.019  -65.953  -139.530 1.00 128.49 ? 182 LEU A C     1 
ATOM 1238  O O     . LEU A 1 185 ? 24.834  -66.001  -139.188 1.00 121.23 ? 182 LEU A O     1 
ATOM 1239  C CB    . LEU A 1 185 ? 26.401  -66.075  -142.001 1.00 133.97 ? 182 LEU A CB    1 
ATOM 1240  C CG    . LEU A 1 185 ? 27.535  -65.137  -142.419 1.00 130.96 ? 182 LEU A CG    1 
ATOM 1241  C CD1   . LEU A 1 185 ? 28.847  -65.902  -142.543 1.00 125.29 ? 182 LEU A CD1   1 
ATOM 1242  C CD2   . LEU A 1 185 ? 27.195  -64.431  -143.724 1.00 114.94 ? 182 LEU A CD2   1 
ATOM 1243  N N     . PRO A 1 186 ? 26.914  -65.182  -138.888 1.00 131.24 ? 183 PRO A N     1 
ATOM 1244  C CA    . PRO A 1 186 ? 26.490  -64.274  -137.811 1.00 131.34 ? 183 PRO A CA    1 
ATOM 1245  C C     . PRO A 1 186 ? 25.287  -63.427  -138.198 1.00 129.57 ? 183 PRO A C     1 
ATOM 1246  O O     . PRO A 1 186 ? 25.316  -62.723  -139.213 1.00 129.94 ? 183 PRO A O     1 
ATOM 1247  C CB    . PRO A 1 186 ? 27.735  -63.412  -137.573 1.00 128.90 ? 183 PRO A CB    1 
ATOM 1248  C CG    . PRO A 1 186 ? 28.876  -64.301  -137.945 1.00 126.59 ? 183 PRO A CG    1 
ATOM 1249  C CD    . PRO A 1 186 ? 28.381  -65.280  -138.986 1.00 128.22 ? 183 PRO A CD    1 
ATOM 1250  N N     . LEU A 1 187 ? 24.219  -63.512  -137.407 1.00 137.67 ? 184 LEU A N     1 
ATOM 1251  C CA    . LEU A 1 187 ? 23.009  -62.748  -137.679 1.00 135.01 ? 184 LEU A CA    1 
ATOM 1252  C C     . LEU A 1 187 ? 23.296  -61.249  -137.692 1.00 124.80 ? 184 LEU A C     1 
ATOM 1253  O O     . LEU A 1 187 ? 24.196  -60.756  -137.005 1.00 117.20 ? 184 LEU A O     1 
ATOM 1254  C CB    . LEU A 1 187 ? 21.940  -63.053  -136.625 1.00 130.84 ? 184 LEU A CB    1 
ATOM 1255  C CG    . LEU A 1 187 ? 21.450  -64.492  -136.415 1.00 128.26 ? 184 LEU A CG    1 
ATOM 1256  C CD1   . LEU A 1 187 ? 21.334  -65.246  -137.736 1.00 126.76 ? 184 LEU A CD1   1 
ATOM 1257  C CD2   . LEU A 1 187 ? 22.325  -65.250  -135.413 1.00 116.62 ? 184 LEU A CD2   1 
ATOM 1258  N N     . GLU A 1 188 ? 22.516  -60.521  -138.487 1.00 123.46 ? 185 GLU A N     1 
ATOM 1259  C CA    . GLU A 1 188 ? 22.622  -59.073  -138.575 1.00 121.05 ? 185 GLU A CA    1 
ATOM 1260  C C     . GLU A 1 188 ? 21.544  -58.435  -137.708 1.00 111.62 ? 185 GLU A C     1 
ATOM 1261  O O     . GLU A 1 188 ? 20.431  -58.954  -137.588 1.00 101.95 ? 185 GLU A O     1 
ATOM 1262  C CB    . GLU A 1 188 ? 22.488  -58.598  -140.026 1.00 115.80 ? 185 GLU A CB    1 
ATOM 1263  C CG    . GLU A 1 188 ? 23.056  -57.207  -140.286 1.00 115.48 ? 185 GLU A CG    1 
ATOM 1264  C CD    . GLU A 1 188 ? 22.933  -56.783  -141.740 1.00 135.25 ? 185 GLU A CD    1 
ATOM 1265  O OE1   . GLU A 1 188 ? 21.837  -56.942  -142.318 1.00 143.54 ? 185 GLU A OE1   1 
ATOM 1266  O OE2   . GLU A 1 188 ? 23.933  -56.291  -142.304 1.00 143.65 ? 185 GLU A OE2   1 
ATOM 1267  N N     . VAL A 1 189 ? 21.881  -57.298  -137.107 1.00 104.92 ? 186 VAL A N     1 
ATOM 1268  C CA    . VAL A 1 189 ? 21.004  -56.617  -136.161 1.00 97.75  ? 186 VAL A CA    1 
ATOM 1269  C C     . VAL A 1 189 ? 20.410  -55.388  -136.834 1.00 81.58  ? 186 VAL A C     1 
ATOM 1270  O O     . VAL A 1 189 ? 21.133  -54.597  -137.452 1.00 78.94  ? 186 VAL A O     1 
ATOM 1271  C CB    . VAL A 1 189 ? 21.757  -56.234  -134.875 1.00 105.08 ? 186 VAL A CB    1 
ATOM 1272  C CG1   . VAL A 1 189 ? 20.822  -55.546  -133.895 1.00 98.37  ? 186 VAL A CG1   1 
ATOM 1273  C CG2   . VAL A 1 189 ? 22.395  -57.463  -134.244 1.00 92.75  ? 186 VAL A CG2   1 
ATOM 1274  N N     . ASP A 1 190 ? 19.093  -55.230  -136.715 1.00 78.25  ? 187 ASP A N     1 
ATOM 1275  C CA    . ASP A 1 190 ? 18.370  -54.111  -137.316 1.00 92.35  ? 187 ASP A CA    1 
ATOM 1276  C C     . ASP A 1 190 ? 18.165  -53.058  -136.230 1.00 89.93  ? 187 ASP A C     1 
ATOM 1277  O O     . ASP A 1 190 ? 17.247  -53.165  -135.413 1.00 80.96  ? 187 ASP A O     1 
ATOM 1278  C CB    . ASP A 1 190 ? 17.046  -54.580  -137.911 1.00 97.17  ? 187 ASP A CB    1 
ATOM 1279  C CG    . ASP A 1 190 ? 16.245  -53.446  -138.516 1.00 98.17  ? 187 ASP A CG    1 
ATOM 1280  O OD1   . ASP A 1 190 ? 16.772  -52.757  -139.415 1.00 104.57 ? 187 ASP A OD1   1 
ATOM 1281  O OD2   . ASP A 1 190 ? 15.087  -53.245  -138.094 1.00 91.07  ? 187 ASP A OD2   1 
ATOM 1282  N N     . LEU A 1 191 ? 19.023  -52.036  -136.224 1.00 91.20  ? 188 LEU A N     1 
ATOM 1283  C CA    . LEU A 1 191 ? 19.007  -50.993  -135.206 1.00 82.08  ? 188 LEU A CA    1 
ATOM 1284  C C     . LEU A 1 191 ? 18.043  -49.856  -135.523 1.00 89.06  ? 188 LEU A C     1 
ATOM 1285  O O     . LEU A 1 191 ? 18.193  -48.758  -134.974 1.00 86.49  ? 188 LEU A O     1 
ATOM 1286  C CB    . LEU A 1 191 ? 20.417  -50.436  -135.000 1.00 88.18  ? 188 LEU A CB    1 
ATOM 1287  C CG    . LEU A 1 191 ? 21.433  -51.435  -134.450 1.00 87.66  ? 188 LEU A CG    1 
ATOM 1288  C CD1   . LEU A 1 191 ? 22.759  -50.753  -134.181 1.00 87.66  ? 188 LEU A CD1   1 
ATOM 1289  C CD2   . LEU A 1 191 ? 20.895  -52.078  -133.184 1.00 74.15  ? 188 LEU A CD2   1 
ATOM 1290  N N     . THR A 1 192 ? 17.069  -50.084  -136.404 1.00 98.38  ? 189 THR A N     1 
ATOM 1291  C CA    . THR A 1 192 ? 16.115  -49.032  -136.729 1.00 106.16 ? 189 THR A CA    1 
ATOM 1292  C C     . THR A 1 192 ? 15.173  -48.769  -135.561 1.00 99.52  ? 189 THR A C     1 
ATOM 1293  O O     . THR A 1 192 ? 14.853  -47.613  -135.263 1.00 94.04  ? 189 THR A O     1 
ATOM 1294  C CB    . THR A 1 192 ? 15.329  -49.401  -137.988 1.00 97.32  ? 189 THR A CB    1 
ATOM 1295  O OG1   . THR A 1 192 ? 14.669  -50.659  -137.798 1.00 99.93  ? 189 THR A OG1   1 
ATOM 1296  C CG2   . THR A 1 192 ? 16.264  -49.504  -139.186 1.00 98.38  ? 189 THR A CG2   1 
ATOM 1297  N N     . LYS A 1 193 ? 14.739  -49.825  -134.873 1.00 91.54  ? 190 LYS A N     1 
ATOM 1298  C CA    . LYS A 1 193 ? 13.859  -49.705  -133.721 1.00 96.18  ? 190 LYS A CA    1 
ATOM 1299  C C     . LYS A 1 193 ? 14.627  -49.605  -132.405 1.00 99.93  ? 190 LYS A C     1 
ATOM 1300  O O     . LYS A 1 193 ? 14.077  -49.941  -131.349 1.00 91.05  ? 190 LYS A O     1 
ATOM 1301  C CB    . LYS A 1 193 ? 12.909  -50.903  -133.684 1.00 81.20  ? 190 LYS A CB    1 
ATOM 1302  C CG    . LYS A 1 193 ? 12.029  -51.018  -134.912 1.00 107.58 ? 190 LYS A CG    1 
ATOM 1303  C CD    . LYS A 1 193 ? 11.016  -52.135  -134.775 1.00 112.83 ? 190 LYS A CD    1 
ATOM 1304  C CE    . LYS A 1 193 ? 10.087  -52.157  -135.973 1.00 107.25 ? 190 LYS A CE    1 
ATOM 1305  N NZ    . LYS A 1 193 ? 9.200   -53.348  -135.970 1.00 114.72 ? 190 LYS A NZ    1 
ATOM 1306  N N     . ALA A 1 194 ? 15.874  -49.143  -132.447 1.00 94.95  ? 191 ALA A N     1 
ATOM 1307  C CA    . ALA A 1 194 ? 16.675  -48.988  -131.241 1.00 87.20  ? 191 ALA A CA    1 
ATOM 1308  C C     . ALA A 1 194 ? 16.216  -47.792  -130.413 1.00 94.59  ? 191 ALA A C     1 
ATOM 1309  O O     . ALA A 1 194 ? 15.727  -46.789  -130.941 1.00 99.27  ? 191 ALA A O     1 
ATOM 1310  C CB    . ALA A 1 194 ? 18.152  -48.830  -131.598 1.00 87.25  ? 191 ALA A CB    1 
ATOM 1311  N N     . LYS A 1 195 ? 16.382  -47.911  -129.097 1.00 92.30  ? 192 LYS A N     1 
ATOM 1312  C CA    . LYS A 1 195 ? 16.052  -46.815  -128.196 1.00 91.67  ? 192 LYS A CA    1 
ATOM 1313  C C     . LYS A 1 195 ? 17.031  -45.666  -128.411 1.00 87.33  ? 192 LYS A C     1 
ATOM 1314  O O     . LYS A 1 195 ? 18.250  -45.862  -128.383 1.00 84.68  ? 192 LYS A O     1 
ATOM 1315  C CB    . LYS A 1 195 ? 16.086  -47.292  -126.743 1.00 86.33  ? 192 LYS A CB    1 
ATOM 1316  C CG    . LYS A 1 195 ? 15.771  -46.212  -125.715 1.00 74.24  ? 192 LYS A CG    1 
ATOM 1317  C CD    . LYS A 1 195 ? 15.873  -46.749  -124.297 1.00 67.93  ? 192 LYS A CD    1 
ATOM 1318  C CE    . LYS A 1 195 ? 15.499  -45.685  -123.282 1.00 70.35  ? 192 LYS A CE    1 
ATOM 1319  N NZ    . LYS A 1 195 ? 14.121  -45.173  -123.506 1.00 75.63  ? 192 LYS A NZ    1 
ATOM 1320  N N     . ARG A 1 196 ? 16.495  -44.467  -128.642 1.00 85.75  ? 193 ARG A N     1 
ATOM 1321  C CA    . ARG A 1 196 ? 17.307  -43.313  -129.001 1.00 90.50  ? 193 ARG A CA    1 
ATOM 1322  C C     . ARG A 1 196 ? 17.196  -42.144  -128.031 1.00 89.28  ? 193 ARG A C     1 
ATOM 1323  O O     . ARG A 1 196 ? 18.027  -41.231  -128.102 1.00 88.42  ? 193 ARG A O     1 
ATOM 1324  C CB    . ARG A 1 196 ? 16.966  -42.844  -130.426 1.00 101.27 ? 193 ARG A CB    1 
ATOM 1325  C CG    . ARG A 1 196 ? 17.439  -43.834  -131.488 1.00 100.51 ? 193 ARG A CG    1 
ATOM 1326  C CD    . ARG A 1 196 ? 17.477  -43.261  -132.899 1.00 97.29  ? 193 ARG A CD    1 
ATOM 1327  N NE    . ARG A 1 196 ? 18.466  -43.965  -133.713 1.00 93.53  ? 193 ARG A NE    1 
ATOM 1328  C CZ    . ARG A 1 196 ? 18.253  -45.141  -134.295 1.00 99.45  ? 193 ARG A CZ    1 
ATOM 1329  N NH1   . ARG A 1 196 ? 17.084  -45.749  -134.151 1.00 97.38  ? 193 ARG A NH1   1 
ATOM 1330  N NH2   . ARG A 1 196 ? 19.210  -45.714  -135.014 1.00 92.73  ? 193 ARG A NH2   1 
ATOM 1331  N N     . GLN A 1 197 ? 16.204  -42.132  -127.142 1.00 90.42  ? 194 GLN A N     1 
ATOM 1332  C CA    . GLN A 1 197 ? 16.120  -41.103  -126.116 1.00 93.88  ? 194 GLN A CA    1 
ATOM 1333  C C     . GLN A 1 197 ? 15.734  -41.751  -124.794 1.00 97.17  ? 194 GLN A C     1 
ATOM 1334  O O     . GLN A 1 197 ? 15.179  -42.852  -124.759 1.00 95.34  ? 194 GLN A O     1 
ATOM 1335  C CB    . GLN A 1 197 ? 15.087  -40.016  -126.454 1.00 91.23  ? 194 GLN A CB    1 
ATOM 1336  C CG    . GLN A 1 197 ? 13.626  -40.477  -126.410 1.00 96.61  ? 194 GLN A CG    1 
ATOM 1337  C CD    . GLN A 1 197 ? 13.256  -41.505  -127.466 1.00 109.03 ? 194 GLN A CD    1 
ATOM 1338  O OE1   . GLN A 1 197 ? 14.049  -41.832  -128.348 1.00 112.45 ? 194 GLN A OE1   1 
ATOM 1339  N NE2   . GLN A 1 197 ? 12.046  -42.044  -127.357 1.00 103.10 ? 194 GLN A NE2   1 
ATOM 1340  N N     . ASP A 1 198 ? 16.026  -41.041  -123.700 1.00 95.47  ? 195 ASP A N     1 
ATOM 1341  C CA    . ASP A 1 198 ? 15.853  -41.616  -122.369 1.00 86.01  ? 195 ASP A CA    1 
ATOM 1342  C C     . ASP A 1 198 ? 14.382  -41.873  -122.068 1.00 81.34  ? 195 ASP A C     1 
ATOM 1343  O O     . ASP A 1 198 ? 14.031  -42.925  -121.521 1.00 76.73  ? 195 ASP A O     1 
ATOM 1344  C CB    . ASP A 1 198 ? 16.465  -40.698  -121.308 1.00 87.33  ? 195 ASP A CB    1 
ATOM 1345  C CG    . ASP A 1 198 ? 17.979  -40.623  -121.398 1.00 90.07  ? 195 ASP A CG    1 
ATOM 1346  O OD1   . ASP A 1 198 ? 18.599  -41.594  -121.880 1.00 84.77  ? 195 ASP A OD1   1 
ATOM 1347  O OD2   . ASP A 1 198 ? 18.551  -39.596  -120.973 1.00 92.85  ? 195 ASP A OD2   1 
ATOM 1348  N N     . LEU A 1 199 ? 13.520  -40.917  -122.408 1.00 83.04  ? 196 LEU A N     1 
ATOM 1349  C CA    . LEU A 1 199 ? 12.122  -40.943  -121.996 1.00 77.71  ? 196 LEU A CA    1 
ATOM 1350  C C     . LEU A 1 199 ? 11.433  -42.243  -122.405 1.00 84.24  ? 196 LEU A C     1 
ATOM 1351  O O     . LEU A 1 199 ? 11.628  -42.752  -123.512 1.00 90.18  ? 196 LEU A O     1 
ATOM 1352  C CB    . LEU A 1 199 ? 11.401  -39.745  -122.618 1.00 80.95  ? 196 LEU A CB    1 
ATOM 1353  C CG    . LEU A 1 199 ? 9.932   -39.487  -122.294 1.00 80.37  ? 196 LEU A CG    1 
ATOM 1354  C CD1   . LEU A 1 199 ? 9.732   -39.356  -120.797 1.00 73.49  ? 196 LEU A CD1   1 
ATOM 1355  C CD2   . LEU A 1 199 ? 9.448   -38.240  -123.022 1.00 69.12  ? 196 LEU A CD2   1 
ATOM 1356  N N     . GLU A 1 200 ? 10.624  -42.782  -121.489 1.00 88.39  ? 197 GLU A N     1 
ATOM 1357  C CA    . GLU A 1 200 ? 9.821   -43.985  -121.718 1.00 86.16  ? 197 GLU A CA    1 
ATOM 1358  C C     . GLU A 1 200 ? 8.365   -43.683  -121.377 1.00 87.00  ? 197 GLU A C     1 
ATOM 1359  O O     . GLU A 1 200 ? 7.936   -43.869  -120.232 1.00 74.65  ? 197 GLU A O     1 
ATOM 1360  C CB    . GLU A 1 200 ? 10.335  -45.168  -120.899 1.00 79.29  ? 197 GLU A CB    1 
ATOM 1361  C CG    . GLU A 1 200 ? 11.599  -45.820  -121.439 1.00 80.78  ? 197 GLU A CG    1 
ATOM 1362  C CD    . GLU A 1 200 ? 11.337  -46.654  -122.683 1.00 83.19  ? 197 GLU A CD    1 
ATOM 1363  O OE1   . GLU A 1 200 ? 10.189  -47.119  -122.860 1.00 68.44  ? 197 GLU A OE1   1 
ATOM 1364  O OE2   . GLU A 1 200 ? 12.281  -46.855  -123.477 1.00 81.03  ? 197 GLU A OE2   1 
ATOM 1365  N N     . PRO A 1 201 ? 7.584   -43.205  -122.351 1.00 90.11  ? 198 PRO A N     1 
ATOM 1366  C CA    . PRO A 1 201 ? 6.234   -42.715  -122.012 1.00 84.66  ? 198 PRO A CA    1 
ATOM 1367  C C     . PRO A 1 201 ? 5.293   -43.795  -121.503 1.00 80.95  ? 198 PRO A C     1 
ATOM 1368  O O     . PRO A 1 201 ? 4.583   -43.566  -120.517 1.00 72.94  ? 198 PRO A O     1 
ATOM 1369  C CB    . PRO A 1 201 ? 5.741   -42.110  -123.336 1.00 78.63  ? 198 PRO A CB    1 
ATOM 1370  C CG    . PRO A 1 201 ? 6.973   -41.916  -124.171 1.00 83.02  ? 198 PRO A CG    1 
ATOM 1371  C CD    . PRO A 1 201 ? 7.908   -43.007  -123.771 1.00 83.70  ? 198 PRO A CD    1 
ATOM 1372  N N     . SER A 1 202 ? 5.261   -44.967  -122.145 1.00 87.35  ? 199 SER A N     1 
ATOM 1373  C CA    . SER A 1 202 ? 4.386   -46.044  -121.684 1.00 87.16  ? 199 SER A CA    1 
ATOM 1374  C C     . SER A 1 202 ? 4.754   -46.507  -120.279 1.00 78.68  ? 199 SER A C     1 
ATOM 1375  O O     . SER A 1 202 ? 3.872   -46.750  -119.441 1.00 82.01  ? 199 SER A O     1 
ATOM 1376  C CB    . SER A 1 202 ? 4.443   -47.217  -122.664 1.00 82.12  ? 199 SER A CB    1 
ATOM 1377  O OG    . SER A 1 202 ? 3.696   -48.319  -122.180 1.00 97.68  ? 199 SER A OG    1 
ATOM 1378  N N     . VAL A 1 203 ? 6.053   -46.632  -120.004 1.00 80.62  ? 200 VAL A N     1 
ATOM 1379  C CA    . VAL A 1 203 ? 6.500   -47.070  -118.686 1.00 74.47  ? 200 VAL A CA    1 
ATOM 1380  C C     . VAL A 1 203 ? 6.129   -46.036  -117.633 1.00 75.73  ? 200 VAL A C     1 
ATOM 1381  O O     . VAL A 1 203 ? 5.615   -46.372  -116.558 1.00 77.21  ? 200 VAL A O     1 
ATOM 1382  C CB    . VAL A 1 203 ? 8.014   -47.344  -118.702 1.00 76.76  ? 200 VAL A CB    1 
ATOM 1383  C CG1   . VAL A 1 203 ? 8.484   -47.797  -117.338 1.00 72.16  ? 200 VAL A CG1   1 
ATOM 1384  C CG2   . VAL A 1 203 ? 8.366   -48.376  -119.766 1.00 79.91  ? 200 VAL A CG2   1 
ATOM 1385  N N     . GLU A 1 204 ? 6.412   -44.765  -117.918 1.00 79.26  ? 201 GLU A N     1 
ATOM 1386  C CA    . GLU A 1 204 ? 6.043   -43.689  -117.006 1.00 63.68  ? 201 GLU A CA    1 
ATOM 1387  C C     . GLU A 1 204 ? 4.544   -43.678  -116.752 1.00 72.35  ? 201 GLU A C     1 
ATOM 1388  O O     . GLU A 1 204 ? 4.100   -43.431  -115.626 1.00 65.51  ? 201 GLU A O     1 
ATOM 1389  C CB    . GLU A 1 204 ? 6.499   -42.346  -117.571 1.00 73.38  ? 201 GLU A CB    1 
ATOM 1390  C CG    . GLU A 1 204 ? 6.014   -41.146  -116.781 1.00 79.19  ? 201 GLU A CG    1 
ATOM 1391  C CD    . GLU A 1 204 ? 6.554   -41.136  -115.366 1.00 97.61  ? 201 GLU A CD    1 
ATOM 1392  O OE1   . GLU A 1 204 ? 7.728   -41.518  -115.178 1.00 97.38  ? 201 GLU A OE1   1 
ATOM 1393  O OE2   . GLU A 1 204 ? 5.814   -40.729  -114.444 1.00 86.92  ? 201 GLU A OE2   1 
ATOM 1394  N N     . GLU A 1 205 ? 3.747   -43.967  -117.784 1.00 85.30  ? 202 GLU A N     1 
ATOM 1395  C CA    . GLU A 1 205 ? 2.299   -43.974  -117.626 1.00 87.80  ? 202 GLU A CA    1 
ATOM 1396  C C     . GLU A 1 205 ? 1.855   -45.094  -116.694 1.00 82.16  ? 202 GLU A C     1 
ATOM 1397  O O     . GLU A 1 205 ? 1.094   -44.863  -115.745 1.00 78.60  ? 202 GLU A O     1 
ATOM 1398  C CB    . GLU A 1 205 ? 1.631   -44.125  -118.994 1.00 87.39  ? 202 GLU A CB    1 
ATOM 1399  C CG    . GLU A 1 205 ? 0.114   -44.199  -118.940 1.00 97.36  ? 202 GLU A CG    1 
ATOM 1400  C CD    . GLU A 1 205 ? -0.509  -44.415  -120.304 1.00 107.09 ? 202 GLU A CD    1 
ATOM 1401  O OE1   . GLU A 1 205 ? -0.047  -45.318  -121.034 1.00 107.67 ? 202 GLU A OE1   1 
ATOM 1402  O OE2   . GLU A 1 205 ? -1.464  -43.686  -120.647 1.00 110.73 ? 202 GLU A OE2   1 
ATOM 1403  N N     . ALA A 1 206 ? 2.310   -46.320  -116.963 1.00 79.78  ? 203 ALA A N     1 
ATOM 1404  C CA    . ALA A 1 206 ? 1.947   -47.445  -116.104 1.00 79.58  ? 203 ALA A CA    1 
ATOM 1405  C C     . ALA A 1 206 ? 2.405   -47.226  -114.663 1.00 80.78  ? 203 ALA A C     1 
ATOM 1406  O O     . ALA A 1 206 ? 1.686   -47.569  -113.711 1.00 78.08  ? 203 ALA A O     1 
ATOM 1407  C CB    . ALA A 1 206 ? 2.536   -48.738  -116.666 1.00 76.49  ? 203 ALA A CB    1 
ATOM 1408  N N     . ARG A 1 207 ? 3.566   -46.592  -114.476 1.00 78.74  ? 204 ARG A N     1 
ATOM 1409  C CA    . ARG A 1 207 ? 4.055   -46.387  -113.117 1.00 75.32  ? 204 ARG A CA    1 
ATOM 1410  C C     . ARG A 1 207 ? 3.270   -45.285  -112.419 1.00 74.16  ? 204 ARG A C     1 
ATOM 1411  O O     . ARG A 1 207 ? 3.014   -45.370  -111.212 1.00 81.29  ? 204 ARG A O     1 
ATOM 1412  C CB    . ARG A 1 207 ? 5.551   -46.079  -113.118 1.00 73.73  ? 204 ARG A CB    1 
ATOM 1413  C CG    . ARG A 1 207 ? 6.122   -45.942  -111.714 1.00 71.57  ? 204 ARG A CG    1 
ATOM 1414  C CD    . ARG A 1 207 ? 7.590   -45.580  -111.734 1.00 71.49  ? 204 ARG A CD    1 
ATOM 1415  N NE    . ARG A 1 207 ? 8.332   -46.319  -112.748 1.00 74.03  ? 204 ARG A NE    1 
ATOM 1416  C CZ    . ARG A 1 207 ? 8.947   -45.749  -113.777 1.00 69.54  ? 204 ARG A CZ    1 
ATOM 1417  N NH1   . ARG A 1 207 ? 8.898   -44.433  -113.934 1.00 75.79  ? 204 ARG A NH1   1 
ATOM 1418  N NH2   . ARG A 1 207 ? 9.606   -46.492  -114.652 1.00 67.67  ? 204 ARG A NH2   1 
ATOM 1419  N N     . TYR A 1 208 ? 2.918   -44.221  -113.150 1.00 80.61  ? 205 TYR A N     1 
ATOM 1420  C CA    . TYR A 1 208 ? 2.050   -43.191  -112.592 1.00 78.59  ? 205 TYR A CA    1 
ATOM 1421  C C     . TYR A 1 208 ? 0.726   -43.803  -112.154 1.00 83.31  ? 205 TYR A C     1 
ATOM 1422  O O     . TYR A 1 208 ? 0.167   -43.424  -111.118 1.00 80.69  ? 205 TYR A O     1 
ATOM 1423  C CB    . TYR A 1 208 ? 1.791   -42.094  -113.627 1.00 79.64  ? 205 TYR A CB    1 
ATOM 1424  C CG    . TYR A 1 208 ? 1.012   -40.916  -113.084 1.00 82.30  ? 205 TYR A CG    1 
ATOM 1425  C CD1   . TYR A 1 208 ? 1.241   -40.441  -111.798 1.00 90.68  ? 205 TYR A CD1   1 
ATOM 1426  C CD2   . TYR A 1 208 ? -0.010  -40.335  -113.821 1.00 89.09  ? 205 TYR A CD2   1 
ATOM 1427  C CE1   . TYR A 1 208 ? 0.527   -39.370  -111.290 1.00 94.09  ? 205 TYR A CE1   1 
ATOM 1428  C CE2   . TYR A 1 208 ? -0.744  -39.273  -113.313 1.00 99.22  ? 205 TYR A CE2   1 
ATOM 1429  C CZ    . TYR A 1 208 ? -0.471  -38.797  -112.046 1.00 94.11  ? 205 TYR A CZ    1 
ATOM 1430  O OH    . TYR A 1 208 ? -1.192  -37.742  -111.535 1.00 84.25  ? 205 TYR A OH    1 
ATOM 1431  N N     . ASN A 1 209 ? 0.204   -44.751  -112.942 1.00 90.24  ? 206 ASN A N     1 
ATOM 1432  C CA    . ASN A 1 209 ? -1.021  -45.444  -112.559 1.00 91.99  ? 206 ASN A CA    1 
ATOM 1433  C C     . ASN A 1 209 ? -0.797  -46.454  -111.443 1.00 96.27  ? 206 ASN A C     1 
ATOM 1434  O O     . ASN A 1 209 ? -1.778  -46.953  -110.881 1.00 100.56 ? 206 ASN A O     1 
ATOM 1435  C CB    . ASN A 1 209 ? -1.643  -46.162  -113.765 1.00 90.08  ? 206 ASN A CB    1 
ATOM 1436  C CG    . ASN A 1 209 ? -1.881  -45.238  -114.948 1.00 91.36  ? 206 ASN A CG    1 
ATOM 1437  O OD1   . ASN A 1 209 ? -1.512  -45.553  -116.080 1.00 97.50  ? 206 ASN A OD1   1 
ATOM 1438  N ND2   . ASN A 1 209 ? -2.517  -44.100  -114.694 1.00 89.25  ? 206 ASN A ND2   1 
ATOM 1439  N N     . SER A 1 210 ? 0.457   -46.748  -111.095 1.00 97.10  ? 207 SER A N     1 
ATOM 1440  C CA    . SER A 1 210 ? 0.739   -47.688  -110.017 1.00 92.93  ? 207 SER A CA    1 
ATOM 1441  C C     . SER A 1 210 ? 0.757   -47.046  -108.634 1.00 94.96  ? 207 SER A C     1 
ATOM 1442  O O     . SER A 1 210 ? 0.806   -47.776  -107.637 1.00 103.53 ? 207 SER A O     1 
ATOM 1443  C CB    . SER A 1 210 ? 2.084   -48.384  -110.254 1.00 92.87  ? 207 SER A CB    1 
ATOM 1444  O OG    . SER A 1 210 ? 2.296   -49.419  -109.310 1.00 101.49 ? 207 SER A OG    1 
ATOM 1445  N N     . CYS A 1 211 ? 0.721   -45.719  -108.536 1.00 85.02  ? 208 CYS A N     1 
ATOM 1446  C CA    . CYS A 1 211 ? 0.848   -45.077  -107.228 1.00 86.58  ? 208 CYS A CA    1 
ATOM 1447  C C     . CYS A 1 211 ? -0.510  -44.800  -106.587 1.00 92.42  ? 208 CYS A C     1 
ATOM 1448  O O     . CYS A 1 211 ? -1.555  -45.045  -107.190 1.00 98.77  ? 208 CYS A O     1 
ATOM 1449  C CB    . CYS A 1 211 ? 1.629   -43.765  -107.350 1.00 83.16  ? 208 CYS A CB    1 
ATOM 1450  S SG    . CYS A 1 211 ? 3.240   -43.901  -108.162 1.00 90.53  ? 208 CYS A SG    1 
ATOM 1451  N N     . CYS B 1 28  ? 6.666   -49.822  -98.735  1.00 103.17 ? 25  CYS B N     1 
ATOM 1452  C CA    . CYS B 1 28  ? 7.839   -48.988  -98.981  1.00 92.14  ? 25  CYS B CA    1 
ATOM 1453  C C     . CYS B 1 28  ? 8.759   -49.614  -100.026 1.00 86.51  ? 25  CYS B C     1 
ATOM 1454  O O     . CYS B 1 28  ? 8.316   -50.404  -100.861 1.00 86.32  ? 25  CYS B O     1 
ATOM 1455  C CB    . CYS B 1 28  ? 8.611   -48.750  -97.681  1.00 83.39  ? 25  CYS B CB    1 
ATOM 1456  S SG    . CYS B 1 28  ? 9.287   -50.244  -96.915  1.00 97.67  ? 25  CYS B SG    1 
ATOM 1457  N N     . PHE B 1 29  ? 10.044  -49.274  -99.967  1.00 71.81  ? 26  PHE B N     1 
ATOM 1458  C CA    . PHE B 1 29  ? 10.998  -49.816  -100.923 1.00 62.25  ? 26  PHE B CA    1 
ATOM 1459  C C     . PHE B 1 29  ? 11.346  -51.246  -100.540 1.00 53.39  ? 26  PHE B C     1 
ATOM 1460  O O     . PHE B 1 29  ? 11.491  -51.571  -99.359  1.00 61.66  ? 26  PHE B O     1 
ATOM 1461  C CB    . PHE B 1 29  ? 12.262  -48.959  -100.975 1.00 52.72  ? 26  PHE B CB    1 
ATOM 1462  C CG    . PHE B 1 29  ? 13.105  -49.205  -102.192 1.00 56.67  ? 26  PHE B CG    1 
ATOM 1463  C CD1   . PHE B 1 29  ? 12.877  -48.492  -103.356 1.00 57.76  ? 26  PHE B CD1   1 
ATOM 1464  C CD2   . PHE B 1 29  ? 14.115  -50.150  -102.179 1.00 53.01  ? 26  PHE B CD2   1 
ATOM 1465  C CE1   . PHE B 1 29  ? 13.643  -48.713  -104.483 1.00 45.48  ? 26  PHE B CE1   1 
ATOM 1466  C CE2   . PHE B 1 29  ? 14.885  -50.375  -103.305 1.00 50.62  ? 26  PHE B CE2   1 
ATOM 1467  C CZ    . PHE B 1 29  ? 14.647  -49.655  -104.458 1.00 44.93  ? 26  PHE B CZ    1 
ATOM 1468  N N     . GLY B 1 30  ? 11.469  -52.104  -101.550 1.00 63.48  ? 27  GLY B N     1 
ATOM 1469  C CA    . GLY B 1 30  ? 11.639  -53.522  -101.328 1.00 51.79  ? 27  GLY B CA    1 
ATOM 1470  C C     . GLY B 1 30  ? 10.357  -54.271  -101.039 1.00 62.86  ? 27  GLY B C     1 
ATOM 1471  O O     . GLY B 1 30  ? 10.378  -55.508  -100.996 1.00 67.86  ? 27  GLY B O     1 
ATOM 1472  N N     . GLN B 1 31  ? 9.243   -53.564  -100.840 1.00 71.77  ? 28  GLN B N     1 
ATOM 1473  C CA    . GLN B 1 31  ? 7.944   -54.167  -100.569 1.00 79.28  ? 28  GLN B CA    1 
ATOM 1474  C C     . GLN B 1 31  ? 6.957   -54.050  -101.717 1.00 78.57  ? 28  GLN B C     1 
ATOM 1475  O O     . GLN B 1 31  ? 6.090   -54.917  -101.855 1.00 77.71  ? 28  GLN B O     1 
ATOM 1476  C CB    . GLN B 1 31  ? 7.311   -53.536  -99.323  1.00 85.04  ? 28  GLN B CB    1 
ATOM 1477  C CG    . GLN B 1 31  ? 8.272   -53.341  -98.171  1.00 83.32  ? 28  GLN B CG    1 
ATOM 1478  C CD    . GLN B 1 31  ? 8.327   -54.543  -97.256  1.00 93.87  ? 28  GLN B CD    1 
ATOM 1479  O OE1   . GLN B 1 31  ? 8.639   -55.653  -97.687  1.00 92.77  ? 28  GLN B OE1   1 
ATOM 1480  N NE2   . GLN B 1 31  ? 8.019   -54.329  -95.982  1.00 105.55 ? 28  GLN B NE2   1 
ATOM 1481  N N     . CYS B 1 32  ? 7.041   -52.988  -102.517 1.00 70.90  ? 29  CYS B N     1 
ATOM 1482  C CA    . CYS B 1 32  ? 6.098   -52.793  -103.610 1.00 74.18  ? 29  CYS B CA    1 
ATOM 1483  C C     . CYS B 1 32  ? 6.162   -53.966  -104.576 1.00 76.45  ? 29  CYS B C     1 
ATOM 1484  O O     . CYS B 1 32  ? 7.245   -54.394  -104.977 1.00 74.57  ? 29  CYS B O     1 
ATOM 1485  C CB    . CYS B 1 32  ? 6.415   -51.495  -104.353 1.00 56.72  ? 29  CYS B CB    1 
ATOM 1486  S SG    . CYS B 1 32  ? 6.236   -49.990  -103.380 1.00 100.49 ? 29  CYS B SG    1 
ATOM 1487  N N     . GLN B 1 33  ? 5.001   -54.481  -104.963 1.00 79.25  ? 30  GLN B N     1 
ATOM 1488  C CA    . GLN B 1 33  ? 4.927   -55.513  -105.985 1.00 82.26  ? 30  GLN B CA    1 
ATOM 1489  C C     . GLN B 1 33  ? 4.514   -54.859  -107.295 1.00 84.57  ? 30  GLN B C     1 
ATOM 1490  O O     . GLN B 1 33  ? 3.595   -54.034  -107.321 1.00 84.19  ? 30  GLN B O     1 
ATOM 1491  C CB    . GLN B 1 33  ? 3.946   -56.619  -105.591 1.00 79.35  ? 30  GLN B CB    1 
ATOM 1492  C CG    . GLN B 1 33  ? 4.585   -57.722  -104.758 1.00 93.94  ? 30  GLN B CG    1 
ATOM 1493  C CD    . GLN B 1 33  ? 3.610   -58.825  -104.388 1.00 112.91 ? 30  GLN B CD    1 
ATOM 1494  O OE1   . GLN B 1 33  ? 2.955   -59.410  -105.253 1.00 118.02 ? 30  GLN B OE1   1 
ATOM 1495  N NE2   . GLN B 1 33  ? 3.517   -59.123  -103.095 1.00 103.38 ? 30  GLN B NE2   1 
ATOM 1496  N N     . TYR B 1 34  ? 5.199   -55.225  -108.374 1.00 77.42  ? 31  TYR B N     1 
ATOM 1497  C CA    . TYR B 1 34  ? 4.944   -54.596  -109.662 1.00 70.60  ? 31  TYR B CA    1 
ATOM 1498  C C     . TYR B 1 34  ? 3.544   -54.929  -110.156 1.00 76.61  ? 31  TYR B C     1 
ATOM 1499  O O     . TYR B 1 34  ? 3.129   -56.093  -110.161 1.00 79.65  ? 31  TYR B O     1 
ATOM 1500  C CB    . TYR B 1 34  ? 5.990   -55.035  -110.686 1.00 70.74  ? 31  TYR B CB    1 
ATOM 1501  C CG    . TYR B 1 34  ? 7.239   -54.189  -110.654 1.00 60.72  ? 31  TYR B CG    1 
ATOM 1502  C CD1   . TYR B 1 34  ? 7.214   -52.865  -111.072 1.00 57.27  ? 31  TYR B CD1   1 
ATOM 1503  C CD2   . TYR B 1 34  ? 8.439   -54.705  -110.184 1.00 63.08  ? 31  TYR B CD2   1 
ATOM 1504  C CE1   . TYR B 1 34  ? 8.351   -52.084  -111.035 1.00 65.23  ? 31  TYR B CE1   1 
ATOM 1505  C CE2   . TYR B 1 34  ? 9.584   -53.929  -110.143 1.00 57.06  ? 31  TYR B CE2   1 
ATOM 1506  C CZ    . TYR B 1 34  ? 9.532   -52.619  -110.569 1.00 65.01  ? 31  TYR B CZ    1 
ATOM 1507  O OH    . TYR B 1 34  ? 10.666  -51.839  -110.531 1.00 62.00  ? 31  TYR B OH    1 
ATOM 1508  N N     . THR B 1 35  ? 2.819   -53.896  -110.574 1.00 83.19  ? 32  THR B N     1 
ATOM 1509  C CA    . THR B 1 35  ? 1.523   -54.080  -111.199 1.00 72.52  ? 32  THR B CA    1 
ATOM 1510  C C     . THR B 1 35  ? 1.700   -54.599  -112.621 1.00 73.22  ? 32  THR B C     1 
ATOM 1511  O O     . THR B 1 35  ? 2.764   -54.463  -113.232 1.00 75.15  ? 32  THR B O     1 
ATOM 1512  C CB    . THR B 1 35  ? 0.737   -52.768  -111.210 1.00 76.79  ? 32  THR B CB    1 
ATOM 1513  O OG1   . THR B 1 35  ? 1.537   -51.732  -111.794 1.00 84.42  ? 32  THR B OG1   1 
ATOM 1514  C CG2   . THR B 1 35  ? 0.353   -52.362  -109.795 1.00 83.44  ? 32  THR B CG2   1 
ATOM 1515  N N     . ALA B 1 36  ? 0.642   -55.231  -113.134 1.00 77.48  ? 33  ALA B N     1 
ATOM 1516  C CA    . ALA B 1 36  ? 0.704   -55.843  -114.458 1.00 80.54  ? 33  ALA B CA    1 
ATOM 1517  C C     . ALA B 1 36  ? 1.110   -54.835  -115.529 1.00 81.00  ? 33  ALA B C     1 
ATOM 1518  O O     . ALA B 1 36  ? 1.958   -55.130  -116.378 1.00 77.57  ? 33  ALA B O     1 
ATOM 1519  C CB    . ALA B 1 36  ? -0.643  -56.476  -114.802 1.00 81.80  ? 33  ALA B CB    1 
ATOM 1520  N N     . GLU B 1 37  ? 0.527   -53.636  -115.494 1.00 75.55  ? 34  GLU B N     1 
ATOM 1521  C CA    . GLU B 1 37  ? 0.839   -52.629  -116.505 1.00 78.56  ? 34  GLU B CA    1 
ATOM 1522  C C     . GLU B 1 37  ? 2.301   -52.209  -116.430 1.00 77.93  ? 34  GLU B C     1 
ATOM 1523  O O     . GLU B 1 37  ? 2.990   -52.133  -117.457 1.00 75.15  ? 34  GLU B O     1 
ATOM 1524  C CB    . GLU B 1 37  ? -0.078  -51.416  -116.340 1.00 86.99  ? 34  GLU B CB    1 
ATOM 1525  C CG    . GLU B 1 37  ? -1.554  -51.747  -116.131 1.00 87.92  ? 34  GLU B CG    1 
ATOM 1526  C CD    . GLU B 1 37  ? -1.935  -51.786  -114.661 1.00 100.05 ? 34  GLU B CD    1 
ATOM 1527  O OE1   . GLU B 1 37  ? -1.459  -50.912  -113.903 1.00 104.27 ? 34  GLU B OE1   1 
ATOM 1528  O OE2   . GLU B 1 37  ? -2.721  -52.677  -114.267 1.00 91.51  ? 34  GLU B OE2   1 
ATOM 1529  N N     . GLU B 1 38  ? 2.798   -51.936  -115.218 1.00 80.60  ? 35  GLU B N     1 
ATOM 1530  C CA    . GLU B 1 38  ? 4.180   -51.493  -115.068 1.00 78.47  ? 35  GLU B CA    1 
ATOM 1531  C C     . GLU B 1 38  ? 5.157   -52.617  -115.386 1.00 73.75  ? 35  GLU B C     1 
ATOM 1532  O O     . GLU B 1 38  ? 6.183   -52.385  -116.041 1.00 63.37  ? 35  GLU B O     1 
ATOM 1533  C CB    . GLU B 1 38  ? 4.417   -50.957  -113.655 1.00 71.01  ? 35  GLU B CB    1 
ATOM 1534  C CG    . GLU B 1 38  ? 5.809   -50.376  -113.449 1.00 72.88  ? 35  GLU B CG    1 
ATOM 1535  C CD    . GLU B 1 38  ? 6.012   -49.769  -112.070 1.00 72.40  ? 35  GLU B CD    1 
ATOM 1536  O OE1   . GLU B 1 38  ? 7.036   -49.079  -111.878 1.00 64.37  ? 35  GLU B OE1   1 
ATOM 1537  O OE2   . GLU B 1 38  ? 5.149   -49.968  -111.187 1.00 64.09  ? 35  GLU B OE2   1 
ATOM 1538  N N     . TYR B 1 39  ? 4.856   -53.839  -114.937 1.00 68.87  ? 36  TYR B N     1 
ATOM 1539  C CA    . TYR B 1 39  ? 5.687   -54.974  -115.319 1.00 64.68  ? 36  TYR B CA    1 
ATOM 1540  C C     . TYR B 1 39  ? 5.763   -55.084  -116.835 1.00 74.25  ? 36  TYR B C     1 
ATOM 1541  O O     . TYR B 1 39  ? 6.841   -55.297  -117.398 1.00 74.93  ? 36  TYR B O     1 
ATOM 1542  C CB    . TYR B 1 39  ? 5.164   -56.286  -114.732 1.00 68.56  ? 36  TYR B CB    1 
ATOM 1543  C CG    . TYR B 1 39  ? 5.699   -57.469  -115.517 1.00 69.54  ? 36  TYR B CG    1 
ATOM 1544  C CD1   . TYR B 1 39  ? 7.031   -57.845  -115.406 1.00 66.78  ? 36  TYR B CD1   1 
ATOM 1545  C CD2   . TYR B 1 39  ? 4.894   -58.174  -116.404 1.00 67.63  ? 36  TYR B CD2   1 
ATOM 1546  C CE1   . TYR B 1 39  ? 7.544   -58.901  -116.132 1.00 65.59  ? 36  TYR B CE1   1 
ATOM 1547  C CE2   . TYR B 1 39  ? 5.400   -59.235  -117.137 1.00 80.41  ? 36  TYR B CE2   1 
ATOM 1548  C CZ    . TYR B 1 39  ? 6.724   -59.593  -116.995 1.00 77.06  ? 36  TYR B CZ    1 
ATOM 1549  O OH    . TYR B 1 39  ? 7.231   -60.645  -117.723 1.00 81.55  ? 36  TYR B OH    1 
ATOM 1550  N N     . GLN B 1 40  ? 4.617   -54.972  -117.511 1.00 74.43  ? 37  GLN B N     1 
ATOM 1551  C CA    . GLN B 1 40  ? 4.590   -55.165  -118.958 1.00 71.27  ? 37  GLN B CA    1 
ATOM 1552  C C     . GLN B 1 40  ? 5.398   -54.079  -119.665 1.00 64.48  ? 37  GLN B C     1 
ATOM 1553  O O     . GLN B 1 40  ? 6.236   -54.372  -120.531 1.00 57.56  ? 37  GLN B O     1 
ATOM 1554  C CB    . GLN B 1 40  ? 3.138   -55.152  -119.447 1.00 79.69  ? 37  GLN B CB    1 
ATOM 1555  C CG    . GLN B 1 40  ? 2.937   -55.545  -120.910 1.00 89.14  ? 37  GLN B CG    1 
ATOM 1556  C CD    . GLN B 1 40  ? 1.548   -55.184  -121.416 1.00 91.73  ? 37  GLN B CD    1 
ATOM 1557  O OE1   . GLN B 1 40  ? 0.928   -55.920  -122.184 1.00 106.79 ? 37  GLN B OE1   1 
ATOM 1558  N NE2   . GLN B 1 40  ? 1.073   -54.010  -121.011 1.00 87.53  ? 37  GLN B NE2   1 
ATOM 1559  N N     . ALA B 1 41  ? 5.186   -52.817  -119.274 1.00 56.02  ? 38  ALA B N     1 
ATOM 1560  C CA    . ALA B 1 41  ? 5.940   -51.702  -119.845 1.00 60.38  ? 38  ALA B CA    1 
ATOM 1561  C C     . ALA B 1 41  ? 7.442   -51.890  -119.669 1.00 66.69  ? 38  ALA B C     1 
ATOM 1562  O O     . ALA B 1 41  ? 8.214   -51.737  -120.623 1.00 63.77  ? 38  ALA B O     1 
ATOM 1563  C CB    . ALA B 1 41  ? 5.484   -50.389  -119.212 1.00 67.69  ? 38  ALA B CB    1 
ATOM 1564  N N     . ILE B 1 42  ? 7.880   -52.218  -118.449 1.00 72.10  ? 39  ILE B N     1 
ATOM 1565  C CA    . ILE B 1 42  ? 9.312   -52.316  -118.187 1.00 69.36  ? 39  ILE B CA    1 
ATOM 1566  C C     . ILE B 1 42  ? 9.913   -53.521  -118.904 1.00 63.88  ? 39  ILE B C     1 
ATOM 1567  O O     . ILE B 1 42  ? 10.999  -53.432  -119.488 1.00 55.58  ? 39  ILE B O     1 
ATOM 1568  C CB    . ILE B 1 42  ? 9.567   -52.374  -116.670 1.00 61.77  ? 39  ILE B CB    1 
ATOM 1569  C CG1   . ILE B 1 42  ? 9.283   -51.014  -116.035 1.00 60.43  ? 39  ILE B CG1   1 
ATOM 1570  C CG2   . ILE B 1 42  ? 11.007  -52.758  -116.388 1.00 61.24  ? 39  ILE B CG2   1 
ATOM 1571  C CD1   . ILE B 1 42  ? 9.309   -51.031  -114.526 1.00 64.79  ? 39  ILE B CD1   1 
ATOM 1572  N N     . GLN B 1 43  ? 9.230   -54.668  -118.859 1.00 62.53  ? 40  GLN B N     1 
ATOM 1573  C CA    . GLN B 1 43  ? 9.730   -55.857  -119.538 1.00 62.26  ? 40  GLN B CA    1 
ATOM 1574  C C     . GLN B 1 43  ? 9.891   -55.617  -121.034 1.00 69.04  ? 40  GLN B C     1 
ATOM 1575  O O     . GLN B 1 43  ? 10.907  -56.006  -121.623 1.00 65.98  ? 40  GLN B O     1 
ATOM 1576  C CB    . GLN B 1 43  ? 8.796   -57.038  -119.276 1.00 62.48  ? 40  GLN B CB    1 
ATOM 1577  C CG    . GLN B 1 43  ? 9.140   -58.304  -120.046 1.00 72.37  ? 40  GLN B CG    1 
ATOM 1578  C CD    . GLN B 1 43  ? 10.378  -58.999  -119.508 1.00 75.53  ? 40  GLN B CD    1 
ATOM 1579  O OE1   . GLN B 1 43  ? 10.282  -59.972  -118.761 1.00 65.24  ? 40  GLN B OE1   1 
ATOM 1580  N NE2   . GLN B 1 43  ? 11.551  -58.505  -119.893 1.00 79.71  ? 40  GLN B NE2   1 
ATOM 1581  N N     . LYS B 1 44  ? 8.909   -54.970  -121.669 1.00 69.32  ? 41  LYS B N     1 
ATOM 1582  C CA    . LYS B 1 44  ? 9.047   -54.663  -123.090 1.00 64.01  ? 41  LYS B CA    1 
ATOM 1583  C C     . LYS B 1 44  ? 10.165  -53.653  -123.329 1.00 58.87  ? 41  LYS B C     1 
ATOM 1584  O O     . LYS B 1 44  ? 11.005  -53.844  -124.217 1.00 68.30  ? 41  LYS B O     1 
ATOM 1585  C CB    . LYS B 1 44  ? 7.720   -54.156  -123.658 1.00 68.32  ? 41  LYS B CB    1 
ATOM 1586  C CG    . LYS B 1 44  ? 6.678   -55.253  -123.845 1.00 73.45  ? 41  LYS B CG    1 
ATOM 1587  C CD    . LYS B 1 44  ? 5.416   -54.721  -124.503 1.00 74.40  ? 41  LYS B CD    1 
ATOM 1588  C CE    . LYS B 1 44  ? 4.315   -55.767  -124.525 1.00 91.38  ? 41  LYS B CE    1 
ATOM 1589  N NZ    . LYS B 1 44  ? 4.607   -56.862  -125.490 1.00 106.53 ? 41  LYS B NZ    1 
ATOM 1590  N N     . ALA B 1 45  ? 10.195  -52.573  -122.542 1.00 61.03  ? 42  ALA B N     1 
ATOM 1591  C CA    . ALA B 1 45  ? 11.165  -51.506  -122.763 1.00 64.59  ? 42  ALA B CA    1 
ATOM 1592  C C     . ALA B 1 45  ? 12.603  -51.977  -122.585 1.00 67.23  ? 42  ALA B C     1 
ATOM 1593  O O     . ALA B 1 45  ? 13.495  -51.507  -123.298 1.00 71.72  ? 42  ALA B O     1 
ATOM 1594  C CB    . ALA B 1 45  ? 10.872  -50.337  -121.822 1.00 58.54  ? 42  ALA B CB    1 
ATOM 1595  N N     . LEU B 1 46  ? 12.848  -52.910  -121.660 1.00 67.69  ? 43  LEU B N     1 
ATOM 1596  C CA    . LEU B 1 46  ? 14.213  -53.344  -121.383 1.00 65.05  ? 43  LEU B CA    1 
ATOM 1597  C C     . LEU B 1 46  ? 14.834  -54.133  -122.530 1.00 70.90  ? 43  LEU B C     1 
ATOM 1598  O O     . LEU B 1 46  ? 16.061  -54.268  -122.575 1.00 65.08  ? 43  LEU B O     1 
ATOM 1599  C CB    . LEU B 1 46  ? 14.248  -54.179  -120.102 1.00 66.41  ? 43  LEU B CB    1 
ATOM 1600  C CG    . LEU B 1 46  ? 14.196  -53.410  -118.780 1.00 67.37  ? 43  LEU B CG    1 
ATOM 1601  C CD1   . LEU B 1 46  ? 14.018  -54.368  -117.622 1.00 55.79  ? 43  LEU B CD1   1 
ATOM 1602  C CD2   . LEU B 1 46  ? 15.441  -52.555  -118.587 1.00 63.44  ? 43  LEU B CD2   1 
ATOM 1603  N N     . ARG B 1 47  ? 14.022  -54.670  -123.445 1.00 67.65  ? 44  ARG B N     1 
ATOM 1604  C CA    . ARG B 1 47  ? 14.571  -55.403  -124.582 1.00 65.89  ? 44  ARG B CA    1 
ATOM 1605  C C     . ARG B 1 47  ? 15.229  -54.473  -125.594 1.00 65.37  ? 44  ARG B C     1 
ATOM 1606  O O     . ARG B 1 47  ? 16.137  -54.897  -126.321 1.00 68.81  ? 44  ARG B O     1 
ATOM 1607  C CB    . ARG B 1 47  ? 13.477  -56.227  -125.258 1.00 55.85  ? 44  ARG B CB    1 
ATOM 1608  C CG    . ARG B 1 47  ? 13.226  -57.574  -124.603 1.00 56.80  ? 44  ARG B CG    1 
ATOM 1609  C CD    . ARG B 1 47  ? 12.176  -58.363  -125.363 1.00 49.18  ? 44  ARG B CD    1 
ATOM 1610  N NE    . ARG B 1 47  ? 10.826  -57.989  -124.955 1.00 49.59  ? 44  ARG B NE    1 
ATOM 1611  C CZ    . ARG B 1 47  ? 10.036  -58.731  -124.183 1.00 64.43  ? 44  ARG B CZ    1 
ATOM 1612  N NH1   . ARG B 1 47  ? 10.452  -59.905  -123.728 1.00 61.92  ? 44  ARG B NH1   1 
ATOM 1613  N NH2   . ARG B 1 47  ? 8.824   -58.296  -123.869 1.00 65.83  ? 44  ARG B NH2   1 
ATOM 1614  N N     . GLN B 1 48  ? 14.778  -53.219  -125.663 1.00 54.97  ? 45  GLN B N     1 
ATOM 1615  C CA    . GLN B 1 48  ? 15.285  -52.270  -126.648 1.00 60.64  ? 45  GLN B CA    1 
ATOM 1616  C C     . GLN B 1 48  ? 16.804  -52.187  -126.597 1.00 59.37  ? 45  GLN B C     1 
ATOM 1617  O O     . GLN B 1 48  ? 17.398  -52.050  -125.525 1.00 71.55  ? 45  GLN B O     1 
ATOM 1618  C CB    . GLN B 1 48  ? 14.676  -50.887  -126.397 1.00 63.67  ? 45  GLN B CB    1 
ATOM 1619  C CG    . GLN B 1 48  ? 13.156  -50.848  -126.467 1.00 62.30  ? 45  GLN B CG    1 
ATOM 1620  C CD    . GLN B 1 48  ? 12.573  -49.497  -126.082 1.00 67.64  ? 45  GLN B CD    1 
ATOM 1621  O OE1   . GLN B 1 48  ? 13.250  -48.655  -125.487 1.00 77.88  ? 45  GLN B OE1   1 
ATOM 1622  N NE2   . GLN B 1 48  ? 11.306  -49.285  -126.424 1.00 69.90  ? 45  GLN B NE2   1 
ATOM 1623  N N     . ARG B 1 49  ? 17.432  -52.285  -127.763 1.00 59.81  ? 46  ARG B N     1 
ATOM 1624  C CA    . ARG B 1 49  ? 18.843  -51.961  -127.855 1.00 66.75  ? 46  ARG B CA    1 
ATOM 1625  C C     . ARG B 1 49  ? 19.025  -50.449  -127.937 1.00 72.29  ? 46  ARG B C     1 
ATOM 1626  O O     . ARG B 1 49  ? 18.103  -49.703  -128.278 1.00 75.64  ? 46  ARG B O     1 
ATOM 1627  C CB    . ARG B 1 49  ? 19.475  -52.654  -129.061 1.00 65.90  ? 46  ARG B CB    1 
ATOM 1628  C CG    . ARG B 1 49  ? 19.406  -54.171  -128.983 1.00 58.61  ? 46  ARG B CG    1 
ATOM 1629  C CD    . ARG B 1 49  ? 20.056  -54.830  -130.184 1.00 74.54  ? 46  ARG B CD    1 
ATOM 1630  N NE    . ARG B 1 49  ? 20.241  -56.265  -129.984 1.00 86.73  ? 46  ARG B NE    1 
ATOM 1631  C CZ    . ARG B 1 49  ? 19.329  -57.183  -130.287 1.00 88.59  ? 46  ARG B CZ    1 
ATOM 1632  N NH1   . ARG B 1 49  ? 18.163  -56.816  -130.801 1.00 85.69  ? 46  ARG B NH1   1 
ATOM 1633  N NH2   . ARG B 1 49  ? 19.582  -58.468  -130.074 1.00 80.77  ? 46  ARG B NH2   1 
ATOM 1634  N N     . LEU B 1 50  ? 20.232  -49.997  -127.617 1.00 62.33  ? 47  LEU B N     1 
ATOM 1635  C CA    . LEU B 1 50  ? 20.506  -48.570  -127.547 1.00 74.47  ? 47  LEU B CA    1 
ATOM 1636  C C     . LEU B 1 50  ? 21.007  -48.048  -128.888 1.00 81.87  ? 47  LEU B C     1 
ATOM 1637  O O     . LEU B 1 50  ? 21.800  -48.704  -129.569 1.00 85.92  ? 47  LEU B O     1 
ATOM 1638  C CB    . LEU B 1 50  ? 21.520  -48.279  -126.439 1.00 78.39  ? 47  LEU B CB    1 
ATOM 1639  C CG    . LEU B 1 50  ? 20.945  -48.494  -125.034 1.00 68.61  ? 47  LEU B CG    1 
ATOM 1640  C CD1   . LEU B 1 50  ? 21.994  -48.262  -123.958 1.00 67.65  ? 47  LEU B CD1   1 
ATOM 1641  C CD2   . LEU B 1 50  ? 19.721  -47.617  -124.799 1.00 67.44  ? 47  LEU B CD2   1 
ATOM 1642  N N     . GLY B 1 51  ? 20.519  -46.866  -129.267 1.00 78.17  ? 48  GLY B N     1 
ATOM 1643  C CA    . GLY B 1 51  ? 20.974  -46.177  -130.452 1.00 79.60  ? 48  GLY B CA    1 
ATOM 1644  C C     . GLY B 1 51  ? 22.372  -45.606  -130.313 1.00 82.95  ? 48  GLY B C     1 
ATOM 1645  O O     . GLY B 1 51  ? 22.977  -45.639  -129.236 1.00 84.29  ? 48  GLY B O     1 
ATOM 1646  N N     . PRO B 1 52  ? 22.916  -45.063  -131.408 1.00 84.21  ? 49  PRO B N     1 
ATOM 1647  C CA    . PRO B 1 52  ? 24.285  -44.522  -131.358 1.00 83.32  ? 49  PRO B CA    1 
ATOM 1648  C C     . PRO B 1 52  ? 24.429  -43.310  -130.454 1.00 85.48  ? 49  PRO B C     1 
ATOM 1649  O O     . PRO B 1 52  ? 25.565  -42.934  -130.135 1.00 87.24  ? 49  PRO B O     1 
ATOM 1650  C CB    . PRO B 1 52  ? 24.578  -44.150  -132.820 1.00 92.07  ? 49  PRO B CB    1 
ATOM 1651  C CG    . PRO B 1 52  ? 23.513  -44.811  -133.633 1.00 89.35  ? 49  PRO B CG    1 
ATOM 1652  C CD    . PRO B 1 52  ? 22.320  -44.958  -132.749 1.00 83.46  ? 49  PRO B CD    1 
ATOM 1653  N N     . GLU B 1 53  ? 23.321  -42.693  -130.033 1.00 81.21  ? 50  GLU B N     1 
ATOM 1654  C CA    . GLU B 1 53  ? 23.405  -41.541  -129.142 1.00 86.07  ? 50  GLU B CA    1 
ATOM 1655  C C     . GLU B 1 53  ? 24.001  -41.915  -127.792 1.00 80.54  ? 50  GLU B C     1 
ATOM 1656  O O     . GLU B 1 53  ? 24.629  -41.073  -127.139 1.00 82.07  ? 50  GLU B O     1 
ATOM 1657  C CB    . GLU B 1 53  ? 22.023  -40.911  -128.962 1.00 90.12  ? 50  GLU B CB    1 
ATOM 1658  C CG    . GLU B 1 53  ? 21.376  -40.438  -130.258 1.00 105.28 ? 50  GLU B CG    1 
ATOM 1659  C CD    . GLU B 1 53  ? 20.561  -41.515  -130.951 1.00 102.51 ? 50  GLU B CD    1 
ATOM 1660  O OE1   . GLU B 1 53  ? 20.918  -42.708  -130.844 1.00 95.75  ? 50  GLU B OE1   1 
ATOM 1661  O OE2   . GLU B 1 53  ? 19.567  -41.160  -131.620 1.00 96.31  ? 50  GLU B OE2   1 
ATOM 1662  N N     . TYR B 1 54  ? 23.834  -43.168  -127.367 1.00 83.22  ? 51  TYR B N     1 
ATOM 1663  C CA    . TYR B 1 54  ? 24.291  -43.601  -126.053 1.00 80.62  ? 51  TYR B CA    1 
ATOM 1664  C C     . TYR B 1 54  ? 25.731  -44.082  -126.060 1.00 76.41  ? 51  TYR B C     1 
ATOM 1665  O O     . TYR B 1 54  ? 26.452  -43.884  -125.074 1.00 86.34  ? 51  TYR B O     1 
ATOM 1666  C CB    . TYR B 1 54  ? 23.412  -44.741  -125.534 1.00 71.14  ? 51  TYR B CB    1 
ATOM 1667  C CG    . TYR B 1 54  ? 21.999  -44.351  -125.184 1.00 69.55  ? 51  TYR B CG    1 
ATOM 1668  C CD1   . TYR B 1 54  ? 21.694  -43.847  -123.930 1.00 73.35  ? 51  TYR B CD1   1 
ATOM 1669  C CD2   . TYR B 1 54  ? 20.966  -44.506  -126.100 1.00 72.56  ? 51  TYR B CD2   1 
ATOM 1670  C CE1   . TYR B 1 54  ? 20.407  -43.497  -123.598 1.00 70.14  ? 51  TYR B CE1   1 
ATOM 1671  C CE2   . TYR B 1 54  ? 19.672  -44.159  -125.775 1.00 73.26  ? 51  TYR B CE2   1 
ATOM 1672  C CZ    . TYR B 1 54  ? 19.400  -43.655  -124.523 1.00 69.79  ? 51  TYR B CZ    1 
ATOM 1673  O OH    . TYR B 1 54  ? 18.116  -43.310  -124.188 1.00 71.09  ? 51  TYR B OH    1 
ATOM 1674  N N     . ILE B 1 55  ? 26.160  -44.707  -127.141 1.00 73.07  ? 52  ILE B N     1 
ATOM 1675  C CA    . ILE B 1 55  ? 27.450  -45.381  -127.172 1.00 78.31  ? 52  ILE B CA    1 
ATOM 1676  C C     . ILE B 1 55  ? 28.550  -44.367  -127.447 1.00 85.16  ? 52  ILE B C     1 
ATOM 1677  O O     . ILE B 1 55  ? 28.395  -43.458  -128.272 1.00 96.94  ? 52  ILE B O     1 
ATOM 1678  C CB    . ILE B 1 55  ? 27.436  -46.508  -128.218 1.00 67.90  ? 52  ILE B CB    1 
ATOM 1679  C CG1   . ILE B 1 55  ? 26.142  -47.318  -128.095 1.00 70.46  ? 52  ILE B CG1   1 
ATOM 1680  C CG2   . ILE B 1 55  ? 28.643  -47.415  -128.044 1.00 73.97  ? 52  ILE B CG2   1 
ATOM 1681  C CD1   . ILE B 1 55  ? 25.910  -47.907  -126.715 1.00 79.31  ? 52  ILE B CD1   1 
ATOM 1682  N N     . SER B 1 56  ? 29.666  -44.522  -126.742 1.00 79.85  ? 53  SER B N     1 
ATOM 1683  C CA    . SER B 1 56  ? 30.867  -43.729  -126.941 1.00 85.94  ? 53  SER B CA    1 
ATOM 1684  C C     . SER B 1 56  ? 32.031  -44.689  -127.137 1.00 90.07  ? 53  SER B C     1 
ATOM 1685  O O     . SER B 1 56  ? 31.891  -45.904  -126.976 1.00 91.69  ? 53  SER B O     1 
ATOM 1686  C CB    . SER B 1 56  ? 31.131  -42.785  -125.759 1.00 90.28  ? 53  SER B CB    1 
ATOM 1687  O OG    . SER B 1 56  ? 29.960  -42.072  -125.399 1.00 88.18  ? 53  SER B OG    1 
ATOM 1688  N N     . SER B 1 57  ? 33.196  -44.142  -127.474 1.00 99.59  ? 54  SER B N     1 
ATOM 1689  C CA    . SER B 1 57  ? 34.335  -44.993  -127.775 1.00 101.98 ? 54  SER B CA    1 
ATOM 1690  C C     . SER B 1 57  ? 35.622  -44.317  -127.329 1.00 112.78 ? 54  SER B C     1 
ATOM 1691  O O     . SER B 1 57  ? 35.723  -43.088  -127.303 1.00 117.53 ? 54  SER B O     1 
ATOM 1692  C CB    . SER B 1 57  ? 34.406  -45.321  -129.272 1.00 96.33  ? 54  SER B CB    1 
ATOM 1693  O OG    . SER B 1 57  ? 34.801  -44.188  -130.028 1.00 91.74  ? 54  SER B OG    1 
ATOM 1694  N N     . ARG B 1 58  ? 36.605  -45.143  -126.976 1.00 118.67 ? 55  ARG B N     1 
ATOM 1695  C CA    . ARG B 1 58  ? 37.941  -44.685  -126.625 1.00 120.76 ? 55  ARG B CA    1 
ATOM 1696  C C     . ARG B 1 58  ? 38.948  -45.630  -127.267 1.00 124.54 ? 55  ARG B C     1 
ATOM 1697  O O     . ARG B 1 58  ? 38.580  -46.597  -127.942 1.00 123.23 ? 55  ARG B O     1 
ATOM 1698  C CB    . ARG B 1 58  ? 38.130  -44.619  -125.101 1.00 118.41 ? 55  ARG B CB    1 
ATOM 1699  C CG    . ARG B 1 58  ? 38.139  -45.981  -124.416 1.00 122.84 ? 55  ARG B CG    1 
ATOM 1700  C CD    . ARG B 1 58  ? 38.468  -45.883  -122.927 1.00 127.38 ? 55  ARG B CD    1 
ATOM 1701  N NE    . ARG B 1 58  ? 38.152  -47.126  -122.227 1.00 126.31 ? 55  ARG B NE    1 
ATOM 1702  C CZ    . ARG B 1 58  ? 37.003  -47.369  -121.606 1.00 119.00 ? 55  ARG B CZ    1 
ATOM 1703  N NH1   . ARG B 1 58  ? 36.121  -46.395  -121.430 1.00 112.47 ? 55  ARG B NH1   1 
ATOM 1704  N NH2   . ARG B 1 58  ? 36.802  -48.543  -121.024 1.00 115.12 ? 55  ARG B NH2   1 
ATOM 1705  N N     . MET B 1 59  ? 40.230  -45.349  -127.062 1.00 131.16 ? 56  MET B N     1 
ATOM 1706  C CA    . MET B 1 59  ? 41.280  -46.218  -127.581 1.00 135.55 ? 56  MET B CA    1 
ATOM 1707  C C     . MET B 1 59  ? 41.991  -46.980  -126.464 1.00 121.78 ? 56  MET B C     1 
ATOM 1708  O O     . MET B 1 59  ? 41.451  -47.939  -125.909 1.00 120.74 ? 56  MET B O     1 
ATOM 1709  C CB    . MET B 1 59  ? 42.283  -45.407  -128.401 1.00 146.67 ? 56  MET B CB    1 
ATOM 1710  C CG    . MET B 1 59  ? 41.690  -44.832  -129.679 1.00 142.65 ? 56  MET B CG    1 
ATOM 1711  S SD    . MET B 1 59  ? 40.953  -46.099  -130.730 1.00 133.96 ? 56  MET B SD    1 
ATOM 1712  C CE    . MET B 1 59  ? 39.523  -45.227  -131.366 1.00 122.41 ? 56  MET B CE    1 
ATOM 1713  N N     . VAL B 1 66  ? 37.379  -49.213  -128.305 1.00 108.51 ? 63  VAL B N     1 
ATOM 1714  C CA    . VAL B 1 66  ? 36.570  -49.822  -127.257 1.00 113.62 ? 63  VAL B CA    1 
ATOM 1715  C C     . VAL B 1 66  ? 35.257  -49.068  -127.090 1.00 97.86  ? 63  VAL B C     1 
ATOM 1716  O O     . VAL B 1 66  ? 35.258  -47.866  -126.830 1.00 99.24  ? 63  VAL B O     1 
ATOM 1717  C CB    . VAL B 1 66  ? 37.335  -49.863  -125.917 1.00 118.27 ? 63  VAL B CB    1 
ATOM 1718  C CG1   . VAL B 1 66  ? 36.427  -50.348  -124.795 1.00 108.91 ? 63  VAL B CG1   1 
ATOM 1719  C CG2   . VAL B 1 66  ? 38.573  -50.742  -126.030 1.00 133.56 ? 63  VAL B CG2   1 
ATOM 1720  N N     . CYS B 1 67  ? 34.137  -49.773  -127.227 1.00 89.80  ? 64  CYS B N     1 
ATOM 1721  C CA    . CYS B 1 67  ? 32.833  -49.156  -127.040 1.00 90.85  ? 64  CYS B CA    1 
ATOM 1722  C C     . CYS B 1 67  ? 32.418  -49.267  -125.578 1.00 94.87  ? 64  CYS B C     1 
ATOM 1723  O O     . CYS B 1 67  ? 32.815  -50.197  -124.870 1.00 108.77 ? 64  CYS B O     1 
ATOM 1724  C CB    . CYS B 1 67  ? 31.784  -49.821  -127.935 1.00 96.75  ? 64  CYS B CB    1 
ATOM 1725  S SG    . CYS B 1 67  ? 32.097  -49.675  -129.710 1.00 112.92 ? 64  CYS B SG    1 
ATOM 1726  N N     . TYR B 1 68  ? 31.593  -48.321  -125.136 1.00 83.60  ? 65  TYR B N     1 
ATOM 1727  C CA    . TYR B 1 68  ? 31.107  -48.301  -123.761 1.00 84.04  ? 65  TYR B CA    1 
ATOM 1728  C C     . TYR B 1 68  ? 29.989  -47.274  -123.655 1.00 85.22  ? 65  TYR B C     1 
ATOM 1729  O O     . TYR B 1 68  ? 29.799  -46.437  -124.541 1.00 84.32  ? 65  TYR B O     1 
ATOM 1730  C CB    . TYR B 1 68  ? 32.228  -47.997  -122.760 1.00 90.99  ? 65  TYR B CB    1 
ATOM 1731  C CG    . TYR B 1 68  ? 32.773  -46.586  -122.830 1.00 90.27  ? 65  TYR B CG    1 
ATOM 1732  C CD1   . TYR B 1 68  ? 32.279  -45.583  -122.004 1.00 78.12  ? 65  TYR B CD1   1 
ATOM 1733  C CD2   . TYR B 1 68  ? 33.791  -46.262  -123.716 1.00 98.59  ? 65  TYR B CD2   1 
ATOM 1734  C CE1   . TYR B 1 68  ? 32.781  -44.293  -122.066 1.00 79.00  ? 65  TYR B CE1   1 
ATOM 1735  C CE2   . TYR B 1 68  ? 34.299  -44.978  -123.785 1.00 100.08 ? 65  TYR B CE2   1 
ATOM 1736  C CZ    . TYR B 1 68  ? 33.792  -43.997  -122.959 1.00 93.96  ? 65  TYR B CZ    1 
ATOM 1737  O OH    . TYR B 1 68  ? 34.300  -42.719  -123.029 1.00 90.12  ? 65  TYR B OH    1 
ATOM 1738  N N     . ILE B 1 69  ? 29.251  -47.352  -122.551 1.00 87.59  ? 66  ILE B N     1 
ATOM 1739  C CA    . ILE B 1 69  ? 28.220  -46.381  -122.204 1.00 81.53  ? 66  ILE B CA    1 
ATOM 1740  C C     . ILE B 1 69  ? 28.724  -45.557  -121.028 1.00 78.70  ? 66  ILE B C     1 
ATOM 1741  O O     . ILE B 1 69  ? 29.233  -46.111  -120.045 1.00 72.46  ? 66  ILE B O     1 
ATOM 1742  C CB    . ILE B 1 69  ? 26.888  -47.070  -121.864 1.00 64.22  ? 66  ILE B CB    1 
ATOM 1743  C CG1   . ILE B 1 69  ? 26.538  -48.104  -122.936 1.00 80.97  ? 66  ILE B CG1   1 
ATOM 1744  C CG2   . ILE B 1 69  ? 25.775  -46.039  -121.743 1.00 56.46  ? 66  ILE B CG2   1 
ATOM 1745  C CD1   . ILE B 1 69  ? 25.271  -48.872  -122.647 1.00 76.03  ? 66  ILE B CD1   1 
ATOM 1746  N N     . GLU B 1 70  ? 28.606  -44.235  -121.139 1.00 78.21  ? 67  GLU B N     1 
ATOM 1747  C CA    . GLU B 1 70  ? 29.058  -43.347  -120.078 1.00 74.79  ? 67  GLU B CA    1 
ATOM 1748  C C     . GLU B 1 70  ? 28.164  -43.474  -118.848 1.00 72.47  ? 67  GLU B C     1 
ATOM 1749  O O     . GLU B 1 70  ? 26.974  -43.788  -118.944 1.00 64.91  ? 67  GLU B O     1 
ATOM 1750  C CB    . GLU B 1 70  ? 29.096  -41.900  -120.574 1.00 74.39  ? 67  GLU B CB    1 
ATOM 1751  C CG    . GLU B 1 70  ? 30.112  -41.666  -121.688 1.00 84.27  ? 67  GLU B CG    1 
ATOM 1752  C CD    . GLU B 1 70  ? 30.322  -40.196  -122.014 1.00 97.89  ? 67  GLU B CD    1 
ATOM 1753  O OE1   . GLU B 1 70  ? 29.533  -39.357  -121.532 1.00 94.34  ? 67  GLU B OE1   1 
ATOM 1754  O OE2   . GLU B 1 70  ? 31.288  -39.881  -122.743 1.00 114.02 ? 67  GLU B OE2   1 
ATOM 1755  N N     . GLY B 1 71  ? 28.772  -43.243  -117.678 1.00 71.84  ? 68  GLY B N     1 
ATOM 1756  C CA    . GLY B 1 71  ? 28.084  -43.474  -116.414 1.00 60.35  ? 68  GLY B CA    1 
ATOM 1757  C C     . GLY B 1 71  ? 26.762  -42.740  -116.289 1.00 62.81  ? 68  GLY B C     1 
ATOM 1758  O O     . GLY B 1 71  ? 25.735  -43.339  -115.952 1.00 65.22  ? 68  GLY B O     1 
ATOM 1759  N N     . HIS B 1 72  ? 26.773  -41.423  -116.526 1.00 55.72  ? 69  HIS B N     1 
ATOM 1760  C CA    . HIS B 1 72  ? 25.556  -40.637  -116.339 1.00 61.80  ? 69  HIS B CA    1 
ATOM 1761  C C     . HIS B 1 72  ? 24.440  -41.120  -117.252 1.00 64.86  ? 69  HIS B C     1 
ATOM 1762  O O     . HIS B 1 72  ? 23.263  -41.045  -116.884 1.00 62.04  ? 69  HIS B O     1 
ATOM 1763  C CB    . HIS B 1 72  ? 25.823  -39.151  -116.587 1.00 66.45  ? 69  HIS B CB    1 
ATOM 1764  C CG    . HIS B 1 72  ? 26.019  -38.797  -118.028 1.00 79.08  ? 69  HIS B CG    1 
ATOM 1765  N ND1   . HIS B 1 72  ? 27.215  -38.975  -118.688 1.00 85.89  ? 69  HIS B ND1   1 
ATOM 1766  C CD2   . HIS B 1 72  ? 25.164  -38.267  -118.936 1.00 77.90  ? 69  HIS B CD2   1 
ATOM 1767  C CE1   . HIS B 1 72  ? 27.090  -38.571  -119.939 1.00 81.24  ? 69  HIS B CE1   1 
ATOM 1768  N NE2   . HIS B 1 72  ? 25.855  -38.137  -120.116 1.00 76.49  ? 69  HIS B NE2   1 
ATOM 1769  N N     . ARG B 1 73  ? 24.789  -41.626  -118.437 1.00 69.26  ? 70  ARG B N     1 
ATOM 1770  C CA    . ARG B 1 73  ? 23.779  -42.175  -119.334 1.00 70.62  ? 70  ARG B CA    1 
ATOM 1771  C C     . ARG B 1 73  ? 23.115  -43.400  -118.724 1.00 62.95  ? 70  ARG B C     1 
ATOM 1772  O O     . ARG B 1 73  ? 21.897  -43.565  -118.830 1.00 63.66  ? 70  ARG B O     1 
ATOM 1773  C CB    . ARG B 1 73  ? 24.403  -42.507  -120.689 1.00 78.85  ? 70  ARG B CB    1 
ATOM 1774  C CG    . ARG B 1 73  ? 25.045  -41.308  -121.371 1.00 79.07  ? 70  ARG B CG    1 
ATOM 1775  C CD    . ARG B 1 73  ? 24.270  -40.895  -122.613 1.00 75.80  ? 70  ARG B CD    1 
ATOM 1776  N NE    . ARG B 1 73  ? 24.735  -39.622  -123.164 1.00 81.47  ? 70  ARG B NE    1 
ATOM 1777  C CZ    . ARG B 1 73  ? 25.859  -39.453  -123.855 1.00 86.02  ? 70  ARG B CZ    1 
ATOM 1778  N NH1   . ARG B 1 73  ? 26.661  -40.482  -124.101 1.00 87.14  ? 70  ARG B NH1   1 
ATOM 1779  N NH2   . ARG B 1 73  ? 26.181  -38.246  -124.304 1.00 82.43  ? 70  ARG B NH2   1 
ATOM 1780  N N     . VAL B 1 74  ? 23.899  -44.270  -118.082 1.00 62.82  ? 71  VAL B N     1 
ATOM 1781  C CA    . VAL B 1 74  ? 23.323  -45.446  -117.435 1.00 69.51  ? 71  VAL B CA    1 
ATOM 1782  C C     . VAL B 1 74  ? 22.453  -45.026  -116.258 1.00 66.09  ? 71  VAL B C     1 
ATOM 1783  O O     . VAL B 1 74  ? 21.384  -45.605  -116.015 1.00 60.03  ? 71  VAL B O     1 
ATOM 1784  C CB    . VAL B 1 74  ? 24.437  -46.414  -116.997 1.00 59.09  ? 71  VAL B CB    1 
ATOM 1785  C CG1   . VAL B 1 74  ? 23.843  -47.685  -116.413 1.00 52.43  ? 71  VAL B CG1   1 
ATOM 1786  C CG2   . VAL B 1 74  ? 25.350  -46.741  -118.167 1.00 58.02  ? 71  VAL B CG2   1 
ATOM 1787  N N     . ILE B 1 75  ? 22.894  -44.010  -115.512 1.00 59.62  ? 72  ILE B N     1 
ATOM 1788  C CA    . ILE B 1 75  ? 22.097  -43.499  -114.400 1.00 60.35  ? 72  ILE B CA    1 
ATOM 1789  C C     . ILE B 1 75  ? 20.752  -42.988  -114.907 1.00 64.35  ? 72  ILE B C     1 
ATOM 1790  O O     . ILE B 1 75  ? 19.695  -43.287  -114.336 1.00 61.50  ? 72  ILE B O     1 
ATOM 1791  C CB    . ILE B 1 75  ? 22.871  -42.400  -113.648 1.00 62.49  ? 72  ILE B CB    1 
ATOM 1792  C CG1   . ILE B 1 75  ? 24.060  -43.001  -112.895 1.00 58.42  ? 72  ILE B CG1   1 
ATOM 1793  C CG2   . ILE B 1 75  ? 21.958  -41.659  -112.683 1.00 50.66  ? 72  ILE B CG2   1 
ATOM 1794  C CD1   . ILE B 1 75  ? 24.912  -41.968  -112.184 1.00 72.09  ? 72  ILE B CD1   1 
ATOM 1795  N N     . ASN B 1 76  ? 20.775  -42.205  -115.989 1.00 70.87  ? 73  ASN B N     1 
ATOM 1796  C CA    . ASN B 1 76  ? 19.541  -41.664  -116.550 1.00 67.80  ? 73  ASN B CA    1 
ATOM 1797  C C     . ASN B 1 76  ? 18.659  -42.771  -117.120 1.00 61.32  ? 73  ASN B C     1 
ATOM 1798  O O     . ASN B 1 76  ? 17.431  -42.724  -116.982 1.00 58.24  ? 73  ASN B O     1 
ATOM 1799  C CB    . ASN B 1 76  ? 19.867  -40.625  -117.625 1.00 73.32  ? 73  ASN B CB    1 
ATOM 1800  C CG    . ASN B 1 76  ? 20.328  -39.305  -117.038 1.00 75.85  ? 73  ASN B CG    1 
ATOM 1801  O OD1   . ASN B 1 76  ? 19.884  -38.901  -115.961 1.00 69.01  ? 73  ASN B OD1   1 
ATOM 1802  N ND2   . ASN B 1 76  ? 21.218  -38.619  -117.748 1.00 78.21  ? 73  ASN B ND2   1 
ATOM 1803  N N     . LEU B 1 77  ? 19.266  -43.769  -117.770 1.00 61.83  ? 74  LEU B N     1 
ATOM 1804  C CA    . LEU B 1 77  ? 18.511  -44.920  -118.256 1.00 63.57  ? 74  LEU B CA    1 
ATOM 1805  C C     . LEU B 1 77  ? 17.773  -45.612  -117.118 1.00 65.84  ? 74  LEU B C     1 
ATOM 1806  O O     . LEU B 1 77  ? 16.585  -45.933  -117.237 1.00 73.59  ? 74  LEU B O     1 
ATOM 1807  C CB    . LEU B 1 77  ? 19.442  -45.906  -118.965 1.00 61.52  ? 74  LEU B CB    1 
ATOM 1808  C CG    . LEU B 1 77  ? 19.818  -45.578  -120.412 1.00 65.70  ? 74  LEU B CG    1 
ATOM 1809  C CD1   . LEU B 1 77  ? 20.979  -46.442  -120.893 1.00 68.04  ? 74  LEU B CD1   1 
ATOM 1810  C CD2   . LEU B 1 77  ? 18.610  -45.737  -121.325 1.00 63.15  ? 74  LEU B CD2   1 
ATOM 1811  N N     . ALA B 1 78  ? 18.464  -45.846  -116.001 1.00 66.63  ? 75  ALA B N     1 
ATOM 1812  C CA    . ALA B 1 78  ? 17.824  -46.529  -114.882 1.00 65.99  ? 75  ALA B CA    1 
ATOM 1813  C C     . ALA B 1 78  ? 16.739  -45.662  -114.259 1.00 66.33  ? 75  ALA B C     1 
ATOM 1814  O O     . ALA B 1 78  ? 15.654  -46.159  -113.925 1.00 61.73  ? 75  ALA B O     1 
ATOM 1815  C CB    . ALA B 1 78  ? 18.868  -46.920  -113.835 1.00 61.48  ? 75  ALA B CB    1 
ATOM 1816  N N     . ASN B 1 79  ? 17.004  -44.361  -114.117 1.00 66.18  ? 76  ASN B N     1 
ATOM 1817  C CA    . ASN B 1 79  ? 16.002  -43.458  -113.567 1.00 61.94  ? 76  ASN B CA    1 
ATOM 1818  C C     . ASN B 1 79  ? 14.756  -43.397  -114.441 1.00 65.24  ? 76  ASN B C     1 
ATOM 1819  O O     . ASN B 1 79  ? 13.643  -43.271  -113.921 1.00 63.63  ? 76  ASN B O     1 
ATOM 1820  C CB    . ASN B 1 79  ? 16.599  -42.062  -113.381 1.00 64.09  ? 76  ASN B CB    1 
ATOM 1821  C CG    . ASN B 1 79  ? 17.437  -41.950  -112.119 1.00 61.28  ? 76  ASN B CG    1 
ATOM 1822  O OD1   . ASN B 1 79  ? 17.060  -42.460  -111.065 1.00 69.86  ? 76  ASN B OD1   1 
ATOM 1823  N ND2   . ASN B 1 79  ? 18.579  -41.279  -112.222 1.00 68.57  ? 76  ASN B ND2   1 
ATOM 1824  N N     . GLU B 1 80  ? 14.912  -43.496  -115.763 1.00 67.81  ? 77  GLU B N     1 
ATOM 1825  C CA    . GLU B 1 80  ? 13.747  -43.473  -116.642 1.00 72.69  ? 77  GLU B CA    1 
ATOM 1826  C C     . GLU B 1 80  ? 13.022  -44.815  -116.663 1.00 69.22  ? 77  GLU B C     1 
ATOM 1827  O O     . GLU B 1 80  ? 11.791  -44.854  -116.775 1.00 62.14  ? 77  GLU B O     1 
ATOM 1828  C CB    . GLU B 1 80  ? 14.163  -43.083  -118.062 1.00 72.51  ? 77  GLU B CB    1 
ATOM 1829  C CG    . GLU B 1 80  ? 14.663  -41.652  -118.209 1.00 77.13  ? 77  GLU B CG    1 
ATOM 1830  C CD    . GLU B 1 80  ? 13.650  -40.621  -117.748 1.00 80.08  ? 77  GLU B CD    1 
ATOM 1831  O OE1   . GLU B 1 80  ? 12.433  -40.885  -117.854 1.00 81.94  ? 77  GLU B OE1   1 
ATOM 1832  O OE2   . GLU B 1 80  ? 14.072  -39.545  -117.274 1.00 71.47  ? 77  GLU B OE2   1 
ATOM 1833  N N     . MET B 1 81  ? 13.766  -45.921  -116.576 1.00 69.14  ? 78  MET B N     1 
ATOM 1834  C CA    . MET B 1 81  ? 13.149  -47.242  -116.637 1.00 62.06  ? 78  MET B CA    1 
ATOM 1835  C C     . MET B 1 81  ? 12.370  -47.563  -115.367 1.00 69.36  ? 78  MET B C     1 
ATOM 1836  O O     . MET B 1 81  ? 11.272  -48.127  -115.436 1.00 69.56  ? 78  MET B O     1 
ATOM 1837  C CB    . MET B 1 81  ? 14.211  -48.307  -116.906 1.00 62.34  ? 78  MET B CB    1 
ATOM 1838  C CG    . MET B 1 81  ? 14.660  -48.383  -118.362 1.00 82.37  ? 78  MET B CG    1 
ATOM 1839  S SD    . MET B 1 81  ? 13.421  -49.043  -119.503 1.00 78.75  ? 78  MET B SD    1 
ATOM 1840  C CE    . MET B 1 81  ? 12.557  -50.221  -118.464 1.00 73.68  ? 78  MET B CE    1 
ATOM 1841  N N     . PHE B 1 82  ? 12.924  -47.235  -114.196 1.00 71.11  ? 79  PHE B N     1 
ATOM 1842  C CA    . PHE B 1 82  ? 12.311  -47.631  -112.935 1.00 63.72  ? 79  PHE B CA    1 
ATOM 1843  C C     . PHE B 1 82  ? 11.789  -46.465  -112.113 1.00 61.58  ? 79  PHE B C     1 
ATOM 1844  O O     . PHE B 1 82  ? 11.090  -46.697  -111.120 1.00 62.18  ? 79  PHE B O     1 
ATOM 1845  C CB    . PHE B 1 82  ? 13.304  -48.419  -112.069 1.00 61.21  ? 79  PHE B CB    1 
ATOM 1846  C CG    . PHE B 1 82  ? 14.003  -49.525  -112.796 1.00 46.76  ? 79  PHE B CG    1 
ATOM 1847  C CD1   . PHE B 1 82  ? 13.339  -50.699  -113.108 1.00 45.10  ? 79  PHE B CD1   1 
ATOM 1848  C CD2   . PHE B 1 82  ? 15.333  -49.395  -113.154 1.00 50.72  ? 79  PHE B CD2   1 
ATOM 1849  C CE1   . PHE B 1 82  ? 13.987  -51.717  -113.775 1.00 41.34  ? 79  PHE B CE1   1 
ATOM 1850  C CE2   . PHE B 1 82  ? 15.985  -50.409  -113.818 1.00 55.05  ? 79  PHE B CE2   1 
ATOM 1851  C CZ    . PHE B 1 82  ? 15.312  -51.572  -114.130 1.00 45.86  ? 79  PHE B CZ    1 
ATOM 1852  N N     . GLY B 1 83  ? 12.108  -45.238  -112.483 1.00 63.24  ? 80  GLY B N     1 
ATOM 1853  C CA    . GLY B 1 83  ? 11.755  -44.143  -111.597 1.00 62.42  ? 80  GLY B CA    1 
ATOM 1854  C C     . GLY B 1 83  ? 12.875  -43.813  -110.634 1.00 62.24  ? 80  GLY B C     1 
ATOM 1855  O O     . GLY B 1 83  ? 13.706  -44.652  -110.286 1.00 70.31  ? 80  GLY B O     1 
ATOM 1856  N N     . TYR B 1 84  ? 12.912  -42.546  -110.210 1.00 59.70  ? 81  TYR B N     1 
ATOM 1857  C CA    . TYR B 1 84  ? 13.925  -42.120  -109.248 1.00 67.47  ? 81  TYR B CA    1 
ATOM 1858  C C     . TYR B 1 84  ? 13.860  -42.912  -107.948 1.00 62.96  ? 81  TYR B C     1 
ATOM 1859  O O     . TYR B 1 84  ? 14.870  -43.012  -107.242 1.00 58.53  ? 81  TYR B O     1 
ATOM 1860  C CB    . TYR B 1 84  ? 13.780  -40.635  -108.923 1.00 51.42  ? 81  TYR B CB    1 
ATOM 1861  C CG    . TYR B 1 84  ? 12.599  -40.312  -108.033 1.00 56.41  ? 81  TYR B CG    1 
ATOM 1862  C CD1   . TYR B 1 84  ? 11.303  -40.285  -108.532 1.00 57.00  ? 81  TYR B CD1   1 
ATOM 1863  C CD2   . TYR B 1 84  ? 12.784  -40.051  -106.680 1.00 65.20  ? 81  TYR B CD2   1 
ATOM 1864  C CE1   . TYR B 1 84  ? 10.229  -39.987  -107.706 1.00 53.76  ? 81  TYR B CE1   1 
ATOM 1865  C CE2   . TYR B 1 84  ? 11.718  -39.759  -105.852 1.00 60.08  ? 81  TYR B CE2   1 
ATOM 1866  C CZ    . TYR B 1 84  ? 10.443  -39.729  -106.368 1.00 56.98  ? 81  TYR B CZ    1 
ATOM 1867  O OH    . TYR B 1 84  ? 9.384   -39.434  -105.540 1.00 57.00  ? 81  TYR B OH    1 
ATOM 1868  N N     . ASN B 1 85  ? 12.696  -43.470  -107.614 1.00 50.30  ? 82  ASN B N     1 
ATOM 1869  C CA    . ASN B 1 85  ? 12.506  -44.210  -106.372 1.00 62.37  ? 82  ASN B CA    1 
ATOM 1870  C C     . ASN B 1 85  ? 12.179  -45.678  -106.625 1.00 60.61  ? 82  ASN B C     1 
ATOM 1871  O O     . ASN B 1 85  ? 11.622  -46.349  -105.748 1.00 53.11  ? 82  ASN B O     1 
ATOM 1872  C CB    . ASN B 1 85  ? 11.411  -43.560  -105.523 1.00 57.01  ? 82  ASN B CB    1 
ATOM 1873  C CG    . ASN B 1 85  ? 10.020  -43.786  -106.086 1.00 58.16  ? 82  ASN B CG    1 
ATOM 1874  O OD1   . ASN B 1 85  ? 9.833   -43.868  -107.299 1.00 56.36  ? 82  ASN B OD1   1 
ATOM 1875  N ND2   . ASN B 1 85  ? 9.035   -43.897  -105.200 1.00 57.58  ? 82  ASN B ND2   1 
ATOM 1876  N N     . GLY B 1 86  ? 12.531  -46.195  -107.797 1.00 59.07  ? 83  GLY B N     1 
ATOM 1877  C CA    . GLY B 1 86  ? 12.205  -47.562  -108.142 1.00 60.47  ? 83  GLY B CA    1 
ATOM 1878  C C     . GLY B 1 86  ? 13.425  -48.453  -108.227 1.00 55.17  ? 83  GLY B C     1 
ATOM 1879  O O     . GLY B 1 86  ? 13.300  -49.677  -108.324 1.00 54.67  ? 83  GLY B O     1 
ATOM 1880  N N     . TRP B 1 87  ? 14.612  -47.854  -108.185 1.00 48.18  ? 84  TRP B N     1 
ATOM 1881  C CA    . TRP B 1 87  ? 15.854  -48.607  -108.138 1.00 52.14  ? 84  TRP B CA    1 
ATOM 1882  C C     . TRP B 1 87  ? 16.771  -48.020  -107.076 1.00 53.16  ? 84  TRP B C     1 
ATOM 1883  O O     . TRP B 1 87  ? 16.698  -46.833  -106.744 1.00 47.53  ? 84  TRP B O     1 
ATOM 1884  C CB    . TRP B 1 87  ? 16.566  -48.619  -109.499 1.00 55.72  ? 84  TRP B CB    1 
ATOM 1885  C CG    . TRP B 1 87  ? 17.199  -47.310  -109.875 1.00 51.60  ? 84  TRP B CG    1 
ATOM 1886  C CD1   . TRP B 1 87  ? 16.558  -46.167  -110.257 1.00 47.47  ? 84  TRP B CD1   1 
ATOM 1887  C CD2   . TRP B 1 87  ? 18.600  -47.009  -109.894 1.00 48.73  ? 84  TRP B CD2   1 
ATOM 1888  N NE1   . TRP B 1 87  ? 17.475  -45.177  -110.521 1.00 56.18  ? 84  TRP B NE1   1 
ATOM 1889  C CE2   . TRP B 1 87  ? 18.735  -45.668  -110.302 1.00 46.46  ? 84  TRP B CE2   1 
ATOM 1890  C CE3   . TRP B 1 87  ? 19.753  -47.745  -109.604 1.00 50.88  ? 84  TRP B CE3   1 
ATOM 1891  C CZ2   . TRP B 1 87  ? 19.976  -45.046  -110.427 1.00 46.05  ? 84  TRP B CZ2   1 
ATOM 1892  C CZ3   . TRP B 1 87  ? 20.985  -47.126  -109.732 1.00 55.47  ? 84  TRP B CZ3   1 
ATOM 1893  C CH2   . TRP B 1 87  ? 21.086  -45.791  -110.139 1.00 54.48  ? 84  TRP B CH2   1 
ATOM 1894  N N     . ALA B 1 88  ? 17.653  -48.872  -106.561 1.00 53.80  ? 85  ALA B N     1 
ATOM 1895  C CA    . ALA B 1 88  ? 18.587  -48.480  -105.518 1.00 47.95  ? 85  ALA B CA    1 
ATOM 1896  C C     . ALA B 1 88  ? 19.870  -49.273  -105.704 1.00 43.80  ? 85  ALA B C     1 
ATOM 1897  O O     . ALA B 1 88  ? 19.865  -50.363  -106.279 1.00 52.79  ? 85  ALA B O     1 
ATOM 1898  C CB    . ALA B 1 88  ? 18.002  -48.717  -104.121 1.00 40.12  ? 85  ALA B CB    1 
ATOM 1899  N N     . HIS B 1 89  ? 20.976  -48.722  -105.208 1.00 39.95  ? 86  HIS B N     1 
ATOM 1900  C CA    . HIS B 1 89  ? 22.233  -49.453  -105.225 1.00 46.05  ? 86  HIS B CA    1 
ATOM 1901  C C     . HIS B 1 89  ? 23.029  -49.136  -103.969 1.00 48.44  ? 86  HIS B C     1 
ATOM 1902  O O     . HIS B 1 89  ? 22.880  -48.068  -103.366 1.00 47.85  ? 86  HIS B O     1 
ATOM 1903  C CB    . HIS B 1 89  ? 23.069  -49.148  -106.483 1.00 41.23  ? 86  HIS B CB    1 
ATOM 1904  C CG    . HIS B 1 89  ? 23.820  -47.854  -106.425 1.00 41.48  ? 86  HIS B CG    1 
ATOM 1905  N ND1   . HIS B 1 89  ? 23.201  -46.634  -106.267 1.00 45.14  ? 86  HIS B ND1   1 
ATOM 1906  C CD2   . HIS B 1 89  ? 25.147  -47.593  -106.506 1.00 43.16  ? 86  HIS B CD2   1 
ATOM 1907  C CE1   . HIS B 1 89  ? 24.112  -45.677  -106.251 1.00 48.63  ? 86  HIS B CE1   1 
ATOM 1908  N NE2   . HIS B 1 89  ? 25.301  -46.233  -106.394 1.00 47.55  ? 86  HIS B NE2   1 
ATOM 1909  N N     . SER B 1 90  ? 23.868  -50.092  -103.579 1.00 39.54  ? 87  SER B N     1 
ATOM 1910  C CA    . SER B 1 90  ? 24.698  -49.983  -102.392 1.00 39.97  ? 87  SER B CA    1 
ATOM 1911  C C     . SER B 1 90  ? 26.035  -50.658  -102.655 1.00 43.11  ? 87  SER B C     1 
ATOM 1912  O O     . SER B 1 90  ? 26.140  -51.555  -103.494 1.00 40.88  ? 87  SER B O     1 
ATOM 1913  C CB    . SER B 1 90  ? 24.021  -50.617  -101.173 1.00 46.00  ? 87  SER B CB    1 
ATOM 1914  O OG    . SER B 1 90  ? 23.669  -51.965  -101.436 1.00 49.25  ? 87  SER B OG    1 
ATOM 1915  N N     . ILE B 1 91  ? 27.051  -50.231  -101.917 1.00 47.57  ? 88  ILE B N     1 
ATOM 1916  C CA    . ILE B 1 91  ? 28.388  -50.799  -102.016 1.00 45.62  ? 88  ILE B CA    1 
ATOM 1917  C C     . ILE B 1 91  ? 28.525  -51.852  -100.926 1.00 44.02  ? 88  ILE B C     1 
ATOM 1918  O O     . ILE B 1 91  ? 28.673  -51.522  -99.745  1.00 52.81  ? 88  ILE B O     1 
ATOM 1919  C CB    . ILE B 1 91  ? 29.466  -49.717  -101.887 1.00 50.03  ? 88  ILE B CB    1 
ATOM 1920  C CG1   . ILE B 1 91  ? 29.248  -48.640  -102.947 1.00 38.47  ? 88  ILE B CG1   1 
ATOM 1921  C CG2   . ILE B 1 91  ? 30.845  -50.329  -102.020 1.00 41.46  ? 88  ILE B CG2   1 
ATOM 1922  C CD1   . ILE B 1 91  ? 30.085  -47.418  -102.733 1.00 41.37  ? 88  ILE B CD1   1 
ATOM 1923  N N     . THR B 1 92  ? 28.473  -53.122  -101.328 1.00 45.01  ? 89  THR B N     1 
ATOM 1924  C CA    . THR B 1 92  ? 28.607  -54.215  -100.370 1.00 41.80  ? 89  THR B CA    1 
ATOM 1925  C C     . THR B 1 92  ? 29.999  -54.229  -99.748  1.00 39.21  ? 89  THR B C     1 
ATOM 1926  O O     . THR B 1 92  ? 30.144  -54.363  -98.527  1.00 46.05  ? 89  THR B O     1 
ATOM 1927  C CB    . THR B 1 92  ? 28.311  -55.545  -101.060 1.00 30.17  ? 89  THR B CB    1 
ATOM 1928  O OG1   . THR B 1 92  ? 26.986  -55.519  -101.605 1.00 37.04  ? 89  THR B OG1   1 
ATOM 1929  C CG2   . THR B 1 92  ? 28.431  -56.700  -100.075 1.00 44.71  ? 89  THR B CG2   1 
ATOM 1930  N N     . GLN B 1 93  ? 31.034  -54.085  -100.570 1.00 42.78  ? 90  GLN B N     1 
ATOM 1931  C CA    . GLN B 1 93  ? 32.400  -54.064  -100.072 1.00 37.44  ? 90  GLN B CA    1 
ATOM 1932  C C     . GLN B 1 93  ? 33.289  -53.464  -101.152 1.00 45.38  ? 90  GLN B C     1 
ATOM 1933  O O     . GLN B 1 93  ? 33.077  -53.711  -102.342 1.00 48.93  ? 90  GLN B O     1 
ATOM 1934  C CB    . GLN B 1 93  ? 32.880  -55.472  -99.693  1.00 46.56  ? 90  GLN B CB    1 
ATOM 1935  C CG    . GLN B 1 93  ? 34.188  -55.503  -98.919  1.00 69.94  ? 90  GLN B CG    1 
ATOM 1936  C CD    . GLN B 1 93  ? 34.702  -56.918  -98.705  1.00 65.82  ? 90  GLN B CD    1 
ATOM 1937  O OE1   . GLN B 1 93  ? 34.388  -57.573  -97.706  1.00 73.98  ? 90  GLN B OE1   1 
ATOM 1938  N NE2   . GLN B 1 93  ? 35.498  -57.397  -99.655  1.00 59.21  ? 90  GLN B NE2   1 
ATOM 1939  N N     . GLN B 1 94  ? 34.255  -52.651  -100.731 1.00 39.43  ? 91  GLN B N     1 
ATOM 1940  C CA    . GLN B 1 94  ? 35.316  -52.157  -101.599 1.00 41.93  ? 91  GLN B CA    1 
ATOM 1941  C C     . GLN B 1 94  ? 36.659  -52.575  -101.015 1.00 41.87  ? 91  GLN B C     1 
ATOM 1942  O O     . GLN B 1 94  ? 36.911  -52.375  -99.822  1.00 50.57  ? 91  GLN B O     1 
ATOM 1943  C CB    . GLN B 1 94  ? 35.238  -50.634  -101.758 1.00 46.36  ? 91  GLN B CB    1 
ATOM 1944  C CG    . GLN B 1 94  ? 36.520  -49.975  -102.250 1.00 57.44  ? 91  GLN B CG    1 
ATOM 1945  C CD    . GLN B 1 94  ? 36.279  -48.619  -102.898 1.00 53.50  ? 91  GLN B CD    1 
ATOM 1946  O OE1   . GLN B 1 94  ? 36.728  -47.591  -102.393 1.00 57.25  ? 91  GLN B OE1   1 
ATOM 1947  N NE2   . GLN B 1 94  ? 35.580  -48.613  -104.028 1.00 51.57  ? 91  GLN B NE2   1 
ATOM 1948  N N     . ASN B 1 95  ? 37.520  -53.148  -101.856 1.00 41.54  ? 92  ASN B N     1 
ATOM 1949  C CA    . ASN B 1 95  ? 38.791  -53.717  -101.421 1.00 48.34  ? 92  ASN B CA    1 
ATOM 1950  C C     . ASN B 1 95  ? 39.909  -53.187  -102.309 1.00 46.12  ? 92  ASN B C     1 
ATOM 1951  O O     . ASN B 1 95  ? 39.844  -53.316  -103.535 1.00 53.49  ? 92  ASN B O     1 
ATOM 1952  C CB    . ASN B 1 95  ? 38.736  -55.249  -101.469 1.00 45.11  ? 92  ASN B CB    1 
ATOM 1953  C CG    . ASN B 1 95  ? 40.023  -55.904  -100.994 1.00 61.05  ? 92  ASN B CG    1 
ATOM 1954  O OD1   . ASN B 1 95  ? 40.774  -55.335  -100.202 1.00 72.15  ? 92  ASN B OD1   1 
ATOM 1955  N ND2   . ASN B 1 95  ? 40.276  -57.117  -101.474 1.00 86.69  ? 92  ASN B ND2   1 
ATOM 1956  N N     . VAL B 1 96  ? 40.908  -52.561  -101.692 1.00 48.98  ? 93  VAL B N     1 
ATOM 1957  C CA    . VAL B 1 96  ? 42.099  -52.092  -102.397 1.00 45.87  ? 93  VAL B CA    1 
ATOM 1958  C C     . VAL B 1 96  ? 43.031  -53.281  -102.612 1.00 51.14  ? 93  VAL B C     1 
ATOM 1959  O O     . VAL B 1 96  ? 43.539  -53.863  -101.651 1.00 65.62  ? 93  VAL B O     1 
ATOM 1960  C CB    . VAL B 1 96  ? 42.801  -50.970  -101.628 1.00 40.73  ? 93  VAL B CB    1 
ATOM 1961  C CG1   . VAL B 1 96  ? 44.100  -50.594  -102.316 1.00 43.44  ? 93  VAL B CG1   1 
ATOM 1962  C CG2   . VAL B 1 96  ? 41.891  -49.764  -101.505 1.00 36.67  ? 93  VAL B CG2   1 
ATOM 1963  N N     . ASP B 1 97  ? 43.248  -53.651  -103.875 1.00 52.18  ? 94  ASP B N     1 
ATOM 1964  C CA    . ASP B 1 97  ? 44.067  -54.824  -104.165 1.00 52.82  ? 94  ASP B CA    1 
ATOM 1965  C C     . ASP B 1 97  ? 45.552  -54.561  -103.939 1.00 56.65  ? 94  ASP B C     1 
ATOM 1966  O O     . ASP B 1 97  ? 46.250  -55.401  -103.359 1.00 52.67  ? 94  ASP B O     1 
ATOM 1967  C CB    . ASP B 1 97  ? 43.820  -55.295  -105.595 1.00 46.28  ? 94  ASP B CB    1 
ATOM 1968  C CG    . ASP B 1 97  ? 42.541  -56.091  -105.729 1.00 53.57  ? 94  ASP B CG    1 
ATOM 1969  O OD1   . ASP B 1 97  ? 42.041  -56.587  -104.697 1.00 61.29  ? 94  ASP B OD1   1 
ATOM 1970  O OD2   . ASP B 1 97  ? 42.048  -56.246  -106.864 1.00 56.33  ? 94  ASP B OD2   1 
ATOM 1971  N N     . PHE B 1 98  ? 46.059  -53.413  -104.388 1.00 55.86  ? 95  PHE B N     1 
ATOM 1972  C CA    . PHE B 1 98  ? 47.487  -53.138  -104.276 1.00 55.83  ? 95  PHE B CA    1 
ATOM 1973  C C     . PHE B 1 98  ? 47.748  -51.651  -104.452 1.00 50.30  ? 95  PHE B C     1 
ATOM 1974  O O     . PHE B 1 98  ? 46.972  -50.933  -105.084 1.00 55.88  ? 95  PHE B O     1 
ATOM 1975  C CB    . PHE B 1 98  ? 48.292  -53.933  -105.312 1.00 62.97  ? 95  PHE B CB    1 
ATOM 1976  C CG    . PHE B 1 98  ? 47.920  -53.618  -106.736 1.00 56.56  ? 95  PHE B CG    1 
ATOM 1977  C CD1   . PHE B 1 98  ? 48.526  -52.577  -107.424 1.00 55.52  ? 95  PHE B CD1   1 
ATOM 1978  C CD2   . PHE B 1 98  ? 46.954  -54.368  -107.384 1.00 59.80  ? 95  PHE B CD2   1 
ATOM 1979  C CE1   . PHE B 1 98  ? 48.169  -52.293  -108.727 1.00 56.21  ? 95  PHE B CE1   1 
ATOM 1980  C CE2   . PHE B 1 98  ? 46.599  -54.089  -108.687 1.00 61.46  ? 95  PHE B CE2   1 
ATOM 1981  C CZ    . PHE B 1 98  ? 47.206  -53.052  -109.358 1.00 50.29  ? 95  PHE B CZ    1 
ATOM 1982  N N     . VAL B 1 99  ? 48.866  -51.208  -103.880 1.00 48.25  ? 96  VAL B N     1 
ATOM 1983  C CA    . VAL B 1 99  ? 49.427  -49.881  -104.111 1.00 53.58  ? 96  VAL B CA    1 
ATOM 1984  C C     . VAL B 1 99  ? 50.933  -50.067  -104.269 1.00 65.27  ? 96  VAL B C     1 
ATOM 1985  O O     . VAL B 1 99  ? 51.631  -50.343  -103.287 1.00 65.18  ? 96  VAL B O     1 
ATOM 1986  C CB    . VAL B 1 99  ? 49.120  -48.902  -102.966 1.00 51.14  ? 96  VAL B CB    1 
ATOM 1987  C CG1   . VAL B 1 99  ? 49.825  -47.574  -103.197 1.00 53.77  ? 96  VAL B CG1   1 
ATOM 1988  C CG2   . VAL B 1 99  ? 47.618  -48.691  -102.821 1.00 49.33  ? 96  VAL B CG2   1 
ATOM 1989  N N     . ASP B 1 100 ? 51.430  -49.950  -105.501 1.00 65.54  ? 97  ASP B N     1 
ATOM 1990  C CA    . ASP B 1 100 ? 52.842  -50.151  -105.800 1.00 69.02  ? 97  ASP B CA    1 
ATOM 1991  C C     . ASP B 1 100 ? 53.479  -48.854  -106.288 1.00 71.25  ? 97  ASP B C     1 
ATOM 1992  O O     . ASP B 1 100 ? 52.832  -48.030  -106.943 1.00 69.72  ? 97  ASP B O     1 
ATOM 1993  C CB    . ASP B 1 100 ? 53.038  -51.261  -106.839 1.00 68.85  ? 97  ASP B CB    1 
ATOM 1994  C CG    . ASP B 1 100 ? 52.657  -52.631  -106.303 1.00 70.33  ? 97  ASP B CG    1 
ATOM 1995  O OD1   . ASP B 1 100 ? 53.011  -52.934  -105.144 1.00 70.21  ? 97  ASP B OD1   1 
ATOM 1996  O OD2   . ASP B 1 100 ? 52.002  -53.400  -107.035 1.00 71.56  ? 97  ASP B OD2   1 
ATOM 1997  N N     . LEU B 1 101 ? 54.762  -48.689  -105.967 1.00 72.60  ? 98  LEU B N     1 
ATOM 1998  C CA    . LEU B 1 101 ? 55.535  -47.493  -106.299 1.00 76.37  ? 98  LEU B CA    1 
ATOM 1999  C C     . LEU B 1 101 ? 56.716  -47.873  -107.188 1.00 88.13  ? 98  LEU B C     1 
ATOM 2000  O O     . LEU B 1 101 ? 57.614  -48.603  -106.754 1.00 96.79  ? 98  LEU B O     1 
ATOM 2001  C CB    . LEU B 1 101 ? 56.015  -46.795  -105.026 1.00 75.76  ? 98  LEU B CB    1 
ATOM 2002  C CG    . LEU B 1 101 ? 56.901  -45.554  -105.179 1.00 73.93  ? 98  LEU B CG    1 
ATOM 2003  C CD1   . LEU B 1 101 ? 56.221  -44.496  -106.031 1.00 72.99  ? 98  LEU B CD1   1 
ATOM 2004  C CD2   . LEU B 1 101 ? 57.270  -44.994  -103.814 1.00 54.51  ? 98  LEU B CD2   1 
ATOM 2005  N N     . ASN B 1 102 ? 56.708  -47.396  -108.434 1.00 85.65  ? 99  ASN B N     1 
ATOM 2006  C CA    . ASN B 1 102 ? 57.794  -47.637  -109.383 1.00 92.70  ? 99  ASN B CA    1 
ATOM 2007  C C     . ASN B 1 102 ? 58.372  -46.297  -109.824 1.00 94.75  ? 99  ASN B C     1 
ATOM 2008  O O     . ASN B 1 102 ? 57.729  -45.564  -110.585 1.00 88.87  ? 99  ASN B O     1 
ATOM 2009  C CB    . ASN B 1 102 ? 57.314  -48.445  -110.587 1.00 91.40  ? 99  ASN B CB    1 
ATOM 2010  C CG    . ASN B 1 102 ? 57.265  -49.933  -110.309 1.00 104.21 ? 99  ASN B CG    1 
ATOM 2011  O OD1   . ASN B 1 102 ? 58.170  -50.488  -109.685 1.00 104.22 ? 99  ASN B OD1   1 
ATOM 2012  N ND2   . ASN B 1 102 ? 56.212  -50.591  -110.783 1.00 116.27 ? 99  ASN B ND2   1 
ATOM 2013  N N     . ASN B 1 103 ? 59.587  -46.004  -109.360 1.00 96.92  ? 100 ASN B N     1 
ATOM 2014  C CA    . ASN B 1 103 ? 60.329  -44.766  -109.635 1.00 105.25 ? 100 ASN B CA    1 
ATOM 2015  C C     . ASN B 1 103 ? 59.407  -43.546  -109.718 1.00 102.49 ? 100 ASN B C     1 
ATOM 2016  O O     . ASN B 1 103 ? 59.342  -42.839  -110.725 1.00 95.39  ? 100 ASN B O     1 
ATOM 2017  C CB    . ASN B 1 103 ? 61.215  -44.878  -110.885 1.00 100.10 ? 100 ASN B CB    1 
ATOM 2018  C CG    . ASN B 1 103 ? 60.475  -45.359  -112.120 1.00 100.36 ? 100 ASN B CG    1 
ATOM 2019  O OD1   . ASN B 1 103 ? 59.938  -46.462  -112.152 1.00 98.57  ? 100 ASN B OD1   1 
ATOM 2020  N ND2   . ASN B 1 103 ? 60.448  -44.519  -113.151 1.00 100.74 ? 100 ASN B ND2   1 
ATOM 2021  N N     . GLY B 1 104 ? 58.678  -43.317  -108.626 1.00 99.38  ? 101 GLY B N     1 
ATOM 2022  C CA    . GLY B 1 104 ? 57.900  -42.107  -108.464 1.00 78.06  ? 101 GLY B CA    1 
ATOM 2023  C C     . GLY B 1 104 ? 56.498  -42.139  -109.031 1.00 83.65  ? 101 GLY B C     1 
ATOM 2024  O O     . GLY B 1 104 ? 55.788  -41.131  -108.931 1.00 83.58  ? 101 GLY B O     1 
ATOM 2025  N N     . LYS B 1 105 ? 56.080  -43.248  -109.634 1.00 95.69  ? 102 LYS B N     1 
ATOM 2026  C CA    . LYS B 1 105 ? 54.743  -43.388  -110.192 1.00 90.86  ? 102 LYS B CA    1 
ATOM 2027  C C     . LYS B 1 105 ? 53.977  -44.470  -109.439 1.00 92.31  ? 102 LYS B C     1 
ATOM 2028  O O     . LYS B 1 105 ? 54.551  -45.490  -109.040 1.00 87.80  ? 102 LYS B O     1 
ATOM 2029  C CB    . LYS B 1 105 ? 54.809  -43.725  -111.684 1.00 94.72  ? 102 LYS B CB    1 
ATOM 2030  C CG    . LYS B 1 105 ? 55.519  -42.671  -112.527 1.00 97.20  ? 102 LYS B CG    1 
ATOM 2031  C CD    . LYS B 1 105 ? 55.558  -43.058  -113.997 1.00 104.03 ? 102 LYS B CD    1 
ATOM 2032  C CE    . LYS B 1 105 ? 56.244  -41.987  -114.833 1.00 106.71 ? 102 LYS B CE    1 
ATOM 2033  N NZ    . LYS B 1 105 ? 56.318  -42.352  -116.277 1.00 102.05 ? 102 LYS B NZ    1 
ATOM 2034  N N     . PHE B 1 106 ? 52.678  -44.246  -109.256 1.00 88.87  ? 103 PHE B N     1 
ATOM 2035  C CA    . PHE B 1 106 ? 51.824  -45.126  -108.469 1.00 79.75  ? 103 PHE B CA    1 
ATOM 2036  C C     . PHE B 1 106 ? 50.916  -45.961  -109.364 1.00 75.20  ? 103 PHE B C     1 
ATOM 2037  O O     . PHE B 1 106 ? 50.331  -45.452  -110.324 1.00 68.11  ? 103 PHE B O     1 
ATOM 2038  C CB    . PHE B 1 106 ? 50.973  -44.321  -107.484 1.00 68.00  ? 103 PHE B CB    1 
ATOM 2039  C CG    . PHE B 1 106 ? 51.730  -43.837  -106.283 1.00 71.29  ? 103 PHE B CG    1 
ATOM 2040  C CD1   . PHE B 1 106 ? 52.138  -44.730  -105.306 1.00 69.20  ? 103 PHE B CD1   1 
ATOM 2041  C CD2   . PHE B 1 106 ? 52.029  -42.493  -106.124 1.00 71.35  ? 103 PHE B CD2   1 
ATOM 2042  C CE1   . PHE B 1 106 ? 52.835  -44.297  -104.195 1.00 63.16  ? 103 PHE B CE1   1 
ATOM 2043  C CE2   . PHE B 1 106 ? 52.727  -42.051  -105.014 1.00 66.43  ? 103 PHE B CE2   1 
ATOM 2044  C CZ    . PHE B 1 106 ? 53.131  -42.955  -104.048 1.00 64.97  ? 103 PHE B CZ    1 
ATOM 2045  N N     . TYR B 1 107 ? 50.789  -47.244  -109.025 1.00 73.06  ? 104 TYR B N     1 
ATOM 2046  C CA    . TYR B 1 107 ? 49.956  -48.189  -109.761 1.00 71.38  ? 104 TYR B CA    1 
ATOM 2047  C C     . TYR B 1 107 ? 49.019  -48.842  -108.756 1.00 64.71  ? 104 TYR B C     1 
ATOM 2048  O O     . TYR B 1 107 ? 49.476  -49.532  -107.838 1.00 64.39  ? 104 TYR B O     1 
ATOM 2049  C CB    . TYR B 1 107 ? 50.796  -49.254  -110.492 1.00 80.19  ? 104 TYR B CB    1 
ATOM 2050  C CG    . TYR B 1 107 ? 51.855  -48.733  -111.463 1.00 94.83  ? 104 TYR B CG    1 
ATOM 2051  C CD1   . TYR B 1 107 ? 52.885  -47.901  -111.034 1.00 98.05  ? 104 TYR B CD1   1 
ATOM 2052  C CD2   . TYR B 1 107 ? 51.824  -49.083  -112.809 1.00 97.15  ? 104 TYR B CD2   1 
ATOM 2053  C CE1   . TYR B 1 107 ? 53.847  -47.429  -111.913 1.00 100.92 ? 104 TYR B CE1   1 
ATOM 2054  C CE2   . TYR B 1 107 ? 52.786  -48.615  -113.698 1.00 108.26 ? 104 TYR B CE2   1 
ATOM 2055  C CZ    . TYR B 1 107 ? 53.795  -47.788  -113.242 1.00 109.08 ? 104 TYR B CZ    1 
ATOM 2056  O OH    . TYR B 1 107 ? 54.755  -47.314  -114.110 1.00 100.76 ? 104 TYR B OH    1 
ATOM 2057  N N     . VAL B 1 108 ? 47.716  -48.609  -108.916 1.00 60.12  ? 105 VAL B N     1 
ATOM 2058  C CA    . VAL B 1 108 ? 46.717  -48.965  -107.914 1.00 57.37  ? 105 VAL B CA    1 
ATOM 2059  C C     . VAL B 1 108 ? 45.590  -49.734  -108.590 1.00 61.22  ? 105 VAL B C     1 
ATOM 2060  O O     . VAL B 1 108 ? 45.078  -49.304  -109.629 1.00 54.91  ? 105 VAL B O     1 
ATOM 2061  C CB    . VAL B 1 108 ? 46.159  -47.721  -107.197 1.00 59.34  ? 105 VAL B CB    1 
ATOM 2062  C CG1   . VAL B 1 108 ? 45.043  -48.115  -106.238 1.00 56.13  ? 105 VAL B CG1   1 
ATOM 2063  C CG2   . VAL B 1 108 ? 47.270  -46.981  -106.463 1.00 60.61  ? 105 VAL B CG2   1 
ATOM 2064  N N     . GLY B 1 109 ? 45.198  -50.858  -107.993 1.00 60.64  ? 106 GLY B N     1 
ATOM 2065  C CA    . GLY B 1 109 ? 44.017  -51.580  -108.427 1.00 57.47  ? 106 GLY B CA    1 
ATOM 2066  C C     . GLY B 1 109 ? 43.002  -51.708  -107.309 1.00 55.66  ? 106 GLY B C     1 
ATOM 2067  O O     . GLY B 1 109 ? 43.358  -52.073  -106.184 1.00 58.43  ? 106 GLY B O     1 
ATOM 2068  N N     . VAL B 1 110 ? 41.739  -51.397  -107.596 1.00 52.25  ? 107 VAL B N     1 
ATOM 2069  C CA    . VAL B 1 110 ? 40.682  -51.392  -106.589 1.00 53.82  ? 107 VAL B CA    1 
ATOM 2070  C C     . VAL B 1 110 ? 39.440  -52.049  -107.177 1.00 49.13  ? 107 VAL B C     1 
ATOM 2071  O O     . VAL B 1 110 ? 39.016  -51.705  -108.285 1.00 45.63  ? 107 VAL B O     1 
ATOM 2072  C CB    . VAL B 1 110 ? 40.368  -49.962  -106.102 1.00 48.60  ? 107 VAL B CB    1 
ATOM 2073  C CG1   . VAL B 1 110 ? 39.115  -49.947  -105.244 1.00 52.48  ? 107 VAL B CG1   1 
ATOM 2074  C CG2   . VAL B 1 110 ? 41.552  -49.397  -105.321 1.00 50.85  ? 107 VAL B CG2   1 
ATOM 2075  N N     . CYS B 1 111 ? 38.871  -53.007  -106.447 1.00 50.35  ? 108 CYS B N     1 
ATOM 2076  C CA    . CYS B 1 111 ? 37.614  -53.647  -106.809 1.00 40.19  ? 108 CYS B CA    1 
ATOM 2077  C C     . CYS B 1 111 ? 36.497  -53.188  -105.879 1.00 43.02  ? 108 CYS B C     1 
ATOM 2078  O O     . CYS B 1 111 ? 36.736  -52.852  -104.715 1.00 51.09  ? 108 CYS B O     1 
ATOM 2079  C CB    . CYS B 1 111 ? 37.729  -55.172  -106.747 1.00 42.88  ? 108 CYS B CB    1 
ATOM 2080  S SG    . CYS B 1 111 ? 37.895  -55.832  -105.078 1.00 50.97  ? 108 CYS B SG    1 
ATOM 2081  N N     . ALA B 1 112 ? 35.270  -53.188  -106.398 1.00 38.94  ? 109 ALA B N     1 
ATOM 2082  C CA    . ALA B 1 112 ? 34.086  -52.822  -105.633 1.00 43.64  ? 109 ALA B CA    1 
ATOM 2083  C C     . ALA B 1 112 ? 32.945  -53.762  -105.993 1.00 44.54  ? 109 ALA B C     1 
ATOM 2084  O O     . ALA B 1 112 ? 32.838  -54.222  -107.133 1.00 44.89  ? 109 ALA B O     1 
ATOM 2085  C CB    . ALA B 1 112 ? 33.677  -51.365  -105.887 1.00 37.26  ? 109 ALA B CB    1 
ATOM 2086  N N     . PHE B 1 113 ? 32.092  -54.043  -105.012 1.00 52.23  ? 110 PHE B N     1 
ATOM 2087  C CA    . PHE B 1 113 ? 30.936  -54.918  -105.194 1.00 46.18  ? 110 PHE B CA    1 
ATOM 2088  C C     . PHE B 1 113 ? 29.682  -54.075  -104.996 1.00 48.07  ? 110 PHE B C     1 
ATOM 2089  O O     . PHE B 1 113 ? 29.376  -53.659  -103.872 1.00 49.71  ? 110 PHE B O     1 
ATOM 2090  C CB    . PHE B 1 113 ? 30.954  -56.092  -104.213 1.00 45.12  ? 110 PHE B CB    1 
ATOM 2091  C CG    . PHE B 1 113 ? 32.126  -57.001  -104.374 1.00 42.29  ? 110 PHE B CG    1 
ATOM 2092  C CD1   . PHE B 1 113 ? 33.401  -56.533  -104.134 1.00 43.62  ? 110 PHE B CD1   1 
ATOM 2093  C CD2   . PHE B 1 113 ? 31.956  -58.331  -104.712 1.00 49.87  ? 110 PHE B CD2   1 
ATOM 2094  C CE1   . PHE B 1 113 ? 34.489  -57.338  -104.282 1.00 50.99  ? 110 PHE B CE1   1 
ATOM 2095  C CE2   . PHE B 1 113 ? 33.061  -59.169  -104.846 1.00 51.00  ? 110 PHE B CE2   1 
ATOM 2096  C CZ    . PHE B 1 113 ? 34.333  -58.658  -104.627 1.00 49.73  ? 110 PHE B CZ    1 
ATOM 2097  N N     . VAL B 1 114 ? 28.962  -53.823  -106.085 1.00 43.55  ? 111 VAL B N     1 
ATOM 2098  C CA    . VAL B 1 114 ? 27.781  -52.968  -106.082 1.00 44.77  ? 111 VAL B CA    1 
ATOM 2099  C C     . VAL B 1 114 ? 26.561  -53.850  -106.299 1.00 44.60  ? 111 VAL B C     1 
ATOM 2100  O O     . VAL B 1 114 ? 26.561  -54.715  -107.183 1.00 45.66  ? 111 VAL B O     1 
ATOM 2101  C CB    . VAL B 1 114 ? 27.879  -51.870  -107.157 1.00 31.17  ? 111 VAL B CB    1 
ATOM 2102  C CG1   . VAL B 1 114 ? 26.631  -51.012  -107.146 1.00 37.41  ? 111 VAL B CG1   1 
ATOM 2103  C CG2   . VAL B 1 114 ? 29.117  -51.020  -106.919 1.00 34.46  ? 111 VAL B CG2   1 
ATOM 2104  N N     . ARG B 1 115 ? 25.527  -53.636  -105.487 1.00 41.46  ? 112 ARG B N     1 
ATOM 2105  C CA    . ARG B 1 115 ? 24.288  -54.401  -105.559 1.00 43.36  ? 112 ARG B CA    1 
ATOM 2106  C C     . ARG B 1 115 ? 23.134  -53.460  -105.872 1.00 48.27  ? 112 ARG B C     1 
ATOM 2107  O O     . ARG B 1 115 ? 22.812  -52.578  -105.069 1.00 53.05  ? 112 ARG B O     1 
ATOM 2108  C CB    . ARG B 1 115 ? 24.018  -55.147  -104.250 1.00 45.99  ? 112 ARG B CB    1 
ATOM 2109  C CG    . ARG B 1 115 ? 22.624  -55.759  -104.180 1.00 51.64  ? 112 ARG B CG    1 
ATOM 2110  C CD    . ARG B 1 115 ? 22.357  -56.446  -102.846 1.00 46.39  ? 112 ARG B CD    1 
ATOM 2111  N NE    . ARG B 1 115 ? 20.944  -56.386  -102.476 1.00 50.41  ? 112 ARG B NE    1 
ATOM 2112  C CZ    . ARG B 1 115 ? 20.275  -57.393  -101.921 1.00 55.34  ? 112 ARG B CZ    1 
ATOM 2113  N NH1   . ARG B 1 115 ? 20.895  -58.543  -101.681 1.00 54.23  ? 112 ARG B NH1   1 
ATOM 2114  N NH2   . ARG B 1 115 ? 18.989  -57.255  -101.613 1.00 43.57  ? 112 ARG B NH2   1 
ATOM 2115  N N     . VAL B 1 116 ? 22.503  -53.664  -107.021 1.00 48.27  ? 113 VAL B N     1 
ATOM 2116  C CA    . VAL B 1 116 ? 21.334  -52.888  -107.420 1.00 45.76  ? 113 VAL B CA    1 
ATOM 2117  C C     . VAL B 1 116 ? 20.089  -53.622  -106.956 1.00 47.70  ? 113 VAL B C     1 
ATOM 2118  O O     . VAL B 1 116 ? 20.015  -54.852  -107.035 1.00 44.31  ? 113 VAL B O     1 
ATOM 2119  C CB    . VAL B 1 116 ? 21.307  -52.667  -108.944 1.00 44.17  ? 113 VAL B CB    1 
ATOM 2120  C CG1   . VAL B 1 116 ? 20.034  -51.949  -109.353 1.00 38.97  ? 113 VAL B CG1   1 
ATOM 2121  C CG2   . VAL B 1 116 ? 22.516  -51.877  -109.385 1.00 50.90  ? 113 VAL B CG2   1 
ATOM 2122  N N     . GLN B 1 117 ? 19.116  -52.870  -106.447 1.00 41.70  ? 114 GLN B N     1 
ATOM 2123  C CA    . GLN B 1 117 ? 17.845  -53.421  -106.004 1.00 41.73  ? 114 GLN B CA    1 
ATOM 2124  C C     . GLN B 1 117 ? 16.702  -52.596  -106.575 1.00 49.43  ? 114 GLN B C     1 
ATOM 2125  O O     . GLN B 1 117 ? 16.781  -51.365  -106.637 1.00 51.61  ? 114 GLN B O     1 
ATOM 2126  C CB    . GLN B 1 117 ? 17.754  -53.449  -104.474 1.00 49.93  ? 114 GLN B CB    1 
ATOM 2127  C CG    . GLN B 1 117 ? 16.536  -54.176  -103.917 1.00 52.36  ? 114 GLN B CG    1 
ATOM 2128  C CD    . GLN B 1 117 ? 16.409  -54.007  -102.414 1.00 46.96  ? 114 GLN B CD    1 
ATOM 2129  O OE1   . GLN B 1 117 ? 17.007  -53.104  -101.828 1.00 54.49  ? 114 GLN B OE1   1 
ATOM 2130  N NE2   . GLN B 1 117 ? 15.637  -54.883  -101.781 1.00 47.74  ? 114 GLN B NE2   1 
ATOM 2131  N N     . LEU B 1 118 ? 15.638  -53.279  -106.979 1.00 52.13  ? 115 LEU B N     1 
ATOM 2132  C CA    . LEU B 1 118 ? 14.424  -52.636  -107.454 1.00 55.79  ? 115 LEU B CA    1 
ATOM 2133  C C     . LEU B 1 118 ? 13.435  -52.507  -106.305 1.00 54.05  ? 115 LEU B C     1 
ATOM 2134  O O     . LEU B 1 118 ? 13.605  -53.097  -105.237 1.00 57.86  ? 115 LEU B O     1 
ATOM 2135  C CB    . LEU B 1 118 ? 13.800  -53.432  -108.602 1.00 59.91  ? 115 LEU B CB    1 
ATOM 2136  C CG    . LEU B 1 118 ? 14.674  -53.633  -109.837 1.00 53.78  ? 115 LEU B CG    1 
ATOM 2137  C CD1   . LEU B 1 118 ? 13.895  -54.374  -110.907 1.00 59.43  ? 115 LEU B CD1   1 
ATOM 2138  C CD2   . LEU B 1 118 ? 15.180  -52.298  -110.351 1.00 42.04  ? 115 LEU B CD2   1 
ATOM 2139  N N     . LYS B 1 119 ? 12.381  -51.724  -106.537 1.00 57.81  ? 116 LYS B N     1 
ATOM 2140  C CA    . LYS B 1 119 ? 11.416  -51.481  -105.473 1.00 56.55  ? 116 LYS B CA    1 
ATOM 2141  C C     . LYS B 1 119 ? 10.639  -52.733  -105.082 1.00 61.07  ? 116 LYS B C     1 
ATOM 2142  O O     . LYS B 1 119 ? 9.870   -52.681  -104.116 1.00 64.18  ? 116 LYS B O     1 
ATOM 2143  C CB    . LYS B 1 119 ? 10.432  -50.380  -105.871 1.00 58.39  ? 116 LYS B CB    1 
ATOM 2144  C CG    . LYS B 1 119 ? 9.485   -50.753  -106.997 1.00 51.99  ? 116 LYS B CG    1 
ATOM 2145  C CD    . LYS B 1 119 ? 8.417   -49.686  -107.161 1.00 64.24  ? 116 LYS B CD    1 
ATOM 2146  C CE    . LYS B 1 119 ? 7.611   -49.888  -108.427 1.00 60.82  ? 116 LYS B CE    1 
ATOM 2147  N NZ    . LYS B 1 119 ? 6.626   -48.792  -108.627 1.00 59.79  ? 116 LYS B NZ    1 
ATOM 2148  N N     . ASP B 1 120 ? 10.816  -53.848  -105.792 1.00 60.08  ? 117 ASP B N     1 
ATOM 2149  C CA    . ASP B 1 120 ? 10.145  -55.094  -105.451 1.00 62.02  ? 117 ASP B CA    1 
ATOM 2150  C C     . ASP B 1 120 ? 11.046  -56.100  -104.751 1.00 62.79  ? 117 ASP B C     1 
ATOM 2151  O O     . ASP B 1 120 ? 10.579  -57.190  -104.412 1.00 65.97  ? 117 ASP B O     1 
ATOM 2152  C CB    . ASP B 1 120 ? 9.547   -55.732  -106.712 1.00 61.62  ? 117 ASP B CB    1 
ATOM 2153  C CG    . ASP B 1 120 ? 10.600  -56.360  -107.606 1.00 57.99  ? 117 ASP B CG    1 
ATOM 2154  O OD1   . ASP B 1 120 ? 11.698  -55.779  -107.731 1.00 58.21  ? 117 ASP B OD1   1 
ATOM 2155  O OD2   . ASP B 1 120 ? 10.331  -57.436  -108.181 1.00 69.51  ? 117 ASP B OD2   1 
ATOM 2156  N N     . GLY B 1 121 ? 12.299  -55.745  -104.471 1.00 59.26  ? 118 GLY B N     1 
ATOM 2157  C CA    . GLY B 1 121 ? 13.244  -56.644  -103.849 1.00 57.21  ? 118 GLY B CA    1 
ATOM 2158  C C     . GLY B 1 121 ? 14.183  -57.343  -104.812 1.00 55.01  ? 118 GLY B C     1 
ATOM 2159  O O     . GLY B 1 121 ? 15.198  -57.896  -104.369 1.00 59.59  ? 118 GLY B O     1 
ATOM 2160  N N     . SER B 1 122 ? 13.867  -57.348  -106.106 1.00 57.59  ? 119 SER B N     1 
ATOM 2161  C CA    . SER B 1 122 ? 14.768  -57.922  -107.097 1.00 48.67  ? 119 SER B CA    1 
ATOM 2162  C C     . SER B 1 122 ? 16.125  -57.228  -107.030 1.00 45.94  ? 119 SER B C     1 
ATOM 2163  O O     . SER B 1 122 ? 16.209  -56.013  -106.832 1.00 50.02  ? 119 SER B O     1 
ATOM 2164  C CB    . SER B 1 122 ? 14.163  -57.789  -108.496 1.00 51.92  ? 119 SER B CB    1 
ATOM 2165  O OG    . SER B 1 122 ? 15.028  -58.320  -109.484 1.00 70.66  ? 119 SER B OG    1 
ATOM 2166  N N     . TYR B 1 123 ? 17.194  -58.003  -107.208 1.00 44.05  ? 120 TYR B N     1 
ATOM 2167  C CA    . TYR B 1 123 ? 18.535  -57.476  -107.000 1.00 51.24  ? 120 TYR B CA    1 
ATOM 2168  C C     . TYR B 1 123 ? 19.515  -58.084  -107.993 1.00 45.51  ? 120 TYR B C     1 
ATOM 2169  O O     . TYR B 1 123 ? 19.315  -59.194  -108.489 1.00 43.27  ? 120 TYR B O     1 
ATOM 2170  C CB    . TYR B 1 123 ? 19.011  -57.727  -105.559 1.00 43.37  ? 120 TYR B CB    1 
ATOM 2171  C CG    . TYR B 1 123 ? 19.017  -59.183  -105.133 1.00 39.45  ? 120 TYR B CG    1 
ATOM 2172  C CD1   . TYR B 1 123 ? 20.133  -59.987  -105.333 1.00 42.81  ? 120 TYR B CD1   1 
ATOM 2173  C CD2   . TYR B 1 123 ? 17.909  -59.747  -104.510 1.00 39.89  ? 120 TYR B CD2   1 
ATOM 2174  C CE1   . TYR B 1 123 ? 20.139  -61.317  -104.937 1.00 37.05  ? 120 TYR B CE1   1 
ATOM 2175  C CE2   . TYR B 1 123 ? 17.907  -61.072  -104.110 1.00 30.18  ? 120 TYR B CE2   1 
ATOM 2176  C CZ    . TYR B 1 123 ? 19.023  -61.852  -104.326 1.00 28.63  ? 120 TYR B CZ    1 
ATOM 2177  O OH    . TYR B 1 123 ? 19.023  -63.170  -103.932 1.00 28.74  ? 120 TYR B OH    1 
ATOM 2178  N N     . HIS B 1 124 ? 20.580  -57.336  -108.276 1.00 39.04  ? 121 HIS B N     1 
ATOM 2179  C CA    . HIS B 1 124 ? 21.703  -57.835  -109.059 1.00 43.11  ? 121 HIS B CA    1 
ATOM 2180  C C     . HIS B 1 124 ? 22.980  -57.232  -108.499 1.00 47.20  ? 121 HIS B C     1 
ATOM 2181  O O     . HIS B 1 124 ? 23.058  -56.016  -108.302 1.00 51.55  ? 121 HIS B O     1 
ATOM 2182  C CB    . HIS B 1 124 ? 21.555  -57.494  -110.550 1.00 54.45  ? 121 HIS B CB    1 
ATOM 2183  C CG    . HIS B 1 124 ? 20.519  -58.311  -111.260 1.00 53.52  ? 121 HIS B CG    1 
ATOM 2184  N ND1   . HIS B 1 124 ? 20.519  -59.689  -111.248 1.00 52.15  ? 121 HIS B ND1   1 
ATOM 2185  C CD2   . HIS B 1 124 ? 19.455  -57.942  -112.011 1.00 49.69  ? 121 HIS B CD2   1 
ATOM 2186  C CE1   . HIS B 1 124 ? 19.496  -60.134  -111.956 1.00 50.72  ? 121 HIS B CE1   1 
ATOM 2187  N NE2   . HIS B 1 124 ? 18.834  -59.094  -112.430 1.00 52.85  ? 121 HIS B NE2   1 
ATOM 2188  N N     . GLU B 1 125 ? 23.972  -58.079  -108.234 1.00 39.46  ? 122 GLU B N     1 
ATOM 2189  C CA    . GLU B 1 125 ? 25.244  -57.655  -107.668 1.00 40.29  ? 122 GLU B CA    1 
ATOM 2190  C C     . GLU B 1 125 ? 26.368  -58.081  -108.601 1.00 37.33  ? 122 GLU B C     1 
ATOM 2191  O O     . GLU B 1 125 ? 26.350  -59.193  -109.138 1.00 40.43  ? 122 GLU B O     1 
ATOM 2192  C CB    . GLU B 1 125 ? 25.444  -58.245  -106.259 1.00 40.88  ? 122 GLU B CB    1 
ATOM 2193  C CG    . GLU B 1 125 ? 26.767  -57.881  -105.588 1.00 47.04  ? 122 GLU B CG    1 
ATOM 2194  C CD    . GLU B 1 125 ? 26.871  -58.413  -104.164 1.00 47.36  ? 122 GLU B CD    1 
ATOM 2195  O OE1   . GLU B 1 125 ? 26.134  -59.363  -103.826 1.00 46.00  ? 122 GLU B OE1   1 
ATOM 2196  O OE2   . GLU B 1 125 ? 27.684  -57.878  -103.379 1.00 46.22  ? 122 GLU B OE2   1 
ATOM 2197  N N     . ASP B 1 126 ? 27.338  -57.194  -108.805 1.00 33.17  ? 123 ASP B N     1 
ATOM 2198  C CA    . ASP B 1 126 ? 28.445  -57.488  -109.703 1.00 40.39  ? 123 ASP B CA    1 
ATOM 2199  C C     . ASP B 1 126 ? 29.707  -56.804  -109.193 1.00 46.76  ? 123 ASP B C     1 
ATOM 2200  O O     . ASP B 1 126 ? 29.693  -56.083  -108.191 1.00 47.56  ? 123 ASP B O     1 
ATOM 2201  C CB    . ASP B 1 126 ? 28.113  -57.063  -111.138 1.00 49.93  ? 123 ASP B CB    1 
ATOM 2202  C CG    . ASP B 1 126 ? 28.671  -58.022  -112.174 1.00 50.22  ? 123 ASP B CG    1 
ATOM 2203  O OD1   . ASP B 1 126 ? 29.900  -58.240  -112.192 1.00 46.80  ? 123 ASP B OD1   1 
ATOM 2204  O OD2   . ASP B 1 126 ? 27.875  -58.565  -112.967 1.00 54.23  ? 123 ASP B OD2   1 
ATOM 2205  N N     . VAL B 1 127 ? 30.805  -57.035  -109.906 1.00 51.77  ? 124 VAL B N     1 
ATOM 2206  C CA    . VAL B 1 127 ? 32.125  -56.546  -109.531 1.00 43.02  ? 124 VAL B CA    1 
ATOM 2207  C C     . VAL B 1 127 ? 32.522  -55.419  -110.470 1.00 50.82  ? 124 VAL B C     1 
ATOM 2208  O O     . VAL B 1 127 ? 32.334  -55.517  -111.688 1.00 54.73  ? 124 VAL B O     1 
ATOM 2209  C CB    . VAL B 1 127 ? 33.155  -57.696  -109.571 1.00 49.04  ? 124 VAL B CB    1 
ATOM 2210  C CG1   . VAL B 1 127 ? 34.552  -57.174  -109.844 1.00 64.47  ? 124 VAL B CG1   1 
ATOM 2211  C CG2   . VAL B 1 127 ? 33.141  -58.455  -108.261 1.00 57.57  ? 124 VAL B CG2   1 
ATOM 2212  N N     . GLY B 1 128 ? 33.061  -54.342  -109.903 1.00 43.52  ? 125 GLY B N     1 
ATOM 2213  C CA    . GLY B 1 128 ? 33.709  -53.316  -110.694 1.00 43.68  ? 125 GLY B CA    1 
ATOM 2214  C C     . GLY B 1 128 ? 35.178  -53.206  -110.355 1.00 42.71  ? 125 GLY B C     1 
ATOM 2215  O O     . GLY B 1 128 ? 35.586  -53.609  -109.262 1.00 48.04  ? 125 GLY B O     1 
ATOM 2216  N N     . TYR B 1 129 ? 35.990  -52.692  -111.279 1.00 51.10  ? 126 TYR B N     1 
ATOM 2217  C CA    . TYR B 1 129 ? 37.403  -52.466  -111.004 1.00 46.84  ? 126 TYR B CA    1 
ATOM 2218  C C     . TYR B 1 129 ? 37.809  -51.045  -111.355 1.00 42.72  ? 126 TYR B C     1 
ATOM 2219  O O     . TYR B 1 129 ? 37.208  -50.414  -112.221 1.00 53.01  ? 126 TYR B O     1 
ATOM 2220  C CB    . TYR B 1 129 ? 38.300  -53.444  -111.773 1.00 46.84  ? 126 TYR B CB    1 
ATOM 2221  C CG    . TYR B 1 129 ? 39.542  -53.848  -111.007 1.00 51.54  ? 126 TYR B CG    1 
ATOM 2222  C CD1   . TYR B 1 129 ? 39.458  -54.613  -109.851 1.00 44.40  ? 126 TYR B CD1   1 
ATOM 2223  C CD2   . TYR B 1 129 ? 40.800  -53.423  -111.419 1.00 51.45  ? 126 TYR B CD2   1 
ATOM 2224  C CE1   . TYR B 1 129 ? 40.602  -54.970  -109.152 1.00 47.04  ? 126 TYR B CE1   1 
ATOM 2225  C CE2   . TYR B 1 129 ? 41.939  -53.769  -110.728 1.00 46.40  ? 126 TYR B CE2   1 
ATOM 2226  C CZ    . TYR B 1 129 ? 41.840  -54.539  -109.598 1.00 49.35  ? 126 TYR B CZ    1 
ATOM 2227  O OH    . TYR B 1 129 ? 43.000  -54.867  -108.933 1.00 48.99  ? 126 TYR B OH    1 
ATOM 2228  N N     . GLY B 1 130 ? 38.828  -50.553  -110.655 1.00 40.99  ? 127 GLY B N     1 
ATOM 2229  C CA    . GLY B 1 130 ? 39.362  -49.226  -110.878 1.00 53.71  ? 127 GLY B CA    1 
ATOM 2230  C C     . GLY B 1 130 ? 40.880  -49.211  -110.878 1.00 63.61  ? 127 GLY B C     1 
ATOM 2231  O O     . GLY B 1 130 ? 41.513  -49.768  -109.976 1.00 58.09  ? 127 GLY B O     1 
ATOM 2232  N N     . VAL B 1 131 ? 41.478  -48.568  -111.880 1.00 64.95  ? 128 VAL B N     1 
ATOM 2233  C CA    . VAL B 1 131 ? 42.916  -48.602  -112.116 1.00 60.05  ? 128 VAL B CA    1 
ATOM 2234  C C     . VAL B 1 131 ? 43.427  -47.170  -112.232 1.00 61.24  ? 128 VAL B C     1 
ATOM 2235  O O     . VAL B 1 131 ? 42.741  -46.300  -112.782 1.00 62.43  ? 128 VAL B O     1 
ATOM 2236  C CB    . VAL B 1 131 ? 43.240  -49.418  -113.388 1.00 61.78  ? 128 VAL B CB    1 
ATOM 2237  C CG1   . VAL B 1 131 ? 44.734  -49.489  -113.626 1.00 73.76  ? 128 VAL B CG1   1 
ATOM 2238  C CG2   . VAL B 1 131 ? 42.656  -50.819  -113.281 1.00 57.95  ? 128 VAL B CG2   1 
ATOM 2239  N N     . SER B 1 132 ? 44.631  -46.926  -111.716 1.00 60.06  ? 129 SER B N     1 
ATOM 2240  C CA    . SER B 1 132 ? 45.294  -45.634  -111.888 1.00 66.76  ? 129 SER B CA    1 
ATOM 2241  C C     . SER B 1 132 ? 46.793  -45.888  -111.956 1.00 76.51  ? 129 SER B C     1 
ATOM 2242  O O     . SER B 1 132 ? 47.408  -46.249  -110.947 1.00 65.82  ? 129 SER B O     1 
ATOM 2243  C CB    . SER B 1 132 ? 44.941  -44.678  -110.752 1.00 67.86  ? 129 SER B CB    1 
ATOM 2244  O OG    . SER B 1 132 ? 45.777  -43.530  -110.758 1.00 64.04  ? 129 SER B OG    1 
ATOM 2245  N N     . GLU B 1 133 ? 47.370  -45.719  -113.145 1.00 85.48  ? 130 GLU B N     1 
ATOM 2246  C CA    . GLU B 1 133 ? 48.785  -45.973  -113.381 1.00 81.38  ? 130 GLU B CA    1 
ATOM 2247  C C     . GLU B 1 133 ? 49.444  -44.695  -113.879 1.00 76.78  ? 130 GLU B C     1 
ATOM 2248  O O     . GLU B 1 133 ? 48.911  -44.022  -114.768 1.00 72.49  ? 130 GLU B O     1 
ATOM 2249  C CB    . GLU B 1 133 ? 48.986  -47.098  -114.407 1.00 84.21  ? 130 GLU B CB    1 
ATOM 2250  C CG    . GLU B 1 133 ? 47.910  -48.181  -114.385 1.00 88.15  ? 130 GLU B CG    1 
ATOM 2251  C CD    . GLU B 1 133 ? 48.292  -49.445  -115.148 1.00 91.02  ? 130 GLU B CD    1 
ATOM 2252  O OE1   . GLU B 1 133 ? 49.418  -49.955  -114.954 1.00 103.15 ? 130 GLU B OE1   1 
ATOM 2253  O OE2   . GLU B 1 133 ? 47.496  -49.872  -116.014 1.00 82.37  ? 130 GLU B OE2   1 
ATOM 2254  N N     . GLY B 1 134 ? 50.583  -44.346  -113.285 1.00 76.90  ? 131 GLY B N     1 
ATOM 2255  C CA    . GLY B 1 134 ? 51.418  -43.271  -113.771 1.00 79.39  ? 131 GLY B CA    1 
ATOM 2256  C C     . GLY B 1 134 ? 51.390  -42.017  -112.928 1.00 71.73  ? 131 GLY B C     1 
ATOM 2257  O O     . GLY B 1 134 ? 52.342  -41.228  -112.991 1.00 76.44  ? 131 GLY B O     1 
ATOM 2258  N N     . LEU B 1 135 ? 50.334  -41.804  -112.149 1.00 72.85  ? 132 LEU B N     1 
ATOM 2259  C CA    . LEU B 1 135 ? 50.221  -40.573  -111.383 1.00 72.94  ? 132 LEU B CA    1 
ATOM 2260  C C     . LEU B 1 135 ? 51.276  -40.514  -110.286 1.00 74.10  ? 132 LEU B C     1 
ATOM 2261  O O     . LEU B 1 135 ? 51.692  -41.535  -109.731 1.00 73.75  ? 132 LEU B O     1 
ATOM 2262  C CB    . LEU B 1 135 ? 48.831  -40.439  -110.763 1.00 67.04  ? 132 LEU B CB    1 
ATOM 2263  C CG    . LEU B 1 135 ? 47.684  -40.076  -111.700 1.00 69.67  ? 132 LEU B CG    1 
ATOM 2264  C CD1   . LEU B 1 135 ? 46.383  -40.001  -110.927 1.00 65.91  ? 132 LEU B CD1   1 
ATOM 2265  C CD2   . LEU B 1 135 ? 47.983  -38.756  -112.383 1.00 67.49  ? 132 LEU B CD2   1 
ATOM 2266  N N     . LYS B 1 136 ? 51.711  -39.295  -109.982 1.00 69.49  ? 133 LYS B N     1 
ATOM 2267  C CA    . LYS B 1 136 ? 52.683  -39.066  -108.926 1.00 69.21  ? 133 LYS B CA    1 
ATOM 2268  C C     . LYS B 1 136 ? 52.028  -38.886  -107.564 1.00 71.25  ? 133 LYS B C     1 
ATOM 2269  O O     . LYS B 1 136 ? 52.716  -38.985  -106.542 1.00 75.25  ? 133 LYS B O     1 
ATOM 2270  C CB    . LYS B 1 136 ? 53.528  -37.829  -109.252 1.00 75.71  ? 133 LYS B CB    1 
ATOM 2271  C CG    . LYS B 1 136 ? 54.280  -37.918  -110.577 1.00 92.70  ? 133 LYS B CG    1 
ATOM 2272  C CD    . LYS B 1 136 ? 54.937  -36.590  -110.925 1.00 90.48  ? 133 LYS B CD    1 
ATOM 2273  C CE    . LYS B 1 136 ? 56.260  -36.404  -110.197 1.00 83.15  ? 133 LYS B CE    1 
ATOM 2274  N NZ    . LYS B 1 136 ? 57.267  -37.424  -110.600 1.00 86.91  ? 133 LYS B NZ    1 
ATOM 2275  N N     . SER B 1 137 ? 50.723  -38.615  -107.530 1.00 67.57  ? 134 SER B N     1 
ATOM 2276  C CA    . SER B 1 137 ? 49.988  -38.416  -106.286 1.00 58.05  ? 134 SER B CA    1 
ATOM 2277  C C     . SER B 1 137 ? 49.361  -39.731  -105.835 1.00 65.24  ? 134 SER B C     1 
ATOM 2278  O O     . SER B 1 137 ? 48.520  -40.300  -106.539 1.00 71.35  ? 134 SER B O     1 
ATOM 2279  C CB    . SER B 1 137 ? 48.916  -37.340  -106.464 1.00 71.68  ? 134 SER B CB    1 
ATOM 2280  O OG    . SER B 1 137 ? 48.061  -37.272  -105.335 1.00 62.35  ? 134 SER B OG    1 
ATOM 2281  N N     . LYS B 1 138 ? 49.783  -40.216  -104.665 1.00 66.28  ? 135 LYS B N     1 
ATOM 2282  C CA    . LYS B 1 138 ? 49.194  -41.425  -104.095 1.00 54.35  ? 135 LYS B CA    1 
ATOM 2283  C C     . LYS B 1 138 ? 47.700  -41.236  -103.845 1.00 56.35  ? 135 LYS B C     1 
ATOM 2284  O O     . LYS B 1 138 ? 46.877  -42.098  -104.189 1.00 50.63  ? 135 LYS B O     1 
ATOM 2285  C CB    . LYS B 1 138 ? 49.926  -41.760  -102.793 1.00 58.99  ? 135 LYS B CB    1 
ATOM 2286  C CG    . LYS B 1 138 ? 49.511  -43.035  -102.078 1.00 53.03  ? 135 LYS B CG    1 
ATOM 2287  C CD    . LYS B 1 138 ? 50.703  -43.581  -101.303 1.00 42.29  ? 135 LYS B CD    1 
ATOM 2288  C CE    . LYS B 1 138 ? 50.293  -44.461  -100.141 1.00 51.65  ? 135 LYS B CE    1 
ATOM 2289  N NZ    . LYS B 1 138 ? 51.481  -44.793  -99.301  1.00 66.62  ? 135 LYS B NZ    1 
ATOM 2290  N N     . ALA B 1 139 ? 47.332  -40.087  -103.270 1.00 58.58  ? 136 ALA B N     1 
ATOM 2291  C CA    . ALA B 1 139 ? 45.937  -39.821  -102.935 1.00 52.35  ? 136 ALA B CA    1 
ATOM 2292  C C     . ALA B 1 139 ? 45.064  -39.733  -104.180 1.00 54.96  ? 136 ALA B C     1 
ATOM 2293  O O     . ALA B 1 139 ? 43.960  -40.287  -104.210 1.00 56.91  ? 136 ALA B O     1 
ATOM 2294  C CB    . ALA B 1 139 ? 45.832  -38.534  -102.120 1.00 58.23  ? 136 ALA B CB    1 
ATOM 2295  N N     . LEU B 1 140 ? 45.539  -39.038  -105.217 1.00 62.95  ? 137 LEU B N     1 
ATOM 2296  C CA    . LEU B 1 140 ? 44.734  -38.884  -106.424 1.00 55.06  ? 137 LEU B CA    1 
ATOM 2297  C C     . LEU B 1 140 ? 44.583  -40.214  -107.146 1.00 59.76  ? 137 LEU B C     1 
ATOM 2298  O O     . LEU B 1 140 ? 43.513  -40.517  -107.693 1.00 58.64  ? 137 LEU B O     1 
ATOM 2299  C CB    . LEU B 1 140 ? 45.370  -37.840  -107.342 1.00 53.14  ? 137 LEU B CB    1 
ATOM 2300  C CG    . LEU B 1 140 ? 44.837  -36.407  -107.254 1.00 61.12  ? 137 LEU B CG    1 
ATOM 2301  C CD1   . LEU B 1 140 ? 44.962  -35.872  -105.840 1.00 66.13  ? 137 LEU B CD1   1 
ATOM 2302  C CD2   . LEU B 1 140 ? 45.574  -35.503  -108.230 1.00 61.04  ? 137 LEU B CD2   1 
ATOM 2303  N N     . SER B 1 141 ? 45.635  -41.034  -107.121 1.00 59.07  ? 138 SER B N     1 
ATOM 2304  C CA    . SER B 1 141 ? 45.552  -42.375  -107.686 1.00 56.44  ? 138 SER B CA    1 
ATOM 2305  C C     . SER B 1 141 ? 44.479  -43.191  -106.979 1.00 60.60  ? 138 SER B C     1 
ATOM 2306  O O     . SER B 1 141 ? 43.634  -43.825  -107.627 1.00 61.18  ? 138 SER B O     1 
ATOM 2307  C CB    . SER B 1 141 ? 46.911  -43.070  -107.589 1.00 52.85  ? 138 SER B CB    1 
ATOM 2308  O OG    . SER B 1 141 ? 47.893  -42.384  -108.344 1.00 68.32  ? 138 SER B OG    1 
ATOM 2309  N N     . LEU B 1 142 ? 44.498  -43.187  -105.642 1.00 61.83  ? 139 LEU B N     1 
ATOM 2310  C CA    . LEU B 1 142 ? 43.489  -43.931  -104.894 1.00 57.42  ? 139 LEU B CA    1 
ATOM 2311  C C     . LEU B 1 142 ? 42.083  -43.400  -105.167 1.00 54.50  ? 139 LEU B C     1 
ATOM 2312  O O     . LEU B 1 142 ? 41.142  -44.185  -105.330 1.00 53.18  ? 139 LEU B O     1 
ATOM 2313  C CB    . LEU B 1 142 ? 43.805  -43.896  -103.400 1.00 51.93  ? 139 LEU B CB    1 
ATOM 2314  C CG    . LEU B 1 142 ? 44.836  -44.929  -102.945 1.00 51.01  ? 139 LEU B CG    1 
ATOM 2315  C CD1   . LEU B 1 142 ? 45.334  -44.620  -101.545 1.00 54.24  ? 139 LEU B CD1   1 
ATOM 2316  C CD2   . LEU B 1 142 ? 44.241  -46.326  -103.013 1.00 45.70  ? 139 LEU B CD2   1 
ATOM 2317  N N     . GLU B 1 143 ? 41.918  -42.074  -105.216 1.00 45.93  ? 140 GLU B N     1 
ATOM 2318  C CA    . GLU B 1 143 ? 40.602  -41.499  -105.492 1.00 50.97  ? 140 GLU B CA    1 
ATOM 2319  C C     . GLU B 1 143 ? 40.070  -41.971  -106.837 1.00 53.94  ? 140 GLU B C     1 
ATOM 2320  O O     . GLU B 1 143 ? 38.924  -42.437  -106.945 1.00 51.72  ? 140 GLU B O     1 
ATOM 2321  C CB    . GLU B 1 143 ? 40.677  -39.973  -105.478 1.00 52.31  ? 140 GLU B CB    1 
ATOM 2322  C CG    . GLU B 1 143 ? 39.480  -39.305  -106.136 1.00 47.82  ? 140 GLU B CG    1 
ATOM 2323  C CD    . GLU B 1 143 ? 39.567  -37.792  -106.106 1.00 63.27  ? 140 GLU B CD    1 
ATOM 2324  O OE1   . GLU B 1 143 ? 40.699  -37.267  -106.160 1.00 76.68  ? 140 GLU B OE1   1 
ATOM 2325  O OE2   . GLU B 1 143 ? 38.511  -37.126  -106.039 1.00 67.29  ? 140 GLU B OE2   1 
ATOM 2326  N N     . LYS B 1 144 ? 40.905  -41.870  -107.875 1.00 55.20  ? 141 LYS B N     1 
ATOM 2327  C CA    . LYS B 1 144 ? 40.489  -42.289  -109.207 1.00 58.71  ? 141 LYS B CA    1 
ATOM 2328  C C     . LYS B 1 144 ? 40.123  -43.765  -109.215 1.00 55.45  ? 141 LYS B C     1 
ATOM 2329  O O     . LYS B 1 144 ? 39.074  -44.153  -109.742 1.00 51.52  ? 141 LYS B O     1 
ATOM 2330  C CB    . LYS B 1 144 ? 41.597  -41.995  -110.217 1.00 53.55  ? 141 LYS B CB    1 
ATOM 2331  C CG    . LYS B 1 144 ? 41.175  -42.127  -111.672 1.00 69.38  ? 141 LYS B CG    1 
ATOM 2332  C CD    . LYS B 1 144 ? 41.955  -43.229  -112.375 1.00 72.43  ? 141 LYS B CD    1 
ATOM 2333  C CE    . LYS B 1 144 ? 41.984  -42.999  -113.882 1.00 69.18  ? 141 LYS B CE    1 
ATOM 2334  N NZ    . LYS B 1 144 ? 42.529  -44.172  -114.625 1.00 80.36  ? 141 LYS B NZ    1 
ATOM 2335  N N     . ALA B 1 145 ? 40.959  -44.599  -108.590 1.00 49.44  ? 142 ALA B N     1 
ATOM 2336  C CA    . ALA B 1 145 ? 40.730  -46.038  -108.645 1.00 46.71  ? 142 ALA B CA    1 
ATOM 2337  C C     . ALA B 1 145 ? 39.454  -46.429  -107.907 1.00 56.81  ? 142 ALA B C     1 
ATOM 2338  O O     . ALA B 1 145 ? 38.644  -47.200  -108.433 1.00 55.46  ? 142 ALA B O     1 
ATOM 2339  C CB    . ALA B 1 145 ? 41.936  -46.782  -108.074 1.00 50.30  ? 142 ALA B CB    1 
ATOM 2340  N N     . ARG B 1 146 ? 39.231  -45.870  -106.714 1.00 49.38  ? 143 ARG B N     1 
ATOM 2341  C CA    . ARG B 1 146 ? 38.042  -46.213  -105.935 1.00 44.52  ? 143 ARG B CA    1 
ATOM 2342  C C     . ARG B 1 146 ? 36.769  -45.762  -106.644 1.00 52.53  ? 143 ARG B C     1 
ATOM 2343  O O     . ARG B 1 146 ? 35.812  -46.542  -106.796 1.00 57.01  ? 143 ARG B O     1 
ATOM 2344  C CB    . ARG B 1 146 ? 38.132  -45.580  -104.546 1.00 52.30  ? 143 ARG B CB    1 
ATOM 2345  C CG    . ARG B 1 146 ? 39.319  -46.049  -103.720 1.00 64.08  ? 143 ARG B CG    1 
ATOM 2346  C CD    . ARG B 1 146 ? 39.213  -45.605  -102.267 1.00 48.07  ? 143 ARG B CD    1 
ATOM 2347  N NE    . ARG B 1 146 ? 38.755  -46.670  -101.382 1.00 50.92  ? 143 ARG B NE    1 
ATOM 2348  C CZ    . ARG B 1 146 ? 39.532  -47.261  -100.482 1.00 46.85  ? 143 ARG B CZ    1 
ATOM 2349  N NH1   . ARG B 1 146 ? 40.795  -46.880  -100.354 1.00 50.00  ? 143 ARG B NH1   1 
ATOM 2350  N NH2   . ARG B 1 146 ? 39.049  -48.223  -99.708  1.00 55.22  ? 143 ARG B NH2   1 
ATOM 2351  N N     . LYS B 1 147 ? 36.733  -44.496  -107.077 1.00 49.19  ? 144 LYS B N     1 
ATOM 2352  C CA    . LYS B 1 147 ? 35.535  -43.987  -107.734 1.00 42.84  ? 144 LYS B CA    1 
ATOM 2353  C C     . LYS B 1 147 ? 35.246  -44.756  -109.015 1.00 50.26  ? 144 LYS B C     1 
ATOM 2354  O O     . LYS B 1 147 ? 34.090  -45.114  -109.293 1.00 49.75  ? 144 LYS B O     1 
ATOM 2355  C CB    . LYS B 1 147 ? 35.702  -42.499  -108.028 1.00 48.80  ? 144 LYS B CB    1 
ATOM 2356  C CG    . LYS B 1 147 ? 35.685  -41.645  -106.786 1.00 46.70  ? 144 LYS B CG    1 
ATOM 2357  C CD    . LYS B 1 147 ? 35.951  -40.198  -107.111 1.00 41.82  ? 144 LYS B CD    1 
ATOM 2358  C CE    . LYS B 1 147 ? 35.907  -39.378  -105.849 1.00 35.55  ? 144 LYS B CE    1 
ATOM 2359  N NZ    . LYS B 1 147 ? 36.042  -37.929  -106.135 1.00 54.70  ? 144 LYS B NZ    1 
ATOM 2360  N N     . GLU B 1 148 ? 36.289  -45.017  -109.810 1.00 47.16  ? 145 GLU B N     1 
ATOM 2361  C CA    . GLU B 1 148 ? 36.127  -45.763  -111.047 1.00 55.59  ? 145 GLU B CA    1 
ATOM 2362  C C     . GLU B 1 148 ? 35.596  -47.166  -110.779 1.00 51.51  ? 145 GLU B C     1 
ATOM 2363  O O     . GLU B 1 148 ? 34.702  -47.644  -111.487 1.00 49.69  ? 145 GLU B O     1 
ATOM 2364  C CB    . GLU B 1 148 ? 37.473  -45.816  -111.772 1.00 62.36  ? 145 GLU B CB    1 
ATOM 2365  C CG    . GLU B 1 148 ? 37.403  -45.681  -113.285 1.00 74.11  ? 145 GLU B CG    1 
ATOM 2366  C CD    . GLU B 1 148 ? 38.777  -45.496  -113.912 1.00 86.36  ? 145 GLU B CD    1 
ATOM 2367  O OE1   . GLU B 1 148 ? 39.618  -46.415  -113.796 1.00 83.27  ? 145 GLU B OE1   1 
ATOM 2368  O OE2   . GLU B 1 148 ? 39.024  -44.422  -114.503 1.00 78.77  ? 145 GLU B OE2   1 
ATOM 2369  N N     . ALA B 1 149 ? 36.142  -47.841  -109.761 1.00 53.25  ? 146 ALA B N     1 
ATOM 2370  C CA    . ALA B 1 149 ? 35.669  -49.176  -109.405 1.00 48.40  ? 146 ALA B CA    1 
ATOM 2371  C C     . ALA B 1 149 ? 34.186  -49.163  -109.067 1.00 42.84  ? 146 ALA B C     1 
ATOM 2372  O O     . ALA B 1 149 ? 33.427  -50.029  -109.520 1.00 45.66  ? 146 ALA B O     1 
ATOM 2373  C CB    . ALA B 1 149 ? 36.483  -49.725  -108.233 1.00 47.33  ? 146 ALA B CB    1 
ATOM 2374  N N     . VAL B 1 150 ? 33.751  -48.184  -108.273 1.00 42.85  ? 147 VAL B N     1 
ATOM 2375  C CA    . VAL B 1 150 ? 32.346  -48.145  -107.870 1.00 37.63  ? 147 VAL B CA    1 
ATOM 2376  C C     . VAL B 1 150 ? 31.446  -47.898  -109.079 1.00 46.89  ? 147 VAL B C     1 
ATOM 2377  O O     . VAL B 1 150 ? 30.409  -48.556  -109.248 1.00 44.06  ? 147 VAL B O     1 
ATOM 2378  C CB    . VAL B 1 150 ? 32.129  -47.099  -106.765 1.00 49.81  ? 147 VAL B CB    1 
ATOM 2379  C CG1   . VAL B 1 150 ? 30.647  -46.766  -106.632 1.00 32.80  ? 147 VAL B CG1   1 
ATOM 2380  C CG2   . VAL B 1 150 ? 32.676  -47.631  -105.452 1.00 49.49  ? 147 VAL B CG2   1 
ATOM 2381  N N     . THR B 1 151 ? 31.821  -46.942  -109.935 1.00 57.84  ? 148 THR B N     1 
ATOM 2382  C CA    . THR B 1 151 ? 30.996  -46.656  -111.109 1.00 47.70  ? 148 THR B CA    1 
ATOM 2383  C C     . THR B 1 151 ? 30.915  -47.868  -112.036 1.00 48.26  ? 148 THR B C     1 
ATOM 2384  O O     . THR B 1 151 ? 29.836  -48.203  -112.550 1.00 39.88  ? 148 THR B O     1 
ATOM 2385  C CB    . THR B 1 151 ? 31.547  -45.437  -111.853 1.00 47.44  ? 148 THR B CB    1 
ATOM 2386  O OG1   . THR B 1 151 ? 31.430  -44.275  -111.021 1.00 55.91  ? 148 THR B OG1   1 
ATOM 2387  C CG2   . THR B 1 151 ? 30.782  -45.202  -113.145 1.00 51.13  ? 148 THR B CG2   1 
ATOM 2388  N N     . ASP B 1 152 ? 32.052  -48.532  -112.269 1.00 43.13  ? 149 ASP B N     1 
ATOM 2389  C CA    . ASP B 1 152 ? 32.071  -49.743  -113.083 1.00 47.05  ? 149 ASP B CA    1 
ATOM 2390  C C     . ASP B 1 152 ? 31.180  -50.827  -112.488 1.00 54.17  ? 149 ASP B C     1 
ATOM 2391  O O     . ASP B 1 152 ? 30.453  -51.514  -113.218 1.00 53.47  ? 149 ASP B O     1 
ATOM 2392  C CB    . ASP B 1 152 ? 33.509  -50.246  -113.232 1.00 48.48  ? 149 ASP B CB    1 
ATOM 2393  C CG    . ASP B 1 152 ? 33.644  -51.341  -114.272 1.00 54.81  ? 149 ASP B CG    1 
ATOM 2394  O OD1   . ASP B 1 152 ? 32.913  -51.309  -115.285 1.00 67.96  ? 149 ASP B OD1   1 
ATOM 2395  O OD2   . ASP B 1 152 ? 34.492  -52.237  -114.076 1.00 47.86  ? 149 ASP B OD2   1 
ATOM 2396  N N     . GLY B 1 153 ? 31.238  -51.012  -111.166 1.00 53.34  ? 150 GLY B N     1 
ATOM 2397  C CA    . GLY B 1 153 ? 30.385  -52.004  -110.535 1.00 47.01  ? 150 GLY B CA    1 
ATOM 2398  C C     . GLY B 1 153 ? 28.911  -51.693  -110.702 1.00 44.04  ? 150 GLY B C     1 
ATOM 2399  O O     . GLY B 1 153 ? 28.101  -52.590  -110.946 1.00 43.02  ? 150 GLY B O     1 
ATOM 2400  N N     . LEU B 1 154 ? 28.549  -50.411  -110.607 1.00 45.40  ? 151 LEU B N     1 
ATOM 2401  C CA    . LEU B 1 154 ? 27.151  -50.036  -110.804 1.00 46.36  ? 151 LEU B CA    1 
ATOM 2402  C C     . LEU B 1 154 ? 26.705  -50.304  -112.236 1.00 50.75  ? 151 LEU B C     1 
ATOM 2403  O O     . LEU B 1 154 ? 25.608  -50.833  -112.464 1.00 49.89  ? 151 LEU B O     1 
ATOM 2404  C CB    . LEU B 1 154 ? 26.941  -48.566  -110.446 1.00 42.66  ? 151 LEU B CB    1 
ATOM 2405  C CG    . LEU B 1 154 ? 25.531  -48.038  -110.718 1.00 47.63  ? 151 LEU B CG    1 
ATOM 2406  C CD1   . LEU B 1 154 ? 24.486  -48.913  -110.039 1.00 50.68  ? 151 LEU B CD1   1 
ATOM 2407  C CD2   . LEU B 1 154 ? 25.400  -46.596  -110.269 1.00 50.43  ? 151 LEU B CD2   1 
ATOM 2408  N N     . LYS B 1 155 ? 27.546  -49.950  -113.212 1.00 49.98  ? 152 LYS B N     1 
ATOM 2409  C CA    . LYS B 1 155 ? 27.195  -50.212  -114.604 1.00 49.28  ? 152 LYS B CA    1 
ATOM 2410  C C     . LYS B 1 155 ? 27.014  -51.705  -114.849 1.00 51.48  ? 152 LYS B C     1 
ATOM 2411  O O     . LYS B 1 155 ? 26.035  -52.127  -115.478 1.00 48.69  ? 152 LYS B O     1 
ATOM 2412  C CB    . LYS B 1 155 ? 28.264  -49.648  -115.540 1.00 49.69  ? 152 LYS B CB    1 
ATOM 2413  C CG    . LYS B 1 155 ? 28.342  -48.129  -115.574 1.00 54.27  ? 152 LYS B CG    1 
ATOM 2414  C CD    . LYS B 1 155 ? 29.194  -47.659  -116.745 1.00 59.12  ? 152 LYS B CD    1 
ATOM 2415  C CE    . LYS B 1 155 ? 30.634  -48.135  -116.624 1.00 62.98  ? 152 LYS B CE    1 
ATOM 2416  N NZ    . LYS B 1 155 ? 31.478  -47.628  -117.745 1.00 67.78  ? 152 LYS B NZ    1 
ATOM 2417  N N     . ARG B 1 156 ? 27.932  -52.524  -114.325 1.00 54.76  ? 153 ARG B N     1 
ATOM 2418  C CA    . ARG B 1 156 ? 27.858  -53.962  -114.564 1.00 52.98  ? 153 ARG B CA    1 
ATOM 2419  C C     . ARG B 1 156 ? 26.696  -54.611  -113.820 1.00 52.58  ? 153 ARG B C     1 
ATOM 2420  O O     . ARG B 1 156 ? 26.165  -55.628  -114.281 1.00 53.52  ? 153 ARG B O     1 
ATOM 2421  C CB    . ARG B 1 156 ? 29.180  -54.633  -114.183 1.00 46.45  ? 153 ARG B CB    1 
ATOM 2422  C CG    . ARG B 1 156 ? 30.342  -54.304  -115.114 1.00 58.92  ? 153 ARG B CG    1 
ATOM 2423  C CD    . ARG B 1 156 ? 31.667  -54.807  -114.563 1.00 61.35  ? 153 ARG B CD    1 
ATOM 2424  N NE    . ARG B 1 156 ? 31.610  -56.220  -114.186 1.00 56.50  ? 153 ARG B NE    1 
ATOM 2425  C CZ    . ARG B 1 156 ? 31.806  -57.235  -115.024 1.00 56.86  ? 153 ARG B CZ    1 
ATOM 2426  N NH1   . ARG B 1 156 ? 32.071  -57.002  -116.301 1.00 69.90  ? 153 ARG B NH1   1 
ATOM 2427  N NH2   . ARG B 1 156 ? 31.733  -58.486  -114.583 1.00 56.55  ? 153 ARG B NH2   1 
ATOM 2428  N N     . ALA B 1 157 ? 26.296  -54.058  -112.671 1.00 55.98  ? 154 ALA B N     1 
ATOM 2429  C CA    . ALA B 1 157 ? 25.126  -54.581  -111.969 1.00 54.61  ? 154 ALA B CA    1 
ATOM 2430  C C     . ALA B 1 157 ? 23.834  -54.222  -112.693 1.00 56.75  ? 154 ALA B C     1 
ATOM 2431  O O     . ALA B 1 157 ? 22.901  -55.033  -112.746 1.00 46.43  ? 154 ALA B O     1 
ATOM 2432  C CB    . ALA B 1 157 ? 25.100  -54.067  -110.531 1.00 47.83  ? 154 ALA B CB    1 
ATOM 2433  N N     . LEU B 1 158 ? 23.744  -52.998  -113.226 1.00 62.91  ? 155 LEU B N     1 
ATOM 2434  C CA    . LEU B 1 158 ? 22.547  -52.611  -113.968 1.00 49.55  ? 155 LEU B CA    1 
ATOM 2435  C C     . LEU B 1 158 ? 22.462  -53.330  -115.305 1.00 59.85  ? 155 LEU B C     1 
ATOM 2436  O O     . LEU B 1 158 ? 21.363  -53.529  -115.834 1.00 58.32  ? 155 LEU B O     1 
ATOM 2437  C CB    . LEU B 1 158 ? 22.518  -51.101  -114.184 1.00 49.17  ? 155 LEU B CB    1 
ATOM 2438  C CG    . LEU B 1 158 ? 22.003  -50.317  -112.985 1.00 43.56  ? 155 LEU B CG    1 
ATOM 2439  C CD1   . LEU B 1 158 ? 22.140  -48.827  -113.221 1.00 32.50  ? 155 LEU B CD1   1 
ATOM 2440  C CD2   . LEU B 1 158 ? 20.553  -50.694  -112.719 1.00 41.60  ? 155 LEU B CD2   1 
ATOM 2441  N N     . ARG B 1 159 ? 23.614  -53.705  -115.866 1.00 63.62  ? 156 ARG B N     1 
ATOM 2442  C CA    . ARG B 1 159 ? 23.656  -54.453  -117.118 1.00 54.97  ? 156 ARG B CA    1 
ATOM 2443  C C     . ARG B 1 159 ? 22.747  -55.678  -117.091 1.00 55.57  ? 156 ARG B C     1 
ATOM 2444  O O     . ARG B 1 159 ? 22.119  -56.015  -118.101 1.00 64.85  ? 156 ARG B O     1 
ATOM 2445  C CB    . ARG B 1 159 ? 25.104  -54.854  -117.397 1.00 59.22  ? 156 ARG B CB    1 
ATOM 2446  C CG    . ARG B 1 159 ? 25.304  -55.803  -118.555 1.00 64.84  ? 156 ARG B CG    1 
ATOM 2447  C CD    . ARG B 1 159 ? 26.712  -56.364  -118.530 1.00 63.72  ? 156 ARG B CD    1 
ATOM 2448  N NE    . ARG B 1 159 ? 27.702  -55.303  -118.683 1.00 71.03  ? 156 ARG B NE    1 
ATOM 2449  C CZ    . ARG B 1 159 ? 29.013  -55.478  -118.562 1.00 73.90  ? 156 ARG B CZ    1 
ATOM 2450  N NH1   . ARG B 1 159 ? 29.500  -56.681  -118.288 1.00 63.18  ? 156 ARG B NH1   1 
ATOM 2451  N NH2   . ARG B 1 159 ? 29.837  -54.449  -118.715 1.00 71.16  ? 156 ARG B NH2   1 
ATOM 2452  N N     . SER B 1 160 ? 22.641  -56.341  -115.939 1.00 58.56  ? 157 SER B N     1 
ATOM 2453  C CA    . SER B 1 160 ? 21.961  -57.631  -115.843 1.00 64.60  ? 157 SER B CA    1 
ATOM 2454  C C     . SER B 1 160 ? 20.445  -57.545  -116.004 1.00 58.29  ? 157 SER B C     1 
ATOM 2455  O O     . SER B 1 160 ? 19.789  -58.593  -115.996 1.00 61.53  ? 157 SER B O     1 
ATOM 2456  C CB    . SER B 1 160 ? 22.288  -58.296  -114.504 1.00 58.80  ? 157 SER B CB    1 
ATOM 2457  O OG    . SER B 1 160 ? 23.685  -58.448  -114.330 1.00 67.47  ? 157 SER B OG    1 
ATOM 2458  N N     . PHE B 1 161 ? 19.864  -56.355  -116.142 1.00 55.76  ? 158 PHE B N     1 
ATOM 2459  C CA    . PHE B 1 161 ? 18.417  -56.240  -116.287 1.00 66.15  ? 158 PHE B CA    1 
ATOM 2460  C C     . PHE B 1 161 ? 17.934  -56.326  -117.732 1.00 71.75  ? 158 PHE B C     1 
ATOM 2461  O O     . PHE B 1 161 ? 16.737  -56.545  -117.952 1.00 66.77  ? 158 PHE B O     1 
ATOM 2462  C CB    . PHE B 1 161 ? 17.923  -54.930  -115.659 1.00 59.93  ? 158 PHE B CB    1 
ATOM 2463  C CG    . PHE B 1 161 ? 17.864  -54.959  -114.150 1.00 60.83  ? 158 PHE B CG    1 
ATOM 2464  C CD1   . PHE B 1 161 ? 16.974  -55.797  -113.494 1.00 59.21  ? 158 PHE B CD1   1 
ATOM 2465  C CD2   . PHE B 1 161 ? 18.697  -54.152  -113.389 1.00 71.86  ? 158 PHE B CD2   1 
ATOM 2466  C CE1   . PHE B 1 161 ? 16.914  -55.829  -112.111 1.00 52.94  ? 158 PHE B CE1   1 
ATOM 2467  C CE2   . PHE B 1 161 ? 18.642  -54.181  -112.005 1.00 57.96  ? 158 PHE B CE2   1 
ATOM 2468  C CZ    . PHE B 1 161 ? 17.750  -55.021  -111.366 1.00 50.90  ? 158 PHE B CZ    1 
ATOM 2469  N N     . GLY B 1 162 ? 18.812  -56.167  -118.709 1.00 69.50  ? 159 GLY B N     1 
ATOM 2470  C CA    . GLY B 1 162 ? 18.427  -56.304  -120.101 1.00 68.50  ? 159 GLY B CA    1 
ATOM 2471  C C     . GLY B 1 162 ? 19.278  -55.417  -120.986 1.00 72.34  ? 159 GLY B C     1 
ATOM 2472  O O     . GLY B 1 162 ? 20.167  -54.702  -120.526 1.00 61.19  ? 159 GLY B O     1 
ATOM 2473  N N     . ASN B 1 163 ? 18.981  -55.486  -122.288 1.00 71.76  ? 160 ASN B N     1 
ATOM 2474  C CA    . ASN B 1 163 ? 19.752  -54.737  -123.275 1.00 65.20  ? 160 ASN B CA    1 
ATOM 2475  C C     . ASN B 1 163 ? 19.646  -53.234  -123.052 1.00 61.20  ? 160 ASN B C     1 
ATOM 2476  O O     . ASN B 1 163 ? 20.633  -52.507  -123.209 1.00 64.67  ? 160 ASN B O     1 
ATOM 2477  C CB    . ASN B 1 163 ? 19.290  -55.106  -124.684 1.00 61.97  ? 160 ASN B CB    1 
ATOM 2478  C CG    . ASN B 1 163 ? 19.358  -56.597  -124.940 1.00 70.72  ? 160 ASN B CG    1 
ATOM 2479  O OD1   . ASN B 1 163 ? 20.433  -57.152  -125.182 1.00 77.53  ? 160 ASN B OD1   1 
ATOM 2480  N ND2   . ASN B 1 163 ? 18.207  -57.258  -124.876 1.00 78.16  ? 160 ASN B ND2   1 
ATOM 2481  N N     . ALA B 1 164 ? 18.457  -52.749  -122.682 1.00 49.67  ? 161 ALA B N     1 
ATOM 2482  C CA    . ALA B 1 164 ? 18.243  -51.309  -122.570 1.00 54.00  ? 161 ALA B CA    1 
ATOM 2483  C C     . ALA B 1 164 ? 19.151  -50.669  -121.528 1.00 60.85  ? 161 ALA B C     1 
ATOM 2484  O O     . ALA B 1 164 ? 19.457  -49.475  -121.626 1.00 57.47  ? 161 ALA B O     1 
ATOM 2485  C CB    . ALA B 1 164 ? 16.779  -51.023  -122.242 1.00 53.22  ? 161 ALA B CB    1 
ATOM 2486  N N     . LEU B 1 165 ? 19.596  -51.434  -120.532 1.00 72.15  ? 162 LEU B N     1 
ATOM 2487  C CA    . LEU B 1 165 ? 20.464  -50.916  -119.483 1.00 61.26  ? 162 LEU B CA    1 
ATOM 2488  C C     . LEU B 1 165 ? 21.933  -51.264  -119.696 1.00 63.92  ? 162 LEU B C     1 
ATOM 2489  O O     . LEU B 1 165 ? 22.752  -51.015  -118.806 1.00 64.71  ? 162 LEU B O     1 
ATOM 2490  C CB    . LEU B 1 165 ? 19.995  -51.419  -118.117 1.00 58.40  ? 162 LEU B CB    1 
ATOM 2491  C CG    . LEU B 1 165 ? 18.797  -50.654  -117.552 1.00 62.25  ? 162 LEU B CG    1 
ATOM 2492  C CD1   . LEU B 1 165 ? 18.323  -51.286  -116.256 1.00 68.70  ? 162 LEU B CD1   1 
ATOM 2493  C CD2   . LEU B 1 165 ? 19.137  -49.186  -117.345 1.00 61.41  ? 162 LEU B CD2   1 
ATOM 2494  N N     . GLY B 1 166 ? 22.284  -51.834  -120.846 1.00 59.48  ? 163 GLY B N     1 
ATOM 2495  C CA    . GLY B 1 166 ? 23.679  -51.957  -121.220 1.00 55.00  ? 163 GLY B CA    1 
ATOM 2496  C C     . GLY B 1 166 ? 24.134  -53.349  -121.606 1.00 65.85  ? 163 GLY B C     1 
ATOM 2497  O O     . GLY B 1 166 ? 25.322  -53.559  -121.859 1.00 66.07  ? 163 GLY B O     1 
ATOM 2498  N N     . ASN B 1 167 ? 23.215  -54.315  -121.641 1.00 64.59  ? 164 ASN B N     1 
ATOM 2499  C CA    . ASN B 1 167 ? 23.614  -55.674  -121.991 1.00 59.98  ? 164 ASN B CA    1 
ATOM 2500  C C     . ASN B 1 167 ? 23.953  -55.794  -123.475 1.00 67.78  ? 164 ASN B C     1 
ATOM 2501  O O     . ASN B 1 167 ? 24.890  -56.516  -123.843 1.00 73.69  ? 164 ASN B O     1 
ATOM 2502  C CB    . ASN B 1 167 ? 22.502  -56.649  -121.615 1.00 51.47  ? 164 ASN B CB    1 
ATOM 2503  C CG    . ASN B 1 167 ? 22.994  -58.072  -121.495 1.00 63.28  ? 164 ASN B CG    1 
ATOM 2504  O OD1   . ASN B 1 167 ? 24.198  -58.326  -121.497 1.00 61.99  ? 164 ASN B OD1   1 
ATOM 2505  N ND2   . ASN B 1 167 ? 22.062  -59.015  -121.420 1.00 60.42  ? 164 ASN B ND2   1 
ATOM 2506  N N     . CYS B 1 168 ? 23.240  -55.053  -124.330 1.00 69.57  ? 165 CYS B N     1 
ATOM 2507  C CA    . CYS B 1 168 ? 23.426  -55.182  -125.772 1.00 75.67  ? 165 CYS B CA    1 
ATOM 2508  C C     . CYS B 1 168 ? 24.834  -54.796  -126.197 1.00 75.29  ? 165 CYS B C     1 
ATOM 2509  O O     . CYS B 1 168 ? 25.319  -55.270  -127.231 1.00 79.19  ? 165 CYS B O     1 
ATOM 2510  C CB    . CYS B 1 168 ? 22.395  -54.324  -126.508 1.00 68.94  ? 165 CYS B CB    1 
ATOM 2511  S SG    . CYS B 1 168 ? 22.410  -52.571  -126.046 1.00 63.06  ? 165 CYS B SG    1 
ATOM 2512  N N     . ILE B 1 169 ? 25.510  -53.951  -125.412 1.00 66.57  ? 166 ILE B N     1 
ATOM 2513  C CA    . ILE B 1 169 ? 26.868  -53.546  -125.749 1.00 69.26  ? 166 ILE B CA    1 
ATOM 2514  C C     . ILE B 1 169 ? 27.807  -54.743  -125.835 1.00 67.40  ? 166 ILE B C     1 
ATOM 2515  O O     . ILE B 1 169 ? 28.872  -54.645  -126.453 1.00 75.39  ? 166 ILE B O     1 
ATOM 2516  C CB    . ILE B 1 169 ? 27.395  -52.503  -124.739 1.00 79.26  ? 166 ILE B CB    1 
ATOM 2517  C CG1   . ILE B 1 169 ? 28.517  -51.687  -125.376 1.00 85.00  ? 166 ILE B CG1   1 
ATOM 2518  C CG2   . ILE B 1 169 ? 27.923  -53.174  -123.487 1.00 77.73  ? 166 ILE B CG2   1 
ATOM 2519  C CD1   . ILE B 1 169 ? 28.061  -50.868  -126.553 1.00 93.70  ? 166 ILE B CD1   1 
ATOM 2520  N N     . LEU B 1 170 ? 27.437  -55.883  -125.244 1.00 70.05  ? 167 LEU B N     1 
ATOM 2521  C CA    . LEU B 1 170 ? 28.319  -57.043  -125.273 1.00 75.49  ? 167 LEU B CA    1 
ATOM 2522  C C     . LEU B 1 170 ? 28.102  -57.934  -126.490 1.00 76.41  ? 167 LEU B C     1 
ATOM 2523  O O     . LEU B 1 170 ? 28.881  -58.871  -126.694 1.00 76.62  ? 167 LEU B O     1 
ATOM 2524  C CB    . LEU B 1 170 ? 28.153  -57.869  -123.992 1.00 78.93  ? 167 LEU B CB    1 
ATOM 2525  C CG    . LEU B 1 170 ? 28.488  -57.157  -122.678 1.00 72.10  ? 167 LEU B CG    1 
ATOM 2526  C CD1   . LEU B 1 170 ? 27.996  -57.970  -121.496 1.00 74.99  ? 167 LEU B CD1   1 
ATOM 2527  C CD2   . LEU B 1 170 ? 29.983  -56.884  -122.555 1.00 68.17  ? 167 LEU B CD2   1 
ATOM 2528  N N     . ASP B 1 171 ? 27.069  -57.677  -127.290 1.00 80.71  ? 168 ASP B N     1 
ATOM 2529  C CA    . ASP B 1 171 ? 26.785  -58.496  -128.462 1.00 85.10  ? 168 ASP B CA    1 
ATOM 2530  C C     . ASP B 1 171 ? 27.615  -57.979  -129.633 1.00 89.61  ? 168 ASP B C     1 
ATOM 2531  O O     . ASP B 1 171 ? 27.432  -56.839  -130.074 1.00 88.94  ? 168 ASP B O     1 
ATOM 2532  C CB    . ASP B 1 171 ? 25.292  -58.469  -128.789 1.00 81.79  ? 168 ASP B CB    1 
ATOM 2533  C CG    . ASP B 1 171 ? 24.886  -59.570  -129.754 1.00 84.19  ? 168 ASP B CG    1 
ATOM 2534  O OD1   . ASP B 1 171 ? 25.765  -60.359  -130.160 1.00 85.98  ? 168 ASP B OD1   1 
ATOM 2535  O OD2   . ASP B 1 171 ? 23.689  -59.655  -130.100 1.00 86.85  ? 168 ASP B OD2   1 
ATOM 2536  N N     . LYS B 1 172 ? 28.534  -58.813  -130.130 1.00 88.88  ? 169 LYS B N     1 
ATOM 2537  C CA    . LYS B 1 172 ? 29.417  -58.389  -131.216 1.00 87.95  ? 169 LYS B CA    1 
ATOM 2538  C C     . LYS B 1 172 ? 28.653  -58.095  -132.502 1.00 89.75  ? 169 LYS B C     1 
ATOM 2539  O O     . LYS B 1 172 ? 29.094  -57.266  -133.306 1.00 96.80  ? 169 LYS B O     1 
ATOM 2540  C CB    . LYS B 1 172 ? 30.507  -59.437  -131.449 1.00 82.70  ? 169 LYS B CB    1 
ATOM 2541  C CG    . LYS B 1 172 ? 31.306  -59.744  -130.191 1.00 102.40 ? 169 LYS B CG    1 
ATOM 2542  C CD    . LYS B 1 172 ? 32.289  -60.893  -130.375 1.00 105.31 ? 169 LYS B CD    1 
ATOM 2543  C CE    . LYS B 1 172 ? 32.972  -61.243  -129.054 1.00 100.87 ? 169 LYS B CE    1 
ATOM 2544  N NZ    . LYS B 1 172 ? 33.888  -62.411  -129.175 1.00 114.58 ? 169 LYS B NZ    1 
ATOM 2545  N N     . ASP B 1 173 ? 27.517  -58.759  -132.722 1.00 88.81  ? 170 ASP B N     1 
ATOM 2546  C CA    . ASP B 1 173 ? 26.709  -58.441  -133.894 1.00 92.08  ? 170 ASP B CA    1 
ATOM 2547  C C     . ASP B 1 173 ? 26.120  -57.040  -133.781 1.00 96.60  ? 170 ASP B C     1 
ATOM 2548  O O     . ASP B 1 173 ? 26.055  -56.299  -134.771 1.00 100.64 ? 170 ASP B O     1 
ATOM 2549  C CB    . ASP B 1 173 ? 25.593  -59.470  -134.062 1.00 93.18  ? 170 ASP B CB    1 
ATOM 2550  C CG    . ASP B 1 173 ? 26.109  -60.894  -134.105 1.00 103.20 ? 170 ASP B CG    1 
ATOM 2551  O OD1   . ASP B 1 173 ? 27.195  -61.126  -134.678 1.00 105.58 ? 170 ASP B OD1   1 
ATOM 2552  O OD2   . ASP B 1 173 ? 25.419  -61.781  -133.561 1.00 103.20 ? 170 ASP B OD2   1 
ATOM 2553  N N     . TYR B 1 174 ? 25.676  -56.670  -132.577 1.00 90.07  ? 171 TYR B N     1 
ATOM 2554  C CA    . TYR B 1 174 ? 25.169  -55.323  -132.328 1.00 83.65  ? 171 TYR B CA    1 
ATOM 2555  C C     . TYR B 1 174 ? 26.240  -54.262  -132.558 1.00 84.10  ? 171 TYR B C     1 
ATOM 2556  O O     . TYR B 1 174 ? 25.947  -53.176  -133.070 1.00 78.49  ? 171 TYR B O     1 
ATOM 2557  C CB    . TYR B 1 174 ? 24.624  -55.250  -130.904 1.00 70.97  ? 171 TYR B CB    1 
ATOM 2558  C CG    . TYR B 1 174 ? 24.343  -53.860  -130.391 1.00 70.31  ? 171 TYR B CG    1 
ATOM 2559  C CD1   . TYR B 1 174 ? 23.136  -53.230  -130.661 1.00 68.33  ? 171 TYR B CD1   1 
ATOM 2560  C CD2   . TYR B 1 174 ? 25.275  -53.187  -129.613 1.00 72.31  ? 171 TYR B CD2   1 
ATOM 2561  C CE1   . TYR B 1 174 ? 22.870  -51.962  -130.182 1.00 70.08  ? 171 TYR B CE1   1 
ATOM 2562  C CE2   . TYR B 1 174 ? 25.017  -51.919  -129.130 1.00 65.53  ? 171 TYR B CE2   1 
ATOM 2563  C CZ    . TYR B 1 174 ? 23.813  -51.312  -129.418 1.00 69.76  ? 171 TYR B CZ    1 
ATOM 2564  O OH    . TYR B 1 174 ? 23.545  -50.052  -128.942 1.00 76.08  ? 171 TYR B OH    1 
ATOM 2565  N N     . LEU B 1 175 ? 27.493  -54.567  -132.217 1.00 87.20  ? 172 LEU B N     1 
ATOM 2566  C CA    . LEU B 1 175 ? 28.562  -53.594  -132.426 1.00 88.51  ? 172 LEU B CA    1 
ATOM 2567  C C     . LEU B 1 175 ? 28.799  -53.359  -133.911 1.00 96.57  ? 172 LEU B C     1 
ATOM 2568  O O     . LEU B 1 175 ? 28.984  -52.215  -134.349 1.00 101.93 ? 172 LEU B O     1 
ATOM 2569  C CB    . LEU B 1 175 ? 29.846  -54.077  -131.756 1.00 87.83  ? 172 LEU B CB    1 
ATOM 2570  C CG    . LEU B 1 175 ? 29.881  -54.120  -130.229 1.00 80.83  ? 172 LEU B CG    1 
ATOM 2571  C CD1   . LEU B 1 175 ? 31.259  -54.566  -129.759 1.00 85.45  ? 172 LEU B CD1   1 
ATOM 2572  C CD2   . LEU B 1 175 ? 29.510  -52.769  -129.643 1.00 85.02  ? 172 LEU B CD2   1 
ATOM 2573  N N     . ARG B 1 176 ? 28.807  -54.437  -134.695 1.00 94.13  ? 173 ARG B N     1 
ATOM 2574  C CA    . ARG B 1 176 ? 28.940  -54.312  -136.140 1.00 93.30  ? 173 ARG B CA    1 
ATOM 2575  C C     . ARG B 1 176 ? 27.776  -53.525  -136.731 1.00 85.52  ? 173 ARG B C     1 
ATOM 2576  O O     . ARG B 1 176 ? 27.977  -52.630  -137.560 1.00 96.46  ? 173 ARG B O     1 
ATOM 2577  C CB    . ARG B 1 176 ? 29.054  -55.702  -136.763 1.00 89.14  ? 173 ARG B CB    1 
ATOM 2578  C CG    . ARG B 1 176 ? 30.398  -56.369  -136.482 1.00 94.68  ? 173 ARG B CG    1 
ATOM 2579  C CD    . ARG B 1 176 ? 30.587  -57.654  -137.272 1.00 104.79 ? 173 ARG B CD    1 
ATOM 2580  N NE    . ARG B 1 176 ? 29.667  -58.696  -136.824 1.00 106.53 ? 173 ARG B NE    1 
ATOM 2581  C CZ    . ARG B 1 176 ? 28.501  -58.973  -137.399 1.00 111.79 ? 173 ARG B CZ    1 
ATOM 2582  N NH1   . ARG B 1 176 ? 28.096  -58.285  -138.458 1.00 113.53 ? 173 ARG B NH1   1 
ATOM 2583  N NH2   . ARG B 1 176 ? 27.738  -59.942  -136.910 1.00 109.49 ? 173 ARG B NH2   1 
ATOM 2584  N N     . SER B 1 177 ? 26.545  -53.841  -136.310 1.00 75.39  ? 174 SER B N     1 
ATOM 2585  C CA    . SER B 1 177 ? 25.397  -53.066  -136.776 1.00 70.86  ? 174 SER B CA    1 
ATOM 2586  C C     . SER B 1 177 ? 25.452  -51.614  -136.313 1.00 88.98  ? 174 SER B C     1 
ATOM 2587  O O     . SER B 1 177 ? 24.784  -50.758  -136.904 1.00 93.93  ? 174 SER B O     1 
ATOM 2588  C CB    . SER B 1 177 ? 24.093  -53.713  -136.305 1.00 81.30  ? 174 SER B CB    1 
ATOM 2589  O OG    . SER B 1 177 ? 23.919  -54.995  -136.889 1.00 87.97  ? 174 SER B OG    1 
ATOM 2590  N N     . LEU B 1 178 ? 26.239  -51.316  -135.278 1.00 96.85  ? 175 LEU B N     1 
ATOM 2591  C CA    . LEU B 1 178 ? 26.434  -49.930  -134.865 1.00 99.61  ? 175 LEU B CA    1 
ATOM 2592  C C     . LEU B 1 178 ? 27.483  -49.226  -135.714 1.00 98.33  ? 175 LEU B C     1 
ATOM 2593  O O     . LEU B 1 178 ? 27.351  -48.027  -135.983 1.00 99.48  ? 175 LEU B O     1 
ATOM 2594  C CB    . LEU B 1 178 ? 26.833  -49.865  -133.389 1.00 98.03  ? 175 LEU B CB    1 
ATOM 2595  C CG    . LEU B 1 178 ? 25.742  -49.450  -132.405 1.00 89.61  ? 175 LEU B CG    1 
ATOM 2596  C CD1   . LEU B 1 178 ? 26.348  -49.249  -131.034 1.00 81.40  ? 175 LEU B CD1   1 
ATOM 2597  C CD2   . LEU B 1 178 ? 25.075  -48.173  -132.884 1.00 89.79  ? 175 LEU B CD2   1 
ATOM 2598  N N     . ASN B 1 179 ? 28.524  -49.946  -136.145 1.00 98.69  ? 176 ASN B N     1 
ATOM 2599  C CA    . ASN B 1 179 ? 29.557  -49.325  -136.972 1.00 113.85 ? 176 ASN B CA    1 
ATOM 2600  C C     . ASN B 1 179 ? 29.009  -48.932  -138.338 1.00 118.22 ? 176 ASN B C     1 
ATOM 2601  O O     . ASN B 1 179 ? 29.409  -47.907  -138.905 1.00 123.70 ? 176 ASN B O     1 
ATOM 2602  C CB    . ASN B 1 179 ? 30.753  -50.267  -137.132 1.00 107.52 ? 176 ASN B CB    1 
ATOM 2603  C CG    . ASN B 1 179 ? 31.606  -50.345  -135.884 1.00 111.43 ? 176 ASN B CG    1 
ATOM 2604  O OD1   . ASN B 1 179 ? 31.788  -51.416  -135.302 1.00 112.27 ? 176 ASN B OD1   1 
ATOM 2605  N ND2   . ASN B 1 179 ? 32.137  -49.203  -135.464 1.00 109.87 ? 176 ASN B ND2   1 
ATOM 2606  N N     . LYS B 1 180 ? 28.100  -49.740  -138.887 1.00 109.32 ? 177 LYS B N     1 
ATOM 2607  C CA    . LYS B 1 180 ? 27.480  -49.440  -140.171 1.00 112.76 ? 177 LYS B CA    1 
ATOM 2608  C C     . LYS B 1 180 ? 26.556  -48.228  -140.118 1.00 118.32 ? 177 LYS B C     1 
ATOM 2609  O O     . LYS B 1 180 ? 26.089  -47.780  -141.172 1.00 119.33 ? 177 LYS B O     1 
ATOM 2610  C CB    . LYS B 1 180 ? 26.711  -50.663  -140.673 1.00 97.26  ? 177 LYS B CB    1 
ATOM 2611  C CG    . LYS B 1 180 ? 27.580  -51.900  -140.851 1.00 100.23 ? 177 LYS B CG    1 
ATOM 2612  C CD    . LYS B 1 180 ? 26.753  -53.112  -141.268 1.00 95.38  ? 177 LYS B CD    1 
ATOM 2613  C CE    . LYS B 1 180 ? 27.618  -54.361  -141.361 1.00 94.40  ? 177 LYS B CE    1 
ATOM 2614  N NZ    . LYS B 1 180 ? 26.831  -55.575  -141.711 1.00 98.71  ? 177 LYS B NZ    1 
ATOM 2615  N N     . LEU B 1 181 ? 26.273  -47.699  -138.928 1.00 111.64 ? 178 LEU B N     1 
ATOM 2616  C CA    . LEU B 1 181 ? 25.405  -46.540  -138.798 1.00 110.66 ? 178 LEU B CA    1 
ATOM 2617  C C     . LEU B 1 181 ? 26.198  -45.248  -139.000 1.00 121.19 ? 178 LEU B C     1 
ATOM 2618  O O     . LEU B 1 181 ? 27.392  -45.189  -138.692 1.00 114.57 ? 178 LEU B O     1 
ATOM 2619  C CB    . LEU B 1 181 ? 24.730  -46.536  -137.429 1.00 102.55 ? 178 LEU B CB    1 
ATOM 2620  C CG    . LEU B 1 181 ? 23.560  -47.518  -137.333 1.00 95.55  ? 178 LEU B CG    1 
ATOM 2621  C CD1   . LEU B 1 181 ? 23.023  -47.550  -135.923 1.00 102.61 ? 178 LEU B CD1   1 
ATOM 2622  C CD2   . LEU B 1 181 ? 22.449  -47.147  -138.308 1.00 98.72  ? 178 LEU B CD2   1 
ATOM 2623  N N     . PRO B 1 182 ? 25.556  -44.207  -139.524 1.00 122.68 ? 179 PRO B N     1 
ATOM 2624  C CA    . PRO B 1 182 ? 26.255  -42.934  -139.750 1.00 115.35 ? 179 PRO B CA    1 
ATOM 2625  C C     . PRO B 1 182 ? 26.716  -42.294  -138.448 1.00 121.83 ? 179 PRO B C     1 
ATOM 2626  O O     . PRO B 1 182 ? 25.938  -42.138  -137.504 1.00 126.56 ? 179 PRO B O     1 
ATOM 2627  C CB    . PRO B 1 182 ? 25.202  -42.071  -140.454 1.00 100.58 ? 179 PRO B CB    1 
ATOM 2628  C CG    . PRO B 1 182 ? 24.171  -43.021  -140.955 1.00 102.66 ? 179 PRO B CG    1 
ATOM 2629  C CD    . PRO B 1 182 ? 24.167  -44.175  -140.014 1.00 106.39 ? 179 PRO B CD    1 
ATOM 2630  N N     . ARG B 1 183 ? 27.999  -41.942  -138.398 1.00 123.72 ? 180 ARG B N     1 
ATOM 2631  C CA    . ARG B 1 183 ? 28.561  -41.242  -137.243 1.00 135.72 ? 180 ARG B CA    1 
ATOM 2632  C C     . ARG B 1 183 ? 27.945  -39.852  -137.142 1.00 136.44 ? 180 ARG B C     1 
ATOM 2633  O O     . ARG B 1 183 ? 28.328  -38.930  -137.865 1.00 134.84 ? 180 ARG B O     1 
ATOM 2634  C CB    . ARG B 1 183 ? 30.080  -41.167  -137.361 1.00 128.82 ? 180 ARG B CB    1 
ATOM 2635  C CG    . ARG B 1 183 ? 30.792  -40.572  -136.145 1.00 130.42 ? 180 ARG B CG    1 
ATOM 2636  C CD    . ARG B 1 183 ? 30.460  -41.248  -134.830 1.00 138.78 ? 180 ARG B CD    1 
ATOM 2637  N NE    . ARG B 1 183 ? 31.146  -40.581  -133.723 1.00 148.39 ? 180 ARG B NE    1 
ATOM 2638  C CZ    . ARG B 1 183 ? 30.806  -40.705  -132.443 1.00 151.42 ? 180 ARG B CZ    1 
ATOM 2639  N NH1   . ARG B 1 183 ? 29.779  -41.471  -132.102 1.00 146.75 ? 180 ARG B NH1   1 
ATOM 2640  N NH2   . ARG B 1 183 ? 31.485  -40.053  -131.506 1.00 147.97 ? 180 ARG B NH2   1 
ATOM 2641  N N     . GLN B 1 184 ? 26.976  -39.700  -136.243 1.00 137.35 ? 181 GLN B N     1 
ATOM 2642  C CA    . GLN B 1 184 ? 26.313  -38.420  -136.046 1.00 136.22 ? 181 GLN B CA    1 
ATOM 2643  C C     . GLN B 1 184 ? 27.121  -37.550  -135.092 1.00 140.69 ? 181 GLN B C     1 
ATOM 2644  O O     . GLN B 1 184 ? 27.799  -38.046  -134.187 1.00 133.70 ? 181 GLN B O     1 
ATOM 2645  C CB    . GLN B 1 184 ? 24.890  -38.617  -135.521 1.00 134.07 ? 181 GLN B CB    1 
ATOM 2646  C CG    . GLN B 1 184 ? 24.785  -39.409  -134.228 1.00 144.75 ? 181 GLN B CG    1 
ATOM 2647  C CD    . GLN B 1 184 ? 23.370  -39.439  -133.679 1.00 139.02 ? 181 GLN B CD    1 
ATOM 2648  O OE1   . GLN B 1 184 ? 22.877  -38.450  -133.131 1.00 143.29 ? 181 GLN B OE1   1 
ATOM 2649  N NE2   . GLN B 1 184 ? 22.702  -40.576  -133.838 1.00 114.66 ? 181 GLN B NE2   1 
ATOM 2650  N N     . LEU B 1 185 ? 27.035  -36.241  -135.291 1.00 146.13 ? 182 LEU B N     1 
ATOM 2651  C CA    . LEU B 1 185 ? 27.780  -35.349  -134.421 1.00 144.28 ? 182 LEU B CA    1 
ATOM 2652  C C     . LEU B 1 185 ? 27.086  -35.250  -133.062 1.00 140.18 ? 182 LEU B C     1 
ATOM 2653  O O     . LEU B 1 185 ? 25.860  -35.365  -132.979 1.00 136.85 ? 182 LEU B O     1 
ATOM 2654  C CB    . LEU B 1 185 ? 27.896  -33.964  -135.057 1.00 140.95 ? 182 LEU B CB    1 
ATOM 2655  C CG    . LEU B 1 185 ? 29.096  -33.085  -134.688 1.00 138.22 ? 182 LEU B CG    1 
ATOM 2656  C CD1   . LEU B 1 185 ? 30.395  -33.787  -135.050 1.00 126.91 ? 182 LEU B CD1   1 
ATOM 2657  C CD2   . LEU B 1 185 ? 29.017  -31.725  -135.372 1.00 122.18 ? 182 LEU B CD2   1 
ATOM 2658  N N     . PRO B 1 186 ? 27.860  -35.090  -131.974 1.00 137.61 ? 183 PRO B N     1 
ATOM 2659  C CA    . PRO B 1 186 ? 27.255  -34.955  -130.640 1.00 137.94 ? 183 PRO B CA    1 
ATOM 2660  C C     . PRO B 1 186 ? 26.130  -33.932  -130.590 1.00 132.75 ? 183 PRO B C     1 
ATOM 2661  O O     . PRO B 1 186 ? 26.328  -32.758  -130.918 1.00 129.87 ? 183 PRO B O     1 
ATOM 2662  C CB    . PRO B 1 186 ? 28.439  -34.528  -129.765 1.00 130.44 ? 183 PRO B CB    1 
ATOM 2663  C CG    . PRO B 1 186 ? 29.630  -35.132  -130.430 1.00 133.81 ? 183 PRO B CG    1 
ATOM 2664  C CD    . PRO B 1 186 ? 29.323  -35.253  -131.905 1.00 136.59 ? 183 PRO B CD    1 
ATOM 2665  N N     . LEU B 1 187 ? 24.941  -34.384  -130.192 1.00 124.68 ? 184 LEU B N     1 
ATOM 2666  C CA    . LEU B 1 187 ? 23.791  -33.498  -130.067 1.00 123.37 ? 184 LEU B CA    1 
ATOM 2667  C C     . LEU B 1 187 ? 24.069  -32.387  -129.059 1.00 126.07 ? 184 LEU B C     1 
ATOM 2668  O O     . LEU B 1 187 ? 24.864  -32.542  -128.128 1.00 126.93 ? 184 LEU B O     1 
ATOM 2669  C CB    . LEU B 1 187 ? 22.544  -34.284  -129.652 1.00 121.34 ? 184 LEU B CB    1 
ATOM 2670  C CG    . LEU B 1 187 ? 22.057  -35.413  -130.569 1.00 131.07 ? 184 LEU B CG    1 
ATOM 2671  C CD1   . LEU B 1 187 ? 22.215  -35.035  -132.040 1.00 124.37 ? 184 LEU B CD1   1 
ATOM 2672  C CD2   . LEU B 1 187 ? 22.745  -36.742  -130.258 1.00 124.92 ? 184 LEU B CD2   1 
ATOM 2673  N N     . GLU B 1 188 ? 23.396  -31.258  -129.252 1.00 123.10 ? 185 GLU B N     1 
ATOM 2674  C CA    . GLU B 1 188 ? 23.545  -30.096  -128.390 1.00 117.10 ? 185 GLU B CA    1 
ATOM 2675  C C     . GLU B 1 188 ? 22.451  -30.069  -127.332 1.00 109.31 ? 185 GLU B C     1 
ATOM 2676  O O     . GLU B 1 188 ? 21.335  -30.549  -127.546 1.00 109.77 ? 185 GLU B O     1 
ATOM 2677  C CB    . GLU B 1 188 ? 23.501  -28.792  -129.190 1.00 117.91 ? 185 GLU B CB    1 
ATOM 2678  C CG    . GLU B 1 188 ? 24.122  -27.613  -128.448 1.00 124.14 ? 185 GLU B CG    1 
ATOM 2679  C CD    . GLU B 1 188 ? 24.063  -26.322  -129.237 1.00 131.54 ? 185 GLU B CD    1 
ATOM 2680  O OE1   . GLU B 1 188 ? 22.976  -26.007  -129.765 1.00 129.62 ? 185 GLU B OE1   1 
ATOM 2681  O OE2   . GLU B 1 188 ? 25.095  -25.623  -129.324 1.00 135.36 ? 185 GLU B OE2   1 
ATOM 2682  N N     . VAL B 1 189 ? 22.786  -29.491  -126.183 1.00 91.15  ? 186 VAL B N     1 
ATOM 2683  C CA    . VAL B 1 189 ? 21.905  -29.452  -125.025 1.00 84.15  ? 186 VAL B CA    1 
ATOM 2684  C C     . VAL B 1 189 ? 21.263  -28.076  -124.955 1.00 90.96  ? 186 VAL B C     1 
ATOM 2685  O O     . VAL B 1 189 ? 21.948  -27.054  -125.091 1.00 92.93  ? 186 VAL B O     1 
ATOM 2686  C CB    . VAL B 1 189 ? 22.673  -29.759  -123.729 1.00 91.56  ? 186 VAL B CB    1 
ATOM 2687  C CG1   . VAL B 1 189 ? 21.730  -29.715  -122.544 1.00 95.22  ? 186 VAL B CG1   1 
ATOM 2688  C CG2   . VAL B 1 189 ? 23.359  -31.111  -123.823 1.00 91.37  ? 186 VAL B CG2   1 
ATOM 2689  N N     . ASP B 1 190 ? 19.949  -28.049  -124.747 1.00 87.00  ? 187 ASP B N     1 
ATOM 2690  C CA    . ASP B 1 190 ? 19.167  -26.814  -124.720 1.00 91.54  ? 187 ASP B CA    1 
ATOM 2691  C C     . ASP B 1 190 ? 18.995  -26.358  -123.275 1.00 90.82  ? 187 ASP B C     1 
ATOM 2692  O O     . ASP B 1 190 ? 18.129  -26.857  -122.551 1.00 87.68  ? 187 ASP B O     1 
ATOM 2693  C CB    . ASP B 1 190 ? 17.821  -27.020  -125.405 1.00 93.85  ? 187 ASP B CB    1 
ATOM 2694  C CG    . ASP B 1 190 ? 16.933  -25.796  -125.322 1.00 97.49  ? 187 ASP B CG    1 
ATOM 2695  O OD1   . ASP B 1 190 ? 17.461  -24.666  -125.338 1.00 93.50  ? 187 ASP B OD1   1 
ATOM 2696  O OD2   . ASP B 1 190 ? 15.699  -25.968  -125.254 1.00 95.00  ? 187 ASP B OD2   1 
ATOM 2697  N N     . LEU B 1 191 ? 19.819  -25.395  -122.864 1.00 88.78  ? 188 LEU B N     1 
ATOM 2698  C CA    . LEU B 1 191 ? 19.832  -24.889  -121.500 1.00 89.53  ? 188 LEU B CA    1 
ATOM 2699  C C     . LEU B 1 191 ? 18.825  -23.762  -121.267 1.00 93.87  ? 188 LEU B C     1 
ATOM 2700  O O     . LEU B 1 191 ? 18.952  -23.028  -120.280 1.00 93.41  ? 188 LEU B O     1 
ATOM 2701  C CB    . LEU B 1 191 ? 21.244  -24.416  -121.139 1.00 80.94  ? 188 LEU B CB    1 
ATOM 2702  C CG    . LEU B 1 191 ? 22.333  -25.495  -121.140 1.00 89.08  ? 188 LEU B CG    1 
ATOM 2703  C CD1   . LEU B 1 191 ? 23.669  -24.936  -120.673 1.00 73.64  ? 188 LEU B CD1   1 
ATOM 2704  C CD2   . LEU B 1 191 ? 21.921  -26.685  -120.283 1.00 87.30  ? 188 LEU B CD2   1 
ATOM 2705  N N     . THR B 1 192 ? 17.829  -23.606  -122.146 1.00 97.77  ? 189 THR B N     1 
ATOM 2706  C CA    . THR B 1 192 ? 16.853  -22.538  -121.945 1.00 98.43  ? 189 THR B CA    1 
ATOM 2707  C C     . THR B 1 192 ? 15.919  -22.850  -120.782 1.00 96.71  ? 189 THR B C     1 
ATOM 2708  O O     . THR B 1 192 ? 15.640  -21.976  -119.955 1.00 91.81  ? 189 THR B O     1 
ATOM 2709  C CB    . THR B 1 192 ? 16.042  -22.299  -123.221 1.00 88.65  ? 189 THR B CB    1 
ATOM 2710  O OG1   . THR B 1 192 ? 15.419  -23.522  -123.637 1.00 91.76  ? 189 THR B OG1   1 
ATOM 2711  C CG2   . THR B 1 192 ? 16.924  -21.764  -124.338 1.00 88.80  ? 189 THR B CG2   1 
ATOM 2712  N N     . LYS B 1 193 ? 15.437  -24.093  -120.691 1.00 97.66  ? 190 LYS B N     1 
ATOM 2713  C CA    . LYS B 1 193 ? 14.577  -24.529  -119.597 1.00 96.84  ? 190 LYS B CA    1 
ATOM 2714  C C     . LYS B 1 193 ? 15.356  -25.165  -118.453 1.00 103.82 ? 190 LYS B C     1 
ATOM 2715  O O     . LYS B 1 193 ? 14.810  -26.009  -117.728 1.00 94.53  ? 190 LYS B O     1 
ATOM 2716  C CB    . LYS B 1 193 ? 13.508  -25.492  -120.114 1.00 92.92  ? 190 LYS B CB    1 
ATOM 2717  C CG    . LYS B 1 193 ? 12.568  -24.876  -121.128 1.00 109.12 ? 190 LYS B CG    1 
ATOM 2718  C CD    . LYS B 1 193 ? 11.442  -25.826  -121.483 1.00 110.10 ? 190 LYS B CD    1 
ATOM 2719  C CE    . LYS B 1 193 ? 10.445  -25.158  -122.413 1.00 111.75 ? 190 LYS B CE    1 
ATOM 2720  N NZ    . LYS B 1 193 ? 9.429   -26.118  -122.922 1.00 128.18 ? 190 LYS B NZ    1 
ATOM 2721  N N     . ALA B 1 194 ? 16.616  -24.783  -118.272 1.00 101.36 ? 191 ALA B N     1 
ATOM 2722  C CA    . ALA B 1 194 ? 17.413  -25.316  -117.181 1.00 83.68  ? 191 ALA B CA    1 
ATOM 2723  C C     . ALA B 1 194 ? 16.910  -24.777  -115.848 1.00 87.52  ? 191 ALA B C     1 
ATOM 2724  O O     . ALA B 1 194 ? 16.358  -23.676  -115.765 1.00 86.72  ? 191 ALA B O     1 
ATOM 2725  C CB    . ALA B 1 194 ? 18.888  -24.961  -117.371 1.00 73.17  ? 191 ALA B CB    1 
ATOM 2726  N N     . LYS B 1 195 ? 17.085  -25.579  -114.800 1.00 94.39  ? 192 LYS B N     1 
ATOM 2727  C CA    . LYS B 1 195 ? 16.663  -25.166  -113.470 1.00 81.02  ? 192 LYS B CA    1 
ATOM 2728  C C     . LYS B 1 195 ? 17.514  -23.989  -113.010 1.00 79.48  ? 192 LYS B C     1 
ATOM 2729  O O     . LYS B 1 195 ? 18.747  -24.055  -113.020 1.00 73.06  ? 192 LYS B O     1 
ATOM 2730  C CB    . LYS B 1 195 ? 16.771  -26.335  -112.490 1.00 78.21  ? 192 LYS B CB    1 
ATOM 2731  C CG    . LYS B 1 195 ? 16.349  -26.007  -111.062 1.00 85.00  ? 192 LYS B CG    1 
ATOM 2732  C CD    . LYS B 1 195 ? 16.527  -27.208  -110.140 1.00 66.14  ? 192 LYS B CD    1 
ATOM 2733  C CE    . LYS B 1 195 ? 16.029  -26.906  -108.737 1.00 75.32  ? 192 LYS B CE    1 
ATOM 2734  N NZ    . LYS B 1 195 ? 14.593  -26.510  -108.725 1.00 70.67  ? 192 LYS B NZ    1 
ATOM 2735  N N     . ARG B 1 196 ? 16.848  -22.912  -112.595 1.00 79.71  ? 193 ARG B N     1 
ATOM 2736  C CA    . ARG B 1 196 ? 17.523  -21.661  -112.296 1.00 85.96  ? 193 ARG B CA    1 
ATOM 2737  C C     . ARG B 1 196 ? 17.370  -21.229  -110.848 1.00 88.81  ? 193 ARG B C     1 
ATOM 2738  O O     . ARG B 1 196 ? 18.150  -20.387  -110.388 1.00 85.30  ? 193 ARG B O     1 
ATOM 2739  C CB    . ARG B 1 196 ? 16.985  -20.545  -113.209 1.00 95.35  ? 193 ARG B CB    1 
ATOM 2740  C CG    . ARG B 1 196 ? 17.278  -20.784  -114.687 1.00 102.28 ? 193 ARG B CG    1 
ATOM 2741  C CD    . ARG B 1 196 ? 17.122  -19.545  -115.556 1.00 103.10 ? 193 ARG B CD    1 
ATOM 2742  N NE    . ARG B 1 196 ? 18.409  -19.099  -116.082 1.00 105.72 ? 193 ARG B NE    1 
ATOM 2743  C CZ    . ARG B 1 196 ? 19.038  -19.691  -117.094 1.00 110.85 ? 193 ARG B CZ    1 
ATOM 2744  N NH1   . ARG B 1 196 ? 18.497  -20.749  -117.686 1.00 107.67 ? 193 ARG B NH1   1 
ATOM 2745  N NH2   . ARG B 1 196 ? 20.207  -19.227  -117.518 1.00 117.68 ? 193 ARG B NH2   1 
ATOM 2746  N N     . GLN B 1 197 ? 16.407  -21.788  -110.118 1.00 84.34  ? 194 GLN B N     1 
ATOM 2747  C CA    . GLN B 1 197 ? 16.240  -21.528  -108.698 1.00 86.42  ? 194 GLN B CA    1 
ATOM 2748  C C     . GLN B 1 197 ? 15.920  -22.840  -107.999 1.00 83.93  ? 194 GLN B C     1 
ATOM 2749  O O     . GLN B 1 197 ? 15.457  -23.799  -108.622 1.00 82.73  ? 194 GLN B O     1 
ATOM 2750  C CB    . GLN B 1 197 ? 15.119  -20.512  -108.445 1.00 91.59  ? 194 GLN B CB    1 
ATOM 2751  C CG    . GLN B 1 197 ? 15.418  -19.110  -108.940 1.00 115.48 ? 194 GLN B CG    1 
ATOM 2752  C CD    . GLN B 1 197 ? 14.270  -18.151  -108.697 1.00 138.50 ? 194 GLN B CD    1 
ATOM 2753  O OE1   . GLN B 1 197 ? 13.117  -18.564  -108.568 1.00 148.12 ? 194 GLN B OE1   1 
ATOM 2754  N NE2   . GLN B 1 197 ? 14.578  -16.859  -108.642 1.00 141.82 ? 194 GLN B NE2   1 
ATOM 2755  N N     . ASP B 1 198 ? 16.165  -22.872  -106.688 1.00 77.62  ? 195 ASP B N     1 
ATOM 2756  C CA    . ASP B 1 198 ? 16.030  -24.121  -105.946 1.00 69.29  ? 195 ASP B CA    1 
ATOM 2757  C C     . ASP B 1 198 ? 14.576  -24.568  -105.881 1.00 71.24  ? 195 ASP B C     1 
ATOM 2758  O O     . ASP B 1 198 ? 14.277  -25.754  -106.064 1.00 74.48  ? 195 ASP B O     1 
ATOM 2759  C CB    . ASP B 1 198 ? 16.621  -23.975  -104.544 1.00 65.46  ? 195 ASP B CB    1 
ATOM 2760  C CG    . ASP B 1 198 ? 18.127  -23.814  -104.565 1.00 66.01  ? 195 ASP B CG    1 
ATOM 2761  O OD1   . ASP B 1 198 ? 18.756  -24.300  -105.528 1.00 72.06  ? 195 ASP B OD1   1 
ATOM 2762  O OD2   . ASP B 1 198 ? 18.682  -23.218  -103.619 1.00 64.22  ? 195 ASP B OD2   1 
ATOM 2763  N N     . LEU B 1 199 ? 13.666  -23.634  -105.602 1.00 75.92  ? 196 LEU B N     1 
ATOM 2764  C CA    . LEU B 1 199 ? 12.271  -23.963  -105.335 1.00 67.62  ? 196 LEU B CA    1 
ATOM 2765  C C     . LEU B 1 199 ? 11.656  -24.769  -106.472 1.00 73.66  ? 196 LEU B C     1 
ATOM 2766  O O     . LEU B 1 199 ? 11.923  -24.522  -107.651 1.00 80.71  ? 196 LEU B O     1 
ATOM 2767  C CB    . LEU B 1 199 ? 11.470  -22.678  -105.117 1.00 78.09  ? 196 LEU B CB    1 
ATOM 2768  C CG    . LEU B 1 199 ? 9.994   -22.845  -104.760 1.00 87.06  ? 196 LEU B CG    1 
ATOM 2769  C CD1   . LEU B 1 199 ? 9.848   -23.705  -103.516 1.00 89.83  ? 196 LEU B CD1   1 
ATOM 2770  C CD2   . LEU B 1 199 ? 9.334   -21.488  -104.570 1.00 87.03  ? 196 LEU B CD2   1 
ATOM 2771  N N     . GLU B 1 200 ? 10.834  -25.750  -106.101 1.00 78.23  ? 197 GLU B N     1 
ATOM 2772  C CA    . GLU B 1 200 ? 10.086  -26.579  -107.044 1.00 78.03  ? 197 GLU B CA    1 
ATOM 2773  C C     . GLU B 1 200 ? 8.624   -26.464  -106.638 1.00 87.64  ? 197 GLU B C     1 
ATOM 2774  O O     . GLU B 1 200 ? 8.136   -27.247  -105.811 1.00 82.14  ? 197 GLU B O     1 
ATOM 2775  C CB    . GLU B 1 200 ? 10.563  -28.030  -107.021 1.00 76.97  ? 197 GLU B CB    1 
ATOM 2776  C CG    . GLU B 1 200 ? 11.924  -28.247  -107.662 1.00 72.51  ? 197 GLU B CG    1 
ATOM 2777  C CD    . GLU B 1 200 ? 11.893  -28.123  -109.171 1.00 74.64  ? 197 GLU B CD    1 
ATOM 2778  O OE1   . GLU B 1 200 ? 10.821  -28.345  -109.771 1.00 81.55  ? 197 GLU B OE1   1 
ATOM 2779  O OE2   . GLU B 1 200 ? 12.948  -27.795  -109.757 1.00 73.89  ? 197 GLU B OE2   1 
ATOM 2780  N N     . PRO B 1 201 ? 7.897   -25.480  -107.182 1.00 94.31  ? 198 PRO B N     1 
ATOM 2781  C CA    . PRO B 1 201 ? 6.557   -25.192  -106.641 1.00 88.31  ? 198 PRO B CA    1 
ATOM 2782  C C     . PRO B 1 201 ? 5.565   -26.330  -106.815 1.00 84.82  ? 198 PRO B C     1 
ATOM 2783  O O     . PRO B 1 201 ? 4.845   -26.655  -105.864 1.00 84.87  ? 198 PRO B O     1 
ATOM 2784  C CB    . PRO B 1 201 ? 6.125   -23.938  -107.419 1.00 86.04  ? 198 PRO B CB    1 
ATOM 2785  C CG    . PRO B 1 201 ? 7.385   -23.377  -108.006 1.00 85.09  ? 198 PRO B CG    1 
ATOM 2786  C CD    . PRO B 1 201 ? 8.270   -24.555  -108.264 1.00 89.97  ? 198 PRO B CD    1 
ATOM 2787  N N     . SER B 1 202 ? 5.505   -26.951  -107.996 1.00 85.72  ? 199 SER B N     1 
ATOM 2788  C CA    . SER B 1 202 ? 4.601   -28.084  -108.184 1.00 80.31  ? 199 SER B CA    1 
ATOM 2789  C C     . SER B 1 202 ? 4.960   -29.231  -107.249 1.00 84.01  ? 199 SER B C     1 
ATOM 2790  O O     . SER B 1 202 ? 4.076   -29.888  -106.681 1.00 84.71  ? 199 SER B O     1 
ATOM 2791  C CB    . SER B 1 202 ? 4.629   -28.548  -109.640 1.00 77.75  ? 199 SER B CB    1 
ATOM 2792  O OG    . SER B 1 202 ? 3.846   -29.717  -109.812 1.00 82.59  ? 199 SER B OG    1 
ATOM 2793  N N     . VAL B 1 203 ? 6.259   -29.479  -107.075 1.00 85.60  ? 200 VAL B N     1 
ATOM 2794  C CA    . VAL B 1 203 ? 6.702   -30.544  -106.184 1.00 80.21  ? 200 VAL B CA    1 
ATOM 2795  C C     . VAL B 1 203 ? 6.306   -30.227  -104.747 1.00 78.93  ? 200 VAL B C     1 
ATOM 2796  O O     . VAL B 1 203 ? 5.790   -31.089  -104.026 1.00 75.04  ? 200 VAL B O     1 
ATOM 2797  C CB    . VAL B 1 203 ? 8.220   -30.756  -106.321 1.00 76.65  ? 200 VAL B CB    1 
ATOM 2798  C CG1   . VAL B 1 203 ? 8.687   -31.859  -105.393 1.00 67.33  ? 200 VAL B CG1   1 
ATOM 2799  C CG2   . VAL B 1 203 ? 8.587   -31.070  -107.764 1.00 79.53  ? 200 VAL B CG2   1 
ATOM 2800  N N     . GLU B 1 204 ? 6.567   -28.994  -104.303 1.00 80.22  ? 201 GLU B N     1 
ATOM 2801  C CA    . GLU B 1 204 ? 6.166   -28.583  -102.958 1.00 83.03  ? 201 GLU B CA    1 
ATOM 2802  C C     . GLU B 1 204 ? 4.663   -28.716  -102.759 1.00 77.11  ? 201 GLU B C     1 
ATOM 2803  O O     . GLU B 1 204 ? 4.207   -29.135  -101.690 1.00 73.03  ? 201 GLU B O     1 
ATOM 2804  C CB    . GLU B 1 204 ? 6.612   -27.147  -102.681 1.00 75.67  ? 201 GLU B CB    1 
ATOM 2805  C CG    . GLU B 1 204 ? 6.036   -26.565  -101.392 1.00 82.50  ? 201 GLU B CG    1 
ATOM 2806  C CD    . GLU B 1 204 ? 6.455   -27.339  -100.154 1.00 85.18  ? 201 GLU B CD    1 
ATOM 2807  O OE1   . GLU B 1 204 ? 7.616   -27.797  -100.102 1.00 84.05  ? 201 GLU B OE1   1 
ATOM 2808  O OE2   . GLU B 1 204 ? 5.626   -27.476  -99.226  1.00 75.15  ? 201 GLU B OE2   1 
ATOM 2809  N N     . GLU B 1 205 ? 3.881   -28.394  -103.789 1.00 79.72  ? 202 GLU B N     1 
ATOM 2810  C CA    . GLU B 1 205 ? 2.431   -28.489  -103.678 1.00 80.51  ? 202 GLU B CA    1 
ATOM 2811  C C     . GLU B 1 205 ? 2.001   -29.938  -103.502 1.00 77.67  ? 202 GLU B C     1 
ATOM 2812  O O     . GLU B 1 205 ? 1.236   -30.265  -102.585 1.00 75.43  ? 202 GLU B O     1 
ATOM 2813  C CB    . GLU B 1 205 ? 1.776   -27.881  -104.920 1.00 85.57  ? 202 GLU B CB    1 
ATOM 2814  C CG    . GLU B 1 205 ? 0.258   -27.963  -104.945 1.00 86.13  ? 202 GLU B CG    1 
ATOM 2815  C CD    . GLU B 1 205 ? -0.327  -27.402  -106.229 1.00 96.38  ? 202 GLU B CD    1 
ATOM 2816  O OE1   . GLU B 1 205 ? 0.161   -27.775  -107.318 1.00 102.42 ? 202 GLU B OE1   1 
ATOM 2817  O OE2   . GLU B 1 205 ? -1.277  -26.595  -106.153 1.00 103.15 ? 202 GLU B OE2   1 
ATOM 2818  N N     . ALA B 1 206 ? 2.483   -30.821  -104.379 1.00 77.93  ? 203 ALA B N     1 
ATOM 2819  C CA    . ALA B 1 206 ? 2.154   -32.237  -104.258 1.00 77.98  ? 203 ALA B CA    1 
ATOM 2820  C C     . ALA B 1 206 ? 2.616   -32.824  -102.927 1.00 81.79  ? 203 ALA B C     1 
ATOM 2821  O O     . ALA B 1 206 ? 1.914   -33.658  -102.336 1.00 78.34  ? 203 ALA B O     1 
ATOM 2822  C CB    . ALA B 1 206 ? 2.767   -33.010  -105.422 1.00 74.10  ? 203 ALA B CB    1 
ATOM 2823  N N     . ARG B 1 207 ? 3.756   -32.363  -102.404 1.00 79.05  ? 204 ARG B N     1 
ATOM 2824  C CA    . ARG B 1 207 ? 4.251   -32.931  -101.156 1.00 73.92  ? 204 ARG B CA    1 
ATOM 2825  C C     . ARG B 1 207 ? 3.432   -32.434  -99.973  1.00 80.64  ? 204 ARG B C     1 
ATOM 2826  O O     . ARG B 1 207 ? 3.139   -33.200  -99.048  1.00 88.52  ? 204 ARG B O     1 
ATOM 2827  C CB    . ARG B 1 207 ? 5.731   -32.597  -100.965 1.00 77.04  ? 204 ARG B CB    1 
ATOM 2828  C CG    . ARG B 1 207 ? 6.340   -33.236  -99.726  1.00 75.97  ? 204 ARG B CG    1 
ATOM 2829  C CD    . ARG B 1 207 ? 7.790   -32.827  -99.517  1.00 72.79  ? 204 ARG B CD    1 
ATOM 2830  N NE    . ARG B 1 207 ? 8.569   -32.776  -100.751 1.00 72.28  ? 204 ARG B NE    1 
ATOM 2831  C CZ    . ARG B 1 207 ? 9.134   -31.666  -101.218 1.00 69.90  ? 204 ARG B CZ    1 
ATOM 2832  N NH1   . ARG B 1 207 ? 8.999   -30.526  -100.555 1.00 72.87  ? 204 ARG B NH1   1 
ATOM 2833  N NH2   . ARG B 1 207 ? 9.834   -31.691  -102.343 1.00 66.02  ? 204 ARG B NH2   1 
ATOM 2834  N N     . TYR B 1 208 ? 3.072   -31.148  -99.975  1.00 74.55  ? 205 TYR B N     1 
ATOM 2835  C CA    . TYR B 1 208 ? 2.181   -30.630  -98.945  1.00 80.35  ? 205 TYR B CA    1 
ATOM 2836  C C     . TYR B 1 208 ? 0.841   -31.354  -98.967  1.00 78.08  ? 205 TYR B C     1 
ATOM 2837  O O     . TYR B 1 208 ? 0.274   -31.657  -97.911  1.00 76.03  ? 205 TYR B O     1 
ATOM 2838  C CB    . TYR B 1 208 ? 1.990   -29.124  -99.130  1.00 82.10  ? 205 TYR B CB    1 
ATOM 2839  C CG    . TYR B 1 208 ? 1.100   -28.493  -98.088  1.00 85.38  ? 205 TYR B CG    1 
ATOM 2840  C CD1   . TYR B 1 208 ? 1.592   -28.167  -96.832  1.00 83.44  ? 205 TYR B CD1   1 
ATOM 2841  C CD2   . TYR B 1 208 ? -0.234  -28.222  -98.360  1.00 90.42  ? 205 TYR B CD2   1 
ATOM 2842  C CE1   . TYR B 1 208 ? 0.779   -27.591  -95.875  1.00 87.83  ? 205 TYR B CE1   1 
ATOM 2843  C CE2   . TYR B 1 208 ? -1.055  -27.645  -97.409  1.00 84.30  ? 205 TYR B CE2   1 
ATOM 2844  C CZ    . TYR B 1 208 ? -0.542  -27.331  -96.169  1.00 88.63  ? 205 TYR B CZ    1 
ATOM 2845  O OH    . TYR B 1 208 ? -1.353  -26.757  -95.218  1.00 98.45  ? 205 TYR B OH    1 
ATOM 2846  N N     . ASN B 1 209 ? 0.318   -31.643  -100.163 1.00 80.59  ? 206 ASN B N     1 
ATOM 2847  C CA    . ASN B 1 209 ? -0.925  -32.401  -100.265 1.00 84.42  ? 206 ASN B CA    1 
ATOM 2848  C C     . ASN B 1 209 ? -0.738  -33.884  -99.975  1.00 89.56  ? 206 ASN B C     1 
ATOM 2849  O O     . ASN B 1 209 ? -1.736  -34.608  -99.885  1.00 85.16  ? 206 ASN B O     1 
ATOM 2850  C CB    . ASN B 1 209 ? -1.558  -32.220  -101.648 1.00 87.23  ? 206 ASN B CB    1 
ATOM 2851  C CG    . ASN B 1 209 ? -1.777  -30.759  -102.006 1.00 90.62  ? 206 ASN B CG    1 
ATOM 2852  O OD1   . ASN B 1 209 ? -1.424  -30.313  -103.100 1.00 95.23  ? 206 ASN B OD1   1 
ATOM 2853  N ND2   . ASN B 1 209 ? -2.357  -30.004  -101.078 1.00 72.61  ? 206 ASN B ND2   1 
ATOM 2854  N N     . SER B 1 210 ? 0.503   -34.351  -99.823  1.00 93.79  ? 207 SER B N     1 
ATOM 2855  C CA    . SER B 1 210 ? 0.755   -35.757  -99.534  1.00 89.95  ? 207 SER B CA    1 
ATOM 2856  C C     . SER B 1 210 ? 0.671   -36.098  -98.049  1.00 89.06  ? 207 SER B C     1 
ATOM 2857  O O     . SER B 1 210 ? 0.710   -37.284  -97.706  1.00 84.00  ? 207 SER B O     1 
ATOM 2858  C CB    . SER B 1 210 ? 2.135   -36.160  -100.067 1.00 89.31  ? 207 SER B CB    1 
ATOM 2859  O OG    . SER B 1 210 ? 2.339   -37.560  -99.965  1.00 96.25  ? 207 SER B OG    1 
ATOM 2860  N N     . CYS B 1 211 ? 0.554   -35.109  -97.166  1.00 91.48  ? 208 CYS B N     1 
ATOM 2861  C CA    . CYS B 1 211 ? 0.587   -35.371  -95.727  1.00 92.27  ? 208 CYS B CA    1 
ATOM 2862  C C     . CYS B 1 211 ? -0.814  -35.598  -95.162  1.00 101.24 ? 208 CYS B C     1 
ATOM 2863  O O     . CYS B 1 211 ? -1.768  -35.826  -95.903  1.00 103.34 ? 208 CYS B O     1 
ATOM 2864  C CB    . CYS B 1 211 ? 1.252   -34.210  -94.986  1.00 77.53  ? 208 CYS B CB    1 
ATOM 2865  S SG    . CYS B 1 211 ? 2.881   -33.738  -95.605  1.00 85.19  ? 208 CYS B SG    1 
ATOM 2866  N N     . CYS C 1 28  ? 6.477   -43.651  -90.520  1.00 79.59  ? 25  CYS C N     1 
ATOM 2867  C CA    . CYS C 1 28  ? 7.668   -42.847  -90.262  1.00 76.52  ? 25  CYS C CA    1 
ATOM 2868  C C     . CYS C 1 28  ? 8.578   -42.780  -91.488  1.00 74.63  ? 25  CYS C C     1 
ATOM 2869  O O     . CYS C 1 28  ? 8.116   -42.970  -92.613  1.00 78.02  ? 25  CYS C O     1 
ATOM 2870  C CB    . CYS C 1 28  ? 8.434   -43.409  -89.060  1.00 70.15  ? 25  CYS C CB    1 
ATOM 2871  S SG    . CYS C 1 28  ? 9.053   -45.099  -89.291  1.00 75.15  ? 25  CYS C SG    1 
ATOM 2872  N N     . PHE C 1 29  ? 9.869   -42.527  -91.264  1.00 65.60  ? 26  PHE C N     1 
ATOM 2873  C CA    . PHE C 1 29  ? 10.829  -42.432  -92.357  1.00 60.21  ? 26  PHE C CA    1 
ATOM 2874  C C     . PHE C 1 29  ? 11.198  -43.830  -92.839  1.00 57.27  ? 26  PHE C C     1 
ATOM 2875  O O     . PHE C 1 29  ? 11.318  -44.769  -92.046  1.00 66.76  ? 26  PHE C O     1 
ATOM 2876  C CB    . PHE C 1 29  ? 12.080  -41.668  -91.913  1.00 60.15  ? 26  PHE C CB    1 
ATOM 2877  C CG    . PHE C 1 29  ? 12.921  -41.159  -93.051  1.00 52.61  ? 26  PHE C CG    1 
ATOM 2878  C CD1   . PHE C 1 29  ? 13.952  -41.922  -93.572  1.00 49.37  ? 26  PHE C CD1   1 
ATOM 2879  C CD2   . PHE C 1 29  ? 12.680  -39.908  -93.596  1.00 50.84  ? 26  PHE C CD2   1 
ATOM 2880  C CE1   . PHE C 1 29  ? 14.722  -41.448  -94.622  1.00 51.31  ? 26  PHE C CE1   1 
ATOM 2881  C CE2   . PHE C 1 29  ? 13.447  -39.431  -94.645  1.00 57.15  ? 26  PHE C CE2   1 
ATOM 2882  C CZ    . PHE C 1 29  ? 14.468  -40.203  -95.158  1.00 55.25  ? 26  PHE C CZ    1 
ATOM 2883  N N     . GLY C 1 30  ? 11.352  -43.973  -94.154  1.00 58.89  ? 27  GLY C N     1 
ATOM 2884  C CA    . GLY C 1 30  ? 11.529  -45.278  -94.754  1.00 55.93  ? 27  GLY C CA    1 
ATOM 2885  C C     . GLY C 1 30  ? 10.243  -46.050  -94.944  1.00 61.15  ? 27  GLY C C     1 
ATOM 2886  O O     . GLY C 1 30  ? 10.254  -47.088  -95.618  1.00 63.81  ? 27  GLY C O     1 
ATOM 2887  N N     . GLN C 1 31  ? 9.132   -45.573  -94.380  1.00 66.11  ? 28  GLN C N     1 
ATOM 2888  C CA    . GLN C 1 31  ? 7.829   -46.205  -94.530  1.00 61.99  ? 28  GLN C CA    1 
ATOM 2889  C C     . GLN C 1 31  ? 6.877   -45.419  -95.417  1.00 64.40  ? 28  GLN C C     1 
ATOM 2890  O O     . GLN C 1 31  ? 6.029   -46.028  -96.072  1.00 75.40  ? 28  GLN C O     1 
ATOM 2891  C CB    . GLN C 1 31  ? 7.172   -46.434  -93.161  1.00 68.47  ? 28  GLN C CB    1 
ATOM 2892  C CG    . GLN C 1 31  ? 8.114   -46.984  -92.098  1.00 77.15  ? 28  GLN C CG    1 
ATOM 2893  C CD    . GLN C 1 31  ? 7.471   -48.072  -91.247  1.00 80.48  ? 28  GLN C CD    1 
ATOM 2894  O OE1   . GLN C 1 31  ? 6.684   -47.792  -90.341  1.00 69.99  ? 28  GLN C OE1   1 
ATOM 2895  N NE2   . GLN C 1 31  ? 7.805   -49.325  -91.543  1.00 73.44  ? 28  GLN C NE2   1 
ATOM 2896  N N     . CYS C 1 32  ? 7.000   -44.089  -95.455  1.00 52.84  ? 29  CYS C N     1 
ATOM 2897  C CA    . CYS C 1 32  ? 6.113   -43.271  -96.274  1.00 64.90  ? 29  CYS C CA    1 
ATOM 2898  C C     . CYS C 1 32  ? 6.209   -43.709  -97.728  1.00 73.49  ? 29  CYS C C     1 
ATOM 2899  O O     . CYS C 1 32  ? 7.307   -43.858  -98.270  1.00 71.74  ? 29  CYS C O     1 
ATOM 2900  C CB    . CYS C 1 32  ? 6.497   -41.794  -96.156  1.00 58.92  ? 29  CYS C CB    1 
ATOM 2901  S SG    . CYS C 1 32  ? 5.423   -40.762  -95.145  1.00 88.06  ? 29  CYS C SG    1 
ATOM 2902  N N     . GLN C 1 33  ? 5.063   -43.904  -98.366  1.00 73.16  ? 30  GLN C N     1 
ATOM 2903  C CA    . GLN C 1 33  ? 5.032   -44.227  -99.782  1.00 71.89  ? 30  GLN C CA    1 
ATOM 2904  C C     . GLN C 1 33  ? 4.630   -42.995  -100.581 1.00 75.05  ? 30  GLN C C     1 
ATOM 2905  O O     . GLN C 1 33  ? 3.704   -42.271  -100.206 1.00 75.44  ? 30  GLN C O     1 
ATOM 2906  C CB    . GLN C 1 33  ? 4.081   -45.392  -100.050 1.00 68.54  ? 30  GLN C CB    1 
ATOM 2907  C CG    . GLN C 1 33  ? 4.370   -46.129  -101.339 1.00 75.51  ? 30  GLN C CG    1 
ATOM 2908  C CD    . GLN C 1 33  ? 3.561   -47.403  -101.457 1.00 99.62  ? 30  GLN C CD    1 
ATOM 2909  O OE1   . GLN C 1 33  ? 4.095   -48.503  -101.305 1.00 107.22 ? 30  GLN C OE1   1 
ATOM 2910  N NE2   . GLN C 1 33  ? 2.264   -47.264  -101.713 1.00 89.61  ? 30  GLN C NE2   1 
ATOM 2911  N N     . TYR C 1 34  ? 5.343   -42.759  -101.677 1.00 69.02  ? 31  TYR C N     1 
ATOM 2912  C CA    . TYR C 1 34  ? 5.110   -41.572  -102.488 1.00 64.17  ? 31  TYR C CA    1 
ATOM 2913  C C     . TYR C 1 34  ? 3.729   -41.599  -103.128 1.00 74.83  ? 31  TYR C C     1 
ATOM 2914  O O     . TYR C 1 34  ? 3.322   -42.602  -103.723 1.00 80.14  ? 31  TYR C O     1 
ATOM 2915  C CB    . TYR C 1 34  ? 6.183   -41.454  -103.566 1.00 66.44  ? 31  TYR C CB    1 
ATOM 2916  C CG    . TYR C 1 34  ? 7.410   -40.711  -103.112 1.00 57.64  ? 31  TYR C CG    1 
ATOM 2917  C CD1   . TYR C 1 34  ? 7.363   -39.346  -102.866 1.00 58.66  ? 31  TYR C CD1   1 
ATOM 2918  C CD2   . TYR C 1 34  ? 8.610   -41.374  -102.909 1.00 57.90  ? 31  TYR C CD2   1 
ATOM 2919  C CE1   . TYR C 1 34  ? 8.482   -38.660  -102.449 1.00 66.83  ? 31  TYR C CE1   1 
ATOM 2920  C CE2   . TYR C 1 34  ? 9.734   -40.697  -102.488 1.00 55.86  ? 31  TYR C CE2   1 
ATOM 2921  C CZ    . TYR C 1 34  ? 9.664   -39.340  -102.257 1.00 63.30  ? 31  TYR C CZ    1 
ATOM 2922  O OH    . TYR C 1 34  ? 10.783  -38.661  -101.836 1.00 58.71  ? 31  TYR C OH    1 
ATOM 2923  N N     . THR C 1 35  ? 3.012   -40.488  -103.003 1.00 76.02  ? 32  THR C N     1 
ATOM 2924  C CA    . THR C 1 35  ? 1.752   -40.315  -103.700 1.00 69.06  ? 32  THR C CA    1 
ATOM 2925  C C     . THR C 1 35  ? 2.010   -40.040  -105.176 1.00 71.69  ? 32  THR C C     1 
ATOM 2926  O O     . THR C 1 35  ? 3.103   -39.631  -105.577 1.00 74.80  ? 32  THR C O     1 
ATOM 2927  C CB    . THR C 1 35  ? 0.941   -39.170  -103.096 1.00 71.79  ? 32  THR C CB    1 
ATOM 2928  O OG1   . THR C 1 35  ? 1.748   -37.988  -103.040 1.00 77.31  ? 32  THR C OG1   1 
ATOM 2929  C CG2   . THR C 1 35  ? 0.479   -39.530  -101.694 1.00 62.98  ? 32  THR C CG2   1 
ATOM 2930  N N     . ALA C 1 36  ? 0.986   -40.302  -105.992 1.00 77.39  ? 33  ALA C N     1 
ATOM 2931  C CA    . ALA C 1 36  ? 1.115   -40.142  -107.437 1.00 73.58  ? 33  ALA C CA    1 
ATOM 2932  C C     . ALA C 1 36  ? 1.556   -38.732  -107.814 1.00 72.82  ? 33  ALA C C     1 
ATOM 2933  O O     . ALA C 1 36  ? 2.438   -38.554  -108.664 1.00 70.06  ? 33  ALA C O     1 
ATOM 2934  C CB    . ALA C 1 36  ? -0.212  -40.483  -108.112 1.00 73.64  ? 33  ALA C CB    1 
ATOM 2935  N N     . GLU C 1 37  ? 0.964   -37.718  -107.181 1.00 67.19  ? 34  GLU C N     1 
ATOM 2936  C CA    . GLU C 1 37  ? 1.283   -36.333  -107.517 1.00 68.09  ? 34  GLU C CA    1 
ATOM 2937  C C     . GLU C 1 37  ? 2.738   -36.006  -107.202 1.00 72.56  ? 34  GLU C C     1 
ATOM 2938  O O     . GLU C 1 37  ? 3.449   -35.434  -108.038 1.00 64.78  ? 34  GLU C O     1 
ATOM 2939  C CB    . GLU C 1 37  ? 0.345   -35.389  -106.764 1.00 66.98  ? 34  GLU C CB    1 
ATOM 2940  C CG    . GLU C 1 37  ? -1.127  -35.796  -106.773 1.00 76.30  ? 34  GLU C CG    1 
ATOM 2941  C CD    . GLU C 1 37  ? -1.513  -36.587  -105.533 1.00 95.65  ? 34  GLU C CD    1 
ATOM 2942  O OE1   . GLU C 1 37  ? -1.050  -36.223  -104.430 1.00 95.92  ? 34  GLU C OE1   1 
ATOM 2943  O OE2   . GLU C 1 37  ? -2.296  -37.556  -105.656 1.00 90.16  ? 34  GLU C OE2   1 
ATOM 2944  N N     . GLU C 1 38  ? 3.204   -36.371  -106.001 1.00 81.02  ? 35  GLU C N     1 
ATOM 2945  C CA    . GLU C 1 38  ? 4.580   -36.057  -105.620 1.00 76.84  ? 35  GLU C CA    1 
ATOM 2946  C C     . GLU C 1 38  ? 5.578   -36.874  -106.427 1.00 64.80  ? 35  GLU C C     1 
ATOM 2947  O O     . GLU C 1 38  ? 6.619   -36.350  -106.843 1.00 59.89  ? 35  GLU C O     1 
ATOM 2948  C CB    . GLU C 1 38  ? 4.796   -36.282  -104.122 1.00 73.46  ? 35  GLU C CB    1 
ATOM 2949  C CG    . GLU C 1 38  ? 6.194   -35.880  -103.655 1.00 74.24  ? 35  GLU C CG    1 
ATOM 2950  C CD    . GLU C 1 38  ? 6.406   -36.025  -102.155 1.00 71.84  ? 35  GLU C CD    1 
ATOM 2951  O OE1   . GLU C 1 38  ? 7.448   -35.541  -101.659 1.00 61.79  ? 35  GLU C OE1   1 
ATOM 2952  O OE2   . GLU C 1 38  ? 5.540   -36.622  -101.478 1.00 70.98  ? 35  GLU C OE2   1 
ATOM 2953  N N     . TYR C 1 39  ? 5.285   -38.158  -106.657 1.00 58.21  ? 36  TYR C N     1 
ATOM 2954  C CA    . TYR C 1 39  ? 6.154   -38.956  -107.515 1.00 60.88  ? 36  TYR C CA    1 
ATOM 2955  C C     . TYR C 1 39  ? 6.292   -38.315  -108.888 1.00 70.91  ? 36  TYR C C     1 
ATOM 2956  O O     . TYR C 1 39  ? 7.400   -38.190  -109.417 1.00 70.69  ? 36  TYR C O     1 
ATOM 2957  C CB    . TYR C 1 39  ? 5.636   -40.388  -107.670 1.00 58.39  ? 36  TYR C CB    1 
ATOM 2958  C CG    . TYR C 1 39  ? 6.191   -41.014  -108.934 1.00 59.16  ? 36  TYR C CG    1 
ATOM 2959  C CD1   . TYR C 1 39  ? 7.525   -41.392  -109.012 1.00 65.16  ? 36  TYR C CD1   1 
ATOM 2960  C CD2   . TYR C 1 39  ? 5.402   -41.170  -110.067 1.00 69.90  ? 36  TYR C CD2   1 
ATOM 2961  C CE1   . TYR C 1 39  ? 8.051   -41.934  -110.169 1.00 67.77  ? 36  TYR C CE1   1 
ATOM 2962  C CE2   . TYR C 1 39  ? 5.920   -41.709  -111.231 1.00 77.58  ? 36  TYR C CE2   1 
ATOM 2963  C CZ    . TYR C 1 39  ? 7.245   -42.091  -111.276 1.00 76.81  ? 36  TYR C CZ    1 
ATOM 2964  O OH    . TYR C 1 39  ? 7.765   -42.628  -112.433 1.00 78.81  ? 36  TYR C OH    1 
ATOM 2965  N N     . GLN C 1 40  ? 5.166   -37.934  -109.496 1.00 72.85  ? 37  GLN C N     1 
ATOM 2966  C CA    . GLN C 1 40  ? 5.208   -37.421  -110.861 1.00 72.13  ? 37  GLN C CA    1 
ATOM 2967  C C     . GLN C 1 40  ? 5.940   -36.084  -110.909 1.00 58.97  ? 37  GLN C C     1 
ATOM 2968  O O     . GLN C 1 40  ? 6.792   -35.860  -111.784 1.00 60.57  ? 37  GLN C O     1 
ATOM 2969  C CB    . GLN C 1 40  ? 3.782   -37.301  -111.399 1.00 81.72  ? 37  GLN C CB    1 
ATOM 2970  C CG    . GLN C 1 40  ? 3.675   -37.053  -112.890 1.00 91.56  ? 37  GLN C CG    1 
ATOM 2971  C CD    . GLN C 1 40  ? 2.258   -36.730  -113.315 1.00 94.37  ? 37  GLN C CD    1 
ATOM 2972  O OE1   . GLN C 1 40  ? 1.416   -36.413  -112.472 1.00 86.86  ? 37  GLN C OE1   1 
ATOM 2973  N NE2   . GLN C 1 40  ? 1.994   -36.767  -114.624 1.00 97.87  ? 37  GLN C NE2   1 
ATOM 2974  N N     . ALA C 1 41  ? 5.636   -35.198  -109.954 1.00 52.64  ? 38  ALA C N     1 
ATOM 2975  C CA    . ALA C 1 41  ? 6.326   -33.919  -109.848 1.00 63.57  ? 38  ALA C CA    1 
ATOM 2976  C C     . ALA C 1 41  ? 7.832   -34.112  -109.730 1.00 66.18  ? 38  ALA C C     1 
ATOM 2977  O O     . ALA C 1 41  ? 8.608   -33.465  -110.441 1.00 66.08  ? 38  ALA C O     1 
ATOM 2978  C CB    . ALA C 1 41  ? 5.784   -33.140  -108.651 1.00 63.02  ? 38  ALA C CB    1 
ATOM 2979  N N     . ILE C 1 42  ? 8.264   -35.008  -108.838 1.00 68.45  ? 39  ILE C N     1 
ATOM 2980  C CA    . ILE C 1 42  ? 9.693   -35.196  -108.610 1.00 61.92  ? 39  ILE C CA    1 
ATOM 2981  C C     . ILE C 1 42  ? 10.354  -35.822  -109.830 1.00 58.71  ? 39  ILE C C     1 
ATOM 2982  O O     . ILE C 1 42  ? 11.451  -35.416  -110.235 1.00 64.36  ? 39  ILE C O     1 
ATOM 2983  C CB    . ILE C 1 42  ? 9.921   -36.049  -107.348 1.00 63.61  ? 39  ILE C CB    1 
ATOM 2984  C CG1   . ILE C 1 42  ? 9.607   -35.241  -106.089 1.00 59.99  ? 39  ILE C CG1   1 
ATOM 2985  C CG2   . ILE C 1 42  ? 11.348  -36.570  -107.299 1.00 61.28  ? 39  ILE C CG2   1 
ATOM 2986  C CD1   . ILE C 1 42  ? 9.630   -36.062  -104.821 1.00 56.29  ? 39  ILE C CD1   1 
ATOM 2987  N N     . GLN C 1 43  ? 9.706   -36.822  -110.432 1.00 56.79  ? 40  GLN C N     1 
ATOM 2988  C CA    . GLN C 1 43  ? 10.265  -37.464  -111.615 1.00 63.86  ? 40  GLN C CA    1 
ATOM 2989  C C     . GLN C 1 43  ? 10.481  -36.461  -112.741 1.00 72.15  ? 40  GLN C C     1 
ATOM 2990  O O     . GLN C 1 43  ? 11.529  -36.475  -113.397 1.00 66.25  ? 40  GLN C O     1 
ATOM 2991  C CB    . GLN C 1 43  ? 9.354   -38.606  -112.071 1.00 64.32  ? 40  GLN C CB    1 
ATOM 2992  C CG    . GLN C 1 43  ? 9.765   -39.265  -113.381 1.00 76.85  ? 40  GLN C CG    1 
ATOM 2993  C CD    . GLN C 1 43  ? 10.997  -40.144  -113.244 1.00 77.49  ? 40  GLN C CD    1 
ATOM 2994  O OE1   . GLN C 1 43  ? 12.061  -39.688  -112.823 1.00 73.54  ? 40  GLN C OE1   1 
ATOM 2995  N NE2   . GLN C 1 43  ? 10.857  -41.414  -113.601 1.00 76.31  ? 40  GLN C NE2   1 
ATOM 2996  N N     . LYS C 1 44  ? 9.505   -35.580  -112.981 1.00 73.77  ? 41  LYS C N     1 
ATOM 2997  C CA    . LYS C 1 44  ? 9.691   -34.553  -114.005 1.00 70.07  ? 41  LYS C CA    1 
ATOM 2998  C C     . LYS C 1 44  ? 10.764  -33.542  -113.605 1.00 61.20  ? 41  LYS C C     1 
ATOM 2999  O O     . LYS C 1 44  ? 11.611  -33.171  -114.426 1.00 68.44  ? 41  LYS C O     1 
ATOM 3000  C CB    . LYS C 1 44  ? 8.367   -33.853  -114.314 1.00 74.60  ? 41  LYS C CB    1 
ATOM 3001  C CG    . LYS C 1 44  ? 7.421   -34.688  -115.161 1.00 85.37  ? 41  LYS C CG    1 
ATOM 3002  C CD    . LYS C 1 44  ? 6.182   -33.898  -115.538 1.00 96.56  ? 41  LYS C CD    1 
ATOM 3003  C CE    . LYS C 1 44  ? 5.161   -34.772  -116.240 1.00 100.85 ? 41  LYS C CE    1 
ATOM 3004  N NZ    . LYS C 1 44  ? 5.603   -35.142  -117.613 1.00 95.53  ? 41  LYS C NZ    1 
ATOM 3005  N N     . ALA C 1 45  ? 10.721  -33.053  -112.361 1.00 57.15  ? 42  ALA C N     1 
ATOM 3006  C CA    . ALA C 1 45  ? 11.644  -32.004  -111.932 1.00 73.13  ? 42  ALA C CA    1 
ATOM 3007  C C     . ALA C 1 45  ? 13.098  -32.465  -111.946 1.00 69.20  ? 42  ALA C C     1 
ATOM 3008  O O     . ALA C 1 45  ? 13.998  -31.660  -112.211 1.00 70.89  ? 42  ALA C O     1 
ATOM 3009  C CB    . ALA C 1 45  ? 11.263  -31.506  -110.537 1.00 63.43  ? 42  ALA C CB    1 
ATOM 3010  N N     . LEU C 1 46  ? 13.354  -33.742  -111.648 1.00 65.46  ? 43  LEU C N     1 
ATOM 3011  C CA    . LEU C 1 46  ? 14.730  -34.228  -111.590 1.00 61.71  ? 43  LEU C CA    1 
ATOM 3012  C C     . LEU C 1 46  ? 15.402  -34.268  -112.955 1.00 74.78  ? 43  LEU C C     1 
ATOM 3013  O O     . LEU C 1 46  ? 16.635  -34.323  -113.022 1.00 75.15  ? 43  LEU C O     1 
ATOM 3014  C CB    . LEU C 1 46  ? 14.776  -35.619  -110.962 1.00 64.20  ? 43  LEU C CB    1 
ATOM 3015  C CG    . LEU C 1 46  ? 14.683  -35.676  -109.440 1.00 75.01  ? 43  LEU C CG    1 
ATOM 3016  C CD1   . LEU C 1 46  ? 14.525  -37.109  -108.973 1.00 68.34  ? 43  LEU C CD1   1 
ATOM 3017  C CD2   . LEU C 1 46  ? 15.909  -35.031  -108.807 1.00 70.23  ? 43  LEU C CD2   1 
ATOM 3018  N N     . ARG C 1 47  ? 14.626  -34.243  -114.040 1.00 72.82  ? 44  ARG C N     1 
ATOM 3019  C CA    . ARG C 1 47  ? 15.218  -34.270  -115.372 1.00 69.96  ? 44  ARG C CA    1 
ATOM 3020  C C     . ARG C 1 47  ? 15.923  -32.963  -115.709 1.00 67.54  ? 44  ARG C C     1 
ATOM 3021  O O     . ARG C 1 47  ? 16.833  -32.958  -116.547 1.00 65.51  ? 44  ARG C O     1 
ATOM 3022  C CB    . ARG C 1 47  ? 14.148  -34.594  -116.411 1.00 65.37  ? 44  ARG C CB    1 
ATOM 3023  C CG    . ARG C 1 47  ? 13.917  -36.082  -116.554 1.00 69.30  ? 44  ARG C CG    1 
ATOM 3024  C CD    . ARG C 1 47  ? 12.896  -36.394  -117.623 1.00 59.16  ? 44  ARG C CD    1 
ATOM 3025  N NE    . ARG C 1 47  ? 11.533  -36.338  -117.107 1.00 54.53  ? 44  ARG C NE    1 
ATOM 3026  C CZ    . ARG C 1 47  ? 10.800  -37.413  -116.838 1.00 65.96  ? 44  ARG C CZ    1 
ATOM 3027  N NH1   . ARG C 1 47  ? 11.302  -38.624  -117.036 1.00 67.14  ? 44  ARG C NH1   1 
ATOM 3028  N NH2   . ARG C 1 47  ? 9.566   -37.280  -116.371 1.00 73.32  ? 44  ARG C NH2   1 
ATOM 3029  N N     . GLN C 1 48  ? 15.495  -31.850  -115.109 1.00 61.19  ? 45  GLN C N     1 
ATOM 3030  C CA    . GLN C 1 48  ? 16.085  -30.547  -115.401 1.00 62.39  ? 45  GLN C CA    1 
ATOM 3031  C C     . GLN C 1 48  ? 17.593  -30.569  -115.205 1.00 57.87  ? 45  GLN C C     1 
ATOM 3032  O O     . GLN C 1 48  ? 18.090  -31.019  -114.171 1.00 73.67  ? 45  GLN C O     1 
ATOM 3033  C CB    . GLN C 1 48  ? 15.475  -29.472  -114.499 1.00 62.08  ? 45  GLN C CB    1 
ATOM 3034  C CG    . GLN C 1 48  ? 13.973  -29.287  -114.622 1.00 72.01  ? 45  GLN C CG    1 
ATOM 3035  C CD    . GLN C 1 48  ? 13.436  -28.299  -113.598 1.00 70.20  ? 45  GLN C CD    1 
ATOM 3036  O OE1   . GLN C 1 48  ? 14.017  -28.118  -112.528 1.00 78.90  ? 45  GLN C OE1   1 
ATOM 3037  N NE2   . GLN C 1 48  ? 12.341  -27.634  -113.935 1.00 70.95  ? 45  GLN C NE2   1 
ATOM 3038  N N     . ARG C 1 49  ? 18.319  -30.071  -116.200 1.00 57.89  ? 46  ARG C N     1 
ATOM 3039  C CA    . ARG C 1 49  ? 19.731  -29.788  -116.012 1.00 73.74  ? 46  ARG C CA    1 
ATOM 3040  C C     . ARG C 1 49  ? 19.904  -28.451  -115.294 1.00 71.76  ? 46  ARG C C     1 
ATOM 3041  O O     . ARG C 1 49  ? 18.987  -27.627  -115.233 1.00 72.46  ? 46  ARG C O     1 
ATOM 3042  C CB    . ARG C 1 49  ? 20.467  -29.783  -117.350 1.00 68.60  ? 46  ARG C CB    1 
ATOM 3043  C CG    . ARG C 1 49  ? 20.412  -31.116  -118.079 1.00 68.65  ? 46  ARG C CG    1 
ATOM 3044  C CD    . ARG C 1 49  ? 21.184  -31.056  -119.381 1.00 87.83  ? 46  ARG C CD    1 
ATOM 3045  N NE    . ARG C 1 49  ? 21.378  -32.376  -119.976 1.00 97.32  ? 46  ARG C NE    1 
ATOM 3046  C CZ    . ARG C 1 49  ? 20.526  -32.947  -120.821 1.00 101.10 ? 46  ARG C CZ    1 
ATOM 3047  N NH1   . ARG C 1 49  ? 19.415  -32.313  -121.176 1.00 84.35  ? 46  ARG C NH1   1 
ATOM 3048  N NH2   . ARG C 1 49  ? 20.784  -34.151  -121.312 1.00 107.08 ? 46  ARG C NH2   1 
ATOM 3049  N N     . LEU C 1 50  ? 21.095  -28.242  -114.736 1.00 72.47  ? 47  LEU C N     1 
ATOM 3050  C CA    . LEU C 1 50  ? 21.349  -27.049  -113.938 1.00 73.53  ? 47  LEU C CA    1 
ATOM 3051  C C     . LEU C 1 50  ? 21.872  -25.905  -114.795 1.00 72.78  ? 47  LEU C C     1 
ATOM 3052  O O     . LEU C 1 50  ? 22.720  -26.097  -115.672 1.00 75.21  ? 47  LEU C O     1 
ATOM 3053  C CB    . LEU C 1 50  ? 22.350  -27.334  -112.815 1.00 76.59  ? 47  LEU C CB    1 
ATOM 3054  C CG    . LEU C 1 50  ? 21.922  -28.199  -111.628 1.00 62.58  ? 47  LEU C CG    1 
ATOM 3055  C CD1   . LEU C 1 50  ? 20.472  -27.940  -111.231 1.00 64.57  ? 47  LEU C CD1   1 
ATOM 3056  C CD2   . LEU C 1 50  ? 22.164  -29.669  -111.903 1.00 71.61  ? 47  LEU C CD2   1 
ATOM 3057  N N     . GLY C 1 51  ? 21.364  -24.702  -114.514 1.00 68.29  ? 48  GLY C N     1 
ATOM 3058  C CA    . GLY C 1 51  ? 21.868  -23.511  -115.130 1.00 70.79  ? 48  GLY C CA    1 
ATOM 3059  C C     . GLY C 1 51  ? 23.248  -23.161  -114.612 1.00 70.18  ? 48  GLY C C     1 
ATOM 3060  O O     . GLY C 1 51  ? 23.795  -23.809  -113.708 1.00 74.37  ? 48  GLY C O     1 
ATOM 3061  N N     . PRO C 1 52  ? 23.842  -22.112  -115.202 1.00 73.25  ? 49  PRO C N     1 
ATOM 3062  C CA    . PRO C 1 52  ? 25.196  -21.708  -114.790 1.00 77.46  ? 49  PRO C CA    1 
ATOM 3063  C C     . PRO C 1 52  ? 25.273  -21.196  -113.359 1.00 82.64  ? 49  PRO C C     1 
ATOM 3064  O O     . PRO C 1 52  ? 26.386  -21.022  -112.846 1.00 74.07  ? 49  PRO C O     1 
ATOM 3065  C CB    . PRO C 1 52  ? 25.558  -20.599  -115.792 1.00 80.99  ? 49  PRO C CB    1 
ATOM 3066  C CG    . PRO C 1 52  ? 24.548  -20.699  -116.892 1.00 84.03  ? 49  PRO C CG    1 
ATOM 3067  C CD    . PRO C 1 52  ? 23.312  -21.288  -116.298 1.00 82.66  ? 49  PRO C CD    1 
ATOM 3068  N N     . GLU C 1 53  ? 24.132  -20.947  -112.706 1.00 84.85  ? 50  GLU C N     1 
ATOM 3069  C CA    . GLU C 1 53  ? 24.144  -20.446  -111.334 1.00 84.72  ? 50  GLU C CA    1 
ATOM 3070  C C     . GLU C 1 53  ? 24.757  -21.450  -110.365 1.00 81.06  ? 50  GLU C C     1 
ATOM 3071  O O     . GLU C 1 53  ? 25.324  -21.056  -109.339 1.00 85.65  ? 50  GLU C O     1 
ATOM 3072  C CB    . GLU C 1 53  ? 22.721  -20.107  -110.884 1.00 83.62  ? 50  GLU C CB    1 
ATOM 3073  C CG    . GLU C 1 53  ? 21.980  -19.112  -111.768 1.00 89.99  ? 50  GLU C CG    1 
ATOM 3074  C CD    . GLU C 1 53  ? 21.216  -19.790  -112.894 1.00 88.65  ? 50  GLU C CD    1 
ATOM 3075  O OE1   . GLU C 1 53  ? 21.682  -20.837  -113.388 1.00 82.21  ? 50  GLU C OE1   1 
ATOM 3076  O OE2   . GLU C 1 53  ? 20.143  -19.279  -113.280 1.00 95.03  ? 50  GLU C OE2   1 
ATOM 3077  N N     . TYR C 1 54  ? 24.643  -22.741  -110.665 1.00 80.35  ? 51  TYR C N     1 
ATOM 3078  C CA    . TYR C 1 54  ? 25.092  -23.795  -109.764 1.00 77.76  ? 51  TYR C CA    1 
ATOM 3079  C C     . TYR C 1 54  ? 26.538  -24.210  -109.995 1.00 78.52  ? 51  TYR C C     1 
ATOM 3080  O O     . TYR C 1 54  ? 27.240  -24.557  -109.036 1.00 75.15  ? 51  TYR C O     1 
ATOM 3081  C CB    . TYR C 1 54  ? 24.189  -25.021  -109.924 1.00 69.14  ? 51  TYR C CB    1 
ATOM 3082  C CG    . TYR C 1 54  ? 22.773  -24.812  -109.444 1.00 72.24  ? 51  TYR C CG    1 
ATOM 3083  C CD1   . TYR C 1 54  ? 22.489  -24.684  -108.091 1.00 77.99  ? 51  TYR C CD1   1 
ATOM 3084  C CD2   . TYR C 1 54  ? 21.720  -24.731  -110.345 1.00 67.69  ? 51  TYR C CD2   1 
ATOM 3085  C CE1   . TYR C 1 54  ? 21.194  -24.494  -107.648 1.00 77.39  ? 51  TYR C CE1   1 
ATOM 3086  C CE2   . TYR C 1 54  ? 20.423  -24.539  -109.913 1.00 76.70  ? 51  TYR C CE2   1 
ATOM 3087  C CZ    . TYR C 1 54  ? 20.165  -24.421  -108.564 1.00 76.88  ? 51  TYR C CZ    1 
ATOM 3088  O OH    . TYR C 1 54  ? 18.871  -24.231  -108.134 1.00 70.77  ? 51  TYR C OH    1 
ATOM 3089  N N     . ILE C 1 55  ? 26.995  -24.172  -111.242 1.00 76.30  ? 52  ILE C N     1 
ATOM 3090  C CA    . ILE C 1 55  ? 28.269  -24.770  -111.625 1.00 65.75  ? 52  ILE C CA    1 
ATOM 3091  C C     . ILE C 1 55  ? 29.418  -23.829  -111.293 1.00 66.50  ? 52  ILE C C     1 
ATOM 3092  O O     . ILE C 1 55  ? 29.338  -22.613  -111.506 1.00 88.16  ? 52  ILE C O     1 
ATOM 3093  C CB    . ILE C 1 55  ? 28.253  -25.130  -113.122 1.00 70.15  ? 52  ILE C CB    1 
ATOM 3094  C CG1   . ILE C 1 55  ? 26.934  -25.817  -113.488 1.00 66.43  ? 52  ILE C CG1   1 
ATOM 3095  C CG2   . ILE C 1 55  ? 29.420  -26.040  -113.470 1.00 74.05  ? 52  ILE C CG2   1 
ATOM 3096  C CD1   . ILE C 1 55  ? 26.646  -27.060  -112.676 1.00 71.53  ? 52  ILE C CD1   1 
ATOM 3097  N N     . SER C 1 56  ? 30.499  -24.401  -110.769 1.00 67.92  ? 53  SER C N     1 
ATOM 3098  C CA    . SER C 1 56  ? 31.741  -23.692  -110.505 1.00 75.32  ? 53  SER C CA    1 
ATOM 3099  C C     . SER C 1 56  ? 32.873  -24.476  -111.155 1.00 75.51  ? 53  SER C C     1 
ATOM 3100  O O     . SER C 1 56  ? 32.676  -25.585  -111.656 1.00 75.56  ? 53  SER C O     1 
ATOM 3101  C CB    . SER C 1 56  ? 31.986  -23.509  -108.999 1.00 74.37  ? 53  SER C CB    1 
ATOM 3102  O OG    . SER C 1 56  ? 30.833  -23.009  -108.341 1.00 77.02  ? 53  SER C OG    1 
ATOM 3103  N N     . SER C 1 57  ? 34.073  -23.902  -111.146 1.00 76.35  ? 54  SER C N     1 
ATOM 3104  C CA    . SER C 1 57  ? 35.182  -24.543  -111.835 1.00 83.52  ? 54  SER C CA    1 
ATOM 3105  C C     . SER C 1 57  ? 36.490  -24.250  -111.119 1.00 84.71  ? 54  SER C C     1 
ATOM 3106  O O     . SER C 1 57  ? 36.638  -23.224  -110.449 1.00 79.48  ? 54  SER C O     1 
ATOM 3107  C CB    . SER C 1 57  ? 35.265  -24.091  -113.298 1.00 87.10  ? 54  SER C CB    1 
ATOM 3108  O OG    . SER C 1 57  ? 35.709  -22.750  -113.402 1.00 84.63  ? 54  SER C OG    1 
ATOM 3109  N N     . ARG C 1 58  ? 37.431  -25.183  -111.256 1.00 96.66  ? 55  ARG C N     1 
ATOM 3110  C CA    . ARG C 1 58  ? 38.787  -25.029  -110.751 1.00 103.67 ? 55  ARG C CA    1 
ATOM 3111  C C     . ARG C 1 58  ? 39.743  -25.554  -111.814 1.00 114.19 ? 55  ARG C C     1 
ATOM 3112  O O     . ARG C 1 58  ? 39.324  -26.005  -112.885 1.00 115.20 ? 55  ARG C O     1 
ATOM 3113  C CB    . ARG C 1 58  ? 38.987  -25.765  -109.419 1.00 91.12  ? 55  ARG C CB    1 
ATOM 3114  C CG    . ARG C 1 58  ? 38.961  -27.278  -109.545 1.00 99.71  ? 55  ARG C CG    1 
ATOM 3115  C CD    . ARG C 1 58  ? 39.291  -27.968  -108.229 1.00 111.44 ? 55  ARG C CD    1 
ATOM 3116  N NE    . ARG C 1 58  ? 38.957  -29.388  -108.281 1.00 112.53 ? 55  ARG C NE    1 
ATOM 3117  C CZ    . ARG C 1 58  ? 37.798  -29.902  -107.886 1.00 104.44 ? 55  ARG C CZ    1 
ATOM 3118  N NH1   . ARG C 1 58  ? 36.919  -29.146  -107.244 1.00 93.21  ? 55  ARG C NH1   1 
ATOM 3119  N NH2   . ARG C 1 58  ? 37.582  -31.205  -107.996 1.00 109.91 ? 55  ARG C NH2   1 
ATOM 3120  N N     . MET C 1 59  ? 41.038  -25.495  -111.521 1.00 118.00 ? 56  MET C N     1 
ATOM 3121  C CA    . MET C 1 59  ? 42.066  -26.008  -112.414 1.00 123.96 ? 56  MET C CA    1 
ATOM 3122  C C     . MET C 1 59  ? 42.660  -27.285  -111.836 1.00 134.79 ? 56  MET C C     1 
ATOM 3123  O O     . MET C 1 59  ? 42.859  -27.395  -110.622 1.00 132.54 ? 56  MET C O     1 
ATOM 3124  C CB    . MET C 1 59  ? 43.161  -24.965  -112.649 1.00 130.70 ? 56  MET C CB    1 
ATOM 3125  C CG    . MET C 1 59  ? 42.674  -23.740  -113.409 1.00 141.07 ? 56  MET C CG    1 
ATOM 3126  S SD    . MET C 1 59  ? 41.909  -24.156  -114.992 1.00 143.35 ? 56  MET C SD    1 
ATOM 3127  C CE    . MET C 1 59  ? 40.565  -22.969  -115.065 1.00 135.01 ? 56  MET C CE    1 
ATOM 3128  N N     . ALA C 1 60  ? 42.943  -28.246  -112.711 1.00 145.31 ? 57  ALA C N     1 
ATOM 3129  C CA    . ALA C 1 60  ? 43.405  -29.563  -112.308 1.00 146.08 ? 57  ALA C CA    1 
ATOM 3130  C C     . ALA C 1 60  ? 44.917  -29.681  -112.490 1.00 148.87 ? 57  ALA C C     1 
ATOM 3131  O O     . ALA C 1 60  ? 45.602  -28.741  -112.902 1.00 146.88 ? 57  ALA C O     1 
ATOM 3132  C CB    . ALA C 1 60  ? 42.669  -30.648  -113.096 1.00 140.12 ? 57  ALA C CB    1 
ATOM 3133  N N     . GLY C 1 61  ? 45.440  -30.869  -112.177 1.00 151.34 ? 58  GLY C N     1 
ATOM 3134  C CA    . GLY C 1 61  ? 46.867  -31.116  -112.270 1.00 154.26 ? 58  GLY C CA    1 
ATOM 3135  C C     . GLY C 1 61  ? 47.404  -31.123  -113.684 1.00 156.69 ? 58  GLY C C     1 
ATOM 3136  O O     . GLY C 1 61  ? 48.602  -30.898  -113.880 1.00 160.88 ? 58  GLY C O     1 
ATOM 3137  N N     . GLY C 1 62  ? 46.551  -31.382  -114.668 1.00 149.47 ? 59  GLY C N     1 
ATOM 3138  C CA    . GLY C 1 62  ? 46.934  -31.329  -116.060 1.00 149.34 ? 59  GLY C CA    1 
ATOM 3139  C C     . GLY C 1 62  ? 46.676  -30.000  -116.732 1.00 153.60 ? 59  GLY C C     1 
ATOM 3140  O O     . GLY C 1 62  ? 46.738  -29.918  -117.963 1.00 146.93 ? 59  GLY C O     1 
ATOM 3141  N N     . GLY C 1 63  ? 46.392  -28.953  -115.962 1.00 153.45 ? 60  GLY C N     1 
ATOM 3142  C CA    . GLY C 1 63  ? 46.068  -27.665  -116.543 1.00 147.89 ? 60  GLY C CA    1 
ATOM 3143  C C     . GLY C 1 63  ? 44.742  -27.634  -117.265 1.00 153.37 ? 60  GLY C C     1 
ATOM 3144  O O     . GLY C 1 63  ? 44.584  -26.875  -118.227 1.00 151.02 ? 60  GLY C O     1 
ATOM 3145  N N     . GLN C 1 64  ? 43.777  -28.437  -116.823 1.00 158.94 ? 61  GLN C N     1 
ATOM 3146  C CA    . GLN C 1 64  ? 42.493  -28.566  -117.492 1.00 155.83 ? 61  GLN C CA    1 
ATOM 3147  C C     . GLN C 1 64  ? 41.366  -28.086  -116.584 1.00 148.54 ? 61  GLN C C     1 
ATOM 3148  O O     . GLN C 1 64  ? 41.492  -28.055  -115.357 1.00 137.81 ? 61  GLN C O     1 
ATOM 3149  C CB    . GLN C 1 64  ? 42.242  -30.017  -117.928 1.00 149.75 ? 61  GLN C CB    1 
ATOM 3150  C CG    . GLN C 1 64  ? 42.442  -31.045  -116.826 1.00 140.93 ? 61  GLN C CG    1 
ATOM 3151  C CD    . GLN C 1 64  ? 42.452  -32.466  -117.355 1.00 138.47 ? 61  GLN C CD    1 
ATOM 3152  O OE1   . GLN C 1 64  ? 42.274  -32.695  -118.552 1.00 134.22 ? 61  GLN C OE1   1 
ATOM 3153  N NE2   . GLN C 1 64  ? 42.664  -33.428  -116.466 1.00 136.24 ? 61  GLN C NE2   1 
ATOM 3154  N N     . LYS C 1 65  ? 40.254  -27.712  -117.214 1.00 144.44 ? 62  LYS C N     1 
ATOM 3155  C CA    . LYS C 1 65  ? 39.103  -27.171  -116.504 1.00 130.76 ? 62  LYS C CA    1 
ATOM 3156  C C     . LYS C 1 65  ? 38.224  -28.304  -115.989 1.00 128.53 ? 62  LYS C C     1 
ATOM 3157  O O     . LYS C 1 65  ? 37.901  -29.237  -116.731 1.00 123.58 ? 62  LYS C O     1 
ATOM 3158  C CB    . LYS C 1 65  ? 38.307  -26.251  -117.432 1.00 123.62 ? 62  LYS C CB    1 
ATOM 3159  C CG    . LYS C 1 65  ? 37.161  -25.483  -116.783 1.00 112.91 ? 62  LYS C CG    1 
ATOM 3160  C CD    . LYS C 1 65  ? 36.464  -24.602  -117.820 1.00 107.48 ? 62  LYS C CD    1 
ATOM 3161  C CE    . LYS C 1 65  ? 35.389  -23.719  -117.204 1.00 99.34  ? 62  LYS C CE    1 
ATOM 3162  N NZ    . LYS C 1 65  ? 34.730  -22.857  -118.227 1.00 102.61 ? 62  LYS C NZ    1 
ATOM 3163  N N     . VAL C 1 66  ? 37.842  -28.225  -114.715 1.00 124.63 ? 63  VAL C N     1 
ATOM 3164  C CA    . VAL C 1 66  ? 37.006  -29.233  -114.072 1.00 109.68 ? 63  VAL C CA    1 
ATOM 3165  C C     . VAL C 1 66  ? 35.831  -28.525  -113.408 1.00 96.31  ? 63  VAL C C     1 
ATOM 3166  O O     . VAL C 1 66  ? 36.031  -27.655  -112.553 1.00 88.04  ? 63  VAL C O     1 
ATOM 3167  C CB    . VAL C 1 66  ? 37.795  -30.058  -113.040 1.00 97.18  ? 63  VAL C CB    1 
ATOM 3168  C CG1   . VAL C 1 66  ? 36.866  -30.976  -112.266 1.00 86.12  ? 63  VAL C CG1   1 
ATOM 3169  C CG2   . VAL C 1 66  ? 38.892  -30.866  -113.727 1.00 119.29 ? 63  VAL C CG2   1 
ATOM 3170  N N     . CYS C 1 67  ? 34.615  -28.907  -113.788 1.00 89.87  ? 64  CYS C N     1 
ATOM 3171  C CA    . CYS C 1 67  ? 33.399  -28.347  -113.219 1.00 78.22  ? 64  CYS C CA    1 
ATOM 3172  C C     . CYS C 1 67  ? 32.949  -29.156  -112.007 1.00 77.12  ? 64  CYS C C     1 
ATOM 3173  O O     . CYS C 1 67  ? 33.283  -30.334  -111.856 1.00 81.21  ? 64  CYS C O     1 
ATOM 3174  C CB    . CYS C 1 67  ? 32.278  -28.305  -114.260 1.00 83.73  ? 64  CYS C CB    1 
ATOM 3175  S SG    . CYS C 1 67  ? 32.609  -27.248  -115.685 1.00 86.93  ? 64  CYS C SG    1 
ATOM 3176  N N     . TYR C 1 68  ? 32.169  -28.508  -111.144 1.00 73.20  ? 65  TYR C N     1 
ATOM 3177  C CA    . TYR C 1 68  ? 31.631  -29.146  -109.949 1.00 66.64  ? 65  TYR C CA    1 
ATOM 3178  C C     . TYR C 1 68  ? 30.524  -28.269  -109.384 1.00 69.88  ? 65  TYR C C     1 
ATOM 3179  O O     . TYR C 1 68  ? 30.408  -27.089  -109.727 1.00 72.74  ? 65  TYR C O     1 
ATOM 3180  C CB    . TYR C 1 68  ? 32.716  -29.385  -108.890 1.00 67.73  ? 65  TYR C CB    1 
ATOM 3181  C CG    . TYR C 1 68  ? 33.252  -28.119  -108.255 1.00 67.85  ? 65  TYR C CG    1 
ATOM 3182  C CD1   . TYR C 1 68  ? 34.306  -27.425  -108.833 1.00 76.97  ? 65  TYR C CD1   1 
ATOM 3183  C CD2   . TYR C 1 68  ? 32.709  -27.622  -107.075 1.00 69.89  ? 65  TYR C CD2   1 
ATOM 3184  C CE1   . TYR C 1 68  ? 34.801  -26.269  -108.260 1.00 83.23  ? 65  TYR C CE1   1 
ATOM 3185  C CE2   . TYR C 1 68  ? 33.197  -26.463  -106.496 1.00 64.13  ? 65  TYR C CE2   1 
ATOM 3186  C CZ    . TYR C 1 68  ? 34.244  -25.792  -107.092 1.00 74.01  ? 65  TYR C CZ    1 
ATOM 3187  O OH    . TYR C 1 68  ? 34.737  -24.641  -106.521 1.00 79.64  ? 65  TYR C OH    1 
ATOM 3188  N N     . ILE C 1 69  ? 29.713  -28.864  -108.511 1.00 70.92  ? 66  ILE C N     1 
ATOM 3189  C CA    . ILE C 1 69  ? 28.667  -28.160  -107.777 1.00 66.02  ? 66  ILE C CA    1 
ATOM 3190  C C     . ILE C 1 69  ? 29.079  -28.084  -106.313 1.00 66.11  ? 66  ILE C C     1 
ATOM 3191  O O     . ILE C 1 69  ? 29.513  -29.087  -105.731 1.00 75.78  ? 66  ILE C O     1 
ATOM 3192  C CB    . ILE C 1 69  ? 27.299  -28.849  -107.931 1.00 56.93  ? 66  ILE C CB    1 
ATOM 3193  C CG1   . ILE C 1 69  ? 27.017  -29.164  -109.401 1.00 72.93  ? 66  ILE C CG1   1 
ATOM 3194  C CG2   . ILE C 1 69  ? 26.196  -27.960  -107.386 1.00 50.67  ? 66  ILE C CG2   1 
ATOM 3195  C CD1   . ILE C 1 69  ? 25.701  -29.884  -109.630 1.00 71.03  ? 66  ILE C CD1   1 
ATOM 3196  N N     . GLU C 1 70  ? 28.964  -26.893  -105.726 1.00 71.27  ? 67  GLU C N     1 
ATOM 3197  C CA    . GLU C 1 70  ? 29.343  -26.697  -104.333 1.00 79.88  ? 67  GLU C CA    1 
ATOM 3198  C C     . GLU C 1 70  ? 28.385  -27.430  -103.397 1.00 74.71  ? 67  GLU C C     1 
ATOM 3199  O O     . GLU C 1 70  ? 27.200  -27.606  -103.696 1.00 72.12  ? 67  GLU C O     1 
ATOM 3200  C CB    . GLU C 1 70  ? 29.377  -25.203  -103.992 1.00 73.90  ? 67  GLU C CB    1 
ATOM 3201  C CG    . GLU C 1 70  ? 30.440  -24.417  -104.758 1.00 84.96  ? 67  GLU C CG    1 
ATOM 3202  C CD    . GLU C 1 70  ? 30.624  -22.991  -104.252 1.00 96.16  ? 67  GLU C CD    1 
ATOM 3203  O OE1   . GLU C 1 70  ? 29.790  -22.521  -103.448 1.00 103.09 ? 67  GLU C OE1   1 
ATOM 3204  O OE2   . GLU C 1 70  ? 31.619  -22.345  -104.649 1.00 100.43 ? 67  GLU C OE2   1 
ATOM 3205  N N     . GLY C 1 71  ? 28.927  -27.859  -102.252 1.00 65.94  ? 68  GLY C N     1 
ATOM 3206  C CA    . GLY C 1 71  ? 28.165  -28.691  -101.330 1.00 58.80  ? 68  GLY C CA    1 
ATOM 3207  C C     . GLY C 1 71  ? 26.836  -28.085  -100.927 1.00 64.89  ? 68  GLY C C     1 
ATOM 3208  O O     . GLY C 1 71  ? 25.791  -28.737  -101.005 1.00 54.05  ? 68  GLY C O     1 
ATOM 3209  N N     . HIS C 1 72  ? 26.860  -26.830  -100.469 1.00 65.94  ? 69  HIS C N     1 
ATOM 3210  C CA    . HIS C 1 72  ? 25.643  -26.184  -99.984  1.00 67.45  ? 69  HIS C CA    1 
ATOM 3211  C C     . HIS C 1 72  ? 24.575  -26.091  -101.066 1.00 69.63  ? 69  HIS C C     1 
ATOM 3212  O O     . HIS C 1 72  ? 23.377  -26.211  -100.771 1.00 67.74  ? 69  HIS C O     1 
ATOM 3213  C CB    . HIS C 1 72  ? 25.984  -24.798  -99.430  1.00 77.08  ? 69  HIS C CB    1 
ATOM 3214  C CG    . HIS C 1 72  ? 26.423  -23.814  -100.469 1.00 84.14  ? 69  HIS C CG    1 
ATOM 3215  N ND1   . HIS C 1 72  ? 25.589  -22.838  -100.973 1.00 83.78  ? 69  HIS C ND1   1 
ATOM 3216  C CD2   . HIS C 1 72  ? 27.615  -23.647  -101.088 1.00 86.51  ? 69  HIS C CD2   1 
ATOM 3217  C CE1   . HIS C 1 72  ? 26.248  -22.116  -101.862 1.00 79.83  ? 69  HIS C CE1   1 
ATOM 3218  N NE2   . HIS C 1 72  ? 27.479  -22.586  -101.950 1.00 83.36  ? 69  HIS C NE2   1 
ATOM 3219  N N     . ARG C 1 73  ? 24.987  -25.926  -102.324 1.00 74.71  ? 70  ARG C N     1 
ATOM 3220  C CA    . ARG C 1 73  ? 24.024  -25.901  -103.417 1.00 71.47  ? 70  ARG C CA    1 
ATOM 3221  C C     . ARG C 1 73  ? 23.323  -27.246  -103.550 1.00 62.43  ? 70  ARG C C     1 
ATOM 3222  O O     . ARG C 1 73  ? 22.102  -27.301  -103.729 1.00 55.29  ? 70  ARG C O     1 
ATOM 3223  C CB    . ARG C 1 73  ? 24.725  -25.514  -104.719 1.00 70.82  ? 70  ARG C CB    1 
ATOM 3224  C CG    . ARG C 1 73  ? 25.427  -24.163  -104.650 1.00 79.49  ? 70  ARG C CG    1 
ATOM 3225  C CD    . ARG C 1 73  ? 24.758  -23.120  -105.535 1.00 77.18  ? 70  ARG C CD    1 
ATOM 3226  N NE    . ARG C 1 73  ? 25.296  -21.779  -105.307 1.00 82.06  ? 70  ARG C NE    1 
ATOM 3227  C CZ    . ARG C 1 73  ? 26.484  -21.361  -105.734 1.00 83.31  ? 70  ARG C CZ    1 
ATOM 3228  N NH1   . ARG C 1 73  ? 27.275  -22.178  -106.418 1.00 88.31  ? 70  ARG C NH1   1 
ATOM 3229  N NH2   . ARG C 1 73  ? 26.884  -20.123  -105.474 1.00 74.95  ? 70  ARG C NH2   1 
ATOM 3230  N N     . VAL C 1 74  ? 24.076  -28.343  -103.432 1.00 67.64  ? 71  VAL C N     1 
ATOM 3231  C CA    . VAL C 1 74  ? 23.480  -29.672  -103.526 1.00 62.52  ? 71  VAL C CA    1 
ATOM 3232  C C     . VAL C 1 74  ? 22.568  -29.934  -102.336 1.00 53.57  ? 71  VAL C C     1 
ATOM 3233  O O     . VAL C 1 74  ? 21.503  -30.551  -102.475 1.00 48.73  ? 71  VAL C O     1 
ATOM 3234  C CB    . VAL C 1 74  ? 24.577  -30.746  -103.632 1.00 50.00  ? 71  VAL C CB    1 
ATOM 3235  C CG1   . VAL C 1 74  ? 23.954  -32.119  -103.845 1.00 46.87  ? 71  VAL C CG1   1 
ATOM 3236  C CG2   . VAL C 1 74  ? 25.548  -30.409  -104.748 1.00 62.44  ? 71  VAL C CG2   1 
ATOM 3237  N N     . ILE C 1 75  ? 22.975  -29.488  -101.145 1.00 53.13  ? 72  ILE C N     1 
ATOM 3238  C CA    . ILE C 1 75  ? 22.142  -29.680  -99.961  1.00 65.54  ? 72  ILE C CA    1 
ATOM 3239  C C     . ILE C 1 75  ? 20.800  -28.978  -100.145 1.00 59.72  ? 72  ILE C C     1 
ATOM 3240  O O     . ILE C 1 75  ? 19.737  -29.553  -99.882  1.00 51.28  ? 72  ILE C O     1 
ATOM 3241  C CB    . ILE C 1 75  ? 22.872  -29.193  -98.696  1.00 63.67  ? 72  ILE C CB    1 
ATOM 3242  C CG1   . ILE C 1 75  ? 24.060  -30.103  -98.377  1.00 60.55  ? 72  ILE C CG1   1 
ATOM 3243  C CG2   . ILE C 1 75  ? 21.932  -29.196  -97.507  1.00 57.18  ? 72  ILE C CG2   1 
ATOM 3244  C CD1   . ILE C 1 75  ? 24.868  -29.653  -97.174  1.00 73.56  ? 72  ILE C CD1   1 
ATOM 3245  N N     . ASN C 1 76  ? 20.829  -27.723  -100.604 1.00 64.80  ? 73  ASN C N     1 
ATOM 3246  C CA    . ASN C 1 76  ? 19.577  -27.000  -100.816 1.00 57.98  ? 73  ASN C CA    1 
ATOM 3247  C C     . ASN C 1 76  ? 18.757  -27.620  -101.943 1.00 59.39  ? 73  ASN C C     1 
ATOM 3248  O O     . ASN C 1 76  ? 17.524  -27.689  -101.854 1.00 58.74  ? 73  ASN C O     1 
ATOM 3249  C CB    . ASN C 1 76  ? 19.857  -25.524  -101.091 1.00 55.59  ? 73  ASN C CB    1 
ATOM 3250  C CG    . ASN C 1 76  ? 20.199  -24.761  -99.832  1.00 74.48  ? 73  ASN C CG    1 
ATOM 3251  O OD1   . ASN C 1 76  ? 19.689  -25.070  -98.752  1.00 74.73  ? 73  ASN C OD1   1 
ATOM 3252  N ND2   . ASN C 1 76  ? 21.056  -23.754  -99.960  1.00 74.39  ? 73  ASN C ND2   1 
ATOM 3253  N N     . LEU C 1 77  ? 19.420  -28.074  -103.011 1.00 47.93  ? 74  LEU C N     1 
ATOM 3254  C CA    . LEU C 1 77  ? 18.720  -28.765  -104.090 1.00 50.15  ? 74  LEU C CA    1 
ATOM 3255  C C     . LEU C 1 77  ? 17.957  -29.973  -103.563 1.00 60.22  ? 74  LEU C C     1 
ATOM 3256  O O     . LEU C 1 77  ? 16.776  -30.167  -103.878 1.00 56.28  ? 74  LEU C O     1 
ATOM 3257  C CB    . LEU C 1 77  ? 19.721  -29.196  -105.161 1.00 56.02  ? 74  LEU C CB    1 
ATOM 3258  C CG    . LEU C 1 77  ? 20.194  -28.129  -106.145 1.00 58.08  ? 74  LEU C CG    1 
ATOM 3259  C CD1   . LEU C 1 77  ? 21.404  -28.626  -106.918 1.00 61.51  ? 74  LEU C CD1   1 
ATOM 3260  C CD2   . LEU C 1 77  ? 19.075  -27.732  -107.090 1.00 62.25  ? 74  LEU C CD2   1 
ATOM 3261  N N     . ALA C 1 78  ? 18.617  -30.791  -102.740 1.00 57.14  ? 75  ALA C N     1 
ATOM 3262  C CA    . ALA C 1 78  ? 17.973  -31.989  -102.215 1.00 52.08  ? 75  ALA C CA    1 
ATOM 3263  C C     . ALA C 1 78  ? 16.853  -31.632  -101.248 1.00 53.62  ? 75  ALA C C     1 
ATOM 3264  O O     . ALA C 1 78  ? 15.780  -32.252  -101.273 1.00 47.90  ? 75  ALA C O     1 
ATOM 3265  C CB    . ALA C 1 78  ? 19.010  -32.883  -101.534 1.00 56.63  ? 75  ALA C CB    1 
ATOM 3266  N N     . ASN C 1 79  ? 17.079  -30.623  -100.401 1.00 57.38  ? 76  ASN C N     1 
ATOM 3267  C CA    . ASN C 1 79  ? 16.046  -30.191  -99.468  1.00 58.85  ? 76  ASN C CA    1 
ATOM 3268  C C     . ASN C 1 79  ? 14.804  -29.699  -100.196 1.00 65.06  ? 76  ASN C C     1 
ATOM 3269  O O     . ASN C 1 79  ? 13.685  -29.878  -99.703  1.00 55.91  ? 76  ASN C O     1 
ATOM 3270  C CB    . ASN C 1 79  ? 16.591  -29.094  -98.554  1.00 56.95  ? 76  ASN C CB    1 
ATOM 3271  C CG    . ASN C 1 79  ? 17.436  -29.643  -97.425  1.00 55.19  ? 76  ASN C CG    1 
ATOM 3272  O OD1   . ASN C 1 79  ? 17.092  -30.653  -96.808  1.00 62.83  ? 76  ASN C OD1   1 
ATOM 3273  N ND2   . ASN C 1 79  ? 18.552  -28.979  -97.147  1.00 58.74  ? 76  ASN C ND2   1 
ATOM 3274  N N     . GLU C 1 80  ? 14.979  -29.069  -101.361 1.00 66.32  ? 77  GLU C N     1 
ATOM 3275  C CA    . GLU C 1 80  ? 13.822  -28.620  -102.130 1.00 62.12  ? 77  GLU C CA    1 
ATOM 3276  C C     . GLU C 1 80  ? 13.172  -29.769  -102.894 1.00 62.05  ? 77  GLU C C     1 
ATOM 3277  O O     . GLU C 1 80  ? 11.944  -29.803  -103.038 1.00 63.12  ? 77  GLU C O     1 
ATOM 3278  C CB    . GLU C 1 80  ? 14.229  -27.505  -103.098 1.00 65.36  ? 77  GLU C CB    1 
ATOM 3279  C CG    . GLU C 1 80  ? 14.652  -26.210  -102.421 1.00 55.53  ? 77  GLU C CG    1 
ATOM 3280  C CD    . GLU C 1 80  ? 13.583  -25.648  -101.507 1.00 66.83  ? 77  GLU C CD    1 
ATOM 3281  O OE1   . GLU C 1 80  ? 12.384  -25.855  -101.788 1.00 72.77  ? 77  GLU C OE1   1 
ATOM 3282  O OE2   . GLU C 1 80  ? 13.943  -25.014  -100.494 1.00 68.77  ? 77  GLU C OE2   1 
ATOM 3283  N N     . MET C 1 81  ? 13.973  -30.717  -103.389 1.00 58.76  ? 78  MET C N     1 
ATOM 3284  C CA    . MET C 1 81  ? 13.419  -31.812  -104.180 1.00 57.53  ? 78  MET C CA    1 
ATOM 3285  C C     . MET C 1 81  ? 12.601  -32.775  -103.328 1.00 62.41  ? 78  MET C C     1 
ATOM 3286  O O     . MET C 1 81  ? 11.522  -33.212  -103.746 1.00 65.19  ? 78  MET C O     1 
ATOM 3287  C CB    . MET C 1 81  ? 14.532  -32.571  -104.904 1.00 53.92  ? 78  MET C CB    1 
ATOM 3288  C CG    . MET C 1 81  ? 15.052  -31.887  -106.154 1.00 72.95  ? 78  MET C CG    1 
ATOM 3289  S SD    . MET C 1 81  ? 13.861  -31.875  -107.513 1.00 62.04  ? 78  MET C SD    1 
ATOM 3290  C CE    . MET C 1 81  ? 12.973  -33.409  -107.249 1.00 57.97  ? 78  MET C CE    1 
ATOM 3291  N N     . PHE C 1 82  ? 13.097  -33.133  -102.142 1.00 71.01  ? 79  PHE C N     1 
ATOM 3292  C CA    . PHE C 1 82  ? 12.442  -34.151  -101.331 1.00 63.66  ? 79  PHE C CA    1 
ATOM 3293  C C     . PHE C 1 82  ? 11.862  -33.619  -100.031 1.00 59.86  ? 79  PHE C C     1 
ATOM 3294  O O     . PHE C 1 82  ? 11.107  -34.342  -99.370  1.00 58.57  ? 79  PHE C O     1 
ATOM 3295  C CB    . PHE C 1 82  ? 13.417  -35.292  -100.997 1.00 56.40  ? 79  PHE C CB    1 
ATOM 3296  C CG    . PHE C 1 82  ? 14.145  -35.841  -102.188 1.00 52.66  ? 79  PHE C CG    1 
ATOM 3297  C CD1   . PHE C 1 82  ? 13.493  -36.656  -103.098 1.00 52.04  ? 79  PHE C CD1   1 
ATOM 3298  C CD2   . PHE C 1 82  ? 15.485  -35.556  -102.389 1.00 60.09  ? 79  PHE C CD2   1 
ATOM 3299  C CE1   . PHE C 1 82  ? 14.162  -37.166  -104.194 1.00 50.46  ? 79  PHE C CE1   1 
ATOM 3300  C CE2   . PHE C 1 82  ? 16.160  -36.064  -103.482 1.00 54.26  ? 79  PHE C CE2   1 
ATOM 3301  C CZ    . PHE C 1 82  ? 15.497  -36.871  -104.385 1.00 52.20  ? 79  PHE C CZ    1 
ATOM 3302  N N     . GLY C 1 83  ? 12.172  -32.389  -99.659  1.00 61.41  ? 80  GLY C N     1 
ATOM 3303  C CA    . GLY C 1 83  ? 11.797  -31.917  -98.340  1.00 63.96  ? 80  GLY C CA    1 
ATOM 3304  C C     . GLY C 1 83  ? 12.898  -32.150  -97.329  1.00 64.05  ? 80  GLY C C     1 
ATOM 3305  O O     . GLY C 1 83  ? 13.720  -33.058  -97.453  1.00 67.81  ? 80  GLY C O     1 
ATOM 3306  N N     . TYR C 1 84  ? 12.928  -31.288  -96.310  1.00 57.57  ? 81  TYR C N     1 
ATOM 3307  C CA    . TYR C 1 84  ? 13.915  -31.444  -95.248  1.00 58.06  ? 81  TYR C CA    1 
ATOM 3308  C C     . TYR C 1 84  ? 13.819  -32.807  -94.578  1.00 63.32  ? 81  TYR C C     1 
ATOM 3309  O O     . TYR C 1 84  ? 14.808  -33.280  -94.007  1.00 59.33  ? 81  TYR C O     1 
ATOM 3310  C CB    . TYR C 1 84  ? 13.744  -30.358  -94.189  1.00 62.41  ? 81  TYR C CB    1 
ATOM 3311  C CG    . TYR C 1 84  ? 12.523  -30.560  -93.322  1.00 66.66  ? 81  TYR C CG    1 
ATOM 3312  C CD1   . TYR C 1 84  ? 11.250  -30.266  -93.793  1.00 65.43  ? 81  TYR C CD1   1 
ATOM 3313  C CD2   . TYR C 1 84  ? 12.644  -31.068  -92.035  1.00 67.67  ? 81  TYR C CD2   1 
ATOM 3314  C CE1   . TYR C 1 84  ? 10.135  -30.458  -92.996  1.00 62.56  ? 81  TYR C CE1   1 
ATOM 3315  C CE2   . TYR C 1 84  ? 11.537  -31.266  -91.236  1.00 64.00  ? 81  TYR C CE2   1 
ATOM 3316  C CZ    . TYR C 1 84  ? 10.286  -30.961  -91.720  1.00 58.72  ? 81  TYR C CZ    1 
ATOM 3317  O OH    . TYR C 1 84  ? 9.185   -31.156  -90.920  1.00 65.10  ? 81  TYR C OH    1 
ATOM 3318  N N     . ASN C 1 85  ? 12.648  -33.444  -94.637  1.00 59.81  ? 82  ASN C N     1 
ATOM 3319  C CA    . ASN C 1 85  ? 12.408  -34.735  -94.006  1.00 62.14  ? 82  ASN C CA    1 
ATOM 3320  C C     . ASN C 1 85  ? 12.112  -35.823  -95.032  1.00 58.80  ? 82  ASN C C     1 
ATOM 3321  O O     . ASN C 1 85  ? 11.515  -36.851  -94.692  1.00 53.46  ? 82  ASN C O     1 
ATOM 3322  C CB    . ASN C 1 85  ? 11.261  -34.630  -92.997  1.00 64.60  ? 82  ASN C CB    1 
ATOM 3323  C CG    . ASN C 1 85  ? 9.900   -34.501  -93.664  1.00 65.38  ? 82  ASN C CG    1 
ATOM 3324  O OD1   . ASN C 1 85  ? 9.776   -33.928  -94.745  1.00 73.77  ? 82  ASN C OD1   1 
ATOM 3325  N ND2   . ASN C 1 85  ? 8.870   -35.034  -93.014  1.00 59.22  ? 82  ASN C ND2   1 
ATOM 3326  N N     . GLY C 1 86  ? 12.523  -35.619  -96.281  1.00 66.22  ? 83  GLY C N     1 
ATOM 3327  C CA    . GLY C 1 86  ? 12.249  -36.578  -97.331  1.00 61.72  ? 83  GLY C CA    1 
ATOM 3328  C C     . GLY C 1 86  ? 13.500  -37.264  -97.835  1.00 50.24  ? 83  GLY C C     1 
ATOM 3329  O O     . GLY C 1 86  ? 13.421  -38.249  -98.576  1.00 54.15  ? 83  GLY C O     1 
ATOM 3330  N N     . TRP C 1 87  ? 14.663  -36.766  -97.431  1.00 53.69  ? 84  TRP C N     1 
ATOM 3331  C CA    . TRP C 1 87  ? 15.923  -37.415  -97.749  1.00 53.95  ? 84  TRP C CA    1 
ATOM 3332  C C     . TRP C 1 87  ? 16.784  -37.484  -96.498  1.00 44.88  ? 84  TRP C C     1 
ATOM 3333  O O     . TRP C 1 87  ? 16.628  -36.696  -95.561  1.00 45.13  ? 84  TRP C O     1 
ATOM 3334  C CB    . TRP C 1 87  ? 16.686  -36.687  -98.866  1.00 56.21  ? 84  TRP C CB    1 
ATOM 3335  C CG    . TRP C 1 87  ? 17.331  -35.407  -98.440  1.00 49.52  ? 84  TRP C CG    1 
ATOM 3336  C CD1   . TRP C 1 87  ? 16.711  -34.228  -98.152  1.00 48.77  ? 84  TRP C CD1   1 
ATOM 3337  C CD2   . TRP C 1 87  ? 18.731  -35.187  -98.234  1.00 48.31  ? 84  TRP C CD2   1 
ATOM 3338  N NE1   . TRP C 1 87  ? 17.642  -33.281  -97.793  1.00 49.81  ? 84  TRP C NE1   1 
ATOM 3339  C CE2   . TRP C 1 87  ? 18.889  -33.847  -97.833  1.00 53.76  ? 84  TRP C CE2   1 
ATOM 3340  C CE3   . TRP C 1 87  ? 19.866  -35.993  -98.352  1.00 48.83  ? 84  TRP C CE3   1 
ATOM 3341  C CZ2   . TRP C 1 87  ? 20.137  -33.295  -97.548  1.00 56.65  ? 84  TRP C CZ2   1 
ATOM 3342  C CZ3   . TRP C 1 87  ? 21.103  -35.444  -98.070  1.00 52.20  ? 84  TRP C CZ3   1 
ATOM 3343  C CH2   . TRP C 1 87  ? 21.229  -34.109  -97.672  1.00 53.97  ? 84  TRP C CH2   1 
ATOM 3344  N N     . ALA C 1 88  ? 17.688  -38.457  -96.493  1.00 49.54  ? 85  ALA C N     1 
ATOM 3345  C CA    . ALA C 1 88  ? 18.588  -38.670  -95.374  1.00 50.18  ? 85  ALA C CA    1 
ATOM 3346  C C     . ALA C 1 88  ? 19.892  -39.224  -95.919  1.00 46.90  ? 85  ALA C C     1 
ATOM 3347  O O     . ALA C 1 88  ? 19.917  -39.833  -96.991  1.00 49.36  ? 85  ALA C O     1 
ATOM 3348  C CB    . ALA C 1 88  ? 17.985  -39.628  -94.342  1.00 39.01  ? 85  ALA C CB    1 
ATOM 3349  N N     . HIS C 1 89  ? 20.978  -39.012  -95.181  1.00 48.48  ? 86  HIS C N     1 
ATOM 3350  C CA    . HIS C 1 89  ? 22.249  -39.616  -95.546  1.00 50.11  ? 86  HIS C CA    1 
ATOM 3351  C C     . HIS C 1 89  ? 23.013  -40.001  -94.290  1.00 54.30  ? 86  HIS C C     1 
ATOM 3352  O O     . HIS C 1 89  ? 22.837  -39.405  -93.223  1.00 50.90  ? 86  HIS C O     1 
ATOM 3353  C CB    . HIS C 1 89  ? 23.098  -38.687  -96.425  1.00 44.93  ? 86  HIS C CB    1 
ATOM 3354  C CG    . HIS C 1 89  ? 23.798  -37.606  -95.668  1.00 50.23  ? 86  HIS C CG    1 
ATOM 3355  N ND1   . HIS C 1 89  ? 23.125  -36.681  -94.902  1.00 54.60  ? 86  HIS C ND1   1 
ATOM 3356  C CD2   . HIS C 1 89  ? 25.110  -37.283  -95.580  1.00 53.64  ? 86  HIS C CD2   1 
ATOM 3357  C CE1   . HIS C 1 89  ? 23.991  -35.843  -94.362  1.00 54.59  ? 86  HIS C CE1   1 
ATOM 3358  N NE2   . HIS C 1 89  ? 25.203  -36.187  -94.758  1.00 53.62  ? 86  HIS C NE2   1 
ATOM 3359  N N     . SER C 1 90  ? 23.862  -41.013  -94.439  1.00 48.33  ? 87  SER C N     1 
ATOM 3360  C CA    . SER C 1 90  ? 24.651  -41.545  -93.345  1.00 49.67  ? 87  SER C CA    1 
ATOM 3361  C C     . SER C 1 90  ? 26.015  -41.952  -93.877  1.00 46.06  ? 87  SER C C     1 
ATOM 3362  O O     . SER C 1 90  ? 26.184  -42.245  -95.062  1.00 48.65  ? 87  SER C O     1 
ATOM 3363  C CB    . SER C 1 90  ? 23.955  -42.736  -92.681  1.00 55.21  ? 87  SER C CB    1 
ATOM 3364  O OG    . SER C 1 90  ? 23.637  -43.736  -93.635  1.00 58.69  ? 87  SER C OG    1 
ATOM 3365  N N     . ILE C 1 91  ? 26.991  -41.971  -92.982  1.00 45.82  ? 88  ILE C N     1 
ATOM 3366  C CA    . ILE C 1 91  ? 28.351  -42.371  -93.314  1.00 38.40  ? 88  ILE C CA    1 
ATOM 3367  C C     . ILE C 1 91  ? 28.471  -43.848  -92.962  1.00 42.85  ? 88  ILE C C     1 
ATOM 3368  O O     . ILE C 1 91  ? 28.540  -44.217  -91.786  1.00 48.42  ? 88  ILE C O     1 
ATOM 3369  C CB    . ILE C 1 91  ? 29.380  -41.516  -92.575  1.00 33.99  ? 88  ILE C CB    1 
ATOM 3370  C CG1   . ILE C 1 91  ? 29.136  -40.044  -92.902  1.00 33.19  ? 88  ILE C CG1   1 
ATOM 3371  C CG2   . ILE C 1 91  ? 30.792  -41.936  -92.947  1.00 38.57  ? 88  ILE C CG2   1 
ATOM 3372  C CD1   . ILE C 1 91  ? 29.905  -39.101  -92.039  1.00 54.65  ? 88  ILE C CD1   1 
ATOM 3373  N N     . THR C 1 92  ? 28.460  -44.702  -93.989  1.00 45.88  ? 89  THR C N     1 
ATOM 3374  C CA    . THR C 1 92  ? 28.604  -46.135  -93.759  1.00 41.21  ? 89  THR C CA    1 
ATOM 3375  C C     . THR C 1 92  ? 29.985  -46.465  -93.207  1.00 41.87  ? 89  THR C C     1 
ATOM 3376  O O     . THR C 1 92  ? 30.109  -47.248  -92.258  1.00 44.05  ? 89  THR C O     1 
ATOM 3377  C CB    . THR C 1 92  ? 28.341  -46.915  -95.048  1.00 37.33  ? 89  THR C CB    1 
ATOM 3378  O OG1   . THR C 1 92  ? 27.018  -46.633  -95.520  1.00 46.20  ? 89  THR C OG1   1 
ATOM 3379  C CG2   . THR C 1 92  ? 28.471  -48.415  -94.802  1.00 38.06  ? 89  THR C CG2   1 
ATOM 3380  N N     . GLN C 1 93  ? 31.031  -45.876  -93.783  1.00 36.84  ? 90  GLN C N     1 
ATOM 3381  C CA    . GLN C 1 93  ? 32.389  -46.109  -93.319  1.00 37.42  ? 90  GLN C CA    1 
ATOM 3382  C C     . GLN C 1 93  ? 33.283  -44.993  -93.840  1.00 45.23  ? 90  GLN C C     1 
ATOM 3383  O O     . GLN C 1 93  ? 33.133  -44.556  -94.983  1.00 52.60  ? 90  GLN C O     1 
ATOM 3384  C CB    . GLN C 1 93  ? 32.894  -47.476  -93.796  1.00 46.19  ? 90  GLN C CB    1 
ATOM 3385  C CG    . GLN C 1 93  ? 34.212  -47.932  -93.193  1.00 51.97  ? 90  GLN C CG    1 
ATOM 3386  C CD    . GLN C 1 93  ? 34.692  -49.230  -93.820  1.00 54.49  ? 90  GLN C CD    1 
ATOM 3387  O OE1   . GLN C 1 93  ? 34.625  -49.402  -95.036  1.00 70.48  ? 90  GLN C OE1   1 
ATOM 3388  N NE2   . GLN C 1 93  ? 35.180  -50.146  -92.995  1.00 69.13  ? 90  GLN C NE2   1 
ATOM 3389  N N     . GLN C 1 94  ? 34.189  -44.520  -92.988  1.00 45.41  ? 91  GLN C N     1 
ATOM 3390  C CA    . GLN C 1 94  ? 35.266  -43.623  -93.385  1.00 38.11  ? 91  GLN C CA    1 
ATOM 3391  C C     . GLN C 1 94  ? 36.586  -44.277  -93.016  1.00 42.70  ? 91  GLN C C     1 
ATOM 3392  O O     . GLN C 1 94  ? 36.761  -44.726  -91.878  1.00 52.30  ? 91  GLN C O     1 
ATOM 3393  C CB    . GLN C 1 94  ? 35.144  -42.255  -92.706  1.00 40.18  ? 91  GLN C CB    1 
ATOM 3394  C CG    . GLN C 1 94  ? 36.437  -41.452  -92.684  1.00 51.30  ? 91  GLN C CG    1 
ATOM 3395  C CD    . GLN C 1 94  ? 36.201  -39.961  -92.525  1.00 54.52  ? 91  GLN C CD    1 
ATOM 3396  O OE1   . GLN C 1 94  ? 36.589  -39.365  -91.522  1.00 59.29  ? 91  GLN C OE1   1 
ATOM 3397  N NE2   . GLN C 1 94  ? 35.573  -39.350  -93.523  1.00 47.74  ? 91  GLN C NE2   1 
ATOM 3398  N N     . ASN C 1 95  ? 37.510  -44.337  -93.974  1.00 44.52  ? 92  ASN C N     1 
ATOM 3399  C CA    . ASN C 1 95  ? 38.778  -45.031  -93.787  1.00 55.67  ? 92  ASN C CA    1 
ATOM 3400  C C     . ASN C 1 95  ? 39.919  -44.144  -94.267  1.00 46.32  ? 92  ASN C C     1 
ATOM 3401  O O     . ASN C 1 95  ? 39.923  -43.706  -95.421  1.00 43.39  ? 92  ASN C O     1 
ATOM 3402  C CB    . ASN C 1 95  ? 38.784  -46.368  -94.532  1.00 43.87  ? 92  ASN C CB    1 
ATOM 3403  C CG    . ASN C 1 95  ? 40.069  -47.145  -94.322  1.00 58.18  ? 92  ASN C CG    1 
ATOM 3404  O OD1   . ASN C 1 95  ? 41.051  -46.950  -95.041  1.00 65.03  ? 92  ASN C OD1   1 
ATOM 3405  N ND2   . ASN C 1 95  ? 40.069  -48.033  -93.332  1.00 56.12  ? 92  ASN C ND2   1 
ATOM 3406  N N     . VAL C 1 96  ? 40.877  -43.879  -93.385  1.00 52.75  ? 93  VAL C N     1 
ATOM 3407  C CA    . VAL C 1 96  ? 42.079  -43.133  -93.750  1.00 50.10  ? 93  VAL C CA    1 
ATOM 3408  C C     . VAL C 1 96  ? 43.024  -44.088  -94.478  1.00 46.65  ? 93  VAL C C     1 
ATOM 3409  O O     . VAL C 1 96  ? 43.507  -45.060  -93.897  1.00 55.85  ? 93  VAL C O     1 
ATOM 3410  C CB    . VAL C 1 96  ? 42.755  -42.516  -92.523  1.00 39.21  ? 93  VAL C CB    1 
ATOM 3411  C CG1   . VAL C 1 96  ? 44.061  -41.841  -92.920  1.00 48.27  ? 93  VAL C CG1   1 
ATOM 3412  C CG2   . VAL C 1 96  ? 41.819  -41.530  -91.842  1.00 38.98  ? 93  VAL C CG2   1 
ATOM 3413  N N     . ASP C 1 97  ? 43.277  -43.814  -95.759  1.00 48.19  ? 94  ASP C N     1 
ATOM 3414  C CA    . ASP C 1 97  ? 44.101  -44.719  -96.554  1.00 49.28  ? 94  ASP C CA    1 
ATOM 3415  C C     . ASP C 1 97  ? 45.573  -44.640  -96.167  1.00 49.65  ? 94  ASP C C     1 
ATOM 3416  O O     . ASP C 1 97  ? 46.241  -45.673  -96.049  1.00 44.86  ? 94  ASP C O     1 
ATOM 3417  C CB    . ASP C 1 97  ? 43.923  -44.423  -98.042  1.00 40.48  ? 94  ASP C CB    1 
ATOM 3418  C CG    . ASP C 1 97  ? 42.643  -45.007  -98.598  1.00 49.11  ? 94  ASP C CG    1 
ATOM 3419  O OD1   . ASP C 1 97  ? 42.088  -45.930  -97.964  1.00 54.06  ? 94  ASP C OD1   1 
ATOM 3420  O OD2   . ASP C 1 97  ? 42.191  -44.552  -99.669  1.00 57.35  ? 94  ASP C OD2   1 
ATOM 3421  N N     . PHE C 1 98  ? 46.100  -43.434  -95.964  1.00 48.93  ? 95  PHE C N     1 
ATOM 3422  C CA    . PHE C 1 98  ? 47.516  -43.286  -95.660  1.00 51.76  ? 95  PHE C CA    1 
ATOM 3423  C C     . PHE C 1 98  ? 47.768  -41.914  -95.055  1.00 57.24  ? 95  PHE C C     1 
ATOM 3424  O O     . PHE C 1 98  ? 47.001  -40.969  -95.258  1.00 53.67  ? 95  PHE C O     1 
ATOM 3425  C CB    . PHE C 1 98  ? 48.386  -43.479  -96.908  1.00 52.76  ? 95  PHE C CB    1 
ATOM 3426  C CG    . PHE C 1 98  ? 48.124  -42.471  -97.987  1.00 54.79  ? 95  PHE C CG    1 
ATOM 3427  C CD1   . PHE C 1 98  ? 48.823  -41.275  -98.024  1.00 54.59  ? 95  PHE C CD1   1 
ATOM 3428  C CD2   . PHE C 1 98  ? 47.177  -42.719  -98.964  1.00 58.00  ? 95  PHE C CD2   1 
ATOM 3429  C CE1   . PHE C 1 98  ? 48.579  -40.345  -99.013  1.00 54.23  ? 95  PHE C CE1   1 
ATOM 3430  C CE2   . PHE C 1 98  ? 46.930  -41.793  -99.957  1.00 61.92  ? 95  PHE C CE2   1 
ATOM 3431  C CZ    . PHE C 1 98  ? 47.633  -40.605  -99.981  1.00 58.52  ? 95  PHE C CZ    1 
ATOM 3432  N N     . VAL C 1 99  ? 48.860  -41.830  -94.297  1.00 54.88  ? 96  VAL C N     1 
ATOM 3433  C CA    . VAL C 1 99  ? 49.408  -40.575  -93.794  1.00 51.69  ? 96  VAL C CA    1 
ATOM 3434  C C     . VAL C 1 99  ? 50.920  -40.651  -93.978  1.00 58.00  ? 96  VAL C C     1 
ATOM 3435  O O     . VAL C 1 99  ? 51.597  -41.396  -93.261  1.00 63.24  ? 96  VAL C O     1 
ATOM 3436  C CB    . VAL C 1 99  ? 49.052  -40.324  -92.321  1.00 52.51  ? 96  VAL C CB    1 
ATOM 3437  C CG1   . VAL C 1 99  ? 49.754  -39.078  -91.807  1.00 45.31  ? 96  VAL C CG1   1 
ATOM 3438  C CG2   . VAL C 1 99  ? 47.545  -40.188  -92.151  1.00 39.45  ? 96  VAL C CG2   1 
ATOM 3439  N N     . ASP C 1 100 ? 51.448  -39.901  -94.941  1.00 57.06  ? 97  ASP C N     1 
ATOM 3440  C CA    . ASP C 1 100 ? 52.866  -39.923  -95.266  1.00 64.30  ? 97  ASP C CA    1 
ATOM 3441  C C     . ASP C 1 100 ? 53.511  -38.586  -94.916  1.00 68.33  ? 97  ASP C C     1 
ATOM 3442  O O     . ASP C 1 100 ? 52.876  -37.532  -94.998  1.00 67.84  ? 97  ASP C O     1 
ATOM 3443  C CB    . ASP C 1 100 ? 53.083  -40.233  -96.753  1.00 73.23  ? 97  ASP C CB    1 
ATOM 3444  C CG    . ASP C 1 100 ? 52.664  -41.648  -97.126  1.00 73.81  ? 97  ASP C CG    1 
ATOM 3445  O OD1   . ASP C 1 100 ? 52.971  -42.582  -96.356  1.00 77.82  ? 97  ASP C OD1   1 
ATOM 3446  O OD2   . ASP C 1 100 ? 52.030  -41.826  -98.188  1.00 73.26  ? 97  ASP C OD2   1 
ATOM 3447  N N     . LEU C 1 101 ? 54.783  -38.640  -94.520  1.00 68.51  ? 98  LEU C N     1 
ATOM 3448  C CA    . LEU C 1 101 ? 55.546  -37.458  -94.126  1.00 67.75  ? 98  LEU C CA    1 
ATOM 3449  C C     . LEU C 1 101 ? 56.739  -37.317  -95.064  1.00 75.75  ? 98  LEU C C     1 
ATOM 3450  O O     . LEU C 1 101 ? 57.654  -38.148  -95.042  1.00 77.15  ? 98  LEU C O     1 
ATOM 3451  C CB    . LEU C 1 101 ? 56.002  -37.555  -92.669  1.00 62.40  ? 98  LEU C CB    1 
ATOM 3452  C CG    . LEU C 1 101 ? 56.865  -36.393  -92.166  1.00 59.61  ? 98  LEU C CG    1 
ATOM 3453  C CD1   . LEU C 1 101 ? 56.151  -35.066  -92.364  1.00 64.65  ? 98  LEU C CD1   1 
ATOM 3454  C CD2   . LEU C 1 101 ? 57.252  -36.583  -90.706  1.00 57.41  ? 98  LEU C CD2   1 
ATOM 3455  N N     . ASN C 1 102 ? 56.731  -36.265  -95.882  1.00 79.61  ? 99  ASN C N     1 
ATOM 3456  C CA    . ASN C 1 102 ? 57.808  -35.985  -96.827  1.00 75.27  ? 99  ASN C CA    1 
ATOM 3457  C C     . ASN C 1 102 ? 58.398  -34.614  -96.524  1.00 81.46  ? 99  ASN C C     1 
ATOM 3458  O O     . ASN C 1 102 ? 57.751  -33.589  -96.771  1.00 77.41  ? 99  ASN C O     1 
ATOM 3459  C CB    . ASN C 1 102 ? 57.310  -36.061  -98.268  1.00 68.90  ? 99  ASN C CB    1 
ATOM 3460  C CG    . ASN C 1 102 ? 57.252  -37.482  -98.785  1.00 85.86  ? 99  ASN C CG    1 
ATOM 3461  O OD1   . ASN C 1 102 ? 58.155  -38.279  -98.535  1.00 97.07  ? 99  ASN C OD1   1 
ATOM 3462  N ND2   . ASN C 1 102 ? 56.194  -37.806  -99.520  1.00 91.79  ? 99  ASN C ND2   1 
ATOM 3463  N N     . ASN C 1 103 ? 59.630  -34.610  -96.016  1.00 89.85  ? 100 ASN C N     1 
ATOM 3464  C CA    . ASN C 1 103 ? 60.382  -33.415  -95.616  1.00 90.72  ? 100 ASN C CA    1 
ATOM 3465  C C     . ASN C 1 103 ? 59.470  -32.356  -94.999  1.00 81.29  ? 100 ASN C C     1 
ATOM 3466  O O     . ASN C 1 103 ? 59.402  -31.210  -95.443  1.00 84.43  ? 100 ASN C O     1 
ATOM 3467  C CB    . ASN C 1 103 ? 61.202  -32.823  -96.773  1.00 92.56  ? 100 ASN C CB    1 
ATOM 3468  C CG    . ASN C 1 103 ? 60.383  -32.564  -98.034  1.00 91.66  ? 100 ASN C CG    1 
ATOM 3469  O OD1   . ASN C 1 103 ? 59.828  -33.480  -98.636  1.00 104.44 ? 100 ASN C OD1   1 
ATOM 3470  N ND2   . ASN C 1 103 ? 60.301  -31.301  -98.429  1.00 88.43  ? 100 ASN C ND2   1 
ATOM 3471  N N     . GLY C 1 104 ? 58.760  -32.763  -93.949  1.00 72.27  ? 101 GLY C N     1 
ATOM 3472  C CA    . GLY C 1 104 ? 57.985  -31.825  -93.167  1.00 73.42  ? 101 GLY C CA    1 
ATOM 3473  C C     . GLY C 1 104 ? 56.599  -31.545  -93.699  1.00 69.58  ? 101 GLY C C     1 
ATOM 3474  O O     . GLY C 1 104 ? 55.875  -30.737  -93.104  1.00 67.92  ? 101 GLY C O     1 
ATOM 3475  N N     . LYS C 1 105 ? 56.209  -32.178  -94.800  1.00 67.95  ? 102 LYS C N     1 
ATOM 3476  C CA    . LYS C 1 105 ? 54.910  -31.972  -95.419  1.00 62.31  ? 102 LYS C CA    1 
ATOM 3477  C C     . LYS C 1 105 ? 54.094  -33.254  -95.314  1.00 64.73  ? 102 LYS C C     1 
ATOM 3478  O O     . LYS C 1 105 ? 54.640  -34.359  -95.407  1.00 56.27  ? 102 LYS C O     1 
ATOM 3479  C CB    . LYS C 1 105 ? 55.087  -31.577  -96.887  1.00 69.81  ? 102 LYS C CB    1 
ATOM 3480  C CG    . LYS C 1 105 ? 55.925  -30.321  -97.083  1.00 70.93  ? 102 LYS C CG    1 
ATOM 3481  C CD    . LYS C 1 105 ? 56.109  -29.993  -98.553  1.00 75.05  ? 102 LYS C CD    1 
ATOM 3482  C CE    . LYS C 1 105 ? 56.945  -28.732  -98.728  1.00 85.10  ? 102 LYS C CE    1 
ATOM 3483  N NZ    . LYS C 1 105 ? 57.171  -28.397  -100.165 1.00 107.10 ? 102 LYS C NZ    1 
ATOM 3484  N N     . PHE C 1 106 ? 52.790  -33.104  -95.102  1.00 64.94  ? 103 PHE C N     1 
ATOM 3485  C CA    . PHE C 1 106 ? 51.894  -34.234  -94.898  1.00 56.73  ? 103 PHE C CA    1 
ATOM 3486  C C     . PHE C 1 106 ? 51.019  -34.458  -96.124  1.00 63.48  ? 103 PHE C C     1 
ATOM 3487  O O     . PHE C 1 106 ? 50.493  -33.506  -96.710  1.00 60.43  ? 103 PHE C O     1 
ATOM 3488  C CB    . PHE C 1 106 ? 51.021  -34.021  -93.661  1.00 54.86  ? 103 PHE C CB    1 
ATOM 3489  C CG    . PHE C 1 106 ? 51.751  -34.233  -92.368  1.00 58.53  ? 103 PHE C CG    1 
ATOM 3490  C CD1   . PHE C 1 106 ? 52.112  -35.507  -91.963  1.00 55.48  ? 103 PHE C CD1   1 
ATOM 3491  C CD2   . PHE C 1 106 ? 52.098  -33.158  -91.570  1.00 62.88  ? 103 PHE C CD2   1 
ATOM 3492  C CE1   . PHE C 1 106 ? 52.791  -35.706  -90.778  1.00 61.76  ? 103 PHE C CE1   1 
ATOM 3493  C CE2   . PHE C 1 106 ? 52.779  -33.350  -90.383  1.00 67.95  ? 103 PHE C CE2   1 
ATOM 3494  C CZ    . PHE C 1 106 ? 53.125  -34.626  -89.986  1.00 67.69  ? 103 PHE C CZ    1 
ATOM 3495  N N     . TYR C 1 107 ? 50.869  -35.727  -96.504  1.00 72.26  ? 104 TYR C N     1 
ATOM 3496  C CA    . TYR C 1 107 ? 50.074  -36.136  -97.657  1.00 62.35  ? 104 TYR C CA    1 
ATOM 3497  C C     . TYR C 1 107 ? 49.104  -37.214  -97.195  1.00 63.76  ? 104 TYR C C     1 
ATOM 3498  O O     . TYR C 1 107 ? 49.531  -38.299  -96.782  1.00 61.41  ? 104 TYR C O     1 
ATOM 3499  C CB    . TYR C 1 107 ? 50.959  -36.644  -98.809  1.00 63.02  ? 104 TYR C CB    1 
ATOM 3500  C CG    . TYR C 1 107 ? 52.011  -35.659  -99.310  1.00 65.43  ? 104 TYR C CG    1 
ATOM 3501  C CD1   . TYR C 1 107 ? 53.003  -35.163  -98.471  1.00 72.66  ? 104 TYR C CD1   1 
ATOM 3502  C CD2   . TYR C 1 107 ? 51.992  -35.211  -100.623 1.00 68.66  ? 104 TYR C CD2   1 
ATOM 3503  C CE1   . TYR C 1 107 ? 53.945  -34.260  -98.924  1.00 72.72  ? 104 TYR C CE1   1 
ATOM 3504  C CE2   . TYR C 1 107 ? 52.932  -34.308  -101.088 1.00 78.32  ? 104 TYR C CE2   1 
ATOM 3505  C CZ    . TYR C 1 107 ? 53.907  -33.834  -100.233 1.00 80.04  ? 104 TYR C CZ    1 
ATOM 3506  O OH    . TYR C 1 107 ? 54.848  -32.933  -100.686 1.00 78.10  ? 104 TYR C OH    1 
ATOM 3507  N N     . VAL C 1 108 ? 47.805  -36.924  -97.271  1.00 58.88  ? 105 VAL C N     1 
ATOM 3508  C CA    . VAL C 1 108 ? 46.772  -37.738  -96.637  1.00 59.88  ? 105 VAL C CA    1 
ATOM 3509  C C     . VAL C 1 108 ? 45.703  -38.083  -97.663  1.00 60.24  ? 105 VAL C C     1 
ATOM 3510  O O     . VAL C 1 108 ? 45.231  -37.206  -98.394  1.00 51.09  ? 105 VAL C O     1 
ATOM 3511  C CB    . VAL C 1 108 ? 46.130  -37.018  -95.435  1.00 54.99  ? 105 VAL C CB    1 
ATOM 3512  C CG1   . VAL C 1 108 ? 44.989  -37.851  -94.871  1.00 48.32  ? 105 VAL C CG1   1 
ATOM 3513  C CG2   . VAL C 1 108 ? 47.167  -36.730  -94.363  1.00 57.11  ? 105 VAL C CG2   1 
ATOM 3514  N N     . GLY C 1 109 ? 45.317  -39.357  -97.709  1.00 58.27  ? 106 GLY C N     1 
ATOM 3515  C CA    . GLY C 1 109 ? 44.174  -39.779  -98.495  1.00 56.75  ? 106 GLY C CA    1 
ATOM 3516  C C     . GLY C 1 109 ? 43.111  -40.444  -97.643  1.00 52.83  ? 106 GLY C C     1 
ATOM 3517  O O     . GLY C 1 109 ? 43.417  -41.331  -96.839  1.00 53.28  ? 106 GLY C O     1 
ATOM 3518  N N     . VAL C 1 110 ? 41.857  -40.024  -97.804  1.00 43.48  ? 107 VAL C N     1 
ATOM 3519  C CA    . VAL C 1 110 ? 40.748  -40.515  -96.990  1.00 47.31  ? 107 VAL C CA    1 
ATOM 3520  C C     . VAL C 1 110 ? 39.555  -40.787  -97.895  1.00 48.37  ? 107 VAL C C     1 
ATOM 3521  O O     . VAL C 1 110 ? 39.164  -39.926  -98.690  1.00 45.12  ? 107 VAL C O     1 
ATOM 3522  C CB    . VAL C 1 110 ? 40.364  -39.511  -95.883  1.00 41.60  ? 107 VAL C CB    1 
ATOM 3523  C CG1   . VAL C 1 110 ? 39.070  -39.930  -95.203  1.00 45.20  ? 107 VAL C CG1   1 
ATOM 3524  C CG2   . VAL C 1 110 ? 41.488  -39.383  -94.864  1.00 48.66  ? 107 VAL C CG2   1 
ATOM 3525  N N     . CYS C 1 111 ? 38.985  -41.986  -97.784  1.00 48.84  ? 108 CYS C N     1 
ATOM 3526  C CA    . CYS C 1 111 ? 37.762  -42.356  -98.480  1.00 47.72  ? 108 CYS C CA    1 
ATOM 3527  C C     . CYS C 1 111 ? 36.609  -42.463  -97.489  1.00 51.71  ? 108 CYS C C     1 
ATOM 3528  O O     . CYS C 1 111 ? 36.810  -42.757  -96.307  1.00 50.07  ? 108 CYS C O     1 
ATOM 3529  C CB    . CYS C 1 111 ? 37.923  -43.684  -99.228  1.00 50.25  ? 108 CYS C CB    1 
ATOM 3530  S SG    . CYS C 1 111 ? 38.062  -45.134  -98.163  1.00 57.05  ? 108 CYS C SG    1 
ATOM 3531  N N     . ALA C 1 112 ? 35.395  -42.212  -97.978  1.00 47.44  ? 109 ALA C N     1 
ATOM 3532  C CA    . ALA C 1 112 ? 34.184  -42.333  -97.178  1.00 39.78  ? 109 ALA C CA    1 
ATOM 3533  C C     . ALA C 1 112 ? 33.083  -42.954  -98.025  1.00 51.07  ? 109 ALA C C     1 
ATOM 3534  O O     . ALA C 1 112 ? 33.009  -42.717  -99.232  1.00 56.31  ? 109 ALA C O     1 
ATOM 3535  C CB    . ALA C 1 112 ? 33.726  -40.971  -96.638  1.00 44.62  ? 109 ALA C CB    1 
ATOM 3536  N N     . PHE C 1 113 ? 32.217  -43.740  -97.389  1.00 49.23  ? 110 PHE C N     1 
ATOM 3537  C CA    . PHE C 1 113 ? 31.104  -44.376  -98.087  1.00 48.09  ? 110 PHE C CA    1 
ATOM 3538  C C     . PHE C 1 113 ? 29.825  -43.775  -97.521  1.00 47.78  ? 110 PHE C C     1 
ATOM 3539  O O     . PHE C 1 113 ? 29.471  -44.027  -96.365  1.00 44.28  ? 110 PHE C O     1 
ATOM 3540  C CB    . PHE C 1 113 ? 31.107  -45.896  -97.930  1.00 43.09  ? 110 PHE C CB    1 
ATOM 3541  C CG    . PHE C 1 113 ? 32.349  -46.564  -98.447  1.00 55.63  ? 110 PHE C CG    1 
ATOM 3542  C CD1   . PHE C 1 113 ? 32.327  -47.343  -99.597  1.00 46.41  ? 110 PHE C CD1   1 
ATOM 3543  C CD2   . PHE C 1 113 ? 33.551  -46.391  -97.782  1.00 62.82  ? 110 PHE C CD2   1 
ATOM 3544  C CE1   . PHE C 1 113 ? 33.493  -47.949  -100.058 1.00 58.62  ? 110 PHE C CE1   1 
ATOM 3545  C CE2   . PHE C 1 113 ? 34.708  -46.984  -98.231  1.00 59.32  ? 110 PHE C CE2   1 
ATOM 3546  C CZ    . PHE C 1 113 ? 34.684  -47.765  -99.371  1.00 65.29  ? 110 PHE C CZ    1 
ATOM 3547  N N     . VAL C 1 114 ? 29.141  -42.979  -98.336  1.00 53.56  ? 111 VAL C N     1 
ATOM 3548  C CA    . VAL C 1 114 ? 27.952  -42.245  -97.921  1.00 45.83  ? 111 VAL C CA    1 
ATOM 3549  C C     . VAL C 1 114 ? 26.741  -42.881  -98.584  1.00 45.56  ? 111 VAL C C     1 
ATOM 3550  O O     . VAL C 1 114 ? 26.749  -43.139  -99.794  1.00 42.06  ? 111 VAL C O     1 
ATOM 3551  C CB    . VAL C 1 114 ? 28.055  -40.756  -98.290  1.00 36.57  ? 111 VAL C CB    1 
ATOM 3552  C CG1   . VAL C 1 114 ? 26.804  -40.015  -97.851  1.00 47.37  ? 111 VAL C CG1   1 
ATOM 3553  C CG2   . VAL C 1 114 ? 29.298  -40.146  -97.677  1.00 36.01  ? 111 VAL C CG2   1 
ATOM 3554  N N     . ARG C 1 115 ? 25.695  -43.111  -97.795  1.00 41.39  ? 112 ARG C N     1 
ATOM 3555  C CA    . ARG C 1 115 ? 24.456  -43.720  -98.266  1.00 40.79  ? 112 ARG C CA    1 
ATOM 3556  C C     . ARG C 1 115 ? 23.315  -42.737  -98.050  1.00 50.89  ? 112 ARG C C     1 
ATOM 3557  O O     . ARG C 1 115 ? 23.005  -42.377  -96.909  1.00 55.07  ? 112 ARG C O     1 
ATOM 3558  C CB    . ARG C 1 115 ? 24.180  -45.032  -97.538  1.00 49.89  ? 112 ARG C CB    1 
ATOM 3559  C CG    . ARG C 1 115 ? 22.787  -45.589  -97.783  1.00 52.23  ? 112 ARG C CG    1 
ATOM 3560  C CD    . ARG C 1 115 ? 22.546  -46.858  -96.981  1.00 42.34  ? 112 ARG C CD    1 
ATOM 3561  N NE    . ARG C 1 115 ? 21.144  -46.988  -96.592  1.00 45.83  ? 112 ARG C NE    1 
ATOM 3562  C CZ    . ARG C 1 115 ? 20.327  -47.936  -97.040  1.00 55.74  ? 112 ARG C CZ    1 
ATOM 3563  N NH1   . ARG C 1 115 ? 20.772  -48.845  -97.898  1.00 56.72  ? 112 ARG C NH1   1 
ATOM 3564  N NH2   . ARG C 1 115 ? 19.065  -47.975  -96.628  1.00 51.11  ? 112 ARG C NH2   1 
ATOM 3565  N N     . VAL C 1 116 ? 22.709  -42.298  -99.138  1.00 49.15  ? 113 VAL C N     1 
ATOM 3566  C CA    . VAL C 1 116 ? 21.543  -41.424  -99.101  1.00 42.50  ? 113 VAL C CA    1 
ATOM 3567  C C     . VAL C 1 116 ? 20.292  -42.284  -99.177  1.00 44.67  ? 113 VAL C C     1 
ATOM 3568  O O     . VAL C 1 116 ? 20.243  -43.258  -99.936  1.00 44.26  ? 113 VAL C O     1 
ATOM 3569  C CB    . VAL C 1 116 ? 21.587  -40.400  -100.249 1.00 45.14  ? 113 VAL C CB    1 
ATOM 3570  C CG1   . VAL C 1 116 ? 20.323  -39.557  -100.264 1.00 41.28  ? 113 VAL C CG1   1 
ATOM 3571  C CG2   . VAL C 1 116 ? 22.811  -39.522  -100.113 1.00 50.87  ? 113 VAL C CG2   1 
ATOM 3572  N N     . GLN C 1 117 ? 19.279  -41.935  -98.387  1.00 45.53  ? 114 GLN C N     1 
ATOM 3573  C CA    . GLN C 1 117 ? 18.008  -42.642  -98.391  1.00 44.47  ? 114 GLN C CA    1 
ATOM 3574  C C     . GLN C 1 117 ? 16.867  -41.642  -98.495  1.00 53.96  ? 114 GLN C C     1 
ATOM 3575  O O     . GLN C 1 117 ? 16.911  -40.567  -97.889  1.00 60.13  ? 114 GLN C O     1 
ATOM 3576  C CB    . GLN C 1 117 ? 17.820  -43.490  -97.126  1.00 41.60  ? 114 GLN C CB    1 
ATOM 3577  C CG    . GLN C 1 117 ? 16.592  -44.398  -97.164  1.00 46.02  ? 114 GLN C CG    1 
ATOM 3578  C CD    . GLN C 1 117 ? 16.306  -45.056  -95.829  1.00 46.56  ? 114 GLN C CD    1 
ATOM 3579  O OE1   . GLN C 1 117 ? 15.379  -45.858  -95.705  1.00 55.16  ? 114 GLN C OE1   1 
ATOM 3580  N NE2   . GLN C 1 117 ? 17.095  -44.712  -94.818  1.00 62.56  ? 114 GLN C NE2   1 
ATOM 3581  N N     . LEU C 1 118 ? 15.845  -42.004  -99.263  1.00 51.23  ? 115 LEU C N     1 
ATOM 3582  C CA    . LEU C 1 118 ? 14.645  -41.192  -99.358  1.00 57.19  ? 115 LEU C CA    1 
ATOM 3583  C C     . LEU C 1 118 ? 13.591  -41.704  -98.382  1.00 52.21  ? 115 LEU C C     1 
ATOM 3584  O O     . LEU C 1 118 ? 13.706  -42.793  -97.815  1.00 59.86  ? 115 LEU C O     1 
ATOM 3585  C CB    . LEU C 1 118 ? 14.095  -41.188  -100.782 1.00 52.10  ? 115 LEU C CB    1 
ATOM 3586  C CG    . LEU C 1 118 ? 15.029  -40.647  -101.860 1.00 49.02  ? 115 LEU C CG    1 
ATOM 3587  C CD1   . LEU C 1 118 ? 14.310  -40.628  -103.196 1.00 54.96  ? 115 LEU C CD1   1 
ATOM 3588  C CD2   . LEU C 1 118 ? 15.544  -39.262  -101.488 1.00 46.99  ? 115 LEU C CD2   1 
ATOM 3589  N N     . LYS C 1 119 ? 12.543  -40.902  -98.193  1.00 56.20  ? 116 LYS C N     1 
ATOM 3590  C CA    . LYS C 1 119 ? 11.525  -41.241  -97.209  1.00 52.08  ? 116 LYS C CA    1 
ATOM 3591  C C     . LYS C 1 119 ? 10.733  -42.492  -97.570  1.00 58.63  ? 116 LYS C C     1 
ATOM 3592  O O     . LYS C 1 119 ? 9.931   -42.944  -96.746  1.00 65.43  ? 116 LYS C O     1 
ATOM 3593  C CB    . LYS C 1 119 ? 10.586  -40.051  -97.001  1.00 56.60  ? 116 LYS C CB    1 
ATOM 3594  C CG    . LYS C 1 119 ? 9.725   -39.686  -98.197  1.00 58.51  ? 116 LYS C CG    1 
ATOM 3595  C CD    . LYS C 1 119 ? 8.733   -38.596  -97.822  1.00 62.44  ? 116 LYS C CD    1 
ATOM 3596  C CE    . LYS C 1 119 ? 8.061   -38.013  -99.048  1.00 62.38  ? 116 LYS C CE    1 
ATOM 3597  N NZ    . LYS C 1 119 ? 7.174   -36.867  -98.707  1.00 64.91  ? 116 LYS C NZ    1 
ATOM 3598  N N     . ASP C 1 120 ? 10.941  -43.073  -98.754  1.00 53.28  ? 117 ASP C N     1 
ATOM 3599  C CA    . ASP C 1 120 ? 10.273  -44.316  -99.118  1.00 50.89  ? 117 ASP C CA    1 
ATOM 3600  C C     . ASP C 1 120 ? 11.181  -45.534  -99.017  1.00 54.35  ? 117 ASP C C     1 
ATOM 3601  O O     . ASP C 1 120 ? 10.738  -46.645  -99.324  1.00 57.52  ? 117 ASP C O     1 
ATOM 3602  C CB    . ASP C 1 120 ? 9.684   -44.213  -100.533 1.00 59.76  ? 117 ASP C CB    1 
ATOM 3603  C CG    . ASP C 1 120 ? 10.736  -44.302  -101.622 1.00 65.36  ? 117 ASP C CG    1 
ATOM 3604  O OD1   . ASP C 1 120 ? 11.841  -43.751  -101.436 1.00 65.63  ? 117 ASP C OD1   1 
ATOM 3605  O OD2   . ASP C 1 120 ? 10.451  -44.925  -102.669 1.00 65.69  ? 117 ASP C OD2   1 
ATOM 3606  N N     . GLY C 1 121 ? 12.419  -45.363  -98.554  1.00 51.96  ? 118 GLY C N     1 
ATOM 3607  C CA    . GLY C 1 121 ? 13.373  -46.441  -98.427  1.00 52.80  ? 118 GLY C CA    1 
ATOM 3608  C C     . GLY C 1 121 ? 14.359  -46.566  -99.572  1.00 50.82  ? 118 GLY C C     1 
ATOM 3609  O O     . GLY C 1 121 ? 15.383  -47.242  -99.413  1.00 49.95  ? 118 GLY C O     1 
ATOM 3610  N N     . SER C 1 122 ? 14.073  -45.951  -100.720 1.00 53.85  ? 119 SER C N     1 
ATOM 3611  C CA    . SER C 1 122 ? 15.024  -45.948  -101.825 1.00 50.15  ? 119 SER C CA    1 
ATOM 3612  C C     . SER C 1 122 ? 16.339  -45.323  -101.375 1.00 49.78  ? 119 SER C C     1 
ATOM 3613  O O     . SER C 1 122 ? 16.359  -44.372  -100.588 1.00 43.19  ? 119 SER C O     1 
ATOM 3614  C CB    . SER C 1 122 ? 14.446  -45.201  -103.029 1.00 48.35  ? 119 SER C CB    1 
ATOM 3615  O OG    . SER C 1 122 ? 14.417  -43.803  -102.810 1.00 64.58  ? 119 SER C OG    1 
ATOM 3616  N N     . TYR C 1 123 ? 17.447  -45.862  -101.877 1.00 47.00  ? 120 TYR C N     1 
ATOM 3617  C CA    . TYR C 1 123 ? 18.759  -45.479  -101.385 1.00 45.06  ? 120 TYR C CA    1 
ATOM 3618  C C     . TYR C 1 123 ? 19.773  -45.461  -102.518 1.00 42.71  ? 120 TYR C C     1 
ATOM 3619  O O     . TYR C 1 123 ? 19.612  -46.141  -103.533 1.00 40.39  ? 120 TYR C O     1 
ATOM 3620  C CB    . TYR C 1 123 ? 19.231  -46.431  -100.272 1.00 44.92  ? 120 TYR C CB    1 
ATOM 3621  C CG    . TYR C 1 123 ? 19.322  -47.889  -100.687 1.00 37.13  ? 120 TYR C CG    1 
ATOM 3622  C CD1   . TYR C 1 123 ? 18.244  -48.752  -100.521 1.00 31.95  ? 120 TYR C CD1   1 
ATOM 3623  C CD2   . TYR C 1 123 ? 20.489  -48.401  -101.239 1.00 40.35  ? 120 TYR C CD2   1 
ATOM 3624  C CE1   . TYR C 1 123 ? 18.328  -50.087  -100.897 1.00 32.68  ? 120 TYR C CE1   1 
ATOM 3625  C CE2   . TYR C 1 123 ? 20.580  -49.730  -101.620 1.00 41.50  ? 120 TYR C CE2   1 
ATOM 3626  C CZ    . TYR C 1 123 ? 19.499  -50.569  -101.448 1.00 43.24  ? 120 TYR C CZ    1 
ATOM 3627  O OH    . TYR C 1 123 ? 19.599  -51.891  -101.827 1.00 40.62  ? 120 TYR C OH    1 
ATOM 3628  N N     . HIS C 1 124 ? 20.820  -44.662  -102.333 1.00 33.46  ? 121 HIS C N     1 
ATOM 3629  C CA    . HIS C 1 124 ? 21.971  -44.675  -103.224 1.00 48.18  ? 121 HIS C CA    1 
ATOM 3630  C C     . HIS C 1 124 ? 23.217  -44.451  -102.384 1.00 53.39  ? 121 HIS C C     1 
ATOM 3631  O O     . HIS C 1 124 ? 23.273  -43.502  -101.596 1.00 48.32  ? 121 HIS C O     1 
ATOM 3632  C CB    . HIS C 1 124 ? 21.845  -43.607  -104.319 1.00 49.38  ? 121 HIS C CB    1 
ATOM 3633  C CG    . HIS C 1 124 ? 20.838  -43.947  -105.375 1.00 47.80  ? 121 HIS C CG    1 
ATOM 3634  N ND1   . HIS C 1 124 ? 19.563  -43.425  -105.387 1.00 55.89  ? 121 HIS C ND1   1 
ATOM 3635  C CD2   . HIS C 1 124 ? 20.916  -44.766  -106.449 1.00 46.47  ? 121 HIS C CD2   1 
ATOM 3636  C CE1   . HIS C 1 124 ? 18.899  -43.908  -106.421 1.00 57.62  ? 121 HIS C CE1   1 
ATOM 3637  N NE2   . HIS C 1 124 ? 19.698  -44.724  -107.083 1.00 51.92  ? 121 HIS C NE2   1 
ATOM 3638  N N     . GLU C 1 125 ? 24.207  -45.322  -102.555 1.00 50.33  ? 122 GLU C N     1 
ATOM 3639  C CA    . GLU C 1 125 ? 25.440  -45.275  -101.787 1.00 48.60  ? 122 GLU C CA    1 
ATOM 3640  C C     . GLU C 1 125 ? 26.629  -45.173  -102.733 1.00 52.11  ? 122 GLU C C     1 
ATOM 3641  O O     . GLU C 1 125 ? 26.689  -45.880  -103.745 1.00 50.77  ? 122 GLU C O     1 
ATOM 3642  C CB    . GLU C 1 125 ? 25.553  -46.518  -100.894 1.00 44.14  ? 122 GLU C CB    1 
ATOM 3643  C CG    . GLU C 1 125 ? 26.813  -46.603  -100.063 1.00 46.92  ? 122 GLU C CG    1 
ATOM 3644  C CD    . GLU C 1 125 ? 26.816  -47.813  -99.148  1.00 56.35  ? 122 GLU C CD    1 
ATOM 3645  O OE1   . GLU C 1 125 ? 26.063  -48.769  -99.423  1.00 61.09  ? 122 GLU C OE1   1 
ATOM 3646  O OE2   . GLU C 1 125 ? 27.565  -47.809  -98.150  1.00 64.23  ? 122 GLU C OE2   1 
ATOM 3647  N N     . ASP C 1 126 ? 27.577  -44.296  -102.402 1.00 44.51  ? 123 ASP C N     1 
ATOM 3648  C CA    . ASP C 1 126 ? 28.749  -44.091  -103.241 1.00 49.01  ? 123 ASP C CA    1 
ATOM 3649  C C     . ASP C 1 126 ? 29.941  -43.724  -102.368 1.00 44.20  ? 123 ASP C C     1 
ATOM 3650  O O     . ASP C 1 126 ? 29.827  -43.578  -101.148 1.00 52.03  ? 123 ASP C O     1 
ATOM 3651  C CB    . ASP C 1 126 ? 28.485  -43.018  -104.302 1.00 54.67  ? 123 ASP C CB    1 
ATOM 3652  C CG    . ASP C 1 126 ? 29.165  -43.325  -105.618 1.00 59.44  ? 123 ASP C CG    1 
ATOM 3653  O OD1   . ASP C 1 126 ? 30.402  -43.484  -105.624 1.00 54.04  ? 123 ASP C OD1   1 
ATOM 3654  O OD2   . ASP C 1 126 ? 28.459  -43.417  -106.643 1.00 67.36  ? 123 ASP C OD2   1 
ATOM 3655  N N     . VAL C 1 127 ? 31.090  -43.558  -103.012 1.00 46.91  ? 124 VAL C N     1 
ATOM 3656  C CA    . VAL C 1 127 ? 32.351  -43.274  -102.341 1.00 49.80  ? 124 VAL C CA    1 
ATOM 3657  C C     . VAL C 1 127 ? 32.730  -41.834  -102.597 1.00 53.63  ? 124 VAL C C     1 
ATOM 3658  O O     . VAL C 1 127 ? 32.562  -41.324  -103.713 1.00 58.93  ? 124 VAL C O     1 
ATOM 3659  C CB    . VAL C 1 127 ? 33.478  -44.205  -102.829 1.00 52.01  ? 124 VAL C CB    1 
ATOM 3660  C CG1   . VAL C 1 127 ? 34.806  -43.849  -102.156 1.00 45.33  ? 124 VAL C CG1   1 
ATOM 3661  C CG2   . VAL C 1 127 ? 33.121  -45.647  -102.602 1.00 71.31  ? 124 VAL C CG2   1 
ATOM 3662  N N     . GLY C 1 128 ? 33.222  -41.155  -101.571 1.00 48.33  ? 125 GLY C N     1 
ATOM 3663  C CA    . GLY C 1 128 ? 33.901  -39.885  -101.717 1.00 47.85  ? 125 GLY C CA    1 
ATOM 3664  C C     . GLY C 1 128 ? 35.353  -40.040  -101.295 1.00 49.33  ? 125 GLY C C     1 
ATOM 3665  O O     . GLY C 1 128 ? 35.692  -40.938  -100.522 1.00 51.11  ? 125 GLY C O     1 
ATOM 3666  N N     . TYR C 1 129 ? 36.212  -39.159  -101.799 1.00 45.45  ? 126 TYR C N     1 
ATOM 3667  C CA    . TYR C 1 129 ? 37.618  -39.150  -101.419 1.00 45.65  ? 126 TYR C CA    1 
ATOM 3668  C C     . TYR C 1 129 ? 37.995  -37.763  -100.935 1.00 43.15  ? 126 TYR C C     1 
ATOM 3669  O O     . TYR C 1 129 ? 37.369  -36.768  -101.308 1.00 53.83  ? 126 TYR C O     1 
ATOM 3670  C CB    . TYR C 1 129 ? 38.566  -39.520  -102.561 1.00 48.33  ? 126 TYR C CB    1 
ATOM 3671  C CG    . TYR C 1 129 ? 39.761  -40.315  -102.086 1.00 45.46  ? 126 TYR C CG    1 
ATOM 3672  C CD1   . TYR C 1 129 ? 41.030  -39.746  -102.019 1.00 54.45  ? 126 TYR C CD1   1 
ATOM 3673  C CD2   . TYR C 1 129 ? 39.604  -41.617  -101.638 1.00 43.08  ? 126 TYR C CD2   1 
ATOM 3674  C CE1   . TYR C 1 129 ? 42.111  -40.475  -101.561 1.00 44.48  ? 126 TYR C CE1   1 
ATOM 3675  C CE2   . TYR C 1 129 ? 40.673  -42.351  -101.182 1.00 51.23  ? 126 TYR C CE2   1 
ATOM 3676  C CZ    . TYR C 1 129 ? 41.924  -41.775  -101.144 1.00 44.14  ? 126 TYR C CZ    1 
ATOM 3677  O OH    . TYR C 1 129 ? 42.996  -42.499  -100.684 1.00 51.10  ? 126 TYR C OH    1 
ATOM 3678  N N     . GLY C 1 130 ? 39.032  -37.711  -100.104 1.00 41.01  ? 127 GLY C N     1 
ATOM 3679  C CA    . GLY C 1 130 ? 39.532  -36.453  -99.590  1.00 42.33  ? 127 GLY C CA    1 
ATOM 3680  C C     . GLY C 1 130 ? 41.043  -36.410  -99.638  1.00 49.05  ? 127 GLY C C     1 
ATOM 3681  O O     . GLY C 1 130 ? 41.703  -37.354  -99.197  1.00 53.11  ? 127 GLY C O     1 
ATOM 3682  N N     . VAL C 1 131 ? 41.608  -35.321  -100.155 1.00 55.71  ? 128 VAL C N     1 
ATOM 3683  C CA    . VAL C 1 131 ? 43.041  -35.224  -100.401 1.00 55.33  ? 128 VAL C CA    1 
ATOM 3684  C C     . VAL C 1 131 ? 43.575  -33.979  -99.707  1.00 54.61  ? 128 VAL C C     1 
ATOM 3685  O O     . VAL C 1 131 ? 42.919  -32.932  -99.695  1.00 63.64  ? 128 VAL C O     1 
ATOM 3686  C CB    . VAL C 1 131 ? 43.347  -35.182  -101.915 1.00 49.42  ? 128 VAL C CB    1 
ATOM 3687  C CG1   . VAL C 1 131 ? 44.844  -35.109  -102.172 1.00 59.49  ? 128 VAL C CG1   1 
ATOM 3688  C CG2   . VAL C 1 131 ? 42.748  -36.392  -102.610 1.00 52.39  ? 128 VAL C CG2   1 
ATOM 3689  N N     . SER C 1 132 ? 44.767  -34.096  -99.123  1.00 52.99  ? 129 SER C N     1 
ATOM 3690  C CA    . SER C 1 132 ? 45.468  -32.949  -98.552  1.00 53.16  ? 129 SER C CA    1 
ATOM 3691  C C     . SER C 1 132 ? 46.961  -33.212  -98.685  1.00 60.67  ? 129 SER C C     1 
ATOM 3692  O O     . SER C 1 132 ? 47.501  -34.073  -97.985  1.00 58.72  ? 129 SER C O     1 
ATOM 3693  C CB    . SER C 1 132 ? 45.071  -32.735  -97.094  1.00 56.09  ? 129 SER C CB    1 
ATOM 3694  O OG    . SER C 1 132 ? 45.937  -31.812  -96.457  1.00 56.41  ? 129 SER C OG    1 
ATOM 3695  N N     . GLU C 1 133 ? 47.613  -32.495  -99.598  1.00 61.68  ? 130 GLU C N     1 
ATOM 3696  C CA    . GLU C 1 133 ? 49.038  -32.642  -99.862  1.00 64.02  ? 130 GLU C CA    1 
ATOM 3697  C C     . GLU C 1 133 ? 49.741  -31.306  -99.672  1.00 60.84  ? 130 GLU C C     1 
ATOM 3698  O O     . GLU C 1 133 ? 49.267  -30.275  -100.163 1.00 64.12  ? 130 GLU C O     1 
ATOM 3699  C CB    . GLU C 1 133 ? 49.285  -33.182  -101.274 1.00 64.99  ? 130 GLU C CB    1 
ATOM 3700  C CG    . GLU C 1 133 ? 48.273  -34.224  -101.727 1.00 67.09  ? 130 GLU C CG    1 
ATOM 3701  C CD    . GLU C 1 133 ? 48.704  -34.959  -102.983 1.00 70.59  ? 130 GLU C CD    1 
ATOM 3702  O OE1   . GLU C 1 133 ? 49.322  -36.041  -102.862 1.00 77.99  ? 130 GLU C OE1   1 
ATOM 3703  O OE2   . GLU C 1 133 ? 48.429  -34.450  -104.090 1.00 68.80  ? 130 GLU C OE2   1 
ATOM 3704  N N     . GLY C 1 134 ? 50.853  -31.322  -98.939  1.00 63.43  ? 131 GLY C N     1 
ATOM 3705  C CA    . GLY C 1 134 ? 51.729  -30.179  -98.811  1.00 68.20  ? 131 GLY C CA    1 
ATOM 3706  C C     . GLY C 1 134 ? 51.686  -29.497  -97.462  1.00 68.74  ? 131 GLY C C     1 
ATOM 3707  O O     . GLY C 1 134 ? 52.651  -28.809  -97.102  1.00 75.33  ? 131 GLY C O     1 
ATOM 3708  N N     . LEU C 1 135 ? 50.601  -29.658  -96.709  1.00 71.38  ? 132 LEU C N     1 
ATOM 3709  C CA    . LEU C 1 135 ? 50.471  -28.957  -95.441  1.00 69.67  ? 132 LEU C CA    1 
ATOM 3710  C C     . LEU C 1 135 ? 51.465  -29.494  -94.418  1.00 69.29  ? 132 LEU C C     1 
ATOM 3711  O O     . LEU C 1 135 ? 51.788  -30.684  -94.395  1.00 65.89  ? 132 LEU C O     1 
ATOM 3712  C CB    . LEU C 1 135 ? 49.050  -29.094  -94.892  1.00 67.15  ? 132 LEU C CB    1 
ATOM 3713  C CG    . LEU C 1 135 ? 47.939  -28.303  -95.583  1.00 72.89  ? 132 LEU C CG    1 
ATOM 3714  C CD1   . LEU C 1 135 ? 46.603  -28.568  -94.909  1.00 62.21  ? 132 LEU C CD1   1 
ATOM 3715  C CD2   . LEU C 1 135 ? 48.258  -26.823  -95.589  1.00 83.00  ? 132 LEU C CD2   1 
ATOM 3716  N N     . LYS C 1 136 ? 51.941  -28.599  -93.552  1.00 70.30  ? 133 LYS C N     1 
ATOM 3717  C CA    . LYS C 1 136 ? 52.858  -28.987  -92.489  1.00 66.60  ? 133 LYS C CA    1 
ATOM 3718  C C     . LYS C 1 136 ? 52.136  -29.426  -91.222  1.00 67.67  ? 133 LYS C C     1 
ATOM 3719  O O     . LYS C 1 136 ? 52.762  -30.040  -90.352  1.00 68.77  ? 133 LYS C O     1 
ATOM 3720  C CB    . LYS C 1 136 ? 53.822  -27.841  -92.157  1.00 66.53  ? 133 LYS C CB    1 
ATOM 3721  C CG    . LYS C 1 136 ? 54.688  -27.388  -93.329  1.00 82.38  ? 133 LYS C CG    1 
ATOM 3722  C CD    . LYS C 1 136 ? 55.509  -26.158  -92.968  1.00 86.28  ? 133 LYS C CD    1 
ATOM 3723  C CE    . LYS C 1 136 ? 56.762  -26.541  -92.186  1.00 85.57  ? 133 LYS C CE    1 
ATOM 3724  N NZ    . LYS C 1 136 ? 57.693  -27.392  -92.977  1.00 98.58  ? 133 LYS C NZ    1 
ATOM 3725  N N     . SER C 1 137 ? 50.851  -29.102  -91.084  1.00 63.13  ? 134 SER C N     1 
ATOM 3726  C CA    . SER C 1 137 ? 50.066  -29.509  -89.925  1.00 64.35  ? 134 SER C CA    1 
ATOM 3727  C C     . SER C 1 137 ? 49.348  -30.816  -90.241  1.00 60.39  ? 134 SER C C     1 
ATOM 3728  O O     . SER C 1 137 ? 48.486  -30.858  -91.125  1.00 64.78  ? 134 SER C O     1 
ATOM 3729  C CB    . SER C 1 137 ? 49.059  -28.425  -89.539  1.00 68.30  ? 134 SER C CB    1 
ATOM 3730  O OG    . SER C 1 137 ? 48.157  -28.896  -88.549  1.00 61.85  ? 134 SER C OG    1 
ATOM 3731  N N     . LYS C 1 138 ? 49.701  -31.880  -89.515  1.00 61.73  ? 135 LYS C N     1 
ATOM 3732  C CA    . LYS C 1 138 ? 49.027  -33.161  -89.700  1.00 56.36  ? 135 LYS C CA    1 
ATOM 3733  C C     . LYS C 1 138 ? 47.538  -33.064  -89.381  1.00 58.91  ? 135 LYS C C     1 
ATOM 3734  O O     . LYS C 1 138 ? 46.702  -33.624  -90.102  1.00 64.73  ? 135 LYS C O     1 
ATOM 3735  C CB    . LYS C 1 138 ? 49.682  -34.228  -88.828  1.00 49.74  ? 135 LYS C CB    1 
ATOM 3736  C CG    . LYS C 1 138 ? 49.087  -35.613  -89.009  1.00 55.54  ? 135 LYS C CG    1 
ATOM 3737  C CD    . LYS C 1 138 ? 50.110  -36.697  -88.735  1.00 54.83  ? 135 LYS C CD    1 
ATOM 3738  C CE    . LYS C 1 138 ? 50.495  -36.720  -87.270  1.00 44.01  ? 135 LYS C CE    1 
ATOM 3739  N NZ    . LYS C 1 138 ? 51.428  -37.837  -86.957  1.00 54.11  ? 135 LYS C NZ    1 
ATOM 3740  N N     . ALA C 1 139 ? 47.190  -32.360  -88.299  1.00 53.54  ? 136 ALA C N     1 
ATOM 3741  C CA    . ALA C 1 139 ? 45.793  -32.290  -87.876  1.00 53.51  ? 136 ALA C CA    1 
ATOM 3742  C C     . ALA C 1 139 ? 44.919  -31.627  -88.934  1.00 58.45  ? 136 ALA C C     1 
ATOM 3743  O O     . ALA C 1 139 ? 43.813  -32.103  -89.223  1.00 59.21  ? 136 ALA C O     1 
ATOM 3744  C CB    . ALA C 1 139 ? 45.683  -31.545  -86.547  1.00 59.35  ? 136 ALA C CB    1 
ATOM 3745  N N     . LEU C 1 140 ? 45.391  -30.524  -89.522  1.00 63.01  ? 137 LEU C N     1 
ATOM 3746  C CA    . LEU C 1 140 ? 44.585  -29.862  -90.540  1.00 62.61  ? 137 LEU C CA    1 
ATOM 3747  C C     . LEU C 1 140 ? 44.504  -30.696  -91.807  1.00 59.92  ? 137 LEU C C     1 
ATOM 3748  O O     . LEU C 1 140 ? 43.461  -30.707  -92.468  1.00 57.95  ? 137 LEU C O     1 
ATOM 3749  C CB    . LEU C 1 140 ? 45.129  -28.469  -90.853  1.00 67.97  ? 137 LEU C CB    1 
ATOM 3750  C CG    . LEU C 1 140 ? 44.408  -27.343  -90.108  1.00 86.41  ? 137 LEU C CG    1 
ATOM 3751  C CD1   . LEU C 1 140 ? 44.503  -27.512  -88.596  1.00 73.65  ? 137 LEU C CD1   1 
ATOM 3752  C CD2   . LEU C 1 140 ? 44.904  -25.981  -90.549  1.00 104.64 ? 137 LEU C CD2   1 
ATOM 3753  N N     . SER C 1 141 ? 45.579  -31.410  -92.146  1.00 59.06  ? 138 SER C N     1 
ATOM 3754  C CA    . SER C 1 141 ? 45.534  -32.316  -93.288  1.00 55.38  ? 138 SER C CA    1 
ATOM 3755  C C     . SER C 1 141 ? 44.449  -33.366  -93.096  1.00 61.40  ? 138 SER C C     1 
ATOM 3756  O O     . SER C 1 141 ? 43.622  -33.597  -93.991  1.00 54.00  ? 138 SER C O     1 
ATOM 3757  C CB    . SER C 1 141 ? 46.897  -32.982  -93.491  1.00 51.32  ? 138 SER C CB    1 
ATOM 3758  O OG    . SER C 1 141 ? 47.906  -32.034  -93.794  1.00 66.16  ? 138 SER C OG    1 
ATOM 3759  N N     . LEU C 1 142 ? 44.425  -34.005  -91.921  1.00 54.18  ? 139 LEU C N     1 
ATOM 3760  C CA    . LEU C 1 142 ? 43.412  -35.020  -91.650  1.00 46.40  ? 139 LEU C CA    1 
ATOM 3761  C C     . LEU C 1 142 ? 42.002  -34.433  -91.651  1.00 48.14  ? 139 LEU C C     1 
ATOM 3762  O O     . LEU C 1 142 ? 41.083  -35.027  -92.224  1.00 42.48  ? 139 LEU C O     1 
ATOM 3763  C CB    . LEU C 1 142 ? 43.708  -35.718  -90.322  1.00 45.95  ? 139 LEU C CB    1 
ATOM 3764  C CG    . LEU C 1 142 ? 44.742  -36.843  -90.394  1.00 47.99  ? 139 LEU C CG    1 
ATOM 3765  C CD1   . LEU C 1 142 ? 45.207  -37.244  -89.003  1.00 41.92  ? 139 LEU C CD1   1 
ATOM 3766  C CD2   . LEU C 1 142 ? 44.167  -38.039  -91.136  1.00 41.22  ? 139 LEU C CD2   1 
ATOM 3767  N N     . GLU C 1 143 ? 41.806  -33.273  -91.013  1.00 44.39  ? 140 GLU C N     1 
ATOM 3768  C CA    . GLU C 1 143 ? 40.477  -32.658  -90.995  1.00 43.82  ? 140 GLU C CA    1 
ATOM 3769  C C     . GLU C 1 143 ? 39.996  -32.359  -92.409  1.00 46.31  ? 140 GLU C C     1 
ATOM 3770  O O     . GLU C 1 143 ? 38.859  -32.691  -92.783  1.00 44.02  ? 140 GLU C O     1 
ATOM 3771  C CB    . GLU C 1 143 ? 40.495  -31.373  -90.165  1.00 53.21  ? 140 GLU C CB    1 
ATOM 3772  C CG    . GLU C 1 143 ? 39.283  -30.471  -90.390  1.00 50.09  ? 140 GLU C CG    1 
ATOM 3773  C CD    . GLU C 1 143 ? 39.324  -29.211  -89.545  1.00 48.83  ? 140 GLU C CD    1 
ATOM 3774  O OE1   . GLU C 1 143 ? 40.438  -28.719  -89.276  1.00 62.66  ? 140 GLU C OE1   1 
ATOM 3775  O OE2   . GLU C 1 143 ? 38.249  -28.704  -89.162  1.00 54.08  ? 140 GLU C OE2   1 
ATOM 3776  N N     . LYS C 1 144 ? 40.864  -31.739  -93.210  1.00 53.00  ? 141 LYS C N     1 
ATOM 3777  C CA    . LYS C 1 144 ? 40.524  -31.392  -94.583  1.00 47.70  ? 141 LYS C CA    1 
ATOM 3778  C C     . LYS C 1 144 ? 40.166  -32.640  -95.372  1.00 40.73  ? 141 LYS C C     1 
ATOM 3779  O O     . LYS C 1 144 ? 39.136  -32.683  -96.059  1.00 38.43  ? 141 LYS C O     1 
ATOM 3780  C CB    . LYS C 1 144 ? 41.705  -30.642  -95.210  1.00 49.13  ? 141 LYS C CB    1 
ATOM 3781  C CG    . LYS C 1 144 ? 41.466  -29.931  -96.542  1.00 60.80  ? 141 LYS C CG    1 
ATOM 3782  C CD    . LYS C 1 144 ? 42.375  -30.505  -97.626  1.00 65.86  ? 141 LYS C CD    1 
ATOM 3783  C CE    . LYS C 1 144 ? 42.640  -29.491  -98.738  1.00 73.33  ? 141 LYS C CE    1 
ATOM 3784  N NZ    . LYS C 1 144 ? 43.332  -30.097  -99.919  1.00 68.09  ? 141 LYS C NZ    1 
ATOM 3785  N N     . ALA C 1 145 ? 40.973  -33.695  -95.231  1.00 34.78  ? 142 ALA C N     1 
ATOM 3786  C CA    . ALA C 1 145 ? 40.742  -34.902  -96.013  1.00 41.53  ? 142 ALA C CA    1 
ATOM 3787  C C     . ALA C 1 145 ? 39.436  -35.578  -95.616  1.00 46.07  ? 142 ALA C C     1 
ATOM 3788  O O     . ALA C 1 145 ? 38.644  -35.956  -96.484  1.00 48.09  ? 142 ALA C O     1 
ATOM 3789  C CB    . ALA C 1 145 ? 41.916  -35.867  -95.845  1.00 44.08  ? 142 ALA C CB    1 
ATOM 3790  N N     . ARG C 1 146 ? 39.172  -35.690  -94.312  1.00 42.84  ? 143 ARG C N     1 
ATOM 3791  C CA    . ARG C 1 146 ? 37.963  -36.367  -93.846  1.00 43.44  ? 143 ARG C CA    1 
ATOM 3792  C C     . ARG C 1 146 ? 36.707  -35.618  -94.276  1.00 47.30  ? 143 ARG C C     1 
ATOM 3793  O O     . ARG C 1 146 ? 35.769  -36.212  -94.839  1.00 53.64  ? 143 ARG C O     1 
ATOM 3794  C CB    . ARG C 1 146 ? 38.018  -36.511  -92.324  1.00 48.22  ? 143 ARG C CB    1 
ATOM 3795  C CG    . ARG C 1 146 ? 39.194  -37.342  -91.816  1.00 57.47  ? 143 ARG C CG    1 
ATOM 3796  C CD    . ARG C 1 146 ? 39.053  -37.684  -90.340  1.00 51.78  ? 143 ARG C CD    1 
ATOM 3797  N NE    . ARG C 1 146 ? 38.571  -39.045  -90.126  1.00 58.21  ? 143 ARG C NE    1 
ATOM 3798  C CZ    . ARG C 1 146 ? 39.304  -40.025  -89.608  1.00 52.27  ? 143 ARG C CZ    1 
ATOM 3799  N NH1   . ARG C 1 146 ? 40.554  -39.794  -89.233  1.00 48.21  ? 143 ARG C NH1   1 
ATOM 3800  N NH2   . ARG C 1 146 ? 38.781  -41.234  -89.453  1.00 59.20  ? 143 ARG C NH2   1 
ATOM 3801  N N     . LYS C 1 147 ? 36.667  -34.305  -94.020  1.00 41.88  ? 144 LYS C N     1 
ATOM 3802  C CA    . LYS C 1 147 ? 35.484  -33.527  -94.372  1.00 42.65  ? 144 LYS C CA    1 
ATOM 3803  C C     . LYS C 1 147 ? 35.250  -33.529  -95.879  1.00 49.48  ? 144 LYS C C     1 
ATOM 3804  O O     . LYS C 1 147 ? 34.109  -33.693  -96.340  1.00 51.70  ? 144 LYS C O     1 
ATOM 3805  C CB    . LYS C 1 147 ? 35.628  -32.098  -93.842  1.00 41.31  ? 144 LYS C CB    1 
ATOM 3806  C CG    . LYS C 1 147 ? 35.528  -31.986  -92.325  1.00 40.95  ? 144 LYS C CG    1 
ATOM 3807  C CD    . LYS C 1 147 ? 35.775  -30.559  -91.848  1.00 48.93  ? 144 LYS C CD    1 
ATOM 3808  C CE    . LYS C 1 147 ? 35.649  -30.457  -90.336  1.00 40.35  ? 144 LYS C CE    1 
ATOM 3809  N NZ    . LYS C 1 147 ? 35.765  -29.052  -89.847  1.00 56.18  ? 144 LYS C NZ    1 
ATOM 3810  N N     . GLU C 1 148 ? 36.319  -33.338  -96.665  1.00 48.45  ? 145 GLU C N     1 
ATOM 3811  C CA    . GLU C 1 148 ? 36.188  -33.361  -98.117  1.00 46.68  ? 145 GLU C CA    1 
ATOM 3812  C C     . GLU C 1 148 ? 35.684  -34.714  -98.605  1.00 48.61  ? 145 GLU C C     1 
ATOM 3813  O O     . GLU C 1 148 ? 34.824  -34.777  -99.490  1.00 51.48  ? 145 GLU C O     1 
ATOM 3814  C CB    . GLU C 1 148 ? 37.532  -33.025  -98.764  1.00 58.38  ? 145 GLU C CB    1 
ATOM 3815  C CG    . GLU C 1 148 ? 37.753  -31.538  -99.006  1.00 71.64  ? 145 GLU C CG    1 
ATOM 3816  C CD    . GLU C 1 148 ? 39.122  -31.235  -99.585  1.00 85.64  ? 145 GLU C CD    1 
ATOM 3817  O OE1   . GLU C 1 148 ? 39.672  -32.090  -100.315 1.00 78.05  ? 145 GLU C OE1   1 
ATOM 3818  O OE2   . GLU C 1 148 ? 39.643  -30.132  -99.312  1.00 79.55  ? 145 GLU C OE2   1 
ATOM 3819  N N     . ALA C 1 149 ? 36.215  -35.805  -98.047  1.00 45.34  ? 146 ALA C N     1 
ATOM 3820  C CA    . ALA C 1 149 ? 35.764  -37.141  -98.430  1.00 49.18  ? 146 ALA C CA    1 
ATOM 3821  C C     . ALA C 1 149 ? 34.271  -37.309  -98.187  1.00 46.79  ? 146 ALA C C     1 
ATOM 3822  O O     . ALA C 1 149 ? 33.544  -37.821  -99.048  1.00 49.92  ? 146 ALA C O     1 
ATOM 3823  C CB    . ALA C 1 149 ? 36.555  -38.200  -97.660  1.00 51.63  ? 146 ALA C CB    1 
ATOM 3824  N N     . VAL C 1 150 ? 33.795  -36.881  -97.018  1.00 44.20  ? 147 VAL C N     1 
ATOM 3825  C CA    . VAL C 1 150 ? 32.383  -37.063  -96.688  1.00 44.21  ? 147 VAL C CA    1 
ATOM 3826  C C     . VAL C 1 150 ? 31.497  -36.229  -97.610  1.00 49.14  ? 147 VAL C C     1 
ATOM 3827  O O     . VAL C 1 150 ? 30.486  -36.717  -98.136  1.00 48.23  ? 147 VAL C O     1 
ATOM 3828  C CB    . VAL C 1 150 ? 32.139  -36.745  -95.204  1.00 53.93  ? 147 VAL C CB    1 
ATOM 3829  C CG1   . VAL C 1 150 ? 30.659  -36.521  -94.937  1.00 38.40  ? 147 VAL C CG1   1 
ATOM 3830  C CG2   . VAL C 1 150 ? 32.655  -37.893  -94.363  1.00 54.46  ? 147 VAL C CG2   1 
ATOM 3831  N N     . THR C 1 151 ? 31.858  -34.959  -97.821  1.00 49.15  ? 148 THR C N     1 
ATOM 3832  C CA    . THR C 1 151 ? 31.046  -34.105  -98.687  1.00 46.51  ? 148 THR C CA    1 
ATOM 3833  C C     . THR C 1 151 ? 31.021  -34.634  -100.120 1.00 54.08  ? 148 THR C C     1 
ATOM 3834  O O     . THR C 1 151 ? 29.964  -34.659  -100.769 1.00 51.63  ? 148 THR C O     1 
ATOM 3835  C CB    . THR C 1 151 ? 31.569  -32.669  -98.644  1.00 47.84  ? 148 THR C CB    1 
ATOM 3836  O OG1   . THR C 1 151 ? 31.388  -32.138  -97.324  1.00 53.17  ? 148 THR C OG1   1 
ATOM 3837  C CG2   . THR C 1 151 ? 30.828  -31.792  -99.640  1.00 41.51  ? 148 THR C CG2   1 
ATOM 3838  N N     . ASP C 1 152 ? 32.183  -35.048  -100.635 1.00 41.82  ? 149 ASP C N     1 
ATOM 3839  C CA    . ASP C 1 152 ? 32.257  -35.631  -101.969 1.00 42.14  ? 149 ASP C CA    1 
ATOM 3840  C C     . ASP C 1 152 ? 31.399  -36.886  -102.080 1.00 53.14  ? 149 ASP C C     1 
ATOM 3841  O O     . ASP C 1 152 ? 30.712  -37.090  -103.089 1.00 58.41  ? 149 ASP C O     1 
ATOM 3842  C CB    . ASP C 1 152 ? 33.711  -35.943  -102.313 1.00 45.48  ? 149 ASP C CB    1 
ATOM 3843  C CG    . ASP C 1 152 ? 33.901  -36.291  -103.768 1.00 56.65  ? 149 ASP C CG    1 
ATOM 3844  O OD1   . ASP C 1 152 ? 33.500  -35.482  -104.630 1.00 69.64  ? 149 ASP C OD1   1 
ATOM 3845  O OD2   . ASP C 1 152 ? 34.444  -37.377  -104.048 1.00 60.06  ? 149 ASP C OD2   1 
ATOM 3846  N N     . GLY C 1 153 ? 31.451  -37.755  -101.066 1.00 52.82  ? 150 GLY C N     1 
ATOM 3847  C CA    . GLY C 1 153 ? 30.620  -38.948  -101.088 1.00 41.50  ? 150 GLY C CA    1 
ATOM 3848  C C     . GLY C 1 153 ? 29.142  -38.621  -101.099 1.00 46.00  ? 150 GLY C C     1 
ATOM 3849  O O     . GLY C 1 153 ? 28.357  -39.273  -101.792 1.00 49.77  ? 150 GLY C O     1 
ATOM 3850  N N     . LEU C 1 154 ? 28.746  -37.587  -100.353 1.00 51.52  ? 151 LEU C N     1 
ATOM 3851  C CA    . LEU C 1 154 ? 27.343  -37.183  -100.357 1.00 50.64  ? 151 LEU C CA    1 
ATOM 3852  C C     . LEU C 1 154 ? 26.925  -36.679  -101.734 1.00 55.75  ? 151 LEU C C     1 
ATOM 3853  O O     . LEU C 1 154 ? 25.851  -37.042  -102.237 1.00 49.54  ? 151 LEU C O     1 
ATOM 3854  C CB    . LEU C 1 154 ? 27.102  -36.109  -99.296  1.00 48.84  ? 151 LEU C CB    1 
ATOM 3855  C CG    . LEU C 1 154 ? 25.699  -35.500  -99.227  1.00 40.37  ? 151 LEU C CG    1 
ATOM 3856  C CD1   . LEU C 1 154 ? 24.645  -36.585  -99.081  1.00 41.04  ? 151 LEU C CD1   1 
ATOM 3857  C CD2   . LEU C 1 154 ? 25.606  -34.504  -98.086  1.00 44.43  ? 151 LEU C CD2   1 
ATOM 3858  N N     . LYS C 1 155 ? 27.767  -35.854  -102.364 1.00 53.28  ? 152 LYS C N     1 
ATOM 3859  C CA    . LYS C 1 155 ? 27.443  -35.369  -103.704 1.00 53.12  ? 152 LYS C CA    1 
ATOM 3860  C C     . LYS C 1 155 ? 27.339  -36.517  -104.703 1.00 63.32  ? 152 LYS C C     1 
ATOM 3861  O O     . LYS C 1 155 ? 26.415  -36.554  -105.526 1.00 73.03  ? 152 LYS C O     1 
ATOM 3862  C CB    . LYS C 1 155 ? 28.476  -34.351  -104.186 1.00 53.31  ? 152 LYS C CB    1 
ATOM 3863  C CG    . LYS C 1 155 ? 28.479  -33.018  -103.452 1.00 50.80  ? 152 LYS C CG    1 
ATOM 3864  C CD    . LYS C 1 155 ? 29.280  -31.999  -104.251 1.00 53.51  ? 152 LYS C CD    1 
ATOM 3865  C CE    . LYS C 1 155 ? 30.734  -32.418  -104.403 1.00 75.97  ? 152 LYS C CE    1 
ATOM 3866  N NZ    . LYS C 1 155 ? 31.543  -31.412  -105.154 1.00 80.97  ? 152 LYS C NZ    1 
ATOM 3867  N N     . ARG C 1 156 ? 28.280  -37.464  -104.650 1.00 55.22  ? 153 ARG C N     1 
ATOM 3868  C CA    . ARG C 1 156 ? 28.269  -38.554  -105.622 1.00 53.33  ? 153 ARG C CA    1 
ATOM 3869  C C     . ARG C 1 156 ? 27.117  -39.518  -105.377 1.00 55.53  ? 153 ARG C C     1 
ATOM 3870  O O     . ARG C 1 156 ? 26.624  -40.143  -106.322 1.00 54.76  ? 153 ARG C O     1 
ATOM 3871  C CB    . ARG C 1 156 ? 29.605  -39.295  -105.608 1.00 43.65  ? 153 ARG C CB    1 
ATOM 3872  C CG    . ARG C 1 156 ? 30.748  -38.455  -106.143 1.00 60.66  ? 153 ARG C CG    1 
ATOM 3873  C CD    . ARG C 1 156 ? 32.091  -39.116  -105.923 1.00 63.19  ? 153 ARG C CD    1 
ATOM 3874  N NE    . ARG C 1 156 ? 32.119  -40.475  -106.452 1.00 59.08  ? 153 ARG C NE    1 
ATOM 3875  C CZ    . ARG C 1 156 ? 32.393  -40.772  -107.717 1.00 66.79  ? 153 ARG C CZ    1 
ATOM 3876  N NH1   . ARG C 1 156 ? 32.661  -39.799  -108.579 1.00 77.76  ? 153 ARG C NH1   1 
ATOM 3877  N NH2   . ARG C 1 156 ? 32.399  -42.036  -108.121 1.00 66.30  ? 153 ARG C NH2   1 
ATOM 3878  N N     . ALA C 1 157 ? 26.678  -39.657  -104.125 1.00 54.22  ? 154 ALA C N     1 
ATOM 3879  C CA    . ALA C 1 157 ? 25.504  -40.475  -103.854 1.00 57.25  ? 154 ALA C CA    1 
ATOM 3880  C C     . ALA C 1 157 ? 24.239  -39.792  -104.356 1.00 55.94  ? 154 ALA C C     1 
ATOM 3881  O O     . ALA C 1 157 ? 23.349  -40.450  -104.908 1.00 51.05  ? 154 ALA C O     1 
ATOM 3882  C CB    . ALA C 1 157 ? 25.403  -40.772  -102.359 1.00 49.31  ? 154 ALA C CB    1 
ATOM 3883  N N     . LEU C 1 158 ? 24.145  -38.470  -104.180 1.00 60.41  ? 155 LEU C N     1 
ATOM 3884  C CA    . LEU C 1 158 ? 22.966  -37.745  -104.646 1.00 52.29  ? 155 LEU C CA    1 
ATOM 3885  C C     . LEU C 1 158 ? 22.914  -37.656  -106.167 1.00 55.90  ? 155 LEU C C     1 
ATOM 3886  O O     . LEU C 1 158 ? 21.827  -37.497  -106.733 1.00 56.71  ? 155 LEU C O     1 
ATOM 3887  C CB    . LEU C 1 158 ? 22.919  -36.351  -104.024 1.00 52.12  ? 155 LEU C CB    1 
ATOM 3888  C CG    . LEU C 1 158 ? 22.362  -36.317  -102.601 1.00 48.18  ? 155 LEU C CG    1 
ATOM 3889  C CD1   . LEU C 1 158 ? 22.470  -34.929  -102.003 1.00 36.01  ? 155 LEU C CD1   1 
ATOM 3890  C CD2   . LEU C 1 158 ? 20.919  -36.793  -102.598 1.00 44.50  ? 155 LEU C CD2   1 
ATOM 3891  N N     . ARG C 1 159 ? 24.071  -37.722  -106.838 1.00 69.54  ? 156 ARG C N     1 
ATOM 3892  C CA    . ARG C 1 159 ? 24.098  -37.703  -108.303 1.00 60.59  ? 156 ARG C CA    1 
ATOM 3893  C C     . ARG C 1 159 ? 23.131  -38.714  -108.912 1.00 58.61  ? 156 ARG C C     1 
ATOM 3894  O O     . ARG C 1 159 ? 22.504  -38.446  -109.943 1.00 69.82  ? 156 ARG C O     1 
ATOM 3895  C CB    . ARG C 1 159 ? 25.510  -38.003  -108.812 1.00 61.93  ? 156 ARG C CB    1 
ATOM 3896  C CG    . ARG C 1 159 ? 26.455  -36.818  -108.952 1.00 74.62  ? 156 ARG C CG    1 
ATOM 3897  C CD    . ARG C 1 159 ? 27.724  -37.273  -109.671 1.00 82.41  ? 156 ARG C CD    1 
ATOM 3898  N NE    . ARG C 1 159 ? 28.878  -36.416  -109.419 1.00 95.91  ? 156 ARG C NE    1 
ATOM 3899  C CZ    . ARG C 1 159 ? 30.126  -36.735  -109.753 1.00 96.75  ? 156 ARG C CZ    1 
ATOM 3900  N NH1   . ARG C 1 159 ? 30.376  -37.894  -110.351 1.00 92.30  ? 156 ARG C NH1   1 
ATOM 3901  N NH2   . ARG C 1 159 ? 31.123  -35.900  -109.489 1.00 92.97  ? 156 ARG C NH2   1 
ATOM 3902  N N     . SER C 1 160 ? 22.988  -39.881  -108.282 1.00 63.50  ? 157 SER C N     1 
ATOM 3903  C CA    . SER C 1 160 ? 22.258  -40.991  -108.885 1.00 61.18  ? 157 SER C CA    1 
ATOM 3904  C C     . SER C 1 160 ? 20.755  -40.760  -108.960 1.00 61.02  ? 157 SER C C     1 
ATOM 3905  O O     . SER C 1 160 ? 20.049  -41.605  -109.522 1.00 62.50  ? 157 SER C O     1 
ATOM 3906  C CB    . SER C 1 160 ? 22.544  -42.279  -108.110 1.00 56.99  ? 157 SER C CB    1 
ATOM 3907  O OG    . SER C 1 160 ? 23.931  -42.548  -108.055 1.00 67.50  ? 157 SER C OG    1 
ATOM 3908  N N     . PHE C 1 161 ? 20.245  -39.651  -108.430 1.00 54.97  ? 158 PHE C N     1 
ATOM 3909  C CA    . PHE C 1 161 ? 18.812  -39.401  -108.462 1.00 69.46  ? 158 PHE C CA    1 
ATOM 3910  C C     . PHE C 1 161 ? 18.351  -38.685  -109.724 1.00 75.64  ? 158 PHE C C     1 
ATOM 3911  O O     . PHE C 1 161 ? 17.152  -38.714  -110.028 1.00 79.14  ? 158 PHE C O     1 
ATOM 3912  C CB    . PHE C 1 161 ? 18.398  -38.601  -107.224 1.00 53.61  ? 158 PHE C CB    1 
ATOM 3913  C CG    . PHE C 1 161 ? 18.358  -39.423  -105.971 1.00 53.98  ? 158 PHE C CG    1 
ATOM 3914  C CD1   . PHE C 1 161 ? 17.440  -40.451  -105.841 1.00 60.11  ? 158 PHE C CD1   1 
ATOM 3915  C CD2   . PHE C 1 161 ? 19.244  -39.186  -104.931 1.00 62.16  ? 158 PHE C CD2   1 
ATOM 3916  C CE1   . PHE C 1 161 ? 17.396  -41.222  -104.698 1.00 52.76  ? 158 PHE C CE1   1 
ATOM 3917  C CE2   . PHE C 1 161 ? 19.204  -39.957  -103.782 1.00 62.55  ? 158 PHE C CE2   1 
ATOM 3918  C CZ    . PHE C 1 161 ? 18.277  -40.975  -103.667 1.00 46.42  ? 158 PHE C CZ    1 
ATOM 3919  N N     . GLY C 1 162 ? 19.256  -38.073  -110.469 1.00 71.66  ? 159 GLY C N     1 
ATOM 3920  C CA    . GLY C 1 162 ? 18.901  -37.445  -111.727 1.00 76.15  ? 159 GLY C CA    1 
ATOM 3921  C C     . GLY C 1 162 ? 19.796  -36.255  -112.009 1.00 66.90  ? 159 GLY C C     1 
ATOM 3922  O O     . GLY C 1 162 ? 20.676  -35.907  -111.227 1.00 65.71  ? 159 GLY C O     1 
ATOM 3923  N N     . ASN C 1 163 ? 19.543  -35.634  -113.166 1.00 69.04  ? 160 ASN C N     1 
ATOM 3924  C CA    . ASN C 1 163 ? 20.354  -34.499  -113.596 1.00 66.18  ? 160 ASN C CA    1 
ATOM 3925  C C     . ASN C 1 163 ? 20.244  -33.333  -112.622 1.00 61.18  ? 160 ASN C C     1 
ATOM 3926  O O     . ASN C 1 163 ? 21.238  -32.653  -112.347 1.00 64.06  ? 160 ASN C O     1 
ATOM 3927  C CB    . ASN C 1 163 ? 19.948  -34.065  -115.003 1.00 70.40  ? 160 ASN C CB    1 
ATOM 3928  C CG    . ASN C 1 163 ? 20.047  -35.192  -116.008 1.00 69.66  ? 160 ASN C CG    1 
ATOM 3929  O OD1   . ASN C 1 163 ? 21.137  -35.537  -116.467 1.00 67.79  ? 160 ASN C OD1   1 
ATOM 3930  N ND2   . ASN C 1 163 ? 18.906  -35.776  -116.356 1.00 78.75  ? 160 ASN C ND2   1 
ATOM 3931  N N     . ALA C 1 164 ? 19.044  -33.091  -112.087 1.00 54.93  ? 161 ALA C N     1 
ATOM 3932  C CA    . ALA C 1 164 ? 18.826  -31.921  -111.241 1.00 60.43  ? 161 ALA C CA    1 
ATOM 3933  C C     . ALA C 1 164 ? 19.704  -31.946  -109.996 1.00 60.95  ? 161 ALA C C     1 
ATOM 3934  O O     . ALA C 1 164 ? 20.008  -30.888  -109.433 1.00 69.81  ? 161 ALA C O     1 
ATOM 3935  C CB    . ALA C 1 164 ? 17.352  -31.827  -110.849 1.00 54.80  ? 161 ALA C CB    1 
ATOM 3936  N N     . LEU C 1 165 ? 20.115  -33.132  -109.548 1.00 55.89  ? 162 LEU C N     1 
ATOM 3937  C CA    . LEU C 1 165 ? 20.968  -33.265  -108.374 1.00 54.05  ? 162 LEU C CA    1 
ATOM 3938  C C     . LEU C 1 165 ? 22.434  -33.487  -108.722 1.00 56.95  ? 162 LEU C C     1 
ATOM 3939  O O     . LEU C 1 165 ? 23.240  -33.749  -107.822 1.00 62.92  ? 162 LEU C O     1 
ATOM 3940  C CB    . LEU C 1 165 ? 20.470  -34.402  -107.485 1.00 50.87  ? 162 LEU C CB    1 
ATOM 3941  C CG    . LEU C 1 165 ? 19.280  -34.038  -106.604 1.00 56.68  ? 162 LEU C CG    1 
ATOM 3942  C CD1   . LEU C 1 165 ? 18.793  -35.253  -105.836 1.00 56.05  ? 162 LEU C CD1   1 
ATOM 3943  C CD2   . LEU C 1 165 ? 19.644  -32.902  -105.658 1.00 52.93  ? 162 LEU C CD2   1 
ATOM 3944  N N     . GLY C 1 166 ? 22.800  -33.395  -109.997 1.00 62.64  ? 163 GLY C N     1 
ATOM 3945  C CA    . GLY C 1 166 ? 24.200  -33.358  -110.365 1.00 67.87  ? 163 GLY C CA    1 
ATOM 3946  C C     . GLY C 1 166 ? 24.631  -34.368  -111.408 1.00 69.19  ? 163 GLY C C     1 
ATOM 3947  O O     . GLY C 1 166 ? 25.824  -34.465  -111.708 1.00 72.62  ? 163 GLY C O     1 
ATOM 3948  N N     . ASN C 1 167 ? 23.693  -35.138  -111.960 1.00 61.59  ? 164 ASN C N     1 
ATOM 3949  C CA    . ASN C 1 167 ? 24.084  -36.139  -112.947 1.00 63.35  ? 164 ASN C CA    1 
ATOM 3950  C C     . ASN C 1 167 ? 24.525  -35.489  -114.255 1.00 75.15  ? 164 ASN C C     1 
ATOM 3951  O O     . ASN C 1 167 ? 25.420  -36.008  -114.933 1.00 75.63  ? 164 ASN C O     1 
ATOM 3952  C CB    . ASN C 1 167 ? 22.927  -37.098  -113.218 1.00 60.13  ? 164 ASN C CB    1 
ATOM 3953  C CG    . ASN C 1 167 ? 23.381  -38.401  -113.844 1.00 66.97  ? 164 ASN C CG    1 
ATOM 3954  O OD1   . ASN C 1 167 ? 24.510  -38.845  -113.634 1.00 74.12  ? 164 ASN C OD1   1 
ATOM 3955  N ND2   . ASN C 1 167 ? 22.520  -38.989  -114.670 1.00 67.50  ? 164 ASN C ND2   1 
ATOM 3956  N N     . CYS C 1 168 ? 23.909  -34.361  -114.622 1.00 75.59  ? 165 CYS C N     1 
ATOM 3957  C CA    . CYS C 1 168 ? 24.194  -33.721  -115.904 1.00 71.15  ? 165 CYS C CA    1 
ATOM 3958  C C     . CYS C 1 168 ? 25.620  -33.187  -115.989 1.00 76.65  ? 165 CYS C C     1 
ATOM 3959  O O     . CYS C 1 168 ? 26.150  -33.030  -117.095 1.00 75.65  ? 165 CYS C O     1 
ATOM 3960  C CB    . CYS C 1 168 ? 23.190  -32.597  -116.159 1.00 61.19  ? 165 CYS C CB    1 
ATOM 3961  S SG    . CYS C 1 168 ? 23.131  -31.334  -114.866 1.00 69.41  ? 165 CYS C SG    1 
ATOM 3962  N N     . ILE C 1 169 ? 26.249  -32.887  -114.847 1.00 75.60  ? 166 ILE C N     1 
ATOM 3963  C CA    . ILE C 1 169 ? 27.606  -32.345  -114.841 1.00 70.19  ? 166 ILE C CA    1 
ATOM 3964  C C     . ILE C 1 169 ? 28.604  -33.277  -115.519 1.00 67.31  ? 166 ILE C C     1 
ATOM 3965  O O     . ILE C 1 169 ? 29.687  -32.838  -115.921 1.00 69.75  ? 166 ILE C O     1 
ATOM 3966  C CB    . ILE C 1 169 ? 28.049  -32.022  -113.396 1.00 68.50  ? 166 ILE C CB    1 
ATOM 3967  C CG1   . ILE C 1 169 ? 29.165  -30.979  -113.405 1.00 75.84  ? 166 ILE C CG1   1 
ATOM 3968  C CG2   . ILE C 1 169 ? 28.535  -33.269  -112.686 1.00 83.43  ? 166 ILE C CG2   1 
ATOM 3969  C CD1   . ILE C 1 169 ? 28.738  -29.648  -113.959 1.00 90.87  ? 166 ILE C CD1   1 
ATOM 3970  N N     . LEU C 1 170 ? 28.264  -34.556  -115.667 1.00 71.58  ? 167 LEU C N     1 
ATOM 3971  C CA    . LEU C 1 170 ? 29.162  -35.519  -116.286 1.00 75.04  ? 167 LEU C CA    1 
ATOM 3972  C C     . LEU C 1 170 ? 28.999  -35.591  -117.796 1.00 79.46  ? 167 LEU C C     1 
ATOM 3973  O O     . LEU C 1 170 ? 29.795  -36.264  -118.460 1.00 83.97  ? 167 LEU C O     1 
ATOM 3974  C CB    . LEU C 1 170 ? 28.937  -36.908  -115.682 1.00 80.80  ? 167 LEU C CB    1 
ATOM 3975  C CG    . LEU C 1 170 ? 29.182  -36.980  -114.174 1.00 75.24  ? 167 LEU C CG    1 
ATOM 3976  C CD1   . LEU C 1 170 ? 28.668  -38.288  -113.584 1.00 72.90  ? 167 LEU C CD1   1 
ATOM 3977  C CD2   . LEU C 1 170 ? 30.658  -36.775  -113.863 1.00 69.64  ? 167 LEU C CD2   1 
ATOM 3978  N N     . ASP C 1 171 ? 27.989  -34.925  -118.346 1.00 80.98  ? 168 ASP C N     1 
ATOM 3979  C CA    . ASP C 1 171 ? 27.728  -34.941  -119.778 1.00 83.21  ? 168 ASP C CA    1 
ATOM 3980  C C     . ASP C 1 171 ? 28.571  -33.866  -120.452 1.00 81.62  ? 168 ASP C C     1 
ATOM 3981  O O     . ASP C 1 171 ? 28.378  -32.671  -120.199 1.00 83.05  ? 168 ASP C O     1 
ATOM 3982  C CB    . ASP C 1 171 ? 26.245  -34.716  -120.062 1.00 78.01  ? 168 ASP C CB    1 
ATOM 3983  C CG    . ASP C 1 171 ? 25.872  -35.047  -121.489 1.00 83.39  ? 168 ASP C CG    1 
ATOM 3984  O OD1   . ASP C 1 171 ? 26.767  -35.467  -122.253 1.00 88.36  ? 168 ASP C OD1   1 
ATOM 3985  O OD2   . ASP C 1 171 ? 24.690  -34.876  -121.852 1.00 80.13  ? 168 ASP C OD2   1 
ATOM 3986  N N     . LYS C 1 172 ? 29.494  -34.289  -121.318 1.00 77.13  ? 169 LYS C N     1 
ATOM 3987  C CA    . LYS C 1 172 ? 30.367  -33.333  -121.991 1.00 86.74  ? 169 LYS C CA    1 
ATOM 3988  C C     . LYS C 1 172 ? 29.582  -32.391  -122.896 1.00 81.27  ? 169 LYS C C     1 
ATOM 3989  O O     . LYS C 1 172 ? 29.997  -31.244  -123.107 1.00 76.43  ? 169 LYS C O     1 
ATOM 3990  C CB    . LYS C 1 172 ? 31.448  -34.077  -122.772 1.00 84.94  ? 169 LYS C CB    1 
ATOM 3991  C CG    . LYS C 1 172 ? 32.234  -35.044  -121.901 1.00 86.00  ? 169 LYS C CG    1 
ATOM 3992  C CD    . LYS C 1 172 ? 33.197  -35.900  -122.702 1.00 92.56  ? 169 LYS C CD    1 
ATOM 3993  C CE    . LYS C 1 172 ? 33.862  -36.941  -121.812 1.00 92.47  ? 169 LYS C CE    1 
ATOM 3994  N NZ    . LYS C 1 172 ? 34.756  -37.847  -122.583 1.00 100.47 ? 169 LYS C NZ    1 
ATOM 3995  N N     . ASP C 1 173 ? 28.442  -32.845  -123.423 1.00 72.92  ? 170 ASP C N     1 
ATOM 3996  C CA    . ASP C 1 173 ? 27.611  -31.969  -124.242 1.00 80.02  ? 170 ASP C CA    1 
ATOM 3997  C C     . ASP C 1 173 ? 27.030  -30.837  -123.405 1.00 82.41  ? 170 ASP C C     1 
ATOM 3998  O O     . ASP C 1 173 ? 26.976  -29.682  -123.851 1.00 89.59  ? 170 ASP C O     1 
ATOM 3999  C CB    . ASP C 1 173 ? 26.489  -32.776  -124.896 1.00 82.56  ? 170 ASP C CB    1 
ATOM 4000  C CG    . ASP C 1 173 ? 27.005  -33.969  -125.677 1.00 90.89  ? 170 ASP C CG    1 
ATOM 4001  O OD1   . ASP C 1 173 ? 28.081  -33.856  -126.301 1.00 93.92  ? 170 ASP C OD1   1 
ATOM 4002  O OD2   . ASP C 1 173 ? 26.330  -35.021  -125.667 1.00 85.31  ? 170 ASP C OD2   1 
ATOM 4003  N N     . TYR C 1 174 ? 26.598  -31.154  -122.184 1.00 74.51  ? 171 TYR C N     1 
ATOM 4004  C CA    . TYR C 1 174 ? 26.128  -30.129  -121.260 1.00 77.22  ? 171 TYR C CA    1 
ATOM 4005  C C     . TYR C 1 174 ? 27.239  -29.134  -120.929 1.00 82.52  ? 171 TYR C C     1 
ATOM 4006  O O     . TYR C 1 174 ? 26.993  -27.927  -120.822 1.00 76.42  ? 171 TYR C O     1 
ATOM 4007  C CB    . TYR C 1 174 ? 25.589  -30.812  -120.003 1.00 77.80  ? 171 TYR C CB    1 
ATOM 4008  C CG    . TYR C 1 174 ? 25.312  -29.910  -118.830 1.00 81.02  ? 171 TYR C CG    1 
ATOM 4009  C CD1   . TYR C 1 174 ? 24.108  -29.229  -118.727 1.00 78.36  ? 171 TYR C CD1   1 
ATOM 4010  C CD2   . TYR C 1 174 ? 26.242  -29.761  -117.811 1.00 75.63  ? 171 TYR C CD2   1 
ATOM 4011  C CE1   . TYR C 1 174 ? 23.840  -28.413  -117.651 1.00 77.57  ? 171 TYR C CE1   1 
ATOM 4012  C CE2   . TYR C 1 174 ? 25.984  -28.944  -116.730 1.00 76.35  ? 171 TYR C CE2   1 
ATOM 4013  C CZ    . TYR C 1 174 ? 24.782  -28.272  -116.656 1.00 79.90  ? 171 TYR C CZ    1 
ATOM 4014  O OH    . TYR C 1 174 ? 24.520  -27.456  -115.580 1.00 77.44  ? 171 TYR C OH    1 
ATOM 4015  N N     . LEU C 1 175 ? 28.479  -29.617  -120.815 1.00 84.11  ? 172 LEU C N     1 
ATOM 4016  C CA    . LEU C 1 175 ? 29.603  -28.727  -120.531 1.00 82.67  ? 172 LEU C CA    1 
ATOM 4017  C C     . LEU C 1 175 ? 29.885  -27.803  -121.710 1.00 86.81  ? 172 LEU C C     1 
ATOM 4018  O O     . LEU C 1 175 ? 30.183  -26.612  -121.523 1.00 91.17  ? 172 LEU C O     1 
ATOM 4019  C CB    . LEU C 1 175 ? 30.842  -29.547  -120.172 1.00 86.20  ? 172 LEU C CB    1 
ATOM 4020  C CG    . LEU C 1 175 ? 30.757  -30.285  -118.833 1.00 84.14  ? 172 LEU C CG    1 
ATOM 4021  C CD1   . LEU C 1 175 ? 32.057  -31.017  -118.530 1.00 81.04  ? 172 LEU C CD1   1 
ATOM 4022  C CD2   . LEU C 1 175 ? 30.391  -29.329  -117.704 1.00 81.34  ? 172 LEU C CD2   1 
ATOM 4023  N N     . ARG C 1 176 ? 29.818  -28.341  -122.931 1.00 86.55  ? 173 ARG C N     1 
ATOM 4024  C CA    . ARG C 1 176 ? 29.976  -27.501  -124.112 1.00 79.41  ? 173 ARG C CA    1 
ATOM 4025  C C     . ARG C 1 176 ? 28.899  -26.425  -124.145 1.00 77.20  ? 173 ARG C C     1 
ATOM 4026  O O     . ARG C 1 176 ? 29.185  -25.249  -124.392 1.00 84.70  ? 173 ARG C O     1 
ATOM 4027  C CB    . ARG C 1 176 ? 29.914  -28.347  -125.386 1.00 81.60  ? 173 ARG C CB    1 
ATOM 4028  C CG    . ARG C 1 176 ? 31.102  -29.268  -125.625 1.00 89.09  ? 173 ARG C CG    1 
ATOM 4029  C CD    . ARG C 1 176 ? 31.084  -29.842  -127.045 1.00 88.33  ? 173 ARG C CD    1 
ATOM 4030  N NE    . ARG C 1 176 ? 29.936  -30.712  -127.293 1.00 91.62  ? 173 ARG C NE    1 
ATOM 4031  C CZ    . ARG C 1 176 ? 28.812  -30.318  -127.887 1.00 102.51 ? 173 ARG C CZ    1 
ATOM 4032  N NH1   . ARG C 1 176 ? 28.681  -29.063  -128.301 1.00 102.01 ? 173 ARG C NH1   1 
ATOM 4033  N NH2   . ARG C 1 176 ? 27.818  -31.177  -128.070 1.00 101.32 ? 173 ARG C NH2   1 
ATOM 4034  N N     . SER C 1 177 ? 27.645  -26.814  -123.895 1.00 69.84  ? 174 SER C N     1 
ATOM 4035  C CA    . SER C 1 177 ? 26.563  -25.836  -123.839 1.00 78.41  ? 174 SER C CA    1 
ATOM 4036  C C     . SER C 1 177 ? 26.711  -24.860  -122.676 1.00 82.28  ? 174 SER C C     1 
ATOM 4037  O O     . SER C 1 177 ? 26.084  -23.796  -122.687 1.00 84.51  ? 174 SER C O     1 
ATOM 4038  C CB    . SER C 1 177 ? 25.216  -26.552  -123.738 1.00 78.36  ? 174 SER C CB    1 
ATOM 4039  O OG    . SER C 1 177 ? 24.961  -27.317  -124.905 1.00 93.09  ? 174 SER C OG    1 
ATOM 4040  N N     . LEU C 1 178 ? 27.512  -25.202  -121.665 1.00 88.12  ? 175 LEU C N     1 
ATOM 4041  C CA    . LEU C 1 178 ? 27.745  -24.270  -120.565 1.00 78.09  ? 175 LEU C CA    1 
ATOM 4042  C C     . LEU C 1 178 ? 28.827  -23.247  -120.893 1.00 89.23  ? 175 LEU C C     1 
ATOM 4043  O O     . LEU C 1 178 ? 28.722  -22.082  -120.492 1.00 91.98  ? 175 LEU C O     1 
ATOM 4044  C CB    . LEU C 1 178 ? 28.122  -25.037  -119.298 1.00 81.56  ? 175 LEU C CB    1 
ATOM 4045  C CG    . LEU C 1 178 ? 27.006  -25.199  -118.266 1.00 84.37  ? 175 LEU C CG    1 
ATOM 4046  C CD1   . LEU C 1 178 ? 27.576  -25.776  -116.987 1.00 74.08  ? 175 LEU C CD1   1 
ATOM 4047  C CD2   . LEU C 1 178 ? 26.343  -23.863  -118.010 1.00 85.75  ? 175 LEU C CD2   1 
ATOM 4048  N N     . ASN C 1 179 ? 29.876  -23.658  -121.611 1.00 90.91  ? 176 ASN C N     1 
ATOM 4049  C CA    . ASN C 1 179 ? 30.922  -22.698  -121.965 1.00 95.86  ? 176 ASN C CA    1 
ATOM 4050  C C     . ASN C 1 179 ? 30.436  -21.659  -122.970 1.00 94.32  ? 176 ASN C C     1 
ATOM 4051  O O     . ASN C 1 179 ? 30.871  -20.503  -122.921 1.00 92.01  ? 176 ASN C O     1 
ATOM 4052  C CB    . ASN C 1 179 ? 32.169  -23.412  -122.490 1.00 108.58 ? 176 ASN C CB    1 
ATOM 4053  C CG    . ASN C 1 179 ? 33.009  -24.011  -121.377 1.00 114.25 ? 176 ASN C CG    1 
ATOM 4054  O OD1   . ASN C 1 179 ? 33.545  -23.284  -120.537 1.00 115.25 ? 176 ASN C OD1   1 
ATOM 4055  N ND2   . ASN C 1 179 ? 33.139  -25.334  -121.369 1.00 110.52 ? 176 ASN C ND2   1 
ATOM 4056  N N     . LYS C 1 180 ? 29.542  -22.044  -123.884 1.00 92.43  ? 177 LYS C N     1 
ATOM 4057  C CA    . LYS C 1 180 ? 29.014  -21.110  -124.874 1.00 88.74  ? 177 LYS C CA    1 
ATOM 4058  C C     . LYS C 1 180 ? 28.179  -20.000  -124.247 1.00 92.58  ? 177 LYS C C     1 
ATOM 4059  O O     . LYS C 1 180 ? 27.805  -19.055  -124.950 1.00 96.14  ? 177 LYS C O     1 
ATOM 4060  C CB    . LYS C 1 180 ? 28.156  -21.864  -125.894 1.00 79.27  ? 177 LYS C CB    1 
ATOM 4061  C CG    . LYS C 1 180 ? 28.869  -22.986  -126.641 1.00 81.80  ? 177 LYS C CG    1 
ATOM 4062  C CD    . LYS C 1 180 ? 27.893  -23.752  -127.536 1.00 103.54 ? 177 LYS C CD    1 
ATOM 4063  C CE    . LYS C 1 180 ? 28.558  -24.950  -128.208 1.00 103.70 ? 177 LYS C CE    1 
ATOM 4064  N NZ    . LYS C 1 180 ? 27.605  -25.760  -129.023 1.00 96.32  ? 177 LYS C NZ    1 
ATOM 4065  N N     . LEU C 1 181 ? 27.868  -20.097  -122.963 1.00 92.29  ? 178 LEU C N     1 
ATOM 4066  C CA    . LEU C 1 181 ? 27.069  -19.152  -122.203 1.00 87.80  ? 178 LEU C CA    1 
ATOM 4067  C C     . LEU C 1 181 ? 27.924  -18.017  -121.644 1.00 93.97  ? 178 LEU C C     1 
ATOM 4068  O O     . LEU C 1 181 ? 29.109  -18.208  -121.344 1.00 75.12  ? 178 LEU C O     1 
ATOM 4069  C CB    . LEU C 1 181 ? 26.361  -19.870  -121.059 1.00 79.09  ? 178 LEU C CB    1 
ATOM 4070  C CG    . LEU C 1 181 ? 25.141  -20.683  -121.490 1.00 92.98  ? 178 LEU C CG    1 
ATOM 4071  C CD1   . LEU C 1 181 ? 24.564  -21.447  -120.316 1.00 90.36  ? 178 LEU C CD1   1 
ATOM 4072  C CD2   . LEU C 1 181 ? 24.090  -19.783  -122.107 1.00 85.04  ? 178 LEU C CD2   1 
ATOM 4073  N N     . PRO C 1 182 ? 27.332  -16.833  -121.510 1.00 109.44 ? 179 PRO C N     1 
ATOM 4074  C CA    . PRO C 1 182 ? 28.058  -15.698  -120.926 1.00 106.55 ? 179 PRO C CA    1 
ATOM 4075  C C     . PRO C 1 182 ? 28.408  -15.959  -119.469 1.00 106.85 ? 179 PRO C C     1 
ATOM 4076  O O     . PRO C 1 182 ? 27.563  -16.383  -118.676 1.00 109.01 ? 179 PRO C O     1 
ATOM 4077  C CB    . PRO C 1 182 ? 27.076  -14.530  -121.067 1.00 113.30 ? 179 PRO C CB    1 
ATOM 4078  C CG    . PRO C 1 182 ? 26.079  -14.965  -122.088 1.00 108.21 ? 179 PRO C CG    1 
ATOM 4079  C CD    . PRO C 1 182 ? 25.988  -16.453  -121.979 1.00 108.06 ? 179 PRO C CD    1 
ATOM 4080  N N     . ARG C 1 183 ? 29.673  -15.722  -119.124 1.00 110.78 ? 180 ARG C N     1 
ATOM 4081  C CA    . ARG C 1 183 ? 30.095  -15.870  -117.738 1.00 114.78 ? 180 ARG C CA    1 
ATOM 4082  C C     . ARG C 1 183 ? 29.327  -14.860  -116.897 1.00 123.14 ? 180 ARG C C     1 
ATOM 4083  O O     . ARG C 1 183 ? 29.601  -13.656  -116.943 1.00 124.35 ? 180 ARG C O     1 
ATOM 4084  C CB    . ARG C 1 183 ? 31.606  -15.678  -117.592 1.00 106.15 ? 180 ARG C CB    1 
ATOM 4085  C CG    . ARG C 1 183 ? 32.140  -16.090  -116.234 1.00 116.43 ? 180 ARG C CG    1 
ATOM 4086  C CD    . ARG C 1 183 ? 31.765  -17.520  -115.906 1.00 125.01 ? 180 ARG C CD    1 
ATOM 4087  N NE    . ARG C 1 183 ? 32.237  -17.912  -114.582 1.00 134.36 ? 180 ARG C NE    1 
ATOM 4088  C CZ    . ARG C 1 183 ? 31.784  -18.965  -113.907 1.00 139.53 ? 180 ARG C CZ    1 
ATOM 4089  N NH1   . ARG C 1 183 ? 30.840  -19.738  -114.430 1.00 125.75 ? 180 ARG C NH1   1 
ATOM 4090  N NH2   . ARG C 1 183 ? 32.270  -19.238  -112.702 1.00 141.14 ? 180 ARG C NH2   1 
ATOM 4091  N N     . GLN C 1 184 ? 28.354  -15.348  -116.133 1.00 123.95 ? 181 GLN C N     1 
ATOM 4092  C CA    . GLN C 1 184 ? 27.471  -14.477  -115.376 1.00 121.88 ? 181 GLN C CA    1 
ATOM 4093  C C     . GLN C 1 184 ? 28.147  -13.956  -114.116 1.00 128.48 ? 181 GLN C C     1 
ATOM 4094  O O     . GLN C 1 184 ? 28.993  -14.621  -113.512 1.00 130.19 ? 181 GLN C O     1 
ATOM 4095  C CB    . GLN C 1 184 ? 26.193  -15.225  -115.004 1.00 119.63 ? 181 GLN C CB    1 
ATOM 4096  C CG    . GLN C 1 184 ? 26.449  -16.522  -114.257 1.00 117.43 ? 181 GLN C CG    1 
ATOM 4097  C CD    . GLN C 1 184 ? 25.176  -17.131  -113.727 1.00 108.90 ? 181 GLN C CD    1 
ATOM 4098  O OE1   . GLN C 1 184 ? 25.199  -17.884  -112.754 1.00 101.69 ? 181 GLN C OE1   1 
ATOM 4099  N NE2   . GLN C 1 184 ? 24.047  -16.788  -114.347 1.00 111.64 ? 181 GLN C NE2   1 
ATOM 4100  N N     . LEU C 1 185 ? 27.775  -12.737  -113.736 1.00 129.68 ? 182 LEU C N     1 
ATOM 4101  C CA    . LEU C 1 185 ? 28.362  -12.150  -112.542 1.00 129.86 ? 182 LEU C CA    1 
ATOM 4102  C C     . LEU C 1 185 ? 27.699  -12.738  -111.296 1.00 127.41 ? 182 LEU C C     1 
ATOM 4103  O O     . LEU C 1 185 ? 26.510  -13.068  -111.326 1.00 125.09 ? 182 LEU C O     1 
ATOM 4104  C CB    . LEU C 1 185 ? 28.204  -10.627  -112.567 1.00 126.50 ? 182 LEU C CB    1 
ATOM 4105  C CG    . LEU C 1 185 ? 29.257  -9.795   -111.830 1.00 129.75 ? 182 LEU C CG    1 
ATOM 4106  C CD1   . LEU C 1 185 ? 30.642  -10.068  -112.405 1.00 113.16 ? 182 LEU C CD1   1 
ATOM 4107  C CD2   . LEU C 1 185 ? 28.932  -8.311   -111.911 1.00 135.97 ? 182 LEU C CD2   1 
ATOM 4108  N N     . PRO C 1 186 ? 28.458  -12.924  -110.208 1.00 126.71 ? 183 PRO C N     1 
ATOM 4109  C CA    . PRO C 1 186 ? 27.877  -13.446  -108.960 1.00 128.79 ? 183 PRO C CA    1 
ATOM 4110  C C     . PRO C 1 186 ? 26.630  -12.706  -108.496 1.00 122.93 ? 183 PRO C C     1 
ATOM 4111  O O     . PRO C 1 186 ? 26.671  -11.492  -108.270 1.00 118.64 ? 183 PRO C O     1 
ATOM 4112  C CB    . PRO C 1 186 ? 29.022  -13.281  -107.955 1.00 122.83 ? 183 PRO C CB    1 
ATOM 4113  C CG    . PRO C 1 186 ? 30.261  -13.375  -108.777 1.00 123.54 ? 183 PRO C CG    1 
ATOM 4114  C CD    . PRO C 1 186 ? 29.930  -12.893  -110.168 1.00 119.92 ? 183 PRO C CD    1 
ATOM 4115  N N     . LEU C 1 187 ? 25.517  -13.426  -108.363 1.00 124.57 ? 184 LEU C N     1 
ATOM 4116  C CA    . LEU C 1 187 ? 24.283  -12.831  -107.863 1.00 126.50 ? 184 LEU C CA    1 
ATOM 4117  C C     . LEU C 1 187 ? 24.467  -12.308  -106.438 1.00 127.60 ? 184 LEU C C     1 
ATOM 4118  O O     . LEU C 1 187 ? 25.287  -12.813  -105.665 1.00 126.28 ? 184 LEU C O     1 
ATOM 4119  C CB    . LEU C 1 187 ? 23.139  -13.848  -107.915 1.00 127.72 ? 184 LEU C CB    1 
ATOM 4120  C CG    . LEU C 1 187 ? 22.746  -14.441  -109.276 1.00 135.01 ? 184 LEU C CG    1 
ATOM 4121  C CD1   . LEU C 1 187 ? 22.811  -13.386  -110.379 1.00 114.93 ? 184 LEU C CD1   1 
ATOM 4122  C CD2   . LEU C 1 187 ? 23.579  -15.673  -109.643 1.00 127.26 ? 184 LEU C CD2   1 
ATOM 4123  N N     . GLU C 1 188 ? 23.700  -11.274  -106.098 1.00 127.08 ? 185 GLU C N     1 
ATOM 4124  C CA    . GLU C 1 188 ? 23.733  -10.663  -104.777 1.00 123.11 ? 185 GLU C CA    1 
ATOM 4125  C C     . GLU C 1 188 ? 22.569  -11.157  -103.921 1.00 116.62 ? 185 GLU C C     1 
ATOM 4126  O O     . GLU C 1 188 ? 21.477  -11.434  -104.424 1.00 107.09 ? 185 GLU C O     1 
ATOM 4127  C CB    . GLU C 1 188 ? 23.697  -9.137   -104.887 1.00 124.11 ? 185 GLU C CB    1 
ATOM 4128  C CG    . GLU C 1 188 ? 24.214  -8.411   -103.655 1.00 123.06 ? 185 GLU C CG    1 
ATOM 4129  C CD    . GLU C 1 188 ? 24.205  -6.904   -103.823 1.00 122.21 ? 185 GLU C CD    1 
ATOM 4130  O OE1   . GLU C 1 188 ? 23.176  -6.360   -104.278 1.00 117.32 ? 185 GLU C OE1   1 
ATOM 4131  O OE2   . GLU C 1 188 ? 25.230  -6.265   -103.507 1.00 128.95 ? 185 GLU C OE2   1 
ATOM 4132  N N     . VAL C 1 189 ? 22.813  -11.258  -102.616 1.00 111.32 ? 186 VAL C N     1 
ATOM 4133  C CA    . VAL C 1 189 ? 21.848  -11.806  -101.668 1.00 107.44 ? 186 VAL C CA    1 
ATOM 4134  C C     . VAL C 1 189 ? 21.228  -10.668  -100.867 1.00 103.79 ? 186 VAL C C     1 
ATOM 4135  O O     . VAL C 1 189 ? 21.939  -9.781   -100.379 1.00 100.13 ? 186 VAL C O     1 
ATOM 4136  C CB    . VAL C 1 189 ? 22.508  -12.839  -100.737 1.00 98.70  ? 186 VAL C CB    1 
ATOM 4137  C CG1   . VAL C 1 189 ? 21.485  -13.417  -99.771  1.00 88.59  ? 186 VAL C CG1   1 
ATOM 4138  C CG2   . VAL C 1 189 ? 23.169  -13.943  -101.548 1.00 91.81  ? 186 VAL C CG2   1 
ATOM 4139  N N     . ASP C 1 190 ? 19.902  -10.686  -100.738 1.00 100.00 ? 187 ASP C N     1 
ATOM 4140  C CA    . ASP C 1 190 ? 19.156  -9.645   -100.030 1.00 102.05 ? 187 ASP C CA    1 
ATOM 4141  C C     . ASP C 1 190 ? 18.878  -10.131  -98.610  1.00 106.28 ? 187 ASP C C     1 
ATOM 4142  O O     . ASP C 1 190 ? 17.952  -10.912  -98.380  1.00 106.85 ? 187 ASP C O     1 
ATOM 4143  C CB    . ASP C 1 190 ? 17.864  -9.309   -100.765 1.00 102.91 ? 187 ASP C CB    1 
ATOM 4144  C CG    . ASP C 1 190 ? 17.047  -8.260   -100.046 1.00 101.33 ? 187 ASP C CG    1 
ATOM 4145  O OD1   . ASP C 1 190 ? 17.579  -7.156   -99.811  1.00 101.97 ? 187 ASP C OD1   1 
ATOM 4146  O OD2   . ASP C 1 190 ? 15.879  -8.542   -99.709  1.00 96.55  ? 187 ASP C OD2   1 
ATOM 4147  N N     . LEU C 1 191 ? 19.687  -9.669   -97.656  1.00 104.51 ? 188 LEU C N     1 
ATOM 4148  C CA    . LEU C 1 191 ? 19.609  -10.081  -96.260  1.00 101.63 ? 188 LEU C CA    1 
ATOM 4149  C C     . LEU C 1 191 ? 18.621  -9.258   -95.435  1.00 105.57 ? 188 LEU C C     1 
ATOM 4150  O O     . LEU C 1 191 ? 18.741  -9.226   -94.205  1.00 107.46 ? 188 LEU C O     1 
ATOM 4151  C CB    . LEU C 1 191 ? 20.996  -10.012  -95.619  1.00 90.43  ? 188 LEU C CB    1 
ATOM 4152  C CG    . LEU C 1 191 ? 22.040  -10.960  -96.208  1.00 94.06  ? 188 LEU C CG    1 
ATOM 4153  C CD1   . LEU C 1 191 ? 23.335  -10.864  -95.432  1.00 90.21  ? 188 LEU C CD1   1 
ATOM 4154  C CD2   . LEU C 1 191 ? 21.519  -12.388  -96.202  1.00 93.88  ? 188 LEU C CD2   1 
ATOM 4155  N N     . THR C 1 192 ? 17.661  -8.583   -96.075  1.00 106.31 ? 189 THR C N     1 
ATOM 4156  C CA    . THR C 1 192 ? 16.736  -7.749   -95.312  1.00 112.91 ? 189 THR C CA    1 
ATOM 4157  C C     . THR C 1 192 ? 15.763  -8.587   -94.489  1.00 100.75 ? 189 THR C C     1 
ATOM 4158  O O     . THR C 1 192 ? 15.524  -8.285   -93.315  1.00 104.79 ? 189 THR C O     1 
ATOM 4159  C CB    . THR C 1 192 ? 15.974  -6.814   -96.252  1.00 110.14 ? 189 THR C CB    1 
ATOM 4160  O OG1   . THR C 1 192 ? 15.289  -7.583   -97.250  1.00 108.30 ? 189 THR C OG1   1 
ATOM 4161  C CG2   . THR C 1 192 ? 16.930  -5.844   -96.933  1.00 95.59  ? 189 THR C CG2   1 
ATOM 4162  N N     . LYS C 1 193 ? 15.194  -9.643   -95.074  1.00 89.01  ? 190 LYS C N     1 
ATOM 4163  C CA    . LYS C 1 193 ? 14.304  -10.546  -94.351  1.00 100.75 ? 190 LYS C CA    1 
ATOM 4164  C C     . LYS C 1 193 ? 15.026  -11.773  -93.804  1.00 104.74 ? 190 LYS C C     1 
ATOM 4165  O O     . LYS C 1 193 ? 14.414  -12.836  -93.653  1.00 88.20  ? 190 LYS C O     1 
ATOM 4166  C CB    . LYS C 1 193 ? 13.111  -10.959  -95.212  1.00 89.84  ? 190 LYS C CB    1 
ATOM 4167  C CG    . LYS C 1 193 ? 12.199  -9.800   -95.579  1.00 99.97  ? 190 LYS C CG    1 
ATOM 4168  C CD    . LYS C 1 193 ? 10.928  -10.280  -96.258  1.00 101.05 ? 190 LYS C CD    1 
ATOM 4169  C CE    . LYS C 1 193 ? 9.970   -9.123   -96.494  1.00 91.73  ? 190 LYS C CE    1 
ATOM 4170  N NZ    . LYS C 1 193 ? 8.785   -9.518   -97.303  1.00 87.75  ? 190 LYS C NZ    1 
ATOM 4171  N N     . ALA C 1 194 ? 16.314  -11.647  -93.502  1.00 100.75 ? 191 ALA C N     1 
ATOM 4172  C CA    . ALA C 1 194 ? 17.052  -12.757  -92.922  1.00 81.59  ? 191 ALA C CA    1 
ATOM 4173  C C     . ALA C 1 194 ? 16.571  -13.015  -91.500  1.00 87.00  ? 191 ALA C C     1 
ATOM 4174  O O     . ALA C 1 194 ? 16.099  -12.109  -90.806  1.00 96.31  ? 191 ALA C O     1 
ATOM 4175  C CB    . ALA C 1 194 ? 18.553  -12.469  -92.929  1.00 81.48  ? 191 ALA C CB    1 
ATOM 4176  N N     . LYS C 1 195 ? 16.670  -14.272  -91.076  1.00 91.55  ? 192 LYS C N     1 
ATOM 4177  C CA    . LYS C 1 195 ? 16.239  -14.640  -89.733  1.00 89.82  ? 192 LYS C CA    1 
ATOM 4178  C C     . LYS C 1 195 ? 17.128  -13.976  -88.689  1.00 86.38  ? 192 LYS C C     1 
ATOM 4179  O O     . LYS C 1 195 ? 18.356  -14.092  -88.731  1.00 84.13  ? 192 LYS C O     1 
ATOM 4180  C CB    . LYS C 1 195 ? 16.265  -16.159  -89.570  1.00 85.19  ? 192 LYS C CB    1 
ATOM 4181  C CG    . LYS C 1 195 ? 15.849  -16.653  -88.193  1.00 79.50  ? 192 LYS C CG    1 
ATOM 4182  C CD    . LYS C 1 195 ? 15.969  -18.165  -88.106  1.00 76.45  ? 192 LYS C CD    1 
ATOM 4183  C CE    . LYS C 1 195 ? 15.497  -18.691  -86.762  1.00 73.99  ? 192 LYS C CE    1 
ATOM 4184  N NZ    . LYS C 1 195 ? 14.082  -18.328  -86.480  1.00 73.86  ? 192 LYS C NZ    1 
ATOM 4185  N N     . ARG C 1 196 ? 16.494  -13.287  -87.741  1.00 84.89  ? 193 ARG C N     1 
ATOM 4186  C CA    . ARG C 1 196 ? 17.197  -12.475  -86.761  1.00 90.36  ? 193 ARG C CA    1 
ATOM 4187  C C     . ARG C 1 196 ? 16.987  -12.923  -85.326  1.00 90.04  ? 193 ARG C C     1 
ATOM 4188  O O     . ARG C 1 196 ? 17.743  -12.493  -84.448  1.00 96.27  ? 193 ARG C O     1 
ATOM 4189  C CB    . ARG C 1 196 ? 16.774  -11.001  -86.889  1.00 91.70  ? 193 ARG C CB    1 
ATOM 4190  C CG    . ARG C 1 196 ? 17.276  -10.340  -88.162  1.00 96.81  ? 193 ARG C CG    1 
ATOM 4191  C CD    . ARG C 1 196 ? 17.180  -8.821   -88.107  1.00 91.80  ? 193 ARG C CD    1 
ATOM 4192  N NE    . ARG C 1 196 ? 18.171  -8.191   -88.978  1.00 101.74 ? 193 ARG C NE    1 
ATOM 4193  C CZ    . ARG C 1 196 ? 18.029  -8.045   -90.291  1.00 104.12 ? 193 ARG C CZ    1 
ATOM 4194  N NH1   . ARG C 1 196 ? 16.934  -8.490   -90.892  1.00 97.84  ? 193 ARG C NH1   1 
ATOM 4195  N NH2   . ARG C 1 196 ? 18.982  -7.459   -91.006  1.00 99.24  ? 193 ARG C NH2   1 
ATOM 4196  N N     . GLN C 1 197 ? 15.987  -13.754  -85.059  1.00 84.60  ? 194 GLN C N     1 
ATOM 4197  C CA    . GLN C 1 197 ? 15.773  -14.318  -83.738  1.00 82.27  ? 194 GLN C CA    1 
ATOM 4198  C C     . GLN C 1 197 ? 15.386  -15.785  -83.865  1.00 81.38  ? 194 GLN C C     1 
ATOM 4199  O O     . GLN C 1 197 ? 14.900  -16.234  -84.906  1.00 84.55  ? 194 GLN C O     1 
ATOM 4200  C CB    . GLN C 1 197 ? 14.734  -13.482  -82.972  1.00 78.26  ? 194 GLN C CB    1 
ATOM 4201  C CG    . GLN C 1 197 ? 13.404  -13.288  -83.698  1.00 92.43  ? 194 GLN C CG    1 
ATOM 4202  C CD    . GLN C 1 197 ? 12.438  -14.437  -83.545  1.00 96.13  ? 194 GLN C CD    1 
ATOM 4203  O OE1   . GLN C 1 197 ? 12.025  -14.768  -82.436  1.00 80.97  ? 194 GLN C OE1   1 
ATOM 4204  N NE2   . GLN C 1 197 ? 12.047  -15.039  -84.669  1.00 102.62 ? 194 GLN C NE2   1 
ATOM 4205  N N     . ASP C 1 198 ? 15.602  -16.530  -82.776  1.00 74.36  ? 195 ASP C N     1 
ATOM 4206  C CA    . ASP C 1 198 ? 15.490  -17.985  -82.835  1.00 73.83  ? 195 ASP C CA    1 
ATOM 4207  C C     . ASP C 1 198 ? 14.052  -18.424  -83.094  1.00 79.23  ? 195 ASP C C     1 
ATOM 4208  O O     . ASP C 1 198 ? 13.801  -19.284  -83.946  1.00 83.35  ? 195 ASP C O     1 
ATOM 4209  C CB    . ASP C 1 198 ? 16.027  -18.606  -81.540  1.00 73.34  ? 195 ASP C CB    1 
ATOM 4210  C CG    . ASP C 1 198 ? 17.532  -18.425  -81.375  1.00 72.96  ? 195 ASP C CG    1 
ATOM 4211  O OD1   . ASP C 1 198 ? 18.233  -18.303  -82.400  1.00 73.77  ? 195 ASP C OD1   1 
ATOM 4212  O OD2   . ASP C 1 198 ? 18.014  -18.414  -80.222  1.00 70.94  ? 195 ASP C OD2   1 
ATOM 4213  N N     . LEU C 1 199 ? 13.101  -17.846  -82.362  1.00 77.05  ? 196 LEU C N     1 
ATOM 4214  C CA    . LEU C 1 199 ? 11.719  -18.315  -82.384  1.00 86.17  ? 196 LEU C CA    1 
ATOM 4215  C C     . LEU C 1 199 ? 11.129  -18.287  -83.793  1.00 85.06  ? 196 LEU C C     1 
ATOM 4216  O O     . LEU C 1 199 ? 11.374  -17.365  -84.577  1.00 85.39  ? 196 LEU C O     1 
ATOM 4217  C CB    . LEU C 1 199 ? 10.863  -17.469  -81.438  1.00 81.67  ? 196 LEU C CB    1 
ATOM 4218  C CG    . LEU C 1 199 ? 9.399   -17.878  -81.259  1.00 85.42  ? 196 LEU C CG    1 
ATOM 4219  C CD1   . LEU C 1 199 ? 9.307   -19.319  -80.781  1.00 81.02  ? 196 LEU C CD1   1 
ATOM 4220  C CD2   . LEU C 1 199 ? 8.684   -16.944  -80.299  1.00 82.75  ? 196 LEU C CD2   1 
ATOM 4221  N N     . GLU C 1 200 ? 10.335  -19.314  -84.103  1.00 79.26  ? 197 GLU C N     1 
ATOM 4222  C CA    . GLU C 1 200 ? 9.604   -19.438  -85.363  1.00 86.28  ? 197 GLU C CA    1 
ATOM 4223  C C     . GLU C 1 200 ? 8.139   -19.590  -84.975  1.00 85.84  ? 197 GLU C C     1 
ATOM 4224  O O     . GLU C 1 200 ? 7.659   -20.712  -84.745  1.00 77.21  ? 197 GLU C O     1 
ATOM 4225  C CB    . GLU C 1 200 ? 10.094  -20.624  -86.193  1.00 75.31  ? 197 GLU C CB    1 
ATOM 4226  C CG    . GLU C 1 200 ? 11.453  -20.414  -86.842  1.00 72.65  ? 197 GLU C CG    1 
ATOM 4227  C CD    . GLU C 1 200 ? 11.409  -19.433  -87.997  1.00 74.13  ? 197 GLU C CD    1 
ATOM 4228  O OE1   . GLU C 1 200 ? 10.332  -19.277  -88.611  1.00 80.43  ? 197 GLU C OE1   1 
ATOM 4229  O OE2   . GLU C 1 200 ? 12.453  -18.809  -88.285  1.00 75.13  ? 197 GLU C OE2   1 
ATOM 4230  N N     . PRO C 1 201 ? 7.398   -18.482  -84.864  1.00 83.70  ? 198 PRO C N     1 
ATOM 4231  C CA    . PRO C 1 201 ? 6.060   -18.555  -84.247  1.00 82.30  ? 198 PRO C CA    1 
ATOM 4232  C C     . PRO C 1 201 ? 5.070   -19.417  -85.011  1.00 74.43  ? 198 PRO C C     1 
ATOM 4233  O O     . PRO C 1 201 ? 4.345   -20.207  -84.391  1.00 78.14  ? 198 PRO C O     1 
ATOM 4234  C CB    . PRO C 1 201 ? 5.618   -17.083  -84.199  1.00 90.06  ? 198 PRO C CB    1 
ATOM 4235  C CG    . PRO C 1 201 ? 6.882   -16.281  -84.381  1.00 89.51  ? 198 PRO C CG    1 
ATOM 4236  C CD    . PRO C 1 201 ? 7.764   -17.110  -85.251  1.00 79.48  ? 198 PRO C CD    1 
ATOM 4237  N N     . SER C 1 202 ? 5.014   -19.293  -86.339  1.00 80.75  ? 199 SER C N     1 
ATOM 4238  C CA    . SER C 1 202 ? 4.125   -20.153  -87.115  1.00 83.89  ? 199 SER C CA    1 
ATOM 4239  C C     . SER C 1 202 ? 4.504   -21.617  -86.932  1.00 82.90  ? 199 SER C C     1 
ATOM 4240  O O     . SER C 1 202 ? 3.631   -22.489  -86.813  1.00 77.49  ? 199 SER C O     1 
ATOM 4241  C CB    . SER C 1 202 ? 4.164   -19.757  -88.590  1.00 67.34  ? 199 SER C CB    1 
ATOM 4242  O OG    . SER C 1 202 ? 3.384   -20.641  -89.373  1.00 67.41  ? 199 SER C OG    1 
ATOM 4243  N N     . VAL C 1 203 ? 5.807   -21.899  -86.892  1.00 83.29  ? 200 VAL C N     1 
ATOM 4244  C CA    . VAL C 1 203 ? 6.276   -23.264  -86.674  1.00 79.63  ? 200 VAL C CA    1 
ATOM 4245  C C     . VAL C 1 203 ? 5.867   -23.742  -85.285  1.00 79.41  ? 200 VAL C C     1 
ATOM 4246  O O     . VAL C 1 203 ? 5.403   -24.875  -85.110  1.00 65.87  ? 200 VAL C O     1 
ATOM 4247  C CB    . VAL C 1 203 ? 7.800   -23.347  -86.878  1.00 80.32  ? 200 VAL C CB    1 
ATOM 4248  C CG1   . VAL C 1 203 ? 8.295   -24.763  -86.640  1.00 69.09  ? 200 VAL C CG1   1 
ATOM 4249  C CG2   . VAL C 1 203 ? 8.189   -22.862  -88.272  1.00 84.32  ? 200 VAL C CG2   1 
ATOM 4250  N N     . GLU C 1 204 ? 6.065   -22.895  -84.271  1.00 81.72  ? 201 GLU C N     1 
ATOM 4251  C CA    . GLU C 1 204 ? 5.669   -23.262  -82.914  1.00 72.71  ? 201 GLU C CA    1 
ATOM 4252  C C     . GLU C 1 204 ? 4.180   -23.580  -82.830  1.00 76.21  ? 201 GLU C C     1 
ATOM 4253  O O     . GLU C 1 204 ? 3.784   -24.543  -82.162  1.00 72.66  ? 201 GLU C O     1 
ATOM 4254  C CB    . GLU C 1 204 ? 6.037   -22.147  -81.936  1.00 71.35  ? 201 GLU C CB    1 
ATOM 4255  C CG    . GLU C 1 204 ? 5.486   -22.359  -80.536  1.00 85.83  ? 201 GLU C CG    1 
ATOM 4256  C CD    . GLU C 1 204 ? 6.014   -23.627  -79.886  1.00 90.68  ? 201 GLU C CD    1 
ATOM 4257  O OE1   . GLU C 1 204 ? 7.205   -23.951  -80.080  1.00 87.30  ? 201 GLU C OE1   1 
ATOM 4258  O OE2   . GLU C 1 204 ? 5.233   -24.299  -79.178  1.00 85.86  ? 201 GLU C OE2   1 
ATOM 4259  N N     . GLU C 1 205 ? 3.341   -22.809  -83.529  1.00 77.43  ? 202 GLU C N     1 
ATOM 4260  C CA    . GLU C 1 205 ? 1.904   -23.074  -83.501  1.00 76.67  ? 202 GLU C CA    1 
ATOM 4261  C C     . GLU C 1 205 ? 1.581   -24.392  -84.189  1.00 79.94  ? 202 GLU C C     1 
ATOM 4262  O O     . GLU C 1 205 ? 0.824   -25.218  -83.656  1.00 70.94  ? 202 GLU C O     1 
ATOM 4263  C CB    . GLU C 1 205 ? 1.123   -21.937  -84.167  1.00 78.80  ? 202 GLU C CB    1 
ATOM 4264  C CG    . GLU C 1 205 ? -0.390  -22.203  -84.202  1.00 86.15  ? 202 GLU C CG    1 
ATOM 4265  C CD    . GLU C 1 205 ? -1.184  -21.130  -84.927  1.00 102.13 ? 202 GLU C CD    1 
ATOM 4266  O OE1   . GLU C 1 205 ? -0.795  -20.752  -86.052  1.00 104.20 ? 202 GLU C OE1   1 
ATOM 4267  O OE2   . GLU C 1 205 ? -2.207  -20.668  -84.375  1.00 104.18 ? 202 GLU C OE2   1 
ATOM 4268  N N     . ALA C 1 206 ? 2.114   -24.586  -85.398  1.00 80.43  ? 203 ALA C N     1 
ATOM 4269  C CA    . ALA C 1 206 ? 1.872   -25.828  -86.121  1.00 80.32  ? 203 ALA C CA    1 
ATOM 4270  C C     . ALA C 1 206 ? 2.322   -27.045  -85.321  1.00 78.38  ? 203 ALA C C     1 
ATOM 4271  O O     . ALA C 1 206 ? 1.691   -28.105  -85.404  1.00 74.14  ? 203 ALA C O     1 
ATOM 4272  C CB    . ALA C 1 206 ? 2.571   -25.783  -87.479  1.00 73.90  ? 203 ALA C CB    1 
ATOM 4273  N N     . ARG C 1 207 ? 3.398   -26.917  -84.537  1.00 74.74  ? 204 ARG C N     1 
ATOM 4274  C CA    . ARG C 1 207 ? 3.864   -28.050  -83.741  1.00 79.45  ? 204 ARG C CA    1 
ATOM 4275  C C     . ARG C 1 207 ? 2.997   -28.255  -82.504  1.00 76.30  ? 204 ARG C C     1 
ATOM 4276  O O     . ARG C 1 207 ? 2.722   -29.394  -82.117  1.00 73.74  ? 204 ARG C O     1 
ATOM 4277  C CB    . ARG C 1 207 ? 5.325   -27.856  -83.336  1.00 79.06  ? 204 ARG C CB    1 
ATOM 4278  C CG    . ARG C 1 207 ? 5.925   -29.039  -82.583  1.00 73.18  ? 204 ARG C CG    1 
ATOM 4279  C CD    . ARG C 1 207 ? 7.341   -28.721  -82.164  1.00 64.41  ? 204 ARG C CD    1 
ATOM 4280  N NE    . ARG C 1 207 ? 8.059   -27.998  -83.207  1.00 63.95  ? 204 ARG C NE    1 
ATOM 4281  C CZ    . ARG C 1 207 ? 8.881   -26.981  -82.972  1.00 68.16  ? 204 ARG C CZ    1 
ATOM 4282  N NH1   . ARG C 1 207 ? 9.084   -26.559  -81.731  1.00 66.72  ? 204 ARG C NH1   1 
ATOM 4283  N NH2   . ARG C 1 207 ? 9.487   -26.375  -83.979  1.00 76.67  ? 204 ARG C NH2   1 
ATOM 4284  N N     . TYR C 1 208 ? 2.586   -27.164  -81.850  1.00 77.04  ? 205 TYR C N     1 
ATOM 4285  C CA    . TYR C 1 208 ? 1.664   -27.270  -80.722  1.00 76.72  ? 205 TYR C CA    1 
ATOM 4286  C C     . TYR C 1 208 ? 0.376   -27.970  -81.127  1.00 75.38  ? 205 TYR C C     1 
ATOM 4287  O O     . TYR C 1 208 ? -0.158  -28.789  -80.370  1.00 62.00  ? 205 TYR C O     1 
ATOM 4288  C CB    . TYR C 1 208 ? 1.347   -25.875  -80.169  1.00 80.05  ? 205 TYR C CB    1 
ATOM 4289  C CG    . TYR C 1 208 ? 0.387   -25.853  -78.993  1.00 90.92  ? 205 TYR C CG    1 
ATOM 4290  C CD1   . TYR C 1 208 ? 0.306   -26.914  -78.097  1.00 93.12  ? 205 TYR C CD1   1 
ATOM 4291  C CD2   . TYR C 1 208 ? -0.501  -24.795  -78.830  1.00 101.46 ? 205 TYR C CD2   1 
ATOM 4292  C CE1   . TYR C 1 208 ? -0.597  -26.890  -77.042  1.00 92.11  ? 205 TYR C CE1   1 
ATOM 4293  C CE2   . TYR C 1 208 ? -1.410  -24.769  -77.781  1.00 103.95 ? 205 TYR C CE2   1 
ATOM 4294  C CZ    . TYR C 1 208 ? -1.451  -25.821  -76.893  1.00 96.84  ? 205 TYR C CZ    1 
ATOM 4295  O OH    . TYR C 1 208 ? -2.349  -25.794  -75.850  1.00 97.19  ? 205 TYR C OH    1 
ATOM 4296  N N     . ASN C 1 209 ? -0.129  -27.677  -82.325  1.00 79.71  ? 206 ASN C N     1 
ATOM 4297  C CA    . ASN C 1 209 ? -1.353  -28.334  -82.768  1.00 81.81  ? 206 ASN C CA    1 
ATOM 4298  C C     . ASN C 1 209 ? -1.142  -29.790  -83.174  1.00 78.39  ? 206 ASN C C     1 
ATOM 4299  O O     . ASN C 1 209 ? -2.130  -30.487  -83.431  1.00 72.88  ? 206 ASN C O     1 
ATOM 4300  C CB    . ASN C 1 209 ? -1.990  -27.557  -83.925  1.00 83.48  ? 206 ASN C CB    1 
ATOM 4301  C CG    . ASN C 1 209 ? -2.224  -26.093  -83.589  1.00 76.18  ? 206 ASN C CG    1 
ATOM 4302  O OD1   . ASN C 1 209 ? -1.878  -25.203  -84.362  1.00 84.24  ? 206 ASN C OD1   1 
ATOM 4303  N ND2   . ASN C 1 209 ? -2.815  -25.840  -82.428  1.00 75.68  ? 206 ASN C ND2   1 
ATOM 4304  N N     . SER C 1 210 ? 0.103   -30.267  -83.234  1.00 79.76  ? 207 SER C N     1 
ATOM 4305  C CA    . SER C 1 210 ? 0.390   -31.642  -83.626  1.00 79.76  ? 207 SER C CA    1 
ATOM 4306  C C     . SER C 1 210 ? 0.372   -32.638  -82.474  1.00 77.87  ? 207 SER C C     1 
ATOM 4307  O O     . SER C 1 210 ? 0.409   -33.847  -82.730  1.00 81.70  ? 207 SER C O     1 
ATOM 4308  C CB    . SER C 1 210 ? 1.757   -31.716  -84.313  1.00 79.13  ? 207 SER C CB    1 
ATOM 4309  O OG    . SER C 1 210 ? 1.988   -33.007  -84.855  1.00 96.88  ? 207 SER C OG    1 
ATOM 4310  N N     . CYS C 1 211 ? 0.317   -32.185  -81.225  1.00 81.31  ? 208 CYS C N     1 
ATOM 4311  C CA    . CYS C 1 211 ? 0.428   -33.118  -80.108  1.00 81.52  ? 208 CYS C CA    1 
ATOM 4312  C C     . CYS C 1 211 ? -0.937  -33.586  -79.613  1.00 88.75  ? 208 CYS C C     1 
ATOM 4313  O O     . CYS C 1 211 ? -1.975  -33.129  -80.090  1.00 94.72  ? 208 CYS C O     1 
ATOM 4314  C CB    . CYS C 1 211 ? 1.197   -32.471  -78.954  1.00 74.04  ? 208 CYS C CB    1 
ATOM 4315  S SG    . CYS C 1 211 ? 2.811   -31.777  -79.382  1.00 82.63  ? 208 CYS C SG    1 
ATOM 4316  N N     . CYS D 1 28  ? 6.168   -42.678  -80.565  1.00 91.12  ? 25  CYS D N     1 
ATOM 4317  C CA    . CYS D 1 28  ? 7.313   -42.123  -79.850  1.00 91.70  ? 25  CYS D CA    1 
ATOM 4318  C C     . CYS D 1 28  ? 8.256   -41.388  -80.802  1.00 90.63  ? 25  CYS D C     1 
ATOM 4319  O O     . CYS D 1 28  ? 7.832   -40.900  -81.850  1.00 90.81  ? 25  CYS D O     1 
ATOM 4320  C CB    . CYS D 1 28  ? 8.065   -43.227  -79.106  1.00 81.07  ? 25  CYS D CB    1 
ATOM 4321  S SG    . CYS D 1 28  ? 8.790   -44.500  -80.166  1.00 79.96  ? 25  CYS D SG    1 
ATOM 4322  N N     . PHE D 1 29  ? 9.533   -41.308  -80.432  1.00 75.79  ? 26  PHE D N     1 
ATOM 4323  C CA    . PHE D 1 29  ? 10.520  -40.635  -81.266  1.00 65.10  ? 26  PHE D CA    1 
ATOM 4324  C C     . PHE D 1 29  ? 10.941  -41.534  -82.420  1.00 70.78  ? 26  PHE D C     1 
ATOM 4325  O O     . PHE D 1 29  ? 11.106  -42.746  -82.257  1.00 77.26  ? 26  PHE D O     1 
ATOM 4326  C CB    . PHE D 1 29  ? 11.746  -40.238  -80.441  1.00 62.47  ? 26  PHE D CB    1 
ATOM 4327  C CG    . PHE D 1 29  ? 12.634  -39.236  -81.122  1.00 53.54  ? 26  PHE D CG    1 
ATOM 4328  C CD1   . PHE D 1 29  ? 12.373  -37.881  -81.023  1.00 55.76  ? 26  PHE D CD1   1 
ATOM 4329  C CD2   . PHE D 1 29  ? 13.727  -39.648  -81.865  1.00 57.14  ? 26  PHE D CD2   1 
ATOM 4330  C CE1   . PHE D 1 29  ? 13.185  -36.955  -81.653  1.00 63.08  ? 26  PHE D CE1   1 
ATOM 4331  C CE2   . PHE D 1 29  ? 14.542  -38.727  -82.498  1.00 54.18  ? 26  PHE D CE2   1 
ATOM 4332  C CZ    . PHE D 1 29  ? 14.269  -37.380  -82.392  1.00 52.94  ? 26  PHE D CZ    1 
ATOM 4333  N N     . GLY D 1 30  ? 11.110  -40.929  -83.597  1.00 72.12  ? 27  GLY D N     1 
ATOM 4334  C CA    . GLY D 1 30  ? 11.389  -41.668  -84.807  1.00 66.13  ? 27  GLY D CA    1 
ATOM 4335  C C     . GLY D 1 30  ? 10.185  -42.297  -85.473  1.00 68.36  ? 27  GLY D C     1 
ATOM 4336  O O     . GLY D 1 30  ? 10.314  -42.800  -86.597  1.00 72.99  ? 27  GLY D O     1 
ATOM 4337  N N     . GLN D 1 31  ? 9.017   -42.284  -84.827  1.00 78.90  ? 28  GLN D N     1 
ATOM 4338  C CA    . GLN D 1 31  ? 7.806   -42.872  -85.386  1.00 79.90  ? 28  GLN D CA    1 
ATOM 4339  C C     . GLN D 1 31  ? 6.766   -41.851  -85.823  1.00 75.96  ? 28  GLN D C     1 
ATOM 4340  O O     . GLN D 1 31  ? 6.017   -42.121  -86.764  1.00 87.31  ? 28  GLN D O     1 
ATOM 4341  C CB    . GLN D 1 31  ? 7.163   -43.820  -84.367  1.00 79.72  ? 28  GLN D CB    1 
ATOM 4342  C CG    . GLN D 1 31  ? 8.158   -44.696  -83.632  1.00 79.23  ? 28  GLN D CG    1 
ATOM 4343  C CD    . GLN D 1 31  ? 8.438   -45.995  -84.357  1.00 95.35  ? 28  GLN D CD    1 
ATOM 4344  O OE1   . GLN D 1 31  ? 8.395   -46.056  -85.587  1.00 98.17  ? 28  GLN D OE1   1 
ATOM 4345  N NE2   . GLN D 1 31  ? 8.722   -47.047  -83.596  1.00 94.36  ? 28  GLN D NE2   1 
ATOM 4346  N N     . CYS D 1 32  ? 6.678   -40.712  -85.138  1.00 69.46  ? 29  CYS D N     1 
ATOM 4347  C CA    . CYS D 1 32  ? 5.703   -39.684  -85.484  1.00 81.91  ? 29  CYS D CA    1 
ATOM 4348  C C     . CYS D 1 32  ? 5.952   -39.170  -86.897  1.00 80.19  ? 29  CYS D C     1 
ATOM 4349  O O     . CYS D 1 32  ? 7.088   -38.862  -87.262  1.00 70.29  ? 29  CYS D O     1 
ATOM 4350  C CB    . CYS D 1 32  ? 5.783   -38.535  -84.479  1.00 76.56  ? 29  CYS D CB    1 
ATOM 4351  S SG    . CYS D 1 32  ? 4.201   -37.762  -84.078  1.00 126.78 ? 29  CYS D SG    1 
ATOM 4352  N N     . GLN D 1 33  ? 4.888   -39.038  -87.683  1.00 76.59  ? 30  GLN D N     1 
ATOM 4353  C CA    . GLN D 1 33  ? 4.990   -38.471  -89.020  1.00 79.77  ? 30  GLN D CA    1 
ATOM 4354  C C     . GLN D 1 33  ? 4.552   -37.013  -89.007  1.00 86.04  ? 30  GLN D C     1 
ATOM 4355  O O     . GLN D 1 33  ? 3.557   -36.655  -88.370  1.00 89.67  ? 30  GLN D O     1 
ATOM 4356  C CB    . GLN D 1 33  ? 4.153   -39.261  -90.029  1.00 80.73  ? 30  GLN D CB    1 
ATOM 4357  C CG    . GLN D 1 33  ? 4.897   -40.428  -90.665  1.00 94.91  ? 30  GLN D CG    1 
ATOM 4358  C CD    . GLN D 1 33  ? 4.054   -41.173  -91.684  1.00 104.02 ? 30  GLN D CD    1 
ATOM 4359  O OE1   . GLN D 1 33  ? 3.517   -40.574  -92.618  1.00 101.76 ? 30  GLN D OE1   1 
ATOM 4360  N NE2   . GLN D 1 33  ? 3.942   -42.488  -91.515  1.00 93.65  ? 30  GLN D NE2   1 
ATOM 4361  N N     . TYR D 1 34  ? 5.309   -36.176  -89.713  1.00 79.42  ? 31  TYR D N     1 
ATOM 4362  C CA    . TYR D 1 34  ? 5.041   -34.745  -89.721  1.00 75.86  ? 31  TYR D CA    1 
ATOM 4363  C C     . TYR D 1 34  ? 3.686   -34.443  -90.340  1.00 86.67  ? 31  TYR D C     1 
ATOM 4364  O O     . TYR D 1 34  ? 3.346   -34.950  -91.414  1.00 96.67  ? 31  TYR D O     1 
ATOM 4365  C CB    . TYR D 1 34  ? 6.136   -34.003  -90.488  1.00 71.31  ? 31  TYR D CB    1 
ATOM 4366  C CG    . TYR D 1 34  ? 7.318   -33.605  -89.641  1.00 61.95  ? 31  TYR D CG    1 
ATOM 4367  C CD1   . TYR D 1 34  ? 7.191   -32.628  -88.664  1.00 63.92  ? 31  TYR D CD1   1 
ATOM 4368  C CD2   . TYR D 1 34  ? 8.559   -34.199  -89.818  1.00 68.03  ? 31  TYR D CD2   1 
ATOM 4369  C CE1   . TYR D 1 34  ? 8.264   -32.255  -87.886  1.00 71.77  ? 31  TYR D CE1   1 
ATOM 4370  C CE2   . TYR D 1 34  ? 9.643   -33.833  -89.042  1.00 61.18  ? 31  TYR D CE2   1 
ATOM 4371  C CZ    . TYR D 1 34  ? 9.488   -32.860  -88.078  1.00 70.76  ? 31  TYR D CZ    1 
ATOM 4372  O OH    . TYR D 1 34  ? 10.559  -32.487  -87.299  1.00 74.54  ? 31  TYR D OH    1 
ATOM 4373  N N     . THR D 1 35  ? 2.910   -33.616  -89.648  1.00 87.62  ? 32  THR D N     1 
ATOM 4374  C CA    . THR D 1 35  ? 1.656   -33.127  -90.191  1.00 82.70  ? 32  THR D CA    1 
ATOM 4375  C C     . THR D 1 35  ? 1.924   -32.060  -91.248  1.00 83.66  ? 32  THR D C     1 
ATOM 4376  O O     . THR D 1 35  ? 2.998   -31.451  -91.298  1.00 78.94  ? 32  THR D O     1 
ATOM 4377  C CB    . THR D 1 35  ? 0.766   -32.573  -89.078  1.00 79.69  ? 32  THR D CB    1 
ATOM 4378  O OG1   . THR D 1 35  ? 1.498   -31.612  -88.304  1.00 77.90  ? 32  THR D OG1   1 
ATOM 4379  C CG2   . THR D 1 35  ? 0.304   -33.699  -88.165  1.00 62.83  ? 32  THR D CG2   1 
ATOM 4380  N N     . ALA D 1 36  ? 0.936   -31.867  -92.127  1.00 79.84  ? 33  ALA D N     1 
ATOM 4381  C CA    . ALA D 1 36  ? 1.093   -30.932  -93.237  1.00 75.02  ? 33  ALA D CA    1 
ATOM 4382  C C     . ALA D 1 36  ? 1.453   -29.533  -92.750  1.00 82.05  ? 33  ALA D C     1 
ATOM 4383  O O     . ALA D 1 36  ? 2.358   -28.894  -93.297  1.00 76.50  ? 33  ALA D O     1 
ATOM 4384  C CB    . ALA D 1 36  ? -0.188  -30.891  -94.069  1.00 71.10  ? 33  ALA D CB    1 
ATOM 4385  N N     . GLU D 1 37  ? 0.768   -29.049  -91.713  1.00 87.06  ? 34  GLU D N     1 
ATOM 4386  C CA    . GLU D 1 37  ? 1.019   -27.699  -91.215  1.00 84.51  ? 34  GLU D CA    1 
ATOM 4387  C C     . GLU D 1 37  ? 2.428   -27.563  -90.651  1.00 73.70  ? 34  GLU D C     1 
ATOM 4388  O O     . GLU D 1 37  ? 3.145   -26.608  -90.978  1.00 65.74  ? 34  GLU D O     1 
ATOM 4389  C CB    . GLU D 1 37  ? -0.034  -27.325  -90.172  1.00 85.22  ? 34  GLU D CB    1 
ATOM 4390  C CG    . GLU D 1 37  ? -1.471  -27.632  -90.597  1.00 86.26  ? 34  GLU D CG    1 
ATOM 4391  C CD    . GLU D 1 37  ? -1.956  -28.982  -90.106  1.00 91.91  ? 34  GLU D CD    1 
ATOM 4392  O OE1   . GLU D 1 37  ? -1.652  -29.340  -88.949  1.00 114.25 ? 34  GLU D OE1   1 
ATOM 4393  O OE2   . GLU D 1 37  ? -2.658  -29.677  -90.872  1.00 85.06  ? 34  GLU D OE2   1 
ATOM 4394  N N     . GLU D 1 38  ? 2.853   -28.514  -89.812  1.00 72.49  ? 35  GLU D N     1 
ATOM 4395  C CA    . GLU D 1 38  ? 4.191   -28.419  -89.236  1.00 77.47  ? 35  GLU D CA    1 
ATOM 4396  C C     . GLU D 1 38  ? 5.256   -28.633  -90.302  1.00 71.20  ? 35  GLU D C     1 
ATOM 4397  O O     . GLU D 1 38  ? 6.291   -27.955  -90.297  1.00 59.73  ? 35  GLU D O     1 
ATOM 4398  C CB    . GLU D 1 38  ? 4.367   -29.413  -88.086  1.00 73.37  ? 35  GLU D CB    1 
ATOM 4399  C CG    . GLU D 1 38  ? 5.720   -29.270  -87.386  1.00 73.22  ? 35  GLU D CG    1 
ATOM 4400  C CD    . GLU D 1 38  ? 5.888   -30.188  -86.188  1.00 77.77  ? 35  GLU D CD    1 
ATOM 4401  O OE1   . GLU D 1 38  ? 6.877   -30.013  -85.443  1.00 66.38  ? 35  GLU D OE1   1 
ATOM 4402  O OE2   . GLU D 1 38  ? 5.040   -31.084  -85.993  1.00 82.20  ? 35  GLU D OE2   1 
ATOM 4403  N N     . TYR D 1 39  ? 5.017   -29.571  -91.223  1.00 62.28  ? 36  TYR D N     1 
ATOM 4404  C CA    . TYR D 1 39  ? 5.935   -29.753  -92.342  1.00 58.41  ? 36  TYR D CA    1 
ATOM 4405  C C     . TYR D 1 39  ? 6.123   -28.452  -93.111  1.00 74.47  ? 36  TYR D C     1 
ATOM 4406  O O     . TYR D 1 39  ? 7.253   -28.060  -93.417  1.00 72.13  ? 36  TYR D O     1 
ATOM 4407  C CB    . TYR D 1 39  ? 5.435   -30.845  -93.288  1.00 66.98  ? 36  TYR D CB    1 
ATOM 4408  C CG    . TYR D 1 39  ? 5.992   -30.642  -94.677  1.00 70.78  ? 36  TYR D CG    1 
ATOM 4409  C CD1   . TYR D 1 39  ? 7.333   -30.880  -94.949  1.00 68.79  ? 36  TYR D CD1   1 
ATOM 4410  C CD2   . TYR D 1 39  ? 5.189   -30.165  -95.707  1.00 73.94  ? 36  TYR D CD2   1 
ATOM 4411  C CE1   . TYR D 1 39  ? 7.855   -30.664  -96.211  1.00 69.60  ? 36  TYR D CE1   1 
ATOM 4412  C CE2   . TYR D 1 39  ? 5.703   -29.949  -96.972  1.00 78.10  ? 36  TYR D CE2   1 
ATOM 4413  C CZ    . TYR D 1 39  ? 7.035   -30.201  -97.217  1.00 75.23  ? 36  TYR D CZ    1 
ATOM 4414  O OH    . TYR D 1 39  ? 7.548   -29.985  -98.473  1.00 81.76  ? 36  TYR D OH    1 
ATOM 4415  N N     . GLN D 1 40  ? 5.022   -27.786  -93.463  1.00 72.05  ? 37  GLN D N     1 
ATOM 4416  C CA    . GLN D 1 40  ? 5.120   -26.578  -94.277  1.00 60.92  ? 37  GLN D CA    1 
ATOM 4417  C C     . GLN D 1 40  ? 5.820   -25.465  -93.515  1.00 69.25  ? 37  GLN D C     1 
ATOM 4418  O O     . GLN D 1 40  ? 6.696   -24.778  -94.058  1.00 77.28  ? 37  GLN D O     1 
ATOM 4419  C CB    . GLN D 1 40  ? 3.732   -26.116  -94.711  1.00 70.27  ? 37  GLN D CB    1 
ATOM 4420  C CG    . GLN D 1 40  ? 3.768   -24.970  -95.699  1.00 91.49  ? 37  GLN D CG    1 
ATOM 4421  C CD    . GLN D 1 40  ? 2.400   -24.378  -95.965  1.00 96.45  ? 37  GLN D CD    1 
ATOM 4422  O OE1   . GLN D 1 40  ? 1.449   -24.625  -95.223  1.00 90.17  ? 37  GLN D OE1   1 
ATOM 4423  N NE2   . GLN D 1 40  ? 2.291   -23.598  -97.037  1.00 101.60 ? 37  GLN D NE2   1 
ATOM 4424  N N     . ALA D 1 41  ? 5.447   -25.281  -92.246  1.00 56.06  ? 38  ALA D N     1 
ATOM 4425  C CA    . ALA D 1 41  ? 6.096   -24.283  -91.408  1.00 63.40  ? 38  ALA D CA    1 
ATOM 4426  C C     . ALA D 1 41  ? 7.603   -24.507  -91.350  1.00 73.36  ? 38  ALA D C     1 
ATOM 4427  O O     . ALA D 1 41  ? 8.390   -23.578  -91.570  1.00 69.41  ? 38  ALA D O     1 
ATOM 4428  C CB    . ALA D 1 41  ? 5.479   -24.317  -90.011  1.00 67.76  ? 38  ALA D CB    1 
ATOM 4429  N N     . ILE D 1 42  ? 8.024   -25.747  -91.081  1.00 72.70  ? 39  ILE D N     1 
ATOM 4430  C CA    . ILE D 1 42  ? 9.448   -26.027  -90.919  1.00 69.56  ? 39  ILE D CA    1 
ATOM 4431  C C     . ILE D 1 42  ? 10.183  -25.890  -92.247  1.00 68.03  ? 39  ILE D C     1 
ATOM 4432  O O     . ILE D 1 42  ? 11.287  -25.337  -92.303  1.00 54.95  ? 39  ILE D O     1 
ATOM 4433  C CB    . ILE D 1 42  ? 9.647   -27.426  -90.307  1.00 62.32  ? 39  ILE D CB    1 
ATOM 4434  C CG1   . ILE D 1 42  ? 9.241   -27.431  -88.837  1.00 61.14  ? 39  ILE D CG1   1 
ATOM 4435  C CG2   . ILE D 1 42  ? 11.096  -27.868  -90.428  1.00 65.87  ? 39  ILE D CG2   1 
ATOM 4436  C CD1   . ILE D 1 42  ? 9.240   -28.807  -88.220  1.00 64.82  ? 39  ILE D CD1   1 
ATOM 4437  N N     . GLN D 1 43  ? 9.603   -26.414  -93.331  1.00 68.29  ? 40  GLN D N     1 
ATOM 4438  C CA    . GLN D 1 43  ? 10.244  -26.303  -94.638  1.00 68.59  ? 40  GLN D CA    1 
ATOM 4439  C C     . GLN D 1 43  ? 10.442  -24.847  -95.039  1.00 69.92  ? 40  GLN D C     1 
ATOM 4440  O O     . GLN D 1 43  ? 11.507  -24.480  -95.550  1.00 68.62  ? 40  GLN D O     1 
ATOM 4441  C CB    . GLN D 1 43  ? 9.432   -27.050  -95.696  1.00 64.95  ? 40  GLN D CB    1 
ATOM 4442  C CG    . GLN D 1 43  ? 9.966   -26.869  -97.106  1.00 68.36  ? 40  GLN D CG    1 
ATOM 4443  C CD    . GLN D 1 43  ? 11.267  -27.617  -97.325  1.00 73.20  ? 40  GLN D CD    1 
ATOM 4444  O OE1   . GLN D 1 43  ? 11.271  -28.827  -97.544  1.00 70.94  ? 40  GLN D OE1   1 
ATOM 4445  N NE2   . GLN D 1 43  ? 12.382  -26.897  -97.254  1.00 68.38  ? 40  GLN D NE2   1 
ATOM 4446  N N     . LYS D 1 44  ? 9.433   -24.000  -94.817  1.00 73.47  ? 41  LYS D N     1 
ATOM 4447  C CA    . LYS D 1 44  ? 9.598   -22.582  -95.123  1.00 65.61  ? 41  LYS D CA    1 
ATOM 4448  C C     . LYS D 1 44  ? 10.647  -21.945  -94.220  1.00 66.54  ? 41  LYS D C     1 
ATOM 4449  O O     . LYS D 1 44  ? 11.512  -21.199  -94.693  1.00 64.53  ? 41  LYS D O     1 
ATOM 4450  C CB    . LYS D 1 44  ? 8.261   -21.847  -95.016  1.00 68.32  ? 41  LYS D CB    1 
ATOM 4451  C CG    . LYS D 1 44  ? 7.317   -22.106  -96.184  1.00 76.32  ? 41  LYS D CG    1 
ATOM 4452  C CD    . LYS D 1 44  ? 6.062   -21.258  -96.064  1.00 83.80  ? 41  LYS D CD    1 
ATOM 4453  C CE    . LYS D 1 44  ? 5.036   -21.609  -97.125  1.00 80.91  ? 41  LYS D CE    1 
ATOM 4454  N NZ    . LYS D 1 44  ? 5.456   -21.145  -98.475  1.00 90.13  ? 41  LYS D NZ    1 
ATOM 4455  N N     . ALA D 1 45  ? 10.580  -22.214  -92.912  1.00 61.51  ? 42  ALA D N     1 
ATOM 4456  C CA    . ALA D 1 45  ? 11.508  -21.578  -91.983  1.00 65.69  ? 42  ALA D CA    1 
ATOM 4457  C C     . ALA D 1 45  ? 12.952  -21.976  -92.264  1.00 70.13  ? 42  ALA D C     1 
ATOM 4458  O O     . ALA D 1 45  ? 13.866  -21.166  -92.069  1.00 72.06  ? 42  ALA D O     1 
ATOM 4459  C CB    . ALA D 1 45  ? 11.130  -21.922  -90.542  1.00 66.63  ? 42  ALA D CB    1 
ATOM 4460  N N     . LEU D 1 46  ? 13.182  -23.212  -92.716  1.00 71.97  ? 43  LEU D N     1 
ATOM 4461  C CA    . LEU D 1 46  ? 14.546  -23.665  -92.965  1.00 66.17  ? 43  LEU D CA    1 
ATOM 4462  C C     . LEU D 1 46  ? 15.182  -22.973  -94.163  1.00 75.19  ? 43  LEU D C     1 
ATOM 4463  O O     . LEU D 1 46  ? 16.413  -22.959  -94.269  1.00 71.28  ? 43  LEU D O     1 
ATOM 4464  C CB    . LEU D 1 46  ? 14.569  -25.181  -93.164  1.00 67.72  ? 43  LEU D CB    1 
ATOM 4465  C CG    . LEU D 1 46  ? 14.501  -25.998  -91.873  1.00 71.83  ? 43  LEU D CG    1 
ATOM 4466  C CD1   . LEU D 1 46  ? 14.318  -27.477  -92.171  1.00 62.58  ? 43  LEU D CD1   1 
ATOM 4467  C CD2   . LEU D 1 46  ? 15.744  -25.761  -91.027  1.00 64.17  ? 43  LEU D CD2   1 
ATOM 4468  N N     . ARG D 1 47  ? 14.377  -22.394  -95.060  1.00 74.38  ? 44  ARG D N     1 
ATOM 4469  C CA    . ARG D 1 47  ? 14.939  -21.674  -96.197  1.00 71.44  ? 44  ARG D CA    1 
ATOM 4470  C C     . ARG D 1 47  ? 15.585  -20.365  -95.762  1.00 73.48  ? 44  ARG D C     1 
ATOM 4471  O O     . ARG D 1 47  ? 16.515  -19.886  -96.421  1.00 75.52  ? 44  ARG D O     1 
ATOM 4472  C CB    . ARG D 1 47  ? 13.859  -21.410  -97.250  1.00 66.74  ? 44  ARG D CB    1 
ATOM 4473  C CG    . ARG D 1 47  ? 13.625  -22.569  -98.210  1.00 70.36  ? 44  ARG D CG    1 
ATOM 4474  C CD    . ARG D 1 47  ? 12.599  -22.230  -99.287  1.00 58.41  ? 44  ARG D CD    1 
ATOM 4475  N NE    . ARG D 1 47  ? 11.224  -22.463  -98.852  1.00 62.97  ? 44  ARG D NE    1 
ATOM 4476  C CZ    . ARG D 1 47  ? 10.475  -23.493  -99.241  1.00 69.27  ? 44  ARG D CZ    1 
ATOM 4477  N NH1   . ARG D 1 47  ? 10.963  -24.397  -100.082 1.00 61.72  ? 44  ARG D NH1   1 
ATOM 4478  N NH2   . ARG D 1 47  ? 9.234   -23.619  -98.791  1.00 66.91  ? 44  ARG D NH2   1 
ATOM 4479  N N     . GLN D 1 48  ? 15.098  -19.777  -94.670  1.00 65.30  ? 45  GLN D N     1 
ATOM 4480  C CA    . GLN D 1 48  ? 15.595  -18.495  -94.180  1.00 70.06  ? 45  GLN D CA    1 
ATOM 4481  C C     . GLN D 1 48  ? 17.105  -18.522  -93.984  1.00 72.53  ? 45  GLN D C     1 
ATOM 4482  O O     . GLN D 1 48  ? 17.655  -19.475  -93.428  1.00 78.31  ? 45  GLN D O     1 
ATOM 4483  C CB    . GLN D 1 48  ? 14.905  -18.145  -92.861  1.00 73.59  ? 45  GLN D CB    1 
ATOM 4484  C CG    . GLN D 1 48  ? 13.391  -18.052  -92.954  1.00 77.87  ? 45  GLN D CG    1 
ATOM 4485  C CD    . GLN D 1 48  ? 12.731  -17.860  -91.600  1.00 86.04  ? 45  GLN D CD    1 
ATOM 4486  O OE1   . GLN D 1 48  ? 11.690  -17.212  -91.490  1.00 92.97  ? 45  GLN D OE1   1 
ATOM 4487  N NE2   . GLN D 1 48  ? 13.329  -18.435  -90.561  1.00 85.31  ? 45  GLN D NE2   1 
ATOM 4488  N N     . ARG D 1 49  ? 17.776  -17.485  -94.477  1.00 71.41  ? 46  ARG D N     1 
ATOM 4489  C CA    . ARG D 1 49  ? 19.169  -17.249  -94.135  1.00 75.51  ? 46  ARG D CA    1 
ATOM 4490  C C     . ARG D 1 49  ? 19.270  -16.564  -92.772  1.00 79.06  ? 46  ARG D C     1 
ATOM 4491  O O     . ARG D 1 49  ? 18.310  -15.969  -92.276  1.00 79.78  ? 46  ARG D O     1 
ATOM 4492  C CB    . ARG D 1 49  ? 19.842  -16.393  -95.208  1.00 82.47  ? 46  ARG D CB    1 
ATOM 4493  C CG    . ARG D 1 49  ? 19.851  -17.024  -96.597  1.00 77.82  ? 46  ARG D CG    1 
ATOM 4494  C CD    . ARG D 1 49  ? 20.547  -16.122  -97.607  1.00 90.94  ? 46  ARG D CD    1 
ATOM 4495  N NE    . ARG D 1 49  ? 20.814  -16.796  -98.876  1.00 113.73 ? 46  ARG D NE    1 
ATOM 4496  C CZ    . ARG D 1 49  ? 19.966  -16.832  -99.899  1.00 105.20 ? 46  ARG D CZ    1 
ATOM 4497  N NH1   . ARG D 1 49  ? 18.787  -16.232  -99.808  1.00 103.72 ? 46  ARG D NH1   1 
ATOM 4498  N NH2   . ARG D 1 49  ? 20.296  -17.468  -101.016 1.00 82.34  ? 46  ARG D NH2   1 
ATOM 4499  N N     . LEU D 1 50  ? 20.455  -16.644  -92.166  1.00 78.11  ? 47  LEU D N     1 
ATOM 4500  C CA    . LEU D 1 50  ? 20.668  -16.089  -90.833  1.00 76.64  ? 47  LEU D CA    1 
ATOM 4501  C C     . LEU D 1 50  ? 21.141  -14.643  -90.915  1.00 82.13  ? 47  LEU D C     1 
ATOM 4502  O O     . LEU D 1 50  ? 21.951  -14.288  -91.776  1.00 83.31  ? 47  LEU D O     1 
ATOM 4503  C CB    . LEU D 1 50  ? 21.686  -16.911  -90.037  1.00 75.58  ? 47  LEU D CB    1 
ATOM 4504  C CG    . LEU D 1 50  ? 21.294  -18.296  -89.518  1.00 72.04  ? 47  LEU D CG    1 
ATOM 4505  C CD1   . LEU D 1 50  ? 19.842  -18.330  -89.071  1.00 67.17  ? 47  LEU D CD1   1 
ATOM 4506  C CD2   . LEU D 1 50  ? 21.564  -19.359  -90.548  1.00 79.31  ? 47  LEU D CD2   1 
ATOM 4507  N N     . GLY D 1 51  ? 20.613  -13.810  -90.018  1.00 81.75  ? 48  GLY D N     1 
ATOM 4508  C CA    . GLY D 1 51  ? 21.059  -12.445  -89.866  1.00 84.65  ? 48  GLY D CA    1 
ATOM 4509  C C     . GLY D 1 51  ? 22.432  -12.357  -89.227  1.00 86.43  ? 48  GLY D C     1 
ATOM 4510  O O     . GLY D 1 51  ? 23.005  -13.363  -88.796  1.00 83.73  ? 48  GLY D O     1 
ATOM 4511  N N     . PRO D 1 52  ? 22.991  -11.144  -89.155  1.00 88.15  ? 49  PRO D N     1 
ATOM 4512  C CA    . PRO D 1 52  ? 24.340  -10.982  -88.583  1.00 88.53  ? 49  PRO D CA    1 
ATOM 4513  C C     . PRO D 1 52  ? 24.428  -11.286  -87.093  1.00 89.86  ? 49  PRO D C     1 
ATOM 4514  O O     . PRO D 1 52  ? 25.547  -11.391  -86.571  1.00 79.85  ? 49  PRO D O     1 
ATOM 4515  C CB    . PRO D 1 52  ? 24.670  -9.505   -88.853  1.00 86.97  ? 49  PRO D CB    1 
ATOM 4516  C CG    . PRO D 1 52  ? 23.656  -9.031   -89.839  1.00 90.43  ? 49  PRO D CG    1 
ATOM 4517  C CD    . PRO D 1 52  ? 22.437  -9.874   -89.649  1.00 88.56  ? 49  PRO D CD    1 
ATOM 4518  N N     . GLU D 1 53  ? 23.298  -11.415  -86.392  1.00 93.73  ? 50  GLU D N     1 
ATOM 4519  C CA    . GLU D 1 53  ? 23.340  -11.704  -84.961  1.00 87.06  ? 50  GLU D CA    1 
ATOM 4520  C C     . GLU D 1 53  ? 23.967  -13.063  -84.675  1.00 92.27  ? 50  GLU D C     1 
ATOM 4521  O O     . GLU D 1 53  ? 24.535  -13.269  -83.596  1.00 105.19 ? 50  GLU D O     1 
ATOM 4522  C CB    . GLU D 1 53  ? 21.932  -11.635  -84.367  1.00 91.04  ? 50  GLU D CB    1 
ATOM 4523  C CG    . GLU D 1 53  ? 21.240  -10.292  -84.556  1.00 115.24 ? 50  GLU D CG    1 
ATOM 4524  C CD    . GLU D 1 53  ? 20.471  -10.197  -85.863  1.00 107.92 ? 50  GLU D CD    1 
ATOM 4525  O OE1   . GLU D 1 53  ? 20.896  -10.816  -86.861  1.00 103.14 ? 50  GLU D OE1   1 
ATOM 4526  O OE2   . GLU D 1 53  ? 19.439  -9.493   -85.891  1.00 102.71 ? 50  GLU D OE2   1 
ATOM 4527  N N     . TYR D 1 54  ? 23.875  -13.996  -85.623  1.00 87.90  ? 51  TYR D N     1 
ATOM 4528  C CA    . TYR D 1 54  ? 24.358  -15.357  -85.426  1.00 82.08  ? 51  TYR D CA    1 
ATOM 4529  C C     . TYR D 1 54  ? 25.823  -15.529  -85.794  1.00 82.05  ? 51  TYR D C     1 
ATOM 4530  O O     . TYR D 1 54  ? 26.518  -16.346  -85.177  1.00 88.46  ? 51  TYR D O     1 
ATOM 4531  C CB    . TYR D 1 54  ? 23.530  -16.340  -86.257  1.00 73.03  ? 51  TYR D CB    1 
ATOM 4532  C CG    . TYR D 1 54  ? 22.107  -16.499  -85.790  1.00 73.13  ? 51  TYR D CG    1 
ATOM 4533  C CD1   . TYR D 1 54  ? 21.797  -17.342  -84.734  1.00 78.91  ? 51  TYR D CD1   1 
ATOM 4534  C CD2   . TYR D 1 54  ? 21.072  -15.811  -86.408  1.00 81.23  ? 51  TYR D CD2   1 
ATOM 4535  C CE1   . TYR D 1 54  ? 20.499  -17.495  -84.302  1.00 71.64  ? 51  TYR D CE1   1 
ATOM 4536  C CE2   . TYR D 1 54  ? 19.768  -15.958  -85.984  1.00 78.34  ? 51  TYR D CE2   1 
ATOM 4537  C CZ    . TYR D 1 54  ? 19.487  -16.801  -84.930  1.00 74.58  ? 51  TYR D CZ    1 
ATOM 4538  O OH    . TYR D 1 54  ? 18.189  -16.949  -84.503  1.00 82.28  ? 51  TYR D OH    1 
ATOM 4539  N N     . ILE D 1 55  ? 26.305  -14.780  -86.776  1.00 77.08  ? 52  ILE D N     1 
ATOM 4540  C CA    . ILE D 1 55  ? 27.619  -15.031  -87.352  1.00 81.53  ? 52  ILE D CA    1 
ATOM 4541  C C     . ILE D 1 55  ? 28.698  -14.435  -86.458  1.00 84.94  ? 52  ILE D C     1 
ATOM 4542  O O     . ILE D 1 55  ? 28.582  -13.302  -85.974  1.00 90.70  ? 52  ILE D O     1 
ATOM 4543  C CB    . ILE D 1 55  ? 27.689  -14.454  -88.778  1.00 82.02  ? 52  ILE D CB    1 
ATOM 4544  C CG1   . ILE D 1 55  ? 26.416  -14.797  -89.565  1.00 80.32  ? 52  ILE D CG1   1 
ATOM 4545  C CG2   . ILE D 1 55  ? 28.917  -14.968  -89.503  1.00 95.06  ? 52  ILE D CG2   1 
ATOM 4546  C CD1   . ILE D 1 55  ? 26.114  -16.279  -89.657  1.00 83.33  ? 52  ILE D CD1   1 
ATOM 4547  N N     . SER D 1 56  ? 29.758  -15.210  -86.243  1.00 88.73  ? 53  SER D N     1 
ATOM 4548  C CA    . SER D 1 56  ? 30.958  -14.823  -85.512  1.00 90.55  ? 53  SER D CA    1 
ATOM 4549  C C     . SER D 1 56  ? 32.167  -15.183  -86.365  1.00 90.45  ? 53  SER D C     1 
ATOM 4550  O O     . SER D 1 56  ? 32.034  -15.772  -87.441  1.00 93.85  ? 53  SER D O     1 
ATOM 4551  C CB    . SER D 1 56  ? 31.029  -15.510  -84.141  1.00 81.20  ? 53  SER D CB    1 
ATOM 4552  O OG    . SER D 1 56  ? 29.803  -15.399  -83.442  1.00 85.39  ? 53  SER D OG    1 
ATOM 4553  N N     . SER D 1 57  ? 33.362  -14.831  -85.895  1.00 89.77  ? 54  SER D N     1 
ATOM 4554  C CA    . SER D 1 57  ? 34.547  -15.129  -86.685  1.00 102.44 ? 54  SER D CA    1 
ATOM 4555  C C     . SER D 1 57  ? 35.713  -15.472  -85.770  1.00 107.91 ? 54  SER D C     1 
ATOM 4556  O O     . SER D 1 57  ? 35.865  -14.899  -84.687  1.00 105.87 ? 54  SER D O     1 
ATOM 4557  C CB    . SER D 1 57  ? 34.924  -13.947  -87.587  1.00 109.40 ? 54  SER D CB    1 
ATOM 4558  O OG    . SER D 1 57  ? 35.455  -12.869  -86.832  1.00 107.10 ? 54  SER D OG    1 
ATOM 4559  N N     . ARG D 1 58  ? 36.531  -16.415  -86.230  1.00 108.94 ? 55  ARG D N     1 
ATOM 4560  C CA    . ARG D 1 58  ? 37.773  -16.821  -85.581  1.00 117.44 ? 55  ARG D CA    1 
ATOM 4561  C C     . ARG D 1 58  ? 38.785  -17.102  -86.686  1.00 123.04 ? 55  ARG D C     1 
ATOM 4562  O O     . ARG D 1 58  ? 38.535  -16.831  -87.865  1.00 122.16 ? 55  ARG D O     1 
ATOM 4563  C CB    . ARG D 1 58  ? 37.586  -18.028  -84.650  1.00 119.80 ? 55  ARG D CB    1 
ATOM 4564  C CG    . ARG D 1 58  ? 37.302  -19.350  -85.346  1.00 114.16 ? 55  ARG D CG    1 
ATOM 4565  C CD    . ARG D 1 58  ? 37.319  -20.503  -84.344  1.00 112.69 ? 55  ARG D CD    1 
ATOM 4566  N NE    . ARG D 1 58  ? 36.755  -21.728  -84.901  1.00 114.55 ? 55  ARG D NE    1 
ATOM 4567  C CZ    . ARG D 1 58  ? 35.489  -22.105  -84.764  1.00 109.62 ? 55  ARG D CZ    1 
ATOM 4568  N NH1   . ARG D 1 58  ? 34.689  -21.454  -83.933  1.00 102.79 ? 55  ARG D NH1   1 
ATOM 4569  N NH2   . ARG D 1 58  ? 35.069  -23.227  -85.332  1.00 116.05 ? 55  ARG D NH2   1 
ATOM 4570  N N     . MET D 1 59  ? 39.940  -17.648  -86.310  1.00 130.94 ? 56  MET D N     1 
ATOM 4571  C CA    . MET D 1 59  ? 40.973  -18.022  -87.273  1.00 129.53 ? 56  MET D CA    1 
ATOM 4572  C C     . MET D 1 59  ? 40.924  -19.539  -87.421  1.00 122.43 ? 56  MET D C     1 
ATOM 4573  O O     . MET D 1 59  ? 41.502  -20.274  -86.618  1.00 122.38 ? 56  MET D O     1 
ATOM 4574  C CB    . MET D 1 59  ? 42.344  -17.542  -86.815  1.00 130.75 ? 56  MET D CB    1 
ATOM 4575  C CG    . MET D 1 59  ? 42.430  -16.038  -86.747  1.00 124.43 ? 56  MET D CG    1 
ATOM 4576  S SD    . MET D 1 59  ? 41.952  -15.260  -88.298  1.00 147.64 ? 56  MET D SD    1 
ATOM 4577  C CE    . MET D 1 59  ? 41.050  -13.839  -87.678  1.00 132.89 ? 56  MET D CE    1 
ATOM 4578  N N     . ALA D 1 60  ? 40.217  -20.004  -88.449  1.00 123.34 ? 57  ALA D N     1 
ATOM 4579  C CA    . ALA D 1 60  ? 39.989  -21.430  -88.650  1.00 127.65 ? 57  ALA D CA    1 
ATOM 4580  C C     . ALA D 1 60  ? 41.176  -22.094  -89.334  1.00 130.54 ? 57  ALA D C     1 
ATOM 4581  O O     . ALA D 1 60  ? 42.278  -21.536  -89.376  1.00 132.97 ? 57  ALA D O     1 
ATOM 4582  C CB    . ALA D 1 60  ? 38.712  -21.648  -89.467  1.00 125.15 ? 57  ALA D CB    1 
ATOM 4583  N N     . GLY D 1 61  ? 40.956  -23.291  -89.878  1.00 122.85 ? 58  GLY D N     1 
ATOM 4584  C CA    . GLY D 1 61  ? 42.010  -23.971  -90.610  1.00 124.38 ? 58  GLY D CA    1 
ATOM 4585  C C     . GLY D 1 61  ? 42.298  -23.265  -91.920  1.00 135.58 ? 58  GLY D C     1 
ATOM 4586  O O     . GLY D 1 61  ? 41.386  -22.996  -92.712  1.00 140.51 ? 58  GLY D O     1 
ATOM 4587  N N     . GLY D 1 62  ? 43.573  -22.970  -92.164  1.00 127.85 ? 59  GLY D N     1 
ATOM 4588  C CA    . GLY D 1 62  ? 43.979  -22.168  -93.297  1.00 121.43 ? 59  GLY D CA    1 
ATOM 4589  C C     . GLY D 1 62  ? 44.464  -20.782  -92.937  1.00 128.35 ? 59  GLY D C     1 
ATOM 4590  O O     . GLY D 1 62  ? 44.962  -20.069  -93.817  1.00 121.08 ? 59  GLY D O     1 
ATOM 4591  N N     . GLY D 1 63  ? 44.329  -20.379  -91.675  1.00 134.53 ? 60  GLY D N     1 
ATOM 4592  C CA    . GLY D 1 63  ? 44.898  -19.138  -91.190  1.00 130.37 ? 60  GLY D CA    1 
ATOM 4593  C C     . GLY D 1 63  ? 44.249  -17.867  -91.682  1.00 136.37 ? 60  GLY D C     1 
ATOM 4594  O O     . GLY D 1 63  ? 44.828  -16.790  -91.507  1.00 136.70 ? 60  GLY D O     1 
ATOM 4595  N N     . GLN D 1 64  ? 43.072  -17.947  -92.290  1.00 131.56 ? 61  GLN D N     1 
ATOM 4596  C CA    . GLN D 1 64  ? 42.347  -16.769  -92.741  1.00 133.14 ? 61  GLN D CA    1 
ATOM 4597  C C     . GLN D 1 64  ? 41.123  -16.531  -91.866  1.00 132.84 ? 61  GLN D C     1 
ATOM 4598  O O     . GLN D 1 64  ? 40.713  -17.381  -91.072  1.00 127.86 ? 61  GLN D O     1 
ATOM 4599  C CB    . GLN D 1 64  ? 41.931  -16.906  -94.210  1.00 134.05 ? 61  GLN D CB    1 
ATOM 4600  C CG    . GLN D 1 64  ? 42.896  -16.259  -95.191  1.00 131.98 ? 61  GLN D CG    1 
ATOM 4601  C CD    . GLN D 1 64  ? 42.181  -15.583  -96.344  1.00 128.21 ? 61  GLN D CD    1 
ATOM 4602  O OE1   . GLN D 1 64  ? 40.960  -15.420  -96.322  1.00 123.01 ? 61  GLN D OE1   1 
ATOM 4603  N NE2   . GLN D 1 64  ? 42.939  -15.182  -97.358  1.00 126.72 ? 61  GLN D NE2   1 
ATOM 4604  N N     . LYS D 1 65  ? 40.541  -15.345  -92.022  1.00 142.02 ? 62  LYS D N     1 
ATOM 4605  C CA    . LYS D 1 65  ? 39.336  -14.989  -91.284  1.00 134.29 ? 62  LYS D CA    1 
ATOM 4606  C C     . LYS D 1 65  ? 38.145  -15.742  -91.864  1.00 123.53 ? 62  LYS D C     1 
ATOM 4607  O O     . LYS D 1 65  ? 37.845  -15.627  -93.057  1.00 115.68 ? 62  LYS D O     1 
ATOM 4608  C CB    . LYS D 1 65  ? 39.105  -13.481  -91.338  1.00 137.82 ? 62  LYS D CB    1 
ATOM 4609  C CG    . LYS D 1 65  ? 37.966  -12.996  -90.456  1.00 139.87 ? 62  LYS D CG    1 
ATOM 4610  C CD    . LYS D 1 65  ? 37.781  -11.493  -90.581  1.00 133.36 ? 62  LYS D CD    1 
ATOM 4611  C CE    . LYS D 1 65  ? 36.622  -11.003  -89.728  1.00 135.68 ? 62  LYS D CE    1 
ATOM 4612  N NZ    . LYS D 1 65  ? 36.404  -9.540   -89.892  1.00 120.89 ? 62  LYS D NZ    1 
ATOM 4613  N N     . VAL D 1 66  ? 37.470  -16.512  -91.015  1.00 116.36 ? 63  VAL D N     1 
ATOM 4614  C CA    . VAL D 1 66  ? 36.443  -17.460  -91.427  1.00 111.45 ? 63  VAL D CA    1 
ATOM 4615  C C     . VAL D 1 66  ? 35.230  -17.271  -90.528  1.00 102.14 ? 63  VAL D C     1 
ATOM 4616  O O     . VAL D 1 66  ? 35.359  -17.260  -89.299  1.00 101.69 ? 63  VAL D O     1 
ATOM 4617  C CB    . VAL D 1 66  ? 36.946  -18.916  -91.366  1.00 118.04 ? 63  VAL D CB    1 
ATOM 4618  C CG1   . VAL D 1 66  ? 35.808  -19.886  -91.640  1.00 88.39  ? 63  VAL D CG1   1 
ATOM 4619  C CG2   . VAL D 1 66  ? 38.078  -19.131  -92.361  1.00 126.01 ? 63  VAL D CG2   1 
ATOM 4620  N N     . CYS D 1 67  ? 34.059  -17.116  -91.138  1.00 104.78 ? 64  CYS D N     1 
ATOM 4621  C CA    . CYS D 1 67  ? 32.836  -16.936  -90.376  1.00 85.89  ? 64  CYS D CA    1 
ATOM 4622  C C     . CYS D 1 67  ? 32.273  -18.295  -89.966  1.00 80.71  ? 64  CYS D C     1 
ATOM 4623  O O     . CYS D 1 67  ? 32.552  -19.325  -90.586  1.00 87.19  ? 64  CYS D O     1 
ATOM 4624  C CB    . CYS D 1 67  ? 31.805  -16.161  -91.198  1.00 88.46  ? 64  CYS D CB    1 
ATOM 4625  S SG    . CYS D 1 67  ? 32.306  -14.479  -91.650  1.00 87.08  ? 64  CYS D SG    1 
ATOM 4626  N N     . TYR D 1 68  ? 31.470  -18.286  -88.905  1.00 81.84  ? 65  TYR D N     1 
ATOM 4627  C CA    . TYR D 1 68  ? 30.891  -19.509  -88.359  1.00 83.38  ? 65  TYR D CA    1 
ATOM 4628  C C     . TYR D 1 68  ? 29.759  -19.131  -87.414  1.00 75.31  ? 65  TYR D C     1 
ATOM 4629  O O     . TYR D 1 68  ? 29.600  -17.968  -87.035  1.00 83.39  ? 65  TYR D O     1 
ATOM 4630  C CB    . TYR D 1 68  ? 31.936  -20.358  -87.626  1.00 81.65  ? 65  TYR D CB    1 
ATOM 4631  C CG    . TYR D 1 68  ? 32.425  -19.745  -86.331  1.00 80.01  ? 65  TYR D CG    1 
ATOM 4632  C CD1   . TYR D 1 68  ? 33.502  -18.871  -86.321  1.00 90.75  ? 65  TYR D CD1   1 
ATOM 4633  C CD2   . TYR D 1 68  ? 31.808  -20.038  -85.120  1.00 77.64  ? 65  TYR D CD2   1 
ATOM 4634  C CE1   . TYR D 1 68  ? 33.952  -18.305  -85.145  1.00 94.54  ? 65  TYR D CE1   1 
ATOM 4635  C CE2   . TYR D 1 68  ? 32.248  -19.472  -83.937  1.00 84.17  ? 65  TYR D CE2   1 
ATOM 4636  C CZ    . TYR D 1 68  ? 33.324  -18.608  -83.956  1.00 95.28  ? 65  TYR D CZ    1 
ATOM 4637  O OH    . TYR D 1 68  ? 33.774  -18.044  -82.783  1.00 86.30  ? 65  TYR D OH    1 
ATOM 4638  N N     . ILE D 1 69  ? 28.970  -20.137  -87.041  1.00 71.65  ? 66  ILE D N     1 
ATOM 4639  C CA    . ILE D 1 69  ? 27.903  -19.998  -86.056  1.00 77.89  ? 66  ILE D CA    1 
ATOM 4640  C C     . ILE D 1 69  ? 28.340  -20.697  -84.776  1.00 79.71  ? 66  ILE D C     1 
ATOM 4641  O O     . ILE D 1 69  ? 28.805  -21.844  -84.814  1.00 86.68  ? 66  ILE D O     1 
ATOM 4642  C CB    . ILE D 1 69  ? 26.576  -20.583  -86.568  1.00 70.13  ? 66  ILE D CB    1 
ATOM 4643  C CG1   . ILE D 1 69  ? 26.278  -20.080  -87.981  1.00 77.98  ? 66  ILE D CG1   1 
ATOM 4644  C CG2   . ILE D 1 69  ? 25.436  -20.220  -85.624  1.00 65.49  ? 66  ILE D CG2   1 
ATOM 4645  C CD1   . ILE D 1 69  ? 25.009  -20.649  -88.573  1.00 72.44  ? 66  ILE D CD1   1 
ATOM 4646  N N     . GLU D 1 70  ? 28.185  -20.010  -83.648  1.00 77.40  ? 67  GLU D N     1 
ATOM 4647  C CA    . GLU D 1 70  ? 28.590  -20.563  -82.364  1.00 75.47  ? 67  GLU D CA    1 
ATOM 4648  C C     . GLU D 1 70  ? 27.704  -21.740  -81.972  1.00 72.98  ? 67  GLU D C     1 
ATOM 4649  O O     . GLU D 1 70  ? 26.537  -21.829  -82.368  1.00 71.91  ? 67  GLU D O     1 
ATOM 4650  C CB    . GLU D 1 70  ? 28.546  -19.483  -81.283  1.00 77.90  ? 67  GLU D CB    1 
ATOM 4651  C CG    . GLU D 1 70  ? 29.538  -18.358  -81.520  1.00 87.03  ? 67  GLU D CG    1 
ATOM 4652  C CD    . GLU D 1 70  ? 29.667  -17.415  -80.339  1.00 94.20  ? 67  GLU D CD    1 
ATOM 4653  O OE1   . GLU D 1 70  ? 28.837  -17.496  -79.408  1.00 95.24  ? 67  GLU D OE1   1 
ATOM 4654  O OE2   . GLU D 1 70  ? 30.614  -16.599  -80.339  1.00 95.62  ? 67  GLU D OE2   1 
ATOM 4655  N N     . GLY D 1 71  ? 28.295  -22.667  -81.210  1.00 62.70  ? 68  GLY D N     1 
ATOM 4656  C CA    . GLY D 1 71  ? 27.605  -23.905  -80.874  1.00 58.29  ? 68  GLY D CA    1 
ATOM 4657  C C     . GLY D 1 71  ? 26.250  -23.684  -80.231  1.00 55.33  ? 68  GLY D C     1 
ATOM 4658  O O     . GLY D 1 71  ? 25.239  -24.234  -80.677  1.00 56.37  ? 68  GLY D O     1 
ATOM 4659  N N     . HIS D 1 72  ? 26.212  -22.879  -79.163  1.00 63.09  ? 69  HIS D N     1 
ATOM 4660  C CA    . HIS D 1 72  ? 24.963  -22.663  -78.437  1.00 74.61  ? 69  HIS D CA    1 
ATOM 4661  C C     . HIS D 1 72  ? 23.893  -22.044  -79.326  1.00 73.90  ? 69  HIS D C     1 
ATOM 4662  O O     . HIS D 1 72  ? 22.702  -22.342  -79.163  1.00 68.85  ? 69  HIS D O     1 
ATOM 4663  C CB    . HIS D 1 72  ? 25.217  -21.784  -77.209  1.00 77.04  ? 69  HIS D CB    1 
ATOM 4664  C CG    . HIS D 1 72  ? 25.565  -20.365  -77.537  1.00 82.89  ? 69  HIS D CG    1 
ATOM 4665  N ND1   . HIS D 1 72  ? 24.657  -19.332  -77.444  1.00 80.10  ? 69  HIS D ND1   1 
ATOM 4666  C CD2   . HIS D 1 72  ? 26.725  -19.808  -77.958  1.00 81.56  ? 69  HIS D CD2   1 
ATOM 4667  C CE1   . HIS D 1 72  ? 25.242  -18.200  -77.792  1.00 78.76  ? 69  HIS D CE1   1 
ATOM 4668  N NE2   . HIS D 1 72  ? 26.498  -18.461  -78.109  1.00 85.27  ? 69  HIS D NE2   1 
ATOM 4669  N N     . ARG D 1 73  ? 24.298  -21.208  -80.286  1.00 69.44  ? 70  ARG D N     1 
ATOM 4670  C CA    . ARG D 1 73  ? 23.333  -20.645  -81.222  1.00 67.47  ? 70  ARG D CA    1 
ATOM 4671  C C     . ARG D 1 73  ? 22.701  -21.737  -82.069  1.00 66.44  ? 70  ARG D C     1 
ATOM 4672  O O     . ARG D 1 73  ? 21.487  -21.732  -82.290  1.00 61.96  ? 70  ARG D O     1 
ATOM 4673  C CB    . ARG D 1 73  ? 24.001  -19.597  -82.112  1.00 75.49  ? 70  ARG D CB    1 
ATOM 4674  C CG    . ARG D 1 73  ? 24.626  -18.433  -81.359  1.00 89.13  ? 70  ARG D CG    1 
ATOM 4675  C CD    . ARG D 1 73  ? 23.847  -17.146  -81.612  1.00 80.82  ? 70  ARG D CD    1 
ATOM 4676  N NE    . ARG D 1 73  ? 24.280  -16.035  -80.764  1.00 82.60  ? 70  ARG D NE    1 
ATOM 4677  C CZ    . ARG D 1 73  ? 25.403  -15.344  -80.944  1.00 97.35  ? 70  ARG D CZ    1 
ATOM 4678  N NH1   . ARG D 1 73  ? 26.216  -15.646  -81.948  1.00 97.61  ? 70  ARG D NH1   1 
ATOM 4679  N NH2   . ARG D 1 73  ? 25.711  -14.349  -80.121  1.00 100.99 ? 70  ARG D NH2   1 
ATOM 4680  N N     . VAL D 1 74  ? 23.507  -22.692  -82.536  1.00 65.18  ? 71  VAL D N     1 
ATOM 4681  C CA    . VAL D 1 74  ? 22.977  -23.786  -83.341  1.00 60.19  ? 71  VAL D CA    1 
ATOM 4682  C C     . VAL D 1 74  ? 22.067  -24.669  -82.498  1.00 57.03  ? 71  VAL D C     1 
ATOM 4683  O O     . VAL D 1 74  ? 21.035  -25.159  -82.975  1.00 53.25  ? 71  VAL D O     1 
ATOM 4684  C CB    . VAL D 1 74  ? 24.127  -24.596  -83.966  1.00 60.47  ? 71  VAL D CB    1 
ATOM 4685  C CG1   . VAL D 1 74  ? 23.580  -25.667  -84.891  1.00 60.99  ? 71  VAL D CG1   1 
ATOM 4686  C CG2   . VAL D 1 74  ? 25.084  -23.682  -84.710  1.00 70.23  ? 71  VAL D CG2   1 
ATOM 4687  N N     . ILE D 1 75  ? 22.438  -24.891  -81.235  1.00 64.68  ? 72  ILE D N     1 
ATOM 4688  C CA    . ILE D 1 75  ? 21.600  -25.689  -80.343  1.00 65.28  ? 72  ILE D CA    1 
ATOM 4689  C C     . ILE D 1 75  ? 20.233  -25.036  -80.179  1.00 62.74  ? 72  ILE D C     1 
ATOM 4690  O O     . ILE D 1 75  ? 19.191  -25.694  -80.292  1.00 61.88  ? 72  ILE D O     1 
ATOM 4691  C CB    . ILE D 1 75  ? 22.298  -25.889  -78.986  1.00 64.09  ? 72  ILE D CB    1 
ATOM 4692  C CG1   . ILE D 1 75  ? 23.505  -26.816  -79.139  1.00 66.04  ? 72  ILE D CG1   1 
ATOM 4693  C CG2   . ILE D 1 75  ? 21.324  -26.450  -77.962  1.00 61.03  ? 72  ILE D CG2   1 
ATOM 4694  C CD1   . ILE D 1 75  ? 24.285  -27.013  -77.859  1.00 79.43  ? 72  ILE D CD1   1 
ATOM 4695  N N     . ASN D 1 76  ? 20.216  -23.725  -79.916  1.00 65.94  ? 73  ASN D N     1 
ATOM 4696  C CA    . ASN D 1 76  ? 18.948  -23.020  -79.751  1.00 69.28  ? 73  ASN D CA    1 
ATOM 4697  C C     . ASN D 1 76  ? 18.160  -22.976  -81.057  1.00 65.88  ? 73  ASN D C     1 
ATOM 4698  O O     . ASN D 1 76  ? 16.930  -23.108  -81.051  1.00 57.10  ? 73  ASN D O     1 
ATOM 4699  C CB    . ASN D 1 76  ? 19.197  -21.606  -79.222  1.00 71.29  ? 73  ASN D CB    1 
ATOM 4700  C CG    . ASN D 1 76  ? 19.527  -21.586  -77.740  1.00 73.07  ? 73  ASN D CG    1 
ATOM 4701  O OD1   . ASN D 1 76  ? 19.025  -22.406  -76.970  1.00 66.43  ? 73  ASN D OD1   1 
ATOM 4702  N ND2   . ASN D 1 76  ? 20.365  -20.640  -77.332  1.00 73.28  ? 73  ASN D ND2   1 
ATOM 4703  N N     . LEU D 1 77  ? 18.850  -22.787  -82.185  1.00 63.58  ? 74  LEU D N     1 
ATOM 4704  C CA    . LEU D 1 77  ? 18.197  -22.822  -83.490  1.00 57.83  ? 74  LEU D CA    1 
ATOM 4705  C C     . LEU D 1 77  ? 17.482  -24.146  -83.715  1.00 61.49  ? 74  LEU D C     1 
ATOM 4706  O O     . LEU D 1 77  ? 16.322  -24.175  -84.140  1.00 62.59  ? 74  LEU D O     1 
ATOM 4707  C CB    . LEU D 1 77  ? 19.227  -22.584  -84.594  1.00 52.42  ? 74  LEU D CB    1 
ATOM 4708  C CG    . LEU D 1 77  ? 19.657  -21.142  -84.855  1.00 62.36  ? 74  LEU D CG    1 
ATOM 4709  C CD1   . LEU D 1 77  ? 20.894  -21.105  -85.743  1.00 61.43  ? 74  LEU D CD1   1 
ATOM 4710  C CD2   . LEU D 1 77  ? 18.518  -20.355  -85.477  1.00 63.67  ? 74  LEU D CD2   1 
ATOM 4711  N N     . ALA D 1 78  ? 18.164  -25.259  -83.434  1.00 56.81  ? 75  ALA D N     1 
ATOM 4712  C CA    . ALA D 1 78  ? 17.550  -26.563  -83.652  1.00 57.75  ? 75  ALA D CA    1 
ATOM 4713  C C     . ALA D 1 78  ? 16.407  -26.799  -82.676  1.00 63.45  ? 75  ALA D C     1 
ATOM 4714  O O     . ALA D 1 78  ? 15.352  -27.322  -83.060  1.00 60.20  ? 75  ALA D O     1 
ATOM 4715  C CB    . ALA D 1 78  ? 18.599  -27.667  -83.529  1.00 63.17  ? 75  ALA D CB    1 
ATOM 4716  N N     . ASN D 1 79  ? 16.591  -26.403  -81.413  1.00 69.52  ? 76  ASN D N     1 
ATOM 4717  C CA    . ASN D 1 79  ? 15.525  -26.557  -80.432  1.00 62.44  ? 76  ASN D CA    1 
ATOM 4718  C C     . ASN D 1 79  ? 14.289  -25.755  -80.819  1.00 64.55  ? 76  ASN D C     1 
ATOM 4719  O O     . ASN D 1 79  ? 13.165  -26.195  -80.562  1.00 62.72  ? 76  ASN D O     1 
ATOM 4720  C CB    . ASN D 1 79  ? 16.029  -26.162  -79.042  1.00 62.37  ? 76  ASN D CB    1 
ATOM 4721  C CG    . ASN D 1 79  ? 16.834  -27.270  -78.376  1.00 63.57  ? 76  ASN D CG    1 
ATOM 4722  O OD1   . ASN D 1 79  ? 16.466  -28.444  -78.440  1.00 69.39  ? 76  ASN D OD1   1 
ATOM 4723  N ND2   . ASN D 1 79  ? 17.938  -26.900  -77.733  1.00 64.69  ? 76  ASN D ND2   1 
ATOM 4724  N N     . GLU D 1 80  ? 14.468  -24.591  -81.451  1.00 65.35  ? 77  GLU D N     1 
ATOM 4725  C CA    . GLU D 1 80  ? 13.314  -23.812  -81.890  1.00 71.95  ? 77  GLU D CA    1 
ATOM 4726  C C     . GLU D 1 80  ? 12.702  -24.378  -83.168  1.00 69.40  ? 77  GLU D C     1 
ATOM 4727  O O     . GLU D 1 80  ? 11.480  -24.328  -83.347  1.00 64.20  ? 77  GLU D O     1 
ATOM 4728  C CB    . GLU D 1 80  ? 13.706  -22.346  -82.096  1.00 80.98  ? 77  GLU D CB    1 
ATOM 4729  C CG    . GLU D 1 80  ? 14.072  -21.606  -80.814  1.00 87.37  ? 77  GLU D CG    1 
ATOM 4730  C CD    . GLU D 1 80  ? 12.958  -21.614  -79.782  1.00 85.58  ? 77  GLU D CD    1 
ATOM 4731  O OE1   . GLU D 1 80  ? 11.773  -21.635  -80.176  1.00 83.89  ? 77  GLU D OE1   1 
ATOM 4732  O OE2   . GLU D 1 80  ? 13.268  -21.623  -78.572  1.00 81.76  ? 77  GLU D OE2   1 
ATOM 4733  N N     . MET D 1 81  ? 13.530  -24.913  -84.070  1.00 65.54  ? 78  MET D N     1 
ATOM 4734  C CA    . MET D 1 81  ? 13.003  -25.435  -85.326  1.00 53.94  ? 78  MET D CA    1 
ATOM 4735  C C     . MET D 1 81  ? 12.197  -26.707  -85.106  1.00 62.76  ? 78  MET D C     1 
ATOM 4736  O O     . MET D 1 81  ? 11.115  -26.870  -85.683  1.00 59.83  ? 78  MET D O     1 
ATOM 4737  C CB    . MET D 1 81  ? 14.140  -25.685  -86.318  1.00 54.19  ? 78  MET D CB    1 
ATOM 4738  C CG    . MET D 1 81  ? 14.653  -24.427  -86.998  1.00 75.68  ? 78  MET D CG    1 
ATOM 4739  S SD    . MET D 1 81  ? 13.500  -23.717  -88.191  1.00 56.21  ? 78  MET D SD    1 
ATOM 4740  C CE    . MET D 1 81  ? 12.708  -25.187  -88.829  1.00 56.63  ? 78  MET D CE    1 
ATOM 4741  N N     . PHE D 1 82  ? 12.692  -27.615  -84.263  1.00 63.55  ? 79  PHE D N     1 
ATOM 4742  C CA    . PHE D 1 82  ? 12.061  -28.917  -84.104  1.00 62.94  ? 79  PHE D CA    1 
ATOM 4743  C C     . PHE D 1 82  ? 11.464  -29.146  -82.725  1.00 63.65  ? 79  PHE D C     1 
ATOM 4744  O O     . PHE D 1 82  ? 10.718  -30.115  -82.547  1.00 59.02  ? 79  PHE D O     1 
ATOM 4745  C CB    . PHE D 1 82  ? 13.075  -30.037  -84.391  1.00 60.94  ? 79  PHE D CB    1 
ATOM 4746  C CG    . PHE D 1 82  ? 13.849  -29.847  -85.665  1.00 56.44  ? 79  PHE D CG    1 
ATOM 4747  C CD1   . PHE D 1 82  ? 13.254  -30.069  -86.897  1.00 50.23  ? 79  PHE D CD1   1 
ATOM 4748  C CD2   . PHE D 1 82  ? 15.178  -29.454  -85.629  1.00 44.20  ? 79  PHE D CD2   1 
ATOM 4749  C CE1   . PHE D 1 82  ? 13.967  -29.895  -88.068  1.00 48.48  ? 79  PHE D CE1   1 
ATOM 4750  C CE2   . PHE D 1 82  ? 15.894  -29.282  -86.795  1.00 43.58  ? 79  PHE D CE2   1 
ATOM 4751  C CZ    . PHE D 1 82  ? 15.288  -29.503  -88.015  1.00 46.03  ? 79  PHE D CZ    1 
ATOM 4752  N N     . GLY D 1 83  ? 11.752  -28.292  -81.759  1.00 65.47  ? 80  GLY D N     1 
ATOM 4753  C CA    . GLY D 1 83  ? 11.332  -28.636  -80.412  1.00 68.52  ? 80  GLY D CA    1 
ATOM 4754  C C     . GLY D 1 83  ? 12.413  -29.389  -79.665  1.00 69.30  ? 80  GLY D C     1 
ATOM 4755  O O     . GLY D 1 83  ? 13.256  -30.069  -80.247  1.00 71.31  ? 80  GLY D O     1 
ATOM 4756  N N     . TYR D 1 84  ? 12.398  -29.244  -78.338  1.00 62.60  ? 81  TYR D N     1 
ATOM 4757  C CA    . TYR D 1 84  ? 13.366  -29.952  -77.504  1.00 56.35  ? 81  TYR D CA    1 
ATOM 4758  C C     . TYR D 1 84  ? 13.308  -31.463  -77.695  1.00 58.17  ? 81  TYR D C     1 
ATOM 4759  O O     . TYR D 1 84  ? 14.308  -32.147  -77.452  1.00 57.06  ? 81  TYR D O     1 
ATOM 4760  C CB    . TYR D 1 84  ? 13.146  -29.610  -76.032  1.00 69.73  ? 81  TYR D CB    1 
ATOM 4761  C CG    . TYR D 1 84  ? 11.881  -30.204  -75.463  1.00 66.72  ? 81  TYR D CG    1 
ATOM 4762  C CD1   . TYR D 1 84  ? 11.921  -31.358  -74.693  1.00 57.27  ? 81  TYR D CD1   1 
ATOM 4763  C CD2   . TYR D 1 84  ? 10.641  -29.640  -75.735  1.00 56.26  ? 81  TYR D CD2   1 
ATOM 4764  C CE1   . TYR D 1 84  ? 10.767  -31.918  -74.184  1.00 57.65  ? 81  TYR D CE1   1 
ATOM 4765  C CE2   . TYR D 1 84  ? 9.482   -30.189  -75.222  1.00 53.21  ? 81  TYR D CE2   1 
ATOM 4766  C CZ    . TYR D 1 84  ? 9.549   -31.330  -74.452  1.00 59.13  ? 81  TYR D CZ    1 
ATOM 4767  O OH    . TYR D 1 84  ? 8.396   -31.883  -73.945  1.00 56.95  ? 81  TYR D OH    1 
ATOM 4768  N N     . ASN D 1 85  ? 12.166  -31.999  -78.128  1.00 46.53  ? 82  ASN D N     1 
ATOM 4769  C CA    . ASN D 1 85  ? 11.992  -33.435  -78.320  1.00 59.29  ? 82  ASN D CA    1 
ATOM 4770  C C     . ASN D 1 85  ? 11.725  -33.787  -79.779  1.00 60.27  ? 82  ASN D C     1 
ATOM 4771  O O     . ASN D 1 85  ? 11.165  -34.850  -80.067  1.00 54.99  ? 82  ASN D O     1 
ATOM 4772  C CB    . ASN D 1 85  ? 10.863  -33.963  -77.434  1.00 63.33  ? 82  ASN D CB    1 
ATOM 4773  C CG    . ASN D 1 85  ? 9.488   -33.557  -77.934  1.00 58.73  ? 82  ASN D CG    1 
ATOM 4774  O OD1   . ASN D 1 85  ? 9.313   -32.478  -78.503  1.00 60.37  ? 82  ASN D OD1   1 
ATOM 4775  N ND2   . ASN D 1 85  ? 8.507   -34.430  -77.735  1.00 61.76  ? 82  ASN D ND2   1 
ATOM 4776  N N     . GLY D 1 86  ? 12.117  -32.919  -80.705  1.00 58.29  ? 83  GLY D N     1 
ATOM 4777  C CA    . GLY D 1 86  ? 11.851  -33.154  -82.108  1.00 63.79  ? 83  GLY D CA    1 
ATOM 4778  C C     . GLY D 1 86  ? 13.111  -33.434  -82.896  1.00 63.36  ? 83  GLY D C     1 
ATOM 4779  O O     . GLY D 1 86  ? 13.050  -33.852  -84.056  1.00 65.24  ? 83  GLY D O     1 
ATOM 4780  N N     . TRP D 1 87  ? 14.262  -33.221  -82.268  1.00 58.48  ? 84  TRP D N     1 
ATOM 4781  C CA    . TRP D 1 87  ? 15.539  -33.567  -82.864  1.00 56.96  ? 84  TRP D CA    1 
ATOM 4782  C C     . TRP D 1 87  ? 16.383  -34.298  -81.833  1.00 60.09  ? 84  TRP D C     1 
ATOM 4783  O O     . TRP D 1 87  ? 16.195  -34.137  -80.624  1.00 52.27  ? 84  TRP D O     1 
ATOM 4784  C CB    . TRP D 1 87  ? 16.283  -32.328  -83.385  1.00 45.44  ? 84  TRP D CB    1 
ATOM 4785  C CG    . TRP D 1 87  ? 16.880  -31.467  -82.317  1.00 55.91  ? 84  TRP D CG    1 
ATOM 4786  C CD1   . TRP D 1 87  ? 16.215  -30.660  -81.440  1.00 59.10  ? 84  TRP D CD1   1 
ATOM 4787  C CD2   . TRP D 1 87  ? 18.271  -31.329  -82.013  1.00 58.99  ? 84  TRP D CD2   1 
ATOM 4788  N NE1   . TRP D 1 87  ? 17.108  -30.028  -80.607  1.00 61.10  ? 84  TRP D NE1   1 
ATOM 4789  C CE2   . TRP D 1 87  ? 18.377  -30.421  -80.939  1.00 61.95  ? 84  TRP D CE2   1 
ATOM 4790  C CE3   . TRP D 1 87  ? 19.438  -31.888  -82.543  1.00 52.08  ? 84  TRP D CE3   1 
ATOM 4791  C CZ2   . TRP D 1 87  ? 19.604  -30.057  -80.385  1.00 54.20  ? 84  TRP D CZ2   1 
ATOM 4792  C CZ3   . TRP D 1 87  ? 20.654  -31.526  -81.994  1.00 59.02  ? 84  TRP D CZ3   1 
ATOM 4793  C CH2   . TRP D 1 87  ? 20.728  -30.618  -80.925  1.00 55.98  ? 84  TRP D CH2   1 
ATOM 4794  N N     . ALA D 1 88  ? 17.307  -35.115  -82.326  1.00 57.24  ? 85  ALA D N     1 
ATOM 4795  C CA    . ALA D 1 88  ? 18.171  -35.903  -81.463  1.00 48.84  ? 85  ALA D CA    1 
ATOM 4796  C C     . ALA D 1 88  ? 19.513  -36.063  -82.155  1.00 48.74  ? 85  ALA D C     1 
ATOM 4797  O O     . ALA D 1 88  ? 19.605  -35.987  -83.381  1.00 49.58  ? 85  ALA D O     1 
ATOM 4798  C CB    . ALA D 1 88  ? 17.555  -37.269  -81.148  1.00 45.35  ? 85  ALA D CB    1 
ATOM 4799  N N     . HIS D 1 89  ? 20.558  -36.285  -81.360  1.00 47.82  ? 86  HIS D N     1 
ATOM 4800  C CA    . HIS D 1 89  ? 21.866  -36.557  -81.934  1.00 42.08  ? 86  HIS D CA    1 
ATOM 4801  C C     . HIS D 1 89  ? 22.610  -37.559  -81.066  1.00 47.06  ? 86  HIS D C     1 
ATOM 4802  O O     . HIS D 1 89  ? 22.365  -37.667  -79.862  1.00 53.78  ? 86  HIS D O     1 
ATOM 4803  C CB    . HIS D 1 89  ? 22.691  -35.271  -82.099  1.00 44.39  ? 86  HIS D CB    1 
ATOM 4804  C CG    . HIS D 1 89  ? 23.321  -34.775  -80.833  1.00 52.51  ? 86  HIS D CG    1 
ATOM 4805  N ND1   . HIS D 1 89  ? 24.590  -34.241  -80.799  1.00 57.95  ? 86  HIS D ND1   1 
ATOM 4806  C CD2   . HIS D 1 89  ? 22.855  -34.716  -79.564  1.00 56.54  ? 86  HIS D CD2   1 
ATOM 4807  C CE1   . HIS D 1 89  ? 24.882  -33.879  -79.562  1.00 59.30  ? 86  HIS D CE1   1 
ATOM 4808  N NE2   . HIS D 1 89  ? 23.846  -34.158  -78.793  1.00 58.56  ? 86  HIS D NE2   1 
ATOM 4809  N N     . SER D 1 90  ? 23.513  -38.302  -81.703  1.00 52.34  ? 87  SER D N     1 
ATOM 4810  C CA    . SER D 1 90  ? 24.318  -39.309  -81.032  1.00 43.78  ? 87  SER D CA    1 
ATOM 4811  C C     . SER D 1 90  ? 25.703  -39.325  -81.661  1.00 45.75  ? 87  SER D C     1 
ATOM 4812  O O     . SER D 1 90  ? 25.879  -38.936  -82.819  1.00 46.51  ? 87  SER D O     1 
ATOM 4813  C CB    . SER D 1 90  ? 23.682  -40.704  -81.122  1.00 42.09  ? 87  SER D CB    1 
ATOM 4814  O OG    . SER D 1 90  ? 23.447  -41.071  -82.469  1.00 50.15  ? 87  SER D OG    1 
ATOM 4815  N N     . ILE D 1 91  ? 26.683  -39.777  -80.889  1.00 43.64  ? 88  ILE D N     1 
ATOM 4816  C CA    . ILE D 1 91  ? 28.057  -39.909  -81.357  1.00 41.72  ? 88  ILE D CA    1 
ATOM 4817  C C     . ILE D 1 91  ? 28.249  -41.350  -81.816  1.00 48.08  ? 88  ILE D C     1 
ATOM 4818  O O     . ILE D 1 91  ? 28.357  -42.265  -80.994  1.00 59.33  ? 88  ILE D O     1 
ATOM 4819  C CB    . ILE D 1 91  ? 29.067  -39.530  -80.267  1.00 41.87  ? 88  ILE D CB    1 
ATOM 4820  C CG1   . ILE D 1 91  ? 28.804  -38.109  -79.769  1.00 37.51  ? 88  ILE D CG1   1 
ATOM 4821  C CG2   . ILE D 1 91  ? 30.488  -39.658  -80.791  1.00 43.29  ? 88  ILE D CG2   1 
ATOM 4822  C CD1   . ILE D 1 91  ? 29.587  -37.762  -78.529  1.00 46.94  ? 88  ILE D CD1   1 
ATOM 4823  N N     . THR D 1 92  ? 28.284  -41.551  -83.136  1.00 50.64  ? 89  THR D N     1 
ATOM 4824  C CA    . THR D 1 92  ? 28.465  -42.892  -83.684  1.00 49.64  ? 89  THR D CA    1 
ATOM 4825  C C     . THR D 1 92  ? 29.844  -43.446  -83.345  1.00 48.46  ? 89  THR D C     1 
ATOM 4826  O O     . THR D 1 92  ? 29.974  -44.602  -82.922  1.00 47.54  ? 89  THR D O     1 
ATOM 4827  C CB    . THR D 1 92  ? 28.258  -42.872  -85.200  1.00 36.56  ? 89  THR D CB    1 
ATOM 4828  O OG1   . THR D 1 92  ? 26.944  -42.388  -85.504  1.00 46.04  ? 89  THR D OG1   1 
ATOM 4829  C CG2   . THR D 1 92  ? 28.417  -44.274  -85.776  1.00 46.14  ? 89  THR D CG2   1 
ATOM 4830  N N     . GLN D 1 93  ? 30.884  -42.640  -83.522  1.00 47.26  ? 90  GLN D N     1 
ATOM 4831  C CA    . GLN D 1 93  ? 32.233  -43.085  -83.210  1.00 44.61  ? 90  GLN D CA    1 
ATOM 4832  C C     . GLN D 1 93  ? 33.121  -41.857  -83.081  1.00 44.34  ? 90  GLN D C     1 
ATOM 4833  O O     . GLN D 1 93  ? 32.999  -40.915  -83.869  1.00 56.14  ? 90  GLN D O     1 
ATOM 4834  C CB    . GLN D 1 93  ? 32.754  -44.033  -84.300  1.00 44.55  ? 90  GLN D CB    1 
ATOM 4835  C CG    . GLN D 1 93  ? 34.036  -44.764  -83.956  1.00 60.12  ? 90  GLN D CG    1 
ATOM 4836  C CD    . GLN D 1 93  ? 34.557  -45.581  -85.124  1.00 64.78  ? 90  GLN D CD    1 
ATOM 4837  O OE1   . GLN D 1 93  ? 35.415  -45.122  -85.876  1.00 75.67  ? 90  GLN D OE1   1 
ATOM 4838  N NE2   . GLN D 1 93  ? 34.027  -46.793  -85.292  1.00 68.23  ? 90  GLN D NE2   1 
ATOM 4839  N N     . GLN D 1 94  ? 33.996  -41.863  -82.078  1.00 40.75  ? 91  GLN D N     1 
ATOM 4840  C CA    . GLN D 1 94  ? 35.047  -40.864  -81.942  1.00 41.18  ? 91  GLN D CA    1 
ATOM 4841  C C     . GLN D 1 94  ? 36.394  -41.564  -81.877  1.00 46.52  ? 91  GLN D C     1 
ATOM 4842  O O     . GLN D 1 94  ? 36.575  -42.496  -81.086  1.00 47.83  ? 91  GLN D O     1 
ATOM 4843  C CB    . GLN D 1 94  ? 34.837  -39.996  -80.698  1.00 44.42  ? 91  GLN D CB    1 
ATOM 4844  C CG    . GLN D 1 94  ? 36.081  -39.269  -80.228  1.00 48.27  ? 91  GLN D CG    1 
ATOM 4845  C CD    . GLN D 1 94  ? 35.760  -38.047  -79.391  1.00 47.96  ? 91  GLN D CD    1 
ATOM 4846  O OE1   . GLN D 1 94  ? 36.080  -37.989  -78.203  1.00 58.96  ? 91  GLN D OE1   1 
ATOM 4847  N NE2   . GLN D 1 94  ? 35.134  -37.055  -80.012  1.00 45.10  ? 91  GLN D NE2   1 
ATOM 4848  N N     . ASN D 1 95  ? 37.337  -41.109  -82.698  1.00 39.63  ? 92  ASN D N     1 
ATOM 4849  C CA    . ASN D 1 95  ? 38.646  -41.740  -82.817  1.00 51.15  ? 92  ASN D CA    1 
ATOM 4850  C C     . ASN D 1 95  ? 39.738  -40.686  -82.733  1.00 46.95  ? 92  ASN D C     1 
ATOM 4851  O O     . ASN D 1 95  ? 39.735  -39.722  -83.507  1.00 50.56  ? 92  ASN D O     1 
ATOM 4852  C CB    . ASN D 1 95  ? 38.765  -42.524  -84.128  1.00 48.32  ? 92  ASN D CB    1 
ATOM 4853  C CG    . ASN D 1 95  ? 40.116  -43.205  -84.275  1.00 59.09  ? 92  ASN D CG    1 
ATOM 4854  O OD1   . ASN D 1 95  ? 40.383  -44.230  -83.643  1.00 61.45  ? 92  ASN D OD1   1 
ATOM 4855  N ND2   . ASN D 1 95  ? 40.980  -42.629  -85.108  1.00 57.73  ? 92  ASN D ND2   1 
ATOM 4856  N N     . VAL D 1 96  ? 40.662  -40.864  -81.794  1.00 43.56  ? 93  VAL D N     1 
ATOM 4857  C CA    . VAL D 1 96  ? 41.836  -40.005  -81.702  1.00 43.61  ? 93  VAL D CA    1 
ATOM 4858  C C     . VAL D 1 96  ? 42.818  -40.446  -82.780  1.00 45.68  ? 93  VAL D C     1 
ATOM 4859  O O     . VAL D 1 96  ? 43.343  -41.563  -82.733  1.00 57.90  ? 93  VAL D O     1 
ATOM 4860  C CB    . VAL D 1 96  ? 42.475  -40.079  -80.308  1.00 43.76  ? 93  VAL D CB    1 
ATOM 4861  C CG1   . VAL D 1 96  ? 43.765  -39.275  -80.275  1.00 49.04  ? 93  VAL D CG1   1 
ATOM 4862  C CG2   . VAL D 1 96  ? 41.504  -39.582  -79.250  1.00 42.95  ? 93  VAL D CG2   1 
ATOM 4863  N N     . ASP D 1 97  ? 43.072  -39.568  -83.753  1.00 48.40  ? 94  ASP D N     1 
ATOM 4864  C CA    . ASP D 1 97  ? 43.925  -39.958  -84.871  1.00 54.83  ? 94  ASP D CA    1 
ATOM 4865  C C     . ASP D 1 97  ? 45.376  -40.105  -84.438  1.00 51.68  ? 94  ASP D C     1 
ATOM 4866  O O     . ASP D 1 97  ? 46.052  -41.065  -84.828  1.00 55.46  ? 94  ASP D O     1 
ATOM 4867  C CB    . ASP D 1 97  ? 43.806  -38.944  -86.008  1.00 42.56  ? 94  ASP D CB    1 
ATOM 4868  C CG    . ASP D 1 97  ? 42.546  -39.134  -86.829  1.00 52.45  ? 94  ASP D CG    1 
ATOM 4869  O OD1   . ASP D 1 97  ? 41.964  -40.236  -86.774  1.00 58.40  ? 94  ASP D OD1   1 
ATOM 4870  O OD2   . ASP D 1 97  ? 42.149  -38.191  -87.545  1.00 55.90  ? 94  ASP D OD2   1 
ATOM 4871  N N     . PHE D 1 98  ? 45.870  -39.180  -83.624  1.00 51.62  ? 95  PHE D N     1 
ATOM 4872  C CA    . PHE D 1 98  ? 47.262  -39.225  -83.208  1.00 50.31  ? 95  PHE D CA    1 
ATOM 4873  C C     . PHE D 1 98  ? 47.443  -38.338  -81.990  1.00 48.92  ? 95  PHE D C     1 
ATOM 4874  O O     . PHE D 1 98  ? 46.654  -37.424  -81.741  1.00 46.76  ? 95  PHE D O     1 
ATOM 4875  C CB    . PHE D 1 98  ? 48.203  -38.785  -84.336  1.00 51.14  ? 95  PHE D CB    1 
ATOM 4876  C CG    . PHE D 1 98  ? 47.981  -37.371  -84.797  1.00 52.62  ? 95  PHE D CG    1 
ATOM 4877  C CD1   . PHE D 1 98  ? 48.682  -36.319  -84.229  1.00 57.52  ? 95  PHE D CD1   1 
ATOM 4878  C CD2   . PHE D 1 98  ? 47.078  -37.094  -85.809  1.00 54.09  ? 95  PHE D CD2   1 
ATOM 4879  C CE1   . PHE D 1 98  ? 48.478  -35.019  -84.656  1.00 52.19  ? 95  PHE D CE1   1 
ATOM 4880  C CE2   . PHE D 1 98  ? 46.871  -35.796  -86.239  1.00 60.28  ? 95  PHE D CE2   1 
ATOM 4881  C CZ    . PHE D 1 98  ? 47.571  -34.759  -85.662  1.00 55.92  ? 95  PHE D CZ    1 
ATOM 4882  N N     . VAL D 1 99  ? 48.484  -38.645  -81.221  1.00 54.76  ? 96  VAL D N     1 
ATOM 4883  C CA    . VAL D 1 99  ? 48.957  -37.772  -80.155  1.00 55.04  ? 96  VAL D CA    1 
ATOM 4884  C C     . VAL D 1 99  ? 50.477  -37.744  -80.247  1.00 57.86  ? 96  VAL D C     1 
ATOM 4885  O O     . VAL D 1 99  ? 51.151  -38.708  -79.870  1.00 69.83  ? 96  VAL D O     1 
ATOM 4886  C CB    . VAL D 1 99  ? 48.481  -38.252  -78.771  1.00 47.16  ? 96  VAL D CB    1 
ATOM 4887  C CG1   . VAL D 1 99  ? 49.084  -37.392  -77.681  1.00 47.67  ? 96  VAL D CG1   1 
ATOM 4888  C CG2   . VAL D 1 99  ? 46.964  -38.231  -78.683  1.00 49.88  ? 96  VAL D CG2   1 
ATOM 4889  N N     . ASP D 1 100 ? 51.025  -36.643  -80.751  1.00 52.24  ? 97  ASP D N     1 
ATOM 4890  C CA    . ASP D 1 100 ? 52.457  -36.517  -80.968  1.00 58.26  ? 97  ASP D CA    1 
ATOM 4891  C C     . ASP D 1 100 ? 53.047  -35.460  -80.045  1.00 64.77  ? 97  ASP D C     1 
ATOM 4892  O O     . ASP D 1 100 ? 52.394  -34.474  -79.691  1.00 61.94  ? 97  ASP D O     1 
ATOM 4893  C CB    . ASP D 1 100 ? 52.760  -36.183  -82.431  1.00 57.02  ? 97  ASP D CB    1 
ATOM 4894  C CG    . ASP D 1 100 ? 52.404  -37.324  -83.366  1.00 64.22  ? 97  ASP D CG    1 
ATOM 4895  O OD1   . ASP D 1 100 ? 52.702  -38.486  -83.017  1.00 76.03  ? 97  ASP D OD1   1 
ATOM 4896  O OD2   . ASP D 1 100 ? 51.819  -37.067  -84.436  1.00 60.71  ? 97  ASP D OD2   1 
ATOM 4897  N N     . LEU D 1 101 ? 54.295  -35.692  -79.651  1.00 59.19  ? 98  LEU D N     1 
ATOM 4898  C CA    . LEU D 1 101 ? 55.023  -34.830  -78.729  1.00 49.38  ? 98  LEU D CA    1 
ATOM 4899  C C     . LEU D 1 101 ? 56.268  -34.293  -79.422  1.00 65.13  ? 98  LEU D C     1 
ATOM 4900  O O     . LEU D 1 101 ? 57.170  -35.062  -79.769  1.00 73.22  ? 98  LEU D O     1 
ATOM 4901  C CB    . LEU D 1 101 ? 55.393  -35.594  -77.458  1.00 50.77  ? 98  LEU D CB    1 
ATOM 4902  C CG    . LEU D 1 101 ? 56.223  -34.845  -76.416  1.00 59.47  ? 98  LEU D CG    1 
ATOM 4903  C CD1   . LEU D 1 101 ? 55.530  -33.560  -76.001  1.00 65.59  ? 98  LEU D CD1   1 
ATOM 4904  C CD2   . LEU D 1 101 ? 56.470  -35.734  -75.216  1.00 41.52  ? 98  LEU D CD2   1 
ATOM 4905  N N     . ASN D 1 102 ? 56.319  -32.981  -79.636  1.00 70.83  ? 99  ASN D N     1 
ATOM 4906  C CA    . ASN D 1 102 ? 57.484  -32.342  -80.235  1.00 73.81  ? 99  ASN D CA    1 
ATOM 4907  C C     . ASN D 1 102 ? 58.033  -31.348  -79.224  1.00 82.38  ? 99  ASN D C     1 
ATOM 4908  O O     . ASN D 1 102 ? 57.440  -30.286  -79.008  1.00 77.32  ? 99  ASN D O     1 
ATOM 4909  C CB    . ASN D 1 102 ? 57.133  -31.663  -81.558  1.00 72.90  ? 99  ASN D CB    1 
ATOM 4910  C CG    . ASN D 1 102 ? 57.112  -32.635  -82.712  1.00 97.14  ? 99  ASN D CG    1 
ATOM 4911  O OD1   . ASN D 1 102 ? 57.979  -33.505  -82.811  1.00 102.80 ? 99  ASN D OD1   1 
ATOM 4912  N ND2   . ASN D 1 102 ? 56.136  -32.486  -83.603  1.00 96.85  ? 99  ASN D ND2   1 
ATOM 4913  N N     . ASN D 1 103 ? 59.174  -31.695  -78.633  1.00 93.22  ? 100 ASN D N     1 
ATOM 4914  C CA    . ASN D 1 103 ? 59.863  -30.903  -77.615  1.00 105.15 ? 100 ASN D CA    1 
ATOM 4915  C C     . ASN D 1 103 ? 58.884  -30.225  -76.658  1.00 95.87  ? 100 ASN D C     1 
ATOM 4916  O O     . ASN D 1 103 ? 58.795  -29.001  -76.573  1.00 102.21 ? 100 ASN D O     1 
ATOM 4917  C CB    . ASN D 1 103 ? 60.801  -29.879  -78.244  1.00 118.13 ? 100 ASN D CB    1 
ATOM 4918  C CG    . ASN D 1 103 ? 61.716  -29.229  -77.217  1.00 137.13 ? 100 ASN D CG    1 
ATOM 4919  O OD1   . ASN D 1 103 ? 62.803  -29.736  -76.913  1.00 135.48 ? 100 ASN D OD1   1 
ATOM 4920  N ND2   . ASN D 1 103 ? 61.271  -28.106  -76.666  1.00 139.79 ? 100 ASN D ND2   1 
ATOM 4921  N N     . GLY D 1 104 ? 58.102  -31.052  -75.970  1.00 79.50  ? 101 GLY D N     1 
ATOM 4922  C CA    . GLY D 1 104 ? 57.281  -30.587  -74.867  1.00 60.18  ? 101 GLY D CA    1 
ATOM 4923  C C     . GLY D 1 104 ? 55.908  -30.055  -75.223  1.00 62.12  ? 101 GLY D C     1 
ATOM 4924  O O     . GLY D 1 104 ? 55.153  -29.687  -74.313  1.00 69.12  ? 101 GLY D O     1 
ATOM 4925  N N     . LYS D 1 105 ? 55.550  -30.006  -76.501  1.00 68.64  ? 102 LYS D N     1 
ATOM 4926  C CA    . LYS D 1 105 ? 54.234  -29.544  -76.917  1.00 69.67  ? 102 LYS D CA    1 
ATOM 4927  C C     . LYS D 1 105 ? 53.476  -30.687  -77.575  1.00 65.51  ? 102 LYS D C     1 
ATOM 4928  O O     . LYS D 1 105 ? 54.061  -31.497  -78.302  1.00 68.96  ? 102 LYS D O     1 
ATOM 4929  C CB    . LYS D 1 105 ? 54.327  -28.346  -77.871  1.00 79.91  ? 102 LYS D CB    1 
ATOM 4930  C CG    . LYS D 1 105 ? 55.003  -27.122  -77.272  1.00 80.10  ? 102 LYS D CG    1 
ATOM 4931  C CD    . LYS D 1 105 ? 54.998  -25.972  -78.263  1.00 93.19  ? 102 LYS D CD    1 
ATOM 4932  C CE    . LYS D 1 105 ? 54.974  -24.631  -77.544  1.00 105.03 ? 102 LYS D CE    1 
ATOM 4933  N NZ    . LYS D 1 105 ? 54.955  -23.482  -78.495  1.00 104.13 ? 102 LYS D NZ    1 
ATOM 4934  N N     . PHE D 1 106 ? 52.168  -30.729  -77.341  1.00 64.81  ? 103 PHE D N     1 
ATOM 4935  C CA    . PHE D 1 106 ? 51.323  -31.823  -77.799  1.00 65.29  ? 103 PHE D CA    1 
ATOM 4936  C C     . PHE D 1 106 ? 50.498  -31.399  -79.004  1.00 63.40  ? 103 PHE D C     1 
ATOM 4937  O O     . PHE D 1 106 ? 49.957  -30.290  -79.043  1.00 64.85  ? 103 PHE D O     1 
ATOM 4938  C CB    . PHE D 1 106 ? 50.397  -32.297  -76.679  1.00 57.22  ? 103 PHE D CB    1 
ATOM 4939  C CG    . PHE D 1 106 ? 51.090  -33.116  -75.633  1.00 64.29  ? 103 PHE D CG    1 
ATOM 4940  C CD1   . PHE D 1 106 ? 51.509  -34.404  -75.912  1.00 63.77  ? 103 PHE D CD1   1 
ATOM 4941  C CD2   . PHE D 1 106 ? 51.338  -32.593  -74.376  1.00 68.22  ? 103 PHE D CD2   1 
ATOM 4942  C CE1   . PHE D 1 106 ? 52.156  -35.159  -74.955  1.00 66.13  ? 103 PHE D CE1   1 
ATOM 4943  C CE2   . PHE D 1 106 ? 51.984  -33.342  -73.414  1.00 64.34  ? 103 PHE D CE2   1 
ATOM 4944  C CZ    . PHE D 1 106 ? 52.393  -34.628  -73.703  1.00 59.45  ? 103 PHE D CZ    1 
ATOM 4945  N N     . TYR D 1 107 ? 50.406  -32.293  -79.986  1.00 55.94  ? 104 TYR D N     1 
ATOM 4946  C CA    . TYR D 1 107 ? 49.672  -32.038  -81.219  1.00 61.91  ? 104 TYR D CA    1 
ATOM 4947  C C     . TYR D 1 107 ? 48.692  -33.186  -81.397  1.00 55.85  ? 104 TYR D C     1 
ATOM 4948  O O     . TYR D 1 107 ? 49.110  -34.334  -81.582  1.00 57.58  ? 104 TYR D O     1 
ATOM 4949  C CB    . TYR D 1 107 ? 50.614  -31.929  -82.432  1.00 59.75  ? 104 TYR D CB    1 
ATOM 4950  C CG    . TYR D 1 107 ? 51.746  -30.918  -82.293  1.00 72.51  ? 104 TYR D CG    1 
ATOM 4951  C CD1   . TYR D 1 107 ? 52.708  -31.045  -81.293  1.00 72.06  ? 104 TYR D CD1   1 
ATOM 4952  C CD2   . TYR D 1 107 ? 51.836  -29.823  -83.142  1.00 68.88  ? 104 TYR D CD2   1 
ATOM 4953  C CE1   . TYR D 1 107 ? 53.728  -30.129  -81.154  1.00 67.13  ? 104 TYR D CE1   1 
ATOM 4954  C CE2   . TYR D 1 107 ? 52.860  -28.897  -83.008  1.00 79.57  ? 104 TYR D CE2   1 
ATOM 4955  C CZ    . TYR D 1 107 ? 53.802  -29.057  -82.011  1.00 74.85  ? 104 TYR D CZ    1 
ATOM 4956  O OH    . TYR D 1 107 ? 54.822  -28.141  -81.872  1.00 75.99  ? 104 TYR D OH    1 
ATOM 4957  N N     . VAL D 1 108 ? 47.395  -32.883  -81.340  1.00 50.27  ? 105 VAL D N     1 
ATOM 4958  C CA    . VAL D 1 108 ? 46.355  -33.900  -81.239  1.00 48.84  ? 105 VAL D CA    1 
ATOM 4959  C C     . VAL D 1 108 ? 45.301  -33.645  -82.307  1.00 54.33  ? 105 VAL D C     1 
ATOM 4960  O O     . VAL D 1 108 ? 44.829  -32.513  -82.461  1.00 59.72  ? 105 VAL D O     1 
ATOM 4961  C CB    . VAL D 1 108 ? 45.705  -33.915  -79.842  1.00 56.41  ? 105 VAL D CB    1 
ATOM 4962  C CG1   . VAL D 1 108 ? 44.557  -34.915  -79.800  1.00 50.77  ? 105 VAL D CG1   1 
ATOM 4963  C CG2   . VAL D 1 108 ? 46.740  -34.229  -78.768  1.00 52.94  ? 105 VAL D CG2   1 
ATOM 4964  N N     . GLY D 1 109 ? 44.930  -34.696  -83.033  1.00 58.44  ? 106 GLY D N     1 
ATOM 4965  C CA    . GLY D 1 109 ? 43.803  -34.644  -83.944  1.00 50.63  ? 106 GLY D CA    1 
ATOM 4966  C C     . GLY D 1 109 ? 42.755  -35.680  -83.592  1.00 46.09  ? 106 GLY D C     1 
ATOM 4967  O O     . GLY D 1 109 ? 43.085  -36.849  -83.371  1.00 48.65  ? 106 GLY D O     1 
ATOM 4968  N N     . VAL D 1 110 ? 41.490  -35.268  -83.526  1.00 39.62  ? 107 VAL D N     1 
ATOM 4969  C CA    . VAL D 1 110 ? 40.396  -36.145  -83.121  1.00 48.74  ? 107 VAL D CA    1 
ATOM 4970  C C     . VAL D 1 110 ? 39.219  -35.925  -84.060  1.00 52.58  ? 107 VAL D C     1 
ATOM 4971  O O     . VAL D 1 110 ? 38.813  -34.783  -84.296  1.00 54.54  ? 107 VAL D O     1 
ATOM 4972  C CB    . VAL D 1 110 ? 39.964  -35.898  -81.660  1.00 45.41  ? 107 VAL D CB    1 
ATOM 4973  C CG1   . VAL D 1 110 ? 38.682  -36.653  -81.350  1.00 46.66  ? 107 VAL D CG1   1 
ATOM 4974  C CG2   . VAL D 1 110 ? 41.070  -36.308  -80.699  1.00 50.41  ? 107 VAL D CG2   1 
ATOM 4975  N N     . CYS D 1 111 ? 38.680  -37.014  -84.601  1.00 54.18  ? 108 CYS D N     1 
ATOM 4976  C CA    . CYS D 1 111 ? 37.477  -36.977  -85.417  1.00 51.31  ? 108 CYS D CA    1 
ATOM 4977  C C     . CYS D 1 111 ? 36.306  -37.580  -84.653  1.00 49.19  ? 108 CYS D C     1 
ATOM 4978  O O     . CYS D 1 111 ? 36.481  -38.459  -83.803  1.00 54.27  ? 108 CYS D O     1 
ATOM 4979  C CB    . CYS D 1 111 ? 37.679  -37.731  -86.736  1.00 47.80  ? 108 CYS D CB    1 
ATOM 4980  S SG    . CYS D 1 111 ? 37.847  -39.518  -86.562  1.00 61.30  ? 108 CYS D SG    1 
ATOM 4981  N N     . ALA D 1 112 ? 35.104  -37.103  -84.969  1.00 47.10  ? 109 ALA D N     1 
ATOM 4982  C CA    . ALA D 1 112 ? 33.882  -37.625  -84.381  1.00 41.18  ? 109 ALA D CA    1 
ATOM 4983  C C     . ALA D 1 112 ? 32.829  -37.735  -85.471  1.00 47.17  ? 109 ALA D C     1 
ATOM 4984  O O     . ALA D 1 112 ? 32.777  -36.909  -86.385  1.00 52.51  ? 109 ALA D O     1 
ATOM 4985  C CB    . ALA D 1 112 ? 33.371  -36.737  -83.238  1.00 34.98  ? 109 ALA D CB    1 
ATOM 4986  N N     . PHE D 1 113 ? 31.984  -38.756  -85.371  1.00 39.30  ? 110 PHE D N     1 
ATOM 4987  C CA    . PHE D 1 113 ? 30.918  -38.959  -86.344  1.00 39.02  ? 110 PHE D CA    1 
ATOM 4988  C C     . PHE D 1 113 ? 29.601  -38.791  -85.598  1.00 45.00  ? 110 PHE D C     1 
ATOM 4989  O O     . PHE D 1 113 ? 29.216  -39.660  -84.809  1.00 46.93  ? 110 PHE D O     1 
ATOM 4990  C CB    . PHE D 1 113 ? 30.999  -40.335  -87.009  1.00 37.54  ? 110 PHE D CB    1 
ATOM 4991  C CG    . PHE D 1 113 ? 32.305  -40.599  -87.711  1.00 39.35  ? 110 PHE D CG    1 
ATOM 4992  C CD1   . PHE D 1 113 ? 33.460  -40.846  -86.982  1.00 40.87  ? 110 PHE D CD1   1 
ATOM 4993  C CD2   . PHE D 1 113 ? 32.396  -40.527  -89.091  1.00 45.06  ? 110 PHE D CD2   1 
ATOM 4994  C CE1   . PHE D 1 113 ? 34.666  -41.076  -87.617  1.00 49.66  ? 110 PHE D CE1   1 
ATOM 4995  C CE2   . PHE D 1 113 ? 33.607  -40.743  -89.734  1.00 40.59  ? 110 PHE D CE2   1 
ATOM 4996  C CZ    . PHE D 1 113 ? 34.741  -41.018  -88.995  1.00 51.08  ? 110 PHE D CZ    1 
ATOM 4997  N N     . VAL D 1 114 ? 28.907  -37.686  -85.864  1.00 46.13  ? 111 VAL D N     1 
ATOM 4998  C CA    . VAL D 1 114 ? 27.679  -37.324  -85.163  1.00 46.52  ? 111 VAL D CA    1 
ATOM 4999  C C     . VAL D 1 114 ? 26.510  -37.483  -86.126  1.00 44.78  ? 111 VAL D C     1 
ATOM 5000  O O     . VAL D 1 114 ? 26.565  -37.003  -87.264  1.00 47.26  ? 111 VAL D O     1 
ATOM 5001  C CB    . VAL D 1 114 ? 27.750  -35.886  -84.619  1.00 40.54  ? 111 VAL D CB    1 
ATOM 5002  C CG1   . VAL D 1 114 ? 26.463  -35.519  -83.905  1.00 52.43  ? 111 VAL D CG1   1 
ATOM 5003  C CG2   . VAL D 1 114 ? 28.946  -35.729  -83.697  1.00 40.41  ? 111 VAL D CG2   1 
ATOM 5004  N N     . ARG D 1 115 ? 25.446  -38.138  -85.664  1.00 46.81  ? 112 ARG D N     1 
ATOM 5005  C CA    . ARG D 1 115 ? 24.258  -38.377  -86.475  1.00 50.47  ? 112 ARG D CA    1 
ATOM 5006  C C     . ARG D 1 115 ? 23.052  -37.732  -85.808  1.00 55.01  ? 112 ARG D C     1 
ATOM 5007  O O     . ARG D 1 115 ? 22.666  -38.124  -84.702  1.00 47.00  ? 112 ARG D O     1 
ATOM 5008  C CB    . ARG D 1 115 ? 24.023  -39.875  -86.678  1.00 44.57  ? 112 ARG D CB    1 
ATOM 5009  C CG    . ARG D 1 115 ? 22.689  -40.209  -87.321  1.00 43.55  ? 112 ARG D CG    1 
ATOM 5010  C CD    . ARG D 1 115 ? 22.508  -41.708  -87.454  1.00 45.76  ? 112 ARG D CD    1 
ATOM 5011  N NE    . ARG D 1 115 ? 21.104  -42.091  -87.367  1.00 51.72  ? 112 ARG D NE    1 
ATOM 5012  C CZ    . ARG D 1 115 ? 20.536  -43.031  -88.116  1.00 65.85  ? 112 ARG D CZ    1 
ATOM 5013  N NH1   . ARG D 1 115 ? 21.254  -43.689  -89.021  1.00 54.18  ? 112 ARG D NH1   1 
ATOM 5014  N NH2   . ARG D 1 115 ? 19.248  -43.310  -87.962  1.00 61.41  ? 112 ARG D NH2   1 
ATOM 5015  N N     . VAL D 1 116 ? 22.455  -36.754  -86.487  1.00 50.66  ? 113 VAL D N     1 
ATOM 5016  C CA    . VAL D 1 116 ? 21.251  -36.078  -86.016  1.00 44.59  ? 113 VAL D CA    1 
ATOM 5017  C C     . VAL D 1 116 ? 20.032  -36.782  -86.591  1.00 48.11  ? 113 VAL D C     1 
ATOM 5018  O O     . VAL D 1 116 ? 20.022  -37.173  -87.762  1.00 51.53  ? 113 VAL D O     1 
ATOM 5019  C CB    . VAL D 1 116 ? 21.268  -34.589  -86.411  1.00 46.29  ? 113 VAL D CB    1 
ATOM 5020  C CG1   . VAL D 1 116 ? 19.964  -33.914  -86.017  1.00 43.64  ? 113 VAL D CG1   1 
ATOM 5021  C CG2   . VAL D 1 116 ? 22.439  -33.890  -85.758  1.00 47.69  ? 113 VAL D CG2   1 
ATOM 5022  N N     . GLN D 1 117 ? 18.996  -36.941  -85.768  1.00 46.18  ? 114 GLN D N     1 
ATOM 5023  C CA    . GLN D 1 117 ? 17.753  -37.574  -86.185  1.00 49.54  ? 114 GLN D CA    1 
ATOM 5024  C C     . GLN D 1 117 ? 16.568  -36.710  -85.782  1.00 55.33  ? 114 GLN D C     1 
ATOM 5025  O O     . GLN D 1 117 ? 16.554  -36.124  -84.694  1.00 62.88  ? 114 GLN D O     1 
ATOM 5026  C CB    . GLN D 1 117 ? 17.598  -38.967  -85.563  1.00 39.91  ? 114 GLN D CB    1 
ATOM 5027  C CG    . GLN D 1 117 ? 16.417  -39.760  -86.105  1.00 46.15  ? 114 GLN D CG    1 
ATOM 5028  C CD    . GLN D 1 117 ? 16.171  -41.039  -85.327  1.00 54.24  ? 114 GLN D CD    1 
ATOM 5029  O OE1   . GLN D 1 117 ? 17.111  -41.712  -84.901  1.00 61.99  ? 114 GLN D OE1   1 
ATOM 5030  N NE2   . GLN D 1 117 ? 14.901  -41.386  -85.144  1.00 60.37  ? 114 GLN D NE2   1 
ATOM 5031  N N     . LEU D 1 118 ? 15.570  -36.645  -86.658  1.00 51.43  ? 115 LEU D N     1 
ATOM 5032  C CA    . LEU D 1 118 ? 14.324  -35.948  -86.380  1.00 52.02  ? 115 LEU D CA    1 
ATOM 5033  C C     . LEU D 1 118 ? 13.286  -36.930  -85.850  1.00 53.56  ? 115 LEU D C     1 
ATOM 5034  O O     . LEU D 1 118 ? 13.459  -38.150  -85.903  1.00 59.63  ? 115 LEU D O     1 
ATOM 5035  C CB    . LEU D 1 118 ? 13.792  -35.244  -87.631  1.00 52.35  ? 115 LEU D CB    1 
ATOM 5036  C CG    . LEU D 1 118 ? 14.687  -34.188  -88.271  1.00 50.00  ? 115 LEU D CG    1 
ATOM 5037  C CD1   . LEU D 1 118 ? 13.960  -33.533  -89.432  1.00 59.67  ? 115 LEU D CD1   1 
ATOM 5038  C CD2   . LEU D 1 118 ? 15.120  -33.165  -87.239  1.00 46.01  ? 115 LEU D CD2   1 
ATOM 5039  N N     . LYS D 1 119 ? 12.190  -36.375  -85.330  1.00 61.35  ? 116 LYS D N     1 
ATOM 5040  C CA    . LYS D 1 119 ? 11.166  -37.206  -84.710  1.00 59.44  ? 116 LYS D CA    1 
ATOM 5041  C C     . LYS D 1 119 ? 10.426  -38.091  -85.706  1.00 65.88  ? 116 LYS D C     1 
ATOM 5042  O O     . LYS D 1 119 ? 9.613   -38.917  -85.278  1.00 59.86  ? 116 LYS D O     1 
ATOM 5043  C CB    . LYS D 1 119 ? 10.161  -36.339  -83.945  1.00 56.16  ? 116 LYS D CB    1 
ATOM 5044  C CG    . LYS D 1 119 ? 9.283   -35.456  -84.815  1.00 66.66  ? 116 LYS D CG    1 
ATOM 5045  C CD    . LYS D 1 119 ? 8.197   -34.795  -83.976  1.00 71.52  ? 116 LYS D CD    1 
ATOM 5046  C CE    . LYS D 1 119 ? 7.470   -33.714  -84.752  1.00 68.42  ? 116 LYS D CE    1 
ATOM 5047  N NZ    . LYS D 1 119 ? 6.481   -33.000  -83.903  1.00 70.93  ? 116 LYS D NZ    1 
ATOM 5048  N N     . ASP D 1 120 ? 10.673  -37.943  -87.009  1.00 65.01  ? 117 ASP D N     1 
ATOM 5049  C CA    . ASP D 1 120 ? 10.046  -38.791  -88.014  1.00 56.64  ? 117 ASP D CA    1 
ATOM 5050  C C     . ASP D 1 120 ? 10.975  -39.860  -88.567  1.00 63.02  ? 117 ASP D C     1 
ATOM 5051  O O     . ASP D 1 120 ? 10.569  -40.603  -89.465  1.00 67.53  ? 117 ASP D O     1 
ATOM 5052  C CB    . ASP D 1 120 ? 9.503   -37.942  -89.169  1.00 52.93  ? 117 ASP D CB    1 
ATOM 5053  C CG    . ASP D 1 120 ? 10.596  -37.426  -90.080  1.00 62.00  ? 117 ASP D CG    1 
ATOM 5054  O OD1   . ASP D 1 120 ? 11.672  -37.050  -89.569  1.00 67.93  ? 117 ASP D OD1   1 
ATOM 5055  O OD2   . ASP D 1 120 ? 10.384  -37.410  -91.311  1.00 64.32  ? 117 ASP D OD2   1 
ATOM 5056  N N     . GLY D 1 121 ? 12.192  -39.976  -88.039  1.00 58.89  ? 118 GLY D N     1 
ATOM 5057  C CA    . GLY D 1 121 ? 13.166  -40.927  -88.515  1.00 56.28  ? 118 GLY D CA    1 
ATOM 5058  C C     . GLY D 1 121 ? 14.181  -40.355  -89.483  1.00 57.33  ? 118 GLY D C     1 
ATOM 5059  O O     . GLY D 1 121 ? 15.215  -40.993  -89.721  1.00 59.96  ? 118 GLY D O     1 
ATOM 5060  N N     . SER D 1 122 ? 13.907  -39.183  -90.056  1.00 52.30  ? 119 SER D N     1 
ATOM 5061  C CA    . SER D 1 122 ? 14.876  -38.527  -90.923  1.00 54.24  ? 119 SER D CA    1 
ATOM 5062  C C     . SER D 1 122 ? 16.179  -38.297  -90.169  1.00 50.85  ? 119 SER D C     1 
ATOM 5063  O O     . SER D 1 122 ? 16.179  -37.994  -88.973  1.00 55.74  ? 119 SER D O     1 
ATOM 5064  C CB    . SER D 1 122 ? 14.320  -37.197  -91.435  1.00 57.06  ? 119 SER D CB    1 
ATOM 5065  O OG    . SER D 1 122 ? 15.266  -36.530  -92.255  1.00 67.66  ? 119 SER D OG    1 
ATOM 5066  N N     . TYR D 1 123 ? 17.297  -38.445  -90.874  1.00 48.05  ? 120 TYR D N     1 
ATOM 5067  C CA    . TYR D 1 123 ? 18.600  -38.387  -90.232  1.00 44.79  ? 120 TYR D CA    1 
ATOM 5068  C C     . TYR D 1 123 ? 19.616  -37.733  -91.155  1.00 49.40  ? 120 TYR D C     1 
ATOM 5069  O O     . TYR D 1 123 ? 19.484  -37.771  -92.379  1.00 52.22  ? 120 TYR D O     1 
ATOM 5070  C CB    . TYR D 1 123 ? 19.080  -39.791  -89.825  1.00 49.88  ? 120 TYR D CB    1 
ATOM 5071  C CG    . TYR D 1 123 ? 19.181  -40.782  -90.970  1.00 43.32  ? 120 TYR D CG    1 
ATOM 5072  C CD1   . TYR D 1 123 ? 20.340  -40.887  -91.731  1.00 38.65  ? 120 TYR D CD1   1 
ATOM 5073  C CD2   . TYR D 1 123 ? 18.120  -41.627  -91.278  1.00 48.95  ? 120 TYR D CD2   1 
ATOM 5074  C CE1   . TYR D 1 123 ? 20.434  -41.799  -92.775  1.00 45.62  ? 120 TYR D CE1   1 
ATOM 5075  C CE2   . TYR D 1 123 ? 18.205  -42.541  -92.318  1.00 42.23  ? 120 TYR D CE2   1 
ATOM 5076  C CZ    . TYR D 1 123 ? 19.364  -42.623  -93.063  1.00 43.52  ? 120 TYR D CZ    1 
ATOM 5077  O OH    . TYR D 1 123 ? 19.452  -43.530  -94.096  1.00 43.89  ? 120 TYR D OH    1 
ATOM 5078  N N     . HIS D 1 124 ? 20.633  -37.126  -90.546  1.00 43.82  ? 121 HIS D N     1 
ATOM 5079  C CA    . HIS D 1 124 ? 21.792  -36.627  -91.272  1.00 51.93  ? 121 HIS D CA    1 
ATOM 5080  C C     . HIS D 1 124 ? 23.012  -36.835  -90.390  1.00 48.99  ? 121 HIS D C     1 
ATOM 5081  O O     . HIS D 1 124 ? 23.003  -36.438  -89.221  1.00 54.53  ? 121 HIS D O     1 
ATOM 5082  C CB    . HIS D 1 124 ? 21.633  -35.145  -91.648  1.00 58.87  ? 121 HIS D CB    1 
ATOM 5083  C CG    . HIS D 1 124 ? 20.641  -34.901  -92.745  1.00 58.79  ? 121 HIS D CG    1 
ATOM 5084  N ND1   . HIS D 1 124 ? 20.703  -35.537  -93.966  1.00 59.51  ? 121 HIS D ND1   1 
ATOM 5085  C CD2   . HIS D 1 124 ? 19.565  -34.082  -92.804  1.00 58.39  ? 121 HIS D CD2   1 
ATOM 5086  C CE1   . HIS D 1 124 ? 19.705  -35.125  -94.727  1.00 52.53  ? 121 HIS D CE1   1 
ATOM 5087  N NE2   . HIS D 1 124 ? 19.000  -34.240  -94.046  1.00 57.86  ? 121 HIS D NE2   1 
ATOM 5088  N N     . GLU D 1 125 ? 24.050  -37.456  -90.943  1.00 50.56  ? 122 GLU D N     1 
ATOM 5089  C CA    . GLU D 1 125 ? 25.267  -37.771  -90.207  1.00 47.34  ? 122 GLU D CA    1 
ATOM 5090  C C     . GLU D 1 125 ? 26.465  -37.160  -90.924  1.00 45.97  ? 122 GLU D C     1 
ATOM 5091  O O     . GLU D 1 125 ? 26.562  -37.225  -92.153  1.00 56.19  ? 122 GLU D O     1 
ATOM 5092  C CB    . GLU D 1 125 ? 25.422  -39.294  -90.059  1.00 45.95  ? 122 GLU D CB    1 
ATOM 5093  C CG    . GLU D 1 125 ? 26.668  -39.754  -89.316  1.00 48.10  ? 122 GLU D CG    1 
ATOM 5094  C CD    . GLU D 1 125 ? 26.715  -41.266  -89.128  1.00 59.83  ? 122 GLU D CD    1 
ATOM 5095  O OE1   . GLU D 1 125 ? 26.026  -41.989  -89.882  1.00 55.31  ? 122 GLU D OE1   1 
ATOM 5096  O OE2   . GLU D 1 125 ? 27.433  -41.731  -88.216  1.00 62.40  ? 122 GLU D OE2   1 
ATOM 5097  N N     . ASP D 1 126 ? 27.381  -36.570  -90.157  1.00 36.44  ? 123 ASP D N     1 
ATOM 5098  C CA    . ASP D 1 126 ? 28.550  -35.920  -90.733  1.00 48.68  ? 123 ASP D CA    1 
ATOM 5099  C C     . ASP D 1 126 ? 29.727  -36.065  -89.774  1.00 49.88  ? 123 ASP D C     1 
ATOM 5100  O O     . ASP D 1 126 ? 29.591  -36.584  -88.662  1.00 40.36  ? 123 ASP D O     1 
ATOM 5101  C CB    . ASP D 1 126 ? 28.240  -34.451  -91.043  1.00 57.78  ? 123 ASP D CB    1 
ATOM 5102  C CG    . ASP D 1 126 ? 28.913  -33.965  -92.311  1.00 58.03  ? 123 ASP D CG    1 
ATOM 5103  O OD1   . ASP D 1 126 ? 30.156  -34.043  -92.397  1.00 53.24  ? 123 ASP D OD1   1 
ATOM 5104  O OD2   . ASP D 1 126 ? 28.192  -33.506  -93.223  1.00 62.28  ? 123 ASP D OD2   1 
ATOM 5105  N N     . VAL D 1 127 ? 30.890  -35.580  -90.206  1.00 50.99  ? 124 VAL D N     1 
ATOM 5106  C CA    . VAL D 1 127 ? 32.133  -35.711  -89.455  1.00 45.90  ? 124 VAL D CA    1 
ATOM 5107  C C     . VAL D 1 127 ? 32.522  -34.354  -88.895  1.00 51.79  ? 124 VAL D C     1 
ATOM 5108  O O     . VAL D 1 127 ? 32.437  -33.337  -89.591  1.00 64.18  ? 124 VAL D O     1 
ATOM 5109  C CB    . VAL D 1 127 ? 33.273  -36.265  -90.331  1.00 46.49  ? 124 VAL D CB    1 
ATOM 5110  C CG1   . VAL D 1 127 ? 34.535  -36.470  -89.506  1.00 53.86  ? 124 VAL D CG1   1 
ATOM 5111  C CG2   . VAL D 1 127 ? 32.855  -37.550  -90.965  1.00 65.52  ? 124 VAL D CG2   1 
ATOM 5112  N N     . GLY D 1 128 ? 32.958  -34.344  -87.639  1.00 51.08  ? 125 GLY D N     1 
ATOM 5113  C CA    . GLY D 1 128 ? 33.617  -33.183  -87.083  1.00 49.22  ? 125 GLY D CA    1 
ATOM 5114  C C     . GLY D 1 128 ? 35.049  -33.508  -86.732  1.00 50.47  ? 125 GLY D C     1 
ATOM 5115  O O     . GLY D 1 128 ? 35.383  -34.679  -86.526  1.00 56.02  ? 125 GLY D O     1 
ATOM 5116  N N     . TYR D 1 129 ? 35.909  -32.494  -86.670  1.00 51.40  ? 126 TYR D N     1 
ATOM 5117  C CA    . TYR D 1 129 ? 37.292  -32.694  -86.261  1.00 51.70  ? 126 TYR D CA    1 
ATOM 5118  C C     . TYR D 1 129 ? 37.647  -31.741  -85.135  1.00 51.63  ? 126 TYR D C     1 
ATOM 5119  O O     . TYR D 1 129 ? 37.041  -30.682  -84.987  1.00 51.16  ? 126 TYR D O     1 
ATOM 5120  C CB    . TYR D 1 129 ? 38.279  -32.492  -87.415  1.00 41.15  ? 126 TYR D CB    1 
ATOM 5121  C CG    . TYR D 1 129 ? 39.484  -33.416  -87.366  1.00 42.24  ? 126 TYR D CG    1 
ATOM 5122  C CD1   . TYR D 1 129 ? 39.358  -34.784  -87.585  1.00 47.47  ? 126 TYR D CD1   1 
ATOM 5123  C CD2   . TYR D 1 129 ? 40.742  -32.923  -87.039  1.00 49.65  ? 126 TYR D CD2   1 
ATOM 5124  C CE1   . TYR D 1 129 ? 40.472  -35.620  -87.534  1.00 50.12  ? 126 TYR D CE1   1 
ATOM 5125  C CE2   . TYR D 1 129 ? 41.848  -33.748  -86.977  1.00 45.59  ? 126 TYR D CE2   1 
ATOM 5126  C CZ    . TYR D 1 129 ? 41.710  -35.090  -87.222  1.00 45.45  ? 126 TYR D CZ    1 
ATOM 5127  O OH    . TYR D 1 129 ? 42.835  -35.878  -87.152  1.00 52.84  ? 126 TYR D OH    1 
ATOM 5128  N N     . GLY D 1 130 ? 38.623  -32.146  -84.331  1.00 43.66  ? 127 GLY D N     1 
ATOM 5129  C CA    . GLY D 1 130 ? 39.082  -31.341  -83.223  1.00 42.43  ? 127 GLY D CA    1 
ATOM 5130  C C     . GLY D 1 130 ? 40.594  -31.303  -83.198  1.00 52.20  ? 127 GLY D C     1 
ATOM 5131  O O     . GLY D 1 130 ? 41.252  -32.341  -83.305  1.00 47.68  ? 127 GLY D O     1 
ATOM 5132  N N     . VAL D 1 131 ? 41.157  -30.109  -83.045  1.00 59.47  ? 128 VAL D N     1 
ATOM 5133  C CA    . VAL D 1 131 ? 42.586  -29.876  -83.190  1.00 49.74  ? 128 VAL D CA    1 
ATOM 5134  C C     . VAL D 1 131 ? 43.110  -29.193  -81.937  1.00 55.34  ? 128 VAL D C     1 
ATOM 5135  O O     . VAL D 1 131 ? 42.437  -28.328  -81.361  1.00 62.17  ? 128 VAL D O     1 
ATOM 5136  C CB    . VAL D 1 131 ? 42.859  -29.009  -84.439  1.00 47.06  ? 128 VAL D CB    1 
ATOM 5137  C CG1   . VAL D 1 131 ? 44.342  -28.772  -84.624  1.00 58.75  ? 128 VAL D CG1   1 
ATOM 5138  C CG2   . VAL D 1 131 ? 42.263  -29.656  -85.679  1.00 57.40  ? 128 VAL D CG2   1 
ATOM 5139  N N     . SER D 1 132 ? 44.308  -29.590  -81.510  1.00 51.53  ? 129 SER D N     1 
ATOM 5140  C CA    . SER D 1 132 ? 45.028  -28.895  -80.445  1.00 53.91  ? 129 SER D CA    1 
ATOM 5141  C C     . SER D 1 132 ? 46.517  -29.077  -80.701  1.00 65.22  ? 129 SER D C     1 
ATOM 5142  O O     . SER D 1 132 ? 47.051  -30.167  -80.478  1.00 71.34  ? 129 SER D O     1 
ATOM 5143  C CB    . SER D 1 132 ? 44.643  -29.429  -79.071  1.00 44.72  ? 129 SER D CB    1 
ATOM 5144  O OG    . SER D 1 132 ? 45.549  -28.960  -78.083  1.00 49.25  ? 129 SER D OG    1 
ATOM 5145  N N     . GLU D 1 133 ? 47.183  -28.021  -81.159  1.00 65.97  ? 130 GLU D N     1 
ATOM 5146  C CA    . GLU D 1 133 ? 48.606  -28.063  -81.470  1.00 66.21  ? 130 GLU D CA    1 
ATOM 5147  C C     . GLU D 1 133 ? 49.327  -27.003  -80.652  1.00 68.13  ? 130 GLU D C     1 
ATOM 5148  O O     . GLU D 1 133 ? 48.906  -25.842  -80.628  1.00 69.65  ? 130 GLU D O     1 
ATOM 5149  C CB    . GLU D 1 133 ? 48.833  -27.845  -82.970  1.00 71.74  ? 130 GLU D CB    1 
ATOM 5150  C CG    . GLU D 1 133 ? 47.759  -28.492  -83.835  1.00 69.65  ? 130 GLU D CG    1 
ATOM 5151  C CD    . GLU D 1 133 ? 48.111  -28.537  -85.312  1.00 75.07  ? 130 GLU D CD    1 
ATOM 5152  O OE1   . GLU D 1 133 ? 49.056  -29.266  -85.689  1.00 76.82  ? 130 GLU D OE1   1 
ATOM 5153  O OE2   . GLU D 1 133 ? 47.435  -27.836  -86.095  1.00 72.14  ? 130 GLU D OE2   1 
ATOM 5154  N N     . GLY D 1 134 ? 50.404  -27.402  -79.973  1.00 70.31  ? 131 GLY D N     1 
ATOM 5155  C CA    . GLY D 1 134 ? 51.279  -26.475  -79.289  1.00 71.34  ? 131 GLY D CA    1 
ATOM 5156  C C     . GLY D 1 134 ? 51.159  -26.482  -77.778  1.00 72.85  ? 131 GLY D C     1 
ATOM 5157  O O     . GLY D 1 134 ? 52.082  -26.019  -77.098  1.00 81.14  ? 131 GLY D O     1 
ATOM 5158  N N     . LEU D 1 135 ? 50.040  -26.950  -77.234  1.00 67.58  ? 132 LEU D N     1 
ATOM 5159  C CA    . LEU D 1 135 ? 49.833  -26.890  -75.793  1.00 55.39  ? 132 LEU D CA    1 
ATOM 5160  C C     . LEU D 1 135 ? 50.771  -27.841  -75.055  1.00 66.27  ? 132 LEU D C     1 
ATOM 5161  O O     . LEU D 1 135 ? 51.125  -28.913  -75.552  1.00 71.79  ? 132 LEU D O     1 
ATOM 5162  C CB    . LEU D 1 135 ? 48.383  -27.228  -75.447  1.00 59.88  ? 132 LEU D CB    1 
ATOM 5163  C CG    . LEU D 1 135 ? 47.332  -26.172  -75.787  1.00 65.73  ? 132 LEU D CG    1 
ATOM 5164  C CD1   . LEU D 1 135 ? 45.946  -26.653  -75.393  1.00 64.30  ? 132 LEU D CD1   1 
ATOM 5165  C CD2   . LEU D 1 135 ? 47.658  -24.851  -75.121  1.00 71.07  ? 132 LEU D CD2   1 
ATOM 5166  N N     . LYS D 1 136 ? 51.169  -27.438  -73.844  1.00 73.07  ? 133 LYS D N     1 
ATOM 5167  C CA    . LYS D 1 136 ? 52.022  -28.271  -73.004  1.00 68.34  ? 133 LYS D CA    1 
ATOM 5168  C C     . LYS D 1 136 ? 51.238  -29.237  -72.126  1.00 59.30  ? 133 LYS D C     1 
ATOM 5169  O O     . LYS D 1 136 ? 51.823  -30.201  -71.619  1.00 61.60  ? 133 LYS D O     1 
ATOM 5170  C CB    . LYS D 1 136 ? 52.918  -27.410  -72.104  1.00 73.30  ? 133 LYS D CB    1 
ATOM 5171  C CG    . LYS D 1 136 ? 53.884  -26.483  -72.831  1.00 84.39  ? 133 LYS D CG    1 
ATOM 5172  C CD    . LYS D 1 136 ? 54.598  -25.573  -71.841  1.00 78.59  ? 133 LYS D CD    1 
ATOM 5173  C CE    . LYS D 1 136 ? 55.748  -26.302  -71.146  1.00 99.84  ? 133 LYS D CE    1 
ATOM 5174  N NZ    . LYS D 1 136 ? 56.819  -26.741  -72.084  1.00 97.06  ? 133 LYS D NZ    1 
ATOM 5175  N N     . SER D 1 137 ? 49.942  -29.005  -71.928  1.00 56.04  ? 134 SER D N     1 
ATOM 5176  C CA    . SER D 1 137 ? 49.113  -29.882  -71.106  1.00 57.56  ? 134 SER D CA    1 
ATOM 5177  C C     . SER D 1 137 ? 48.471  -30.923  -72.016  1.00 67.24  ? 134 SER D C     1 
ATOM 5178  O O     . SER D 1 137 ? 47.664  -30.583  -72.887  1.00 73.00  ? 134 SER D O     1 
ATOM 5179  C CB    . SER D 1 137 ? 48.058  -29.075  -70.351  1.00 61.75  ? 134 SER D CB    1 
ATOM 5180  O OG    . SER D 1 137 ? 47.119  -29.924  -69.711  1.00 64.18  ? 134 SER D OG    1 
ATOM 5181  N N     . LYS D 1 138 ? 48.840  -32.193  -71.823  1.00 63.95  ? 135 LYS D N     1 
ATOM 5182  C CA    . LYS D 1 138 ? 48.232  -33.265  -72.606  1.00 60.52  ? 135 LYS D CA    1 
ATOM 5183  C C     . LYS D 1 138 ? 46.733  -33.365  -72.353  1.00 55.99  ? 135 LYS D C     1 
ATOM 5184  O O     . LYS D 1 138 ? 45.946  -33.538  -73.292  1.00 55.21  ? 135 LYS D O     1 
ATOM 5185  C CB    . LYS D 1 138 ? 48.907  -34.600  -72.292  1.00 63.19  ? 135 LYS D CB    1 
ATOM 5186  C CG    . LYS D 1 138 ? 48.374  -35.764  -73.116  1.00 69.92  ? 135 LYS D CG    1 
ATOM 5187  C CD    . LYS D 1 138 ? 49.437  -36.827  -73.324  1.00 65.84  ? 135 LYS D CD    1 
ATOM 5188  C CE    . LYS D 1 138 ? 49.789  -37.505  -72.008  1.00 53.75  ? 135 LYS D CE    1 
ATOM 5189  N NZ    . LYS D 1 138 ? 50.771  -38.616  -72.178  1.00 53.73  ? 135 LYS D NZ    1 
ATOM 5190  N N     . ALA D 1 139 ? 46.320  -33.273  -71.086  1.00 59.46  ? 136 ALA D N     1 
ATOM 5191  C CA    . ALA D 1 139 ? 44.907  -33.443  -70.765  1.00 61.69  ? 136 ALA D CA    1 
ATOM 5192  C C     . ALA D 1 139 ? 44.060  -32.359  -71.415  1.00 56.10  ? 136 ALA D C     1 
ATOM 5193  O O     . ALA D 1 139 ? 43.002  -32.644  -71.990  1.00 62.45  ? 136 ALA D O     1 
ATOM 5194  C CB    . ALA D 1 139 ? 44.708  -33.445  -69.250  1.00 73.06  ? 136 ALA D CB    1 
ATOM 5195  N N     . LEU D 1 140 ? 44.524  -31.111  -71.355  1.00 55.01  ? 137 LEU D N     1 
ATOM 5196  C CA    . LEU D 1 140 ? 43.758  -30.017  -71.937  1.00 61.42  ? 137 LEU D CA    1 
ATOM 5197  C C     . LEU D 1 140 ? 43.724  -30.128  -73.455  1.00 57.99  ? 137 LEU D C     1 
ATOM 5198  O O     . LEU D 1 140 ? 42.695  -29.850  -74.080  1.00 63.06  ? 137 LEU D O     1 
ATOM 5199  C CB    . LEU D 1 140 ? 44.360  -28.681  -71.497  1.00 63.90  ? 137 LEU D CB    1 
ATOM 5200  C CG    . LEU D 1 140 ? 43.539  -27.409  -71.725  1.00 68.93  ? 137 LEU D CG    1 
ATOM 5201  C CD1   . LEU D 1 140 ? 42.258  -27.445  -70.906  1.00 59.76  ? 137 LEU D CD1   1 
ATOM 5202  C CD2   . LEU D 1 140 ? 44.362  -26.176  -71.389  1.00 68.47  ? 137 LEU D CD2   1 
ATOM 5203  N N     . SER D 1 141 ? 44.827  -30.580  -74.057  1.00 54.13  ? 138 SER D N     1 
ATOM 5204  C CA    . SER D 1 141 ? 44.861  -30.806  -75.498  1.00 50.05  ? 138 SER D CA    1 
ATOM 5205  C C     . SER D 1 141 ? 43.835  -31.852  -75.919  1.00 54.75  ? 138 SER D C     1 
ATOM 5206  O O     . SER D 1 141 ? 43.049  -31.631  -76.851  1.00 56.29  ? 138 SER D O     1 
ATOM 5207  C CB    . SER D 1 141 ? 46.270  -31.229  -75.920  1.00 46.19  ? 138 SER D CB    1 
ATOM 5208  O OG    . SER D 1 141 ? 47.215  -30.209  -75.649  1.00 65.04  ? 138 SER D OG    1 
ATOM 5209  N N     . LEU D 1 142 ? 43.830  -33.004  -75.241  1.00 52.72  ? 139 LEU D N     1 
ATOM 5210  C CA    . LEU D 1 142 ? 42.880  -34.059  -75.579  1.00 49.04  ? 139 LEU D CA    1 
ATOM 5211  C C     . LEU D 1 142 ? 41.440  -33.605  -75.366  1.00 53.98  ? 139 LEU D C     1 
ATOM 5212  O O     . LEU D 1 142 ? 40.570  -33.874  -76.202  1.00 55.14  ? 139 LEU D O     1 
ATOM 5213  C CB    . LEU D 1 142 ? 43.171  -35.314  -74.757  1.00 56.71  ? 139 LEU D CB    1 
ATOM 5214  C CG    . LEU D 1 142 ? 44.282  -36.217  -75.288  1.00 55.61  ? 139 LEU D CG    1 
ATOM 5215  C CD1   . LEU D 1 142 ? 44.697  -37.233  -74.235  1.00 49.95  ? 139 LEU D CD1   1 
ATOM 5216  C CD2   . LEU D 1 142 ? 43.828  -36.907  -76.562  1.00 52.22  ? 139 LEU D CD2   1 
ATOM 5217  N N     . GLU D 1 143 ? 41.168  -32.923  -74.249  1.00 52.72  ? 140 GLU D N     1 
ATOM 5218  C CA    . GLU D 1 143 ? 39.816  -32.437  -73.983  1.00 57.38  ? 140 GLU D CA    1 
ATOM 5219  C C     . GLU D 1 143 ? 39.358  -31.480  -75.076  1.00 53.35  ? 140 GLU D C     1 
ATOM 5220  O O     . GLU D 1 143 ? 38.240  -31.599  -75.600  1.00 56.83  ? 140 GLU D O     1 
ATOM 5221  C CB    . GLU D 1 143 ? 39.767  -31.764  -72.611  1.00 55.98  ? 140 GLU D CB    1 
ATOM 5222  C CG    . GLU D 1 143 ? 38.533  -30.924  -72.368  1.00 52.95  ? 140 GLU D CG    1 
ATOM 5223  C CD    . GLU D 1 143 ? 38.522  -30.306  -70.982  1.00 59.43  ? 140 GLU D CD    1 
ATOM 5224  O OE1   . GLU D 1 143 ? 39.617  -29.999  -70.461  1.00 72.32  ? 140 GLU D OE1   1 
ATOM 5225  O OE2   . GLU D 1 143 ? 37.423  -30.127  -70.413  1.00 55.28  ? 140 GLU D OE2   1 
ATOM 5226  N N     . LYS D 1 144 ? 40.224  -30.532  -75.442  1.00 50.49  ? 141 LYS D N     1 
ATOM 5227  C CA    . LYS D 1 144 ? 39.891  -29.570  -76.484  1.00 53.78  ? 141 LYS D CA    1 
ATOM 5228  C C     . LYS D 1 144 ? 39.589  -30.286  -77.790  1.00 53.31  ? 141 LYS D C     1 
ATOM 5229  O O     . LYS D 1 144 ? 38.566  -30.021  -78.434  1.00 48.35  ? 141 LYS D O     1 
ATOM 5230  C CB    . LYS D 1 144 ? 41.049  -28.582  -76.653  1.00 53.40  ? 141 LYS D CB    1 
ATOM 5231  C CG    . LYS D 1 144 ? 40.755  -27.346  -77.494  1.00 59.65  ? 141 LYS D CG    1 
ATOM 5232  C CD    . LYS D 1 144 ? 42.047  -26.812  -78.116  1.00 71.19  ? 141 LYS D CD    1 
ATOM 5233  C CE    . LYS D 1 144 ? 41.826  -25.524  -78.898  1.00 74.15  ? 141 LYS D CE    1 
ATOM 5234  N NZ    . LYS D 1 144 ? 41.310  -25.780  -80.270  1.00 73.90  ? 141 LYS D NZ    1 
ATOM 5235  N N     . ALA D 1 145 ? 40.440  -31.245  -78.166  1.00 51.10  ? 142 ALA D N     1 
ATOM 5236  C CA    . ALA D 1 145 ? 40.270  -31.906  -79.454  1.00 47.37  ? 142 ALA D CA    1 
ATOM 5237  C C     . ALA D 1 145 ? 38.992  -32.739  -79.489  1.00 48.91  ? 142 ALA D C     1 
ATOM 5238  O O     . ALA D 1 145 ? 38.227  -32.661  -80.456  1.00 47.90  ? 142 ALA D O     1 
ATOM 5239  C CB    . ALA D 1 145 ? 41.489  -32.773  -79.763  1.00 43.31  ? 142 ALA D CB    1 
ATOM 5240  N N     . ARG D 1 146 ? 38.717  -33.498  -78.426  1.00 41.99  ? 143 ARG D N     1 
ATOM 5241  C CA    . ARG D 1 146 ? 37.523  -34.341  -78.408  1.00 44.47  ? 143 ARG D CA    1 
ATOM 5242  C C     . ARG D 1 146 ? 36.247  -33.503  -78.421  1.00 45.99  ? 143 ARG D C     1 
ATOM 5243  O O     . ARG D 1 146 ? 35.329  -33.755  -79.223  1.00 52.42  ? 143 ARG D O     1 
ATOM 5244  C CB    . ARG D 1 146 ? 37.555  -35.262  -77.187  1.00 40.34  ? 143 ARG D CB    1 
ATOM 5245  C CG    . ARG D 1 146 ? 38.741  -36.216  -77.160  1.00 48.49  ? 143 ARG D CG    1 
ATOM 5246  C CD    . ARG D 1 146 ? 38.561  -37.300  -76.110  1.00 45.26  ? 143 ARG D CD    1 
ATOM 5247  N NE    . ARG D 1 146 ? 38.125  -38.564  -76.695  1.00 59.33  ? 143 ARG D NE    1 
ATOM 5248  C CZ    . ARG D 1 146 ? 38.888  -39.649  -76.761  1.00 54.74  ? 143 ARG D CZ    1 
ATOM 5249  N NH1   . ARG D 1 146 ? 40.117  -39.621  -76.264  1.00 50.48  ? 143 ARG D NH1   1 
ATOM 5250  N NH2   . ARG D 1 146 ? 38.422  -40.763  -77.311  1.00 63.04  ? 143 ARG D NH2   1 
ATOM 5251  N N     . LYS D 1 147 ? 36.158  -32.508  -77.531  1.00 45.61  ? 144 LYS D N     1 
ATOM 5252  C CA    . LYS D 1 147 ? 34.948  -31.697  -77.470  1.00 43.86  ? 144 LYS D CA    1 
ATOM 5253  C C     . LYS D 1 147 ? 34.728  -30.929  -78.769  1.00 42.55  ? 144 LYS D C     1 
ATOM 5254  O O     . LYS D 1 147 ? 33.595  -30.855  -79.270  1.00 36.82  ? 144 LYS D O     1 
ATOM 5255  C CB    . LYS D 1 147 ? 35.012  -30.763  -76.262  1.00 37.45  ? 144 LYS D CB    1 
ATOM 5256  C CG    . LYS D 1 147 ? 34.856  -31.525  -74.953  1.00 45.06  ? 144 LYS D CG    1 
ATOM 5257  C CD    . LYS D 1 147 ? 35.006  -30.641  -73.729  1.00 63.68  ? 144 LYS D CD    1 
ATOM 5258  C CE    . LYS D 1 147 ? 34.819  -31.462  -72.458  1.00 48.11  ? 144 LYS D CE    1 
ATOM 5259  N NZ    . LYS D 1 147 ? 34.836  -30.614  -71.237  1.00 47.20  ? 144 LYS D NZ    1 
ATOM 5260  N N     . GLU D 1 148 ? 35.795  -30.341  -79.329  1.00 44.17  ? 145 GLU D N     1 
ATOM 5261  C CA    . GLU D 1 148 ? 35.662  -29.652  -80.607  1.00 48.57  ? 145 GLU D CA    1 
ATOM 5262  C C     . GLU D 1 148 ? 35.202  -30.605  -81.705  1.00 51.07  ? 145 GLU D C     1 
ATOM 5263  O O     . GLU D 1 148 ? 34.363  -30.240  -82.531  1.00 59.86  ? 145 GLU D O     1 
ATOM 5264  C CB    . GLU D 1 148 ? 36.981  -28.984  -81.006  1.00 57.91  ? 145 GLU D CB    1 
ATOM 5265  C CG    . GLU D 1 148 ? 37.140  -27.547  -80.518  1.00 67.86  ? 145 GLU D CG    1 
ATOM 5266  C CD    . GLU D 1 148 ? 38.471  -26.932  -80.921  1.00 80.43  ? 145 GLU D CD    1 
ATOM 5267  O OE1   . GLU D 1 148 ? 39.009  -27.304  -81.989  1.00 70.16  ? 145 GLU D OE1   1 
ATOM 5268  O OE2   . GLU D 1 148 ? 38.973  -26.067  -80.171  1.00 76.96  ? 145 GLU D OE2   1 
ATOM 5269  N N     . ALA D 1 149 ? 35.755  -31.821  -81.745  1.00 47.07  ? 146 ALA D N     1 
ATOM 5270  C CA    . ALA D 1 149 ? 35.323  -32.787  -82.753  1.00 50.60  ? 146 ALA D CA    1 
ATOM 5271  C C     . ALA D 1 149 ? 33.827  -33.048  -82.649  1.00 46.84  ? 146 ALA D C     1 
ATOM 5272  O O     . ALA D 1 149 ? 33.110  -33.035  -83.660  1.00 49.62  ? 146 ALA D O     1 
ATOM 5273  C CB    . ALA D 1 149 ? 36.109  -34.091  -82.608  1.00 51.41  ? 146 ALA D CB    1 
ATOM 5274  N N     . VAL D 1 150 ? 33.332  -33.257  -81.429  1.00 40.04  ? 147 VAL D N     1 
ATOM 5275  C CA    . VAL D 1 150 ? 31.915  -33.577  -81.259  1.00 38.35  ? 147 VAL D CA    1 
ATOM 5276  C C     . VAL D 1 150 ? 31.039  -32.395  -81.669  1.00 49.46  ? 147 VAL D C     1 
ATOM 5277  O O     . VAL D 1 150 ? 30.061  -32.551  -82.417  1.00 50.48  ? 147 VAL D O     1 
ATOM 5278  C CB    . VAL D 1 150 ? 31.639  -34.016  -79.810  1.00 44.18  ? 147 VAL D CB    1 
ATOM 5279  C CG1   . VAL D 1 150 ? 30.148  -33.967  -79.517  1.00 30.93  ? 147 VAL D CG1   1 
ATOM 5280  C CG2   . VAL D 1 150 ? 32.184  -35.414  -79.574  1.00 52.82  ? 147 VAL D CG2   1 
ATOM 5281  N N     . THR D 1 151 ? 31.378  -31.191  -81.194  1.00 59.75  ? 148 THR D N     1 
ATOM 5282  C CA    . THR D 1 151 ? 30.569  -30.014  -81.511  1.00 51.42  ? 148 THR D CA    1 
ATOM 5283  C C     . THR D 1 151 ? 30.586  -29.706  -83.007  1.00 52.42  ? 148 THR D C     1 
ATOM 5284  O O     . THR D 1 151 ? 29.545  -29.387  -83.597  1.00 53.56  ? 148 THR D O     1 
ATOM 5285  C CB    . THR D 1 151 ? 31.059  -28.811  -80.703  1.00 52.37  ? 148 THR D CB    1 
ATOM 5286  O OG1   . THR D 1 151 ? 30.833  -29.050  -79.308  1.00 58.29  ? 148 THR D OG1   1 
ATOM 5287  C CG2   . THR D 1 151 ? 30.322  -27.549  -81.118  1.00 55.30  ? 148 THR D CG2   1 
ATOM 5288  N N     . ASP D 1 152 ? 31.767  -29.771  -83.629  1.00 47.96  ? 149 ASP D N     1 
ATOM 5289  C CA    . ASP D 1 152 ? 31.886  -29.552  -85.066  1.00 49.53  ? 149 ASP D CA    1 
ATOM 5290  C C     . ASP D 1 152 ? 31.059  -30.562  -85.850  1.00 48.70  ? 149 ASP D C     1 
ATOM 5291  O O     . ASP D 1 152 ? 30.396  -30.202  -86.831  1.00 45.43  ? 149 ASP D O     1 
ATOM 5292  C CB    . ASP D 1 152 ? 33.357  -29.623  -85.474  1.00 41.58  ? 149 ASP D CB    1 
ATOM 5293  C CG    . ASP D 1 152 ? 33.594  -29.133  -86.883  1.00 51.92  ? 149 ASP D CG    1 
ATOM 5294  O OD1   . ASP D 1 152 ? 33.199  -27.988  -87.193  1.00 58.76  ? 149 ASP D OD1   1 
ATOM 5295  O OD2   . ASP D 1 152 ? 34.181  -29.889  -87.681  1.00 58.09  ? 149 ASP D OD2   1 
ATOM 5296  N N     . GLY D 1 153 ? 31.103  -31.837  -85.449  1.00 50.51  ? 150 GLY D N     1 
ATOM 5297  C CA    . GLY D 1 153 ? 30.291  -32.834  -86.126  1.00 52.72  ? 150 GLY D CA    1 
ATOM 5298  C C     . GLY D 1 153 ? 28.808  -32.557  -85.995  1.00 48.52  ? 150 GLY D C     1 
ATOM 5299  O O     . GLY D 1 153 ? 28.048  -32.721  -86.954  1.00 48.46  ? 150 GLY D O     1 
ATOM 5300  N N     . LEU D 1 154 ? 28.380  -32.097  -84.818  1.00 53.01  ? 151 LEU D N     1 
ATOM 5301  C CA    . LEU D 1 154 ? 26.970  -31.768  -84.636  1.00 57.17  ? 151 LEU D CA    1 
ATOM 5302  C C     . LEU D 1 154 ? 26.555  -30.604  -85.529  1.00 61.38  ? 151 LEU D C     1 
ATOM 5303  O O     . LEU D 1 154 ? 25.498  -30.650  -86.173  1.00 55.19  ? 151 LEU D O     1 
ATOM 5304  C CB    . LEU D 1 154 ? 26.700  -31.445  -83.166  1.00 54.19  ? 151 LEU D CB    1 
ATOM 5305  C CG    . LEU D 1 154 ? 25.287  -30.970  -82.828  1.00 52.89  ? 151 LEU D CG    1 
ATOM 5306  C CD1   . LEU D 1 154 ? 24.258  -31.961  -83.340  1.00 51.06  ? 151 LEU D CD1   1 
ATOM 5307  C CD2   . LEU D 1 154 ? 25.139  -30.759  -81.330  1.00 51.23  ? 151 LEU D CD2   1 
ATOM 5308  N N     . LYS D 1 155 ? 27.384  -29.558  -85.589  1.00 57.81  ? 152 LYS D N     1 
ATOM 5309  C CA    . LYS D 1 155 ? 27.077  -28.417  -86.450  1.00 51.89  ? 152 LYS D CA    1 
ATOM 5310  C C     . LYS D 1 155 ? 27.018  -28.827  -87.918  1.00 63.56  ? 152 LYS D C     1 
ATOM 5311  O O     . LYS D 1 155 ? 26.106  -28.421  -88.653  1.00 69.19  ? 152 LYS D O     1 
ATOM 5312  C CB    . LYS D 1 155 ? 28.103  -27.303  -86.237  1.00 43.80  ? 152 LYS D CB    1 
ATOM 5313  C CG    . LYS D 1 155 ? 28.010  -26.634  -84.869  1.00 62.81  ? 152 LYS D CG    1 
ATOM 5314  C CD    . LYS D 1 155 ? 28.820  -25.343  -84.809  1.00 62.33  ? 152 LYS D CD    1 
ATOM 5315  C CE    . LYS D 1 155 ? 30.310  -25.590  -85.001  1.00 64.99  ? 152 LYS D CE    1 
ATOM 5316  N NZ    . LYS D 1 155 ? 31.117  -24.336  -84.887  1.00 75.36  ? 152 LYS D NZ    1 
ATOM 5317  N N     . ARG D 1 156 ? 27.976  -29.643  -88.363  1.00 59.02  ? 153 ARG D N     1 
ATOM 5318  C CA    . ARG D 1 156 ? 28.003  -30.039  -89.767  1.00 50.71  ? 153 ARG D CA    1 
ATOM 5319  C C     . ARG D 1 156 ? 26.853  -30.981  -90.105  1.00 59.16  ? 153 ARG D C     1 
ATOM 5320  O O     . ARG D 1 156 ? 26.388  -31.002  -91.251  1.00 64.67  ? 153 ARG D O     1 
ATOM 5321  C CB    . ARG D 1 156 ? 29.354  -30.673  -90.107  1.00 41.07  ? 153 ARG D CB    1 
ATOM 5322  C CG    . ARG D 1 156 ? 30.508  -29.676  -90.108  1.00 59.54  ? 153 ARG D CG    1 
ATOM 5323  C CD    . ARG D 1 156 ? 31.857  -30.367  -90.201  1.00 56.30  ? 153 ARG D CD    1 
ATOM 5324  N NE    . ARG D 1 156 ? 31.912  -31.309  -91.315  1.00 54.13  ? 153 ARG D NE    1 
ATOM 5325  C CZ    . ARG D 1 156 ? 32.222  -30.977  -92.563  1.00 64.66  ? 153 ARG D CZ    1 
ATOM 5326  N NH1   . ARG D 1 156 ? 32.508  -29.718  -92.864  1.00 74.24  ? 153 ARG D NH1   1 
ATOM 5327  N NH2   . ARG D 1 156 ? 32.245  -31.906  -93.510  1.00 58.41  ? 153 ARG D NH2   1 
ATOM 5328  N N     . ALA D 1 157 ? 26.382  -31.761  -89.128  1.00 60.57  ? 154 ALA D N     1 
ATOM 5329  C CA    . ALA D 1 157 ? 25.209  -32.600  -89.350  1.00 63.31  ? 154 ALA D CA    1 
ATOM 5330  C C     . ALA D 1 157 ? 23.940  -31.761  -89.437  1.00 59.93  ? 154 ALA D C     1 
ATOM 5331  O O     . ALA D 1 157 ? 23.043  -32.062  -90.235  1.00 57.43  ? 154 ALA D O     1 
ATOM 5332  C CB    . ALA D 1 157 ? 25.092  -33.643  -88.240  1.00 46.58  ? 154 ALA D CB    1 
ATOM 5333  N N     . LEU D 1 158 ? 23.832  -30.723  -88.604  1.00 64.27  ? 155 LEU D N     1 
ATOM 5334  C CA    . LEU D 1 158 ? 22.656  -29.860  -88.658  1.00 54.66  ? 155 LEU D CA    1 
ATOM 5335  C C     . LEU D 1 158 ? 22.650  -28.997  -89.916  1.00 61.28  ? 155 LEU D C     1 
ATOM 5336  O O     . LEU D 1 158 ? 21.582  -28.549  -90.348  1.00 58.99  ? 155 LEU D O     1 
ATOM 5337  C CB    . LEU D 1 158 ? 22.568  -29.002  -87.396  1.00 55.16  ? 155 LEU D CB    1 
ATOM 5338  C CG    . LEU D 1 158 ? 21.966  -29.744  -86.196  1.00 44.69  ? 155 LEU D CG    1 
ATOM 5339  C CD1   . LEU D 1 158 ? 22.027  -28.910  -84.933  1.00 40.19  ? 155 LEU D CD1   1 
ATOM 5340  C CD2   . LEU D 1 158 ? 20.532  -30.159  -86.487  1.00 43.20  ? 155 LEU D CD2   1 
ATOM 5341  N N     . ARG D 1 159 ? 23.828  -28.726  -90.492  1.00 65.08  ? 156 ARG D N     1 
ATOM 5342  C CA    . ARG D 1 159 ? 23.895  -27.978  -91.749  1.00 59.04  ? 156 ARG D CA    1 
ATOM 5343  C C     . ARG D 1 159 ? 22.956  -28.541  -92.812  1.00 59.55  ? 156 ARG D C     1 
ATOM 5344  O O     . ARG D 1 159 ? 22.366  -27.788  -93.595  1.00 60.81  ? 156 ARG D O     1 
ATOM 5345  C CB    . ARG D 1 159 ? 25.313  -28.007  -92.320  1.00 64.09  ? 156 ARG D CB    1 
ATOM 5346  C CG    . ARG D 1 159 ? 26.279  -26.939  -91.867  1.00 64.32  ? 156 ARG D CG    1 
ATOM 5347  C CD    . ARG D 1 159 ? 27.502  -27.049  -92.764  1.00 67.25  ? 156 ARG D CD    1 
ATOM 5348  N NE    . ARG D 1 159 ? 28.716  -26.479  -92.196  1.00 85.34  ? 156 ARG D NE    1 
ATOM 5349  C CZ    . ARG D 1 159 ? 29.923  -26.665  -92.720  1.00 92.70  ? 156 ARG D CZ    1 
ATOM 5350  N NH1   . ARG D 1 159 ? 30.061  -27.403  -93.815  1.00 85.85  ? 156 ARG D NH1   1 
ATOM 5351  N NH2   . ARG D 1 159 ? 30.989  -26.117  -92.154  1.00 104.00 ? 156 ARG D NH2   1 
ATOM 5352  N N     . SER D 1 160 ? 22.807  -29.866  -92.856  1.00 60.03  ? 157 SER D N     1 
ATOM 5353  C CA    . SER D 1 160 ? 22.131  -30.520  -93.972  1.00 57.15  ? 157 SER D CA    1 
ATOM 5354  C C     . SER D 1 160 ? 20.624  -30.287  -94.009  1.00 60.61  ? 157 SER D C     1 
ATOM 5355  O O     . SER D 1 160 ? 19.978  -30.726  -94.966  1.00 64.22  ? 157 SER D O     1 
ATOM 5356  C CB    . SER D 1 160 ? 22.408  -32.024  -93.935  1.00 62.39  ? 157 SER D CB    1 
ATOM 5357  O OG    . SER D 1 160 ? 23.797  -32.295  -93.951  1.00 73.19  ? 157 SER D OG    1 
ATOM 5358  N N     . PHE D 1 161 ? 20.044  -29.616  -93.015  1.00 52.29  ? 158 PHE D N     1 
ATOM 5359  C CA    . PHE D 1 161 ? 18.603  -29.394  -93.016  1.00 60.99  ? 158 PHE D CA    1 
ATOM 5360  C C     . PHE D 1 161 ? 18.175  -28.109  -93.714  1.00 63.90  ? 158 PHE D C     1 
ATOM 5361  O O     . PHE D 1 161 ? 16.991  -27.971  -94.042  1.00 65.39  ? 158 PHE D O     1 
ATOM 5362  C CB    . PHE D 1 161 ? 18.062  -29.423  -91.583  1.00 56.61  ? 158 PHE D CB    1 
ATOM 5363  C CG    . PHE D 1 161 ? 17.961  -30.809  -91.019  1.00 60.09  ? 158 PHE D CG    1 
ATOM 5364  C CD1   . PHE D 1 161 ? 17.081  -31.725  -91.573  1.00 62.34  ? 158 PHE D CD1   1 
ATOM 5365  C CD2   . PHE D 1 161 ? 18.760  -31.211  -89.961  1.00 59.58  ? 158 PHE D CD2   1 
ATOM 5366  C CE1   . PHE D 1 161 ? 16.988  -33.009  -91.076  1.00 54.88  ? 158 PHE D CE1   1 
ATOM 5367  C CE2   . PHE D 1 161 ? 18.671  -32.497  -89.459  1.00 54.98  ? 158 PHE D CE2   1 
ATOM 5368  C CZ    . PHE D 1 161 ? 17.783  -33.396  -90.018  1.00 51.81  ? 158 PHE D CZ    1 
ATOM 5369  N N     . GLY D 1 162 ? 19.087  -27.184  -93.964  1.00 54.30  ? 159 GLY D N     1 
ATOM 5370  C CA    . GLY D 1 162 ? 18.753  -25.978  -94.696  1.00 71.75  ? 159 GLY D CA    1 
ATOM 5371  C C     . GLY D 1 162 ? 19.625  -24.819  -94.259  1.00 76.79  ? 159 GLY D C     1 
ATOM 5372  O O     . GLY D 1 162 ? 20.499  -24.952  -93.405  1.00 65.72  ? 159 GLY D O     1 
ATOM 5373  N N     . ASN D 1 163 ? 19.374  -23.668  -94.889  1.00 80.31  ? 160 ASN D N     1 
ATOM 5374  C CA    . ASN D 1 163 ? 20.163  -22.473  -94.606  1.00 70.11  ? 160 ASN D CA    1 
ATOM 5375  C C     . ASN D 1 163 ? 20.009  -22.034  -93.156  1.00 66.40  ? 160 ASN D C     1 
ATOM 5376  O O     . ASN D 1 163 ? 20.979  -21.595  -92.530  1.00 56.36  ? 160 ASN D O     1 
ATOM 5377  C CB    . ASN D 1 163 ? 19.762  -21.339  -95.549  1.00 75.39  ? 160 ASN D CB    1 
ATOM 5378  C CG    . ASN D 1 163 ? 19.878  -21.726  -97.008  1.00 74.53  ? 160 ASN D CG    1 
ATOM 5379  O OD1   . ASN D 1 163 ? 20.971  -21.752  -97.572  1.00 77.17  ? 160 ASN D OD1   1 
ATOM 5380  N ND2   . ASN D 1 163 ? 18.745  -22.034  -97.626  1.00 72.09  ? 160 ASN D ND2   1 
ATOM 5381  N N     . ALA D 1 164 ? 18.793  -22.145  -92.610  1.00 67.10  ? 161 ALA D N     1 
ATOM 5382  C CA    . ALA D 1 164 ? 18.509  -21.630  -91.272  1.00 66.03  ? 161 ALA D CA    1 
ATOM 5383  C C     . ALA D 1 164 ? 19.350  -22.302  -90.195  1.00 63.69  ? 161 ALA D C     1 
ATOM 5384  O O     . ALA D 1 164 ? 19.588  -21.707  -89.137  1.00 61.96  ? 161 ALA D O     1 
ATOM 5385  C CB    . ALA D 1 164 ? 17.024  -21.795  -90.958  1.00 63.03  ? 161 ALA D CB    1 
ATOM 5386  N N     . LEU D 1 165 ? 19.797  -23.533  -90.429  1.00 61.39  ? 162 LEU D N     1 
ATOM 5387  C CA    . LEU D 1 165 ? 20.616  -24.253  -89.465  1.00 60.10  ? 162 LEU D CA    1 
ATOM 5388  C C     . LEU D 1 165 ? 22.101  -24.227  -89.809  1.00 62.90  ? 162 LEU D C     1 
ATOM 5389  O O     . LEU D 1 165 ? 22.883  -24.947  -89.181  1.00 66.65  ? 162 LEU D O     1 
ATOM 5390  C CB    . LEU D 1 165 ? 20.127  -25.695  -89.330  1.00 51.89  ? 162 LEU D CB    1 
ATOM 5391  C CG    . LEU D 1 165 ? 18.892  -25.848  -88.444  1.00 54.57  ? 162 LEU D CG    1 
ATOM 5392  C CD1   . LEU D 1 165 ? 18.408  -27.285  -88.444  1.00 63.18  ? 162 LEU D CD1   1 
ATOM 5393  C CD2   . LEU D 1 165 ? 19.187  -25.371  -87.032  1.00 56.45  ? 162 LEU D CD2   1 
ATOM 5394  N N     . GLY D 1 166 ? 22.502  -23.439  -90.804  1.00 60.39  ? 163 GLY D N     1 
ATOM 5395  C CA    . GLY D 1 166 ? 23.910  -23.172  -91.023  1.00 61.28  ? 163 GLY D CA    1 
ATOM 5396  C C     . GLY D 1 166 ? 24.414  -23.438  -92.427  1.00 69.25  ? 163 GLY D C     1 
ATOM 5397  O O     . GLY D 1 166 ? 25.616  -23.326  -92.680  1.00 66.02  ? 163 GLY D O     1 
ATOM 5398  N N     . ASN D 1 167 ? 23.526  -23.812  -93.349  1.00 68.09  ? 164 ASN D N     1 
ATOM 5399  C CA    . ASN D 1 167 ? 23.988  -24.106  -94.700  1.00 67.38  ? 164 ASN D CA    1 
ATOM 5400  C C     . ASN D 1 167 ? 24.408  -22.842  -95.444  1.00 73.87  ? 164 ASN D C     1 
ATOM 5401  O O     . ASN D 1 167 ? 25.335  -22.886  -96.260  1.00 81.18  ? 164 ASN D O     1 
ATOM 5402  C CB    . ASN D 1 167 ? 22.901  -24.835  -95.484  1.00 63.22  ? 164 ASN D CB    1 
ATOM 5403  C CG    . ASN D 1 167 ? 23.451  -25.563  -96.688  1.00 73.68  ? 164 ASN D CG    1 
ATOM 5404  O OD1   . ASN D 1 167 ? 24.664  -25.707  -96.834  1.00 69.02  ? 164 ASN D OD1   1 
ATOM 5405  N ND2   . ASN D 1 167 ? 22.566  -25.982  -97.584  1.00 70.68  ? 164 ASN D ND2   1 
ATOM 5406  N N     . CYS D 1 168 ? 23.737  -21.716  -95.183  1.00 67.96  ? 165 CYS D N     1 
ATOM 5407  C CA    . CYS D 1 168 ? 24.005  -20.484  -95.922  1.00 71.31  ? 165 CYS D CA    1 
ATOM 5408  C C     . CYS D 1 168 ? 25.406  -19.939  -95.662  1.00 80.14  ? 165 CYS D C     1 
ATOM 5409  O O     . CYS D 1 168 ? 25.934  -19.183  -96.486  1.00 85.73  ? 165 CYS D O     1 
ATOM 5410  C CB    . CYS D 1 168 ? 22.955  -19.430  -95.576  1.00 75.14  ? 165 CYS D CB    1 
ATOM 5411  S SG    . CYS D 1 168 ? 22.826  -19.059  -93.817  1.00 77.73  ? 165 CYS D SG    1 
ATOM 5412  N N     . ILE D 1 169 ? 26.012  -20.284  -94.522  1.00 74.96  ? 166 ILE D N     1 
ATOM 5413  C CA    . ILE D 1 169 ? 27.342  -19.783  -94.179  1.00 75.02  ? 166 ILE D CA    1 
ATOM 5414  C C     . ILE D 1 169 ? 28.396  -20.155  -95.218  1.00 76.73  ? 166 ILE D C     1 
ATOM 5415  O O     . ILE D 1 169 ? 29.462  -19.531  -95.265  1.00 77.44  ? 166 ILE D O     1 
ATOM 5416  C CB    . ILE D 1 169 ? 27.752  -20.286  -92.777  1.00 80.25  ? 166 ILE D CB    1 
ATOM 5417  C CG1   . ILE D 1 169 ? 28.816  -19.376  -92.165  1.00 82.83  ? 166 ILE D CG1   1 
ATOM 5418  C CG2   . ILE D 1 169 ? 28.289  -21.701  -92.850  1.00 82.39  ? 166 ILE D CG2   1 
ATOM 5419  C CD1   . ILE D 1 169 ? 28.337  -17.973  -91.897  1.00 95.09  ? 166 ILE D CD1   1 
ATOM 5420  N N     . LEU D 1 170 ? 28.132  -21.158  -96.056  1.00 80.11  ? 167 LEU D N     1 
ATOM 5421  C CA    . LEU D 1 170 ? 29.099  -21.595  -97.054  1.00 89.26  ? 167 LEU D CA    1 
ATOM 5422  C C     . LEU D 1 170 ? 28.977  -20.854  -98.379  1.00 85.74  ? 167 LEU D C     1 
ATOM 5423  O O     . LEU D 1 170 ? 29.829  -21.043  -99.255  1.00 86.56  ? 167 LEU D O     1 
ATOM 5424  C CB    . LEU D 1 170 ? 28.951  -23.098  -97.302  1.00 88.69  ? 167 LEU D CB    1 
ATOM 5425  C CG    . LEU D 1 170 ? 29.170  -23.971  -96.067  1.00 73.40  ? 167 LEU D CG    1 
ATOM 5426  C CD1   . LEU D 1 170 ? 28.714  -25.403  -96.323  1.00 83.73  ? 167 LEU D CD1   1 
ATOM 5427  C CD2   . LEU D 1 170 ? 30.625  -23.928  -95.622  1.00 78.99  ? 167 LEU D CD2   1 
ATOM 5428  N N     . ASP D 1 171 ? 27.941  -20.037  -98.553  1.00 89.16  ? 168 ASP D N     1 
ATOM 5429  C CA    . ASP D 1 171 ? 27.722  -19.305  -99.795  1.00 85.02  ? 168 ASP D CA    1 
ATOM 5430  C C     . ASP D 1 171 ? 28.509  -17.999  -99.746  1.00 88.21  ? 168 ASP D C     1 
ATOM 5431  O O     . ASP D 1 171 ? 28.246  -17.145  -98.893  1.00 88.72  ? 168 ASP D O     1 
ATOM 5432  C CB    . ASP D 1 171 ? 26.233  -19.036  -100.009 1.00 79.90  ? 168 ASP D CB    1 
ATOM 5433  C CG    . ASP D 1 171 ? 25.916  -18.603  -101.429 1.00 86.53  ? 168 ASP D CG    1 
ATOM 5434  O OD1   . ASP D 1 171 ? 26.855  -18.527  -102.247 1.00 93.20  ? 168 ASP D OD1   1 
ATOM 5435  O OD2   . ASP D 1 171 ? 24.732  -18.333  -101.726 1.00 90.16  ? 168 ASP D OD2   1 
ATOM 5436  N N     . LYS D 1 172 ? 29.482  -17.853  -100.652 1.00 90.95  ? 169 LYS D N     1 
ATOM 5437  C CA    . LYS D 1 172 ? 30.312  -16.650  -100.671 1.00 96.94  ? 169 LYS D CA    1 
ATOM 5438  C C     . LYS D 1 172 ? 29.503  -15.402  -101.015 1.00 94.98  ? 169 LYS D C     1 
ATOM 5439  O O     . LYS D 1 172 ? 29.848  -14.298  -100.574 1.00 96.40  ? 169 LYS D O     1 
ATOM 5440  C CB    . LYS D 1 172 ? 31.476  -16.822  -101.650 1.00 106.23 ? 169 LYS D CB    1 
ATOM 5441  C CG    . LYS D 1 172 ? 32.333  -18.056  -101.397 1.00 105.13 ? 169 LYS D CG    1 
ATOM 5442  C CD    . LYS D 1 172 ? 33.368  -18.255  -102.502 1.00 110.33 ? 169 LYS D CD    1 
ATOM 5443  C CE    . LYS D 1 172 ? 34.135  -19.562  -102.334 1.00 118.73 ? 169 LYS D CE    1 
ATOM 5444  N NZ    . LYS D 1 172 ? 35.088  -19.797  -103.458 1.00 121.68 ? 169 LYS D NZ    1 
ATOM 5445  N N     . ASP D 1 173 ? 28.434  -15.551  -101.800 1.00 92.96  ? 170 ASP D N     1 
ATOM 5446  C CA    . ASP D 1 173 ? 27.576  -14.408  -102.091 1.00 96.77  ? 170 ASP D CA    1 
ATOM 5447  C C     . ASP D 1 173 ? 26.876  -13.941  -100.823 1.00 96.79  ? 170 ASP D C     1 
ATOM 5448  O O     . ASP D 1 173 ? 26.716  -12.735  -100.594 1.00 104.13 ? 170 ASP D O     1 
ATOM 5449  C CB    . ASP D 1 173 ? 26.558  -14.774  -103.172 1.00 99.19  ? 170 ASP D CB    1 
ATOM 5450  C CG    . ASP D 1 173 ? 27.213  -15.327  -104.425 1.00 103.36 ? 170 ASP D CG    1 
ATOM 5451  O OD1   . ASP D 1 173 ? 28.309  -14.850  -104.786 1.00 109.19 ? 170 ASP D OD1   1 
ATOM 5452  O OD2   . ASP D 1 173 ? 26.627  -16.236  -105.051 1.00 95.84  ? 170 ASP D OD2   1 
ATOM 5453  N N     . TYR D 1 174 ? 26.452  -14.893  -99.993  1.00 87.39  ? 171 TYR D N     1 
ATOM 5454  C CA    . TYR D 1 174 ? 25.892  -14.564  -98.689  1.00 83.48  ? 171 TYR D CA    1 
ATOM 5455  C C     . TYR D 1 174 ? 26.917  -13.831  -97.827  1.00 89.15  ? 171 TYR D C     1 
ATOM 5456  O O     . TYR D 1 174 ? 26.570  -12.901  -97.089  1.00 88.64  ? 171 TYR D O     1 
ATOM 5457  C CB    . TYR D 1 174 ? 25.407  -15.855  -98.026  1.00 86.55  ? 171 TYR D CB    1 
ATOM 5458  C CG    . TYR D 1 174 ? 25.025  -15.761  -96.572  1.00 82.42  ? 171 TYR D CG    1 
ATOM 5459  C CD1   . TYR D 1 174 ? 23.729  -15.429  -96.202  1.00 81.98  ? 171 TYR D CD1   1 
ATOM 5460  C CD2   . TYR D 1 174 ? 25.942  -16.043  -95.571  1.00 81.11  ? 171 TYR D CD2   1 
ATOM 5461  C CE1   . TYR D 1 174 ? 23.361  -15.356  -94.877  1.00 83.14  ? 171 TYR D CE1   1 
ATOM 5462  C CE2   . TYR D 1 174 ? 25.583  -15.972  -94.239  1.00 84.47  ? 171 TYR D CE2   1 
ATOM 5463  C CZ    . TYR D 1 174 ? 24.291  -15.628  -93.898  1.00 84.21  ? 171 TYR D CZ    1 
ATOM 5464  O OH    . TYR D 1 174 ? 23.926  -15.555  -92.574  1.00 83.01  ? 171 TYR D OH    1 
ATOM 5465  N N     . LEU D 1 175 ? 28.199  -14.196  -97.949  1.00 96.73  ? 172 LEU D N     1 
ATOM 5466  C CA    . LEU D 1 175 ? 29.244  -13.514  -97.187  1.00 97.14  ? 172 LEU D CA    1 
ATOM 5467  C C     . LEU D 1 175 ? 29.434  -12.078  -97.664  1.00 99.65  ? 172 LEU D C     1 
ATOM 5468  O O     . LEU D 1 175 ? 29.594  -11.158  -96.847  1.00 101.90 ? 172 LEU D O     1 
ATOM 5469  C CB    . LEU D 1 175 ? 30.563  -14.283  -97.289  1.00 100.92 ? 172 LEU D CB    1 
ATOM 5470  C CG    . LEU D 1 175 ? 30.681  -15.639  -96.588  1.00 99.89  ? 172 LEU D CG    1 
ATOM 5471  C CD1   . LEU D 1 175 ? 32.085  -16.204  -96.767  1.00 96.49  ? 172 LEU D CD1   1 
ATOM 5472  C CD2   . LEU D 1 175 ? 30.335  -15.525  -95.110  1.00 93.59  ? 172 LEU D CD2   1 
ATOM 5473  N N     . ARG D 1 176 ? 29.440  -11.871  -98.983  1.00 99.90  ? 173 ARG D N     1 
ATOM 5474  C CA    . ARG D 1 176 ? 29.537  -10.515  -99.516  1.00 100.52 ? 173 ARG D CA    1 
ATOM 5475  C C     . ARG D 1 176 ? 28.357  -9.668   -99.056  1.00 98.82  ? 173 ARG D C     1 
ATOM 5476  O O     . ARG D 1 176 ? 28.529  -8.511   -98.653  1.00 104.27 ? 173 ARG D O     1 
ATOM 5477  C CB    . ARG D 1 176 ? 29.617  -10.543  -101.045 1.00 102.70 ? 173 ARG D CB    1 
ATOM 5478  C CG    . ARG D 1 176 ? 30.933  -11.070  -101.601 1.00 105.01 ? 173 ARG D CG    1 
ATOM 5479  C CD    . ARG D 1 176 ? 31.066  -10.830  -103.106 1.00 104.73 ? 173 ARG D CD    1 
ATOM 5480  N NE    . ARG D 1 176 ? 30.083  -11.582  -103.885 1.00 106.42 ? 173 ARG D NE    1 
ATOM 5481  C CZ    . ARG D 1 176 ? 28.937  -11.081  -104.337 1.00 112.39 ? 173 ARG D CZ    1 
ATOM 5482  N NH1   . ARG D 1 176 ? 28.621  -9.814   -104.100 1.00 118.70 ? 173 ARG D NH1   1 
ATOM 5483  N NH2   . ARG D 1 176 ? 28.108  -11.845  -105.035 1.00 111.53 ? 173 ARG D NH2   1 
ATOM 5484  N N     . SER D 1 177 ? 27.143  -10.221  -99.129  1.00 87.27  ? 174 SER D N     1 
ATOM 5485  C CA    . SER D 1 177 ? 25.971  -9.508   -98.627  1.00 86.68  ? 174 SER D CA    1 
ATOM 5486  C C     . SER D 1 177 ? 26.005  -9.309   -97.116  1.00 97.72  ? 174 SER D C     1 
ATOM 5487  O O     . SER D 1 177 ? 25.284  -8.451   -96.596  1.00 99.61  ? 174 SER D O     1 
ATOM 5488  C CB    . SER D 1 177 ? 24.698  -10.259  -99.008  1.00 92.99  ? 174 SER D CB    1 
ATOM 5489  O OG    . SER D 1 177 ? 24.525  -10.290  -100.415 1.00 109.94 ? 174 SER D OG    1 
ATOM 5490  N N     . LEU D 1 178 ? 26.811  -10.089  -96.398  1.00 101.43 ? 175 LEU D N     1 
ATOM 5491  C CA    . LEU D 1 178 ? 26.948  -9.882   -94.960  1.00 94.98  ? 175 LEU D CA    1 
ATOM 5492  C C     . LEU D 1 178 ? 27.936  -8.771   -94.632  1.00 100.40 ? 175 LEU D C     1 
ATOM 5493  O O     . LEU D 1 178 ? 27.715  -8.006   -93.685  1.00 103.45 ? 175 LEU D O     1 
ATOM 5494  C CB    . LEU D 1 178 ? 27.389  -11.180  -94.283  1.00 101.23 ? 175 LEU D CB    1 
ATOM 5495  C CG    . LEU D 1 178 ? 26.319  -11.970  -93.534  1.00 98.86  ? 175 LEU D CG    1 
ATOM 5496  C CD1   . LEU D 1 178 ? 26.981  -13.096  -92.772  1.00 101.69 ? 175 LEU D CD1   1 
ATOM 5497  C CD2   . LEU D 1 178 ? 25.579  -11.052  -92.584  1.00 89.68  ? 175 LEU D CD2   1 
ATOM 5498  N N     . ASN D 1 179 ? 29.012  -8.647   -95.414  1.00 107.19 ? 176 ASN D N     1 
ATOM 5499  C CA    . ASN D 1 179 ? 30.007  -7.614   -95.125  1.00 113.91 ? 176 ASN D CA    1 
ATOM 5500  C C     . ASN D 1 179 ? 29.456  -6.211   -95.357  1.00 116.31 ? 176 ASN D C     1 
ATOM 5501  O O     . ASN D 1 179 ? 29.784  -5.279   -94.612  1.00 114.38 ? 176 ASN D O     1 
ATOM 5502  C CB    . ASN D 1 179 ? 31.263  -7.836   -95.970  1.00 111.77 ? 176 ASN D CB    1 
ATOM 5503  C CG    . ASN D 1 179 ? 32.123  -8.972   -95.453  1.00 119.95 ? 176 ASN D CG    1 
ATOM 5504  O OD1   . ASN D 1 179 ? 32.655  -8.900   -94.343  1.00 118.81 ? 176 ASN D OD1   1 
ATOM 5505  N ND2   . ASN D 1 179 ? 32.271  -10.023  -96.253  1.00 119.27 ? 176 ASN D ND2   1 
ATOM 5506  N N     . LYS D 1 180 ? 28.626  -6.038   -96.386  1.00 117.04 ? 177 LYS D N     1 
ATOM 5507  C CA    . LYS D 1 180 ? 28.039  -4.738   -96.694  1.00 119.63 ? 177 LYS D CA    1 
ATOM 5508  C C     . LYS D 1 180 ? 27.029  -4.264   -95.654  1.00 125.31 ? 177 LYS D C     1 
ATOM 5509  O O     . LYS D 1 180 ? 26.561  -3.124   -95.749  1.00 124.79 ? 177 LYS D O     1 
ATOM 5510  C CB    . LYS D 1 180 ? 27.401  -4.780   -98.082  1.00 108.02 ? 177 LYS D CB    1 
ATOM 5511  C CG    . LYS D 1 180 ? 28.409  -5.131   -99.168  1.00 108.90 ? 177 LYS D CG    1 
ATOM 5512  C CD    . LYS D 1 180 ? 27.781  -5.266   -100.543 1.00 113.19 ? 177 LYS D CD    1 
ATOM 5513  C CE    . LYS D 1 180 ? 28.828  -5.711   -101.553 1.00 112.59 ? 177 LYS D CE    1 
ATOM 5514  N NZ    . LYS D 1 180 ? 28.270  -5.927   -102.915 1.00 105.78 ? 177 LYS D NZ    1 
ATOM 5515  N N     . LEU D 1 181 ? 26.675  -5.102   -94.681  1.00 123.34 ? 178 LEU D N     1 
ATOM 5516  C CA    . LEU D 1 181 ? 25.718  -4.720   -93.655  1.00 119.84 ? 178 LEU D CA    1 
ATOM 5517  C C     . LEU D 1 181 ? 26.405  -3.937   -92.534  1.00 130.63 ? 178 LEU D C     1 
ATOM 5518  O O     . LEU D 1 181 ? 27.597  -4.124   -92.277  1.00 127.11 ? 178 LEU D O     1 
ATOM 5519  C CB    . LEU D 1 181 ? 25.039  -5.957   -93.076  1.00 105.11 ? 178 LEU D CB    1 
ATOM 5520  C CG    . LEU D 1 181 ? 23.936  -6.577   -93.937  1.00 106.74 ? 178 LEU D CG    1 
ATOM 5521  C CD1   . LEU D 1 181 ? 23.449  -7.850   -93.289  1.00 96.51  ? 178 LEU D CD1   1 
ATOM 5522  C CD2   . LEU D 1 181 ? 22.775  -5.613   -94.142  1.00 108.75 ? 178 LEU D CD2   1 
ATOM 5523  N N     . PRO D 1 182 ? 25.675  -3.037   -91.876  1.00 140.46 ? 179 PRO D N     1 
ATOM 5524  C CA    . PRO D 1 182 ? 26.262  -2.264   -90.772  1.00 138.89 ? 179 PRO D CA    1 
ATOM 5525  C C     . PRO D 1 182 ? 26.657  -3.165   -89.609  1.00 142.98 ? 179 PRO D C     1 
ATOM 5526  O O     . PRO D 1 182 ? 25.855  -3.964   -89.119  1.00 146.43 ? 179 PRO D O     1 
ATOM 5527  C CB    . PRO D 1 182 ? 25.139  -1.297   -90.380  1.00 131.31 ? 179 PRO D CB    1 
ATOM 5528  C CG    . PRO D 1 182 ? 24.200  -1.280   -91.538  1.00 126.87 ? 179 PRO D CG    1 
ATOM 5529  C CD    . PRO D 1 182 ? 24.295  -2.623   -92.178  1.00 134.36 ? 179 PRO D CD    1 
ATOM 5530  N N     . ARG D 1 183 ? 27.908  -3.033   -89.175  1.00 137.67 ? 180 ARG D N     1 
ATOM 5531  C CA    . ARG D 1 183 ? 28.437  -3.816   -88.060  1.00 143.59 ? 180 ARG D CA    1 
ATOM 5532  C C     . ARG D 1 183 ? 27.724  -3.413   -86.772  1.00 142.84 ? 180 ARG D C     1 
ATOM 5533  O O     . ARG D 1 183 ? 28.001  -2.358   -86.197  1.00 142.61 ? 180 ARG D O     1 
ATOM 5534  C CB    . ARG D 1 183 ? 29.943  -3.607   -87.949  1.00 138.35 ? 180 ARG D CB    1 
ATOM 5535  C CG    . ARG D 1 183 ? 30.784  -4.759   -88.488  1.00 146.41 ? 180 ARG D CG    1 
ATOM 5536  C CD    . ARG D 1 183 ? 30.484  -6.067   -87.777  1.00 143.81 ? 180 ARG D CD    1 
ATOM 5537  N NE    . ARG D 1 183 ? 30.745  -5.980   -86.344  1.00 150.28 ? 180 ARG D NE    1 
ATOM 5538  C CZ    . ARG D 1 183 ? 30.328  -6.873   -85.452  1.00 151.65 ? 180 ARG D CZ    1 
ATOM 5539  N NH1   . ARG D 1 183 ? 29.623  -7.924   -85.845  1.00 139.30 ? 180 ARG D NH1   1 
ATOM 5540  N NH2   . ARG D 1 183 ? 30.613  -6.713   -84.167  1.00 158.40 ? 180 ARG D NH2   1 
ATOM 5541  N N     . GLN D 1 184 ? 26.792  -4.252   -86.318  1.00 141.47 ? 181 GLN D N     1 
ATOM 5542  C CA    . GLN D 1 184 ? 26.004  -3.974   -85.123  1.00 138.35 ? 181 GLN D CA    1 
ATOM 5543  C C     . GLN D 1 184 ? 26.750  -4.375   -83.853  1.00 140.73 ? 181 GLN D C     1 
ATOM 5544  O O     . GLN D 1 184 ? 27.547  -5.316   -83.846  1.00 145.47 ? 181 GLN D O     1 
ATOM 5545  C CB    . GLN D 1 184 ? 24.664  -4.711   -85.181  1.00 132.17 ? 181 GLN D CB    1 
ATOM 5546  C CG    . GLN D 1 184 ? 24.787  -6.221   -85.333  1.00 133.61 ? 181 GLN D CG    1 
ATOM 5547  C CD    . GLN D 1 184 ? 23.449  -6.931   -85.220  1.00 125.00 ? 181 GLN D CD    1 
ATOM 5548  O OE1   . GLN D 1 184 ? 23.101  -7.470   -84.166  1.00 130.42 ? 181 GLN D OE1   1 
ATOM 5549  N NE2   . GLN D 1 184 ? 22.694  -6.937   -86.311  1.00 106.65 ? 181 GLN D NE2   1 
ATOM 5550  N N     . LEU D 1 185 ? 26.481  -3.639   -82.761  1.00 132.71 ? 182 LEU D N     1 
ATOM 5551  C CA    . LEU D 1 185 ? 27.095  -3.940   -81.476  1.00 142.59 ? 182 LEU D CA    1 
ATOM 5552  C C     . LEU D 1 185 ? 26.382  -5.117   -80.804  1.00 138.56 ? 182 LEU D C     1 
ATOM 5553  O O     . LEU D 1 185 ? 25.172  -5.291   -80.971  1.00 129.29 ? 182 LEU D O     1 
ATOM 5554  C CB    . LEU D 1 185 ? 27.052  -2.714   -80.565  1.00 143.18 ? 182 LEU D CB    1 
ATOM 5555  C CG    . LEU D 1 185 ? 28.130  -2.557   -79.486  1.00 137.60 ? 182 LEU D CG    1 
ATOM 5556  C CD1   . LEU D 1 185 ? 29.522  -2.496   -80.107  1.00 134.76 ? 182 LEU D CD1   1 
ATOM 5557  C CD2   . LEU D 1 185 ? 27.871  -1.324   -78.631  1.00 130.89 ? 182 LEU D CD2   1 
ATOM 5558  N N     . PRO D 1 186 ? 27.125  -5.959   -80.056  1.00 136.61 ? 183 PRO D N     1 
ATOM 5559  C CA    . PRO D 1 186 ? 26.497  -7.083   -79.342  1.00 128.70 ? 183 PRO D CA    1 
ATOM 5560  C C     . PRO D 1 186 ? 25.277  -6.693   -78.517  1.00 125.52 ? 183 PRO D C     1 
ATOM 5561  O O     . PRO D 1 186 ? 25.361  -5.834   -77.634  1.00 117.12 ? 183 PRO D O     1 
ATOM 5562  C CB    . PRO D 1 186 ? 27.629  -7.597   -78.445  1.00 124.69 ? 183 PRO D CB    1 
ATOM 5563  C CG    . PRO D 1 186 ? 28.873  -7.268   -79.191  1.00 125.59 ? 183 PRO D CG    1 
ATOM 5564  C CD    . PRO D 1 186 ? 28.596  -6.048   -80.041  1.00 136.16 ? 183 PRO D CD    1 
ATOM 5565  N N     . LEU D 1 187 ? 24.136  -7.310   -78.822  1.00 130.83 ? 184 LEU D N     1 
ATOM 5566  C CA    . LEU D 1 187 ? 22.908  -7.067   -78.075  1.00 130.12 ? 184 LEU D CA    1 
ATOM 5567  C C     . LEU D 1 187 ? 23.069  -7.464   -76.609  1.00 127.93 ? 184 LEU D C     1 
ATOM 5568  O O     . LEU D 1 187 ? 23.857  -8.348   -76.260  1.00 128.90 ? 184 LEU D O     1 
ATOM 5569  C CB    . LEU D 1 187 ? 21.738  -7.828   -78.703  1.00 131.58 ? 184 LEU D CB    1 
ATOM 5570  C CG    . LEU D 1 187 ? 21.370  -7.511   -80.159  1.00 140.71 ? 184 LEU D CG    1 
ATOM 5571  C CD1   . LEU D 1 187 ? 21.504  -6.016   -80.446  1.00 130.11 ? 184 LEU D CD1   1 
ATOM 5572  C CD2   . LEU D 1 187 ? 22.174  -8.344   -81.157  1.00 125.86 ? 184 LEU D CD2   1 
ATOM 5573  N N     . GLU D 1 188 ? 22.305  -6.797   -75.747  1.00 124.19 ? 185 GLU D N     1 
ATOM 5574  C CA    . GLU D 1 188 ? 22.326  -7.043   -74.313  1.00 118.17 ? 185 GLU D CA    1 
ATOM 5575  C C     . GLU D 1 188 ? 21.178  -7.949   -73.881  1.00 117.23 ? 185 GLU D C     1 
ATOM 5576  O O     . GLU D 1 188 ? 20.084  -7.920   -74.452  1.00 113.77 ? 185 GLU D O     1 
ATOM 5577  C CB    . GLU D 1 188 ? 22.247  -5.728   -73.537  1.00 118.02 ? 185 GLU D CB    1 
ATOM 5578  C CG    . GLU D 1 188 ? 22.722  -5.830   -72.099  1.00 126.89 ? 185 GLU D CG    1 
ATOM 5579  C CD    . GLU D 1 188 ? 22.634  -4.510   -71.368  1.00 129.54 ? 185 GLU D CD    1 
ATOM 5580  O OE1   . GLU D 1 188 ? 21.577  -3.850   -71.465  1.00 126.62 ? 185 GLU D OE1   1 
ATOM 5581  O OE2   . GLU D 1 188 ? 23.616  -4.135   -70.694  1.00 130.94 ? 185 GLU D OE2   1 
ATOM 5582  N N     . VAL D 1 189 ? 21.441  -8.750   -72.850  1.00 113.29 ? 186 VAL D N     1 
ATOM 5583  C CA    . VAL D 1 189 ? 20.491  -9.726   -72.326  1.00 107.29 ? 186 VAL D CA    1 
ATOM 5584  C C     . VAL D 1 189 ? 19.915  -9.184   -71.026  1.00 104.03 ? 186 VAL D C     1 
ATOM 5585  O O     . VAL D 1 189 ? 20.661  -8.723   -70.152  1.00 107.09 ? 186 VAL D O     1 
ATOM 5586  C CB    . VAL D 1 189 ? 21.153  -11.096  -72.094  1.00 104.28 ? 186 VAL D CB    1 
ATOM 5587  C CG1   . VAL D 1 189 ? 20.135  -12.096  -71.566  1.00 101.56 ? 186 VAL D CG1   1 
ATOM 5588  C CG2   . VAL D 1 189 ? 21.806  -11.607  -73.371  1.00 97.59  ? 186 VAL D CG2   1 
ATOM 5589  N N     . ASP D 1 190 ? 18.589  -9.234   -70.899  1.00 96.81  ? 187 ASP D N     1 
ATOM 5590  C CA    . ASP D 1 190 ? 17.873  -8.721   -69.731  1.00 98.21  ? 187 ASP D CA    1 
ATOM 5591  C C     . ASP D 1 190 ? 17.577  -9.896   -68.803  1.00 99.43  ? 187 ASP D C     1 
ATOM 5592  O O     . ASP D 1 190 ? 16.643  -10.666  -69.037  1.00 97.68  ? 187 ASP D O     1 
ATOM 5593  C CB    . ASP D 1 190 ? 16.596  -7.998   -70.148  1.00 106.08 ? 187 ASP D CB    1 
ATOM 5594  C CG    . ASP D 1 190 ? 15.808  -7.475   -68.961  1.00 109.26 ? 187 ASP D CG    1 
ATOM 5595  O OD1   . ASP D 1 190 ? 16.370  -6.685   -68.173  1.00 107.27 ? 187 ASP D OD1   1 
ATOM 5596  O OD2   . ASP D 1 190 ? 14.629  -7.858   -68.814  1.00 103.24 ? 187 ASP D OD2   1 
ATOM 5597  N N     . LEU D 1 191 ? 18.379  -10.033  -67.746  1.00 102.50 ? 188 LEU D N     1 
ATOM 5598  C CA    . LEU D 1 191 ? 18.282  -11.147  -66.811  1.00 97.16  ? 188 LEU D CA    1 
ATOM 5599  C C     . LEU D 1 191 ? 17.251  -10.928  -65.701  1.00 103.02 ? 188 LEU D C     1 
ATOM 5600  O O     . LEU D 1 191 ? 17.323  -11.608  -64.669  1.00 104.24 ? 188 LEU D O     1 
ATOM 5601  C CB    . LEU D 1 191 ? 19.654  -11.423  -66.192  1.00 97.77  ? 188 LEU D CB    1 
ATOM 5602  C CG    . LEU D 1 191 ? 20.735  -11.869  -67.176  1.00 103.40 ? 188 LEU D CG    1 
ATOM 5603  C CD1   . LEU D 1 191 ? 22.019  -12.205  -66.443  1.00 99.48  ? 188 LEU D CD1   1 
ATOM 5604  C CD2   . LEU D 1 191 ? 20.249  -13.063  -67.982  1.00 101.13 ? 188 LEU D CD2   1 
ATOM 5605  N N     . THR D 1 192 ? 16.299  -10.010  -65.878  1.00 107.05 ? 189 THR D N     1 
ATOM 5606  C CA    . THR D 1 192 ? 15.304  -9.779   -64.834  1.00 107.70 ? 189 THR D CA    1 
ATOM 5607  C C     . THR D 1 192 ? 14.340  -10.954  -64.721  1.00 100.57 ? 189 THR D C     1 
ATOM 5608  O O     . THR D 1 192 ? 13.985  -11.370  -63.611  1.00 88.82  ? 189 THR D O     1 
ATOM 5609  C CB    . THR D 1 192 ? 14.539  -8.485   -65.114  1.00 105.97 ? 189 THR D CB    1 
ATOM 5610  O OG1   . THR D 1 192 ? 13.942  -8.551   -66.416  1.00 103.95 ? 189 THR D OG1   1 
ATOM 5611  C CG2   . THR D 1 192 ? 15.474  -7.283   -65.049  1.00 98.09  ? 189 THR D CG2   1 
ATOM 5612  N N     . LYS D 1 193 ? 13.915  -11.509  -65.857  1.00 99.68  ? 190 LYS D N     1 
ATOM 5613  C CA    . LYS D 1 193 ? 13.034  -12.670  -65.895  1.00 102.99 ? 190 LYS D CA    1 
ATOM 5614  C C     . LYS D 1 193 ? 13.799  -13.983  -65.989  1.00 97.80  ? 190 LYS D C     1 
ATOM 5615  O O     . LYS D 1 193 ? 13.267  -14.973  -66.511  1.00 90.29  ? 190 LYS D O     1 
ATOM 5616  C CB    . LYS D 1 193 ? 12.056  -12.536  -67.061  1.00 96.61  ? 190 LYS D CB    1 
ATOM 5617  C CG    . LYS D 1 193 ? 11.169  -11.322  -66.947  1.00 111.36 ? 190 LYS D CG    1 
ATOM 5618  C CD    . LYS D 1 193 ? 10.134  -11.274  -68.043  1.00 124.96 ? 190 LYS D CD    1 
ATOM 5619  C CE    . LYS D 1 193 ? 9.211   -10.095  -67.832  1.00 128.80 ? 190 LYS D CE    1 
ATOM 5620  N NZ    . LYS D 1 193 ? 8.323   -9.898   -68.995  1.00 112.97 ? 190 LYS D NZ    1 
ATOM 5621  N N     . ALA D 1 194 ? 15.035  -14.015  -65.501  1.00 97.95  ? 191 ALA D N     1 
ATOM 5622  C CA    . ALA D 1 194 ? 15.821  -15.238  -65.514  1.00 93.37  ? 191 ALA D CA    1 
ATOM 5623  C C     . ALA D 1 194 ? 15.286  -16.233  -64.490  1.00 97.88  ? 191 ALA D C     1 
ATOM 5624  O O     . ALA D 1 194 ? 14.741  -15.859  -63.448  1.00 98.48  ? 191 ALA D O     1 
ATOM 5625  C CB    . ALA D 1 194 ? 17.291  -14.932  -65.231  1.00 92.39  ? 191 ALA D CB    1 
ATOM 5626  N N     . LYS D 1 195 ? 15.448  -17.517  -64.802  1.00 101.48 ? 192 LYS D N     1 
ATOM 5627  C CA    . LYS D 1 195 ? 15.004  -18.573  -63.902  1.00 90.58  ? 192 LYS D CA    1 
ATOM 5628  C C     . LYS D 1 195 ? 15.840  -18.565  -62.627  1.00 95.33  ? 192 LYS D C     1 
ATOM 5629  O O     . LYS D 1 195 ? 17.073  -18.592  -62.677  1.00 95.73  ? 192 LYS D O     1 
ATOM 5630  C CB    . LYS D 1 195 ? 15.102  -19.928  -64.600  1.00 82.36  ? 192 LYS D CB    1 
ATOM 5631  C CG    . LYS D 1 195 ? 14.677  -21.114  -63.753  1.00 86.01  ? 192 LYS D CG    1 
ATOM 5632  C CD    . LYS D 1 195 ? 14.857  -22.414  -64.518  1.00 80.11  ? 192 LYS D CD    1 
ATOM 5633  C CE    . LYS D 1 195 ? 14.365  -23.602  -63.713  1.00 78.07  ? 192 LYS D CE    1 
ATOM 5634  N NZ    . LYS D 1 195 ? 12.929  -23.466  -63.347  1.00 91.31  ? 192 LYS D NZ    1 
ATOM 5635  N N     . ARG D 1 196 ? 15.162  -18.523  -61.479  1.00 89.72  ? 193 ARG D N     1 
ATOM 5636  C CA    . ARG D 1 196 ? 15.825  -18.381  -60.193  1.00 89.33  ? 193 ARG D CA    1 
ATOM 5637  C C     . ARG D 1 196 ? 15.581  -19.527  -59.225  1.00 95.55  ? 193 ARG D C     1 
ATOM 5638  O O     . ARG D 1 196 ? 16.296  -19.618  -58.221  1.00 102.34 ? 193 ARG D O     1 
ATOM 5639  C CB    . ARG D 1 196 ? 15.422  -17.060  -59.518  1.00 90.33  ? 193 ARG D CB    1 
ATOM 5640  C CG    . ARG D 1 196 ? 16.015  -15.831  -60.187  1.00 86.89  ? 193 ARG D CG    1 
ATOM 5641  C CD    . ARG D 1 196 ? 15.921  -14.622  -59.270  1.00 80.49  ? 193 ARG D CD    1 
ATOM 5642  N NE    . ARG D 1 196 ? 16.965  -13.635  -59.535  1.00 80.43  ? 193 ARG D NE    1 
ATOM 5643  C CZ    . ARG D 1 196 ? 16.913  -12.726  -60.504  1.00 99.08  ? 193 ARG D CZ    1 
ATOM 5644  N NH1   . ARG D 1 196 ? 15.862  -12.676  -61.312  1.00 102.51 ? 193 ARG D NH1   1 
ATOM 5645  N NH2   . ARG D 1 196 ? 17.912  -11.866  -60.663  1.00 94.92  ? 193 ARG D NH2   1 
ATOM 5646  N N     . GLN D 1 197 ? 14.594  -20.384  -59.472  1.00 85.34  ? 194 GLN D N     1 
ATOM 5647  C CA    . GLN D 1 197 ? 14.398  -21.564  -58.646  1.00 90.20  ? 194 GLN D CA    1 
ATOM 5648  C C     . GLN D 1 197 ? 14.079  -22.754  -59.534  1.00 90.24  ? 194 GLN D C     1 
ATOM 5649  O O     . GLN D 1 197 ? 13.636  -22.606  -60.676  1.00 80.87  ? 194 GLN D O     1 
ATOM 5650  C CB    . GLN D 1 197 ? 13.283  -21.357  -57.619  1.00 80.94  ? 194 GLN D CB    1 
ATOM 5651  C CG    . GLN D 1 197 ? 13.625  -20.354  -56.545  1.00 99.89  ? 194 GLN D CG    1 
ATOM 5652  C CD    . GLN D 1 197 ? 12.498  -20.165  -55.565  1.00 115.22 ? 194 GLN D CD    1 
ATOM 5653  O OE1   . GLN D 1 197 ? 11.336  -20.417  -55.887  1.00 121.62 ? 194 GLN D OE1   1 
ATOM 5654  N NE2   . GLN D 1 197 ? 12.829  -19.720  -54.359  1.00 108.86 ? 194 GLN D NE2   1 
ATOM 5655  N N     . ASP D 1 198 ? 14.307  -23.948  -58.982  1.00 92.57  ? 195 ASP D N     1 
ATOM 5656  C CA    . ASP D 1 198 ? 14.235  -25.166  -59.781  1.00 83.31  ? 195 ASP D CA    1 
ATOM 5657  C C     . ASP D 1 198 ? 12.808  -25.446  -60.238  1.00 83.05  ? 195 ASP D C     1 
ATOM 5658  O O     . ASP D 1 198 ? 12.573  -25.761  -61.410  1.00 91.27  ? 195 ASP D O     1 
ATOM 5659  C CB    . ASP D 1 198 ? 14.792  -26.347  -58.982  1.00 85.65  ? 195 ASP D CB    1 
ATOM 5660  C CG    . ASP D 1 198 ? 16.284  -26.228  -58.730  1.00 85.49  ? 195 ASP D CG    1 
ATOM 5661  O OD1   . ASP D 1 198 ? 16.967  -25.570  -59.540  1.00 82.57  ? 195 ASP D OD1   1 
ATOM 5662  O OD2   . ASP D 1 198 ? 16.775  -26.797  -57.732  1.00 82.70  ? 195 ASP D OD2   1 
ATOM 5663  N N     . LEU D 1 199 ? 11.849  -25.340  -59.320  1.00 87.50  ? 196 LEU D N     1 
ATOM 5664  C CA    . LEU D 1 199 ? 10.483  -25.780  -59.574  1.00 89.47  ? 196 LEU D CA    1 
ATOM 5665  C C     . LEU D 1 199 ? 9.873   -25.087  -60.790  1.00 90.24  ? 196 LEU D C     1 
ATOM 5666  O O     . LEU D 1 199 ? 10.073  -23.890  -61.016  1.00 83.58  ? 196 LEU D O     1 
ATOM 5667  C CB    . LEU D 1 199 ? 9.627   -25.525  -58.332  1.00 88.57  ? 196 LEU D CB    1 
ATOM 5668  C CG    . LEU D 1 199 ? 8.177   -26.002  -58.331  1.00 97.79  ? 196 LEU D CG    1 
ATOM 5669  C CD1   . LEU D 1 199 ? 8.119   -27.493  -58.611  1.00 93.26  ? 196 LEU D CD1   1 
ATOM 5670  C CD2   . LEU D 1 199 ? 7.543   -25.685  -56.990  1.00 97.54  ? 196 LEU D CD2   1 
ATOM 5671  N N     . GLU D 1 200 ? 9.123   -25.858  -61.578  1.00 90.74  ? 197 GLU D N     1 
ATOM 5672  C CA    . GLU D 1 200 ? 8.391   -25.353  -62.739  1.00 88.18  ? 197 GLU D CA    1 
ATOM 5673  C C     . GLU D 1 200 ? 6.920   -25.735  -62.609  1.00 91.94  ? 197 GLU D C     1 
ATOM 5674  O O     . GLU D 1 200 ? 6.504   -26.811  -63.056  1.00 82.11  ? 197 GLU D O     1 
ATOM 5675  C CB    . GLU D 1 200 ? 8.975   -25.877  -64.049  1.00 75.21  ? 197 GLU D CB    1 
ATOM 5676  C CG    . GLU D 1 200 ? 10.264  -25.194  -64.469  1.00 76.38  ? 197 GLU D CG    1 
ATOM 5677  C CD    . GLU D 1 200 ? 10.025  -23.775  -64.965  1.00 86.37  ? 197 GLU D CD    1 
ATOM 5678  O OE1   . GLU D 1 200 ? 8.897   -23.484  -65.421  1.00 89.00  ? 197 GLU D OE1   1 
ATOM 5679  O OE2   . GLU D 1 200 ? 10.965  -22.953  -64.907  1.00 83.64  ? 197 GLU D OE2   1 
ATOM 5680  N N     . PRO D 1 201 ? 6.112   -24.876  -61.979  1.00 100.73 ? 198 PRO D N     1 
ATOM 5681  C CA    . PRO D 1 201 ? 4.719   -25.267  -61.693  1.00 96.80  ? 198 PRO D CA    1 
ATOM 5682  C C     . PRO D 1 201 ? 3.891   -25.492  -62.946  1.00 90.08  ? 198 PRO D C     1 
ATOM 5683  O O     . PRO D 1 201 ? 3.103   -26.446  -62.999  1.00 86.95  ? 198 PRO D O     1 
ATOM 5684  C CB    . PRO D 1 201 ? 4.189   -24.090  -60.856  1.00 101.64 ? 198 PRO D CB    1 
ATOM 5685  C CG    . PRO D 1 201 ? 5.411   -23.366  -60.373  1.00 99.40  ? 198 PRO D CG    1 
ATOM 5686  C CD    . PRO D 1 201 ? 6.441   -23.551  -61.436  1.00 92.19  ? 198 PRO D CD    1 
ATOM 5687  N N     . SER D 1 202 ? 4.045   -24.635  -63.960  1.00 90.78  ? 199 SER D N     1 
ATOM 5688  C CA    . SER D 1 202 ? 3.303   -24.818  -65.203  1.00 93.51  ? 199 SER D CA    1 
ATOM 5689  C C     . SER D 1 202 ? 3.629   -26.163  -65.844  1.00 93.44  ? 199 SER D C     1 
ATOM 5690  O O     . SER D 1 202 ? 2.732   -26.864  -66.331  1.00 85.15  ? 199 SER D O     1 
ATOM 5691  C CB    . SER D 1 202 ? 3.613   -23.661  -66.157  1.00 86.02  ? 199 SER D CB    1 
ATOM 5692  O OG    . SER D 1 202 ? 2.993   -23.834  -67.417  1.00 84.62  ? 199 SER D OG    1 
ATOM 5693  N N     . VAL D 1 203 ? 4.909   -26.541  -65.843  1.00 91.64  ? 200 VAL D N     1 
ATOM 5694  C CA    . VAL D 1 203 ? 5.322   -27.836  -66.379  1.00 83.95  ? 200 VAL D CA    1 
ATOM 5695  C C     . VAL D 1 203 ? 4.809   -28.973  -65.499  1.00 83.12  ? 200 VAL D C     1 
ATOM 5696  O O     . VAL D 1 203 ? 4.312   -29.993  -65.994  1.00 80.07  ? 200 VAL D O     1 
ATOM 5697  C CB    . VAL D 1 203 ? 6.853   -27.889  -66.521  1.00 76.81  ? 200 VAL D CB    1 
ATOM 5698  C CG1   . VAL D 1 203 ? 7.288   -29.241  -67.048  1.00 69.01  ? 200 VAL D CG1   1 
ATOM 5699  C CG2   . VAL D 1 203 ? 7.351   -26.771  -67.428  1.00 84.70  ? 200 VAL D CG2   1 
ATOM 5700  N N     . GLU D 1 204 ? 4.976   -28.830  -64.181  1.00 82.15  ? 201 GLU D N     1 
ATOM 5701  C CA    . GLU D 1 204 ? 4.570   -29.868  -63.236  1.00 81.65  ? 201 GLU D CA    1 
ATOM 5702  C C     . GLU D 1 204 ? 3.082   -30.192  -63.339  1.00 84.66  ? 201 GLU D C     1 
ATOM 5703  O O     . GLU D 1 204 ? 2.691   -31.365  -63.262  1.00 71.93  ? 201 GLU D O     1 
ATOM 5704  C CB    . GLU D 1 204 ? 4.933   -29.433  -61.815  1.00 84.42  ? 201 GLU D CB    1 
ATOM 5705  C CG    . GLU D 1 204 ? 4.444   -30.365  -60.726  1.00 98.23  ? 201 GLU D CG    1 
ATOM 5706  C CD    . GLU D 1 204 ? 5.076   -31.741  -60.819  1.00 99.92  ? 201 GLU D CD    1 
ATOM 5707  O OE1   . GLU D 1 204 ? 6.284   -31.825  -61.134  1.00 96.10  ? 201 GLU D OE1   1 
ATOM 5708  O OE2   . GLU D 1 204 ? 4.363   -32.738  -60.581  1.00 89.94  ? 201 GLU D OE2   1 
ATOM 5709  N N     . GLU D 1 205 ? 2.236   -29.176  -63.537  1.00 90.44  ? 202 GLU D N     1 
ATOM 5710  C CA    . GLU D 1 205 ? 0.800   -29.431  -63.631  1.00 92.80  ? 202 GLU D CA    1 
ATOM 5711  C C     . GLU D 1 205 ? 0.464   -30.218  -64.892  1.00 90.82  ? 202 GLU D C     1 
ATOM 5712  O O     . GLU D 1 205 ? -0.273  -31.211  -64.840  1.00 87.18  ? 202 GLU D O     1 
ATOM 5713  C CB    . GLU D 1 205 ? 0.015   -28.117  -63.597  1.00 92.31  ? 202 GLU D CB    1 
ATOM 5714  C CG    . GLU D 1 205 ? -1.495  -28.315  -63.718  1.00 91.25  ? 202 GLU D CG    1 
ATOM 5715  C CD    . GLU D 1 205 ? -2.268  -27.011  -63.724  1.00 93.99  ? 202 GLU D CD    1 
ATOM 5716  O OE1   . GLU D 1 205 ? -1.891  -26.094  -64.483  1.00 91.42  ? 202 GLU D OE1   1 
ATOM 5717  O OE2   . GLU D 1 205 ? -3.262  -26.908  -62.975  1.00 107.06 ? 202 GLU D OE2   1 
ATOM 5718  N N     . ALA D 1 206 ? 0.966   -29.761  -66.042  1.00 92.64  ? 203 ALA D N     1 
ATOM 5719  C CA    . ALA D 1 206 ? 0.737   -30.479  -67.290  1.00 87.04  ? 203 ALA D CA    1 
ATOM 5720  C C     . ALA D 1 206 ? 1.266   -31.906  -67.227  1.00 84.28  ? 203 ALA D C     1 
ATOM 5721  O O     . ALA D 1 206 ? 0.655   -32.819  -67.797  1.00 83.58  ? 203 ALA D O     1 
ATOM 5722  C CB    . ALA D 1 206 ? 1.377   -29.722  -68.453  1.00 88.75  ? 203 ALA D CB    1 
ATOM 5723  N N     . ARG D 1 207 ? 2.369   -32.134  -66.507  1.00 85.06  ? 204 ARG D N     1 
ATOM 5724  C CA    . ARG D 1 207 ? 2.902   -33.490  -66.442  1.00 79.62  ? 204 ARG D CA    1 
ATOM 5725  C C     . ARG D 1 207 ? 2.047   -34.364  -65.534  1.00 81.31  ? 204 ARG D C     1 
ATOM 5726  O O     . ARG D 1 207 ? 1.806   -35.537  -65.844  1.00 81.83  ? 204 ARG D O     1 
ATOM 5727  C CB    . ARG D 1 207 ? 4.353   -33.485  -65.960  1.00 76.99  ? 204 ARG D CB    1 
ATOM 5728  C CG    . ARG D 1 207 ? 4.986   -34.874  -65.979  1.00 75.89  ? 204 ARG D CG    1 
ATOM 5729  C CD    . ARG D 1 207 ? 6.395   -34.881  -65.421  1.00 67.17  ? 204 ARG D CD    1 
ATOM 5730  N NE    . ARG D 1 207 ? 7.177   -33.719  -65.830  1.00 75.12  ? 204 ARG D NE    1 
ATOM 5731  C CZ    . ARG D 1 207 ? 7.670   -32.827  -64.976  1.00 74.68  ? 204 ARG D CZ    1 
ATOM 5732  N NH1   . ARG D 1 207 ? 7.456   -32.966  -63.675  1.00 79.02  ? 204 ARG D NH1   1 
ATOM 5733  N NH2   . ARG D 1 207 ? 8.375   -31.797  -65.419  1.00 71.28  ? 204 ARG D NH2   1 
ATOM 5734  N N     . TYR D 1 208 ? 1.590   -33.817  -64.402  1.00 88.92  ? 205 TYR D N     1 
ATOM 5735  C CA    . TYR D 1 208 ? 0.667   -34.558  -63.548  1.00 92.97  ? 205 TYR D CA    1 
ATOM 5736  C C     . TYR D 1 208 ? -0.609  -34.923  -64.299  1.00 91.65  ? 205 TYR D C     1 
ATOM 5737  O O     . TYR D 1 208 ? -1.131  -36.034  -64.147  1.00 83.16  ? 205 TYR D O     1 
ATOM 5738  C CB    . TYR D 1 208 ? 0.339   -33.747  -62.292  1.00 90.58  ? 205 TYR D CB    1 
ATOM 5739  C CG    . TYR D 1 208 ? -0.620  -34.447  -61.350  1.00 98.53  ? 205 TYR D CG    1 
ATOM 5740  C CD1   . TYR D 1 208 ? -0.199  -35.501  -60.548  1.00 95.40  ? 205 TYR D CD1   1 
ATOM 5741  C CD2   . TYR D 1 208 ? -1.950  -34.058  -61.272  1.00 96.25  ? 205 TYR D CD2   1 
ATOM 5742  C CE1   . TYR D 1 208 ? -1.078  -36.145  -59.689  1.00 94.64  ? 205 TYR D CE1   1 
ATOM 5743  C CE2   . TYR D 1 208 ? -2.836  -34.696  -60.417  1.00 92.35  ? 205 TYR D CE2   1 
ATOM 5744  C CZ    . TYR D 1 208 ? -2.394  -35.737  -59.628  1.00 95.31  ? 205 TYR D CZ    1 
ATOM 5745  O OH    . TYR D 1 208 ? -3.270  -36.372  -58.778  1.00 102.14 ? 205 TYR D OH    1 
ATOM 5746  N N     . ASN D 1 209 ? -1.130  -33.999  -65.111  1.00 97.40  ? 206 ASN D N     1 
ATOM 5747  C CA    . ASN D 1 209 ? -2.308  -34.290  -65.923  1.00 99.83  ? 206 ASN D CA    1 
ATOM 5748  C C     . ASN D 1 209 ? -2.000  -35.146  -67.143  1.00 102.51 ? 206 ASN D C     1 
ATOM 5749  O O     . ASN D 1 209 ? -2.935  -35.589  -67.820  1.00 106.10 ? 206 ASN D O     1 
ATOM 5750  C CB    . ASN D 1 209 ? -2.988  -32.992  -66.366  1.00 97.56  ? 206 ASN D CB    1 
ATOM 5751  C CG    . ASN D 1 209 ? -3.326  -32.086  -65.199  1.00 103.66 ? 206 ASN D CG    1 
ATOM 5752  O OD1   . ASN D 1 209 ? -3.025  -30.893  -65.218  1.00 104.54 ? 206 ASN D OD1   1 
ATOM 5753  N ND2   . ASN D 1 209 ? -3.955  -32.651  -64.173  1.00 100.89 ? 206 ASN D ND2   1 
ATOM 5754  N N     . SER D 1 210 ? -0.724  -35.381  -67.446  1.00 101.24 ? 207 SER D N     1 
ATOM 5755  C CA    . SER D 1 210 ? -0.347  -36.216  -68.577  1.00 92.93  ? 207 SER D CA    1 
ATOM 5756  C C     . SER D 1 210 ? -0.280  -37.699  -68.230  1.00 91.08  ? 207 SER D C     1 
ATOM 5757  O O     . SER D 1 210 ? -0.130  -38.523  -69.139  1.00 98.43  ? 207 SER D O     1 
ATOM 5758  C CB    . SER D 1 210 ? 1.007   -35.761  -69.135  1.00 94.82  ? 207 SER D CB    1 
ATOM 5759  O OG    . SER D 1 210 ? 1.313   -36.428  -70.348  1.00 107.81 ? 207 SER D OG    1 
ATOM 5760  N N     . CYS D 1 211 ? -0.383  -38.060  -66.953  1.00 88.86  ? 208 CYS D N     1 
ATOM 5761  C CA    . CYS D 1 211 ? -0.219  -39.450  -66.537  1.00 84.89  ? 208 CYS D CA    1 
ATOM 5762  C C     . CYS D 1 211 ? -1.562  -40.173  -66.503  1.00 89.07  ? 208 CYS D C     1 
ATOM 5763  O O     . CYS D 1 211 ? -2.548  -39.703  -67.067  1.00 101.41 ? 208 CYS D O     1 
ATOM 5764  C CB    . CYS D 1 211 ? 0.447   -39.527  -65.162  1.00 87.45  ? 208 CYS D CB    1 
ATOM 5765  S SG    . CYS D 1 211 ? 2.000   -38.614  -65.015  1.00 93.00  ? 208 CYS D SG    1 
ATOM 5766  N N     . CYS E 1 28  ? 5.506   -47.533  -71.776  1.00 89.03  ? 25  CYS E N     1 
ATOM 5767  C CA    . CYS E 1 28  ? 6.623   -47.468  -70.838  1.00 85.95  ? 25  CYS E CA    1 
ATOM 5768  C C     . CYS E 1 28  ? 7.602   -46.360  -71.224  1.00 88.58  ? 25  CYS E C     1 
ATOM 5769  O O     . CYS E 1 28  ? 7.220   -45.391  -71.881  1.00 97.17  ? 25  CYS E O     1 
ATOM 5770  C CB    . CYS E 1 28  ? 7.350   -48.812  -70.772  1.00 84.58  ? 25  CYS E CB    1 
ATOM 5771  S SG    . CYS E 1 28  ? 8.118   -49.329  -72.321  1.00 85.55  ? 25  CYS E SG    1 
ATOM 5772  N N     . PHE E 1 29  ? 8.865   -46.512  -70.826  1.00 75.70  ? 26  PHE E N     1 
ATOM 5773  C CA    . PHE E 1 29  ? 9.877   -45.510  -71.131  1.00 72.54  ? 26  PHE E CA    1 
ATOM 5774  C C     . PHE E 1 29  ? 10.332  -45.636  -72.577  1.00 74.02  ? 26  PHE E C     1 
ATOM 5775  O O     . PHE E 1 29  ? 10.482  -46.741  -73.105  1.00 82.19  ? 26  PHE E O     1 
ATOM 5776  C CB    . PHE E 1 29  ? 11.082  -45.643  -70.200  1.00 71.54  ? 26  PHE E CB    1 
ATOM 5777  C CG    . PHE E 1 29  ? 11.983  -44.441  -70.204  1.00 67.87  ? 26  PHE E CG    1 
ATOM 5778  C CD1   . PHE E 1 29  ? 11.712  -43.356  -69.386  1.00 65.27  ? 26  PHE E CD1   1 
ATOM 5779  C CD2   . PHE E 1 29  ? 13.098  -44.392  -71.025  1.00 66.01  ? 26  PHE E CD2   1 
ATOM 5780  C CE1   . PHE E 1 29  ? 12.536  -42.244  -69.384  1.00 59.68  ? 26  PHE E CE1   1 
ATOM 5781  C CE2   . PHE E 1 29  ? 13.926  -43.282  -71.028  1.00 66.40  ? 26  PHE E CE2   1 
ATOM 5782  C CZ    . PHE E 1 29  ? 13.644  -42.206  -70.206  1.00 56.52  ? 26  PHE E CZ    1 
ATOM 5783  N N     . GLY E 1 30  ? 10.553  -44.489  -73.216  1.00 74.25  ? 27  GLY E N     1 
ATOM 5784  C CA    . GLY E 1 30  ? 10.834  -44.456  -74.631  1.00 78.50  ? 27  GLY E CA    1 
ATOM 5785  C C     . GLY E 1 30  ? 9.611   -44.556  -75.509  1.00 75.84  ? 27  GLY E C     1 
ATOM 5786  O O     . GLY E 1 30  ? 9.727   -44.379  -76.728  1.00 79.77  ? 27  GLY E O     1 
ATOM 5787  N N     . GLN E 1 31  ? 8.441   -44.832  -74.932  1.00 76.62  ? 28  GLN E N     1 
ATOM 5788  C CA    . GLN E 1 31  ? 7.193   -44.945  -75.673  1.00 77.92  ? 28  GLN E CA    1 
ATOM 5789  C C     . GLN E 1 31  ? 6.236   -43.785  -75.445  1.00 87.07  ? 28  GLN E C     1 
ATOM 5790  O O     . GLN E 1 31  ? 5.489   -43.433  -76.361  1.00 94.62  ? 28  GLN E O     1 
ATOM 5791  C CB    . GLN E 1 31  ? 6.475   -46.247  -75.297  1.00 82.76  ? 28  GLN E CB    1 
ATOM 5792  C CG    . GLN E 1 31  ? 7.392   -47.451  -75.178  1.00 86.83  ? 28  GLN E CG    1 
ATOM 5793  C CD    . GLN E 1 31  ? 7.564   -48.194  -76.486  1.00 94.34  ? 28  GLN E CD    1 
ATOM 5794  O OE1   . GLN E 1 31  ? 7.514   -47.600  -77.564  1.00 111.98 ? 28  GLN E OE1   1 
ATOM 5795  N NE2   . GLN E 1 31  ? 7.767   -49.503  -76.397  1.00 74.26  ? 28  GLN E NE2   1 
ATOM 5796  N N     . CYS E 1 32  ? 6.235   -43.191  -74.251  1.00 85.10  ? 29  CYS E N     1 
ATOM 5797  C CA    . CYS E 1 32  ? 5.314   -42.100  -73.953  1.00 86.23  ? 29  CYS E CA    1 
ATOM 5798  C C     . CYS E 1 32  ? 5.545   -40.941  -74.914  1.00 86.45  ? 29  CYS E C     1 
ATOM 5799  O O     . CYS E 1 32  ? 6.684   -40.535  -75.145  1.00 83.22  ? 29  CYS E O     1 
ATOM 5800  C CB    . CYS E 1 32  ? 5.504   -41.635  -72.509  1.00 82.53  ? 29  CYS E CB    1 
ATOM 5801  S SG    . CYS E 1 32  ? 5.115   -42.874  -71.246  1.00 98.39  ? 29  CYS E SG    1 
ATOM 5802  N N     . GLN E 1 33  ? 4.465   -40.403  -75.470  1.00 86.84  ? 30  GLN E N     1 
ATOM 5803  C CA    . GLN E 1 33  ? 4.544   -39.226  -76.324  1.00 79.70  ? 30  GLN E CA    1 
ATOM 5804  C C     . GLN E 1 33  ? 4.111   -37.994  -75.541  1.00 76.00  ? 30  GLN E C     1 
ATOM 5805  O O     . GLN E 1 33  ? 3.134   -38.038  -74.787  1.00 76.04  ? 30  GLN E O     1 
ATOM 5806  C CB    . GLN E 1 33  ? 3.685   -39.395  -77.582  1.00 80.98  ? 30  GLN E CB    1 
ATOM 5807  C CG    . GLN E 1 33  ? 4.420   -40.083  -78.734  1.00 108.70 ? 30  GLN E CG    1 
ATOM 5808  C CD    . GLN E 1 33  ? 3.573   -40.222  -79.993  1.00 116.15 ? 30  GLN E CD    1 
ATOM 5809  O OE1   . GLN E 1 33  ? 3.031   -39.241  -80.504  1.00 112.07 ? 30  GLN E OE1   1 
ATOM 5810  N NE2   . GLN E 1 33  ? 3.470   -41.445  -80.505  1.00 109.26 ? 30  GLN E NE2   1 
ATOM 5811  N N     . TYR E 1 34  ? 4.856   -36.900  -75.704  1.00 75.19  ? 31  TYR E N     1 
ATOM 5812  C CA    . TYR E 1 34  ? 4.553   -35.682  -74.964  1.00 75.71  ? 31  TYR E CA    1 
ATOM 5813  C C     . TYR E 1 34  ? 3.197   -35.133  -75.383  1.00 77.79  ? 31  TYR E C     1 
ATOM 5814  O O     . TYR E 1 34  ? 2.908   -34.993  -76.575  1.00 82.37  ? 31  TYR E O     1 
ATOM 5815  C CB    . TYR E 1 34  ? 5.639   -34.628  -75.194  1.00 67.47  ? 31  TYR E CB    1 
ATOM 5816  C CG    . TYR E 1 34  ? 6.813   -34.728  -74.246  1.00 65.59  ? 31  TYR E CG    1 
ATOM 5817  C CD1   . TYR E 1 34  ? 6.669   -34.427  -72.898  1.00 70.41  ? 31  TYR E CD1   1 
ATOM 5818  C CD2   . TYR E 1 34  ? 8.062   -35.129  -74.698  1.00 59.46  ? 31  TYR E CD2   1 
ATOM 5819  C CE1   . TYR E 1 34  ? 7.738   -34.523  -72.028  1.00 75.45  ? 31  TYR E CE1   1 
ATOM 5820  C CE2   . TYR E 1 34  ? 9.137   -35.228  -73.836  1.00 58.07  ? 31  TYR E CE2   1 
ATOM 5821  C CZ    . TYR E 1 34  ? 8.970   -34.924  -72.503  1.00 73.28  ? 31  TYR E CZ    1 
ATOM 5822  O OH    . TYR E 1 34  ? 10.040  -35.022  -71.643  1.00 75.23  ? 31  TYR E OH    1 
ATOM 5823  N N     . THR E 1 35  ? 2.365   -34.826  -74.392  1.00 85.78  ? 32  THR E N     1 
ATOM 5824  C CA    . THR E 1 35  ? 1.087   -34.178  -74.627  1.00 75.90  ? 32  THR E CA    1 
ATOM 5825  C C     . THR E 1 35  ? 1.287   -32.700  -74.942  1.00 77.67  ? 32  THR E C     1 
ATOM 5826  O O     . THR E 1 35  ? 2.309   -32.097  -74.604  1.00 69.29  ? 32  THR E O     1 
ATOM 5827  C CB    . THR E 1 35  ? 0.170   -34.337  -73.417  1.00 79.71  ? 32  THR E CB    1 
ATOM 5828  O OG1   . THR E 1 35  ? 0.860   -33.912  -72.237  1.00 90.60  ? 32  THR E OG1   1 
ATOM 5829  C CG2   . THR E 1 35  ? -0.257  -35.791  -73.261  1.00 68.69  ? 32  THR E CG2   1 
ATOM 5830  N N     . ALA E 1 36  ? 0.286   -32.121  -75.610  1.00 82.51  ? 33  ALA E N     1 
ATOM 5831  C CA    . ALA E 1 36  ? 0.377   -30.731  -76.046  1.00 80.85  ? 33  ALA E CA    1 
ATOM 5832  C C     . ALA E 1 36  ? 0.679   -29.802  -74.876  1.00 83.83  ? 33  ALA E C     1 
ATOM 5833  O O     . ALA E 1 36  ? 1.545   -28.925  -74.972  1.00 82.03  ? 33  ALA E O     1 
ATOM 5834  C CB    . ALA E 1 36  ? -0.919  -30.321  -76.745  1.00 84.93  ? 33  ALA E CB    1 
ATOM 5835  N N     . GLU E 1 37  ? -0.013  -29.995  -73.753  1.00 85.92  ? 34  GLU E N     1 
ATOM 5836  C CA    . GLU E 1 37  ? 0.210   -29.140  -72.592  1.00 82.14  ? 34  GLU E CA    1 
ATOM 5837  C C     . GLU E 1 37  ? 1.618   -29.318  -72.042  1.00 79.12  ? 34  GLU E C     1 
ATOM 5838  O O     . GLU E 1 37  ? 2.329   -28.335  -71.805  1.00 65.31  ? 34  GLU E O     1 
ATOM 5839  C CB    . GLU E 1 37  ? -0.840  -29.429  -71.518  1.00 86.39  ? 34  GLU E CB    1 
ATOM 5840  C CG    . GLU E 1 37  ? -2.263  -29.490  -72.051  1.00 89.04  ? 34  GLU E CG    1 
ATOM 5841  C CD    . GLU E 1 37  ? -2.702  -30.901  -72.380  1.00 97.19  ? 34  GLU E CD    1 
ATOM 5842  O OE1   . GLU E 1 37  ? -2.396  -31.821  -71.591  1.00 104.02 ? 34  GLU E OE1   1 
ATOM 5843  O OE2   . GLU E 1 37  ? -3.352  -31.089  -73.430  1.00 92.21  ? 34  GLU E OE2   1 
ATOM 5844  N N     . GLU E 1 38  ? 2.051   -30.569  -71.862  1.00 86.57  ? 35  GLU E N     1 
ATOM 5845  C CA    . GLU E 1 38  ? 3.378   -30.801  -71.302  1.00 81.62  ? 35  GLU E CA    1 
ATOM 5846  C C     . GLU E 1 38  ? 4.468   -30.374  -72.274  1.00 75.93  ? 35  GLU E C     1 
ATOM 5847  O O     . GLU E 1 38  ? 5.465   -29.763  -71.865  1.00 69.04  ? 35  GLU E O     1 
ATOM 5848  C CB    . GLU E 1 38  ? 3.546   -32.271  -70.920  1.00 71.90  ? 35  GLU E CB    1 
ATOM 5849  C CG    . GLU E 1 38  ? 4.876   -32.573  -70.245  1.00 74.41  ? 35  GLU E CG    1 
ATOM 5850  C CD    . GLU E 1 38  ? 4.998   -34.018  -69.806  1.00 81.68  ? 35  GLU E CD    1 
ATOM 5851  O OE1   . GLU E 1 38  ? 5.959   -34.337  -69.074  1.00 69.63  ? 35  GLU E OE1   1 
ATOM 5852  O OE2   . GLU E 1 38  ? 4.134   -34.831  -70.195  1.00 89.44  ? 35  GLU E OE2   1 
ATOM 5853  N N     . TYR E 1 39  ? 4.290   -30.669  -73.567  1.00 64.56  ? 36  TYR E N     1 
ATOM 5854  C CA    . TYR E 1 39  ? 5.254   -30.206  -74.558  1.00 64.08  ? 36  TYR E CA    1 
ATOM 5855  C C     . TYR E 1 39  ? 5.399   -28.693  -74.516  1.00 69.45  ? 36  TYR E C     1 
ATOM 5856  O O     . TYR E 1 39  ? 6.517   -28.169  -74.492  1.00 69.57  ? 36  TYR E O     1 
ATOM 5857  C CB    . TYR E 1 39  ? 4.863   -30.633  -75.974  1.00 66.69  ? 36  TYR E CB    1 
ATOM 5858  C CG    . TYR E 1 39  ? 5.510   -29.708  -76.984  1.00 57.14  ? 36  TYR E CG    1 
ATOM 5859  C CD1   . TYR E 1 39  ? 6.873   -29.773  -77.230  1.00 52.88  ? 36  TYR E CD1   1 
ATOM 5860  C CD2   . TYR E 1 39  ? 4.772   -28.728  -77.642  1.00 69.48  ? 36  TYR E CD2   1 
ATOM 5861  C CE1   . TYR E 1 39  ? 7.482   -28.911  -78.118  1.00 68.92  ? 36  TYR E CE1   1 
ATOM 5862  C CE2   . TYR E 1 39  ? 5.374   -27.860  -78.535  1.00 78.99  ? 36  TYR E CE2   1 
ATOM 5863  C CZ    . TYR E 1 39  ? 6.729   -27.957  -78.769  1.00 79.69  ? 36  TYR E CZ    1 
ATOM 5864  O OH    . TYR E 1 39  ? 7.335   -27.096  -79.652  1.00 76.39  ? 36  TYR E OH    1 
ATOM 5865  N N     . GLN E 1 40  ? 4.276   -27.970  -74.549  1.00 67.83  ? 37  GLN E N     1 
ATOM 5866  C CA    . GLN E 1 40  ? 4.365   -26.517  -74.620  1.00 67.90  ? 37  GLN E CA    1 
ATOM 5867  C C     . GLN E 1 40  ? 4.966   -25.948  -73.343  1.00 78.19  ? 37  GLN E C     1 
ATOM 5868  O O     . GLN E 1 40  ? 5.799   -25.035  -73.398  1.00 77.98  ? 37  GLN E O     1 
ATOM 5869  C CB    . GLN E 1 40  ? 2.993   -25.909  -74.899  1.00 72.76  ? 37  GLN E CB    1 
ATOM 5870  C CG    . GLN E 1 40  ? 3.059   -24.420  -75.187  1.00 91.72  ? 37  GLN E CG    1 
ATOM 5871  C CD    . GLN E 1 40  ? 1.695   -23.787  -75.318  1.00 97.24  ? 37  GLN E CD    1 
ATOM 5872  O OE1   . GLN E 1 40  ? 0.791   -24.064  -74.532  1.00 95.10  ? 37  GLN E OE1   1 
ATOM 5873  N NE2   . GLN E 1 40  ? 1.532   -22.942  -76.332  1.00 97.52  ? 37  GLN E NE2   1 
ATOM 5874  N N     . ALA E 1 41  ? 4.552   -26.473  -72.186  1.00 77.34  ? 38  ALA E N     1 
ATOM 5875  C CA    . ALA E 1 41  ? 5.133   -26.049  -70.917  1.00 69.90  ? 38  ALA E CA    1 
ATOM 5876  C C     . ALA E 1 41  ? 6.649   -26.223  -70.913  1.00 73.74  ? 38  ALA E C     1 
ATOM 5877  O O     . ALA E 1 41  ? 7.389   -25.303  -70.544  1.00 70.72  ? 38  ALA E O     1 
ATOM 5878  C CB    . ALA E 1 41  ? 4.495   -26.832  -69.770  1.00 71.76  ? 38  ALA E CB    1 
ATOM 5879  N N     . ILE E 1 42  ? 7.129   -27.400  -71.326  1.00 70.64  ? 39  ILE E N     1 
ATOM 5880  C CA    . ILE E 1 42  ? 8.564   -27.671  -71.279  1.00 64.68  ? 39  ILE E CA    1 
ATOM 5881  C C     . ILE E 1 42  ? 9.306   -26.814  -72.298  1.00 64.82  ? 39  ILE E C     1 
ATOM 5882  O O     . ILE E 1 42  ? 10.392  -26.290  -72.018  1.00 57.74  ? 39  ILE E O     1 
ATOM 5883  C CB    . ILE E 1 42  ? 8.832   -29.171  -71.500  1.00 63.22  ? 39  ILE E CB    1 
ATOM 5884  C CG1   . ILE E 1 42  ? 8.407   -29.973  -70.271  1.00 60.23  ? 39  ILE E CG1   1 
ATOM 5885  C CG2   . ILE E 1 42  ? 10.303  -29.419  -71.772  1.00 67.64  ? 39  ILE E CG2   1 
ATOM 5886  C CD1   . ILE E 1 42  ? 8.467   -31.470  -70.459  1.00 66.33  ? 39  ILE E CD1   1 
ATOM 5887  N N     . GLN E 1 43  ? 8.751   -26.687  -73.505  1.00 66.04  ? 40  GLN E N     1 
ATOM 5888  C CA    . GLN E 1 43  ? 9.362   -25.854  -74.534  1.00 68.26  ? 40  GLN E CA    1 
ATOM 5889  C C     . GLN E 1 43  ? 9.497   -24.412  -74.059  1.00 77.04  ? 40  GLN E C     1 
ATOM 5890  O O     . GLN E 1 43  ? 10.518  -23.760  -74.310  1.00 74.42  ? 40  GLN E O     1 
ATOM 5891  C CB    . GLN E 1 43  ? 8.536   -25.939  -75.821  1.00 73.99  ? 40  GLN E CB    1 
ATOM 5892  C CG    . GLN E 1 43  ? 8.986   -25.030  -76.957  1.00 86.57  ? 40  GLN E CG    1 
ATOM 5893  C CD    . GLN E 1 43  ? 10.254  -25.515  -77.645  1.00 80.75  ? 40  GLN E CD    1 
ATOM 5894  O OE1   . GLN E 1 43  ? 11.061  -26.242  -77.065  1.00 73.62  ? 40  GLN E OE1   1 
ATOM 5895  N NE2   . GLN E 1 43  ? 10.426  -25.120  -78.900  1.00 75.76  ? 40  GLN E NE2   1 
ATOM 5896  N N     . LYS E 1 44  ? 8.472   -23.895  -73.377  1.00 79.62  ? 41  LYS E N     1 
ATOM 5897  C CA    . LYS E 1 44  ? 8.543   -22.547  -72.824  1.00 71.29  ? 41  LYS E CA    1 
ATOM 5898  C C     . LYS E 1 44  ? 9.601   -22.458  -71.731  1.00 76.39  ? 41  LYS E C     1 
ATOM 5899  O O     . LYS E 1 44  ? 10.429  -21.539  -71.725  1.00 76.16  ? 41  LYS E O     1 
ATOM 5900  C CB    . LYS E 1 44  ? 7.177   -22.146  -72.261  1.00 76.69  ? 41  LYS E CB    1 
ATOM 5901  C CG    . LYS E 1 44  ? 6.099   -21.832  -73.289  1.00 86.77  ? 41  LYS E CG    1 
ATOM 5902  C CD    . LYS E 1 44  ? 4.832   -21.376  -72.576  1.00 93.33  ? 41  LYS E CD    1 
ATOM 5903  C CE    . LYS E 1 44  ? 3.652   -21.237  -73.518  1.00 95.60  ? 41  LYS E CE    1 
ATOM 5904  N NZ    . LYS E 1 44  ? 3.781   -20.064  -74.421  1.00 100.37 ? 41  LYS E NZ    1 
ATOM 5905  N N     . ALA E 1 45  ? 9.578   -23.405  -70.788  1.00 74.28  ? 42  ALA E N     1 
ATOM 5906  C CA    . ALA E 1 45  ? 10.475  -23.343  -69.638  1.00 69.05  ? 42  ALA E CA    1 
ATOM 5907  C C     . ALA E 1 45  ? 11.938  -23.463  -70.053  1.00 69.27  ? 42  ALA E C     1 
ATOM 5908  O O     . ALA E 1 45  ? 12.816  -22.844  -69.442  1.00 78.13  ? 42  ALA E O     1 
ATOM 5909  C CB    . ALA E 1 45  ? 10.109  -24.437  -68.633  1.00 63.44  ? 42  ALA E CB    1 
ATOM 5910  N N     . LEU E 1 46  ? 12.224  -24.252  -71.093  1.00 70.63  ? 43  LEU E N     1 
ATOM 5911  C CA    . LEU E 1 46  ? 13.613  -24.468  -71.487  1.00 69.25  ? 43  LEU E CA    1 
ATOM 5912  C C     . LEU E 1 46  ? 14.268  -23.228  -72.087  1.00 79.71  ? 43  LEU E C     1 
ATOM 5913  O O     . LEU E 1 46  ? 15.501  -23.162  -72.133  1.00 81.63  ? 43  LEU E O     1 
ATOM 5914  C CB    . LEU E 1 46  ? 13.706  -25.637  -72.469  1.00 74.21  ? 43  LEU E CB    1 
ATOM 5915  C CG    . LEU E 1 46  ? 13.650  -27.016  -71.811  1.00 71.45  ? 43  LEU E CG    1 
ATOM 5916  C CD1   . LEU E 1 46  ? 13.545  -28.128  -72.841  1.00 64.43  ? 43  LEU E CD1   1 
ATOM 5917  C CD2   . LEU E 1 46  ? 14.858  -27.229  -70.905  1.00 67.82  ? 43  LEU E CD2   1 
ATOM 5918  N N     . ARG E 1 47  ? 13.484  -22.250  -72.546  1.00 78.82  ? 44  ARG E N     1 
ATOM 5919  C CA    . ARG E 1 47  ? 14.076  -21.033  -73.098  1.00 78.32  ? 44  ARG E CA    1 
ATOM 5920  C C     . ARG E 1 47  ? 14.708  -20.164  -72.016  1.00 76.70  ? 44  ARG E C     1 
ATOM 5921  O O     . ARG E 1 47  ? 15.608  -19.369  -72.312  1.00 79.35  ? 44  ARG E O     1 
ATOM 5922  C CB    . ARG E 1 47  ? 13.031  -20.231  -73.881  1.00 81.53  ? 44  ARG E CB    1 
ATOM 5923  C CG    . ARG E 1 47  ? 12.855  -20.676  -75.330  1.00 87.16  ? 44  ARG E CG    1 
ATOM 5924  C CD    . ARG E 1 47  ? 11.858  -19.797  -76.082  1.00 73.19  ? 44  ARG E CD    1 
ATOM 5925  N NE    . ARG E 1 47  ? 10.477  -20.234  -75.895  1.00 82.66  ? 44  ARG E NE    1 
ATOM 5926  C CZ    . ARG E 1 47  ? 9.770   -20.883  -76.815  1.00 77.39  ? 44  ARG E CZ    1 
ATOM 5927  N NH1   . ARG E 1 47  ? 10.314  -21.169  -77.990  1.00 81.99  ? 44  ARG E NH1   1 
ATOM 5928  N NH2   . ARG E 1 47  ? 8.519   -21.248  -76.564  1.00 71.75  ? 44  ARG E NH2   1 
ATOM 5929  N N     . GLN E 1 48  ? 14.221  -20.263  -70.778  1.00 74.35  ? 45  GLN E N     1 
ATOM 5930  C CA    . GLN E 1 48  ? 14.706  -19.425  -69.685  1.00 78.16  ? 45  GLN E CA    1 
ATOM 5931  C C     . GLN E 1 48  ? 16.217  -19.529  -69.515  1.00 77.24  ? 45  GLN E C     1 
ATOM 5932  O O     . GLN E 1 48  ? 16.776  -20.628  -69.474  1.00 80.34  ? 45  GLN E O     1 
ATOM 5933  C CB    . GLN E 1 48  ? 14.031  -19.819  -68.368  1.00 70.44  ? 45  GLN E CB    1 
ATOM 5934  C CG    . GLN E 1 48  ? 12.521  -19.754  -68.355  1.00 74.32  ? 45  GLN E CG    1 
ATOM 5935  C CD    . GLN E 1 48  ? 11.946  -20.252  -67.039  1.00 84.35  ? 45  GLN E CD    1 
ATOM 5936  O OE1   . GLN E 1 48  ? 11.847  -19.497  -66.072  1.00 93.62  ? 45  GLN E OE1   1 
ATOM 5937  N NE2   . GLN E 1 48  ? 11.610  -21.538  -66.982  1.00 84.38  ? 45  GLN E NE2   1 
ATOM 5938  N N     . ARG E 1 49  ? 16.876  -18.380  -69.399  1.00 71.17  ? 46  ARG E N     1 
ATOM 5939  C CA    . ARG E 1 49  ? 18.249  -18.385  -68.928  1.00 74.90  ? 46  ARG E CA    1 
ATOM 5940  C C     . ARG E 1 49  ? 18.259  -18.523  -67.406  1.00 81.81  ? 46  ARG E C     1 
ATOM 5941  O O     . ARG E 1 49  ? 17.261  -18.262  -66.728  1.00 72.86  ? 46  ARG E O     1 
ATOM 5942  C CB    . ARG E 1 49  ? 18.980  -17.115  -69.364  1.00 73.88  ? 46  ARG E CB    1 
ATOM 5943  C CG    . ARG E 1 49  ? 19.081  -16.939  -70.874  1.00 70.74  ? 46  ARG E CG    1 
ATOM 5944  C CD    . ARG E 1 49  ? 19.844  -15.672  -71.226  1.00 91.46  ? 46  ARG E CD    1 
ATOM 5945  N NE    . ARG E 1 49  ? 20.204  -15.593  -72.641  1.00 110.83 ? 46  ARG E NE    1 
ATOM 5946  C CZ    . ARG E 1 49  ? 19.431  -15.059  -73.582  1.00 106.61 ? 46  ARG E CZ    1 
ATOM 5947  N NH1   . ARG E 1 49  ? 18.246  -14.554  -73.262  1.00 94.23  ? 46  ARG E NH1   1 
ATOM 5948  N NH2   . ARG E 1 49  ? 19.842  -15.026  -74.844  1.00 102.42 ? 46  ARG E NH2   1 
ATOM 5949  N N     . LEU E 1 50  ? 19.400  -18.945  -66.868  1.00 76.98  ? 47  LEU E N     1 
ATOM 5950  C CA    . LEU E 1 50  ? 19.504  -19.223  -65.442  1.00 79.09  ? 47  LEU E CA    1 
ATOM 5951  C C     . LEU E 1 50  ? 19.949  -17.994  -64.659  1.00 83.68  ? 47  LEU E C     1 
ATOM 5952  O O     . LEU E 1 50  ? 20.811  -17.232  -65.106  1.00 85.07  ? 47  LEU E O     1 
ATOM 5953  C CB    . LEU E 1 50  ? 20.467  -20.381  -65.174  1.00 77.43  ? 47  LEU E CB    1 
ATOM 5954  C CG    . LEU E 1 50  ? 20.006  -21.786  -65.574  1.00 59.63  ? 47  LEU E CG    1 
ATOM 5955  C CD1   . LEU E 1 50  ? 18.507  -21.970  -65.340  1.00 60.12  ? 47  LEU E CD1   1 
ATOM 5956  C CD2   . LEU E 1 50  ? 20.391  -22.125  -66.992  1.00 77.66  ? 47  LEU E CD2   1 
ATOM 5957  N N     . GLY E 1 51  ? 19.339  -17.805  -63.487  1.00 81.59  ? 48  GLY E N     1 
ATOM 5958  C CA    . GLY E 1 51  ? 19.731  -16.775  -62.554  1.00 77.21  ? 48  GLY E CA    1 
ATOM 5959  C C     . GLY E 1 51  ? 21.055  -17.072  -61.876  1.00 86.01  ? 48  GLY E C     1 
ATOM 5960  O O     . GLY E 1 51  ? 21.633  -18.152  -62.036  1.00 85.60  ? 48  GLY E O     1 
ATOM 5961  N N     . PRO E 1 52  ? 21.560  -16.110  -61.094  1.00 91.08  ? 49  PRO E N     1 
ATOM 5962  C CA    . PRO E 1 52  ? 22.876  -16.287  -60.452  1.00 86.79  ? 49  PRO E CA    1 
ATOM 5963  C C     . PRO E 1 52  ? 22.924  -17.383  -59.396  1.00 84.66  ? 49  PRO E C     1 
ATOM 5964  O O     . PRO E 1 52  ? 24.030  -17.759  -58.984  1.00 77.30  ? 49  PRO E O     1 
ATOM 5965  C CB    . PRO E 1 52  ? 23.154  -14.914  -59.821  1.00 98.14  ? 49  PRO E CB    1 
ATOM 5966  C CG    . PRO E 1 52  ? 22.160  -13.972  -60.429  1.00 93.40  ? 49  PRO E CG    1 
ATOM 5967  C CD    . PRO E 1 52  ? 20.972  -14.790  -60.816  1.00 92.41  ? 49  PRO E CD    1 
ATOM 5968  N N     . GLU E 1 53  ? 21.780  -17.898  -58.937  1.00 84.75  ? 50  GLU E N     1 
ATOM 5969  C CA    . GLU E 1 53  ? 21.803  -18.967  -57.942  1.00 86.09  ? 50  GLU E CA    1 
ATOM 5970  C C     . GLU E 1 53  ? 22.458  -20.228  -58.490  1.00 89.28  ? 50  GLU E C     1 
ATOM 5971  O O     . GLU E 1 53  ? 22.992  -21.036  -57.722  1.00 95.50  ? 50  GLU E O     1 
ATOM 5972  C CB    . GLU E 1 53  ? 20.387  -19.278  -57.449  1.00 83.86  ? 50  GLU E CB    1 
ATOM 5973  C CG    . GLU E 1 53  ? 19.664  -18.097  -56.826  1.00 97.65  ? 50  GLU E CG    1 
ATOM 5974  C CD    . GLU E 1 53  ? 18.900  -17.267  -57.841  1.00 94.91  ? 50  GLU E CD    1 
ATOM 5975  O OE1   . GLU E 1 53  ? 19.345  -17.172  -59.005  1.00 89.07  ? 50  GLU E OE1   1 
ATOM 5976  O OE2   . GLU E 1 53  ? 17.853  -16.699  -57.466  1.00 96.72  ? 50  GLU E OE2   1 
ATOM 5977  N N     . TYR E 1 54  ? 22.419  -20.416  -59.808  1.00 84.66  ? 51  TYR E N     1 
ATOM 5978  C CA    . TYR E 1 54  ? 22.917  -21.626  -60.449  1.00 74.90  ? 51  TYR E CA    1 
ATOM 5979  C C     . TYR E 1 54  ? 24.397  -21.541  -60.791  1.00 75.54  ? 51  TYR E C     1 
ATOM 5980  O O     . TYR E 1 54  ? 25.107  -22.551  -60.737  1.00 81.05  ? 51  TYR E O     1 
ATOM 5981  C CB    . TYR E 1 54  ? 22.115  -21.886  -61.723  1.00 66.00  ? 51  TYR E CB    1 
ATOM 5982  C CG    . TYR E 1 54  ? 20.688  -22.254  -61.436  1.00 69.43  ? 51  TYR E CG    1 
ATOM 5983  C CD1   . TYR E 1 54  ? 20.383  -23.168  -60.442  1.00 77.06  ? 51  TYR E CD1   1 
ATOM 5984  C CD2   . TYR E 1 54  ? 19.643  -21.654  -62.119  1.00 81.23  ? 51  TYR E CD2   1 
ATOM 5985  C CE1   . TYR E 1 54  ? 19.083  -23.503  -60.164  1.00 74.66  ? 51  TYR E CE1   1 
ATOM 5986  C CE2   . TYR E 1 54  ? 18.334  -21.984  -61.849  1.00 83.14  ? 51  TYR E CE2   1 
ATOM 5987  C CZ    . TYR E 1 54  ? 18.061  -22.908  -60.870  1.00 74.15  ? 51  TYR E CZ    1 
ATOM 5988  O OH    . TYR E 1 54  ? 16.760  -23.240  -60.591  1.00 79.70  ? 51  TYR E OH    1 
ATOM 5989  N N     . ILE E 1 55  ? 24.863  -20.357  -61.150  1.00 72.43  ? 52  ILE E N     1 
ATOM 5990  C CA    . ILE E 1 55  ? 26.207  -20.188  -61.685  1.00 80.77  ? 52  ILE E CA    1 
ATOM 5991  C C     . ILE E 1 55  ? 27.218  -20.078  -60.555  1.00 81.14  ? 52  ILE E C     1 
ATOM 5992  O O     . ILE E 1 55  ? 26.988  -19.394  -59.550  1.00 94.31  ? 52  ILE E O     1 
ATOM 5993  C CB    . ILE E 1 55  ? 26.266  -18.954  -62.601  1.00 81.31  ? 52  ILE E CB    1 
ATOM 5994  C CG1   . ILE E 1 55  ? 25.064  -18.931  -63.547  1.00 81.00  ? 52  ILE E CG1   1 
ATOM 5995  C CG2   . ILE E 1 55  ? 27.560  -18.948  -63.391  1.00 82.20  ? 52  ILE E CG2   1 
ATOM 5996  C CD1   . ILE E 1 55  ? 24.933  -20.173  -64.401  1.00 76.79  ? 52  ILE E CD1   1 
ATOM 5997  N N     . SER E 1 56  ? 28.357  -20.736  -60.735  1.00 80.66  ? 53  SER E N     1 
ATOM 5998  C CA    . SER E 1 56  ? 29.496  -20.619  -59.841  1.00 82.84  ? 53  SER E CA    1 
ATOM 5999  C C     . SER E 1 56  ? 30.706  -20.267  -60.694  1.00 84.36  ? 53  SER E C     1 
ATOM 6000  O O     . SER E 1 56  ? 30.643  -20.278  -61.925  1.00 82.67  ? 53  SER E O     1 
ATOM 6001  C CB    . SER E 1 56  ? 29.734  -21.906  -59.039  1.00 84.54  ? 53  SER E CB    1 
ATOM 6002  O OG    . SER E 1 56  ? 30.848  -21.763  -58.171  1.00 106.99 ? 53  SER E OG    1 
ATOM 6003  N N     . SER E 1 57  ? 31.818  -19.948  -60.041  1.00 95.74  ? 54  SER E N     1 
ATOM 6004  C CA    . SER E 1 57  ? 32.982  -19.490  -60.781  1.00 102.54 ? 54  SER E CA    1 
ATOM 6005  C C     . SER E 1 57  ? 34.259  -19.904  -60.071  1.00 104.82 ? 54  SER E C     1 
ATOM 6006  O O     . SER E 1 57  ? 34.291  -20.066  -58.847  1.00 106.11 ? 54  SER E O     1 
ATOM 6007  C CB    . SER E 1 57  ? 32.965  -17.970  -60.971  1.00 99.53  ? 54  SER E CB    1 
ATOM 6008  O OG    . SER E 1 57  ? 33.240  -17.296  -59.754  1.00 109.29 ? 54  SER E OG    1 
ATOM 6009  N N     . ARG E 1 58  ? 35.314  -20.059  -60.864  1.00 106.30 ? 55  ARG E N     1 
ATOM 6010  C CA    . ARG E 1 58  ? 36.652  -20.349  -60.377  1.00 112.96 ? 55  ARG E CA    1 
ATOM 6011  C C     . ARG E 1 58  ? 37.628  -19.475  -61.154  1.00 121.99 ? 55  ARG E C     1 
ATOM 6012  O O     . ARG E 1 58  ? 37.230  -18.680  -62.012  1.00 119.25 ? 55  ARG E O     1 
ATOM 6013  C CB    . ARG E 1 58  ? 36.994  -21.837  -60.531  1.00 109.47 ? 55  ARG E CB    1 
ATOM 6014  C CG    . ARG E 1 58  ? 37.150  -22.291  -61.981  1.00 117.43 ? 55  ARG E CG    1 
ATOM 6015  C CD    . ARG E 1 58  ? 37.617  -23.740  -62.071  1.00 126.88 ? 55  ARG E CD    1 
ATOM 6016  N NE    . ARG E 1 58  ? 37.458  -24.291  -63.414  1.00 122.95 ? 55  ARG E NE    1 
ATOM 6017  C CZ    . ARG E 1 58  ? 36.389  -24.965  -63.826  1.00 117.16 ? 55  ARG E CZ    1 
ATOM 6018  N NH1   . ARG E 1 58  ? 35.456  -25.328  -62.957  1.00 107.31 ? 55  ARG E NH1   1 
ATOM 6019  N NH2   . ARG E 1 58  ? 36.327  -25.411  -65.072  1.00 120.09 ? 55  ARG E NH2   1 
ATOM 6020  N N     . MET E 1 59  ? 38.917  -19.629  -60.861  1.00 126.46 ? 56  MET E N     1 
ATOM 6021  C CA    . MET E 1 59  ? 39.972  -18.906  -61.565  1.00 127.25 ? 56  MET E CA    1 
ATOM 6022  C C     . MET E 1 59  ? 40.652  -19.881  -62.516  1.00 128.92 ? 56  MET E C     1 
ATOM 6023  O O     . MET E 1 59  ? 41.325  -20.821  -62.081  1.00 132.55 ? 56  MET E O     1 
ATOM 6024  C CB    . MET E 1 59  ? 40.972  -18.291  -60.589  1.00 129.25 ? 56  MET E CB    1 
ATOM 6025  C CG    . MET E 1 59  ? 40.413  -17.151  -59.763  1.00 130.58 ? 56  MET E CG    1 
ATOM 6026  S SD    . MET E 1 59  ? 39.762  -15.835  -60.815  1.00 137.53 ? 56  MET E SD    1 
ATOM 6027  C CE    . MET E 1 59  ? 38.318  -15.306  -59.896  1.00 119.79 ? 56  MET E CE    1 
ATOM 6028  N N     . ALA E 1 60  ? 40.472  -19.653  -63.812  1.00 127.43 ? 57  ALA E N     1 
ATOM 6029  C CA    . ALA E 1 60  ? 40.994  -20.552  -64.830  1.00 137.18 ? 57  ALA E CA    1 
ATOM 6030  C C     . ALA E 1 60  ? 42.512  -20.428  -64.909  1.00 138.62 ? 57  ALA E C     1 
ATOM 6031  O O     . ALA E 1 60  ? 43.184  -19.942  -63.994  1.00 129.62 ? 57  ALA E O     1 
ATOM 6032  C CB    . ALA E 1 60  ? 40.342  -20.264  -66.176  1.00 138.96 ? 57  ALA E CB    1 
ATOM 6033  N N     . GLY E 1 61  ? 43.066  -20.871  -66.031  1.00 142.14 ? 58  GLY E N     1 
ATOM 6034  C CA    . GLY E 1 61  ? 44.499  -20.881  -66.202  1.00 135.88 ? 58  GLY E CA    1 
ATOM 6035  C C     . GLY E 1 61  ? 45.149  -19.515  -66.162  1.00 140.08 ? 58  GLY E C     1 
ATOM 6036  O O     . GLY E 1 61  ? 45.965  -19.230  -65.280  1.00 134.92 ? 58  GLY E O     1 
ATOM 6037  N N     . GLY E 1 62  ? 44.782  -18.655  -67.106  1.00 144.38 ? 59  GLY E N     1 
ATOM 6038  C CA    . GLY E 1 62  ? 45.484  -17.403  -67.291  1.00 133.03 ? 59  GLY E CA    1 
ATOM 6039  C C     . GLY E 1 62  ? 45.082  -16.277  -66.366  1.00 137.55 ? 59  GLY E C     1 
ATOM 6040  O O     . GLY E 1 62  ? 45.044  -15.115  -66.785  1.00 135.60 ? 59  GLY E O     1 
ATOM 6041  N N     . GLY E 1 63  ? 44.807  -16.598  -65.106  1.00 132.36 ? 60  GLY E N     1 
ATOM 6042  C CA    . GLY E 1 63  ? 44.339  -15.588  -64.170  1.00 134.10 ? 60  GLY E CA    1 
ATOM 6043  C C     . GLY E 1 63  ? 43.033  -14.950  -64.596  1.00 143.02 ? 60  GLY E C     1 
ATOM 6044  O O     . GLY E 1 63  ? 42.844  -13.742  -64.410  1.00 137.39 ? 60  GLY E O     1 
ATOM 6045  N N     . GLN E 1 64  ? 42.132  -15.738  -65.173  1.00 146.85 ? 61  GLN E N     1 
ATOM 6046  C CA    . GLN E 1 64  ? 40.854  -15.269  -65.693  1.00 143.95 ? 61  GLN E CA    1 
ATOM 6047  C C     . GLN E 1 64  ? 39.716  -15.959  -64.944  1.00 137.05 ? 61  GLN E C     1 
ATOM 6048  O O     . GLN E 1 64  ? 39.937  -16.793  -64.064  1.00 134.15 ? 61  GLN E O     1 
ATOM 6049  C CB    . GLN E 1 64  ? 40.763  -15.520  -67.202  1.00 137.28 ? 61  GLN E CB    1 
ATOM 6050  C CG    . GLN E 1 64  ? 41.023  -16.968  -67.602  1.00 133.00 ? 61  GLN E CG    1 
ATOM 6051  C CD    . GLN E 1 64  ? 41.415  -17.117  -69.061  1.00 136.67 ? 61  GLN E CD    1 
ATOM 6052  O OE1   . GLN E 1 64  ? 41.263  -16.188  -69.856  1.00 133.29 ? 61  GLN E OE1   1 
ATOM 6053  N NE2   . GLN E 1 64  ? 41.931  -18.289  -69.419  1.00 136.87 ? 61  GLN E NE2   1 
ATOM 6054  N N     . LYS E 1 65  ? 38.486  -15.605  -65.305  1.00 131.28 ? 62  LYS E N     1 
ATOM 6055  C CA    . LYS E 1 65  ? 37.289  -16.118  -64.653  1.00 120.29 ? 62  LYS E CA    1 
ATOM 6056  C C     . LYS E 1 65  ? 36.538  -17.046  -65.597  1.00 113.95 ? 62  LYS E C     1 
ATOM 6057  O O     . LYS E 1 65  ? 36.430  -16.771  -66.796  1.00 119.09 ? 62  LYS E O     1 
ATOM 6058  C CB    . LYS E 1 65  ? 36.373  -14.972  -64.210  1.00 120.48 ? 62  LYS E CB    1 
ATOM 6059  C CG    . LYS E 1 65  ? 35.205  -15.399  -63.331  1.00 114.16 ? 62  LYS E CG    1 
ATOM 6060  C CD    . LYS E 1 65  ? 34.320  -14.211  -62.974  1.00 113.56 ? 62  LYS E CD    1 
ATOM 6061  C CE    . LYS E 1 65  ? 33.146  -14.629  -62.101  1.00 110.43 ? 62  LYS E CE    1 
ATOM 6062  N NZ    . LYS E 1 65  ? 32.229  -13.493  -61.799  1.00 101.57 ? 62  LYS E NZ    1 
ATOM 6063  N N     . VAL E 1 66  ? 36.021  -18.146  -65.050  1.00 111.98 ? 63  VAL E N     1 
ATOM 6064  C CA    . VAL E 1 66  ? 35.251  -19.128  -65.810  1.00 104.68 ? 63  VAL E CA    1 
ATOM 6065  C C     . VAL E 1 66  ? 34.053  -19.572  -64.985  1.00 97.92  ? 63  VAL E C     1 
ATOM 6066  O O     . VAL E 1 66  ? 34.204  -20.018  -63.842  1.00 100.28 ? 63  VAL E O     1 
ATOM 6067  C CB    . VAL E 1 66  ? 36.101  -20.343  -66.232  1.00 102.86 ? 63  VAL E CB    1 
ATOM 6068  C CG1   . VAL E 1 66  ? 35.216  -21.426  -66.806  1.00 97.01  ? 63  VAL E CG1   1 
ATOM 6069  C CG2   . VAL E 1 66  ? 37.093  -19.923  -67.293  1.00 110.10 ? 63  VAL E CG2   1 
ATOM 6070  N N     . CYS E 1 67  ? 32.864  -19.438  -65.563  1.00 86.69  ? 64  CYS E N     1 
ATOM 6071  C CA    . CYS E 1 67  ? 31.608  -19.832  -64.948  1.00 83.62  ? 64  CYS E CA    1 
ATOM 6072  C C     . CYS E 1 67  ? 31.274  -21.284  -65.278  1.00 78.48  ? 64  CYS E C     1 
ATOM 6073  O O     . CYS E 1 67  ? 31.747  -21.848  -66.267  1.00 79.04  ? 64  CYS E O     1 
ATOM 6074  C CB    . CYS E 1 67  ? 30.473  -18.921  -65.419  1.00 84.83  ? 64  CYS E CB    1 
ATOM 6075  S SG    . CYS E 1 67  ? 30.658  -17.181  -64.963  1.00 100.14 ? 64  CYS E SG    1 
ATOM 6076  N N     . TYR E 1 68  ? 30.438  -21.884  -64.433  1.00 81.43  ? 65  TYR E N     1 
ATOM 6077  C CA    . TYR E 1 68  ? 29.990  -23.258  -64.626  1.00 82.68  ? 65  TYR E CA    1 
ATOM 6078  C C     . TYR E 1 68  ? 28.795  -23.508  -63.718  1.00 77.38  ? 65  TYR E C     1 
ATOM 6079  O O     . TYR E 1 68  ? 28.540  -22.750  -62.778  1.00 79.44  ? 65  TYR E O     1 
ATOM 6080  C CB    . TYR E 1 68  ? 31.109  -24.272  -64.345  1.00 81.93  ? 65  TYR E CB    1 
ATOM 6081  C CG    . TYR E 1 68  ? 31.523  -24.395  -62.891  1.00 80.83  ? 65  TYR E CG    1 
ATOM 6082  C CD1   . TYR E 1 68  ? 30.866  -25.268  -62.032  1.00 75.13  ? 65  TYR E CD1   1 
ATOM 6083  C CD2   . TYR E 1 68  ? 32.587  -23.658  -62.384  1.00 88.46  ? 65  TYR E CD2   1 
ATOM 6084  C CE1   . TYR E 1 68  ? 31.241  -25.390  -60.708  1.00 85.57  ? 65  TYR E CE1   1 
ATOM 6085  C CE2   . TYR E 1 68  ? 32.972  -23.775  -61.058  1.00 92.35  ? 65  TYR E CE2   1 
ATOM 6086  C CZ    . TYR E 1 68  ? 32.294  -24.644  -60.226  1.00 84.38  ? 65  TYR E CZ    1 
ATOM 6087  O OH    . TYR E 1 68  ? 32.668  -24.770  -58.906  1.00 79.43  ? 65  TYR E OH    1 
ATOM 6088  N N     . ILE E 1 69  ? 28.062  -24.580  -64.016  1.00 78.80  ? 66  ILE E N     1 
ATOM 6089  C CA    . ILE E 1 69  ? 26.947  -25.038  -63.192  1.00 78.06  ? 66  ILE E CA    1 
ATOM 6090  C C     . ILE E 1 69  ? 27.347  -26.343  -62.519  1.00 69.01  ? 66  ILE E C     1 
ATOM 6091  O O     . ILE E 1 69  ? 27.829  -27.270  -63.182  1.00 72.25  ? 66  ILE E O     1 
ATOM 6092  C CB    . ILE E 1 69  ? 25.665  -25.218  -64.024  1.00 65.46  ? 66  ILE E CB    1 
ATOM 6093  C CG1   . ILE E 1 69  ? 25.426  -23.987  -64.898  1.00 77.19  ? 66  ILE E CG1   1 
ATOM 6094  C CG2   . ILE E 1 69  ? 24.471  -25.452  -63.111  1.00 57.79  ? 66  ILE E CG2   1 
ATOM 6095  C CD1   . ILE E 1 69  ? 24.208  -24.094  -65.788  1.00 73.73  ? 66  ILE E CD1   1 
ATOM 6096  N N     . GLU E 1 70  ? 27.138  -26.417  -61.207  1.00 68.02  ? 67  GLU E N     1 
ATOM 6097  C CA    . GLU E 1 70  ? 27.492  -27.611  -60.454  1.00 74.30  ? 67  GLU E CA    1 
ATOM 6098  C C     . GLU E 1 70  ? 26.571  -28.775  -60.810  1.00 69.98  ? 67  GLU E C     1 
ATOM 6099  O O     . GLU E 1 70  ? 25.412  -28.588  -61.194  1.00 65.13  ? 67  GLU E O     1 
ATOM 6100  C CB    . GLU E 1 70  ? 27.452  -27.322  -58.953  1.00 77.96  ? 67  GLU E CB    1 
ATOM 6101  C CG    . GLU E 1 70  ? 28.493  -26.294  -58.519  1.00 80.33  ? 67  GLU E CG    1 
ATOM 6102  C CD    . GLU E 1 70  ? 28.630  -26.175  -57.013  1.00 92.32  ? 67  GLU E CD    1 
ATOM 6103  O OE1   . GLU E 1 70  ? 27.779  -26.730  -56.287  1.00 97.66  ? 67  GLU E OE1   1 
ATOM 6104  O OE2   . GLU E 1 70  ? 29.604  -25.538  -56.556  1.00 94.07  ? 67  GLU E OE2   1 
ATOM 6105  N N     . GLY E 1 71  ? 27.122  -29.988  -60.697  1.00 71.21  ? 68  GLY E N     1 
ATOM 6106  C CA    . GLY E 1 71  ? 26.414  -31.182  -61.143  1.00 60.25  ? 68  GLY E CA    1 
ATOM 6107  C C     . GLY E 1 71  ? 25.037  -31.338  -60.530  1.00 63.83  ? 68  GLY E C     1 
ATOM 6108  O O     . GLY E 1 71  ? 24.048  -31.547  -61.239  1.00 63.30  ? 68  GLY E O     1 
ATOM 6109  N N     . HIS E 1 72  ? 24.955  -31.267  -59.197  1.00 62.30  ? 69  HIS E N     1 
ATOM 6110  C CA    . HIS E 1 72  ? 23.678  -31.480  -58.522  1.00 71.58  ? 69  HIS E CA    1 
ATOM 6111  C C     . HIS E 1 72  ? 22.634  -30.461  -58.958  1.00 72.40  ? 69  HIS E C     1 
ATOM 6112  O O     . HIS E 1 72  ? 21.440  -30.784  -59.017  1.00 68.81  ? 69  HIS E O     1 
ATOM 6113  C CB    . HIS E 1 72  ? 23.872  -31.443  -57.005  1.00 76.14  ? 69  HIS E CB    1 
ATOM 6114  C CG    . HIS E 1 72  ? 24.210  -30.087  -56.470  1.00 83.70  ? 69  HIS E CG    1 
ATOM 6115  N ND1   . HIS E 1 72  ? 23.278  -29.272  -55.864  1.00 88.92  ? 69  HIS E ND1   1 
ATOM 6116  C CD2   . HIS E 1 72  ? 25.379  -29.404  -56.445  1.00 75.85  ? 69  HIS E CD2   1 
ATOM 6117  C CE1   . HIS E 1 72  ? 23.857  -28.144  -55.493  1.00 83.46  ? 69  HIS E CE1   1 
ATOM 6118  N NE2   . HIS E 1 72  ? 25.133  -28.201  -55.831  1.00 79.86  ? 69  HIS E NE2   1 
ATOM 6119  N N     . ARG E 1 73  ? 23.061  -29.240  -59.295  1.00 71.52  ? 70  ARG E N     1 
ATOM 6120  C CA    . ARG E 1 73  ? 22.116  -28.250  -59.797  1.00 72.29  ? 70  ARG E CA    1 
ATOM 6121  C C     . ARG E 1 73  ? 21.509  -28.701  -61.118  1.00 67.46  ? 70  ARG E C     1 
ATOM 6122  O O     . ARG E 1 73  ? 20.294  -28.604  -61.313  1.00 67.50  ? 70  ARG E O     1 
ATOM 6123  C CB    . ARG E 1 73  ? 22.807  -26.895  -59.962  1.00 74.61  ? 70  ARG E CB    1 
ATOM 6124  C CG    . ARG E 1 73  ? 23.419  -26.344  -58.685  1.00 79.76  ? 70  ARG E CG    1 
ATOM 6125  C CD    . ARG E 1 73  ? 22.684  -25.103  -58.194  1.00 80.08  ? 70  ARG E CD    1 
ATOM 6126  N NE    . ARG E 1 73  ? 23.138  -24.698  -56.865  1.00 79.20  ? 70  ARG E NE    1 
ATOM 6127  C CZ    . ARG E 1 73  ? 24.295  -24.091  -56.614  1.00 82.83  ? 70  ARG E CZ    1 
ATOM 6128  N NH1   . ARG E 1 73  ? 25.132  -23.804  -57.602  1.00 92.69  ? 70  ARG E NH1   1 
ATOM 6129  N NH2   . ARG E 1 73  ? 24.615  -23.771  -55.368  1.00 95.12  ? 70  ARG E NH2   1 
ATOM 6130  N N     . VAL E 1 74  ? 22.334  -29.235  -62.021  1.00 71.07  ? 71  VAL E N     1 
ATOM 6131  C CA    . VAL E 1 74  ? 21.826  -29.702  -63.308  1.00 62.68  ? 71  VAL E CA    1 
ATOM 6132  C C     . VAL E 1 74  ? 20.929  -30.919  -63.117  1.00 57.00  ? 71  VAL E C     1 
ATOM 6133  O O     . VAL E 1 74  ? 19.906  -31.068  -63.798  1.00 57.69  ? 71  VAL E O     1 
ATOM 6134  C CB    . VAL E 1 74  ? 22.993  -30.001  -64.267  1.00 58.09  ? 71  VAL E CB    1 
ATOM 6135  C CG1   . VAL E 1 74  ? 22.471  -30.381  -65.641  1.00 59.28  ? 71  VAL E CG1   1 
ATOM 6136  C CG2   . VAL E 1 74  ? 23.916  -28.802  -64.366  1.00 61.91  ? 71  VAL E CG2   1 
ATOM 6137  N N     . ILE E 1 75  ? 21.298  -31.806  -62.191  1.00 58.41  ? 72  ILE E N     1 
ATOM 6138  C CA    . ILE E 1 75  ? 20.483  -32.988  -61.917  1.00 60.33  ? 72  ILE E CA    1 
ATOM 6139  C C     . ILE E 1 75  ? 19.094  -32.579  -61.438  1.00 61.34  ? 72  ILE E C     1 
ATOM 6140  O O     . ILE E 1 75  ? 18.074  -33.093  -61.917  1.00 66.11  ? 72  ILE E O     1 
ATOM 6141  C CB    . ILE E 1 75  ? 21.189  -33.896  -60.894  1.00 59.89  ? 72  ILE E CB    1 
ATOM 6142  C CG1   . ILE E 1 75  ? 22.428  -34.541  -61.518  1.00 63.25  ? 72  ILE E CG1   1 
ATOM 6143  C CG2   . ILE E 1 75  ? 20.237  -34.963  -60.384  1.00 52.70  ? 72  ILE E CG2   1 
ATOM 6144  C CD1   . ILE E 1 75  ? 23.219  -35.397  -60.554  1.00 81.26  ? 72  ILE E CD1   1 
ATOM 6145  N N     . ASN E 1 76  ? 19.032  -31.649  -60.481  1.00 67.19  ? 73  ASN E N     1 
ATOM 6146  C CA    . ASN E 1 76  ? 17.736  -31.200  -59.982  1.00 73.05  ? 73  ASN E CA    1 
ATOM 6147  C C     . ASN E 1 76  ? 16.962  -30.433  -61.050  1.00 73.29  ? 73  ASN E C     1 
ATOM 6148  O O     . ASN E 1 76  ? 15.735  -30.559  -61.142  1.00 70.51  ? 73  ASN E O     1 
ATOM 6149  C CB    . ASN E 1 76  ? 17.920  -30.353  -58.724  1.00 76.35  ? 73  ASN E CB    1 
ATOM 6150  C CG    . ASN E 1 76  ? 18.216  -31.195  -57.501  1.00 77.96  ? 73  ASN E CG    1 
ATOM 6151  O OD1   . ASN E 1 76  ? 17.722  -32.318  -57.374  1.00 62.19  ? 73  ASN E OD1   1 
ATOM 6152  N ND2   . ASN E 1 76  ? 19.026  -30.662  -56.594  1.00 84.78  ? 73  ASN E ND2   1 
ATOM 6153  N N     . LEU E 1 77  ? 17.656  -29.621  -61.853  1.00 63.62  ? 74  LEU E N     1 
ATOM 6154  C CA    . LEU E 1 77  ? 17.005  -28.930  -62.964  1.00 59.24  ? 74  LEU E CA    1 
ATOM 6155  C C     . LEU E 1 77  ? 16.327  -29.921  -63.900  1.00 72.40  ? 74  LEU E C     1 
ATOM 6156  O O     . LEU E 1 77  ? 15.182  -29.716  -64.317  1.00 70.33  ? 74  LEU E O     1 
ATOM 6157  C CB    . LEU E 1 77  ? 18.024  -28.082  -63.727  1.00 58.34  ? 74  LEU E CB    1 
ATOM 6158  C CG    . LEU E 1 77  ? 18.394  -26.730  -63.117  1.00 68.97  ? 74  LEU E CG    1 
ATOM 6159  C CD1   . LEU E 1 77  ? 19.627  -26.151  -63.797  1.00 59.15  ? 74  LEU E CD1   1 
ATOM 6160  C CD2   . LEU E 1 77  ? 17.226  -25.761  -63.198  1.00 75.76  ? 74  LEU E CD2   1 
ATOM 6161  N N     . ALA E 1 78  ? 17.028  -31.002  -64.250  1.00 68.00  ? 75  ALA E N     1 
ATOM 6162  C CA    . ALA E 1 78  ? 16.451  -31.994  -65.151  1.00 61.98  ? 75  ALA E CA    1 
ATOM 6163  C C     . ALA E 1 78  ? 15.301  -32.739  -64.486  1.00 68.34  ? 75  ALA E C     1 
ATOM 6164  O O     . ALA E 1 78  ? 14.290  -33.038  -65.134  1.00 73.27  ? 75  ALA E O     1 
ATOM 6165  C CB    . ALA E 1 78  ? 17.531  -32.969  -65.619  1.00 68.33  ? 75  ALA E CB    1 
ATOM 6166  N N     . ASN E 1 79  ? 15.447  -33.067  -63.199  1.00 68.92  ? 76  ASN E N     1 
ATOM 6167  C CA    . ASN E 1 79  ? 14.364  -33.731  -62.482  1.00 68.44  ? 76  ASN E CA    1 
ATOM 6168  C C     . ASN E 1 79  ? 13.115  -32.860  -62.416  1.00 72.05  ? 76  ASN E C     1 
ATOM 6169  O O     . ASN E 1 79  ? 11.994  -33.380  -62.456  1.00 64.42  ? 76  ASN E O     1 
ATOM 6170  C CB    . ASN E 1 79  ? 14.825  -34.120  -61.078  1.00 70.13  ? 76  ASN E CB    1 
ATOM 6171  C CG    . ASN E 1 79  ? 15.652  -35.392  -61.071  1.00 71.19  ? 76  ASN E CG    1 
ATOM 6172  O OD1   . ASN E 1 79  ? 15.327  -36.359  -61.762  1.00 74.78  ? 76  ASN E OD1   1 
ATOM 6173  N ND2   . ASN E 1 79  ? 16.730  -35.397  -60.293  1.00 69.26  ? 76  ASN E ND2   1 
ATOM 6174  N N     . GLU E 1 80  ? 13.283  -31.540  -62.317  1.00 73.23  ? 77  GLU E N     1 
ATOM 6175  C CA    . GLU E 1 80  ? 12.126  -30.650  -62.294  1.00 75.38  ? 77  GLU E CA    1 
ATOM 6176  C C     . GLU E 1 80  ? 11.548  -30.445  -63.689  1.00 70.67  ? 77  GLU E C     1 
ATOM 6177  O O     . GLU E 1 80  ? 10.327  -30.343  -63.847  1.00 68.10  ? 77  GLU E O     1 
ATOM 6178  C CB    . GLU E 1 80  ? 12.506  -29.299  -61.680  1.00 82.58  ? 77  GLU E CB    1 
ATOM 6179  C CG    . GLU E 1 80  ? 12.847  -29.346  -60.198  1.00 85.32  ? 77  GLU E CG    1 
ATOM 6180  C CD    . GLU E 1 80  ? 11.722  -29.913  -59.351  1.00 84.22  ? 77  GLU E CD    1 
ATOM 6181  O OE1   . GLU E 1 80  ? 10.541  -29.743  -59.723  1.00 83.76  ? 77  GLU E OE1   1 
ATOM 6182  O OE2   . GLU E 1 80  ? 12.020  -30.543  -58.315  1.00 81.25  ? 77  GLU E OE2   1 
ATOM 6183  N N     . MET E 1 81  ? 12.406  -30.384  -64.711  1.00 70.92  ? 78  MET E N     1 
ATOM 6184  C CA    . MET E 1 81  ? 11.918  -30.147  -66.065  1.00 63.58  ? 78  MET E CA    1 
ATOM 6185  C C     . MET E 1 81  ? 11.168  -31.356  -66.612  1.00 61.66  ? 78  MET E C     1 
ATOM 6186  O O     . MET E 1 81  ? 10.096  -31.205  -67.208  1.00 67.63  ? 78  MET E O     1 
ATOM 6187  C CB    . MET E 1 81  ? 13.080  -29.768  -66.984  1.00 61.09  ? 78  MET E CB    1 
ATOM 6188  C CG    . MET E 1 81  ? 13.552  -28.326  -66.834  1.00 80.23  ? 78  MET E CG    1 
ATOM 6189  S SD    . MET E 1 81  ? 12.410  -27.081  -67.470  1.00 66.73  ? 78  MET E SD    1 
ATOM 6190  C CE    . MET E 1 81  ? 11.671  -27.946  -68.850  1.00 65.79  ? 78  MET E CE    1 
ATOM 6191  N N     . PHE E 1 82  ? 11.695  -32.565  -66.402  1.00 67.30  ? 79  PHE E N     1 
ATOM 6192  C CA    . PHE E 1 82  ? 11.128  -33.756  -67.019  1.00 66.91  ? 79  PHE E CA    1 
ATOM 6193  C C     . PHE E 1 82  ? 10.519  -34.736  -66.029  1.00 61.84  ? 79  PHE E C     1 
ATOM 6194  O O     . PHE E 1 82  ? 9.837   -35.674  -66.458  1.00 65.33  ? 79  PHE E O     1 
ATOM 6195  C CB    . PHE E 1 82  ? 12.199  -34.494  -67.835  1.00 59.12  ? 79  PHE E CB    1 
ATOM 6196  C CG    . PHE E 1 82  ? 12.977  -33.606  -68.755  1.00 46.96  ? 79  PHE E CG    1 
ATOM 6197  C CD1   . PHE E 1 82  ? 12.416  -33.136  -69.929  1.00 51.50  ? 79  PHE E CD1   1 
ATOM 6198  C CD2   . PHE E 1 82  ? 14.272  -33.232  -68.437  1.00 44.10  ? 79  PHE E CD2   1 
ATOM 6199  C CE1   . PHE E 1 82  ? 13.132  -32.313  -70.772  1.00 50.78  ? 79  PHE E CE1   1 
ATOM 6200  C CE2   . PHE E 1 82  ? 14.994  -32.410  -69.276  1.00 51.32  ? 79  PHE E CE2   1 
ATOM 6201  C CZ    . PHE E 1 82  ? 14.423  -31.948  -70.446  1.00 50.31  ? 79  PHE E CZ    1 
ATOM 6202  N N     . GLY E 1 83  ? 10.730  -34.548  -64.738  1.00 62.08  ? 80  GLY E N     1 
ATOM 6203  C CA    . GLY E 1 83  ? 10.308  -35.587  -63.815  1.00 70.58  ? 80  GLY E CA    1 
ATOM 6204  C C     . GLY E 1 83  ? 11.422  -36.570  -63.525  1.00 72.00  ? 80  GLY E C     1 
ATOM 6205  O O     . GLY E 1 83  ? 12.342  -36.767  -64.317  1.00 72.88  ? 80  GLY E O     1 
ATOM 6206  N N     . TYR E 1 84  ? 11.355  -37.175  -62.335  1.00 64.39  ? 81  TYR E N     1 
ATOM 6207  C CA    . TYR E 1 84  ? 12.353  -38.174  -61.958  1.00 67.28  ? 81  TYR E CA    1 
ATOM 6208  C C     . TYR E 1 84  ? 12.395  -39.334  -62.946  1.00 73.29  ? 81  TYR E C     1 
ATOM 6209  O O     . TYR E 1 84  ? 13.429  -39.999  -63.080  1.00 75.30  ? 81  TYR E O     1 
ATOM 6210  C CB    . TYR E 1 84  ? 12.072  -38.698  -60.550  1.00 62.84  ? 81  TYR E CB    1 
ATOM 6211  C CG    . TYR E 1 84  ? 10.849  -39.580  -60.472  1.00 58.57  ? 81  TYR E CG    1 
ATOM 6212  C CD1   . TYR E 1 84  ? 9.572   -39.035  -60.491  1.00 55.50  ? 81  TYR E CD1   1 
ATOM 6213  C CD2   . TYR E 1 84  ? 10.971  -40.962  -60.410  1.00 57.58  ? 81  TYR E CD2   1 
ATOM 6214  C CE1   . TYR E 1 84  ? 8.451   -39.845  -60.434  1.00 55.34  ? 81  TYR E CE1   1 
ATOM 6215  C CE2   . TYR E 1 84  ? 9.859   -41.777  -60.357  1.00 63.99  ? 81  TYR E CE2   1 
ATOM 6216  C CZ    . TYR E 1 84  ? 8.602   -41.213  -60.370  1.00 64.34  ? 81  TYR E CZ    1 
ATOM 6217  O OH    . TYR E 1 84  ? 7.493   -42.026  -60.313  1.00 53.03  ? 81  TYR E OH    1 
ATOM 6218  N N     . ASN E 1 85  ? 11.288  -39.593  -63.644  1.00 59.45  ? 82  ASN E N     1 
ATOM 6219  C CA    . ASN E 1 85  ? 11.199  -40.700  -64.590  1.00 60.83  ? 82  ASN E CA    1 
ATOM 6220  C C     . ASN E 1 85  ? 10.967  -40.218  -66.018  1.00 61.81  ? 82  ASN E C     1 
ATOM 6221  O O     . ASN E 1 85  ? 10.511  -40.991  -66.867  1.00 59.08  ? 82  ASN E O     1 
ATOM 6222  C CB    . ASN E 1 85  ? 10.099  -41.676  -64.168  1.00 60.74  ? 82  ASN E CB    1 
ATOM 6223  C CG    . ASN E 1 85  ? 8.701   -41.123  -64.397  1.00 62.17  ? 82  ASN E CG    1 
ATOM 6224  O OD1   . ASN E 1 85  ? 8.472   -39.919  -64.293  1.00 60.83  ? 82  ASN E OD1   1 
ATOM 6225  N ND2   . ASN E 1 85  ? 7.759   -42.007  -64.711  1.00 65.89  ? 82  ASN E ND2   1 
ATOM 6226  N N     . GLY E 1 86  ? 11.308  -38.968  -66.311  1.00 64.28  ? 83  GLY E N     1 
ATOM 6227  C CA    . GLY E 1 86  ? 11.057  -38.417  -67.627  1.00 66.13  ? 83  GLY E CA    1 
ATOM 6228  C C     . GLY E 1 86  ? 12.337  -38.191  -68.401  1.00 64.39  ? 83  GLY E C     1 
ATOM 6229  O O     . GLY E 1 86  ? 12.304  -37.915  -69.603  1.00 67.66  ? 83  GLY E O     1 
ATOM 6230  N N     . TRP E 1 87  ? 13.473  -38.320  -67.723  1.00 58.87  ? 84  TRP E N     1 
ATOM 6231  C CA    . TRP E 1 87  ? 14.772  -38.260  -68.370  1.00 56.52  ? 84  TRP E CA    1 
ATOM 6232  C C     . TRP E 1 87  ? 15.630  -39.406  -67.859  1.00 59.32  ? 84  TRP E C     1 
ATOM 6233  O O     . TRP E 1 87  ? 15.426  -39.913  -66.752  1.00 58.65  ? 84  TRP E O     1 
ATOM 6234  C CB    . TRP E 1 87  ? 15.483  -36.928  -68.113  1.00 58.74  ? 84  TRP E CB    1 
ATOM 6235  C CG    . TRP E 1 87  ? 16.024  -36.799  -66.727  1.00 58.17  ? 84  TRP E CG    1 
ATOM 6236  C CD1   . TRP E 1 87  ? 15.307  -36.624  -65.581  1.00 56.57  ? 84  TRP E CD1   1 
ATOM 6237  C CD2   . TRP E 1 87  ? 17.402  -36.844  -66.336  1.00 56.99  ? 84  TRP E CD2   1 
ATOM 6238  N NE1   . TRP E 1 87  ? 16.153  -36.551  -64.500  1.00 62.28  ? 84  TRP E NE1   1 
ATOM 6239  C CE2   . TRP E 1 87  ? 17.444  -36.684  -64.937  1.00 61.01  ? 84  TRP E CE2   1 
ATOM 6240  C CE3   . TRP E 1 87  ? 18.603  -37.001  -67.033  1.00 62.06  ? 84  TRP E CE3   1 
ATOM 6241  C CZ2   . TRP E 1 87  ? 18.639  -36.679  -64.222  1.00 53.72  ? 84  TRP E CZ2   1 
ATOM 6242  C CZ3   . TRP E 1 87  ? 19.789  -36.996  -66.320  1.00 65.24  ? 84  TRP E CZ3   1 
ATOM 6243  C CH2   . TRP E 1 87  ? 19.798  -36.837  -64.929  1.00 61.01  ? 84  TRP E CH2   1 
ATOM 6244  N N     . ALA E 1 88  ? 16.588  -39.813  -68.685  1.00 59.94  ? 85  ALA E N     1 
ATOM 6245  C CA    . ALA E 1 88  ? 17.483  -40.904  -68.343  1.00 48.43  ? 85  ALA E CA    1 
ATOM 6246  C C     . ALA E 1 88  ? 18.823  -40.636  -69.002  1.00 52.27  ? 85  ALA E C     1 
ATOM 6247  O O     . ALA E 1 88  ? 18.902  -39.938  -70.014  1.00 59.98  ? 85  ALA E O     1 
ATOM 6248  C CB    . ALA E 1 88  ? 16.919  -42.254  -68.793  1.00 43.11  ? 85  ALA E CB    1 
ATOM 6249  N N     . HIS E 1 89  ? 19.882  -41.197  -68.425  1.00 50.03  ? 86  HIS E N     1 
ATOM 6250  C CA    . HIS E 1 89  ? 21.191  -41.113  -69.049  1.00 55.79  ? 86  HIS E CA    1 
ATOM 6251  C C     . HIS E 1 89  ? 21.965  -42.397  -68.800  1.00 54.29  ? 86  HIS E C     1 
ATOM 6252  O O     . HIS E 1 89  ? 21.754  -43.089  -67.800  1.00 52.42  ? 86  HIS E O     1 
ATOM 6253  C CB    . HIS E 1 89  ? 21.996  -39.906  -68.540  1.00 48.65  ? 86  HIS E CB    1 
ATOM 6254  C CG    . HIS E 1 89  ? 22.637  -40.118  -67.206  1.00 53.73  ? 86  HIS E CG    1 
ATOM 6255  N ND1   . HIS E 1 89  ? 21.915  -40.427  -66.074  1.00 56.26  ? 86  HIS E ND1   1 
ATOM 6256  C CD2   . HIS E 1 89  ? 23.932  -40.045  -66.818  1.00 50.51  ? 86  HIS E CD2   1 
ATOM 6257  C CE1   . HIS E 1 89  ? 22.738  -40.548  -65.049  1.00 59.21  ? 86  HIS E CE1   1 
ATOM 6258  N NE2   . HIS E 1 89  ? 23.968  -40.319  -65.473  1.00 61.49  ? 86  HIS E NE2   1 
ATOM 6259  N N     . SER E 1 90  ? 22.870  -42.696  -69.727  1.00 57.39  ? 87  SER E N     1 
ATOM 6260  C CA    . SER E 1 90  ? 23.703  -43.885  -69.677  1.00 42.75  ? 87  SER E CA    1 
ATOM 6261  C C     . SER E 1 90  ? 25.078  -43.524  -70.218  1.00 41.35  ? 87  SER E C     1 
ATOM 6262  O O     . SER E 1 90  ? 25.239  -42.561  -70.970  1.00 39.77  ? 87  SER E O     1 
ATOM 6263  C CB    . SER E 1 90  ? 23.090  -45.045  -70.473  1.00 41.35  ? 87  SER E CB    1 
ATOM 6264  O OG    . SER E 1 90  ? 22.818  -44.663  -71.810  1.00 51.62  ? 87  SER E OG    1 
ATOM 6265  N N     . ILE E 1 91  ? 26.075  -44.296  -69.805  1.00 49.10  ? 88  ILE E N     1 
ATOM 6266  C CA    . ILE E 1 91  ? 27.451  -44.109  -70.243  1.00 49.59  ? 88  ILE E CA    1 
ATOM 6267  C C     . ILE E 1 91  ? 27.705  -45.051  -71.412  1.00 51.49  ? 88  ILE E C     1 
ATOM 6268  O O     . ILE E 1 91  ? 27.843  -46.265  -71.227  1.00 59.36  ? 88  ILE E O     1 
ATOM 6269  C CB    . ILE E 1 91  ? 28.439  -44.354  -69.097  1.00 42.59  ? 88  ILE E CB    1 
ATOM 6270  C CG1   . ILE E 1 91  ? 28.096  -43.437  -67.922  1.00 35.09  ? 88  ILE E CG1   1 
ATOM 6271  C CG2   . ILE E 1 91  ? 29.867  -44.117  -69.569  1.00 36.66  ? 88  ILE E CG2   1 
ATOM 6272  C CD1   . ILE E 1 91  ? 28.830  -43.770  -66.655  1.00 35.45  ? 88  ILE E CD1   1 
ATOM 6273  N N     . THR E 1 92  ? 27.767  -44.489  -72.620  1.00 46.88  ? 89  THR E N     1 
ATOM 6274  C CA    . THR E 1 92  ? 28.028  -45.303  -73.802  1.00 48.59  ? 89  THR E CA    1 
ATOM 6275  C C     . THR E 1 92  ? 29.422  -45.918  -73.740  1.00 50.89  ? 89  THR E C     1 
ATOM 6276  O O     . THR E 1 92  ? 29.595  -47.116  -73.997  1.00 63.51  ? 89  THR E O     1 
ATOM 6277  C CB    . THR E 1 92  ? 27.866  -44.462  -75.070  1.00 42.80  ? 89  THR E CB    1 
ATOM 6278  O OG1   . THR E 1 92  ? 26.540  -43.923  -75.127  1.00 53.98  ? 89  THR E OG1   1 
ATOM 6279  C CG2   . THR E 1 92  ? 28.108  -45.315  -76.299  1.00 56.31  ? 89  THR E CG2   1 
ATOM 6280  N N     . GLN E 1 93  ? 30.428  -45.119  -73.388  1.00 45.95  ? 90  GLN E N     1 
ATOM 6281  C CA    . GLN E 1 93  ? 31.788  -45.621  -73.248  1.00 44.40  ? 90  GLN E CA    1 
ATOM 6282  C C     . GLN E 1 93  ? 32.607  -44.630  -72.435  1.00 47.48  ? 90  GLN E C     1 
ATOM 6283  O O     . GLN E 1 93  ? 32.464  -43.416  -72.600  1.00 50.13  ? 90  GLN E O     1 
ATOM 6284  C CB    . GLN E 1 93  ? 32.461  -45.856  -74.605  1.00 51.87  ? 90  GLN E CB    1 
ATOM 6285  C CG    . GLN E 1 93  ? 33.784  -46.601  -74.492  1.00 56.31  ? 90  GLN E CG    1 
ATOM 6286  C CD    . GLN E 1 93  ? 34.502  -46.724  -75.821  1.00 55.28  ? 90  GLN E CD    1 
ATOM 6287  O OE1   . GLN E 1 93  ? 35.007  -45.740  -76.363  1.00 77.70  ? 90  GLN E OE1   1 
ATOM 6288  N NE2   . GLN E 1 93  ? 34.536  -47.939  -76.362  1.00 67.56  ? 90  GLN E NE2   1 
ATOM 6289  N N     . GLN E 1 94  ? 33.458  -45.156  -71.557  1.00 43.98  ? 91  GLN E N     1 
ATOM 6290  C CA    . GLN E 1 94  ? 34.471  -44.369  -70.867  1.00 40.94  ? 91  GLN E CA    1 
ATOM 6291  C C     . GLN E 1 94  ? 35.840  -44.956  -71.168  1.00 39.24  ? 91  GLN E C     1 
ATOM 6292  O O     . GLN E 1 94  ? 36.039  -46.169  -71.041  1.00 42.73  ? 91  GLN E O     1 
ATOM 6293  C CB    . GLN E 1 94  ? 34.232  -44.339  -69.357  1.00 46.66  ? 91  GLN E CB    1 
ATOM 6294  C CG    . GLN E 1 94  ? 35.463  -43.966  -68.549  1.00 54.81  ? 91  GLN E CG    1 
ATOM 6295  C CD    . GLN E 1 94  ? 35.112  -43.397  -67.194  1.00 49.02  ? 91  GLN E CD    1 
ATOM 6296  O OE1   . GLN E 1 94  ? 35.415  -43.991  -66.164  1.00 55.95  ? 91  GLN E OE1   1 
ATOM 6297  N NE2   . GLN E 1 94  ? 34.484  -42.227  -67.189  1.00 48.89  ? 91  GLN E NE2   1 
ATOM 6298  N N     . ASN E 1 95  ? 36.781  -44.101  -71.567  1.00 43.01  ? 92  ASN E N     1 
ATOM 6299  C CA    . ASN E 1 95  ? 38.109  -44.540  -71.976  1.00 53.36  ? 92  ASN E CA    1 
ATOM 6300  C C     . ASN E 1 95  ? 39.160  -43.695  -71.270  1.00 48.10  ? 92  ASN E C     1 
ATOM 6301  O O     . ASN E 1 95  ? 39.156  -42.466  -71.391  1.00 49.64  ? 92  ASN E O     1 
ATOM 6302  C CB    . ASN E 1 95  ? 38.279  -44.446  -73.493  1.00 38.70  ? 92  ASN E CB    1 
ATOM 6303  C CG    . ASN E 1 95  ? 39.639  -44.937  -73.957  1.00 50.51  ? 92  ASN E CG    1 
ATOM 6304  O OD1   . ASN E 1 95  ? 40.626  -44.199  -73.924  1.00 53.54  ? 92  ASN E OD1   1 
ATOM 6305  N ND2   . ASN E 1 95  ? 39.698  -46.191  -74.390  1.00 48.35  ? 92  ASN E ND2   1 
ATOM 6306  N N     . VAL E 1 96  ? 40.063  -44.354  -70.551  1.00 41.94  ? 93  VAL E N     1 
ATOM 6307  C CA    . VAL E 1 96  ? 41.177  -43.672  -69.901  1.00 42.06  ? 93  VAL E CA    1 
ATOM 6308  C C     . VAL E 1 96  ? 42.221  -43.358  -70.968  1.00 46.01  ? 93  VAL E C     1 
ATOM 6309  O O     . VAL E 1 96  ? 42.827  -44.264  -71.541  1.00 60.80  ? 93  VAL E O     1 
ATOM 6310  C CB    . VAL E 1 96  ? 41.775  -44.520  -68.775  1.00 34.08  ? 93  VAL E CB    1 
ATOM 6311  C CG1   . VAL E 1 96  ? 43.001  -43.839  -68.205  1.00 44.05  ? 93  VAL E CG1   1 
ATOM 6312  C CG2   . VAL E 1 96  ? 40.740  -44.761  -67.690  1.00 40.24  ? 93  VAL E CG2   1 
ATOM 6313  N N     . ASP E 1 97  ? 42.429  -42.068  -71.235  1.00 41.91  ? 94  ASP E N     1 
ATOM 6314  C CA    . ASP E 1 97  ? 43.356  -41.677  -72.292  1.00 49.06  ? 94  ASP E CA    1 
ATOM 6315  C C     . ASP E 1 97  ? 44.807  -41.904  -71.883  1.00 49.75  ? 94  ASP E C     1 
ATOM 6316  O O     . ASP E 1 97  ? 45.611  -42.390  -72.688  1.00 44.21  ? 94  ASP E O     1 
ATOM 6317  C CB    . ASP E 1 97  ? 43.126  -40.218  -72.684  1.00 53.83  ? 94  ASP E CB    1 
ATOM 6318  C CG    . ASP E 1 97  ? 41.920  -40.041  -73.589  1.00 57.17  ? 94  ASP E CG    1 
ATOM 6319  O OD1   . ASP E 1 97  ? 41.489  -41.036  -74.209  1.00 53.87  ? 94  ASP E OD1   1 
ATOM 6320  O OD2   . ASP E 1 97  ? 41.406  -38.908  -73.689  1.00 59.73  ? 94  ASP E OD2   1 
ATOM 6321  N N     . PHE E 1 98  ? 45.167  -41.563  -70.647  1.00 51.28  ? 95  PHE E N     1 
ATOM 6322  C CA    . PHE E 1 98  ? 46.554  -41.708  -70.225  1.00 55.45  ? 95  PHE E CA    1 
ATOM 6323  C C     . PHE E 1 98  ? 46.647  -41.682  -68.706  1.00 58.82  ? 95  PHE E C     1 
ATOM 6324  O O     . PHE E 1 98  ? 45.811  -41.081  -68.027  1.00 50.35  ? 95  PHE E O     1 
ATOM 6325  C CB    . PHE E 1 98  ? 47.430  -40.602  -70.825  1.00 60.52  ? 95  PHE E CB    1 
ATOM 6326  C CG    . PHE E 1 98  ? 47.033  -39.214  -70.398  1.00 61.28  ? 95  PHE E CG    1 
ATOM 6327  C CD1   . PHE E 1 98  ? 46.069  -38.506  -71.099  1.00 59.75  ? 95  PHE E CD1   1 
ATOM 6328  C CD2   . PHE E 1 98  ? 47.626  -38.615  -69.297  1.00 64.30  ? 95  PHE E CD2   1 
ATOM 6329  C CE1   . PHE E 1 98  ? 45.703  -37.230  -70.709  1.00 58.15  ? 95  PHE E CE1   1 
ATOM 6330  C CE2   . PHE E 1 98  ? 47.262  -37.340  -68.903  1.00 67.07  ? 95  PHE E CE2   1 
ATOM 6331  C CZ    . PHE E 1 98  ? 46.300  -36.647  -69.612  1.00 59.13  ? 95  PHE E CZ    1 
ATOM 6332  N N     . VAL E 1 99  ? 47.691  -42.333  -68.189  1.00 62.29  ? 96  VAL E N     1 
ATOM 6333  C CA    . VAL E 1 99  ? 48.085  -42.271  -66.783  1.00 55.65  ? 96  VAL E CA    1 
ATOM 6334  C C     . VAL E 1 99  ? 49.606  -42.158  -66.748  1.00 54.14  ? 96  VAL E C     1 
ATOM 6335  O O     . VAL E 1 99  ? 50.307  -43.140  -67.014  1.00 47.08  ? 96  VAL E O     1 
ATOM 6336  C CB    . VAL E 1 99  ? 47.620  -43.500  -65.987  1.00 48.56  ? 96  VAL E CB    1 
ATOM 6337  C CG1   . VAL E 1 99  ? 48.162  -43.447  -64.565  1.00 51.60  ? 96  VAL E CG1   1 
ATOM 6338  C CG2   . VAL E 1 99  ? 46.100  -43.598  -65.981  1.00 46.03  ? 96  VAL E CG2   1 
ATOM 6339  N N     . ASP E 1 100 ? 50.118  -40.976  -66.417  1.00 60.14  ? 97  ASP E N     1 
ATOM 6340  C CA    . ASP E 1 100 ? 51.551  -40.715  -66.430  1.00 69.58  ? 97  ASP E CA    1 
ATOM 6341  C C     . ASP E 1 100 ? 52.082  -40.466  -65.022  1.00 70.45  ? 97  ASP E C     1 
ATOM 6342  O O     . ASP E 1 100 ? 51.386  -39.922  -64.160  1.00 66.32  ? 97  ASP E O     1 
ATOM 6343  C CB    . ASP E 1 100 ? 51.870  -39.519  -67.330  1.00 72.67  ? 97  ASP E CB    1 
ATOM 6344  C CG    . ASP E 1 100 ? 51.583  -39.804  -68.793  1.00 70.81  ? 97  ASP E CG    1 
ATOM 6345  O OD1   . ASP E 1 100 ? 51.921  -40.911  -69.261  1.00 71.84  ? 97  ASP E OD1   1 
ATOM 6346  O OD2   . ASP E 1 100 ? 51.014  -38.926  -69.473  1.00 66.85  ? 97  ASP E OD2   1 
ATOM 6347  N N     . LEU E 1 101 ? 53.336  -40.869  -64.803  1.00 68.69  ? 98  LEU E N     1 
ATOM 6348  C CA    . LEU E 1 101 ? 54.008  -40.768  -63.509  1.00 69.75  ? 98  LEU E CA    1 
ATOM 6349  C C     . LEU E 1 101 ? 55.251  -39.893  -63.634  1.00 82.08  ? 98  LEU E C     1 
ATOM 6350  O O     . LEU E 1 101 ? 56.215  -40.271  -64.309  1.00 89.48  ? 98  LEU E O     1 
ATOM 6351  C CB    . LEU E 1 101 ? 54.381  -42.157  -62.994  1.00 74.04  ? 98  LEU E CB    1 
ATOM 6352  C CG    . LEU E 1 101 ? 55.162  -42.241  -61.680  1.00 69.30  ? 98  LEU E CG    1 
ATOM 6353  C CD1   . LEU E 1 101 ? 54.421  -41.539  -60.555  1.00 74.88  ? 98  LEU E CD1   1 
ATOM 6354  C CD2   . LEU E 1 101 ? 55.452  -43.693  -61.324  1.00 68.22  ? 98  LEU E CD2   1 
ATOM 6355  N N     . ASN E 1 102 ? 55.230  -38.726  -62.991  1.00 83.50  ? 99  ASN E N     1 
ATOM 6356  C CA    . ASN E 1 102 ? 56.371  -37.813  -62.971  1.00 89.95  ? 99  ASN E CA    1 
ATOM 6357  C C     . ASN E 1 102 ? 56.776  -37.553  -61.525  1.00 96.08  ? 99  ASN E C     1 
ATOM 6358  O O     . ASN E 1 102 ? 56.049  -36.879  -60.786  1.00 97.48  ? 99  ASN E O     1 
ATOM 6359  C CB    . ASN E 1 102 ? 56.059  -36.506  -63.698  1.00 91.93  ? 99  ASN E CB    1 
ATOM 6360  C CG    . ASN E 1 102 ? 56.858  -36.350  -64.980  1.00 107.68 ? 99  ASN E CG    1 
ATOM 6361  O OD1   . ASN E 1 102 ? 58.051  -36.657  -65.022  1.00 101.37 ? 99  ASN E OD1   1 
ATOM 6362  N ND2   . ASN E 1 102 ? 56.203  -35.872  -66.034  1.00 111.45 ? 99  ASN E ND2   1 
ATOM 6363  N N     . ASN E 1 103 ? 57.937  -38.082  -61.139  1.00 106.62 ? 100 ASN E N     1 
ATOM 6364  C CA    . ASN E 1 103 ? 58.519  -37.964  -59.796  1.00 105.47 ? 100 ASN E CA    1 
ATOM 6365  C C     . ASN E 1 103 ? 57.462  -38.037  -58.693  1.00 100.18 ? 100 ASN E C     1 
ATOM 6366  O O     . ASN E 1 103 ? 57.314  -37.138  -57.865  1.00 106.71 ? 100 ASN E O     1 
ATOM 6367  C CB    . ASN E 1 103 ? 59.360  -36.691  -59.666  1.00 102.01 ? 100 ASN E CB    1 
ATOM 6368  C CG    . ASN E 1 103 ? 58.612  -35.439  -60.088  1.00 108.05 ? 100 ASN E CG    1 
ATOM 6369  O OD1   . ASN E 1 103 ? 57.879  -34.843  -59.299  1.00 109.06 ? 100 ASN E OD1   1 
ATOM 6370  N ND2   . ASN E 1 103 ? 58.800  -35.032  -61.339  1.00 108.03 ? 100 ASN E ND2   1 
ATOM 6371  N N     . GLY E 1 104 ? 56.720  -39.142  -58.697  1.00 92.67  ? 101 GLY E N     1 
ATOM 6372  C CA    . GLY E 1 104 ? 55.811  -39.451  -57.615  1.00 81.06  ? 101 GLY E CA    1 
ATOM 6373  C C     . GLY E 1 104 ? 54.423  -38.861  -57.732  1.00 78.81  ? 101 GLY E C     1 
ATOM 6374  O O     . GLY E 1 104 ? 53.596  -39.090  -56.840  1.00 78.50  ? 101 GLY E O     1 
ATOM 6375  N N     . LYS E 1 105 ? 54.138  -38.107  -58.789  1.00 87.47  ? 102 LYS E N     1 
ATOM 6376  C CA    . LYS E 1 105 ? 52.827  -37.510  -58.994  1.00 88.67  ? 102 LYS E CA    1 
ATOM 6377  C C     . LYS E 1 105 ? 52.188  -38.098  -60.246  1.00 79.20  ? 102 LYS E C     1 
ATOM 6378  O O     . LYS E 1 105 ? 52.872  -38.355  -61.243  1.00 76.31  ? 102 LYS E O     1 
ATOM 6379  C CB    . LYS E 1 105 ? 52.942  -35.985  -59.115  1.00 93.23  ? 102 LYS E CB    1 
ATOM 6380  C CG    . LYS E 1 105 ? 53.558  -35.318  -57.890  1.00 87.74  ? 102 LYS E CG    1 
ATOM 6381  C CD    . LYS E 1 105 ? 53.656  -33.809  -58.053  1.00 96.30  ? 102 LYS E CD    1 
ATOM 6382  C CE    . LYS E 1 105 ? 54.249  -33.158  -56.809  1.00 99.93  ? 102 LYS E CE    1 
ATOM 6383  N NZ    . LYS E 1 105 ? 54.380  -31.677  -56.940  1.00 100.38 ? 102 LYS E NZ    1 
ATOM 6384  N N     . PHE E 1 106 ? 50.875  -38.304  -60.191  1.00 77.80  ? 103 PHE E N     1 
ATOM 6385  C CA    . PHE E 1 106 ? 50.125  -38.932  -61.270  1.00 65.02  ? 103 PHE E CA    1 
ATOM 6386  C C     . PHE E 1 106 ? 49.293  -37.901  -62.018  1.00 72.66  ? 103 PHE E C     1 
ATOM 6387  O O     . PHE E 1 106 ? 48.659  -37.037  -61.407  1.00 74.62  ? 103 PHE E O     1 
ATOM 6388  C CB    . PHE E 1 106 ? 49.212  -40.036  -60.732  1.00 62.59  ? 103 PHE E CB    1 
ATOM 6389  C CG    . PHE E 1 106 ? 49.937  -41.298  -60.378  1.00 69.66  ? 103 PHE E CG    1 
ATOM 6390  C CD1   . PHE E 1 106 ? 50.435  -42.124  -61.371  1.00 68.72  ? 103 PHE E CD1   1 
ATOM 6391  C CD2   . PHE E 1 106 ? 50.139  -41.649  -59.055  1.00 69.82  ? 103 PHE E CD2   1 
ATOM 6392  C CE1   . PHE E 1 106 ? 51.108  -43.283  -61.052  1.00 67.06  ? 103 PHE E CE1   1 
ATOM 6393  C CE2   . PHE E 1 106 ? 50.814  -42.806  -58.727  1.00 67.86  ? 103 PHE E CE2   1 
ATOM 6394  C CZ    . PHE E 1 106 ? 51.299  -43.626  -59.728  1.00 69.11  ? 103 PHE E CZ    1 
ATOM 6395  N N     . TYR E 1 107 ? 49.292  -38.006  -63.346  1.00 69.12  ? 104 TYR E N     1 
ATOM 6396  C CA    . TYR E 1 107 ? 48.535  -37.112  -64.215  1.00 73.18  ? 104 TYR E CA    1 
ATOM 6397  C C     . TYR E 1 107 ? 47.685  -37.982  -65.129  1.00 67.17  ? 104 TYR E C     1 
ATOM 6398  O O     . TYR E 1 107 ? 48.221  -38.759  -65.926  1.00 59.86  ? 104 TYR E O     1 
ATOM 6399  C CB    . TYR E 1 107 ? 49.449  -36.173  -65.024  1.00 76.84  ? 104 TYR E CB    1 
ATOM 6400  C CG    . TYR E 1 107 ? 50.380  -35.292  -64.194  1.00 91.75  ? 104 TYR E CG    1 
ATOM 6401  C CD1   . TYR E 1 107 ? 51.325  -35.842  -63.332  1.00 85.71  ? 104 TYR E CD1   1 
ATOM 6402  C CD2   . TYR E 1 107 ? 50.294  -33.906  -64.260  1.00 91.25  ? 104 TYR E CD2   1 
ATOM 6403  C CE1   . TYR E 1 107 ? 52.160  -35.043  -62.572  1.00 91.11  ? 104 TYR E CE1   1 
ATOM 6404  C CE2   . TYR E 1 107 ? 51.128  -33.095  -63.500  1.00 92.42  ? 104 TYR E CE2   1 
ATOM 6405  C CZ    . TYR E 1 107 ? 52.058  -33.670  -62.659  1.00 99.15  ? 104 TYR E CZ    1 
ATOM 6406  O OH    . TYR E 1 107 ? 52.890  -32.875  -61.902  1.00 103.24 ? 104 TYR E OH    1 
ATOM 6407  N N     . VAL E 1 108 ? 46.364  -37.857  -65.004  1.00 61.38  ? 105 VAL E N     1 
ATOM 6408  C CA    . VAL E 1 108 ? 45.414  -38.784  -65.605  1.00 53.86  ? 105 VAL E CA    1 
ATOM 6409  C C     . VAL E 1 108 ? 44.382  -37.993  -66.396  1.00 54.18  ? 105 VAL E C     1 
ATOM 6410  O O     . VAL E 1 108 ? 43.838  -37.001  -65.898  1.00 59.22  ? 105 VAL E O     1 
ATOM 6411  C CB    . VAL E 1 108 ? 44.723  -39.654  -64.536  1.00 51.04  ? 105 VAL E CB    1 
ATOM 6412  C CG1   . VAL E 1 108 ? 43.652  -40.523  -65.164  1.00 54.37  ? 105 VAL E CG1   1 
ATOM 6413  C CG2   . VAL E 1 108 ? 45.743  -40.515  -63.796  1.00 59.59  ? 105 VAL E CG2   1 
ATOM 6414  N N     . GLY E 1 109 ? 44.122  -38.426  -67.628  1.00 56.58  ? 106 GLY E N     1 
ATOM 6415  C CA    . GLY E 1 109 ? 43.029  -37.892  -68.417  1.00 53.31  ? 106 GLY E CA    1 
ATOM 6416  C C     . GLY E 1 109 ? 42.055  -38.981  -68.819  1.00 47.74  ? 106 GLY E C     1 
ATOM 6417  O O     . GLY E 1 109 ? 42.466  -40.033  -69.317  1.00 52.22  ? 106 GLY E O     1 
ATOM 6418  N N     . VAL E 1 110 ? 40.761  -38.742  -68.613  1.00 46.90  ? 107 VAL E N     1 
ATOM 6419  C CA    . VAL E 1 110 ? 39.720  -39.736  -68.860  1.00 48.16  ? 107 VAL E CA    1 
ATOM 6420  C C     . VAL E 1 110 ? 38.559  -39.056  -69.571  1.00 49.13  ? 107 VAL E C     1 
ATOM 6421  O O     . VAL E 1 110 ? 38.092  -38.000  -69.135  1.00 55.75  ? 107 VAL E O     1 
ATOM 6422  C CB    . VAL E 1 110 ? 39.238  -40.398  -67.551  1.00 49.91  ? 107 VAL E CB    1 
ATOM 6423  C CG1   . VAL E 1 110 ? 37.986  -41.235  -67.795  1.00 44.79  ? 107 VAL E CG1   1 
ATOM 6424  C CG2   . VAL E 1 110 ? 40.344  -41.259  -66.949  1.00 50.52  ? 107 VAL E CG2   1 
ATOM 6425  N N     . CYS E 1 111 ? 38.106  -39.648  -70.673  1.00 46.10  ? 108 CYS E N     1 
ATOM 6426  C CA    . CYS E 1 111 ? 36.932  -39.175  -71.389  1.00 48.51  ? 108 CYS E CA    1 
ATOM 6427  C C     . CYS E 1 111 ? 35.771  -40.135  -71.171  1.00 47.95  ? 108 CYS E C     1 
ATOM 6428  O O     . CYS E 1 111 ? 35.967  -41.329  -70.927  1.00 54.18  ? 108 CYS E O     1 
ATOM 6429  C CB    . CYS E 1 111 ? 37.213  -39.024  -72.889  1.00 51.92  ? 108 CYS E CB    1 
ATOM 6430  S SG    . CYS E 1 111 ? 37.462  -40.572  -73.780  1.00 50.29  ? 108 CYS E SG    1 
ATOM 6431  N N     . ALA E 1 112 ? 34.556  -39.597  -71.238  1.00 45.16  ? 109 ALA E N     1 
ATOM 6432  C CA    . ALA E 1 112 ? 33.349  -40.397  -71.104  1.00 46.53  ? 109 ALA E CA    1 
ATOM 6433  C C     . ALA E 1 112 ? 32.312  -39.914  -72.107  1.00 51.40  ? 109 ALA E C     1 
ATOM 6434  O O     . ALA E 1 112 ? 32.226  -38.721  -72.407  1.00 47.44  ? 109 ALA E O     1 
ATOM 6435  C CB    . ALA E 1 112 ? 32.784  -40.337  -69.677  1.00 36.37  ? 109 ALA E CB    1 
ATOM 6436  N N     . PHE E 1 113 ? 31.516  -40.852  -72.611  1.00 39.08  ? 110 PHE E N     1 
ATOM 6437  C CA    . PHE E 1 113 ? 30.458  -40.565  -73.576  1.00 38.40  ? 110 PHE E CA    1 
ATOM 6438  C C     . PHE E 1 113 ? 29.116  -40.861  -72.917  1.00 46.59  ? 110 PHE E C     1 
ATOM 6439  O O     . PHE E 1 113 ? 28.768  -42.026  -72.699  1.00 47.59  ? 110 PHE E O     1 
ATOM 6440  C CB    . PHE E 1 113 ? 30.641  -41.387  -74.851  1.00 45.23  ? 110 PHE E CB    1 
ATOM 6441  C CG    . PHE E 1 113 ? 31.900  -41.064  -75.600  1.00 37.76  ? 110 PHE E CG    1 
ATOM 6442  C CD1   . PHE E 1 113 ? 31.913  -40.058  -76.551  1.00 36.34  ? 110 PHE E CD1   1 
ATOM 6443  C CD2   . PHE E 1 113 ? 33.071  -41.763  -75.355  1.00 40.53  ? 110 PHE E CD2   1 
ATOM 6444  C CE1   . PHE E 1 113 ? 33.068  -39.753  -77.240  1.00 43.05  ? 110 PHE E CE1   1 
ATOM 6445  C CE2   . PHE E 1 113 ? 34.229  -41.460  -76.043  1.00 49.13  ? 110 PHE E CE2   1 
ATOM 6446  C CZ    . PHE E 1 113 ? 34.226  -40.454  -76.985  1.00 52.82  ? 110 PHE E CZ    1 
ATOM 6447  N N     . VAL E 1 114 ? 28.361  -39.806  -72.617  1.00 48.10  ? 111 VAL E N     1 
ATOM 6448  C CA    . VAL E 1 114 ? 27.099  -39.901  -71.888  1.00 46.88  ? 111 VAL E CA    1 
ATOM 6449  C C     . VAL E 1 114 ? 25.960  -39.599  -72.852  1.00 41.83  ? 111 VAL E C     1 
ATOM 6450  O O     . VAL E 1 114 ? 26.023  -38.624  -73.609  1.00 45.14  ? 111 VAL E O     1 
ATOM 6451  C CB    . VAL E 1 114 ? 27.074  -38.936  -70.688  1.00 36.10  ? 111 VAL E CB    1 
ATOM 6452  C CG1   . VAL E 1 114 ? 25.745  -39.028  -69.949  1.00 44.60  ? 111 VAL E CG1   1 
ATOM 6453  C CG2   . VAL E 1 114 ? 28.235  -39.225  -69.748  1.00 33.04  ? 111 VAL E CG2   1 
ATOM 6454  N N     . ARG E 1 115 ? 24.918  -40.430  -72.819  1.00 46.78  ? 112 ARG E N     1 
ATOM 6455  C CA    . ARG E 1 115 ? 23.740  -40.258  -73.662  1.00 51.36  ? 112 ARG E CA    1 
ATOM 6456  C C     . ARG E 1 115 ? 22.522  -40.053  -72.776  1.00 53.99  ? 112 ARG E C     1 
ATOM 6457  O O     . ARG E 1 115 ? 22.116  -40.968  -72.052  1.00 44.78  ? 112 ARG E O     1 
ATOM 6458  C CB    . ARG E 1 115 ? 23.504  -41.464  -74.573  1.00 48.30  ? 112 ARG E CB    1 
ATOM 6459  C CG    . ARG E 1 115 ? 22.133  -41.411  -75.240  1.00 46.69  ? 112 ARG E CG    1 
ATOM 6460  C CD    . ARG E 1 115 ? 21.819  -42.633  -76.081  1.00 51.54  ? 112 ARG E CD    1 
ATOM 6461  N NE    . ARG E 1 115 ? 20.384  -42.911  -76.050  1.00 57.38  ? 112 ARG E NE    1 
ATOM 6462  C CZ    . ARG E 1 115 ? 19.669  -43.296  -77.101  1.00 64.36  ? 112 ARG E CZ    1 
ATOM 6463  N NH1   . ARG E 1 115 ? 20.257  -43.447  -78.281  1.00 74.40  ? 112 ARG E NH1   1 
ATOM 6464  N NH2   . ARG E 1 115 ? 18.366  -43.524  -76.975  1.00 58.58  ? 112 ARG E NH2   1 
ATOM 6465  N N     . VAL E 1 116 ? 21.924  -38.876  -72.864  1.00 54.48  ? 113 VAL E N     1 
ATOM 6466  C CA    . VAL E 1 116 ? 20.697  -38.576  -72.140  1.00 51.07  ? 113 VAL E CA    1 
ATOM 6467  C C     . VAL E 1 116 ? 19.516  -38.883  -73.044  1.00 52.37  ? 113 VAL E C     1 
ATOM 6468  O O     . VAL E 1 116 ? 19.535  -38.564  -74.237  1.00 54.23  ? 113 VAL E O     1 
ATOM 6469  C CB    . VAL E 1 116 ? 20.671  -37.108  -71.677  1.00 43.46  ? 113 VAL E CB    1 
ATOM 6470  C CG1   . VAL E 1 116 ? 19.343  -36.788  -71.016  1.00 44.87  ? 113 VAL E CG1   1 
ATOM 6471  C CG2   . VAL E 1 116 ? 21.815  -36.831  -70.728  1.00 53.65  ? 113 VAL E CG2   1 
ATOM 6472  N N     . GLN E 1 117 ? 18.481  -39.501  -72.480  1.00 50.09  ? 114 GLN E N     1 
ATOM 6473  C CA    . GLN E 1 117 ? 17.264  -39.811  -73.214  1.00 50.42  ? 114 GLN E CA    1 
ATOM 6474  C C     . GLN E 1 117 ? 16.054  -39.360  -72.411  1.00 58.34  ? 114 GLN E C     1 
ATOM 6475  O O     . GLN E 1 117 ? 16.016  -39.516  -71.186  1.00 63.16  ? 114 GLN E O     1 
ATOM 6476  C CB    . GLN E 1 117 ? 17.151  -41.313  -73.513  1.00 50.53  ? 114 GLN E CB    1 
ATOM 6477  C CG    . GLN E 1 117 ? 15.995  -41.678  -74.436  1.00 45.41  ? 114 GLN E CG    1 
ATOM 6478  C CD    . GLN E 1 117 ? 15.788  -43.176  -74.553  1.00 57.63  ? 114 GLN E CD    1 
ATOM 6479  O OE1   . GLN E 1 117 ? 15.053  -43.646  -75.420  1.00 64.70  ? 114 GLN E OE1   1 
ATOM 6480  N NE2   . GLN E 1 117 ? 16.433  -43.933  -73.675  1.00 66.55  ? 114 GLN E NE2   1 
ATOM 6481  N N     . LEU E 1 118 ? 15.061  -38.816  -73.107  1.00 58.27  ? 115 LEU E N     1 
ATOM 6482  C CA    . LEU E 1 118 ? 13.798  -38.433  -72.497  1.00 58.01  ? 115 LEU E CA    1 
ATOM 6483  C C     . LEU E 1 118 ? 12.790  -39.565  -72.645  1.00 57.88  ? 115 LEU E C     1 
ATOM 6484  O O     . LEU E 1 118 ? 12.999  -40.527  -73.386  1.00 66.52  ? 115 LEU E O     1 
ATOM 6485  C CB    . LEU E 1 118 ? 13.250  -37.144  -73.117  1.00 55.80  ? 115 LEU E CB    1 
ATOM 6486  C CG    . LEU E 1 118 ? 14.138  -35.907  -72.989  1.00 61.47  ? 115 LEU E CG    1 
ATOM 6487  C CD1   . LEU E 1 118 ? 13.444  -34.684  -73.567  1.00 62.77  ? 115 LEU E CD1   1 
ATOM 6488  C CD2   . LEU E 1 118 ? 14.531  -35.682  -71.537  1.00 54.13  ? 115 LEU E CD2   1 
ATOM 6489  N N     . LYS E 1 119 ? 11.678  -39.434  -71.921  1.00 62.67  ? 116 LYS E N     1 
ATOM 6490  C CA    . LYS E 1 119 ? 10.668  -40.484  -71.884  1.00 64.31  ? 116 LYS E CA    1 
ATOM 6491  C C     . LYS E 1 119 ? 9.962   -40.691  -73.218  1.00 61.19  ? 116 LYS E C     1 
ATOM 6492  O O     . LYS E 1 119 ? 9.168   -41.631  -73.335  1.00 63.31  ? 116 LYS E O     1 
ATOM 6493  C CB    . LYS E 1 119 ? 9.637   -40.177  -70.795  1.00 64.94  ? 116 LYS E CB    1 
ATOM 6494  C CG    . LYS E 1 119 ? 8.777   -38.950  -71.074  1.00 70.38  ? 116 LYS E CG    1 
ATOM 6495  C CD    . LYS E 1 119 ? 7.658   -38.815  -70.047  1.00 76.09  ? 116 LYS E CD    1 
ATOM 6496  C CE    . LYS E 1 119 ? 6.967   -37.463  -70.151  1.00 73.13  ? 116 LYS E CE    1 
ATOM 6497  N NZ    . LYS E 1 119 ? 5.938   -37.260  -69.092  1.00 78.74  ? 116 LYS E NZ    1 
ATOM 6498  N N     . ASP E 1 120 ? 10.223  -39.853  -74.220  1.00 56.28  ? 117 ASP E N     1 
ATOM 6499  C CA    . ASP E 1 120 ? 9.625   -40.016  -75.537  1.00 63.40  ? 117 ASP E CA    1 
ATOM 6500  C C     . ASP E 1 120 ? 10.585  -40.609  -76.558  1.00 66.77  ? 117 ASP E C     1 
ATOM 6501  O O     . ASP E 1 120 ? 10.220  -40.738  -77.730  1.00 64.28  ? 117 ASP E O     1 
ATOM 6502  C CB    . ASP E 1 120 ? 9.083   -38.676  -76.044  1.00 55.82  ? 117 ASP E CB    1 
ATOM 6503  C CG    . ASP E 1 120 ? 10.178  -37.738  -76.503  1.00 62.63  ? 117 ASP E CG    1 
ATOM 6504  O OD1   . ASP E 1 120 ? 11.249  -37.711  -75.863  1.00 70.43  ? 117 ASP E OD1   1 
ATOM 6505  O OD2   . ASP E 1 120 ? 9.965   -37.024  -77.506  1.00 64.08  ? 117 ASP E OD2   1 
ATOM 6506  N N     . GLY E 1 121 ? 11.789  -40.990  -76.141  1.00 66.49  ? 118 GLY E N     1 
ATOM 6507  C CA    . GLY E 1 121 ? 12.786  -41.525  -77.034  1.00 54.08  ? 118 GLY E CA    1 
ATOM 6508  C C     . GLY E 1 121 ? 13.795  -40.507  -77.519  1.00 54.45  ? 118 GLY E C     1 
ATOM 6509  O O     . GLY E 1 121 ? 14.842  -40.898  -78.050  1.00 61.99  ? 118 GLY E O     1 
ATOM 6510  N N     . SER E 1 122 ? 13.497  -39.216  -77.369  1.00 51.35  ? 119 SER E N     1 
ATOM 6511  C CA    . SER E 1 122 ? 14.452  -38.176  -77.725  1.00 60.28  ? 119 SER E CA    1 
ATOM 6512  C C     . SER E 1 122 ? 15.748  -38.367  -76.948  1.00 54.55  ? 119 SER E C     1 
ATOM 6513  O O     . SER E 1 122 ? 15.738  -38.760  -75.779  1.00 55.82  ? 119 SER E O     1 
ATOM 6514  C CB    . SER E 1 122 ? 13.862  -36.793  -77.439  1.00 60.76  ? 119 SER E CB    1 
ATOM 6515  O OG    . SER E 1 122 ? 14.788  -35.766  -77.749  1.00 75.96  ? 119 SER E OG    1 
ATOM 6516  N N     . TYR E 1 123 ? 16.871  -38.088  -77.604  1.00 44.04  ? 120 TYR E N     1 
ATOM 6517  C CA    . TYR E 1 123 ? 18.172  -38.361  -77.016  1.00 52.83  ? 120 TYR E CA    1 
ATOM 6518  C C     . TYR E 1 123 ? 19.171  -37.288  -77.422  1.00 53.26  ? 120 TYR E C     1 
ATOM 6519  O O     . TYR E 1 123 ? 19.028  -36.643  -78.462  1.00 50.56  ? 120 TYR E O     1 
ATOM 6520  C CB    . TYR E 1 123 ? 18.681  -39.760  -77.421  1.00 50.24  ? 120 TYR E CB    1 
ATOM 6521  C CG    . TYR E 1 123 ? 18.798  -39.986  -78.917  1.00 49.94  ? 120 TYR E CG    1 
ATOM 6522  C CD1   . TYR E 1 123 ? 19.929  -39.584  -79.617  1.00 44.86  ? 120 TYR E CD1   1 
ATOM 6523  C CD2   . TYR E 1 123 ? 17.781  -40.617  -79.626  1.00 43.49  ? 120 TYR E CD2   1 
ATOM 6524  C CE1   . TYR E 1 123 ? 20.040  -39.793  -80.984  1.00 52.21  ? 120 TYR E CE1   1 
ATOM 6525  C CE2   . TYR E 1 123 ? 17.883  -40.829  -80.993  1.00 42.99  ? 120 TYR E CE2   1 
ATOM 6526  C CZ    . TYR E 1 123 ? 19.015  -40.414  -81.667  1.00 50.19  ? 120 TYR E CZ    1 
ATOM 6527  O OH    . TYR E 1 123 ? 19.128  -40.621  -83.026  1.00 50.95  ? 120 TYR E OH    1 
ATOM 6528  N N     . HIS E 1 124 ? 20.173  -37.091  -76.569  1.00 45.70  ? 121 HIS E N     1 
ATOM 6529  C CA    . HIS E 1 124 ? 21.316  -36.245  -76.881  1.00 48.21  ? 121 HIS E CA    1 
ATOM 6530  C C     . HIS E 1 124 ? 22.546  -36.857  -76.229  1.00 51.41  ? 121 HIS E C     1 
ATOM 6531  O O     . HIS E 1 124 ? 22.524  -37.164  -75.033  1.00 56.01  ? 121 HIS E O     1 
ATOM 6532  C CB    . HIS E 1 124 ? 21.099  -34.804  -76.401  1.00 53.91  ? 121 HIS E CB    1 
ATOM 6533  C CG    . HIS E 1 124 ? 20.132  -34.024  -77.239  1.00 57.23  ? 121 HIS E CG    1 
ATOM 6534  N ND1   . HIS E 1 124 ? 18.815  -33.840  -76.880  1.00 66.57  ? 121 HIS E ND1   1 
ATOM 6535  C CD2   . HIS E 1 124 ? 20.296  -33.366  -78.410  1.00 52.43  ? 121 HIS E CD2   1 
ATOM 6536  C CE1   . HIS E 1 124 ? 18.206  -33.111  -77.798  1.00 64.88  ? 121 HIS E CE1   1 
ATOM 6537  N NE2   . HIS E 1 124 ? 19.083  -32.811  -78.739  1.00 59.19  ? 121 HIS E NE2   1 
ATOM 6538  N N     . GLU E 1 125 ? 23.608  -37.032  -77.010  1.00 49.00  ? 122 GLU E N     1 
ATOM 6539  C CA    . GLU E 1 125 ? 24.840  -37.650  -76.540  1.00 44.82  ? 122 GLU E CA    1 
ATOM 6540  C C     . GLU E 1 125 ? 26.011  -36.702  -76.767  1.00 51.56  ? 122 GLU E C     1 
ATOM 6541  O O     . GLU E 1 125 ? 26.114  -36.068  -77.822  1.00 52.72  ? 122 GLU E O     1 
ATOM 6542  C CB    . GLU E 1 125 ? 25.070  -38.988  -77.260  1.00 44.56  ? 122 GLU E CB    1 
ATOM 6543  C CG    . GLU E 1 125 ? 26.345  -39.723  -76.881  1.00 45.67  ? 122 GLU E CG    1 
ATOM 6544  C CD    . GLU E 1 125 ? 26.458  -41.068  -77.578  1.00 53.66  ? 122 GLU E CD    1 
ATOM 6545  O OE1   . GLU E 1 125 ? 25.786  -41.260  -78.613  1.00 56.22  ? 122 GLU E OE1   1 
ATOM 6546  O OE2   . GLU E 1 125 ? 27.212  -41.936  -77.093  1.00 59.46  ? 122 GLU E OE2   1 
ATOM 6547  N N     . ASP E 1 126 ? 26.891  -36.603  -75.771  1.00 43.77  ? 123 ASP E N     1 
ATOM 6548  C CA    . ASP E 1 126 ? 28.054  -35.729  -75.860  1.00 44.01  ? 123 ASP E CA    1 
ATOM 6549  C C     . ASP E 1 126 ? 29.199  -36.354  -75.073  1.00 42.79  ? 123 ASP E C     1 
ATOM 6550  O O     . ASP E 1 126 ? 29.042  -37.394  -74.427  1.00 39.03  ? 123 ASP E O     1 
ATOM 6551  C CB    . ASP E 1 126 ? 27.719  -34.324  -75.352  1.00 47.36  ? 123 ASP E CB    1 
ATOM 6552  C CG    . ASP E 1 126 ? 28.418  -33.235  -76.142  1.00 56.33  ? 123 ASP E CG    1 
ATOM 6553  O OD1   . ASP E 1 126 ? 29.663  -33.165  -76.086  1.00 45.06  ? 123 ASP E OD1   1 
ATOM 6554  O OD2   . ASP E 1 126 ? 27.719  -32.445  -76.814  1.00 59.48  ? 123 ASP E OD2   1 
ATOM 6555  N N     . VAL E 1 127 ? 30.359  -35.706  -75.124  1.00 42.99  ? 124 VAL E N     1 
ATOM 6556  C CA    . VAL E 1 127 ? 31.576  -36.207  -74.496  1.00 43.57  ? 124 VAL E CA    1 
ATOM 6557  C C     . VAL E 1 127 ? 31.918  -35.333  -73.297  1.00 50.36  ? 124 VAL E C     1 
ATOM 6558  O O     . VAL E 1 127 ? 31.813  -34.103  -73.361  1.00 54.82  ? 124 VAL E O     1 
ATOM 6559  C CB    . VAL E 1 127 ? 32.747  -36.257  -75.500  1.00 44.85  ? 124 VAL E CB    1 
ATOM 6560  C CG1   . VAL E 1 127 ? 33.032  -34.874  -76.080  1.00 52.70  ? 124 VAL E CG1   1 
ATOM 6561  C CG2   . VAL E 1 127 ? 33.992  -36.842  -74.853  1.00 35.63  ? 124 VAL E CG2   1 
ATOM 6562  N N     . GLY E 1 128 ? 32.317  -35.972  -72.199  1.00 50.90  ? 125 GLY E N     1 
ATOM 6563  C CA    . GLY E 1 128 ? 32.905  -35.270  -71.075  1.00 42.44  ? 125 GLY E CA    1 
ATOM 6564  C C     . GLY E 1 128 ? 34.340  -35.676  -70.831  1.00 46.94  ? 125 GLY E C     1 
ATOM 6565  O O     . GLY E 1 128 ? 34.749  -36.765  -71.243  1.00 53.37  ? 125 GLY E O     1 
ATOM 6566  N N     . TYR E 1 129 ? 35.115  -34.821  -70.165  1.00 49.03  ? 126 TYR E N     1 
ATOM 6567  C CA    . TYR E 1 129 ? 36.494  -35.141  -69.826  1.00 47.75  ? 126 TYR E CA    1 
ATOM 6568  C C     . TYR E 1 129 ? 36.748  -34.958  -68.339  1.00 49.50  ? 126 TYR E C     1 
ATOM 6569  O O     . TYR E 1 129 ? 36.098  -34.149  -67.679  1.00 61.64  ? 126 TYR E O     1 
ATOM 6570  C CB    . TYR E 1 129 ? 37.490  -34.278  -70.614  1.00 51.81  ? 126 TYR E CB    1 
ATOM 6571  C CG    . TYR E 1 129 ? 38.785  -34.992  -70.936  1.00 52.94  ? 126 TYR E CG    1 
ATOM 6572  C CD1   . TYR E 1 129 ? 38.822  -36.067  -71.816  1.00 51.72  ? 126 TYR E CD1   1 
ATOM 6573  C CD2   . TYR E 1 129 ? 39.970  -34.610  -70.320  1.00 53.14  ? 126 TYR E CD2   1 
ATOM 6574  C CE1   . TYR E 1 129 ? 40.023  -36.715  -72.097  1.00 54.00  ? 126 TYR E CE1   1 
ATOM 6575  C CE2   . TYR E 1 129 ? 41.160  -35.251  -70.585  1.00 60.43  ? 126 TYR E CE2   1 
ATOM 6576  C CZ    . TYR E 1 129 ? 41.185  -36.301  -71.471  1.00 60.21  ? 126 TYR E CZ    1 
ATOM 6577  O OH    . TYR E 1 129 ? 42.393  -36.914  -71.715  1.00 60.84  ? 126 TYR E OH    1 
ATOM 6578  N N     . GLY E 1 130 ? 37.702  -35.731  -67.826  1.00 55.37  ? 127 GLY E N     1 
ATOM 6579  C CA    . GLY E 1 130 ? 38.094  -35.681  -66.432  1.00 49.01  ? 127 GLY E CA    1 
ATOM 6580  C C     . GLY E 1 130 ? 39.603  -35.693  -66.275  1.00 55.33  ? 127 GLY E C     1 
ATOM 6581  O O     . GLY E 1 130 ? 40.293  -36.512  -66.891  1.00 52.19  ? 127 GLY E O     1 
ATOM 6582  N N     . VAL E 1 131 ? 40.129  -34.790  -65.449  1.00 57.58  ? 128 VAL E N     1 
ATOM 6583  C CA    . VAL E 1 131 ? 41.563  -34.562  -65.320  1.00 53.91  ? 128 VAL E CA    1 
ATOM 6584  C C     . VAL E 1 131 ? 41.940  -34.659  -63.846  1.00 63.24  ? 128 VAL E C     1 
ATOM 6585  O O     . VAL E 1 131 ? 41.167  -34.252  -62.971  1.00 67.43  ? 128 VAL E O     1 
ATOM 6586  C CB    . VAL E 1 131 ? 41.958  -33.191  -65.914  1.00 56.37  ? 128 VAL E CB    1 
ATOM 6587  C CG1   . VAL E 1 131 ? 43.460  -32.970  -65.825  1.00 64.71  ? 128 VAL E CG1   1 
ATOM 6588  C CG2   . VAL E 1 131 ? 41.498  -33.084  -67.360  1.00 66.03  ? 128 VAL E CG2   1 
ATOM 6589  N N     . SER E 1 132 ? 43.128  -35.201  -63.574  1.00 57.28  ? 129 SER E N     1 
ATOM 6590  C CA    . SER E 1 132 ? 43.672  -35.240  -62.217  1.00 54.09  ? 129 SER E CA    1 
ATOM 6591  C C     . SER E 1 132 ? 45.186  -35.111  -62.296  1.00 63.04  ? 129 SER E C     1 
ATOM 6592  O O     . SER E 1 132 ? 45.866  -36.048  -62.724  1.00 69.20  ? 129 SER E O     1 
ATOM 6593  C CB    . SER E 1 132 ? 43.277  -36.526  -61.498  1.00 61.02  ? 129 SER E CB    1 
ATOM 6594  O OG    . SER E 1 132 ? 44.046  -36.696  -60.317  1.00 54.08  ? 129 SER E OG    1 
ATOM 6595  N N     . GLU E 1 133 ? 45.708  -33.967  -61.862  1.00 72.64  ? 130 GLU E N     1 
ATOM 6596  C CA    . GLU E 1 133 ? 47.135  -33.677  -61.899  1.00 78.69  ? 130 GLU E CA    1 
ATOM 6597  C C     . GLU E 1 133 ? 47.645  -33.437  -60.487  1.00 80.31  ? 130 GLU E C     1 
ATOM 6598  O O     . GLU E 1 133 ? 47.036  -32.679  -59.724  1.00 86.24  ? 130 GLU E O     1 
ATOM 6599  C CB    . GLU E 1 133 ? 47.431  -32.441  -62.755  1.00 80.86  ? 130 GLU E CB    1 
ATOM 6600  C CG    . GLU E 1 133 ? 46.581  -32.283  -64.000  1.00 88.54  ? 130 GLU E CG    1 
ATOM 6601  C CD    . GLU E 1 133 ? 47.118  -31.199  -64.918  1.00 103.81 ? 130 GLU E CD    1 
ATOM 6602  O OE1   . GLU E 1 133 ? 47.640  -30.189  -64.395  1.00 96.09  ? 130 GLU E OE1   1 
ATOM 6603  O OE2   . GLU E 1 133 ? 47.022  -31.355  -66.155  1.00 100.11 ? 130 GLU E OE2   1 
ATOM 6604  N N     . GLY E 1 134 ? 48.745  -34.099  -60.134  1.00 76.30  ? 131 GLY E N     1 
ATOM 6605  C CA    . GLY E 1 134 ? 49.468  -33.814  -58.915  1.00 74.54  ? 131 GLY E CA    1 
ATOM 6606  C C     . GLY E 1 134 ? 49.323  -34.845  -57.817  1.00 84.84  ? 131 GLY E C     1 
ATOM 6607  O O     . GLY E 1 134 ? 50.196  -34.916  -56.943  1.00 96.88  ? 131 GLY E O     1 
ATOM 6608  N N     . LEU E 1 135 ? 48.251  -35.633  -57.819  1.00 88.12  ? 132 LEU E N     1 
ATOM 6609  C CA    . LEU E 1 135 ? 48.036  -36.570  -56.725  1.00 72.17  ? 132 LEU E CA    1 
ATOM 6610  C C     . LEU E 1 135 ? 49.081  -37.679  -56.748  1.00 74.36  ? 132 LEU E C     1 
ATOM 6611  O O     . LEU E 1 135 ? 49.544  -38.111  -57.807  1.00 80.51  ? 132 LEU E O     1 
ATOM 6612  C CB    . LEU E 1 135 ? 46.633  -37.175  -56.788  1.00 73.66  ? 132 LEU E CB    1 
ATOM 6613  C CG    . LEU E 1 135 ? 45.471  -36.271  -56.372  1.00 77.23  ? 132 LEU E CG    1 
ATOM 6614  C CD1   . LEU E 1 135 ? 44.148  -37.007  -56.504  1.00 81.24  ? 132 LEU E CD1   1 
ATOM 6615  C CD2   . LEU E 1 135 ? 45.671  -35.770  -54.950  1.00 81.27  ? 132 LEU E CD2   1 
ATOM 6616  N N     . LYS E 1 136 ? 49.442  -38.146  -55.555  1.00 68.00  ? 133 LYS E N     1 
ATOM 6617  C CA    . LYS E 1 136 ? 50.423  -39.211  -55.415  1.00 71.87  ? 133 LYS E CA    1 
ATOM 6618  C C     . LYS E 1 136 ? 49.797  -40.596  -55.470  1.00 68.06  ? 133 LYS E C     1 
ATOM 6619  O O     . LYS E 1 136 ? 50.516  -41.580  -55.682  1.00 68.52  ? 133 LYS E O     1 
ATOM 6620  C CB    . LYS E 1 136 ? 51.190  -39.034  -54.100  1.00 75.48  ? 133 LYS E CB    1 
ATOM 6621  C CG    . LYS E 1 136 ? 51.899  -37.681  -53.992  1.00 83.15  ? 133 LYS E CG    1 
ATOM 6622  C CD    . LYS E 1 136 ? 52.512  -37.459  -52.616  1.00 97.53  ? 133 LYS E CD    1 
ATOM 6623  C CE    . LYS E 1 136 ? 53.864  -38.149  -52.497  1.00 98.97  ? 133 LYS E CE    1 
ATOM 6624  N NZ    . LYS E 1 136 ? 54.856  -37.582  -53.454  1.00 83.36  ? 133 LYS E NZ    1 
ATOM 6625  N N     . SER E 1 137 ? 48.484  -40.693  -55.273  1.00 67.91  ? 134 SER E N     1 
ATOM 6626  C CA    . SER E 1 137 ? 47.762  -41.957  -55.341  1.00 62.91  ? 134 SER E CA    1 
ATOM 6627  C C     . SER E 1 137 ? 47.204  -42.140  -56.749  1.00 69.74  ? 134 SER E C     1 
ATOM 6628  O O     . SER E 1 137 ? 46.394  -41.327  -57.210  1.00 69.51  ? 134 SER E O     1 
ATOM 6629  C CB    . SER E 1 137 ? 46.639  -41.993  -54.305  1.00 61.40  ? 134 SER E CB    1 
ATOM 6630  O OG    . SER E 1 137 ? 45.797  -43.116  -54.501  1.00 60.82  ? 134 SER E OG    1 
ATOM 6631  N N     . LYS E 1 138 ? 47.657  -43.189  -57.441  1.00 69.36  ? 135 LYS E N     1 
ATOM 6632  C CA    . LYS E 1 138 ? 47.109  -43.487  -58.761  1.00 64.61  ? 135 LYS E CA    1 
ATOM 6633  C C     . LYS E 1 138 ? 45.612  -43.762  -58.680  1.00 55.87  ? 135 LYS E C     1 
ATOM 6634  O O     . LYS E 1 138 ? 44.843  -43.328  -59.547  1.00 60.93  ? 135 LYS E O     1 
ATOM 6635  C CB    . LYS E 1 138 ? 47.847  -44.671  -59.389  1.00 56.56  ? 135 LYS E CB    1 
ATOM 6636  C CG    . LYS E 1 138 ? 47.397  -45.000  -60.808  1.00 57.45  ? 135 LYS E CG    1 
ATOM 6637  C CD    . LYS E 1 138 ? 48.528  -45.606  -61.631  1.00 60.03  ? 135 LYS E CD    1 
ATOM 6638  C CE    . LYS E 1 138 ? 48.921  -46.982  -61.120  1.00 60.23  ? 135 LYS E CE    1 
ATOM 6639  N NZ    . LYS E 1 138 ? 49.964  -47.630  -61.973  1.00 70.62  ? 135 LYS E NZ    1 
ATOM 6640  N N     . ALA E 1 139 ? 45.182  -44.492  -57.646  1.00 57.14  ? 136 ALA E N     1 
ATOM 6641  C CA    . ALA E 1 139 ? 43.772  -44.844  -57.516  1.00 57.05  ? 136 ALA E CA    1 
ATOM 6642  C C     . ALA E 1 139 ? 42.901  -43.604  -57.362  1.00 52.82  ? 136 ALA E C     1 
ATOM 6643  O O     . ALA E 1 139 ? 41.844  -43.500  -57.993  1.00 57.26  ? 136 ALA E O     1 
ATOM 6644  C CB    . ALA E 1 139 ? 43.574  -45.782  -56.326  1.00 62.23  ? 136 ALA E CB    1 
ATOM 6645  N N     . LEU E 1 140 ? 43.328  -42.652  -56.530  1.00 60.01  ? 137 LEU E N     1 
ATOM 6646  C CA    . LEU E 1 140 ? 42.528  -41.446  -56.336  1.00 57.99  ? 137 LEU E CA    1 
ATOM 6647  C C     . LEU E 1 140 ? 42.540  -40.569  -57.582  1.00 58.86  ? 137 LEU E C     1 
ATOM 6648  O O     . LEU E 1 140 ? 41.525  -39.945  -57.918  1.00 64.35  ? 137 LEU E O     1 
ATOM 6649  C CB    . LEU E 1 140 ? 43.031  -40.669  -55.119  1.00 70.73  ? 137 LEU E CB    1 
ATOM 6650  C CG    . LEU E 1 140 ? 42.288  -40.907  -53.796  1.00 69.15  ? 137 LEU E CG    1 
ATOM 6651  C CD1   . LEU E 1 140 ? 42.307  -42.379  -53.409  1.00 56.98  ? 137 LEU E CD1   1 
ATOM 6652  C CD2   . LEU E 1 140 ? 42.873  -40.048  -52.680  1.00 59.56  ? 137 LEU E CD2   1 
ATOM 6653  N N     . SER E 1 141 ? 43.672  -40.524  -58.291  1.00 58.56  ? 138 SER E N     1 
ATOM 6654  C CA    . SER E 1 141 ? 43.734  -39.791  -59.552  1.00 59.29  ? 138 SER E CA    1 
ATOM 6655  C C     . SER E 1 141 ? 42.741  -40.356  -60.558  1.00 53.72  ? 138 SER E C     1 
ATOM 6656  O O     . SER E 1 141 ? 41.971  -39.612  -61.179  1.00 55.00  ? 138 SER E O     1 
ATOM 6657  C CB    . SER E 1 141 ? 45.156  -39.832  -60.116  1.00 57.59  ? 138 SER E CB    1 
ATOM 6658  O OG    . SER E 1 141 ? 46.075  -39.195  -59.247  1.00 68.10  ? 138 SER E OG    1 
ATOM 6659  N N     . LEU E 1 142 ? 42.752  -41.680  -60.734  1.00 51.10  ? 139 LEU E N     1 
ATOM 6660  C CA    . LEU E 1 142 ? 41.816  -42.317  -61.652  1.00 48.39  ? 139 LEU E CA    1 
ATOM 6661  C C     . LEU E 1 142 ? 40.374  -42.103  -61.215  1.00 50.22  ? 139 LEU E C     1 
ATOM 6662  O O     . LEU E 1 142 ? 39.503  -41.841  -62.048  1.00 51.64  ? 139 LEU E O     1 
ATOM 6663  C CB    . LEU E 1 142 ? 42.121  -43.807  -61.768  1.00 45.85  ? 139 LEU E CB    1 
ATOM 6664  C CG    . LEU E 1 142 ? 43.237  -44.145  -62.747  1.00 57.45  ? 139 LEU E CG    1 
ATOM 6665  C CD1   . LEU E 1 142 ? 43.682  -45.581  -62.544  1.00 57.85  ? 139 LEU E CD1   1 
ATOM 6666  C CD2   . LEU E 1 142 ? 42.766  -43.908  -64.176  1.00 51.08  ? 139 LEU E CD2   1 
ATOM 6667  N N     . GLU E 1 143 ? 40.096  -42.225  -59.914  1.00 53.45  ? 140 GLU E N     1 
ATOM 6668  C CA    . GLU E 1 143 ? 38.735  -42.022  -59.429  1.00 55.11  ? 140 GLU E CA    1 
ATOM 6669  C C     . GLU E 1 143 ? 38.241  -40.620  -59.758  1.00 49.94  ? 140 GLU E C     1 
ATOM 6670  O O     . GLU E 1 143 ? 37.142  -40.441  -60.306  1.00 58.80  ? 140 GLU E O     1 
ATOM 6671  C CB    . GLU E 1 143 ? 38.677  -42.265  -57.921  1.00 58.52  ? 140 GLU E CB    1 
ATOM 6672  C CG    . GLU E 1 143 ? 37.422  -41.722  -57.269  1.00 55.72  ? 140 GLU E CG    1 
ATOM 6673  C CD    . GLU E 1 143 ? 37.374  -41.991  -55.778  1.00 58.41  ? 140 GLU E CD    1 
ATOM 6674  O OE1   . GLU E 1 143 ? 38.450  -42.017  -55.144  1.00 73.07  ? 140 GLU E OE1   1 
ATOM 6675  O OE2   . GLU E 1 143 ? 36.262  -42.168  -55.238  1.00 63.37  ? 140 GLU E OE2   1 
ATOM 6676  N N     . LYS E 1 144 ? 39.058  -39.609  -59.446  1.00 50.14  ? 141 LYS E N     1 
ATOM 6677  C CA    . LYS E 1 144 ? 38.672  -38.232  -59.723  1.00 54.21  ? 141 LYS E CA    1 
ATOM 6678  C C     . LYS E 1 144 ? 38.457  -38.027  -61.215  1.00 60.08  ? 141 LYS E C     1 
ATOM 6679  O O     . LYS E 1 144 ? 37.445  -37.454  -61.636  1.00 57.85  ? 141 LYS E O     1 
ATOM 6680  C CB    . LYS E 1 144 ? 39.730  -37.270  -59.177  1.00 43.51  ? 141 LYS E CB    1 
ATOM 6681  C CG    . LYS E 1 144 ? 39.293  -35.808  -59.126  1.00 56.43  ? 141 LYS E CG    1 
ATOM 6682  C CD    . LYS E 1 144 ? 40.152  -34.919  -60.016  1.00 65.71  ? 141 LYS E CD    1 
ATOM 6683  C CE    . LYS E 1 144 ? 40.110  -33.469  -59.530  1.00 64.69  ? 141 LYS E CE    1 
ATOM 6684  N NZ    . LYS E 1 144 ? 40.735  -32.508  -60.491  1.00 68.96  ? 141 LYS E NZ    1 
ATOM 6685  N N     . ALA E 1 145 ? 39.378  -38.540  -62.035  1.00 56.55  ? 142 ALA E N     1 
ATOM 6686  C CA    . ALA E 1 145 ? 39.287  -38.308  -63.471  1.00 52.03  ? 142 ALA E CA    1 
ATOM 6687  C C     . ALA E 1 145 ? 38.059  -38.986  -64.067  1.00 52.16  ? 142 ALA E C     1 
ATOM 6688  O O     . ALA E 1 145 ? 37.328  -38.369  -64.848  1.00 56.61  ? 142 ALA E O     1 
ATOM 6689  C CB    . ALA E 1 145 ? 40.560  -38.797  -64.161  1.00 49.86  ? 142 ALA E CB    1 
ATOM 6690  N N     . ARG E 1 146 ? 37.787  -40.232  -63.673  1.00 42.26  ? 143 ARG E N     1 
ATOM 6691  C CA    . ARG E 1 146 ? 36.641  -40.958  -64.218  1.00 47.46  ? 143 ARG E CA    1 
ATOM 6692  C C     . ARG E 1 146 ? 35.324  -40.303  -63.817  1.00 48.13  ? 143 ARG E C     1 
ATOM 6693  O O     . ARG E 1 146 ? 34.458  -40.041  -64.671  1.00 54.35  ? 143 ARG E O     1 
ATOM 6694  C CB    . ARG E 1 146 ? 36.676  -42.419  -63.756  1.00 45.51  ? 143 ARG E CB    1 
ATOM 6695  C CG    . ARG E 1 146 ? 37.897  -43.212  -64.222  1.00 55.39  ? 143 ARG E CG    1 
ATOM 6696  C CD    . ARG E 1 146 ? 37.717  -44.712  -63.996  1.00 44.46  ? 143 ARG E CD    1 
ATOM 6697  N NE    . ARG E 1 146 ? 37.347  -45.425  -65.218  1.00 59.65  ? 143 ARG E NE    1 
ATOM 6698  C CZ    . ARG E 1 146 ? 38.146  -46.278  -65.851  1.00 53.19  ? 143 ARG E CZ    1 
ATOM 6699  N NH1   . ARG E 1 146 ? 39.353  -46.532  -65.366  1.00 46.99  ? 143 ARG E NH1   1 
ATOM 6700  N NH2   . ARG E 1 146 ? 37.738  -46.887  -66.959  1.00 58.96  ? 143 ARG E NH2   1 
ATOM 6701  N N     . LYS E 1 147 ? 35.148  -40.032  -62.519  1.00 46.60  ? 144 LYS E N     1 
ATOM 6702  C CA    . LYS E 1 147 ? 33.895  -39.439  -62.068  1.00 48.09  ? 144 LYS E CA    1 
ATOM 6703  C C     . LYS E 1 147 ? 33.686  -38.054  -62.676  1.00 54.41  ? 144 LYS E C     1 
ATOM 6704  O O     . LYS E 1 147 ? 32.576  -37.721  -63.113  1.00 51.18  ? 144 LYS E O     1 
ATOM 6705  C CB    . LYS E 1 147 ? 33.867  -39.387  -60.541  1.00 47.47  ? 144 LYS E CB    1 
ATOM 6706  C CG    . LYS E 1 147 ? 33.717  -40.756  -59.887  1.00 54.95  ? 144 LYS E CG    1 
ATOM 6707  C CD    . LYS E 1 147 ? 33.786  -40.657  -58.368  1.00 59.97  ? 144 LYS E CD    1 
ATOM 6708  C CE    . LYS E 1 147 ? 33.608  -42.016  -57.710  1.00 46.93  ? 144 LYS E CE    1 
ATOM 6709  N NZ    . LYS E 1 147 ? 33.544  -41.891  -56.229  1.00 51.67  ? 144 LYS E NZ    1 
ATOM 6710  N N     . GLU E 1 148 ? 34.742  -37.232  -62.707  1.00 47.14  ? 145 GLU E N     1 
ATOM 6711  C CA    . GLU E 1 148 ? 34.642  -35.908  -63.310  1.00 56.49  ? 145 GLU E CA    1 
ATOM 6712  C C     . GLU E 1 148 ? 34.285  -35.998  -64.789  1.00 64.00  ? 145 GLU E C     1 
ATOM 6713  O O     . GLU E 1 148 ? 33.468  -35.214  -65.284  1.00 66.52  ? 145 GLU E O     1 
ATOM 6714  C CB    . GLU E 1 148 ? 35.960  -35.160  -63.112  1.00 59.81  ? 145 GLU E CB    1 
ATOM 6715  C CG    . GLU E 1 148 ? 35.822  -33.675  -62.842  1.00 73.30  ? 145 GLU E CG    1 
ATOM 6716  C CD    . GLU E 1 148 ? 37.137  -33.059  -62.403  1.00 87.95  ? 145 GLU E CD    1 
ATOM 6717  O OE1   . GLU E 1 148 ? 37.949  -32.682  -63.278  1.00 85.01  ? 145 GLU E OE1   1 
ATOM 6718  O OE2   . GLU E 1 148 ? 37.364  -32.976  -61.175  1.00 75.89  ? 145 GLU E OE2   1 
ATOM 6719  N N     . ALA E 1 149 ? 34.901  -36.936  -65.515  1.00 55.52  ? 146 ALA E N     1 
ATOM 6720  C CA    . ALA E 1 149 ? 34.576  -37.118  -66.926  1.00 52.23  ? 146 ALA E CA    1 
ATOM 6721  C C     . ALA E 1 149 ? 33.102  -37.437  -67.112  1.00 50.22  ? 146 ALA E C     1 
ATOM 6722  O O     . ALA E 1 149 ? 32.429  -36.849  -67.970  1.00 47.28  ? 146 ALA E O     1 
ATOM 6723  C CB    . ALA E 1 149 ? 35.441  -38.227  -67.523  1.00 50.89  ? 146 ALA E CB    1 
ATOM 6724  N N     . VAL E 1 150 ? 32.577  -38.360  -66.307  1.00 42.25  ? 147 VAL E N     1 
ATOM 6725  C CA    . VAL E 1 150 ? 31.182  -38.760  -66.464  1.00 37.35  ? 147 VAL E CA    1 
ATOM 6726  C C     . VAL E 1 150 ? 30.247  -37.596  -66.144  1.00 47.53  ? 147 VAL E C     1 
ATOM 6727  O O     . VAL E 1 150 ? 29.275  -37.341  -66.868  1.00 46.64  ? 147 VAL E O     1 
ATOM 6728  C CB    . VAL E 1 150 ? 30.880  -39.998  -65.607  1.00 47.90  ? 147 VAL E CB    1 
ATOM 6729  C CG1   . VAL E 1 150 ? 29.380  -40.169  -65.426  1.00 36.45  ? 147 VAL E CG1   1 
ATOM 6730  C CG2   . VAL E 1 150 ? 31.463  -41.214  -66.285  1.00 48.20  ? 147 VAL E CG2   1 
ATOM 6731  N N     . THR E 1 151 ? 30.521  -36.879  -65.049  1.00 57.81  ? 148 THR E N     1 
ATOM 6732  C CA    . THR E 1 151 ? 29.668  -35.751  -64.678  1.00 47.70  ? 148 THR E CA    1 
ATOM 6733  C C     . THR E 1 151 ? 29.695  -34.662  -65.749  1.00 49.84  ? 148 THR E C     1 
ATOM 6734  O O     . THR E 1 151 ? 28.646  -34.112  -66.116  1.00 44.36  ? 148 THR E O     1 
ATOM 6735  C CB    . THR E 1 151 ? 30.106  -35.198  -63.319  1.00 50.63  ? 148 THR E CB    1 
ATOM 6736  O OG1   . THR E 1 151 ? 29.879  -36.189  -62.307  1.00 74.04  ? 148 THR E OG1   1 
ATOM 6737  C CG2   . THR E 1 151 ? 29.329  -33.940  -62.966  1.00 39.01  ? 148 THR E CG2   1 
ATOM 6738  N N     . ASP E 1 152 ? 30.886  -34.336  -66.259  1.00 47.93  ? 149 ASP E N     1 
ATOM 6739  C CA    . ASP E 1 152 ? 31.004  -33.359  -67.337  1.00 53.02  ? 149 ASP E CA    1 
ATOM 6740  C C     . ASP E 1 152 ? 30.230  -33.802  -68.576  1.00 54.97  ? 149 ASP E C     1 
ATOM 6741  O O     . ASP E 1 152 ? 29.565  -32.987  -69.226  1.00 56.13  ? 149 ASP E O     1 
ATOM 6742  C CB    . ASP E 1 152 ? 32.479  -33.134  -67.673  1.00 48.44  ? 149 ASP E CB    1 
ATOM 6743  C CG    . ASP E 1 152 ? 32.697  -31.944  -68.583  1.00 54.25  ? 149 ASP E CG    1 
ATOM 6744  O OD1   . ASP E 1 152 ? 32.245  -30.833  -68.234  1.00 66.08  ? 149 ASP E OD1   1 
ATOM 6745  O OD2   . ASP E 1 152 ? 33.326  -32.119  -69.647  1.00 66.99  ? 149 ASP E OD2   1 
ATOM 6746  N N     . GLY E 1 153 ? 30.333  -35.086  -68.933  1.00 52.44  ? 150 GLY E N     1 
ATOM 6747  C CA    . GLY E 1 153 ? 29.587  -35.587  -70.078  1.00 56.73  ? 150 GLY E CA    1 
ATOM 6748  C C     . GLY E 1 153 ? 28.089  -35.477  -69.887  1.00 54.46  ? 150 GLY E C     1 
ATOM 6749  O O     . GLY E 1 153 ? 27.357  -35.150  -70.823  1.00 50.72  ? 150 GLY E O     1 
ATOM 6750  N N     . LEU E 1 154 ? 27.615  -35.730  -68.666  1.00 48.28  ? 151 LEU E N     1 
ATOM 6751  C CA    . LEU E 1 154 ? 26.190  -35.590  -68.389  1.00 42.58  ? 151 LEU E CA    1 
ATOM 6752  C C     . LEU E 1 154 ? 25.747  -34.138  -68.525  1.00 51.50  ? 151 LEU E C     1 
ATOM 6753  O O     . LEU E 1 154 ? 24.697  -33.853  -69.117  1.00 51.60  ? 151 LEU E O     1 
ATOM 6754  C CB    . LEU E 1 154 ? 25.878  -36.119  -66.991  1.00 41.38  ? 151 LEU E CB    1 
ATOM 6755  C CG    . LEU E 1 154 ? 24.440  -35.957  -66.503  1.00 39.95  ? 151 LEU E CG    1 
ATOM 6756  C CD1   . LEU E 1 154 ? 23.464  -36.565  -67.495  1.00 53.08  ? 151 LEU E CD1   1 
ATOM 6757  C CD2   . LEU E 1 154 ? 24.279  -36.579  -65.130  1.00 55.58  ? 151 LEU E CD2   1 
ATOM 6758  N N     . LYS E 1 155 ? 26.541  -33.206  -67.987  1.00 50.56  ? 152 LYS E N     1 
ATOM 6759  C CA    . LYS E 1 155 ? 26.205  -31.789  -68.112  1.00 37.56  ? 152 LYS E CA    1 
ATOM 6760  C C     . LYS E 1 155 ? 26.175  -31.359  -69.575  1.00 55.97  ? 152 LYS E C     1 
ATOM 6761  O O     . LYS E 1 155 ? 25.247  -30.663  -70.010  1.00 68.81  ? 152 LYS E O     1 
ATOM 6762  C CB    . LYS E 1 155 ? 27.195  -30.932  -67.324  1.00 46.21  ? 152 LYS E CB    1 
ATOM 6763  C CG    . LYS E 1 155 ? 27.104  -31.087  -65.812  1.00 55.84  ? 152 LYS E CG    1 
ATOM 6764  C CD    . LYS E 1 155 ? 27.888  -29.992  -65.103  1.00 48.80  ? 152 LYS E CD    1 
ATOM 6765  C CE    . LYS E 1 155 ? 29.371  -30.067  -65.428  1.00 55.49  ? 152 LYS E CE    1 
ATOM 6766  N NZ    . LYS E 1 155 ? 30.152  -29.032  -64.697  1.00 63.50  ? 152 LYS E NZ    1 
ATOM 6767  N N     . ARG E 1 156 ? 27.170  -31.782  -70.356  1.00 58.97  ? 153 ARG E N     1 
ATOM 6768  C CA    . ARG E 1 156 ? 27.221  -31.372  -71.756  1.00 52.99  ? 153 ARG E CA    1 
ATOM 6769  C C     . ARG E 1 156 ? 26.126  -32.037  -72.582  1.00 54.43  ? 153 ARG E C     1 
ATOM 6770  O O     . ARG E 1 156 ? 25.657  -31.451  -73.565  1.00 60.18  ? 153 ARG E O     1 
ATOM 6771  C CB    . ARG E 1 156 ? 28.600  -31.671  -72.349  1.00 48.01  ? 153 ARG E CB    1 
ATOM 6772  C CG    . ARG E 1 156 ? 29.715  -30.783  -71.810  1.00 52.87  ? 153 ARG E CG    1 
ATOM 6773  C CD    . ARG E 1 156 ? 31.083  -31.263  -72.264  1.00 57.75  ? 153 ARG E CD    1 
ATOM 6774  N NE    . ARG E 1 156 ? 31.131  -31.448  -73.712  1.00 53.68  ? 153 ARG E NE    1 
ATOM 6775  C CZ    . ARG E 1 156 ? 31.396  -30.483  -74.588  1.00 60.48  ? 153 ARG E CZ    1 
ATOM 6776  N NH1   . ARG E 1 156 ? 31.642  -29.249  -74.169  1.00 56.54  ? 153 ARG E NH1   1 
ATOM 6777  N NH2   . ARG E 1 156 ? 31.412  -30.753  -75.887  1.00 60.00  ? 153 ARG E NH2   1 
ATOM 6778  N N     . ALA E 1 157 ? 25.698  -33.244  -72.206  1.00 50.43  ? 154 ALA E N     1 
ATOM 6779  C CA    . ALA E 1 157 ? 24.583  -33.873  -72.905  1.00 55.89  ? 154 ALA E CA    1 
ATOM 6780  C C     . ALA E 1 157 ? 23.268  -33.179  -72.580  1.00 58.11  ? 154 ALA E C     1 
ATOM 6781  O O     . ALA E 1 157 ? 22.414  -33.013  -73.458  1.00 58.46  ? 154 ALA E O     1 
ATOM 6782  C CB    . ALA E 1 157 ? 24.510  -35.357  -72.556  1.00 47.52  ? 154 ALA E CB    1 
ATOM 6783  N N     . LEU E 1 158 ? 23.079  -32.780  -71.320  1.00 62.93  ? 155 LEU E N     1 
ATOM 6784  C CA    . LEU E 1 158 ? 21.851  -32.084  -70.953  1.00 58.65  ? 155 LEU E CA    1 
ATOM 6785  C C     . LEU E 1 158 ? 21.807  -30.676  -71.536  1.00 57.07  ? 155 LEU E C     1 
ATOM 6786  O O     . LEU E 1 158 ? 20.717  -30.135  -71.753  1.00 53.58  ? 155 LEU E O     1 
ATOM 6787  C CB    . LEU E 1 158 ? 21.701  -32.049  -69.432  1.00 55.29  ? 155 LEU E CB    1 
ATOM 6788  C CG    . LEU E 1 158 ? 21.142  -33.337  -68.828  1.00 52.53  ? 155 LEU E CG    1 
ATOM 6789  C CD1   . LEU E 1 158 ? 21.153  -33.297  -67.309  1.00 48.45  ? 155 LEU E CD1   1 
ATOM 6790  C CD2   . LEU E 1 158 ? 19.735  -33.569  -69.347  1.00 49.17  ? 155 LEU E CD2   1 
ATOM 6791  N N     . ARG E 1 159 ? 22.975  -30.071  -71.784  1.00 59.25  ? 156 ARG E N     1 
ATOM 6792  C CA    . ARG E 1 159 ? 23.028  -28.742  -72.395  1.00 53.01  ? 156 ARG E CA    1 
ATOM 6793  C C     . ARG E 1 159 ? 22.170  -28.642  -73.652  1.00 53.33  ? 156 ARG E C     1 
ATOM 6794  O O     . ARG E 1 159 ? 21.545  -27.605  -73.905  1.00 58.19  ? 156 ARG E O     1 
ATOM 6795  C CB    . ARG E 1 159 ? 24.470  -28.390  -72.758  1.00 58.33  ? 156 ARG E CB    1 
ATOM 6796  C CG    . ARG E 1 159 ? 25.296  -27.746  -71.669  1.00 64.49  ? 156 ARG E CG    1 
ATOM 6797  C CD    . ARG E 1 159 ? 26.613  -27.265  -72.264  1.00 71.20  ? 156 ARG E CD    1 
ATOM 6798  N NE    . ARG E 1 159 ? 27.662  -27.098  -71.265  1.00 87.85  ? 156 ARG E NE    1 
ATOM 6799  C CZ    . ARG E 1 159 ? 28.943  -26.902  -71.561  1.00 90.82  ? 156 ARG E CZ    1 
ATOM 6800  N NH1   . ARG E 1 159 ? 29.331  -26.851  -72.830  1.00 87.45  ? 156 ARG E NH1   1 
ATOM 6801  N NH2   . ARG E 1 159 ? 29.837  -26.757  -70.592  1.00 100.30 ? 156 ARG E NH2   1 
ATOM 6802  N N     . SER E 1 160 ? 22.121  -29.710  -74.450  1.00 56.79  ? 157 SER E N     1 
ATOM 6803  C CA    . SER E 1 160 ? 21.518  -29.661  -75.780  1.00 60.88  ? 157 SER E CA    1 
ATOM 6804  C C     . SER E 1 160 ? 19.999  -29.531  -75.765  1.00 65.28  ? 157 SER E C     1 
ATOM 6805  O O     . SER E 1 160 ? 19.406  -29.390  -76.841  1.00 61.90  ? 157 SER E O     1 
ATOM 6806  C CB    . SER E 1 160 ? 21.911  -30.908  -76.576  1.00 59.05  ? 157 SER E CB    1 
ATOM 6807  O OG    . SER E 1 160 ? 23.318  -31.042  -76.667  1.00 69.05  ? 157 SER E OG    1 
ATOM 6808  N N     . PHE E 1 161 ? 19.355  -29.560  -74.601  1.00 64.84  ? 158 PHE E N     1 
ATOM 6809  C CA    . PHE E 1 161 ? 17.904  -29.443  -74.546  1.00 64.78  ? 158 PHE E CA    1 
ATOM 6810  C C     . PHE E 1 161 ? 17.414  -28.004  -74.463  1.00 72.78  ? 158 PHE E C     1 
ATOM 6811  O O     . PHE E 1 161 ? 16.230  -27.756  -74.718  1.00 70.79  ? 158 PHE E O     1 
ATOM 6812  C CB    . PHE E 1 161 ? 17.355  -30.249  -73.366  1.00 49.04  ? 158 PHE E CB    1 
ATOM 6813  C CG    . PHE E 1 161 ? 17.326  -31.726  -73.615  1.00 53.25  ? 158 PHE E CG    1 
ATOM 6814  C CD1   . PHE E 1 161 ? 16.492  -32.253  -74.587  1.00 57.74  ? 158 PHE E CD1   1 
ATOM 6815  C CD2   . PHE E 1 161 ? 18.140  -32.587  -72.898  1.00 58.20  ? 158 PHE E CD2   1 
ATOM 6816  C CE1   . PHE E 1 161 ? 16.459  -33.609  -74.832  1.00 56.22  ? 158 PHE E CE1   1 
ATOM 6817  C CE2   . PHE E 1 161 ? 18.112  -33.946  -73.139  1.00 59.03  ? 158 PHE E CE2   1 
ATOM 6818  C CZ    . PHE E 1 161 ? 17.270  -34.458  -74.108  1.00 59.15  ? 158 PHE E CZ    1 
ATOM 6819  N N     . GLY E 1 162 ? 18.279  -27.061  -74.134  1.00 72.44  ? 159 GLY E N     1 
ATOM 6820  C CA    . GLY E 1 162 ? 17.898  -25.663  -74.114  1.00 74.87  ? 159 GLY E CA    1 
ATOM 6821  C C     . GLY E 1 162 ? 18.709  -24.891  -73.093  1.00 75.74  ? 159 GLY E C     1 
ATOM 6822  O O     . GLY E 1 162 ? 19.567  -25.433  -72.399  1.00 61.32  ? 159 GLY E O     1 
ATOM 6823  N N     . ASN E 1 163 ? 18.416  -23.588  -73.032  1.00 76.02  ? 160 ASN E N     1 
ATOM 6824  C CA    . ASN E 1 163 ? 19.148  -22.693  -72.140  1.00 69.53  ? 160 ASN E CA    1 
ATOM 6825  C C     . ASN E 1 163 ? 18.959  -23.073  -70.678  1.00 75.25  ? 160 ASN E C     1 
ATOM 6826  O O     . ASN E 1 163 ? 19.904  -22.995  -69.885  1.00 69.09  ? 160 ASN E O     1 
ATOM 6827  C CB    . ASN E 1 163 ? 18.714  -21.246  -72.369  1.00 68.93  ? 160 ASN E CB    1 
ATOM 6828  C CG    . ASN E 1 163 ? 18.876  -20.808  -73.808  1.00 77.94  ? 160 ASN E CG    1 
ATOM 6829  O OD1   . ASN E 1 163 ? 19.983  -20.511  -74.257  1.00 86.76  ? 160 ASN E OD1   1 
ATOM 6830  N ND2   . ASN E 1 163 ? 17.769  -20.760  -74.540  1.00 82.82  ? 160 ASN E ND2   1 
ATOM 6831  N N     . ALA E 1 164 ? 17.743  -23.479  -70.300  1.00 71.68  ? 161 ALA E N     1 
ATOM 6832  C CA    . ALA E 1 164 ? 17.436  -23.748  -68.900  1.00 62.41  ? 161 ALA E CA    1 
ATOM 6833  C C     . ALA E 1 164 ? 18.294  -24.856  -68.307  1.00 58.59  ? 161 ALA E C     1 
ATOM 6834  O O     . ALA E 1 164 ? 18.497  -24.876  -67.090  1.00 65.81  ? 161 ALA E O     1 
ATOM 6835  C CB    . ALA E 1 164 ? 15.958  -24.097  -68.745  1.00 71.03  ? 161 ALA E CB    1 
ATOM 6836  N N     . LEU E 1 165 ? 18.811  -25.766  -69.130  1.00 68.08  ? 162 LEU E N     1 
ATOM 6837  C CA    . LEU E 1 165 ? 19.651  -26.855  -68.655  1.00 52.66  ? 162 LEU E CA    1 
ATOM 6838  C C     . LEU E 1 165 ? 21.136  -26.585  -68.853  1.00 56.94  ? 162 LEU E C     1 
ATOM 6839  O O     . LEU E 1 165 ? 21.953  -27.476  -68.602  1.00 63.49  ? 162 LEU E O     1 
ATOM 6840  C CB    . LEU E 1 165 ? 19.263  -28.164  -69.347  1.00 52.13  ? 162 LEU E CB    1 
ATOM 6841  C CG    . LEU E 1 165 ? 18.023  -28.850  -68.778  1.00 55.87  ? 162 LEU E CG    1 
ATOM 6842  C CD1   . LEU E 1 165 ? 17.679  -30.073  -69.601  1.00 65.25  ? 162 LEU E CD1   1 
ATOM 6843  C CD2   . LEU E 1 165 ? 18.245  -29.217  -67.323  1.00 59.07  ? 162 LEU E CD2   1 
ATOM 6844  N N     . GLY E 1 166 ? 21.506  -25.379  -69.277  1.00 52.96  ? 163 GLY E N     1 
ATOM 6845  C CA    . GLY E 1 166 ? 22.899  -24.986  -69.247  1.00 59.93  ? 163 GLY E CA    1 
ATOM 6846  C C     . GLY E 1 166 ? 23.468  -24.454  -70.546  1.00 65.20  ? 163 GLY E C     1 
ATOM 6847  O O     . GLY E 1 166 ? 24.667  -24.176  -70.618  1.00 59.30  ? 163 GLY E O     1 
ATOM 6848  N N     . ASN E 1 167 ? 22.640  -24.308  -71.582  1.00 62.65  ? 164 ASN E N     1 
ATOM 6849  C CA    . ASN E 1 167 ? 23.166  -23.819  -72.854  1.00 70.65  ? 164 ASN E CA    1 
ATOM 6850  C C     . ASN E 1 167 ? 23.551  -22.346  -72.771  1.00 74.19  ? 164 ASN E C     1 
ATOM 6851  O O     . ASN E 1 167 ? 24.559  -21.932  -73.361  1.00 75.51  ? 164 ASN E O     1 
ATOM 6852  C CB    . ASN E 1 167 ? 22.139  -24.035  -73.968  1.00 72.75  ? 164 ASN E CB    1 
ATOM 6853  C CG    . ASN E 1 167 ? 22.757  -23.979  -75.355  1.00 77.71  ? 164 ASN E CG    1 
ATOM 6854  O OD1   . ASN E 1 167 ? 23.864  -24.471  -75.575  1.00 76.72  ? 164 ASN E OD1   1 
ATOM 6855  N ND2   . ASN E 1 167 ? 22.047  -23.362  -76.297  1.00 74.24  ? 164 ASN E ND2   1 
ATOM 6856  N N     . CYS E 1 168 ? 22.804  -21.558  -71.991  1.00 73.31  ? 165 CYS E N     1 
ATOM 6857  C CA    . CYS E 1 168 ? 23.038  -20.118  -71.944  1.00 78.09  ? 165 CYS E CA    1 
ATOM 6858  C C     . CYS E 1 168 ? 24.422  -19.787  -71.406  1.00 81.70  ? 165 CYS E C     1 
ATOM 6859  O O     . CYS E 1 168 ? 24.954  -18.710  -71.695  1.00 84.96  ? 165 CYS E O     1 
ATOM 6860  C CB    . CYS E 1 168 ? 21.963  -19.434  -71.100  1.00 71.12  ? 165 CYS E CB    1 
ATOM 6861  S SG    . CYS E 1 168 ? 21.823  -20.049  -69.411  1.00 75.47  ? 165 CYS E SG    1 
ATOM 6862  N N     . ILE E 1 169 ? 25.020  -20.693  -70.626  1.00 78.70  ? 166 ILE E N     1 
ATOM 6863  C CA    . ILE E 1 169 ? 26.351  -20.457  -70.082  1.00 78.29  ? 166 ILE E CA    1 
ATOM 6864  C C     . ILE E 1 169 ? 27.368  -20.217  -71.192  1.00 79.21  ? 166 ILE E C     1 
ATOM 6865  O O     . ILE E 1 169 ? 28.441  -19.659  -70.937  1.00 82.59  ? 166 ILE E O     1 
ATOM 6866  C CB    . ILE E 1 169 ? 26.783  -21.632  -69.177  1.00 86.67  ? 166 ILE E CB    1 
ATOM 6867  C CG1   . ILE E 1 169 ? 27.839  -21.172  -68.174  1.00 84.40  ? 166 ILE E CG1   1 
ATOM 6868  C CG2   . ILE E 1 169 ? 27.342  -22.774  -70.002  1.00 85.40  ? 166 ILE E CG2   1 
ATOM 6869  C CD1   . ILE E 1 169 ? 27.328  -20.147  -67.197  1.00 98.02  ? 166 ILE E CD1   1 
ATOM 6870  N N     . LEU E 1 170 ? 27.050  -20.612  -72.429  1.00 81.92  ? 167 LEU E N     1 
ATOM 6871  C CA    . LEU E 1 170 ? 27.966  -20.433  -73.548  1.00 82.97  ? 167 LEU E CA    1 
ATOM 6872  C C     . LEU E 1 170 ? 27.813  -19.080  -74.231  1.00 82.77  ? 167 LEU E C     1 
ATOM 6873  O O     . LEU E 1 170 ? 28.613  -18.758  -75.117  1.00 90.44  ? 167 LEU E O     1 
ATOM 6874  C CB    . LEU E 1 170 ? 27.774  -21.555  -74.575  1.00 86.07  ? 167 LEU E CB    1 
ATOM 6875  C CG    . LEU E 1 170 ? 28.039  -22.967  -74.049  1.00 67.87  ? 167 LEU E CG    1 
ATOM 6876  C CD1   . LEU E 1 170 ? 27.548  -24.031  -75.029  1.00 77.47  ? 167 LEU E CD1   1 
ATOM 6877  C CD2   . LEU E 1 170 ? 29.517  -23.149  -73.737  1.00 64.12  ? 167 LEU E CD2   1 
ATOM 6878  N N     . ASP E 1 171 ? 26.820  -18.284  -73.837  1.00 89.50  ? 168 ASP E N     1 
ATOM 6879  C CA    . ASP E 1 171 ? 26.561  -16.992  -74.462  1.00 94.72  ? 168 ASP E CA    1 
ATOM 6880  C C     . ASP E 1 171 ? 27.474  -15.936  -73.847  1.00 91.98  ? 168 ASP E C     1 
ATOM 6881  O O     . ASP E 1 171 ? 27.387  -15.655  -72.647  1.00 100.11 ? 168 ASP E O     1 
ATOM 6882  C CB    . ASP E 1 171 ? 25.094  -16.605  -74.290  1.00 92.03  ? 168 ASP E CB    1 
ATOM 6883  C CG    . ASP E 1 171 ? 24.683  -15.451  -75.184  1.00 91.24  ? 168 ASP E CG    1 
ATOM 6884  O OD1   . ASP E 1 171 ? 25.535  -14.960  -75.952  1.00 97.83  ? 168 ASP E OD1   1 
ATOM 6885  O OD2   . ASP E 1 171 ? 23.512  -15.024  -75.106  1.00 91.23  ? 168 ASP E OD2   1 
ATOM 6886  N N     . LYS E 1 172 ? 28.355  -15.360  -74.671  1.00 86.22  ? 169 LYS E N     1 
ATOM 6887  C CA    . LYS E 1 172 ? 29.318  -14.382  -74.173  1.00 89.52  ? 169 LYS E CA    1 
ATOM 6888  C C     . LYS E 1 172 ? 28.642  -13.111  -73.662  1.00 92.42  ? 169 LYS E C     1 
ATOM 6889  O O     . LYS E 1 172 ? 29.129  -12.487  -72.711  1.00 93.54  ? 169 LYS E O     1 
ATOM 6890  C CB    . LYS E 1 172 ? 30.322  -14.053  -75.281  1.00 89.56  ? 169 LYS E CB    1 
ATOM 6891  C CG    . LYS E 1 172 ? 31.006  -15.284  -75.879  1.00 91.56  ? 169 LYS E CG    1 
ATOM 6892  C CD    . LYS E 1 172 ? 31.856  -14.935  -77.102  1.00 96.62  ? 169 LYS E CD    1 
ATOM 6893  C CE    . LYS E 1 172 ? 32.421  -16.186  -77.780  1.00 107.20 ? 169 LYS E CE    1 
ATOM 6894  N NZ    . LYS E 1 172 ? 33.179  -15.871  -79.030  1.00 94.05  ? 169 LYS E NZ    1 
ATOM 6895  N N     . ASP E 1 173 ? 27.523  -12.715  -74.272  1.00 90.39  ? 170 ASP E N     1 
ATOM 6896  C CA    . ASP E 1 173 ? 26.771  -11.556  -73.793  1.00 93.52  ? 170 ASP E CA    1 
ATOM 6897  C C     . ASP E 1 173 ? 26.088  -11.850  -72.462  1.00 93.24  ? 170 ASP E C     1 
ATOM 6898  O O     . ASP E 1 173 ? 25.994  -10.973  -71.593  1.00 100.94 ? 170 ASP E O     1 
ATOM 6899  C CB    . ASP E 1 173 ? 25.746  -11.127  -74.842  1.00 96.16  ? 170 ASP E CB    1 
ATOM 6900  C CG    . ASP E 1 173 ? 26.376  -10.861  -76.193  1.00 100.26 ? 170 ASP E CG    1 
ATOM 6901  O OD1   . ASP E 1 173 ? 27.508  -10.332  -76.230  1.00 95.30  ? 170 ASP E OD1   1 
ATOM 6902  O OD2   . ASP E 1 173 ? 25.742  -11.184  -77.219  1.00 101.62 ? 170 ASP E OD2   1 
ATOM 6903  N N     . TYR E 1 174 ? 25.582  -13.075  -72.307  1.00 91.71  ? 171 TYR E N     1 
ATOM 6904  C CA    . TYR E 1 174 ? 24.942  -13.499  -71.068  1.00 87.70  ? 171 TYR E CA    1 
ATOM 6905  C C     . TYR E 1 174 ? 25.888  -13.412  -69.878  1.00 92.42  ? 171 TYR E C     1 
ATOM 6906  O O     . TYR E 1 174 ? 25.472  -13.015  -68.784  1.00 94.42  ? 171 TYR E O     1 
ATOM 6907  C CB    . TYR E 1 174 ? 24.467  -14.938  -71.238  1.00 82.43  ? 171 TYR E CB    1 
ATOM 6908  C CG    . TYR E 1 174 ? 23.981  -15.632  -69.994  1.00 88.52  ? 171 TYR E CG    1 
ATOM 6909  C CD1   . TYR E 1 174 ? 22.872  -15.170  -69.298  1.00 88.10  ? 171 TYR E CD1   1 
ATOM 6910  C CD2   . TYR E 1 174 ? 24.675  -16.715  -69.477  1.00 88.33  ? 171 TYR E CD2   1 
ATOM 6911  C CE1   . TYR E 1 174 ? 22.428  -15.813  -68.156  1.00 88.53  ? 171 TYR E CE1   1 
ATOM 6912  C CE2   . TYR E 1 174 ? 24.248  -17.356  -68.332  1.00 75.71  ? 171 TYR E CE2   1 
ATOM 6913  C CZ    . TYR E 1 174 ? 23.125  -16.900  -67.675  1.00 83.35  ? 171 TYR E CZ    1 
ATOM 6914  O OH    . TYR E 1 174 ? 22.696  -17.536  -66.534  1.00 80.79  ? 171 TYR E OH    1 
ATOM 6915  N N     . LEU E 1 175 ? 27.168  -13.736  -70.074  1.00 93.84  ? 172 LEU E N     1 
ATOM 6916  C CA    . LEU E 1 175 ? 28.115  -13.679  -68.963  1.00 104.59 ? 172 LEU E CA    1 
ATOM 6917  C C     . LEU E 1 175 ? 28.349  -12.242  -68.513  1.00 101.04 ? 172 LEU E C     1 
ATOM 6918  O O     . LEU E 1 175 ? 28.384  -11.954  -67.307  1.00 96.93  ? 172 LEU E O     1 
ATOM 6919  C CB    . LEU E 1 175 ? 29.434  -14.344  -69.361  1.00 103.98 ? 172 LEU E CB    1 
ATOM 6920  C CG    . LEU E 1 175 ? 29.407  -15.861  -69.563  1.00 96.41  ? 172 LEU E CG    1 
ATOM 6921  C CD1   . LEU E 1 175 ? 30.801  -16.388  -69.882  1.00 84.04  ? 172 LEU E CD1   1 
ATOM 6922  C CD2   . LEU E 1 175 ? 28.819  -16.563  -68.347  1.00 95.47  ? 172 LEU E CD2   1 
ATOM 6923  N N     . ARG E 1 176 ? 28.508  -11.324  -69.468  1.00 101.87 ? 173 ARG E N     1 
ATOM 6924  C CA    . ARG E 1 176 ? 28.635  -9.916   -69.113  1.00 109.29 ? 173 ARG E CA    1 
ATOM 6925  C C     . ARG E 1 176 ? 27.375  -9.411   -68.416  1.00 106.99 ? 173 ARG E C     1 
ATOM 6926  O O     . ARG E 1 176 ? 27.461  -8.705   -67.405  1.00 111.98 ? 173 ARG E O     1 
ATOM 6927  C CB    . ARG E 1 176 ? 28.960  -9.084   -70.352  1.00 103.23 ? 173 ARG E CB    1 
ATOM 6928  C CG    . ARG E 1 176 ? 30.379  -9.310   -70.872  1.00 104.24 ? 173 ARG E CG    1 
ATOM 6929  C CD    . ARG E 1 176 ? 30.786  -8.289   -71.928  1.00 118.02 ? 173 ARG E CD    1 
ATOM 6930  N NE    . ARG E 1 176 ? 29.992  -8.409   -73.147  1.00 110.07 ? 173 ARG E NE    1 
ATOM 6931  C CZ    . ARG E 1 176 ? 28.927  -7.663   -73.425  1.00 104.55 ? 173 ARG E CZ    1 
ATOM 6932  N NH1   . ARG E 1 176 ? 28.524  -6.732   -72.569  1.00 106.49 ? 173 ARG E NH1   1 
ATOM 6933  N NH2   . ARG E 1 176 ? 28.266  -7.846   -74.560  1.00 107.28 ? 173 ARG E NH2   1 
ATOM 6934  N N     . SER E 1 177 ? 26.194  -9.761   -68.940  1.00 98.17  ? 174 SER E N     1 
ATOM 6935  C CA    . SER E 1 177 ? 24.947  -9.378   -68.280  1.00 95.21  ? 174 SER E CA    1 
ATOM 6936  C C     . SER E 1 177 ? 24.799  -10.016  -66.902  1.00 101.38 ? 174 SER E C     1 
ATOM 6937  O O     . SER E 1 177 ? 23.998  -9.541   -66.090  1.00 100.60 ? 174 SER E O     1 
ATOM 6938  C CB    . SER E 1 177 ? 23.751  -9.753   -69.160  1.00 95.72  ? 174 SER E CB    1 
ATOM 6939  O OG    . SER E 1 177 ? 23.763  -9.022   -70.377  1.00 97.93  ? 174 SER E OG    1 
ATOM 6940  N N     . LEU E 1 178 ? 25.548  -11.086  -66.629  1.00 102.81 ? 175 LEU E N     1 
ATOM 6941  C CA    . LEU E 1 178 ? 25.574  -11.683  -65.297  1.00 98.53  ? 175 LEU E CA    1 
ATOM 6942  C C     . LEU E 1 178 ? 26.520  -10.941  -64.363  1.00 104.49 ? 175 LEU E C     1 
ATOM 6943  O O     . LEU E 1 178 ? 26.265  -10.870  -63.155  1.00 110.75 ? 175 LEU E O     1 
ATOM 6944  C CB    . LEU E 1 178 ? 25.979  -13.156  -65.380  1.00 97.66  ? 175 LEU E CB    1 
ATOM 6945  C CG    . LEU E 1 178 ? 24.872  -14.199  -65.237  1.00 94.39  ? 175 LEU E CG    1 
ATOM 6946  C CD1   . LEU E 1 178 ? 25.480  -15.585  -65.151  1.00 94.73  ? 175 LEU E CD1   1 
ATOM 6947  C CD2   . LEU E 1 178 ? 24.058  -13.906  -63.994  1.00 91.66  ? 175 LEU E CD2   1 
ATOM 6948  N N     . ASN E 1 179 ? 27.617  -10.400  -64.898  1.00 105.24 ? 176 ASN E N     1 
ATOM 6949  C CA    . ASN E 1 179 ? 28.567  -9.675   -64.056  1.00 111.57 ? 176 ASN E CA    1 
ATOM 6950  C C     . ASN E 1 179 ? 27.962  -8.390   -63.498  1.00 117.32 ? 176 ASN E C     1 
ATOM 6951  O O     . ASN E 1 179 ? 28.271  -7.992   -62.368  1.00 118.10 ? 176 ASN E O     1 
ATOM 6952  C CB    . ASN E 1 179 ? 29.834  -9.353   -64.849  1.00 102.71 ? 176 ASN E CB    1 
ATOM 6953  C CG    . ASN E 1 179 ? 30.715  -10.568  -65.067  1.00 113.08 ? 176 ASN E CG    1 
ATOM 6954  O OD1   . ASN E 1 179 ? 30.998  -10.954  -66.204  1.00 119.09 ? 176 ASN E OD1   1 
ATOM 6955  N ND2   . ASN E 1 179 ? 31.163  -11.173  -63.973  1.00 114.69 ? 176 ASN E ND2   1 
ATOM 6956  N N     . LYS E 1 180 ? 27.108  -7.721   -64.276  1.00 114.97 ? 177 LYS E N     1 
ATOM 6957  C CA    . LYS E 1 180 ? 26.488  -6.467   -63.852  1.00 119.84 ? 177 LYS E CA    1 
ATOM 6958  C C     . LYS E 1 180 ? 25.502  -6.629   -62.699  1.00 120.78 ? 177 LYS E C     1 
ATOM 6959  O O     . LYS E 1 180 ? 25.069  -5.617   -62.133  1.00 119.97 ? 177 LYS E O     1 
ATOM 6960  C CB    . LYS E 1 180 ? 25.792  -5.815   -65.047  1.00 115.61 ? 177 LYS E CB    1 
ATOM 6961  C CG    . LYS E 1 180 ? 26.737  -5.525   -66.205  1.00 107.55 ? 177 LYS E CG    1 
ATOM 6962  C CD    . LYS E 1 180 ? 26.001  -4.971   -67.413  1.00 103.54 ? 177 LYS E CD    1 
ATOM 6963  C CE    . LYS E 1 180 ? 26.954  -4.784   -68.584  1.00 109.70 ? 177 LYS E CE    1 
ATOM 6964  N NZ    . LYS E 1 180 ? 26.262  -4.307   -69.813  1.00 107.30 ? 177 LYS E NZ    1 
ATOM 6965  N N     . LEU E 1 181 ? 25.131  -7.899   -62.322  1.00 117.79 ? 178 LEU E N     1 
ATOM 6966  C CA    . LEU E 1 181 ? 24.213  -8.099   -61.210  1.00 123.46 ? 178 LEU E CA    1 
ATOM 6967  C C     . LEU E 1 181 ? 24.966  -8.119   -59.884  1.00 137.14 ? 178 LEU E C     1 
ATOM 6968  O O     . LEU E 1 181 ? 26.133  -8.525   -59.830  1.00 135.60 ? 178 LEU E O     1 
ATOM 6969  C CB    . LEU E 1 181 ? 23.446  -9.408   -61.376  1.00 118.06 ? 178 LEU E CB    1 
ATOM 6970  C CG    . LEU E 1 181 ? 22.277  -9.403   -62.357  1.00 114.96 ? 178 LEU E CG    1 
ATOM 6971  C CD1   . LEU E 1 181 ? 21.664  -10.796  -62.476  1.00 102.89 ? 178 LEU E CD1   1 
ATOM 6972  C CD2   . LEU E 1 181 ? 21.241  -8.388   -61.914  1.00 110.90 ? 178 LEU E CD2   1 
ATOM 6973  N N     . PRO E 1 182 ? 24.324  -7.681   -58.800  1.00 140.67 ? 179 PRO E N     1 
ATOM 6974  C CA    . PRO E 1 182 ? 24.988  -7.719   -57.489  1.00 132.91 ? 179 PRO E CA    1 
ATOM 6975  C C     . PRO E 1 182 ? 25.282  -9.153   -57.072  1.00 139.85 ? 179 PRO E C     1 
ATOM 6976  O O     . PRO E 1 182 ? 24.401  -10.017  -57.088  1.00 142.33 ? 179 PRO E O     1 
ATOM 6977  C CB    . PRO E 1 182 ? 23.974  -7.051   -56.551  1.00 131.20 ? 179 PRO E CB    1 
ATOM 6978  C CG    . PRO E 1 182 ? 23.032  -6.311   -57.439  1.00 129.95 ? 179 PRO E CG    1 
ATOM 6979  C CD    . PRO E 1 182 ? 22.984  -7.073   -58.727  1.00 131.17 ? 179 PRO E CD    1 
ATOM 6980  N N     . ARG E 1 183 ? 26.539  -9.404   -56.710  1.00 139.32 ? 180 ARG E N     1 
ATOM 6981  C CA    . ARG E 1 183 ? 26.962  -10.729  -56.265  1.00 143.36 ? 180 ARG E CA    1 
ATOM 6982  C C     . ARG E 1 183 ? 26.274  -11.084  -54.951  1.00 143.62 ? 180 ARG E C     1 
ATOM 6983  O O     . ARG E 1 183 ? 26.639  -10.571  -53.888  1.00 148.72 ? 180 ARG E O     1 
ATOM 6984  C CB    . ARG E 1 183 ? 28.480  -10.774  -56.123  1.00 137.62 ? 180 ARG E CB    1 
ATOM 6985  C CG    . ARG E 1 183 ? 29.033  -12.172  -55.943  1.00 132.51 ? 180 ARG E CG    1 
ATOM 6986  C CD    . ARG E 1 183 ? 28.596  -13.099  -57.059  1.00 135.39 ? 180 ARG E CD    1 
ATOM 6987  N NE    . ARG E 1 183 ? 29.115  -14.449  -56.862  1.00 144.82 ? 180 ARG E NE    1 
ATOM 6988  C CZ    . ARG E 1 183 ? 28.650  -15.532  -57.477  1.00 149.75 ? 180 ARG E CZ    1 
ATOM 6989  N NH1   . ARG E 1 183 ? 27.643  -15.434  -58.336  1.00 137.82 ? 180 ARG E NH1   1 
ATOM 6990  N NH2   . ARG E 1 183 ? 29.191  -16.717  -57.225  1.00 144.16 ? 180 ARG E NH2   1 
ATOM 6991  N N     . GLN E 1 184 ? 25.284  -11.971  -55.016  1.00 137.45 ? 181 GLN E N     1 
ATOM 6992  C CA    . GLN E 1 184 ? 24.523  -12.330  -53.829  1.00 137.64 ? 181 GLN E CA    1 
ATOM 6993  C C     . GLN E 1 184 ? 25.271  -13.356  -52.988  1.00 144.01 ? 181 GLN E C     1 
ATOM 6994  O O     . GLN E 1 184 ? 26.009  -14.201  -53.503  1.00 140.36 ? 181 GLN E O     1 
ATOM 6995  C CB    . GLN E 1 184 ? 23.154  -12.896  -54.213  1.00 133.42 ? 181 GLN E CB    1 
ATOM 6996  C CG    . GLN E 1 184 ? 23.221  -14.120  -55.121  1.00 134.44 ? 181 GLN E CG    1 
ATOM 6997  C CD    . GLN E 1 184 ? 21.865  -14.765  -55.354  1.00 122.77 ? 181 GLN E CD    1 
ATOM 6998  O OE1   . GLN E 1 184 ? 21.344  -15.489  -54.501  1.00 115.38 ? 181 GLN E OE1   1 
ATOM 6999  N NE2   . GLN E 1 184 ? 21.286  -14.500  -56.517  1.00 105.61 ? 181 GLN E NE2   1 
ATOM 7000  N N     . LEU E 1 185 ? 25.079  -13.262  -51.674  1.00 140.76 ? 182 LEU E N     1 
ATOM 7001  C CA    . LEU E 1 185 ? 25.660  -14.189  -50.720  1.00 136.55 ? 182 LEU E CA    1 
ATOM 7002  C C     . LEU E 1 185 ? 24.835  -15.476  -50.711  1.00 131.44 ? 182 LEU E C     1 
ATOM 7003  O O     . LEU E 1 185 ? 23.628  -15.439  -50.962  1.00 127.48 ? 182 LEU E O     1 
ATOM 7004  C CB    . LEU E 1 185 ? 25.700  -13.562  -49.328  1.00 143.67 ? 182 LEU E CB    1 
ATOM 7005  C CG    . LEU E 1 185 ? 26.790  -14.017  -48.355  1.00 147.24 ? 182 LEU E CG    1 
ATOM 7006  C CD1   . LEU E 1 185 ? 28.172  -13.752  -48.943  1.00 143.88 ? 182 LEU E CD1   1 
ATOM 7007  C CD2   . LEU E 1 185 ? 26.642  -13.324  -47.006  1.00 119.82 ? 182 LEU E CD2   1 
ATOM 7008  N N     . PRO E 1 186 ? 25.467  -16.636  -50.461  1.00 135.25 ? 183 PRO E N     1 
ATOM 7009  C CA    . PRO E 1 186 ? 24.721  -17.905  -50.456  1.00 132.70 ? 183 PRO E CA    1 
ATOM 7010  C C     . PRO E 1 186 ? 23.427  -17.902  -49.654  1.00 132.21 ? 183 PRO E C     1 
ATOM 7011  O O     . PRO E 1 186 ? 23.426  -17.652  -48.444  1.00 128.60 ? 183 PRO E O     1 
ATOM 7012  C CB    . PRO E 1 186 ? 25.728  -18.891  -49.849  1.00 128.56 ? 183 PRO E CB    1 
ATOM 7013  C CG    . PRO E 1 186 ? 27.054  -18.351  -50.228  1.00 135.43 ? 183 PRO E CG    1 
ATOM 7014  C CD    . PRO E 1 186 ? 26.922  -16.853  -50.377  1.00 136.88 ? 183 PRO E CD    1 
ATOM 7015  N N     . LEU E 1 187 ? 22.318  -18.178  -50.340  1.00 130.49 ? 184 LEU E N     1 
ATOM 7016  C CA    . LEU E 1 187 ? 21.024  -18.302  -49.683  1.00 127.98 ? 184 LEU E CA    1 
ATOM 7017  C C     . LEU E 1 187 ? 21.071  -19.436  -48.664  1.00 133.17 ? 184 LEU E C     1 
ATOM 7018  O O     . LEU E 1 187 ? 21.853  -20.383  -48.793  1.00 128.92 ? 184 LEU E O     1 
ATOM 7019  C CB    . LEU E 1 187 ? 19.921  -18.544  -50.717  1.00 122.29 ? 184 LEU E CB    1 
ATOM 7020  C CG    . LEU E 1 187 ? 19.763  -17.454  -51.785  1.00 126.58 ? 184 LEU E CG    1 
ATOM 7021  C CD1   . LEU E 1 187 ? 18.742  -17.861  -52.843  1.00 97.71  ? 184 LEU E CD1   1 
ATOM 7022  C CD2   . LEU E 1 187 ? 19.390  -16.116  -51.152  1.00 115.66 ? 184 LEU E CD2   1 
ATOM 7023  N N     . GLU E 1 188 ? 20.226  -19.344  -47.643  1.00 135.54 ? 185 GLU E N     1 
ATOM 7024  C CA    . GLU E 1 188 ? 20.214  -20.344  -46.586  1.00 125.50 ? 185 GLU E CA    1 
ATOM 7025  C C     . GLU E 1 188 ? 19.164  -21.415  -46.838  1.00 119.14 ? 185 GLU E C     1 
ATOM 7026  O O     . GLU E 1 188 ? 18.091  -21.153  -47.388  1.00 108.20 ? 185 GLU E O     1 
ATOM 7027  C CB    . GLU E 1 188 ? 19.933  -19.705  -45.222  1.00 129.27 ? 185 GLU E CB    1 
ATOM 7028  C CG    . GLU E 1 188 ? 20.368  -20.572  -44.043  1.00 129.50 ? 185 GLU E CG    1 
ATOM 7029  C CD    . GLU E 1 188 ? 20.069  -19.944  -42.694  1.00 136.54 ? 185 GLU E CD    1 
ATOM 7030  O OE1   . GLU E 1 188 ? 18.927  -19.480  -42.493  1.00 138.70 ? 185 GLU E OE1   1 
ATOM 7031  O OE2   . GLU E 1 188 ? 20.975  -19.917  -41.834  1.00 134.16 ? 185 GLU E OE2   1 
ATOM 7032  N N     . VAL E 1 189 ? 19.497  -22.637  -46.430  1.00 122.95 ? 186 VAL E N     1 
ATOM 7033  C CA    . VAL E 1 189 ? 18.628  -23.795  -46.580  1.00 119.21 ? 186 VAL E CA    1 
ATOM 7034  C C     . VAL E 1 189 ? 18.073  -24.120  -45.202  1.00 104.51 ? 186 VAL E C     1 
ATOM 7035  O O     . VAL E 1 189 ? 18.830  -24.220  -44.230  1.00 103.76 ? 186 VAL E O     1 
ATOM 7036  C CB    . VAL E 1 189 ? 19.379  -24.998  -47.176  1.00 109.45 ? 186 VAL E CB    1 
ATOM 7037  C CG1   . VAL E 1 189 ? 18.439  -26.182  -47.337  1.00 104.08 ? 186 VAL E CG1   1 
ATOM 7038  C CG2   . VAL E 1 189 ? 20.008  -24.624  -48.509  1.00 104.83 ? 186 VAL E CG2   1 
ATOM 7039  N N     . ASP E 1 190 ? 16.758  -24.279  -45.118  1.00 100.34 ? 187 ASP E N     1 
ATOM 7040  C CA    . ASP E 1 190 ? 16.076  -24.532  -43.851  1.00 109.31 ? 187 ASP E CA    1 
ATOM 7041  C C     . ASP E 1 190 ? 15.809  -26.030  -43.744  1.00 103.65 ? 187 ASP E C     1 
ATOM 7042  O O     . ASP E 1 190 ? 14.883  -26.552  -44.370  1.00 104.90 ? 187 ASP E O     1 
ATOM 7043  C CB    . ASP E 1 190 ? 14.792  -23.718  -43.750  1.00 118.22 ? 187 ASP E CB    1 
ATOM 7044  C CG    . ASP E 1 190 ? 14.067  -23.949  -42.442  1.00 129.72 ? 187 ASP E CG    1 
ATOM 7045  O OD1   . ASP E 1 190 ? 14.680  -23.711  -41.379  1.00 126.26 ? 187 ASP E OD1   1 
ATOM 7046  O OD2   . ASP E 1 190 ? 12.895  -24.378  -42.476  1.00 130.07 ? 187 ASP E OD2   1 
ATOM 7047  N N     . LEU E 1 191 ? 16.620  -26.722  -42.942  1.00 101.32 ? 188 LEU E N     1 
ATOM 7048  C CA    . LEU E 1 191 ? 16.546  -28.171  -42.794  1.00 105.66 ? 188 LEU E CA    1 
ATOM 7049  C C     . LEU E 1 191 ? 15.483  -28.623  -41.799  1.00 108.01 ? 188 LEU E C     1 
ATOM 7050  O O     . LEU E 1 191 ? 15.576  -29.740  -41.276  1.00 113.07 ? 188 LEU E O     1 
ATOM 7051  C CB    . LEU E 1 191 ? 17.904  -28.730  -42.367  1.00 99.77  ? 188 LEU E CB    1 
ATOM 7052  C CG    . LEU E 1 191 ? 19.064  -28.547  -43.340  1.00 96.08  ? 188 LEU E CG    1 
ATOM 7053  C CD1   . LEU E 1 191 ? 20.285  -29.273  -42.811  1.00 92.17  ? 188 LEU E CD1   1 
ATOM 7054  C CD2   . LEU E 1 191 ? 18.684  -29.038  -44.728  1.00 101.33 ? 188 LEU E CD2   1 
ATOM 7055  N N     . THR E 1 192 ? 14.490  -27.781  -41.511  1.00 112.77 ? 189 THR E N     1 
ATOM 7056  C CA    . THR E 1 192 ? 13.447  -28.163  -40.565  1.00 116.25 ? 189 THR E CA    1 
ATOM 7057  C C     . THR E 1 192 ? 12.539  -29.246  -41.139  1.00 111.90 ? 189 THR E C     1 
ATOM 7058  O O     . THR E 1 192 ? 12.150  -30.179  -40.426  1.00 103.26 ? 189 THR E O     1 
ATOM 7059  C CB    . THR E 1 192 ? 12.633  -26.935  -40.165  1.00 116.82 ? 189 THR E CB    1 
ATOM 7060  O OG1   . THR E 1 192 ? 12.106  -26.310  -41.342  1.00 117.43 ? 189 THR E OG1   1 
ATOM 7061  C CG2   . THR E 1 192 ? 13.502  -25.944  -39.405  1.00 114.38 ? 189 THR E CG2   1 
ATOM 7062  N N     . LYS E 1 193 ? 12.193  -29.146  -42.426  1.00 111.65 ? 190 LYS E N     1 
ATOM 7063  C CA    . LYS E 1 193 ? 11.365  -30.146  -43.091  1.00 112.14 ? 190 LYS E CA    1 
ATOM 7064  C C     . LYS E 1 193 ? 12.187  -31.239  -43.762  1.00 107.34 ? 190 LYS E C     1 
ATOM 7065  O O     . LYS E 1 193 ? 11.725  -31.849  -44.736  1.00 98.05  ? 190 LYS E O     1 
ATOM 7066  C CB    . LYS E 1 193 ? 10.447  -29.479  -44.117  1.00 103.49 ? 190 LYS E CB    1 
ATOM 7067  C CG    . LYS E 1 193 ? 9.457   -28.480  -43.543  1.00 106.54 ? 190 LYS E CG    1 
ATOM 7068  C CD    . LYS E 1 193 ? 8.496   -28.008  -44.623  1.00 107.26 ? 190 LYS E CD    1 
ATOM 7069  C CE    . LYS E 1 193 ? 7.421   -27.092  -44.070  1.00 106.62 ? 190 LYS E CE    1 
ATOM 7070  N NZ    . LYS E 1 193 ? 6.599   -26.503  -45.163  1.00 110.79 ? 190 LYS E NZ    1 
ATOM 7071  N N     . ALA E 1 194 ? 13.391  -31.507  -43.266  1.00 104.46 ? 191 ALA E N     1 
ATOM 7072  C CA    . ALA E 1 194 ? 14.222  -32.551  -43.844  1.00 93.90  ? 191 ALA E CA    1 
ATOM 7073  C C     . ALA E 1 194 ? 13.667  -33.933  -43.520  1.00 92.90  ? 191 ALA E C     1 
ATOM 7074  O O     . ALA E 1 194 ? 13.062  -34.159  -42.468  1.00 93.64  ? 191 ALA E O     1 
ATOM 7075  C CB    . ALA E 1 194 ? 15.657  -32.435  -43.333  1.00 88.26  ? 191 ALA E CB    1 
ATOM 7076  N N     . LYS E 1 195 ? 13.878  -34.862  -44.449  1.00 89.71  ? 192 LYS E N     1 
ATOM 7077  C CA    . LYS E 1 195 ? 13.449  -36.239  -44.250  1.00 88.00  ? 192 LYS E CA    1 
ATOM 7078  C C     . LYS E 1 195 ? 14.282  -36.875  -43.145  1.00 88.54  ? 192 LYS E C     1 
ATOM 7079  O O     . LYS E 1 195 ? 15.516  -36.844  -43.188  1.00 85.35  ? 192 LYS E O     1 
ATOM 7080  C CB    . LYS E 1 195 ? 13.587  -37.024  -45.552  1.00 88.85  ? 192 LYS E CB    1 
ATOM 7081  C CG    . LYS E 1 195 ? 13.183  -38.484  -45.467  1.00 87.80  ? 192 LYS E CG    1 
ATOM 7082  C CD    . LYS E 1 195 ? 13.422  -39.178  -46.800  1.00 86.53  ? 192 LYS E CD    1 
ATOM 7083  C CE    . LYS E 1 195 ? 12.959  -40.623  -46.771  1.00 86.83  ? 192 LYS E CE    1 
ATOM 7084  N NZ    . LYS E 1 195 ? 11.513  -40.736  -46.446  1.00 93.23  ? 192 LYS E NZ    1 
ATOM 7085  N N     . ARG E 1 196 ? 13.607  -37.453  -42.150  1.00 85.98  ? 193 ARG E N     1 
ATOM 7086  C CA    . ARG E 1 196 ? 14.276  -37.967  -40.965  1.00 89.08  ? 193 ARG E CA    1 
ATOM 7087  C C     . ARG E 1 196 ? 14.089  -39.460  -40.738  1.00 85.45  ? 193 ARG E C     1 
ATOM 7088  O O     . ARG E 1 196 ? 14.841  -40.041  -39.948  1.00 92.02  ? 193 ARG E O     1 
ATOM 7089  C CB    . ARG E 1 196 ? 13.809  -37.201  -39.717  1.00 88.81  ? 193 ARG E CB    1 
ATOM 7090  C CG    . ARG E 1 196 ? 14.306  -35.763  -39.689  1.00 88.59  ? 193 ARG E CG    1 
ATOM 7091  C CD    . ARG E 1 196 ? 14.181  -35.133  -38.313  1.00 87.92  ? 193 ARG E CD    1 
ATOM 7092  N NE    . ARG E 1 196 ? 15.161  -34.065  -38.124  1.00 94.20  ? 193 ARG E NE    1 
ATOM 7093  C CZ    . ARG E 1 196 ? 15.014  -32.824  -38.578  1.00 101.33 ? 193 ARG E CZ    1 
ATOM 7094  N NH1   . ARG E 1 196 ? 13.923  -32.487  -39.254  1.00 104.16 ? 193 ARG E NH1   1 
ATOM 7095  N NH2   . ARG E 1 196 ? 15.961  -31.919  -38.360  1.00 88.34  ? 193 ARG E NH2   1 
ATOM 7096  N N     . GLN E 1 197 ? 13.113  -40.090  -41.388  1.00 85.58  ? 194 GLN E N     1 
ATOM 7097  C CA    . GLN E 1 197 ? 12.956  -41.535  -41.343  1.00 97.97  ? 194 GLN E CA    1 
ATOM 7098  C C     . GLN E 1 197 ? 12.595  -42.030  -42.738  1.00 99.98  ? 194 GLN E C     1 
ATOM 7099  O O     . GLN E 1 197 ? 12.094  -41.276  -43.576  1.00 95.62  ? 194 GLN E O     1 
ATOM 7100  C CB    . GLN E 1 197 ? 11.930  -41.946  -40.271  1.00 94.28  ? 194 GLN E CB    1 
ATOM 7101  C CG    . GLN E 1 197 ? 10.509  -41.435  -40.473  1.00 105.46 ? 194 GLN E CG    1 
ATOM 7102  C CD    . GLN E 1 197 ? 9.672   -42.306  -41.386  1.00 100.01 ? 194 GLN E CD    1 
ATOM 7103  O OE1   . GLN E 1 197 ? 9.446   -43.482  -41.101  1.00 95.31  ? 194 GLN E OE1   1 
ATOM 7104  N NE2   . GLN E 1 197 ? 9.183   -41.724  -42.478  1.00 101.45 ? 194 GLN E NE2   1 
ATOM 7105  N N     . ASP E 1 198 ? 12.853  -43.320  -42.975  1.00 91.38  ? 195 ASP E N     1 
ATOM 7106  C CA    . ASP E 1 198 ? 12.810  -43.859  -44.334  1.00 88.28  ? 195 ASP E CA    1 
ATOM 7107  C C     . ASP E 1 198 ? 11.397  -43.877  -44.912  1.00 90.19  ? 195 ASP E C     1 
ATOM 7108  O O     . ASP E 1 198 ? 11.186  -43.458  -46.056  1.00 85.87  ? 195 ASP E O     1 
ATOM 7109  C CB    . ASP E 1 198 ? 13.417  -45.265  -44.356  1.00 88.62  ? 195 ASP E CB    1 
ATOM 7110  C CG    . ASP E 1 198 ? 14.912  -45.263  -44.084  1.00 81.45  ? 195 ASP E CG    1 
ATOM 7111  O OD1   . ASP E 1 198 ? 15.569  -44.243  -44.377  1.00 83.23  ? 195 ASP E OD1   1 
ATOM 7112  O OD2   . ASP E 1 198 ? 15.431  -46.285  -43.587  1.00 84.30  ? 195 ASP E OD2   1 
ATOM 7113  N N     . LEU E 1 199 ? 10.424  -44.373  -44.148  1.00 93.85  ? 196 LEU E N     1 
ATOM 7114  C CA    . LEU E 1 199 ? 9.097   -44.651  -44.693  1.00 92.12  ? 196 LEU E CA    1 
ATOM 7115  C C     . LEU E 1 199 ? 8.465   -43.409  -45.321  1.00 90.33  ? 196 LEU E C     1 
ATOM 7116  O O     . LEU E 1 199 ? 8.576   -42.296  -44.799  1.00 90.90  ? 196 LEU E O     1 
ATOM 7117  C CB    . LEU E 1 199 ? 8.190   -45.223  -43.601  1.00 89.88  ? 196 LEU E CB    1 
ATOM 7118  C CG    . LEU E 1 199 ? 6.798   -45.665  -44.054  1.00 91.91  ? 196 LEU E CG    1 
ATOM 7119  C CD1   . LEU E 1 199 ? 6.923   -46.677  -45.179  1.00 92.45  ? 196 LEU E CD1   1 
ATOM 7120  C CD2   . LEU E 1 199 ? 6.011   -46.259  -42.895  1.00 105.93 ? 196 LEU E CD2   1 
ATOM 7121  N N     . GLU E 1 200 ? 7.782   -43.617  -46.451  1.00 90.51  ? 197 GLU E N     1 
ATOM 7122  C CA    . GLU E 1 200 ? 7.072   -42.569  -47.189  1.00 90.11  ? 197 GLU E CA    1 
ATOM 7123  C C     . GLU E 1 200 ? 5.612   -42.975  -47.336  1.00 94.27  ? 197 GLU E C     1 
ATOM 7124  O O     . GLU E 1 200 ? 5.242   -43.658  -48.305  1.00 86.30  ? 197 GLU E O     1 
ATOM 7125  C CB    . GLU E 1 200 ? 7.705   -42.327  -48.558  1.00 81.10  ? 197 GLU E CB    1 
ATOM 7126  C CG    . GLU E 1 200 ? 9.023   -41.572  -48.523  1.00 76.84  ? 197 GLU E CG    1 
ATOM 7127  C CD    . GLU E 1 200 ? 8.843   -40.103  -48.201  1.00 85.83  ? 197 GLU E CD    1 
ATOM 7128  O OE1   . GLU E 1 200 ? 7.748   -39.564  -48.468  1.00 82.63  ? 197 GLU E OE1   1 
ATOM 7129  O OE2   . GLU E 1 200 ? 9.797   -39.487  -47.680  1.00 93.65  ? 197 GLU E OE2   1 
ATOM 7130  N N     . PRO E 1 201 ? 4.748   -42.586  -46.394  1.00 101.22 ? 198 PRO E N     1 
ATOM 7131  C CA    . PRO E 1 201 ? 3.378   -43.132  -46.388  1.00 88.47  ? 198 PRO E CA    1 
ATOM 7132  C C     . PRO E 1 201 ? 2.554   -42.764  -47.614  1.00 88.40  ? 198 PRO E C     1 
ATOM 7133  O O     . PRO E 1 201 ? 1.851   -43.628  -48.149  1.00 83.95  ? 198 PRO E O     1 
ATOM 7134  C CB    . PRO E 1 201 ? 2.775   -42.547  -45.101  1.00 79.61  ? 198 PRO E CB    1 
ATOM 7135  C CG    . PRO E 1 201 ? 3.951   -42.092  -44.281  1.00 82.34  ? 198 PRO E CG    1 
ATOM 7136  C CD    . PRO E 1 201 ? 4.994   -41.679  -45.261  1.00 93.24  ? 198 PRO E CD    1 
ATOM 7137  N N     . SER E 1 202 ? 2.610   -41.508  -48.072  1.00 89.41  ? 199 SER E N     1 
ATOM 7138  C CA    . SER E 1 202 ? 1.853   -41.116  -49.261  1.00 92.89  ? 199 SER E CA    1 
ATOM 7139  C C     . SER E 1 202 ? 2.291   -41.907  -50.490  1.00 100.20 ? 199 SER E C     1 
ATOM 7140  O O     . SER E 1 202 ? 1.453   -42.344  -51.295  1.00 101.98 ? 199 SER E O     1 
ATOM 7141  C CB    . SER E 1 202 ? 2.009   -39.614  -49.505  1.00 88.14  ? 199 SER E CB    1 
ATOM 7142  O OG    . SER E 1 202 ? 1.377   -39.217  -50.709  1.00 98.73  ? 199 SER E OG    1 
ATOM 7143  N N     . VAL E 1 203 ? 3.600   -42.110  -50.641  1.00 100.36 ? 200 VAL E N     1 
ATOM 7144  C CA    . VAL E 1 203 ? 4.114   -42.874  -51.771  1.00 85.27  ? 200 VAL E CA    1 
ATOM 7145  C C     . VAL E 1 203 ? 3.652   -44.324  -51.682  1.00 87.13  ? 200 VAL E C     1 
ATOM 7146  O O     . VAL E 1 203 ? 3.214   -44.913  -52.676  1.00 88.85  ? 200 VAL E O     1 
ATOM 7147  C CB    . VAL E 1 203 ? 5.648   -42.763  -51.836  1.00 77.72  ? 200 VAL E CB    1 
ATOM 7148  C CG1   . VAL E 1 203 ? 6.185   -43.574  -52.994  1.00 84.12  ? 200 VAL E CG1   1 
ATOM 7149  C CG2   . VAL E 1 203 ? 6.068   -41.302  -51.969  1.00 71.19  ? 200 VAL E CG2   1 
ATOM 7150  N N     . GLU E 1 204 ? 3.769   -44.926  -50.495  1.00 87.98  ? 201 GLU E N     1 
ATOM 7151  C CA    . GLU E 1 204 ? 3.300   -46.297  -50.300  1.00 85.66  ? 201 GLU E CA    1 
ATOM 7152  C C     . GLU E 1 204 ? 1.814   -46.430  -50.613  1.00 87.65  ? 201 GLU E C     1 
ATOM 7153  O O     . GLU E 1 204 ? 1.385   -47.421  -51.216  1.00 90.17  ? 201 GLU E O     1 
ATOM 7154  C CB    . GLU E 1 204 ? 3.589   -46.752  -48.867  1.00 84.95  ? 201 GLU E CB    1 
ATOM 7155  C CG    . GLU E 1 204 ? 2.972   -48.092  -48.498  1.00 92.56  ? 201 GLU E CG    1 
ATOM 7156  C CD    . GLU E 1 204 ? 3.500   -49.232  -49.346  1.00 91.21  ? 201 GLU E CD    1 
ATOM 7157  O OE1   . GLU E 1 204 ? 4.707   -49.226  -49.666  1.00 87.94  ? 201 GLU E OE1   1 
ATOM 7158  O OE2   . GLU E 1 204 ? 2.711   -50.144  -49.677  1.00 94.84  ? 201 GLU E OE2   1 
ATOM 7159  N N     . GLU E 1 205 ? 1.019   -45.424  -50.243  1.00 91.97  ? 202 GLU E N     1 
ATOM 7160  C CA    . GLU E 1 205 ? -0.418  -45.473  -50.494  1.00 96.87  ? 202 GLU E CA    1 
ATOM 7161  C C     . GLU E 1 205 ? -0.716  -45.417  -51.987  1.00 87.97  ? 202 GLU E C     1 
ATOM 7162  O O     . GLU E 1 205 ? -1.459  -46.256  -52.517  1.00 87.73  ? 202 GLU E O     1 
ATOM 7163  C CB    . GLU E 1 205 ? -1.106  -44.318  -49.762  1.00 101.22 ? 202 GLU E CB    1 
ATOM 7164  C CG    . GLU E 1 205 ? -2.610  -44.225  -49.970  1.00 100.22 ? 202 GLU E CG    1 
ATOM 7165  C CD    . GLU E 1 205 ? -3.207  -43.025  -49.263  1.00 101.45 ? 202 GLU E CD    1 
ATOM 7166  O OE1   . GLU E 1 205 ? -2.658  -41.913  -49.417  1.00 95.79  ? 202 GLU E OE1   1 
ATOM 7167  O OE2   . GLU E 1 205 ? -4.220  -43.188  -48.551  1.00 116.53 ? 202 GLU E OE2   1 
ATOM 7168  N N     . ALA E 1 206 ? -0.151  -44.428  -52.682  1.00 86.10  ? 203 ALA E N     1 
ATOM 7169  C CA    . ALA E 1 206 ? -0.356  -44.344  -54.125  1.00 85.50  ? 203 ALA E CA    1 
ATOM 7170  C C     . ALA E 1 206 ? 0.147   -45.591  -54.846  1.00 87.17  ? 203 ALA E C     1 
ATOM 7171  O O     . ALA E 1 206 ? -0.478  -46.048  -55.816  1.00 95.18  ? 203 ALA E O     1 
ATOM 7172  C CB    . ALA E 1 206 ? 0.328   -43.096  -54.677  1.00 82.95  ? 203 ALA E CB    1 
ATOM 7173  N N     . ARG E 1 207 ? 1.229   -46.199  -54.352  1.00 79.45  ? 204 ARG E N     1 
ATOM 7174  C CA    . ARG E 1 207 ? 1.774   -47.366  -55.034  1.00 83.48  ? 204 ARG E CA    1 
ATOM 7175  C C     . ARG E 1 207 ? 0.884   -48.577  -54.809  1.00 88.32  ? 204 ARG E C     1 
ATOM 7176  O O     . ARG E 1 207 ? 0.688   -49.389  -55.722  1.00 90.69  ? 204 ARG E O     1 
ATOM 7177  C CB    . ARG E 1 207 ? 3.193   -47.650  -54.548  1.00 83.24  ? 204 ARG E CB    1 
ATOM 7178  C CG    . ARG E 1 207 ? 3.894   -48.773  -55.295  1.00 89.44  ? 204 ARG E CG    1 
ATOM 7179  C CD    . ARG E 1 207 ? 5.245   -49.058  -54.677  1.00 79.93  ? 204 ARG E CD    1 
ATOM 7180  N NE    . ARG E 1 207 ? 5.956   -47.851  -54.266  1.00 73.38  ? 204 ARG E NE    1 
ATOM 7181  C CZ    . ARG E 1 207 ? 6.638   -47.753  -53.129  1.00 73.14  ? 204 ARG E CZ    1 
ATOM 7182  N NH1   . ARG E 1 207 ? 6.681   -48.783  -52.296  1.00 78.46  ? 204 ARG E NH1   1 
ATOM 7183  N NH2   . ARG E 1 207 ? 7.264   -46.629  -52.816  1.00 74.31  ? 204 ARG E NH2   1 
ATOM 7184  N N     . TYR E 1 208 ? 0.362   -48.735  -53.591  1.00 88.63  ? 205 TYR E N     1 
ATOM 7185  C CA    . TYR E 1 208 ? -0.627  -49.778  -53.356  1.00 89.83  ? 205 TYR E CA    1 
ATOM 7186  C C     . TYR E 1 208 ? -1.835  -49.574  -54.261  1.00 94.94  ? 205 TYR E C     1 
ATOM 7187  O O     . TYR E 1 208 ? -2.407  -50.542  -54.777  1.00 89.11  ? 205 TYR E O     1 
ATOM 7188  C CB    . TYR E 1 208 ? -1.046  -49.803  -51.886  1.00 82.17  ? 205 TYR E CB    1 
ATOM 7189  C CG    . TYR E 1 208 ? -2.040  -50.898  -51.580  1.00 87.59  ? 205 TYR E CG    1 
ATOM 7190  C CD1   . TYR E 1 208 ? -1.622  -52.210  -51.397  1.00 85.95  ? 205 TYR E CD1   1 
ATOM 7191  C CD2   . TYR E 1 208 ? -3.399  -50.625  -51.487  1.00 88.41  ? 205 TYR E CD2   1 
ATOM 7192  C CE1   . TYR E 1 208 ? -2.528  -53.219  -51.126  1.00 83.53  ? 205 TYR E CE1   1 
ATOM 7193  C CE2   . TYR E 1 208 ? -4.313  -51.629  -51.216  1.00 86.72  ? 205 TYR E CE2   1 
ATOM 7194  C CZ    . TYR E 1 208 ? -3.871  -52.923  -51.036  1.00 80.81  ? 205 TYR E CZ    1 
ATOM 7195  O OH    . TYR E 1 208 ? -4.775  -53.926  -50.765  1.00 84.52  ? 205 TYR E OH    1 
ATOM 7196  N N     . ASN E 1 209 ? -2.227  -48.314  -54.479  1.00 95.69  ? 206 ASN E N     1 
ATOM 7197  C CA    . ASN E 1 209 ? -3.322  -48.025  -55.398  1.00 97.48  ? 206 ASN E CA    1 
ATOM 7198  C C     . ASN E 1 209 ? -2.929  -48.216  -56.855  1.00 98.20  ? 206 ASN E C     1 
ATOM 7199  O O     . ASN E 1 209 ? -3.799  -48.145  -57.728  1.00 103.64 ? 206 ASN E O     1 
ATOM 7200  C CB    . ASN E 1 209 ? -3.825  -46.595  -55.203  1.00 95.91  ? 206 ASN E CB    1 
ATOM 7201  C CG    . ASN E 1 209 ? -4.206  -46.304  -53.772  1.00 97.71  ? 206 ASN E CG    1 
ATOM 7202  O OD1   . ASN E 1 209 ? -4.820  -47.134  -53.102  1.00 94.06  ? 206 ASN E OD1   1 
ATOM 7203  N ND2   . ASN E 1 209 ? -3.842  -45.121  -53.290  1.00 104.24 ? 206 ASN E ND2   1 
ATOM 7204  N N     . SER E 1 210 ? -1.649  -48.450  -57.140  1.00 97.90  ? 207 SER E N     1 
ATOM 7205  C CA    . SER E 1 210 ? -1.218  -48.665  -58.516  1.00 94.40  ? 207 SER E CA    1 
ATOM 7206  C C     . SER E 1 210 ? -1.348  -50.117  -58.969  1.00 91.15  ? 207 SER E C     1 
ATOM 7207  O O     . SER E 1 210 ? -1.177  -50.390  -60.162  1.00 94.88  ? 207 SER E O     1 
ATOM 7208  C CB    . SER E 1 210 ? 0.233   -48.205  -58.686  1.00 94.68  ? 207 SER E CB    1 
ATOM 7209  O OG    . SER E 1 210 ? 0.614   -48.209  -60.052  1.00 109.75 ? 207 SER E OG    1 
ATOM 7210  N N     . CYS E 1 211 ? -1.650  -51.046  -58.066  1.00 86.44  ? 208 CYS E N     1 
ATOM 7211  C CA    . CYS E 1 211 ? -1.671  -52.463  -58.424  1.00 83.10  ? 208 CYS E CA    1 
ATOM 7212  C C     . CYS E 1 211 ? -3.058  -52.924  -58.865  1.00 90.98  ? 208 CYS E C     1 
ATOM 7213  O O     . CYS E 1 211 ? -3.936  -52.116  -59.155  1.00 97.80  ? 208 CYS E O     1 
ATOM 7214  C CB    . CYS E 1 211 ? -1.199  -53.320  -57.248  1.00 82.35  ? 208 CYS E CB    1 
ATOM 7215  S SG    . CYS E 1 211 ? 0.405   -52.855  -56.553  1.00 99.37  ? 208 CYS E SG    1 
ATOM 7216  N N     . CYS F 1 28  ? 5.274   -56.463  -66.927  1.00 91.90  ? 25  CYS F N     1 
ATOM 7217  C CA    . CYS F 1 28  ? 6.359   -56.845  -66.028  1.00 91.65  ? 25  CYS F CA    1 
ATOM 7218  C C     . CYS F 1 28  ? 7.216   -55.635  -65.649  1.00 89.29  ? 25  CYS F C     1 
ATOM 7219  O O     . CYS F 1 28  ? 6.735   -54.501  -65.653  1.00 84.06  ? 25  CYS F O     1 
ATOM 7220  C CB    . CYS F 1 28  ? 7.220   -57.938  -66.667  1.00 87.21  ? 25  CYS F CB    1 
ATOM 7221  S SG    . CYS F 1 28  ? 8.065   -57.473  -68.198  1.00 95.93  ? 25  CYS F SG    1 
ATOM 7222  N N     . PHE F 1 29  ? 8.481   -55.879  -65.308  1.00 76.39  ? 26  PHE F N     1 
ATOM 7223  C CA    . PHE F 1 29  ? 9.382   -54.796  -64.940  1.00 67.68  ? 26  PHE F CA    1 
ATOM 7224  C C     . PHE F 1 29  ? 9.878   -54.083  -66.189  1.00 66.53  ? 26  PHE F C     1 
ATOM 7225  O O     . PHE F 1 29  ? 10.140  -54.710  -67.218  1.00 67.63  ? 26  PHE F O     1 
ATOM 7226  C CB    . PHE F 1 29  ? 10.567  -55.321  -64.130  1.00 62.33  ? 26  PHE F CB    1 
ATOM 7227  C CG    . PHE F 1 29  ? 11.324  -54.246  -63.408  1.00 61.18  ? 26  PHE F CG    1 
ATOM 7228  C CD1   . PHE F 1 29  ? 10.902  -53.797  -62.170  1.00 63.08  ? 26  PHE F CD1   1 
ATOM 7229  C CD2   . PHE F 1 29  ? 12.451  -53.674  -63.973  1.00 61.43  ? 26  PHE F CD2   1 
ATOM 7230  C CE1   . PHE F 1 29  ? 11.593  -52.801  -61.506  1.00 62.62  ? 26  PHE F CE1   1 
ATOM 7231  C CE2   . PHE F 1 29  ? 13.144  -52.676  -63.313  1.00 62.82  ? 26  PHE F CE2   1 
ATOM 7232  C CZ    . PHE F 1 29  ? 12.714  -52.240  -62.079  1.00 55.71  ? 26  PHE F CZ    1 
ATOM 7233  N N     . GLY F 1 30  ? 9.996   -52.760  -66.097  1.00 63.89  ? 27  GLY F N     1 
ATOM 7234  C CA    . GLY F 1 30  ? 10.301  -51.950  -67.254  1.00 68.89  ? 27  GLY F CA    1 
ATOM 7235  C C     . GLY F 1 30  ? 9.109   -51.633  -68.129  1.00 77.72  ? 27  GLY F C     1 
ATOM 7236  O O     . GLY F 1 30  ? 9.240   -50.823  -69.056  1.00 75.36  ? 27  GLY F O     1 
ATOM 7237  N N     . GLN F 1 31  ? 7.954   -52.247  -67.871  1.00 78.59  ? 28  GLN F N     1 
ATOM 7238  C CA    . GLN F 1 31  ? 6.736   -51.995  -68.630  1.00 75.11  ? 28  GLN F CA    1 
ATOM 7239  C C     . GLN F 1 31  ? 5.681   -51.221  -67.852  1.00 81.38  ? 28  GLN F C     1 
ATOM 7240  O O     . GLN F 1 31  ? 4.920   -50.464  -68.460  1.00 96.38  ? 28  GLN F O     1 
ATOM 7241  C CB    . GLN F 1 31  ? 6.130   -53.320  -69.113  1.00 81.97  ? 28  GLN F CB    1 
ATOM 7242  C CG    . GLN F 1 31  ? 7.157   -54.304  -69.657  1.00 88.12  ? 28  GLN F CG    1 
ATOM 7243  C CD    . GLN F 1 31  ? 7.411   -54.136  -71.146  1.00 90.89  ? 28  GLN F CD    1 
ATOM 7244  O OE1   . GLN F 1 31  ? 7.311   -53.034  -71.689  1.00 101.84 ? 28  GLN F OE1   1 
ATOM 7245  N NE2   . GLN F 1 31  ? 7.750   -55.235  -71.813  1.00 86.28  ? 28  GLN F NE2   1 
ATOM 7246  N N     . CYS F 1 32  ? 5.615   -51.392  -66.530  1.00 85.82  ? 29  CYS F N     1 
ATOM 7247  C CA    . CYS F 1 32  ? 4.610   -50.702  -65.729  1.00 81.68  ? 29  CYS F CA    1 
ATOM 7248  C C     . CYS F 1 32  ? 4.763   -49.197  -65.897  1.00 76.07  ? 29  CYS F C     1 
ATOM 7249  O O     . CYS F 1 32  ? 5.875   -48.670  -65.854  1.00 71.31  ? 29  CYS F O     1 
ATOM 7250  C CB    . CYS F 1 32  ? 4.753   -51.091  -64.257  1.00 70.94  ? 29  CYS F CB    1 
ATOM 7251  S SG    . CYS F 1 32  ? 4.438   -52.838  -63.907  1.00 115.26 ? 29  CYS F SG    1 
ATOM 7252  N N     . GLN F 1 33  ? 3.649   -48.505  -66.106  1.00 79.99  ? 30  GLN F N     1 
ATOM 7253  C CA    . GLN F 1 33  ? 3.658   -47.053  -66.200  1.00 81.04  ? 30  GLN F CA    1 
ATOM 7254  C C     . GLN F 1 33  ? 3.168   -46.434  -64.897  1.00 85.60  ? 30  GLN F C     1 
ATOM 7255  O O     . GLN F 1 33  ? 2.168   -46.874  -64.323  1.00 94.02  ? 30  GLN F O     1 
ATOM 7256  C CB    . GLN F 1 33  ? 2.795   -46.576  -67.369  1.00 76.26  ? 30  GLN F CB    1 
ATOM 7257  C CG    . GLN F 1 33  ? 3.142   -45.177  -67.845  1.00 85.35  ? 30  GLN F CG    1 
ATOM 7258  C CD    . GLN F 1 33  ? 2.411   -44.786  -69.113  1.00 91.36  ? 30  GLN F CD    1 
ATOM 7259  O OE1   . GLN F 1 33  ? 1.953   -45.644  -69.869  1.00 102.17 ? 30  GLN F OE1   1 
ATOM 7260  N NE2   . GLN F 1 33  ? 2.299   -43.483  -69.352  1.00 84.74  ? 30  GLN F NE2   1 
ATOM 7261  N N     . TYR F 1 34  ? 3.877   -45.403  -64.442  1.00 76.14  ? 31  TYR F N     1 
ATOM 7262  C CA    . TYR F 1 34  ? 3.549   -44.764  -63.175  1.00 80.07  ? 31  TYR F CA    1 
ATOM 7263  C C     . TYR F 1 34  ? 2.179   -44.105  -63.253  1.00 86.37  ? 31  TYR F C     1 
ATOM 7264  O O     . TYR F 1 34  ? 1.877   -43.382  -64.208  1.00 89.65  ? 31  TYR F O     1 
ATOM 7265  C CB    . TYR F 1 34  ? 4.607   -43.720  -62.812  1.00 73.30  ? 31  TYR F CB    1 
ATOM 7266  C CG    . TYR F 1 34  ? 5.801   -44.269  -62.066  1.00 68.46  ? 31  TYR F CG    1 
ATOM 7267  C CD1   . TYR F 1 34  ? 5.677   -44.743  -60.766  1.00 78.06  ? 31  TYR F CD1   1 
ATOM 7268  C CD2   . TYR F 1 34  ? 7.053   -44.311  -62.661  1.00 62.83  ? 31  TYR F CD2   1 
ATOM 7269  C CE1   . TYR F 1 34  ? 6.769   -45.245  -60.082  1.00 81.70  ? 31  TYR F CE1   1 
ATOM 7270  C CE2   . TYR F 1 34  ? 8.150   -44.810  -61.985  1.00 68.00  ? 31  TYR F CE2   1 
ATOM 7271  C CZ    . TYR F 1 34  ? 8.002   -45.276  -60.698  1.00 78.54  ? 31  TYR F CZ    1 
ATOM 7272  O OH    . TYR F 1 34  ? 9.094   -45.774  -60.026  1.00 82.19  ? 31  TYR F OH    1 
ATOM 7273  N N     . THR F 1 35  ? 1.346   -44.368  -62.251  1.00 92.13  ? 32  THR F N     1 
ATOM 7274  C CA    . THR F 1 35  ? 0.071   -43.685  -62.128  1.00 82.37  ? 32  THR F CA    1 
ATOM 7275  C C     . THR F 1 35  ? 0.286   -42.262  -61.624  1.00 77.25  ? 32  THR F C     1 
ATOM 7276  O O     . THR F 1 35  ? 1.311   -41.939  -61.018  1.00 78.77  ? 32  THR F O     1 
ATOM 7277  C CB    . THR F 1 35  ? -0.866  -44.444  -61.189  1.00 79.78  ? 32  THR F CB    1 
ATOM 7278  O OG1   . THR F 1 35  ? -0.199  -44.703  -59.947  1.00 91.29  ? 32  THR F OG1   1 
ATOM 7279  C CG2   . THR F 1 35  ? -1.294  -45.761  -61.817  1.00 74.94  ? 32  THR F CG2   1 
ATOM 7280  N N     . ALA F 1 36  ? -0.698  -41.403  -61.904  1.00 77.94  ? 33  ALA F N     1 
ATOM 7281  C CA    . ALA F 1 36  ? -0.585  -39.989  -61.554  1.00 85.71  ? 33  ALA F CA    1 
ATOM 7282  C C     . ALA F 1 36  ? -0.311  -39.792  -60.067  1.00 83.76  ? 33  ALA F C     1 
ATOM 7283  O O     . ALA F 1 36  ? 0.564   -39.003  -59.689  1.00 69.03  ? 33  ALA F O     1 
ATOM 7284  C CB    . ALA F 1 36  ? -1.859  -39.251  -61.963  1.00 83.58  ? 33  ALA F CB    1 
ATOM 7285  N N     . GLU F 1 37  ? -1.033  -40.517  -59.209  1.00 83.69  ? 34  GLU F N     1 
ATOM 7286  C CA    . GLU F 1 37  ? -0.855  -40.350  -57.770  1.00 85.68  ? 34  GLU F CA    1 
ATOM 7287  C C     . GLU F 1 37  ? 0.551   -40.750  -57.349  1.00 83.06  ? 34  GLU F C     1 
ATOM 7288  O O     . GLU F 1 37  ? 1.224   -40.014  -56.617  1.00 76.35  ? 34  GLU F O     1 
ATOM 7289  C CB    . GLU F 1 37  ? -1.893  -41.169  -56.999  1.00 96.94  ? 34  GLU F CB    1 
ATOM 7290  C CG    . GLU F 1 37  ? -3.323  -41.081  -57.519  1.00 98.88  ? 34  GLU F CG    1 
ATOM 7291  C CD    . GLU F 1 37  ? -3.674  -42.238  -58.434  1.00 98.84  ? 34  GLU F CD    1 
ATOM 7292  O OE1   . GLU F 1 37  ? -3.284  -43.383  -58.118  1.00 99.18  ? 34  GLU F OE1   1 
ATOM 7293  O OE2   . GLU F 1 37  ? -4.349  -42.008  -59.459  1.00 87.43  ? 34  GLU F OE2   1 
ATOM 7294  N N     . GLU F 1 38  ? 1.019   -41.911  -57.819  1.00 84.30  ? 35  GLU F N     1 
ATOM 7295  C CA    . GLU F 1 38  ? 2.345   -42.382  -57.432  1.00 80.43  ? 35  GLU F CA    1 
ATOM 7296  C C     . GLU F 1 38  ? 3.436   -41.510  -58.033  1.00 72.82  ? 35  GLU F C     1 
ATOM 7297  O O     . GLU F 1 38  ? 4.434   -41.210  -57.364  1.00 64.15  ? 35  GLU F O     1 
ATOM 7298  C CB    . GLU F 1 38  ? 2.535   -43.843  -57.840  1.00 77.49  ? 35  GLU F CB    1 
ATOM 7299  C CG    . GLU F 1 38  ? 3.865   -44.423  -57.383  1.00 80.49  ? 35  GLU F CG    1 
ATOM 7300  C CD    . GLU F 1 38  ? 4.022   -45.896  -57.714  1.00 89.49  ? 35  GLU F CD    1 
ATOM 7301  O OE1   . GLU F 1 38  ? 4.992   -46.511  -57.219  1.00 78.16  ? 35  GLU F OE1   1 
ATOM 7302  O OE2   . GLU F 1 38  ? 3.183   -46.436  -58.467  1.00 91.09  ? 35  GLU F OE2   1 
ATOM 7303  N N     . TYR F 1 39  ? 3.265   -41.088  -59.290  1.00 69.03  ? 36  TYR F N     1 
ATOM 7304  C CA    . TYR F 1 39  ? 4.224   -40.160  -59.875  1.00 71.77  ? 36  TYR F CA    1 
ATOM 7305  C C     . TYR F 1 39  ? 4.355   -38.904  -59.027  1.00 79.74  ? 36  TYR F C     1 
ATOM 7306  O O     . TYR F 1 39  ? 5.467   -38.479  -58.704  1.00 81.18  ? 36  TYR F O     1 
ATOM 7307  C CB    . TYR F 1 39  ? 3.832   -39.767  -61.299  1.00 70.62  ? 36  TYR F CB    1 
ATOM 7308  C CG    . TYR F 1 39  ? 4.427   -38.417  -61.638  1.00 65.25  ? 36  TYR F CG    1 
ATOM 7309  C CD1   . TYR F 1 39  ? 5.791   -38.273  -61.858  1.00 65.96  ? 36  TYR F CD1   1 
ATOM 7310  C CD2   . TYR F 1 39  ? 3.634   -37.275  -61.677  1.00 76.26  ? 36  TYR F CD2   1 
ATOM 7311  C CE1   . TYR F 1 39  ? 6.344   -37.036  -62.128  1.00 70.80  ? 36  TYR F CE1   1 
ATOM 7312  C CE2   . TYR F 1 39  ? 4.177   -36.036  -61.947  1.00 81.68  ? 36  TYR F CE2   1 
ATOM 7313  C CZ    . TYR F 1 39  ? 5.532   -35.923  -62.174  1.00 82.00  ? 36  TYR F CZ    1 
ATOM 7314  O OH    . TYR F 1 39  ? 6.077   -34.689  -62.441  1.00 84.45  ? 36  TYR F OH    1 
ATOM 7315  N N     . GLN F 1 40  ? 3.226   -38.281  -58.679  1.00 81.62  ? 37  GLN F N     1 
ATOM 7316  C CA    . GLN F 1 40  ? 3.292   -37.018  -57.952  1.00 82.47  ? 37  GLN F CA    1 
ATOM 7317  C C     . GLN F 1 40  ? 3.862   -37.218  -56.554  1.00 80.94  ? 37  GLN F C     1 
ATOM 7318  O O     . GLN F 1 40  ? 4.671   -36.407  -56.086  1.00 76.81  ? 37  GLN F O     1 
ATOM 7319  C CB    . GLN F 1 40  ? 1.914   -36.361  -57.905  1.00 86.95  ? 37  GLN F CB    1 
ATOM 7320  C CG    . GLN F 1 40  ? 1.932   -34.953  -57.335  1.00 86.27  ? 37  GLN F CG    1 
ATOM 7321  C CD    . GLN F 1 40  ? 0.546   -34.363  -57.184  1.00 87.30  ? 37  GLN F CD    1 
ATOM 7322  O OE1   . GLN F 1 40  ? -0.333  -34.956  -56.559  1.00 88.44  ? 37  GLN F OE1   1 
ATOM 7323  N NE2   . GLN F 1 40  ? 0.340   -33.189  -57.770  1.00 86.06  ? 37  GLN F NE2   1 
ATOM 7324  N N     . ALA F 1 41  ? 3.443   -38.287  -55.870  1.00 70.42  ? 38  ALA F N     1 
ATOM 7325  C CA    . ALA F 1 41  ? 3.995   -38.605  -54.558  1.00 79.74  ? 38  ALA F CA    1 
ATOM 7326  C C     . ALA F 1 41  ? 5.514   -38.737  -54.613  1.00 80.80  ? 38  ALA F C     1 
ATOM 7327  O O     . ALA F 1 41  ? 6.229   -38.149  -53.794  1.00 72.33  ? 38  ALA F O     1 
ATOM 7328  C CB    . ALA F 1 41  ? 3.360   -39.890  -54.025  1.00 81.72  ? 38  ALA F CB    1 
ATOM 7329  N N     . ILE F 1 42  ? 6.024   -39.506  -55.581  1.00 77.77  ? 39  ILE F N     1 
ATOM 7330  C CA    . ILE F 1 42  ? 7.465   -39.736  -55.663  1.00 67.25  ? 39  ILE F CA    1 
ATOM 7331  C C     . ILE F 1 42  ? 8.189   -38.455  -56.062  1.00 68.45  ? 39  ILE F C     1 
ATOM 7332  O O     . ILE F 1 42  ? 9.262   -38.139  -55.533  1.00 65.99  ? 39  ILE F O     1 
ATOM 7333  C CB    . ILE F 1 42  ? 7.766   -40.887  -56.641  1.00 58.88  ? 39  ILE F CB    1 
ATOM 7334  C CG1   . ILE F 1 42  ? 7.363   -42.229  -56.029  1.00 55.23  ? 39  ILE F CG1   1 
ATOM 7335  C CG2   . ILE F 1 42  ? 9.238   -40.913  -56.999  1.00 64.69  ? 39  ILE F CG2   1 
ATOM 7336  C CD1   . ILE F 1 42  ? 7.456   -43.396  -56.991  1.00 69.65  ? 39  ILE F CD1   1 
ATOM 7337  N N     . GLN F 1 43  ? 7.630   -37.714  -57.020  1.00 68.50  ? 40  GLN F N     1 
ATOM 7338  C CA    . GLN F 1 43  ? 8.225   -36.456  -57.452  1.00 69.81  ? 40  GLN F CA    1 
ATOM 7339  C C     . GLN F 1 43  ? 8.360   -35.487  -56.285  1.00 80.57  ? 40  GLN F C     1 
ATOM 7340  O O     . GLN F 1 43  ? 9.384   -34.807  -56.146  1.00 77.05  ? 40  GLN F O     1 
ATOM 7341  C CB    . GLN F 1 43  ? 7.370   -35.852  -58.569  1.00 68.48  ? 40  GLN F CB    1 
ATOM 7342  C CG    . GLN F 1 43  ? 7.781   -34.471  -59.061  1.00 86.29  ? 40  GLN F CG    1 
ATOM 7343  C CD    . GLN F 1 43  ? 9.022   -34.492  -59.939  1.00 81.70  ? 40  GLN F CD    1 
ATOM 7344  O OE1   . GLN F 1 43  ? 9.781   -35.462  -59.952  1.00 70.27  ? 40  GLN F OE1   1 
ATOM 7345  N NE2   . GLN F 1 43  ? 9.222   -33.418  -60.694  1.00 83.27  ? 40  GLN F NE2   1 
ATOM 7346  N N     . LYS F 1 44  ? 7.329   -35.402  -55.440  1.00 84.70  ? 41  LYS F N     1 
ATOM 7347  C CA    . LYS F 1 44  ? 7.401   -34.553  -54.254  1.00 78.47  ? 41  LYS F CA    1 
ATOM 7348  C C     . LYS F 1 44  ? 8.421   -35.088  -53.255  1.00 75.12  ? 41  LYS F C     1 
ATOM 7349  O O     . LYS F 1 44  ? 9.247   -34.331  -52.730  1.00 73.24  ? 41  LYS F O     1 
ATOM 7350  C CB    . LYS F 1 44  ? 6.020   -34.446  -53.609  1.00 81.86  ? 41  LYS F CB    1 
ATOM 7351  C CG    . LYS F 1 44  ? 5.038   -33.584  -54.389  1.00 89.80  ? 41  LYS F CG    1 
ATOM 7352  C CD    . LYS F 1 44  ? 3.722   -33.449  -53.646  1.00 86.71  ? 41  LYS F CD    1 
ATOM 7353  C CE    . LYS F 1 44  ? 2.666   -32.757  -54.488  1.00 87.16  ? 41  LYS F CE    1 
ATOM 7354  N NZ    . LYS F 1 44  ? 2.952   -31.308  -54.660  1.00 71.87  ? 41  LYS F NZ    1 
ATOM 7355  N N     . ALA F 1 45  ? 8.370   -36.394  -52.974  1.00 71.25  ? 42  ALA F N     1 
ATOM 7356  C CA    . ALA F 1 45  ? 9.231   -36.983  -51.954  1.00 70.08  ? 42  ALA F CA    1 
ATOM 7357  C C     . ALA F 1 45  ? 10.707  -36.866  -52.306  1.00 69.06  ? 42  ALA F C     1 
ATOM 7358  O O     . ALA F 1 45  ? 11.540  -36.700  -51.409  1.00 77.88  ? 42  ALA F O     1 
ATOM 7359  C CB    . ALA F 1 45  ? 8.853   -38.448  -51.735  1.00 70.43  ? 42  ALA F CB    1 
ATOM 7360  N N     . LEU F 1 46  ? 11.054  -36.953  -53.593  1.00 77.81  ? 43  LEU F N     1 
ATOM 7361  C CA    . LEU F 1 46  ? 12.457  -36.880  -53.988  1.00 76.12  ? 43  LEU F CA    1 
ATOM 7362  C C     . LEU F 1 46  ? 13.042  -35.490  -53.784  1.00 78.08  ? 43  LEU F C     1 
ATOM 7363  O O     . LEU F 1 46  ? 14.269  -35.347  -53.749  1.00 75.66  ? 43  LEU F O     1 
ATOM 7364  C CB    . LEU F 1 46  ? 12.619  -37.322  -55.443  1.00 67.53  ? 43  LEU F CB    1 
ATOM 7365  C CG    . LEU F 1 46  ? 12.593  -38.842  -55.616  1.00 68.16  ? 43  LEU F CG    1 
ATOM 7366  C CD1   . LEU F 1 46  ? 12.544  -39.221  -57.078  1.00 65.75  ? 43  LEU F CD1   1 
ATOM 7367  C CD2   . LEU F 1 46  ? 13.793  -39.480  -54.931  1.00 68.92  ? 43  LEU F CD2   1 
ATOM 7368  N N     . ARG F 1 47  ? 12.192  -34.467  -53.661  1.00 80.20  ? 44  ARG F N     1 
ATOM 7369  C CA    . ARG F 1 47  ? 12.674  -33.116  -53.398  1.00 80.86  ? 44  ARG F CA    1 
ATOM 7370  C C     . ARG F 1 47  ? 13.198  -32.979  -51.973  1.00 78.32  ? 44  ARG F C     1 
ATOM 7371  O O     . ARG F 1 47  ? 14.048  -32.119  -51.711  1.00 72.69  ? 44  ARG F O     1 
ATOM 7372  C CB    . ARG F 1 47  ? 11.557  -32.105  -53.655  1.00 78.44  ? 44  ARG F CB    1 
ATOM 7373  C CG    . ARG F 1 47  ? 11.409  -31.703  -55.113  1.00 86.72  ? 44  ARG F CG    1 
ATOM 7374  C CD    . ARG F 1 47  ? 10.319  -30.661  -55.300  1.00 84.71  ? 44  ARG F CD    1 
ATOM 7375  N NE    . ARG F 1 47  ? 9.002   -31.283  -55.410  1.00 79.66  ? 44  ARG F NE    1 
ATOM 7376  C CZ    . ARG F 1 47  ? 8.323   -31.419  -56.546  1.00 82.20  ? 44  ARG F CZ    1 
ATOM 7377  N NH1   . ARG F 1 47  ? 8.829   -30.973  -57.689  1.00 93.26  ? 44  ARG F NH1   1 
ATOM 7378  N NH2   . ARG F 1 47  ? 7.131   -32.002  -56.536  1.00 81.30  ? 44  ARG F NH2   1 
ATOM 7379  N N     . GLN F 1 48  ? 12.683  -33.789  -51.043  1.00 69.89  ? 45  GLN F N     1 
ATOM 7380  C CA    . GLN F 1 48  ? 13.090  -33.711  -49.644  1.00 69.41  ? 45  GLN F CA    1 
ATOM 7381  C C     . GLN F 1 48  ? 14.600  -33.812  -49.503  1.00 72.06  ? 45  GLN F C     1 
ATOM 7382  O O     . GLN F 1 48  ? 15.232  -34.705  -50.073  1.00 79.26  ? 45  GLN F O     1 
ATOM 7383  C CB    . GLN F 1 48  ? 12.435  -34.833  -48.830  1.00 70.57  ? 45  GLN F CB    1 
ATOM 7384  C CG    . GLN F 1 48  ? 10.916  -34.819  -48.797  1.00 68.16  ? 45  GLN F CG    1 
ATOM 7385  C CD    . GLN F 1 48  ? 10.340  -36.054  -48.119  1.00 79.94  ? 45  GLN F CD    1 
ATOM 7386  O OE1   . GLN F 1 48  ? 9.948   -36.023  -46.950  1.00 91.53  ? 45  GLN F OE1   1 
ATOM 7387  N NE2   . GLN F 1 48  ? 10.286  -37.153  -48.860  1.00 74.21  ? 45  GLN F NE2   1 
ATOM 7388  N N     . ARG F 1 49  ? 15.173  -32.896  -48.732  1.00 69.38  ? 46  ARG F N     1 
ATOM 7389  C CA    . ARG F 1 49  ? 16.549  -33.075  -48.308  1.00 69.48  ? 46  ARG F CA    1 
ATOM 7390  C C     . ARG F 1 49  ? 16.605  -34.053  -47.137  1.00 76.41  ? 46  ARG F C     1 
ATOM 7391  O O     . ARG F 1 49  ? 15.615  -34.286  -46.438  1.00 75.47  ? 46  ARG F O     1 
ATOM 7392  C CB    . ARG F 1 49  ? 17.176  -31.733  -47.938  1.00 75.70  ? 46  ARG F CB    1 
ATOM 7393  C CG    . ARG F 1 49  ? 17.239  -30.762  -49.109  1.00 77.39  ? 46  ARG F CG    1 
ATOM 7394  C CD    . ARG F 1 49  ? 17.881  -29.445  -48.719  1.00 80.38  ? 46  ARG F CD    1 
ATOM 7395  N NE    . ARG F 1 49  ? 18.217  -28.633  -49.886  1.00 95.22  ? 46  ARG F NE    1 
ATOM 7396  C CZ    . ARG F 1 49  ? 17.393  -27.763  -50.462  1.00 102.29 ? 46  ARG F CZ    1 
ATOM 7397  N NH1   . ARG F 1 49  ? 16.170  -27.583  -49.983  1.00 101.95 ? 46  ARG F NH1   1 
ATOM 7398  N NH2   . ARG F 1 49  ? 17.795  -27.072  -51.522  1.00 82.28  ? 46  ARG F NH2   1 
ATOM 7399  N N     . LEU F 1 50  ? 17.784  -34.626  -46.926  1.00 76.69  ? 47  LEU F N     1 
ATOM 7400  C CA    . LEU F 1 50  ? 17.954  -35.680  -45.937  1.00 82.38  ? 47  LEU F CA    1 
ATOM 7401  C C     . LEU F 1 50  ? 18.350  -35.102  -44.584  1.00 80.09  ? 47  LEU F C     1 
ATOM 7402  O O     . LEU F 1 50  ? 19.147  -34.162  -44.505  1.00 77.39  ? 47  LEU F O     1 
ATOM 7403  C CB    . LEU F 1 50  ? 19.003  -36.682  -46.416  1.00 82.79  ? 47  LEU F CB    1 
ATOM 7404  C CG    . LEU F 1 50  ? 18.561  -37.495  -47.639  1.00 72.37  ? 47  LEU F CG    1 
ATOM 7405  C CD1   . LEU F 1 50  ? 19.662  -38.435  -48.089  1.00 67.41  ? 47  LEU F CD1   1 
ATOM 7406  C CD2   . LEU F 1 50  ? 17.247  -38.241  -47.420  1.00 60.53  ? 47  LEU F CD2   1 
ATOM 7407  N N     . GLY F 1 51  ? 17.778  -35.663  -43.520  1.00 83.14  ? 48  GLY F N     1 
ATOM 7408  C CA    . GLY F 1 51  ? 18.145  -35.299  -42.172  1.00 88.72  ? 48  GLY F CA    1 
ATOM 7409  C C     . GLY F 1 51  ? 19.519  -35.798  -41.764  1.00 94.37  ? 48  GLY F C     1 
ATOM 7410  O O     . GLY F 1 51  ? 20.171  -36.564  -42.481  1.00 94.22  ? 48  GLY F O     1 
ATOM 7411  N N     . PRO F 1 52  ? 19.986  -35.365  -40.588  1.00 93.03  ? 49  PRO F N     1 
ATOM 7412  C CA    . PRO F 1 52  ? 21.325  -35.772  -40.124  1.00 91.50  ? 49  PRO F CA    1 
ATOM 7413  C C     . PRO F 1 52  ? 21.448  -37.255  -39.797  1.00 87.43  ? 49  PRO F C     1 
ATOM 7414  O O     . PRO F 1 52  ? 22.579  -37.740  -39.652  1.00 85.43  ? 49  PRO F O     1 
ATOM 7415  C CB    . PRO F 1 52  ? 21.547  -34.911  -38.870  1.00 93.26  ? 49  PRO F CB    1 
ATOM 7416  C CG    . PRO F 1 52  ? 20.497  -33.840  -38.918  1.00 100.33 ? 49  PRO F CG    1 
ATOM 7417  C CD    . PRO F 1 52  ? 19.344  -34.397  -39.683  1.00 92.17  ? 49  PRO F CD    1 
ATOM 7418  N N     . GLU F 1 53  ? 20.335  -37.988  -39.688  1.00 80.90  ? 50  GLU F N     1 
ATOM 7419  C CA    . GLU F 1 53  ? 20.403  -39.414  -39.378  1.00 84.60  ? 50  GLU F CA    1 
ATOM 7420  C C     . GLU F 1 53  ? 21.115  -40.200  -40.469  1.00 89.32  ? 50  GLU F C     1 
ATOM 7421  O O     . GLU F 1 53  ? 21.679  -41.268  -40.199  1.00 86.70  ? 50  GLU F O     1 
ATOM 7422  C CB    . GLU F 1 53  ? 18.997  -39.978  -39.167  1.00 86.25  ? 50  GLU F CB    1 
ATOM 7423  C CG    . GLU F 1 53  ? 18.210  -39.300  -38.063  1.00 105.29 ? 50  GLU F CG    1 
ATOM 7424  C CD    . GLU F 1 53  ? 17.437  -38.089  -38.546  1.00 99.31  ? 50  GLU F CD    1 
ATOM 7425  O OE1   . GLU F 1 53  ? 17.907  -37.409  -39.484  1.00 91.32  ? 50  GLU F OE1   1 
ATOM 7426  O OE2   . GLU F 1 53  ? 16.366  -37.804  -37.970  1.00 102.27 ? 50  GLU F OE2   1 
ATOM 7427  N N     . TYR F 1 54  ? 21.091  -39.697  -41.702  1.00 90.12  ? 51  TYR F N     1 
ATOM 7428  C CA    . TYR F 1 54  ? 21.632  -40.406  -42.855  1.00 83.47  ? 51  TYR F CA    1 
ATOM 7429  C C     . TYR F 1 54  ? 23.111  -40.129  -43.086  1.00 82.56  ? 51  TYR F C     1 
ATOM 7430  O O     . TYR F 1 54  ? 23.828  -41.009  -43.578  1.00 83.33  ? 51  TYR F O     1 
ATOM 7431  C CB    . TYR F 1 54  ? 20.843  -40.019  -44.108  1.00 75.83  ? 51  TYR F CB    1 
ATOM 7432  C CG    . TYR F 1 54  ? 19.412  -40.497  -44.088  1.00 69.45  ? 51  TYR F CG    1 
ATOM 7433  C CD1   . TYR F 1 54  ? 19.092  -41.788  -43.692  1.00 73.94  ? 51  TYR F CD1   1 
ATOM 7434  C CD2   . TYR F 1 54  ? 18.375  -39.641  -44.429  1.00 72.60  ? 51  TYR F CD2   1 
ATOM 7435  C CE1   . TYR F 1 54  ? 17.780  -42.220  -43.666  1.00 75.15  ? 51  TYR F CE1   1 
ATOM 7436  C CE2   . TYR F 1 54  ? 17.061  -40.062  -44.403  1.00 74.80  ? 51  TYR F CE2   1 
ATOM 7437  C CZ    . TYR F 1 54  ? 16.768  -41.350  -44.023  1.00 71.83  ? 51  TYR F CZ    1 
ATOM 7438  O OH    . TYR F 1 54  ? 15.455  -41.760  -44.001  1.00 72.41  ? 51  TYR F OH    1 
ATOM 7439  N N     . ILE F 1 55  ? 23.582  -38.934  -42.751  1.00 74.14  ? 52  ILE F N     1 
ATOM 7440  C CA    . ILE F 1 55  ? 24.920  -38.504  -43.137  1.00 72.46  ? 52  ILE F CA    1 
ATOM 7441  C C     . ILE F 1 55  ? 25.952  -39.087  -42.183  1.00 74.32  ? 52  ILE F C     1 
ATOM 7442  O O     . ILE F 1 55  ? 25.749  -39.131  -40.963  1.00 86.09  ? 52  ILE F O     1 
ATOM 7443  C CB    . ILE F 1 55  ? 24.996  -36.967  -43.174  1.00 71.99  ? 52  ILE F CB    1 
ATOM 7444  C CG1   . ILE F 1 55  ? 23.763  -36.391  -43.877  1.00 69.16  ? 52  ILE F CG1   1 
ATOM 7445  C CG2   . ILE F 1 55  ? 26.265  -36.514  -43.879  1.00 80.60  ? 52  ILE F CG2   1 
ATOM 7446  C CD1   . ILE F 1 55  ? 23.555  -36.911  -45.284  1.00 71.18  ? 52  ILE F CD1   1 
ATOM 7447  N N     . SER F 1 56  ? 27.071  -39.536  -42.748  1.00 77.98  ? 53  SER F N     1 
ATOM 7448  C CA    . SER F 1 56  ? 28.224  -40.027  -42.008  1.00 81.94  ? 53  SER F CA    1 
ATOM 7449  C C     . SER F 1 56  ? 29.454  -39.278  -42.503  1.00 88.03  ? 53  SER F C     1 
ATOM 7450  O O     . SER F 1 56  ? 29.390  -38.514  -43.470  1.00 88.34  ? 53  SER F O     1 
ATOM 7451  C CB    . SER F 1 56  ? 28.409  -41.542  -42.176  1.00 87.23  ? 53  SER F CB    1 
ATOM 7452  O OG    . SER F 1 56  ? 27.195  -42.240  -41.968  1.00 91.81  ? 53  SER F OG    1 
ATOM 7453  N N     . SER F 1 57  ? 30.586  -39.497  -41.839  1.00 91.82  ? 54  SER F N     1 
ATOM 7454  C CA    . SER F 1 57  ? 31.781  -38.747  -42.191  1.00 96.58  ? 54  SER F CA    1 
ATOM 7455  C C     . SER F 1 57  ? 33.035  -39.578  -41.961  1.00 107.36 ? 54  SER F C     1 
ATOM 7456  O O     . SER F 1 57  ? 33.080  -40.448  -41.087  1.00 101.12 ? 54  SER F O     1 
ATOM 7457  C CB    . SER F 1 57  ? 31.870  -37.443  -41.387  1.00 97.28  ? 54  SER F CB    1 
ATOM 7458  O OG    . SER F 1 57  ? 33.113  -36.794  -41.591  1.00 106.03 ? 54  SER F OG    1 
ATOM 7459  N N     . ARG F 1 58  ? 34.052  -39.292  -42.774  1.00 109.73 ? 55  ARG F N     1 
ATOM 7460  C CA    . ARG F 1 58  ? 35.390  -39.849  -42.643  1.00 111.97 ? 55  ARG F CA    1 
ATOM 7461  C C     . ARG F 1 58  ? 36.376  -38.721  -42.918  1.00 119.97 ? 55  ARG F C     1 
ATOM 7462  O O     . ARG F 1 58  ? 35.982  -37.581  -43.180  1.00 122.47 ? 55  ARG F O     1 
ATOM 7463  C CB    . ARG F 1 58  ? 35.613  -41.037  -43.589  1.00 114.21 ? 55  ARG F CB    1 
ATOM 7464  C CG    . ARG F 1 58  ? 35.657  -40.665  -45.067  1.00 119.96 ? 55  ARG F CG    1 
ATOM 7465  C CD    . ARG F 1 58  ? 36.011  -41.865  -45.938  1.00 115.42 ? 55  ARG F CD    1 
ATOM 7466  N NE    . ARG F 1 58  ? 35.738  -41.611  -47.350  1.00 117.21 ? 55  ARG F NE    1 
ATOM 7467  C CZ    . ARG F 1 58  ? 34.601  -41.927  -47.961  1.00 117.18 ? 55  ARG F CZ    1 
ATOM 7468  N NH1   . ARG F 1 58  ? 33.693  -42.665  -47.338  1.00 102.06 ? 55  ARG F NH1   1 
ATOM 7469  N NH2   . ARG F 1 58  ? 34.437  -41.637  -49.244  1.00 120.61 ? 55  ARG F NH2   1 
ATOM 7470  N N     . MET F 1 59  ? 37.667  -39.030  -42.850  1.00 126.13 ? 56  MET F N     1 
ATOM 7471  C CA    . MET F 1 59  ? 38.714  -38.059  -43.142  1.00 134.00 ? 56  MET F CA    1 
ATOM 7472  C C     . MET F 1 59  ? 39.383  -38.401  -44.467  1.00 141.98 ? 56  MET F C     1 
ATOM 7473  O O     . MET F 1 59  ? 39.744  -39.559  -44.707  1.00 139.51 ? 56  MET F O     1 
ATOM 7474  C CB    . MET F 1 59  ? 39.737  -37.999  -42.007  1.00 140.48 ? 56  MET F CB    1 
ATOM 7475  C CG    . MET F 1 59  ? 39.148  -37.436  -40.720  1.00 140.65 ? 56  MET F CG    1 
ATOM 7476  S SD    . MET F 1 59  ? 38.416  -35.800  -40.969  1.00 138.53 ? 56  MET F SD    1 
ATOM 7477  C CE    . MET F 1 59  ? 36.960  -35.878  -39.919  1.00 119.34 ? 56  MET F CE    1 
ATOM 7478  N N     . ALA F 1 60  ? 39.543  -37.391  -45.320  1.00 149.28 ? 57  ALA F N     1 
ATOM 7479  C CA    . ALA F 1 60  ? 40.112  -37.574  -46.648  1.00 150.17 ? 57  ALA F CA    1 
ATOM 7480  C C     . ALA F 1 60  ? 41.636  -37.482  -46.567  1.00 153.86 ? 57  ALA F C     1 
ATOM 7481  O O     . ALA F 1 60  ? 42.224  -37.617  -45.489  1.00 153.93 ? 57  ALA F O     1 
ATOM 7482  C CB    . ALA F 1 60  ? 39.510  -36.551  -47.616  1.00 141.83 ? 57  ALA F CB    1 
ATOM 7483  N N     . GLY F 1 61  ? 42.290  -37.243  -47.704  1.00 152.76 ? 58  GLY F N     1 
ATOM 7484  C CA    . GLY F 1 61  ? 43.743  -37.226  -47.720  1.00 154.60 ? 58  GLY F CA    1 
ATOM 7485  C C     . GLY F 1 61  ? 44.321  -35.987  -47.060  1.00 158.34 ? 58  GLY F C     1 
ATOM 7486  O O     . GLY F 1 61  ? 45.286  -36.071  -46.295  1.00 158.85 ? 58  GLY F O     1 
ATOM 7487  N N     . GLY F 1 62  ? 43.735  -34.825  -47.340  1.00 155.93 ? 59  GLY F N     1 
ATOM 7488  C CA    . GLY F 1 62  ? 44.239  -33.572  -46.815  1.00 153.09 ? 59  GLY F CA    1 
ATOM 7489  C C     . GLY F 1 62  ? 43.770  -33.258  -45.409  1.00 153.76 ? 59  GLY F C     1 
ATOM 7490  O O     . GLY F 1 62  ? 43.845  -32.107  -44.967  1.00 143.99 ? 59  GLY F O     1 
ATOM 7491  N N     . GLY F 1 63  ? 43.290  -34.270  -44.695  1.00 155.31 ? 60  GLY F N     1 
ATOM 7492  C CA    . GLY F 1 63  ? 42.804  -34.063  -43.343  1.00 147.21 ? 60  GLY F CA    1 
ATOM 7493  C C     . GLY F 1 63  ? 41.567  -33.195  -43.265  1.00 143.31 ? 60  GLY F C     1 
ATOM 7494  O O     . GLY F 1 63  ? 41.470  -32.341  -42.375  1.00 139.67 ? 60  GLY F O     1 
ATOM 7495  N N     . GLN F 1 64  ? 40.620  -33.390  -44.177  1.00 146.46 ? 61  GLN F N     1 
ATOM 7496  C CA    . GLN F 1 64  ? 39.402  -32.599  -44.230  1.00 148.73 ? 61  GLN F CA    1 
ATOM 7497  C C     . GLN F 1 64  ? 38.181  -33.507  -44.124  1.00 143.90 ? 61  GLN F C     1 
ATOM 7498  O O     . GLN F 1 64  ? 38.263  -34.724  -44.313  1.00 135.97 ? 61  GLN F O     1 
ATOM 7499  C CB    . GLN F 1 64  ? 39.337  -31.769  -45.520  1.00 146.62 ? 61  GLN F CB    1 
ATOM 7500  C CG    . GLN F 1 64  ? 39.674  -32.550  -46.781  1.00 143.96 ? 61  GLN F CG    1 
ATOM 7501  C CD    . GLN F 1 64  ? 39.711  -31.673  -48.015  1.00 132.09 ? 61  GLN F CD    1 
ATOM 7502  O OE1   . GLN F 1 64  ? 39.258  -30.529  -47.992  1.00 127.88 ? 61  GLN F OE1   1 
ATOM 7503  N NE2   . GLN F 1 64  ? 40.257  -32.204  -49.103  1.00 134.08 ? 61  GLN F NE2   1 
ATOM 7504  N N     . LYS F 1 65  ? 37.041  -32.892  -43.820  1.00 138.65 ? 62  LYS F N     1 
ATOM 7505  C CA    . LYS F 1 65  ? 35.800  -33.628  -43.616  1.00 127.21 ? 62  LYS F CA    1 
ATOM 7506  C C     . LYS F 1 65  ? 35.112  -33.896  -44.949  1.00 126.83 ? 62  LYS F C     1 
ATOM 7507  O O     . LYS F 1 65  ? 34.938  -32.984  -45.762  1.00 128.96 ? 62  LYS F O     1 
ATOM 7508  C CB    . LYS F 1 65  ? 34.873  -32.844  -42.686  1.00 119.02 ? 62  LYS F CB    1 
ATOM 7509  C CG    . LYS F 1 65  ? 33.593  -33.568  -42.302  1.00 116.26 ? 62  LYS F CG    1 
ATOM 7510  C CD    . LYS F 1 65  ? 32.709  -32.691  -41.428  1.00 110.48 ? 62  LYS F CD    1 
ATOM 7511  C CE    . LYS F 1 65  ? 31.472  -33.442  -40.968  1.00 110.18 ? 62  LYS F CE    1 
ATOM 7512  N NZ    . LYS F 1 65  ? 30.563  -32.587  -40.156  1.00 98.83  ? 62  LYS F NZ    1 
ATOM 7513  N N     . VAL F 1 66  ? 34.726  -35.152  -45.173  1.00 119.14 ? 63  VAL F N     1 
ATOM 7514  C CA    . VAL F 1 66  ? 33.969  -35.561  -46.352  1.00 111.08 ? 63  VAL F CA    1 
ATOM 7515  C C     . VAL F 1 66  ? 32.710  -36.271  -45.877  1.00 100.68 ? 63  VAL F C     1 
ATOM 7516  O O     . VAL F 1 66  ? 32.793  -37.264  -45.144  1.00 108.76 ? 63  VAL F O     1 
ATOM 7517  C CB    . VAL F 1 66  ? 34.783  -36.481  -47.278  1.00 121.03 ? 63  VAL F CB    1 
ATOM 7518  C CG1   . VAL F 1 66  ? 33.898  -37.025  -48.393  1.00 116.67 ? 63  VAL F CG1   1 
ATOM 7519  C CG2   . VAL F 1 66  ? 35.968  -35.734  -47.863  1.00 126.27 ? 63  VAL F CG2   1 
ATOM 7520  N N     . CYS F 1 67  ? 31.553  -35.781  -46.305  1.00 92.10  ? 64  CYS F N     1 
ATOM 7521  C CA    . CYS F 1 67  ? 30.284  -36.389  -45.942  1.00 89.36  ? 64  CYS F CA    1 
ATOM 7522  C C     . CYS F 1 67  ? 29.895  -37.459  -46.955  1.00 90.19  ? 64  CYS F C     1 
ATOM 7523  O O     . CYS F 1 67  ? 30.327  -37.444  -48.111  1.00 99.49  ? 64  CYS F O     1 
ATOM 7524  C CB    . CYS F 1 67  ? 29.186  -35.331  -45.847  1.00 86.54  ? 64  CYS F CB    1 
ATOM 7525  S SG    . CYS F 1 67  ? 29.467  -34.093  -44.557  1.00 98.36  ? 64  CYS F SG    1 
ATOM 7526  N N     . TYR F 1 68  ? 29.058  -38.391  -46.508  1.00 75.13  ? 65  TYR F N     1 
ATOM 7527  C CA    . TYR F 1 68  ? 28.593  -39.468  -47.372  1.00 80.53  ? 65  TYR F CA    1 
ATOM 7528  C C     . TYR F 1 68  ? 27.406  -40.154  -46.716  1.00 81.85  ? 65  TYR F C     1 
ATOM 7529  O O     . TYR F 1 68  ? 27.148  -39.988  -45.519  1.00 86.49  ? 65  TYR F O     1 
ATOM 7530  C CB    . TYR F 1 68  ? 29.705  -40.486  -47.667  1.00 81.85  ? 65  TYR F CB    1 
ATOM 7531  C CG    . TYR F 1 68  ? 30.127  -41.325  -46.479  1.00 82.02  ? 65  TYR F CG    1 
ATOM 7532  C CD1   . TYR F 1 68  ? 29.487  -42.524  -46.188  1.00 79.10  ? 65  TYR F CD1   1 
ATOM 7533  C CD2   . TYR F 1 68  ? 31.174  -40.926  -45.659  1.00 91.80  ? 65  TYR F CD2   1 
ATOM 7534  C CE1   . TYR F 1 68  ? 29.867  -43.292  -45.107  1.00 84.99  ? 65  TYR F CE1   1 
ATOM 7535  C CE2   . TYR F 1 68  ? 31.565  -41.690  -44.578  1.00 95.02  ? 65  TYR F CE2   1 
ATOM 7536  C CZ    . TYR F 1 68  ? 30.907  -42.873  -44.306  1.00 88.47  ? 65  TYR F CZ    1 
ATOM 7537  O OH    . TYR F 1 68  ? 31.286  -43.642  -43.231  1.00 91.23  ? 65  TYR F OH    1 
ATOM 7538  N N     . ILE F 1 69  ? 26.687  -40.928  -47.525  1.00 76.92  ? 66  ILE F N     1 
ATOM 7539  C CA    . ILE F 1 69  ? 25.584  -41.766  -47.072  1.00 76.82  ? 66  ILE F CA    1 
ATOM 7540  C C     . ILE F 1 69  ? 26.031  -43.217  -47.169  1.00 73.78  ? 66  ILE F C     1 
ATOM 7541  O O     . ILE F 1 69  ? 26.574  -43.636  -48.198  1.00 91.37  ? 66  ILE F O     1 
ATOM 7542  C CB    . ILE F 1 69  ? 24.316  -41.522  -47.906  1.00 67.63  ? 66  ILE F CB    1 
ATOM 7543  C CG1   . ILE F 1 69  ? 24.062  -40.023  -48.040  1.00 73.59  ? 66  ILE F CG1   1 
ATOM 7544  C CG2   . ILE F 1 69  ? 23.114  -42.200  -47.266  1.00 66.38  ? 66  ILE F CG2   1 
ATOM 7545  C CD1   . ILE F 1 69  ? 22.871  -39.689  -48.889  1.00 78.11  ? 66  ILE F CD1   1 
ATOM 7546  N N     . GLU F 1 70  ? 25.819  -43.976  -46.099  1.00 71.68  ? 67  GLU F N     1 
ATOM 7547  C CA    . GLU F 1 70  ? 26.225  -45.374  -46.087  1.00 76.92  ? 67  GLU F CA    1 
ATOM 7548  C C     . GLU F 1 70  ? 25.365  -46.192  -47.044  1.00 71.13  ? 67  GLU F C     1 
ATOM 7549  O O     . GLU F 1 70  ? 24.207  -45.861  -47.307  1.00 68.22  ? 67  GLU F O     1 
ATOM 7550  C CB    . GLU F 1 70  ? 26.146  -45.940  -44.671  1.00 75.47  ? 67  GLU F CB    1 
ATOM 7551  C CG    . GLU F 1 70  ? 27.127  -45.278  -43.721  1.00 88.71  ? 67  GLU F CG    1 
ATOM 7552  C CD    . GLU F 1 70  ? 27.245  -45.979  -42.383  1.00 96.00  ? 67  GLU F CD    1 
ATOM 7553  O OE1   . GLU F 1 70  ? 28.197  -45.664  -41.640  1.00 96.11  ? 67  GLU F OE1   1 
ATOM 7554  O OE2   . GLU F 1 70  ? 26.412  -46.859  -42.083  1.00 102.30 ? 67  GLU F OE2   1 
ATOM 7555  N N     . GLY F 1 71  ? 25.962  -47.261  -47.578  1.00 68.80  ? 68  GLY F N     1 
ATOM 7556  C CA    . GLY F 1 71  ? 25.296  -48.034  -48.620  1.00 66.10  ? 68  GLY F CA    1 
ATOM 7557  C C     . GLY F 1 71  ? 23.919  -48.503  -48.216  1.00 66.02  ? 68  GLY F C     1 
ATOM 7558  O O     . GLY F 1 71  ? 22.929  -48.243  -48.910  1.00 67.37  ? 68  GLY F O     1 
ATOM 7559  N N     . HIS F 1 72  ? 23.809  -49.162  -47.053  1.00 66.04  ? 69  HIS F N     1 
ATOM 7560  C CA    . HIS F 1 72  ? 22.534  -49.713  -46.609  1.00 66.03  ? 69  HIS F CA    1 
ATOM 7561  C C     . HIS F 1 72  ? 21.482  -48.625  -46.458  1.00 70.66  ? 69  HIS F C     1 
ATOM 7562  O O     . HIS F 1 72  ? 20.294  -48.880  -46.685  1.00 66.64  ? 69  HIS F O     1 
ATOM 7563  C CB    . HIS F 1 72  ? 22.722  -50.478  -45.295  1.00 69.52  ? 69  HIS F CB    1 
ATOM 7564  C CG    . HIS F 1 72  ? 23.015  -49.604  -44.118  1.00 78.94  ? 69  HIS F CG    1 
ATOM 7565  N ND1   . HIS F 1 72  ? 22.058  -49.262  -43.186  1.00 79.52  ? 69  HIS F ND1   1 
ATOM 7566  C CD2   . HIS F 1 72  ? 24.162  -49.009  -43.715  1.00 81.09  ? 69  HIS F CD2   1 
ATOM 7567  C CE1   . HIS F 1 72  ? 22.603  -48.492  -42.261  1.00 76.43  ? 69  HIS F CE1   1 
ATOM 7568  N NE2   . HIS F 1 72  ? 23.879  -48.324  -42.559  1.00 81.01  ? 69  HIS F NE2   1 
ATOM 7569  N N     . ARG F 1 73  ? 21.904  -47.406  -46.101  1.00 69.92  ? 70  ARG F N     1 
ATOM 7570  C CA    . ARG F 1 73  ? 20.959  -46.299  -46.014  1.00 72.22  ? 70  ARG F CA    1 
ATOM 7571  C C     . ARG F 1 73  ? 20.350  -46.010  -47.376  1.00 69.26  ? 70  ARG F C     1 
ATOM 7572  O O     . ARG F 1 73  ? 19.134  -45.812  -47.496  1.00 60.59  ? 70  ARG F O     1 
ATOM 7573  C CB    . ARG F 1 73  ? 21.661  -45.043  -45.499  1.00 81.42  ? 70  ARG F CB    1 
ATOM 7574  C CG    . ARG F 1 73  ? 22.355  -45.165  -44.154  1.00 86.22  ? 70  ARG F CG    1 
ATOM 7575  C CD    . ARG F 1 73  ? 21.671  -44.326  -43.085  1.00 92.18  ? 70  ARG F CD    1 
ATOM 7576  N NE    . ARG F 1 73  ? 22.233  -44.568  -41.758  1.00 96.05  ? 70  ARG F NE    1 
ATOM 7577  C CZ    . ARG F 1 73  ? 23.408  -44.100  -41.344  1.00 95.83  ? 70  ARG F CZ    1 
ATOM 7578  N NH1   . ARG F 1 73  ? 24.153  -43.356  -42.152  1.00 91.93  ? 70  ARG F NH1   1 
ATOM 7579  N NH2   . ARG F 1 73  ? 23.839  -44.372  -40.120  1.00 93.47  ? 70  ARG F NH2   1 
ATOM 7580  N N     . VAL F 1 74  ? 21.183  -46.005  -48.419  1.00 72.58  ? 71  VAL F N     1 
ATOM 7581  C CA    . VAL F 1 74  ? 20.700  -45.744  -49.768  1.00 63.49  ? 71  VAL F CA    1 
ATOM 7582  C C     . VAL F 1 74  ? 19.808  -46.882  -50.245  1.00 58.54  ? 71  VAL F C     1 
ATOM 7583  O O     . VAL F 1 74  ? 18.791  -46.652  -50.911  1.00 59.23  ? 71  VAL F O     1 
ATOM 7584  C CB    . VAL F 1 74  ? 21.890  -45.518  -50.719  1.00 60.23  ? 71  VAL F CB    1 
ATOM 7585  C CG1   . VAL F 1 74  ? 21.398  -45.131  -52.100  1.00 67.55  ? 71  VAL F CG1   1 
ATOM 7586  C CG2   . VAL F 1 74  ? 22.822  -44.453  -50.162  1.00 55.78  ? 71  VAL F CG2   1 
ATOM 7587  N N     . ILE F 1 75  ? 20.170  -48.124  -49.914  1.00 50.62  ? 72  ILE F N     1 
ATOM 7588  C CA    . ILE F 1 75  ? 19.341  -49.262  -50.313  1.00 64.40  ? 72  ILE F CA    1 
ATOM 7589  C C     . ILE F 1 75  ? 17.951  -49.146  -49.694  1.00 66.68  ? 72  ILE F C     1 
ATOM 7590  O O     . ILE F 1 75  ? 16.933  -49.344  -50.368  1.00 62.43  ? 72  ILE F O     1 
ATOM 7591  C CB    . ILE F 1 75  ? 20.019  -50.593  -49.942  1.00 65.07  ? 72  ILE F CB    1 
ATOM 7592  C CG1   . ILE F 1 75  ? 21.269  -50.813  -50.793  1.00 67.53  ? 72  ILE F CG1   1 
ATOM 7593  C CG2   . ILE F 1 75  ? 19.074  -51.752  -50.196  1.00 60.31  ? 72  ILE F CG2   1 
ATOM 7594  C CD1   . ILE F 1 75  ? 22.024  -52.082  -50.448  1.00 69.51  ? 72  ILE F CD1   1 
ATOM 7595  N N     . ASN F 1 76  ? 17.887  -48.833  -48.395  1.00 78.88  ? 73  ASN F N     1 
ATOM 7596  C CA    . ASN F 1 76  ? 16.589  -48.710  -47.734  1.00 69.81  ? 73  ASN F CA    1 
ATOM 7597  C C     . ASN F 1 76  ? 15.798  -47.520  -48.272  1.00 68.03  ? 73  ASN F C     1 
ATOM 7598  O O     . ASN F 1 76  ? 14.577  -47.613  -48.461  1.00 67.37  ? 73  ASN F O     1 
ATOM 7599  C CB    . ASN F 1 76  ? 16.783  -48.593  -46.223  1.00 74.36  ? 73  ASN F CB    1 
ATOM 7600  C CG    . ASN F 1 76  ? 17.134  -49.919  -45.580  1.00 79.02  ? 73  ASN F CG    1 
ATOM 7601  O OD1   . ASN F 1 76  ? 16.682  -50.975  -46.026  1.00 79.92  ? 73  ASN F OD1   1 
ATOM 7602  N ND2   . ASN F 1 76  ? 17.942  -49.873  -44.527  1.00 79.13  ? 73  ASN F ND2   1 
ATOM 7603  N N     . LEU F 1 77  ? 16.475  -46.397  -48.526  1.00 61.60  ? 74  LEU F N     1 
ATOM 7604  C CA    . LEU F 1 77  ? 15.818  -45.244  -49.135  1.00 57.60  ? 74  LEU F CA    1 
ATOM 7605  C C     . LEU F 1 77  ? 15.188  -45.610  -50.474  1.00 68.39  ? 74  LEU F C     1 
ATOM 7606  O O     . LEU F 1 77  ? 14.042  -45.242  -50.757  1.00 69.21  ? 74  LEU F O     1 
ATOM 7607  C CB    . LEU F 1 77  ? 16.824  -44.109  -49.309  1.00 61.35  ? 74  LEU F CB    1 
ATOM 7608  C CG    . LEU F 1 77  ? 17.143  -43.291  -48.061  1.00 60.45  ? 74  LEU F CG    1 
ATOM 7609  C CD1   . LEU F 1 77  ? 18.373  -42.434  -48.305  1.00 65.73  ? 74  LEU F CD1   1 
ATOM 7610  C CD2   . LEU F 1 77  ? 15.952  -42.438  -47.659  1.00 64.76  ? 74  LEU F CD2   1 
ATOM 7611  N N     . ALA F 1 78  ? 15.932  -46.330  -51.318  1.00 66.57  ? 75  ALA F N     1 
ATOM 7612  C CA    . ALA F 1 78  ? 15.413  -46.699  -52.630  1.00 64.06  ? 75  ALA F CA    1 
ATOM 7613  C C     . ALA F 1 78  ? 14.268  -47.695  -52.513  1.00 62.80  ? 75  ALA F C     1 
ATOM 7614  O O     . ALA F 1 78  ? 13.289  -47.614  -53.265  1.00 64.83  ? 75  ALA F O     1 
ATOM 7615  C CB    . ALA F 1 78  ? 16.534  -47.265  -53.501  1.00 64.76  ? 75  ALA F CB    1 
ATOM 7616  N N     . ASN F 1 79  ? 14.380  -48.659  -51.596  1.00 55.38  ? 76  ASN F N     1 
ATOM 7617  C CA    . ASN F 1 79  ? 13.286  -49.602  -51.398  1.00 66.21  ? 76  ASN F CA    1 
ATOM 7618  C C     . ASN F 1 79  ? 12.021  -48.904  -50.916  1.00 77.11  ? 76  ASN F C     1 
ATOM 7619  O O     . ASN F 1 79  ? 10.912  -49.321  -51.268  1.00 76.31  ? 76  ASN F O     1 
ATOM 7620  C CB    . ASN F 1 79  ? 13.698  -50.703  -50.423  1.00 63.26  ? 76  ASN F CB    1 
ATOM 7621  C CG    . ASN F 1 79  ? 14.531  -51.782  -51.087  1.00 65.22  ? 76  ASN F CG    1 
ATOM 7622  O OD1   . ASN F 1 79  ? 14.243  -52.199  -52.211  1.00 80.80  ? 76  ASN F OD1   1 
ATOM 7623  N ND2   . ASN F 1 79  ? 15.562  -52.251  -50.391  1.00 72.38  ? 76  ASN F ND2   1 
ATOM 7624  N N     . GLU F 1 80  ? 12.160  -47.843  -50.116  1.00 74.12  ? 77  GLU F N     1 
ATOM 7625  C CA    . GLU F 1 80  ? 10.976  -47.124  -49.655  1.00 75.30  ? 77  GLU F CA    1 
ATOM 7626  C C     . GLU F 1 80  ? 10.414  -46.199  -50.732  1.00 70.08  ? 77  GLU F C     1 
ATOM 7627  O O     . GLU F 1 80  ? 9.193   -46.042  -50.839  1.00 69.16  ? 77  GLU F O     1 
ATOM 7628  C CB    . GLU F 1 80  ? 11.302  -46.331  -48.386  1.00 81.21  ? 77  GLU F CB    1 
ATOM 7629  C CG    . GLU F 1 80  ? 11.621  -47.203  -47.171  1.00 86.80  ? 77  GLU F CG    1 
ATOM 7630  C CD    . GLU F 1 80  ? 10.501  -48.168  -46.818  1.00 77.76  ? 77  GLU F CD    1 
ATOM 7631  O OE1   . GLU F 1 80  ? 9.322   -47.832  -47.053  1.00 75.03  ? 77  GLU F OE1   1 
ATOM 7632  O OE2   . GLU F 1 80  ? 10.804  -49.277  -46.330  1.00 65.48  ? 77  GLU F OE2   1 
ATOM 7633  N N     . MET F 1 81  ? 11.281  -45.588  -51.545  1.00 71.46  ? 78  MET F N     1 
ATOM 7634  C CA    . MET F 1 81  ? 10.801  -44.648  -52.554  1.00 67.75  ? 78  MET F CA    1 
ATOM 7635  C C     . MET F 1 81  ? 10.048  -45.356  -53.676  1.00 67.07  ? 78  MET F C     1 
ATOM 7636  O O     . MET F 1 81  ? 9.002   -44.873  -54.125  1.00 69.51  ? 78  MET F O     1 
ATOM 7637  C CB    . MET F 1 81  ? 11.967  -43.836  -53.120  1.00 68.48  ? 78  MET F CB    1 
ATOM 7638  C CG    . MET F 1 81  ? 12.436  -42.711  -52.208  1.00 88.67  ? 78  MET F CG    1 
ATOM 7639  S SD    . MET F 1 81  ? 11.277  -41.332  -52.072  1.00 84.62  ? 78  MET F SD    1 
ATOM 7640  C CE    . MET F 1 81  ? 10.546  -41.319  -53.706  1.00 65.36  ? 78  MET F CE    1 
ATOM 7641  N N     . PHE F 1 82  ? 10.558  -46.496  -54.147  1.00 64.03  ? 79  PHE F N     1 
ATOM 7642  C CA    . PHE F 1 82  ? 9.995   -47.154  -55.319  1.00 69.65  ? 79  PHE F CA    1 
ATOM 7643  C C     . PHE F 1 82  ? 9.362   -48.507  -55.029  1.00 71.24  ? 79  PHE F C     1 
ATOM 7644  O O     . PHE F 1 82  ? 8.678   -49.047  -55.906  1.00 64.79  ? 79  PHE F O     1 
ATOM 7645  C CB    . PHE F 1 82  ? 11.075  -47.339  -56.399  1.00 59.72  ? 79  PHE F CB    1 
ATOM 7646  C CG    . PHE F 1 82  ? 11.871  -46.098  -56.688  1.00 50.73  ? 79  PHE F CG    1 
ATOM 7647  C CD1   . PHE F 1 82  ? 11.322  -45.052  -57.415  1.00 52.82  ? 79  PHE F CD1   1 
ATOM 7648  C CD2   . PHE F 1 82  ? 13.178  -45.986  -56.243  1.00 47.08  ? 79  PHE F CD2   1 
ATOM 7649  C CE1   . PHE F 1 82  ? 12.063  -43.914  -57.683  1.00 52.11  ? 79  PHE F CE1   1 
ATOM 7650  C CE2   . PHE F 1 82  ? 13.920  -44.854  -56.509  1.00 52.38  ? 79  PHE F CE2   1 
ATOM 7651  C CZ    . PHE F 1 82  ? 13.363  -43.816  -57.230  1.00 58.68  ? 79  PHE F CZ    1 
ATOM 7652  N N     . GLY F 1 83  ? 9.558   -49.063  -53.844  1.00 75.74  ? 80  GLY F N     1 
ATOM 7653  C CA    . GLY F 1 83  ? 9.116   -50.430  -53.615  1.00 72.16  ? 80  GLY F CA    1 
ATOM 7654  C C     . GLY F 1 83  ? 10.214  -51.434  -53.898  1.00 69.77  ? 80  GLY F C     1 
ATOM 7655  O O     . GLY F 1 83  ? 11.125  -51.200  -54.691  1.00 74.85  ? 80  GLY F O     1 
ATOM 7656  N N     . TYR F 1 84  ? 10.138  -52.579  -53.211  1.00 67.79  ? 81  TYR F N     1 
ATOM 7657  C CA    . TYR F 1 84  ? 11.132  -53.627  -53.433  1.00 63.27  ? 81  TYR F CA    1 
ATOM 7658  C C     . TYR F 1 84  ? 11.178  -54.075  -54.888  1.00 69.02  ? 81  TYR F C     1 
ATOM 7659  O O     . TYR F 1 84  ? 12.222  -54.551  -55.347  1.00 69.82  ? 81  TYR F O     1 
ATOM 7660  C CB    . TYR F 1 84  ? 10.853  -54.842  -52.550  1.00 53.77  ? 81  TYR F CB    1 
ATOM 7661  C CG    . TYR F 1 84  ? 9.673   -55.671  -53.008  1.00 57.42  ? 81  TYR F CG    1 
ATOM 7662  C CD1   . TYR F 1 84  ? 8.369   -55.251  -52.786  1.00 64.19  ? 81  TYR F CD1   1 
ATOM 7663  C CD2   . TYR F 1 84  ? 9.867   -56.874  -53.678  1.00 59.59  ? 81  TYR F CD2   1 
ATOM 7664  C CE1   . TYR F 1 84  ? 7.293   -56.012  -53.209  1.00 62.17  ? 81  TYR F CE1   1 
ATOM 7665  C CE2   . TYR F 1 84  ? 8.796   -57.639  -54.108  1.00 72.76  ? 81  TYR F CE2   1 
ATOM 7666  C CZ    . TYR F 1 84  ? 7.511   -57.202  -53.870  1.00 70.05  ? 81  TYR F CZ    1 
ATOM 7667  O OH    . TYR F 1 84  ? 6.439   -57.959  -54.289  1.00 66.02  ? 81  TYR F OH    1 
ATOM 7668  N N     . ASN F 1 85  ? 10.080  -53.909  -55.627  1.00 59.64  ? 82  ASN F N     1 
ATOM 7669  C CA    . ASN F 1 85  ? 9.983   -54.346  -57.014  1.00 61.95  ? 82  ASN F CA    1 
ATOM 7670  C C     . ASN F 1 85  ? 9.816   -53.171  -57.967  1.00 65.70  ? 82  ASN F C     1 
ATOM 7671  O O     . ASN F 1 85  ? 9.330   -53.347  -59.089  1.00 69.65  ? 82  ASN F O     1 
ATOM 7672  C CB    . ASN F 1 85  ? 8.824   -55.332  -57.179  1.00 60.20  ? 82  ASN F CB    1 
ATOM 7673  C CG    . ASN F 1 85  ? 7.466   -54.658  -57.105  1.00 59.16  ? 82  ASN F CG    1 
ATOM 7674  O OD1   . ASN F 1 85  ? 7.290   -53.661  -56.406  1.00 66.57  ? 82  ASN F OD1   1 
ATOM 7675  N ND2   . ASN F 1 85  ? 6.494   -55.205  -57.832  1.00 67.16  ? 82  ASN F ND2   1 
ATOM 7676  N N     . GLY F 1 86  ? 10.214  -51.976  -57.543  1.00 62.27  ? 83  GLY F N     1 
ATOM 7677  C CA    . GLY F 1 86  ? 10.044  -50.793  -58.360  1.00 60.83  ? 83  GLY F CA    1 
ATOM 7678  C C     . GLY F 1 86  ? 11.347  -50.194  -58.840  1.00 55.92  ? 83  GLY F C     1 
ATOM 7679  O O     . GLY F 1 86  ? 11.343  -49.301  -59.692  1.00 67.52  ? 83  GLY F O     1 
ATOM 7680  N N     . TRP F 1 87  ? 12.468  -50.669  -58.302  1.00 54.79  ? 84  TRP F N     1 
ATOM 7681  C CA    . TRP F 1 87  ? 13.781  -50.250  -58.764  1.00 60.59  ? 84  TRP F CA    1 
ATOM 7682  C C     . TRP F 1 87  ? 14.667  -51.474  -58.933  1.00 58.55  ? 84  TRP F C     1 
ATOM 7683  O O     . TRP F 1 87  ? 14.455  -52.508  -58.294  1.00 59.06  ? 84  TRP F O     1 
ATOM 7684  C CB    . TRP F 1 87  ? 14.445  -49.257  -57.793  1.00 52.74  ? 84  TRP F CB    1 
ATOM 7685  C CG    . TRP F 1 87  ? 14.990  -49.877  -56.540  1.00 59.08  ? 84  TRP F CG    1 
ATOM 7686  C CD1   . TRP F 1 87  ? 14.278  -50.392  -55.495  1.00 65.55  ? 84  TRP F CD1   1 
ATOM 7687  C CD2   . TRP F 1 87  ? 16.372  -50.026  -56.196  1.00 61.58  ? 84  TRP F CD2   1 
ATOM 7688  N NE1   . TRP F 1 87  ? 15.134  -50.864  -54.527  1.00 64.43  ? 84  TRP F NE1   1 
ATOM 7689  C CE2   . TRP F 1 87  ? 16.424  -50.649  -54.933  1.00 63.81  ? 84  TRP F CE2   1 
ATOM 7690  C CE3   . TRP F 1 87  ? 17.571  -49.698  -56.837  1.00 54.45  ? 84  TRP F CE3   1 
ATOM 7691  C CZ2   . TRP F 1 87  ? 17.628  -50.951  -54.298  1.00 60.08  ? 84  TRP F CZ2   1 
ATOM 7692  C CZ3   . TRP F 1 87  ? 18.763  -49.997  -56.206  1.00 58.40  ? 84  TRP F CZ3   1 
ATOM 7693  C CH2   . TRP F 1 87  ? 18.784  -50.617  -54.949  1.00 63.60  ? 84  TRP F CH2   1 
ATOM 7694  N N     . ALA F 1 88  ? 15.659  -51.348  -59.807  1.00 51.71  ? 85  ALA F N     1 
ATOM 7695  C CA    . ALA F 1 88  ? 16.576  -52.440  -60.081  1.00 41.42  ? 85  ALA F CA    1 
ATOM 7696  C C     . ALA F 1 88  ? 17.927  -51.848  -60.439  1.00 44.00  ? 85  ALA F C     1 
ATOM 7697  O O     . ALA F 1 88  ? 18.021  -50.701  -60.879  1.00 47.82  ? 85  ALA F O     1 
ATOM 7698  C CB    . ALA F 1 88  ? 16.060  -53.336  -61.209  1.00 44.59  ? 85  ALA F CB    1 
ATOM 7699  N N     . HIS F 1 89  ? 18.981  -52.634  -60.241  1.00 40.43  ? 86  HIS F N     1 
ATOM 7700  C CA    . HIS F 1 89  ? 20.294  -52.194  -60.683  1.00 52.64  ? 86  HIS F CA    1 
ATOM 7701  C C     . HIS F 1 89  ? 21.091  -53.389  -61.177  1.00 53.29  ? 86  HIS F C     1 
ATOM 7702  O O     . HIS F 1 89  ? 20.877  -54.525  -60.743  1.00 52.81  ? 86  HIS F O     1 
ATOM 7703  C CB    . HIS F 1 89  ? 21.070  -51.477  -59.571  1.00 45.59  ? 86  HIS F CB    1 
ATOM 7704  C CG    . HIS F 1 89  ? 21.707  -52.404  -58.584  1.00 55.75  ? 86  HIS F CG    1 
ATOM 7705  N ND1   . HIS F 1 89  ? 20.986  -53.308  -57.835  1.00 55.67  ? 86  HIS F ND1   1 
ATOM 7706  C CD2   . HIS F 1 89  ? 23.002  -52.564  -58.223  1.00 58.97  ? 86  HIS F CD2   1 
ATOM 7707  C CE1   . HIS F 1 89  ? 21.809  -53.984  -57.054  1.00 61.39  ? 86  HIS F CE1   1 
ATOM 7708  N NE2   . HIS F 1 89  ? 23.039  -53.552  -57.270  1.00 62.54  ? 86  HIS F NE2   1 
ATOM 7709  N N     . SER F 1 90  ? 22.023  -53.111  -62.084  1.00 52.43  ? 87  SER F N     1 
ATOM 7710  C CA    . SER F 1 90  ? 22.887  -54.123  -62.665  1.00 48.32  ? 87  SER F CA    1 
ATOM 7711  C C     . SER F 1 90  ? 24.267  -53.514  -62.846  1.00 44.84  ? 87  SER F C     1 
ATOM 7712  O O     . SER F 1 90  ? 24.416  -52.292  -62.938  1.00 45.98  ? 87  SER F O     1 
ATOM 7713  C CB    . SER F 1 90  ? 22.357  -54.649  -64.009  1.00 46.87  ? 87  SER F CB    1 
ATOM 7714  O OG    . SER F 1 90  ? 22.148  -53.600  -64.939  1.00 49.01  ? 87  SER F OG    1 
ATOM 7715  N N     . ILE F 1 91  ? 25.275  -54.375  -62.876  1.00 44.71  ? 88  ILE F N     1 
ATOM 7716  C CA    . ILE F 1 91  ? 26.656  -53.960  -63.078  1.00 51.05  ? 88  ILE F CA    1 
ATOM 7717  C C     . ILE F 1 91  ? 26.937  -54.089  -64.568  1.00 48.09  ? 88  ILE F C     1 
ATOM 7718  O O     . ILE F 1 91  ? 27.116  -55.195  -65.087  1.00 49.09  ? 88  ILE F O     1 
ATOM 7719  C CB    . ILE F 1 91  ? 27.625  -54.801  -62.247  1.00 48.82  ? 88  ILE F CB    1 
ATOM 7720  C CG1   . ILE F 1 91  ? 27.260  -54.729  -60.764  1.00 37.20  ? 88  ILE F CG1   1 
ATOM 7721  C CG2   . ILE F 1 91  ? 29.054  -54.338  -62.480  1.00 43.27  ? 88  ILE F CG2   1 
ATOM 7722  C CD1   . ILE F 1 91  ? 28.000  -55.736  -59.919  1.00 50.90  ? 88  ILE F CD1   1 
ATOM 7723  N N     . THR F 1 92  ? 26.985  -52.951  -65.262  1.00 46.51  ? 89  THR F N     1 
ATOM 7724  C CA    . THR F 1 92  ? 27.239  -52.977  -66.697  1.00 45.75  ? 89  THR F CA    1 
ATOM 7725  C C     . THR F 1 92  ? 28.635  -53.507  -67.005  1.00 48.78  ? 89  THR F C     1 
ATOM 7726  O O     . THR F 1 92  ? 28.799  -54.378  -67.867  1.00 54.35  ? 89  THR F O     1 
ATOM 7727  C CB    . THR F 1 92  ? 27.043  -51.578  -67.284  1.00 40.48  ? 89  THR F CB    1 
ATOM 7728  O OG1   . THR F 1 92  ? 25.700  -51.142  -67.037  1.00 50.58  ? 89  THR F OG1   1 
ATOM 7729  C CG2   . THR F 1 92  ? 27.306  -51.573  -68.785  1.00 39.50  ? 89  THR F CG2   1 
ATOM 7730  N N     . GLN F 1 93  ? 29.650  -53.007  -66.307  1.00 43.79  ? 90  GLN F N     1 
ATOM 7731  C CA    . GLN F 1 93  ? 31.006  -53.485  -66.528  1.00 44.33  ? 90  GLN F CA    1 
ATOM 7732  C C     . GLN F 1 93  ? 31.858  -53.038  -65.351  1.00 51.30  ? 90  GLN F C     1 
ATOM 7733  O O     . GLN F 1 93  ? 31.740  -51.898  -64.894  1.00 54.46  ? 90  GLN F O     1 
ATOM 7734  C CB    . GLN F 1 93  ? 31.562  -52.944  -67.850  1.00 48.52  ? 90  GLN F CB    1 
ATOM 7735  C CG    . GLN F 1 93  ? 32.857  -53.576  -68.339  1.00 64.23  ? 90  GLN F CG    1 
ATOM 7736  C CD    . GLN F 1 93  ? 33.381  -52.877  -69.585  1.00 77.06  ? 90  GLN F CD    1 
ATOM 7737  O OE1   . GLN F 1 93  ? 33.377  -51.645  -69.659  1.00 86.51  ? 90  GLN F OE1   1 
ATOM 7738  N NE2   . GLN F 1 93  ? 33.828  -53.655  -70.571  1.00 94.35  ? 90  GLN F NE2   1 
ATOM 7739  N N     . GLN F 1 94  ? 32.719  -53.936  -64.878  1.00 50.16  ? 91  GLN F N     1 
ATOM 7740  C CA    . GLN F 1 94  ? 33.733  -53.637  -63.875  1.00 43.46  ? 91  GLN F CA    1 
ATOM 7741  C C     . GLN F 1 94  ? 35.111  -53.989  -64.416  1.00 45.69  ? 91  GLN F C     1 
ATOM 7742  O O     . GLN F 1 94  ? 35.327  -55.110  -64.886  1.00 52.54  ? 91  GLN F O     1 
ATOM 7743  C CB    . GLN F 1 94  ? 33.452  -54.423  -62.594  1.00 47.78  ? 91  GLN F CB    1 
ATOM 7744  C CG    . GLN F 1 94  ? 34.650  -54.598  -61.686  1.00 60.23  ? 91  GLN F CG    1 
ATOM 7745  C CD    . GLN F 1 94  ? 34.257  -54.908  -60.257  1.00 51.94  ? 91  GLN F CD    1 
ATOM 7746  O OE1   . GLN F 1 94  ? 34.541  -55.991  -59.750  1.00 62.73  ? 91  GLN F OE1   1 
ATOM 7747  N NE2   . GLN F 1 94  ? 33.609  -53.958  -59.598  1.00 47.93  ? 91  GLN F NE2   1 
ATOM 7748  N N     . ASN F 1 95  ? 36.050  -53.051  -64.311  1.00 40.92  ? 92  ASN F N     1 
ATOM 7749  C CA    . ASN F 1 95  ? 37.386  -53.211  -64.875  1.00 50.10  ? 92  ASN F CA    1 
ATOM 7750  C C     . ASN F 1 95  ? 38.414  -52.848  -63.816  1.00 44.58  ? 92  ASN F C     1 
ATOM 7751  O O     . ASN F 1 95  ? 38.354  -51.757  -63.238  1.00 51.16  ? 92  ASN F O     1 
ATOM 7752  C CB    . ASN F 1 95  ? 37.565  -52.342  -66.124  1.00 42.49  ? 92  ASN F CB    1 
ATOM 7753  C CG    . ASN F 1 95  ? 38.927  -52.521  -66.767  1.00 58.11  ? 92  ASN F CG    1 
ATOM 7754  O OD1   . ASN F 1 95  ? 39.128  -53.424  -67.583  1.00 66.73  ? 92  ASN F OD1   1 
ATOM 7755  N ND2   . ASN F 1 95  ? 39.872  -51.661  -66.403  1.00 57.75  ? 92  ASN F ND2   1 
ATOM 7756  N N     . VAL F 1 96  ? 39.338  -53.763  -63.543  1.00 41.54  ? 93  VAL F N     1 
ATOM 7757  C CA    . VAL F 1 96  ? 40.428  -53.491  -62.612  1.00 42.80  ? 93  VAL F CA    1 
ATOM 7758  C C     . VAL F 1 96  ? 41.465  -52.628  -63.321  1.00 47.18  ? 93  VAL F C     1 
ATOM 7759  O O     . VAL F 1 96  ? 42.111  -53.073  -64.275  1.00 53.10  ? 93  VAL F O     1 
ATOM 7760  C CB    . VAL F 1 96  ? 41.053  -54.791  -62.092  1.00 29.86  ? 93  VAL F CB    1 
ATOM 7761  C CG1   . VAL F 1 96  ? 42.256  -54.480  -61.220  1.00 36.69  ? 93  VAL F CG1   1 
ATOM 7762  C CG2   . VAL F 1 96  ? 40.025  -55.598  -61.319  1.00 26.04  ? 93  VAL F CG2   1 
ATOM 7763  N N     . ASP F 1 97  ? 41.640  -51.396  -62.839  1.00 42.69  ? 94  ASP F N     1 
ATOM 7764  C CA    . ASP F 1 97  ? 42.542  -50.470  -63.512  1.00 43.57  ? 94  ASP F CA    1 
ATOM 7765  C C     . ASP F 1 97  ? 43.995  -50.890  -63.339  1.00 44.51  ? 94  ASP F C     1 
ATOM 7766  O O     . ASP F 1 97  ? 44.773  -50.858  -64.299  1.00 48.97  ? 94  ASP F O     1 
ATOM 7767  C CB    . ASP F 1 97  ? 42.333  -49.055  -62.978  1.00 45.04  ? 94  ASP F CB    1 
ATOM 7768  C CG    . ASP F 1 97  ? 41.095  -48.396  -63.545  1.00 49.41  ? 94  ASP F CG    1 
ATOM 7769  O OD1   . ASP F 1 97  ? 40.612  -48.851  -64.601  1.00 64.22  ? 94  ASP F OD1   1 
ATOM 7770  O OD2   . ASP F 1 97  ? 40.607  -47.422  -62.936  1.00 51.10  ? 94  ASP F OD2   1 
ATOM 7771  N N     . PHE F 1 98  ? 44.376  -51.301  -62.134  1.00 52.96  ? 95  PHE F N     1 
ATOM 7772  C CA    . PHE F 1 98  ? 45.760  -51.664  -61.880  1.00 49.18  ? 95  PHE F CA    1 
ATOM 7773  C C     . PHE F 1 98  ? 45.841  -52.474  -60.598  1.00 45.90  ? 95  PHE F C     1 
ATOM 7774  O O     . PHE F 1 98  ? 44.983  -52.359  -59.719  1.00 46.76  ? 95  PHE F O     1 
ATOM 7775  C CB    . PHE F 1 98  ? 46.648  -50.420  -61.767  1.00 56.49  ? 95  PHE F CB    1 
ATOM 7776  C CG    . PHE F 1 98  ? 46.273  -49.513  -60.628  1.00 57.44  ? 95  PHE F CG    1 
ATOM 7777  C CD1   . PHE F 1 98  ? 45.311  -48.530  -60.794  1.00 62.70  ? 95  PHE F CD1   1 
ATOM 7778  C CD2   . PHE F 1 98  ? 46.879  -49.647  -59.391  1.00 48.21  ? 95  PHE F CD2   1 
ATOM 7779  C CE1   . PHE F 1 98  ? 44.963  -47.698  -59.746  1.00 60.94  ? 95  PHE F CE1   1 
ATOM 7780  C CE2   . PHE F 1 98  ? 46.532  -48.820  -58.341  1.00 51.20  ? 95  PHE F CE2   1 
ATOM 7781  C CZ    . PHE F 1 98  ? 45.575  -47.844  -58.519  1.00 53.11  ? 95  PHE F CZ    1 
ATOM 7782  N N     . VAL F 1 99  ? 46.885  -53.292  -60.507  1.00 49.64  ? 96  VAL F N     1 
ATOM 7783  C CA    . VAL F 1 99  ? 47.261  -53.953  -59.264  1.00 48.62  ? 96  VAL F CA    1 
ATOM 7784  C C     . VAL F 1 99  ? 48.773  -53.837  -59.148  1.00 54.31  ? 96  VAL F C     1 
ATOM 7785  O O     . VAL F 1 99  ? 49.516  -54.551  -59.829  1.00 66.08  ? 96  VAL F O     1 
ATOM 7786  C CB    . VAL F 1 99  ? 46.808  -55.423  -59.233  1.00 42.46  ? 96  VAL F CB    1 
ATOM 7787  C CG1   . VAL F 1 99  ? 47.330  -56.108  -57.986  1.00 44.33  ? 96  VAL F CG1   1 
ATOM 7788  C CG2   . VAL F 1 99  ? 45.292  -55.520  -59.294  1.00 37.83  ? 96  VAL F CG2   1 
ATOM 7789  N N     . ASP F 1 100 ? 49.242  -52.946  -58.284  1.00 58.32  ? 97  ASP F N     1 
ATOM 7790  C CA    . ASP F 1 100 ? 50.664  -52.683  -58.145  1.00 68.88  ? 97  ASP F CA    1 
ATOM 7791  C C     . ASP F 1 100 ? 51.164  -53.125  -56.778  1.00 67.08  ? 97  ASP F C     1 
ATOM 7792  O O     . ASP F 1 100 ? 50.440  -53.071  -55.779  1.00 63.14  ? 97  ASP F O     1 
ATOM 7793  C CB    . ASP F 1 100 ? 50.974  -51.198  -58.363  1.00 68.84  ? 97  ASP F CB    1 
ATOM 7794  C CG    . ASP F 1 100 ? 50.729  -50.760  -59.794  1.00 69.27  ? 97  ASP F CG    1 
ATOM 7795  O OD1   . ASP F 1 100 ? 51.103  -51.514  -60.718  1.00 69.20  ? 97  ASP F OD1   1 
ATOM 7796  O OD2   . ASP F 1 100 ? 50.162  -49.667  -59.996  1.00 77.82  ? 97  ASP F OD2   1 
ATOM 7797  N N     . LEU F 1 101 ? 52.418  -53.566  -56.756  1.00 67.93  ? 98  LEU F N     1 
ATOM 7798  C CA    . LEU F 1 101 ? 53.089  -54.063  -55.561  1.00 67.38  ? 98  LEU F CA    1 
ATOM 7799  C C     . LEU F 1 101 ? 54.293  -53.170  -55.295  1.00 69.23  ? 98  LEU F C     1 
ATOM 7800  O O     . LEU F 1 101 ? 55.235  -53.138  -56.094  1.00 74.24  ? 98  LEU F O     1 
ATOM 7801  C CB    . LEU F 1 101 ? 53.509  -55.522  -55.738  1.00 67.13  ? 98  LEU F CB    1 
ATOM 7802  C CG    . LEU F 1 101 ? 54.283  -56.178  -54.593  1.00 64.77  ? 98  LEU F CG    1 
ATOM 7803  C CD1   . LEU F 1 101 ? 53.505  -56.085  -53.292  1.00 64.56  ? 98  LEU F CD1   1 
ATOM 7804  C CD2   . LEU F 1 101 ? 54.611  -57.626  -54.931  1.00 47.83  ? 98  LEU F CD2   1 
ATOM 7805  N N     . ASN F 1 102 ? 54.256  -52.436  -54.185  1.00 77.60  ? 99  ASN F N     1 
ATOM 7806  C CA    . ASN F 1 102 ? 55.335  -51.540  -53.781  1.00 82.81  ? 99  ASN F CA    1 
ATOM 7807  C C     . ASN F 1 102 ? 55.857  -51.999  -52.428  1.00 84.35  ? 99  ASN F C     1 
ATOM 7808  O O     . ASN F 1 102 ? 55.171  -51.842  -51.411  1.00 83.48  ? 99  ASN F O     1 
ATOM 7809  C CB    . ASN F 1 102 ? 54.861  -50.088  -53.710  1.00 89.07  ? 99  ASN F CB    1 
ATOM 7810  C CG    . ASN F 1 102 ? 54.845  -49.404  -55.064  1.00 101.87 ? 99  ASN F CG    1 
ATOM 7811  O OD1   . ASN F 1 102 ? 55.769  -49.559  -55.863  1.00 105.13 ? 99  ASN F OD1   1 
ATOM 7812  N ND2   . ASN F 1 102 ? 53.792  -48.634  -55.324  1.00 82.76  ? 99  ASN F ND2   1 
ATOM 7813  N N     . ASN F 1 103 ? 57.080  -52.529  -52.419  1.00 93.49  ? 100 ASN F N     1 
ATOM 7814  C CA    . ASN F 1 103 ? 57.757  -53.046  -51.226  1.00 94.11  ? 100 ASN F CA    1 
ATOM 7815  C C     . ASN F 1 103 ? 56.796  -53.766  -50.276  1.00 79.10  ? 100 ASN F C     1 
ATOM 7816  O O     . ASN F 1 103 ? 56.666  -53.436  -49.098  1.00 87.35  ? 100 ASN F O     1 
ATOM 7817  C CB    . ASN F 1 103 ? 58.543  -51.944  -50.498  1.00 95.32  ? 100 ASN F CB    1 
ATOM 7818  C CG    . ASN F 1 103 ? 57.736  -50.667  -50.273  1.00 99.27  ? 100 ASN F CG    1 
ATOM 7819  O OD1   . ASN F 1 103 ? 57.328  -49.998  -51.223  1.00 103.95 ? 100 ASN F OD1   1 
ATOM 7820  N ND2   . ASN F 1 103 ? 57.471  -50.348  -49.013  1.00 104.77 ? 100 ASN F ND2   1 
ATOM 7821  N N     . GLY F 1 104 ? 56.124  -54.780  -50.823  1.00 76.77  ? 101 GLY F N     1 
ATOM 7822  C CA    . GLY F 1 104 ? 55.327  -55.694  -50.032  1.00 65.80  ? 101 GLY F CA    1 
ATOM 7823  C C     . GLY F 1 104 ? 53.899  -55.271  -49.765  1.00 73.69  ? 101 GLY F C     1 
ATOM 7824  O O     . GLY F 1 104 ? 53.166  -56.018  -49.104  1.00 72.83  ? 101 GLY F O     1 
ATOM 7825  N N     . LYS F 1 105 ? 53.479  -54.104  -50.242  1.00 80.26  ? 102 LYS F N     1 
ATOM 7826  C CA    . LYS F 1 105 ? 52.121  -53.617  -50.051  1.00 77.56  ? 102 LYS F CA    1 
ATOM 7827  C C     . LYS F 1 105 ? 51.426  -53.502  -51.402  1.00 76.47  ? 102 LYS F C     1 
ATOM 7828  O O     . LYS F 1 105 ? 52.054  -53.152  -52.407  1.00 71.03  ? 102 LYS F O     1 
ATOM 7829  C CB    . LYS F 1 105 ? 52.127  -52.260  -49.335  1.00 78.99  ? 102 LYS F CB    1 
ATOM 7830  C CG    . LYS F 1 105 ? 52.789  -52.297  -47.966  1.00 82.75  ? 102 LYS F CG    1 
ATOM 7831  C CD    . LYS F 1 105 ? 52.789  -50.935  -47.296  1.00 93.43  ? 102 LYS F CD    1 
ATOM 7832  C CE    . LYS F 1 105 ? 53.442  -51.013  -45.924  1.00 109.66 ? 102 LYS F CE    1 
ATOM 7833  N NZ    . LYS F 1 105 ? 53.492  -49.692  -45.240  1.00 108.57 ? 102 LYS F NZ    1 
ATOM 7834  N N     . PHE F 1 106 ? 50.129  -53.795  -51.420  1.00 69.61  ? 103 PHE F N     1 
ATOM 7835  C CA    . PHE F 1 106 ? 49.340  -53.800  -52.645  1.00 64.86  ? 103 PHE F CA    1 
ATOM 7836  C C     . PHE F 1 106 ? 48.457  -52.563  -52.720  1.00 63.71  ? 103 PHE F C     1 
ATOM 7837  O O     . PHE F 1 106 ? 47.859  -52.150  -51.722  1.00 65.95  ? 103 PHE F O     1 
ATOM 7838  C CB    . PHE F 1 106 ? 48.468  -55.055  -52.740  1.00 65.06  ? 103 PHE F CB    1 
ATOM 7839  C CG    . PHE F 1 106 ? 49.217  -56.290  -53.146  1.00 70.13  ? 103 PHE F CG    1 
ATOM 7840  C CD1   . PHE F 1 106 ? 49.674  -56.435  -54.444  1.00 56.58  ? 103 PHE F CD1   1 
ATOM 7841  C CD2   . PHE F 1 106 ? 49.461  -57.307  -52.236  1.00 70.57  ? 103 PHE F CD2   1 
ATOM 7842  C CE1   . PHE F 1 106 ? 50.362  -57.565  -54.829  1.00 54.72  ? 103 PHE F CE1   1 
ATOM 7843  C CE2   . PHE F 1 106 ? 50.151  -58.443  -52.617  1.00 65.73  ? 103 PHE F CE2   1 
ATOM 7844  C CZ    . PHE F 1 106 ? 50.602  -58.571  -53.915  1.00 53.73  ? 103 PHE F CZ    1 
ATOM 7845  N N     . TYR F 1 107 ? 48.393  -51.967  -53.910  1.00 60.78  ? 104 TYR F N     1 
ATOM 7846  C CA    . TYR F 1 107 ? 47.588  -50.779  -54.168  1.00 61.74  ? 104 TYR F CA    1 
ATOM 7847  C C     . TYR F 1 107 ? 46.726  -51.069  -55.387  1.00 55.88  ? 104 TYR F C     1 
ATOM 7848  O O     . TYR F 1 107 ? 47.256  -51.307  -56.478  1.00 58.68  ? 104 TYR F O     1 
ATOM 7849  C CB    . TYR F 1 107 ? 48.456  -49.530  -54.401  1.00 56.30  ? 104 TYR F CB    1 
ATOM 7850  C CG    . TYR F 1 107 ? 49.447  -49.189  -53.294  1.00 68.43  ? 104 TYR F CG    1 
ATOM 7851  C CD1   . TYR F 1 107 ? 50.444  -50.081  -52.917  1.00 69.54  ? 104 TYR F CD1   1 
ATOM 7852  C CD2   . TYR F 1 107 ? 49.381  -47.970  -52.630  1.00 63.65  ? 104 TYR F CD2   1 
ATOM 7853  C CE1   . TYR F 1 107 ? 51.341  -49.777  -51.916  1.00 78.32  ? 104 TYR F CE1   1 
ATOM 7854  C CE2   . TYR F 1 107 ? 50.280  -47.654  -51.625  1.00 67.84  ? 104 TYR F CE2   1 
ATOM 7855  C CZ    . TYR F 1 107 ? 51.258  -48.563  -51.273  1.00 78.72  ? 104 TYR F CZ    1 
ATOM 7856  O OH    . TYR F 1 107 ? 52.157  -48.265  -50.274  1.00 71.11  ? 104 TYR F OH    1 
ATOM 7857  N N     . VAL F 1 108 ? 45.406  -51.070  -55.204  1.00 49.86  ? 105 VAL F N     1 
ATOM 7858  C CA    . VAL F 1 108 ? 44.472  -51.556  -56.213  1.00 50.06  ? 105 VAL F CA    1 
ATOM 7859  C C     . VAL F 1 108 ? 43.400  -50.498  -56.441  1.00 57.13  ? 105 VAL F C     1 
ATOM 7860  O O     . VAL F 1 108 ? 42.829  -49.969  -55.481  1.00 56.75  ? 105 VAL F O     1 
ATOM 7861  C CB    . VAL F 1 108 ? 43.837  -52.899  -55.799  1.00 50.83  ? 105 VAL F CB    1 
ATOM 7862  C CG1   . VAL F 1 108 ? 42.781  -53.325  -56.806  1.00 36.84  ? 105 VAL F CG1   1 
ATOM 7863  C CG2   . VAL F 1 108 ? 44.906  -53.979  -55.673  1.00 50.50  ? 105 VAL F CG2   1 
ATOM 7864  N N     . GLY F 1 109 ? 43.139  -50.187  -57.709  1.00 62.54  ? 106 GLY F N     1 
ATOM 7865  C CA    . GLY F 1 109 ? 42.026  -49.336  -58.085  1.00 57.18  ? 106 GLY F CA    1 
ATOM 7866  C C     . GLY F 1 109 ? 41.082  -50.044  -59.035  1.00 46.67  ? 106 GLY F C     1 
ATOM 7867  O O     . GLY F 1 109 ? 41.524  -50.649  -60.016  1.00 48.55  ? 106 GLY F O     1 
ATOM 7868  N N     . VAL F 1 110 ? 39.782  -49.986  -58.759  1.00 41.75  ? 107 VAL F N     1 
ATOM 7869  C CA    . VAL F 1 110 ? 38.788  -50.703  -59.550  1.00 47.28  ? 107 VAL F CA    1 
ATOM 7870  C C     . VAL F 1 110 ? 37.610  -49.776  -59.804  1.00 52.26  ? 107 VAL F C     1 
ATOM 7871  O O     . VAL F 1 110 ? 37.080  -49.166  -58.870  1.00 49.88  ? 107 VAL F O     1 
ATOM 7872  C CB    . VAL F 1 110 ? 38.323  -51.995  -58.848  1.00 41.24  ? 107 VAL F CB    1 
ATOM 7873  C CG1   . VAL F 1 110 ? 37.130  -52.600  -59.571  1.00 46.11  ? 107 VAL F CG1   1 
ATOM 7874  C CG2   . VAL F 1 110 ? 39.470  -52.999  -58.773  1.00 40.07  ? 107 VAL F CG2   1 
ATOM 7875  N N     . CYS F 1 111 ? 37.198  -49.676  -61.063  1.00 50.94  ? 108 CYS F N     1 
ATOM 7876  C CA    . CYS F 1 111 ? 36.023  -48.910  -61.444  1.00 54.89  ? 108 CYS F CA    1 
ATOM 7877  C C     . CYS F 1 111 ? 34.881  -49.860  -61.776  1.00 44.47  ? 108 CYS F C     1 
ATOM 7878  O O     . CYS F 1 111 ? 35.100  -50.986  -62.231  1.00 41.69  ? 108 CYS F O     1 
ATOM 7879  C CB    . CYS F 1 111 ? 36.313  -48.013  -62.652  1.00 53.51  ? 108 CYS F CB    1 
ATOM 7880  S SG    . CYS F 1 111 ? 36.572  -48.912  -64.203  1.00 80.98  ? 108 CYS F SG    1 
ATOM 7881  N N     . ALA F 1 112 ? 33.658  -49.394  -61.540  1.00 42.61  ? 109 ALA F N     1 
ATOM 7882  C CA    . ALA F 1 112 ? 32.461  -50.161  -61.844  1.00 47.51  ? 109 ALA F CA    1 
ATOM 7883  C C     . ALA F 1 112 ? 31.415  -49.231  -62.437  1.00 48.02  ? 109 ALA F C     1 
ATOM 7884  O O     . ALA F 1 112 ? 31.331  -48.056  -62.070  1.00 44.22  ? 109 ALA F O     1 
ATOM 7885  C CB    . ALA F 1 112 ? 31.908  -50.867  -60.596  1.00 50.73  ? 109 ALA F CB    1 
ATOM 7886  N N     . PHE F 1 113 ? 30.621  -49.765  -63.363  1.00 40.65  ? 110 PHE F N     1 
ATOM 7887  C CA    . PHE F 1 113 ? 29.560  -49.012  -64.026  1.00 47.09  ? 110 PHE F CA    1 
ATOM 7888  C C     . PHE F 1 113 ? 28.224  -49.636  -63.650  1.00 49.10  ? 110 PHE F C     1 
ATOM 7889  O O     . PHE F 1 113 ? 27.882  -50.720  -64.134  1.00 45.76  ? 110 PHE F O     1 
ATOM 7890  C CB    . PHE F 1 113 ? 29.756  -49.008  -65.542  1.00 40.72  ? 110 PHE F CB    1 
ATOM 7891  C CG    . PHE F 1 113 ? 31.022  -48.336  -65.984  1.00 44.02  ? 110 PHE F CG    1 
ATOM 7892  C CD1   . PHE F 1 113 ? 31.035  -46.989  -66.309  1.00 37.78  ? 110 PHE F CD1   1 
ATOM 7893  C CD2   . PHE F 1 113 ? 32.205  -49.051  -66.068  1.00 49.65  ? 110 PHE F CD2   1 
ATOM 7894  C CE1   . PHE F 1 113 ? 32.204  -46.371  -66.719  1.00 44.65  ? 110 PHE F CE1   1 
ATOM 7895  C CE2   . PHE F 1 113 ? 33.375  -48.438  -66.469  1.00 58.50  ? 110 PHE F CE2   1 
ATOM 7896  C CZ    . PHE F 1 113 ? 33.375  -47.095  -66.794  1.00 56.54  ? 110 PHE F CZ    1 
ATOM 7897  N N     . VAL F 1 114 ? 27.457  -48.938  -62.816  1.00 43.22  ? 111 VAL F N     1 
ATOM 7898  C CA    . VAL F 1 114 ? 26.198  -49.447  -62.286  1.00 42.51  ? 111 VAL F CA    1 
ATOM 7899  C C     . VAL F 1 114 ? 25.063  -48.667  -62.928  1.00 44.42  ? 111 VAL F C     1 
ATOM 7900  O O     . VAL F 1 114 ? 25.109  -47.433  -62.996  1.00 44.73  ? 111 VAL F O     1 
ATOM 7901  C CB    . VAL F 1 114 ? 26.145  -49.330  -60.753  1.00 44.32  ? 111 VAL F CB    1 
ATOM 7902  C CG1   . VAL F 1 114 ? 24.822  -49.867  -60.226  1.00 48.84  ? 111 VAL F CG1   1 
ATOM 7903  C CG2   . VAL F 1 114 ? 27.325  -50.053  -60.119  1.00 36.44  ? 111 VAL F CG2   1 
ATOM 7904  N N     . ARG F 1 115 ? 24.046  -49.385  -63.401  1.00 45.22  ? 112 ARG F N     1 
ATOM 7905  C CA    . ARG F 1 115 ? 22.884  -48.780  -64.038  1.00 52.87  ? 112 ARG F CA    1 
ATOM 7906  C C     . ARG F 1 115 ? 21.639  -49.163  -63.252  1.00 54.57  ? 112 ARG F C     1 
ATOM 7907  O O     . ARG F 1 115 ? 21.298  -50.348  -63.161  1.00 47.56  ? 112 ARG F O     1 
ATOM 7908  C CB    . ARG F 1 115 ? 22.756  -49.219  -65.499  1.00 49.95  ? 112 ARG F CB    1 
ATOM 7909  C CG    . ARG F 1 115 ? 21.450  -48.789  -66.149  1.00 57.34  ? 112 ARG F CG    1 
ATOM 7910  C CD    . ARG F 1 115 ? 21.342  -49.271  -67.584  1.00 54.68  ? 112 ARG F CD    1 
ATOM 7911  N NE    . ARG F 1 115 ? 19.954  -49.508  -67.969  1.00 57.60  ? 112 ARG F NE    1 
ATOM 7912  C CZ    . ARG F 1 115 ? 19.442  -49.187  -69.153  1.00 77.43  ? 112 ARG F CZ    1 
ATOM 7913  N NH1   . ARG F 1 115 ? 20.206  -48.607  -70.072  1.00 62.62  ? 112 ARG F NH1   1 
ATOM 7914  N NH2   . ARG F 1 115 ? 18.166  -49.439  -69.417  1.00 72.86  ? 112 ARG F NH2   1 
ATOM 7915  N N     . VAL F 1 116 ? 20.974  -48.163  -62.676  1.00 51.12  ? 113 VAL F N     1 
ATOM 7916  C CA    . VAL F 1 116 ? 19.724  -48.355  -61.949  1.00 54.43  ? 113 VAL F CA    1 
ATOM 7917  C C     . VAL F 1 116 ? 18.563  -48.126  -62.903  1.00 50.82  ? 113 VAL F C     1 
ATOM 7918  O O     . VAL F 1 116 ? 18.593  -47.205  -63.725  1.00 53.86  ? 113 VAL F O     1 
ATOM 7919  C CB    . VAL F 1 116 ? 19.635  -47.408  -60.737  1.00 57.30  ? 113 VAL F CB    1 
ATOM 7920  C CG1   . VAL F 1 116 ? 18.288  -47.555  -60.040  1.00 50.18  ? 113 VAL F CG1   1 
ATOM 7921  C CG2   . VAL F 1 116 ? 20.765  -47.677  -59.768  1.00 55.77  ? 113 VAL F CG2   1 
ATOM 7922  N N     . GLN F 1 117 ? 17.534  -48.964  -62.798  1.00 43.48  ? 114 GLN F N     1 
ATOM 7923  C CA    . GLN F 1 117 ? 16.338  -48.829  -63.615  1.00 49.52  ? 114 GLN F CA    1 
ATOM 7924  C C     . GLN F 1 117 ? 15.100  -48.895  -62.734  1.00 56.56  ? 114 GLN F C     1 
ATOM 7925  O O     . GLN F 1 117 ? 15.046  -49.674  -61.777  1.00 59.29  ? 114 GLN F O     1 
ATOM 7926  C CB    . GLN F 1 117 ? 16.268  -49.912  -64.695  1.00 53.80  ? 114 GLN F CB    1 
ATOM 7927  C CG    . GLN F 1 117 ? 15.141  -49.715  -65.694  1.00 53.51  ? 114 GLN F CG    1 
ATOM 7928  C CD    . GLN F 1 117 ? 14.994  -50.885  -66.640  1.00 60.01  ? 114 GLN F CD    1 
ATOM 7929  O OE1   . GLN F 1 117 ? 15.597  -50.904  -67.712  1.00 72.78  ? 114 GLN F OE1   1 
ATOM 7930  N NE2   . GLN F 1 117 ? 14.192  -51.871  -66.251  1.00 64.66  ? 114 GLN F NE2   1 
ATOM 7931  N N     . LEU F 1 118 ? 14.107  -48.078  -63.069  1.00 56.11  ? 115 LEU F N     1 
ATOM 7932  C CA    . LEU F 1 118 ? 12.828  -48.076  -62.380  1.00 55.27  ? 115 LEU F CA    1 
ATOM 7933  C C     . LEU F 1 118 ? 11.845  -48.988  -63.103  1.00 58.44  ? 115 LEU F C     1 
ATOM 7934  O O     . LEU F 1 118 ? 12.096  -49.462  -64.214  1.00 72.22  ? 115 LEU F O     1 
ATOM 7935  C CB    . LEU F 1 118 ? 12.260  -46.660  -62.287  1.00 57.35  ? 115 LEU F CB    1 
ATOM 7936  C CG    . LEU F 1 118 ? 13.112  -45.625  -61.554  1.00 53.77  ? 115 LEU F CG    1 
ATOM 7937  C CD1   . LEU F 1 118 ? 12.375  -44.299  -61.479  1.00 60.92  ? 115 LEU F CD1   1 
ATOM 7938  C CD2   . LEU F 1 118 ? 13.492  -46.123  -60.169  1.00 60.34  ? 115 LEU F CD2   1 
ATOM 7939  N N     . LYS F 1 119 ? 10.712  -49.251  -62.447  1.00 61.03  ? 116 LYS F N     1 
ATOM 7940  C CA    . LYS F 1 119 ? 9.735   -50.179  -63.004  1.00 67.13  ? 116 LYS F CA    1 
ATOM 7941  C C     . LYS F 1 119 ? 9.071   -49.658  -64.272  1.00 64.76  ? 116 LYS F C     1 
ATOM 7942  O O     . LYS F 1 119 ? 8.288   -50.394  -64.882  1.00 59.98  ? 116 LYS F O     1 
ATOM 7943  C CB    . LYS F 1 119 ? 8.651   -50.521  -61.975  1.00 63.23  ? 116 LYS F CB    1 
ATOM 7944  C CG    . LYS F 1 119 ? 7.713   -49.374  -61.618  1.00 64.34  ? 116 LYS F CG    1 
ATOM 7945  C CD    . LYS F 1 119 ? 6.554   -49.879  -60.763  1.00 75.39  ? 116 LYS F CD    1 
ATOM 7946  C CE    . LYS F 1 119 ? 5.739   -48.738  -60.177  1.00 83.27  ? 116 LYS F CE    1 
ATOM 7947  N NZ    . LYS F 1 119 ? 4.667   -49.233  -59.263  1.00 90.30  ? 116 LYS F NZ    1 
ATOM 7948  N N     . ASP F 1 120 ? 9.338   -48.415  -64.672  1.00 63.64  ? 117 ASP F N     1 
ATOM 7949  C CA    . ASP F 1 120 ? 8.794   -47.866  -65.906  1.00 69.11  ? 117 ASP F CA    1 
ATOM 7950  C C     . ASP F 1 120 ? 9.816   -47.811  -67.031  1.00 68.92  ? 117 ASP F C     1 
ATOM 7951  O O     . ASP F 1 120 ? 9.501   -47.309  -68.113  1.00 71.07  ? 117 ASP F O     1 
ATOM 7952  C CB    . ASP F 1 120 ? 8.208   -46.473  -65.654  1.00 58.34  ? 117 ASP F CB    1 
ATOM 7953  C CG    . ASP F 1 120 ? 9.274   -45.409  -65.488  1.00 60.19  ? 117 ASP F CG    1 
ATOM 7954  O OD1   . ASP F 1 120 ? 10.321  -45.703  -64.878  1.00 70.80  ? 117 ASP F OD1   1 
ATOM 7955  O OD2   . ASP F 1 120 ? 9.059   -44.273  -65.963  1.00 60.25  ? 117 ASP F OD2   1 
ATOM 7956  N N     . GLY F 1 121 ? 11.023  -48.330  -66.811  1.00 63.68  ? 118 GLY F N     1 
ATOM 7957  C CA    . GLY F 1 121 ? 12.072  -48.301  -67.800  1.00 60.00  ? 118 GLY F CA    1 
ATOM 7958  C C     . GLY F 1 121 ? 13.057  -47.161  -67.641  1.00 60.46  ? 118 GLY F C     1 
ATOM 7959  O O     . GLY F 1 121 ? 14.129  -47.200  -68.257  1.00 65.48  ? 118 GLY F O     1 
ATOM 7960  N N     . SER F 1 122 ? 12.710  -46.140  -66.856  1.00 60.12  ? 119 SER F N     1 
ATOM 7961  C CA    . SER F 1 122 ? 13.637  -45.048  -66.587  1.00 65.21  ? 119 SER F CA    1 
ATOM 7962  C C     . SER F 1 122 ? 14.923  -45.583  -65.971  1.00 60.10  ? 119 SER F C     1 
ATOM 7963  O O     . SER F 1 122 ? 14.905  -46.515  -65.163  1.00 59.84  ? 119 SER F O     1 
ATOM 7964  C CB    . SER F 1 122 ? 12.999  -44.018  -65.655  1.00 57.48  ? 119 SER F CB    1 
ATOM 7965  O OG    . SER F 1 122 ? 13.912  -42.972  -65.368  1.00 72.31  ? 119 SER F OG    1 
ATOM 7966  N N     . TYR F 1 123 ? 16.046  -44.974  -66.340  1.00 54.53  ? 120 TYR F N     1 
ATOM 7967  C CA    . TYR F 1 123 ? 17.340  -45.505  -65.949  1.00 46.00  ? 120 TYR F CA    1 
ATOM 7968  C C     . TYR F 1 123 ? 18.318  -44.372  -65.668  1.00 53.61  ? 120 TYR F C     1 
ATOM 7969  O O     . TYR F 1 123 ? 18.170  -43.258  -66.175  1.00 58.16  ? 120 TYR F O     1 
ATOM 7970  C CB    . TYR F 1 123 ? 17.900  -46.443  -67.033  1.00 52.82  ? 120 TYR F CB    1 
ATOM 7971  C CG    . TYR F 1 123 ? 18.097  -45.797  -68.392  1.00 50.86  ? 120 TYR F CG    1 
ATOM 7972  C CD1   . TYR F 1 123 ? 19.284  -45.148  -68.700  1.00 56.61  ? 120 TYR F CD1   1 
ATOM 7973  C CD2   . TYR F 1 123 ? 17.106  -45.849  -69.370  1.00 45.06  ? 120 TYR F CD2   1 
ATOM 7974  C CE1   . TYR F 1 123 ? 19.483  -44.558  -69.933  1.00 54.18  ? 120 TYR F CE1   1 
ATOM 7975  C CE2   . TYR F 1 123 ? 17.299  -45.261  -70.614  1.00 49.23  ? 120 TYR F CE2   1 
ATOM 7976  C CZ    . TYR F 1 123 ? 18.491  -44.616  -70.887  1.00 54.61  ? 120 TYR F CZ    1 
ATOM 7977  O OH    . TYR F 1 123 ? 18.703  -44.023  -72.113  1.00 56.42  ? 120 TYR F OH    1 
ATOM 7978  N N     . HIS F 1 124 ? 19.305  -44.668  -64.825  1.00 55.36  ? 121 HIS F N     1 
ATOM 7979  C CA    . HIS F 1 124 ? 20.439  -43.787  -64.584  1.00 49.27  ? 121 HIS F CA    1 
ATOM 7980  C C     . HIS F 1 124 ? 21.668  -44.654  -64.367  1.00 54.04  ? 121 HIS F C     1 
ATOM 7981  O O     . HIS F 1 124 ? 21.637  -45.578  -63.548  1.00 56.13  ? 121 HIS F O     1 
ATOM 7982  C CB    . HIS F 1 124 ? 20.203  -42.875  -63.372  1.00 57.13  ? 121 HIS F CB    1 
ATOM 7983  C CG    . HIS F 1 124 ? 19.236  -41.759  -63.627  1.00 58.72  ? 121 HIS F CG    1 
ATOM 7984  N ND1   . HIS F 1 124 ? 19.389  -40.860  -64.661  1.00 62.38  ? 121 HIS F ND1   1 
ATOM 7985  C CD2   . HIS F 1 124 ? 18.110  -41.390  -62.973  1.00 57.32  ? 121 HIS F CD2   1 
ATOM 7986  C CE1   . HIS F 1 124 ? 18.395  -39.990  -64.636  1.00 61.02  ? 121 HIS F CE1   1 
ATOM 7987  N NE2   . HIS F 1 124 ? 17.604  -40.290  -63.623  1.00 57.10  ? 121 HIS F NE2   1 
ATOM 7988  N N     . GLU F 1 125 ? 22.743  -44.357  -65.092  1.00 56.84  ? 122 GLU F N     1 
ATOM 7989  C CA    . GLU F 1 125 ? 23.980  -45.120  -65.018  1.00 51.29  ? 122 GLU F CA    1 
ATOM 7990  C C     . GLU F 1 125 ? 25.122  -44.186  -64.645  1.00 53.71  ? 122 GLU F C     1 
ATOM 7991  O O     . GLU F 1 125 ? 25.213  -43.068  -65.161  1.00 52.26  ? 122 GLU F O     1 
ATOM 7992  C CB    . GLU F 1 125 ? 24.267  -45.829  -66.353  1.00 52.55  ? 122 GLU F CB    1 
ATOM 7993  C CG    . GLU F 1 125 ? 25.562  -46.631  -66.388  1.00 55.04  ? 122 GLU F CG    1 
ATOM 7994  C CD    . GLU F 1 125 ? 25.762  -47.373  -67.700  1.00 52.63  ? 122 GLU F CD    1 
ATOM 7995  O OE1   . GLU F 1 125 ? 25.138  -46.989  -68.711  1.00 58.94  ? 122 GLU F OE1   1 
ATOM 7996  O OE2   . GLU F 1 125 ? 26.546  -48.344  -67.723  1.00 60.03  ? 122 GLU F OE2   1 
ATOM 7997  N N     . ASP F 1 126 ? 25.984  -44.641  -63.739  1.00 46.27  ? 123 ASP F N     1 
ATOM 7998  C CA    . ASP F 1 126 ? 27.103  -43.833  -63.277  1.00 46.71  ? 123 ASP F CA    1 
ATOM 7999  C C     . ASP F 1 126 ? 28.264  -44.759  -62.935  1.00 42.56  ? 123 ASP F C     1 
ATOM 8000  O O     . ASP F 1 126 ? 28.160  -45.984  -63.038  1.00 51.68  ? 123 ASP F O     1 
ATOM 8001  C CB    . ASP F 1 126 ? 26.695  -42.962  -62.086  1.00 50.39  ? 123 ASP F CB    1 
ATOM 8002  C CG    . ASP F 1 126 ? 27.342  -41.594  -62.121  1.00 59.00  ? 123 ASP F CG    1 
ATOM 8003  O OD1   . ASP F 1 126 ? 28.588  -41.525  -62.158  1.00 54.70  ? 123 ASP F OD1   1 
ATOM 8004  O OD2   . ASP F 1 126 ? 26.601  -40.588  -62.116  1.00 67.90  ? 123 ASP F OD2   1 
ATOM 8005  N N     . VAL F 1 127 ? 29.378  -44.163  -62.522  1.00 44.85  ? 124 VAL F N     1 
ATOM 8006  C CA    . VAL F 1 127 ? 30.608  -44.894  -62.243  1.00 45.98  ? 124 VAL F CA    1 
ATOM 8007  C C     . VAL F 1 127 ? 30.842  -44.942  -60.743  1.00 57.86  ? 124 VAL F C     1 
ATOM 8008  O O     . VAL F 1 127 ? 30.637  -43.948  -60.039  1.00 60.11  ? 124 VAL F O     1 
ATOM 8009  C CB    . VAL F 1 127 ? 31.821  -44.254  -62.942  1.00 43.87  ? 124 VAL F CB    1 
ATOM 8010  C CG1   . VAL F 1 127 ? 33.058  -45.130  -62.782  1.00 51.03  ? 124 VAL F CG1   1 
ATOM 8011  C CG2   . VAL F 1 127 ? 31.515  -44.030  -64.383  1.00 65.98  ? 124 VAL F CG2   1 
ATOM 8012  N N     . GLY F 1 128 ? 31.270  -46.102  -60.258  1.00 52.80  ? 125 GLY F N     1 
ATOM 8013  C CA    . GLY F 1 128 ? 31.806  -46.197  -58.919  1.00 49.10  ? 125 GLY F CA    1 
ATOM 8014  C C     . GLY F 1 128 ? 33.263  -46.586  -58.962  1.00 48.83  ? 125 GLY F C     1 
ATOM 8015  O O     . GLY F 1 128 ? 33.715  -47.193  -59.937  1.00 54.71  ? 125 GLY F O     1 
ATOM 8016  N N     . TYR F 1 129 ? 34.009  -46.245  -57.918  1.00 52.43  ? 126 TYR F N     1 
ATOM 8017  C CA    . TYR F 1 129 ? 35.408  -46.626  -57.822  1.00 48.82  ? 126 TYR F CA    1 
ATOM 8018  C C     . TYR F 1 129 ? 35.670  -47.321  -56.500  1.00 51.96  ? 126 TYR F C     1 
ATOM 8019  O O     . TYR F 1 129 ? 34.958  -47.104  -55.523  1.00 54.86  ? 126 TYR F O     1 
ATOM 8020  C CB    . TYR F 1 129 ? 36.338  -45.416  -57.951  1.00 43.11  ? 126 TYR F CB    1 
ATOM 8021  C CG    . TYR F 1 129 ? 37.633  -45.734  -58.657  1.00 51.53  ? 126 TYR F CG    1 
ATOM 8022  C CD1   . TYR F 1 129 ? 37.661  -46.043  -60.011  1.00 56.26  ? 126 TYR F CD1   1 
ATOM 8023  C CD2   . TYR F 1 129 ? 38.825  -45.788  -57.947  1.00 58.31  ? 126 TYR F CD2   1 
ATOM 8024  C CE1   . TYR F 1 129 ? 38.856  -46.342  -60.644  1.00 57.41  ? 126 TYR F CE1   1 
ATOM 8025  C CE2   . TYR F 1 129 ? 40.013  -46.094  -58.565  1.00 60.05  ? 126 TYR F CE2   1 
ATOM 8026  C CZ    . TYR F 1 129 ? 40.027  -46.371  -59.911  1.00 59.11  ? 126 TYR F CZ    1 
ATOM 8027  O OH    . TYR F 1 129 ? 41.231  -46.670  -60.502  1.00 57.90  ? 126 TYR F OH    1 
ATOM 8028  N N     . GLY F 1 130 ? 36.683  -48.178  -56.490  1.00 45.67  ? 127 GLY F N     1 
ATOM 8029  C CA    . GLY F 1 130 ? 37.048  -48.889  -55.285  1.00 48.42  ? 127 GLY F CA    1 
ATOM 8030  C C     . GLY F 1 130 ? 38.548  -48.867  -55.081  1.00 51.53  ? 127 GLY F C     1 
ATOM 8031  O O     . GLY F 1 130 ? 39.308  -49.148  -56.013  1.00 52.44  ? 127 GLY F O     1 
ATOM 8032  N N     . VAL F 1 131 ? 38.990  -48.541  -53.868  1.00 52.79  ? 128 VAL F N     1 
ATOM 8033  C CA    . VAL F 1 131 ? 40.397  -48.309  -53.575  1.00 48.56  ? 128 VAL F CA    1 
ATOM 8034  C C     . VAL F 1 131 ? 40.802  -49.198  -52.408  1.00 52.57  ? 128 VAL F C     1 
ATOM 8035  O O     . VAL F 1 131 ? 40.031  -49.384  -51.461  1.00 53.22  ? 128 VAL F O     1 
ATOM 8036  C CB    . VAL F 1 131 ? 40.649  -46.821  -53.248  1.00 48.54  ? 128 VAL F CB    1 
ATOM 8037  C CG1   . VAL F 1 131 ? 42.119  -46.566  -52.989  1.00 60.35  ? 128 VAL F CG1   1 
ATOM 8038  C CG2   . VAL F 1 131 ? 40.146  -45.932  -54.372  1.00 56.22  ? 128 VAL F CG2   1 
ATOM 8039  N N     . SER F 1 132 ? 42.018  -49.738  -52.474  1.00 51.30  ? 129 SER F N     1 
ATOM 8040  C CA    . SER F 1 132 ? 42.608  -50.472  -51.356  1.00 54.19  ? 129 SER F CA    1 
ATOM 8041  C C     . SER F 1 132 ? 44.115  -50.271  -51.412  1.00 56.47  ? 129 SER F C     1 
ATOM 8042  O O     . SER F 1 132 ? 44.781  -50.858  -52.267  1.00 57.58  ? 129 SER F O     1 
ATOM 8043  C CB    . SER F 1 132 ? 42.254  -51.955  -51.421  1.00 53.00  ? 129 SER F CB    1 
ATOM 8044  O OG    . SER F 1 132 ? 43.062  -52.697  -50.524  1.00 52.46  ? 129 SER F OG    1 
ATOM 8045  N N     . GLU F 1 133 ? 44.654  -49.473  -50.494  1.00 59.96  ? 130 GLU F N     1 
ATOM 8046  C CA    . GLU F 1 133 ? 46.075  -49.158  -50.459  1.00 69.32  ? 130 GLU F CA    1 
ATOM 8047  C C     . GLU F 1 133 ? 46.670  -49.579  -49.122  1.00 73.01  ? 130 GLU F C     1 
ATOM 8048  O O     . GLU F 1 133 ? 46.099  -49.289  -48.066  1.00 70.05  ? 130 GLU F O     1 
ATOM 8049  C CB    . GLU F 1 133 ? 46.298  -47.660  -50.686  1.00 70.29  ? 130 GLU F CB    1 
ATOM 8050  C CG    . GLU F 1 133 ? 45.327  -47.026  -51.664  1.00 71.22  ? 130 GLU F CG    1 
ATOM 8051  C CD    . GLU F 1 133 ? 45.727  -45.629  -52.122  1.00 76.79  ? 130 GLU F CD    1 
ATOM 8052  O OE1   . GLU F 1 133 ? 46.939  -45.362  -52.250  1.00 74.64  ? 130 GLU F OE1   1 
ATOM 8053  O OE2   . GLU F 1 133 ? 44.822  -44.792  -52.326  1.00 79.65  ? 130 GLU F OE2   1 
ATOM 8054  N N     . GLY F 1 134 ? 47.802  -50.283  -49.174  1.00 70.24  ? 131 GLY F N     1 
ATOM 8055  C CA    . GLY F 1 134 ? 48.593  -50.601  -48.004  1.00 69.42  ? 131 GLY F CA    1 
ATOM 8056  C C     . GLY F 1 134 ? 48.544  -52.052  -47.577  1.00 66.72  ? 131 GLY F C     1 
ATOM 8057  O O     . GLY F 1 134 ? 49.478  -52.519  -46.911  1.00 72.68  ? 131 GLY F O     1 
ATOM 8058  N N     . LEU F 1 135 ? 47.494  -52.780  -47.949  1.00 66.82  ? 132 LEU F N     1 
ATOM 8059  C CA    . LEU F 1 135 ? 47.328  -54.154  -47.499  1.00 66.86  ? 132 LEU F CA    1 
ATOM 8060  C C     . LEU F 1 135 ? 48.377  -55.071  -48.122  1.00 66.62  ? 132 LEU F C     1 
ATOM 8061  O O     . LEU F 1 135 ? 48.820  -54.870  -49.255  1.00 77.05  ? 132 LEU F O     1 
ATOM 8062  C CB    . LEU F 1 135 ? 45.929  -54.659  -47.847  1.00 67.93  ? 132 LEU F CB    1 
ATOM 8063  C CG    . LEU F 1 135 ? 44.778  -54.089  -47.019  1.00 62.90  ? 132 LEU F CG    1 
ATOM 8064  C CD1   . LEU F 1 135 ? 43.455  -54.658  -47.492  1.00 51.44  ? 132 LEU F CD1   1 
ATOM 8065  C CD2   . LEU F 1 135 ? 44.990  -54.367  -45.543  1.00 62.20  ? 132 LEU F CD2   1 
ATOM 8066  N N     . LYS F 1 136 ? 48.768  -56.095  -47.363  1.00 62.64  ? 133 LYS F N     1 
ATOM 8067  C CA    . LYS F 1 136 ? 49.733  -57.076  -47.840  1.00 60.60  ? 133 LYS F CA    1 
ATOM 8068  C C     . LYS F 1 136 ? 49.082  -58.229  -48.589  1.00 61.04  ? 133 LYS F C     1 
ATOM 8069  O O     . LYS F 1 136 ? 49.779  -58.954  -49.307  1.00 62.08  ? 133 LYS F O     1 
ATOM 8070  C CB    . LYS F 1 136 ? 50.540  -57.644  -46.667  1.00 70.61  ? 133 LYS F CB    1 
ATOM 8071  C CG    . LYS F 1 136 ? 51.336  -56.619  -45.876  1.00 74.83  ? 133 LYS F CG    1 
ATOM 8072  C CD    . LYS F 1 136 ? 51.934  -57.263  -44.635  1.00 83.81  ? 133 LYS F CD    1 
ATOM 8073  C CE    . LYS F 1 136 ? 53.203  -58.041  -44.955  1.00 84.79  ? 133 LYS F CE    1 
ATOM 8074  N NZ    . LYS F 1 136 ? 54.290  -57.167  -45.471  1.00 96.35  ? 133 LYS F NZ    1 
ATOM 8075  N N     . SER F 1 137 ? 47.775  -58.427  -48.427  1.00 62.61  ? 134 SER F N     1 
ATOM 8076  C CA    . SER F 1 137 ? 47.062  -59.503  -49.103  1.00 69.44  ? 134 SER F CA    1 
ATOM 8077  C C     . SER F 1 137 ? 46.448  -58.983  -50.398  1.00 63.60  ? 134 SER F C     1 
ATOM 8078  O O     . SER F 1 137 ? 45.589  -58.093  -50.372  1.00 60.94  ? 134 SER F O     1 
ATOM 8079  C CB    . SER F 1 137 ? 45.985  -60.096  -48.197  1.00 70.17  ? 134 SER F CB    1 
ATOM 8080  O OG    . SER F 1 137 ? 45.162  -61.005  -48.908  1.00 64.28  ? 134 SER F OG    1 
ATOM 8081  N N     . LYS F 1 138 ? 46.898  -59.533  -51.528  1.00 63.78  ? 135 LYS F N     1 
ATOM 8082  C CA    . LYS F 1 138 ? 46.323  -59.171  -52.819  1.00 63.94  ? 135 LYS F CA    1 
ATOM 8083  C C     . LYS F 1 138 ? 44.838  -59.509  -52.887  1.00 55.49  ? 135 LYS F C     1 
ATOM 8084  O O     . LYS F 1 138 ? 44.035  -58.718  -53.400  1.00 48.87  ? 135 LYS F O     1 
ATOM 8085  C CB    . LYS F 1 138 ? 47.075  -59.887  -53.943  1.00 64.39  ? 135 LYS F CB    1 
ATOM 8086  C CG    . LYS F 1 138 ? 46.585  -59.533  -55.339  1.00 60.20  ? 135 LYS F CG    1 
ATOM 8087  C CD    . LYS F 1 138 ? 47.687  -59.660  -56.378  1.00 55.81  ? 135 LYS F CD    1 
ATOM 8088  C CE    . LYS F 1 138 ? 48.096  -61.111  -56.570  1.00 53.79  ? 135 LYS F CE    1 
ATOM 8089  N NZ    . LYS F 1 138 ? 49.112  -61.276  -57.654  1.00 66.64  ? 135 LYS F NZ    1 
ATOM 8090  N N     . ALA F 1 139 ? 44.455  -60.683  -52.379  1.00 55.04  ? 136 ALA F N     1 
ATOM 8091  C CA    . ALA F 1 139 ? 43.068  -61.128  -52.493  1.00 53.13  ? 136 ALA F CA    1 
ATOM 8092  C C     . ALA F 1 139 ? 42.117  -60.192  -51.758  1.00 53.41  ? 136 ALA F C     1 
ATOM 8093  O O     . ALA F 1 139 ? 41.068  -59.809  -52.293  1.00 58.90  ? 136 ALA F O     1 
ATOM 8094  C CB    . ALA F 1 139 ? 42.935  -62.555  -51.963  1.00 47.67  ? 136 ALA F CB    1 
ATOM 8095  N N     . LEU F 1 140 ? 42.469  -59.796  -50.533  1.00 50.70  ? 137 LEU F N     1 
ATOM 8096  C CA    . LEU F 1 140 ? 41.584  -58.903  -49.792  1.00 53.87  ? 137 LEU F CA    1 
ATOM 8097  C C     . LEU F 1 140 ? 41.560  -57.510  -50.399  1.00 52.59  ? 137 LEU F C     1 
ATOM 8098  O O     . LEU F 1 140 ? 40.515  -56.848  -50.384  1.00 52.43  ? 137 LEU F O     1 
ATOM 8099  C CB    . LEU F 1 140 ? 41.983  -58.839  -48.319  1.00 61.60  ? 137 LEU F CB    1 
ATOM 8100  C CG    . LEU F 1 140 ? 41.152  -59.748  -47.409  1.00 58.55  ? 137 LEU F CG    1 
ATOM 8101  C CD1   . LEU F 1 140 ? 41.243  -61.204  -47.832  1.00 58.43  ? 137 LEU F CD1   1 
ATOM 8102  C CD2   . LEU F 1 140 ? 41.545  -59.571  -45.954  1.00 75.37  ? 137 LEU F CD2   1 
ATOM 8103  N N     . SER F 1 141 ? 42.693  -57.053  -50.936  1.00 55.15  ? 138 SER F N     1 
ATOM 8104  C CA    . SER F 1 141 ? 42.722  -55.770  -51.630  1.00 51.73  ? 138 SER F CA    1 
ATOM 8105  C C     . SER F 1 141 ? 41.751  -55.773  -52.802  1.00 51.16  ? 138 SER F C     1 
ATOM 8106  O O     . SER F 1 141 ? 40.940  -54.851  -52.959  1.00 53.73  ? 138 SER F O     1 
ATOM 8107  C CB    . SER F 1 141 ? 44.143  -55.465  -52.108  1.00 49.60  ? 138 SER F CB    1 
ATOM 8108  O OG    . SER F 1 141 ? 45.041  -55.347  -51.018  1.00 56.42  ? 138 SER F OG    1 
ATOM 8109  N N     . LEU F 1 142 ? 41.817  -56.816  -53.633  1.00 45.70  ? 139 LEU F N     1 
ATOM 8110  C CA    . LEU F 1 142 ? 40.911  -56.915  -54.771  1.00 45.03  ? 139 LEU F CA    1 
ATOM 8111  C C     . LEU F 1 142 ? 39.458  -57.001  -54.319  1.00 43.62  ? 139 LEU F C     1 
ATOM 8112  O O     . LEU F 1 142 ? 38.581  -56.360  -54.910  1.00 45.51  ? 139 LEU F O     1 
ATOM 8113  C CB    . LEU F 1 142 ? 41.281  -58.122  -55.630  1.00 42.88  ? 139 LEU F CB    1 
ATOM 8114  C CG    . LEU F 1 142 ? 42.432  -57.886  -56.605  1.00 42.72  ? 139 LEU F CG    1 
ATOM 8115  C CD1   . LEU F 1 142 ? 42.937  -59.204  -57.158  1.00 37.42  ? 139 LEU F CD1   1 
ATOM 8116  C CD2   . LEU F 1 142 ? 41.986  -56.962  -57.724  1.00 44.13  ? 139 LEU F CD2   1 
ATOM 8117  N N     . GLU F 1 143 ? 39.180  -57.789  -53.276  1.00 45.85  ? 140 GLU F N     1 
ATOM 8118  C CA    . GLU F 1 143 ? 37.809  -57.904  -52.782  1.00 49.65  ? 140 GLU F CA    1 
ATOM 8119  C C     . GLU F 1 143 ? 37.266  -56.549  -52.348  1.00 50.12  ? 140 GLU F C     1 
ATOM 8120  O O     . GLU F 1 143 ? 36.169  -56.138  -52.761  1.00 58.90  ? 140 GLU F O     1 
ATOM 8121  C CB    . GLU F 1 143 ? 37.756  -58.884  -51.611  1.00 51.99  ? 140 GLU F CB    1 
ATOM 8122  C CG    . GLU F 1 143 ? 36.482  -58.781  -50.797  1.00 49.28  ? 140 GLU F CG    1 
ATOM 8123  C CD    . GLU F 1 143 ? 36.434  -59.776  -49.652  1.00 65.17  ? 140 GLU F CD    1 
ATOM 8124  O OE1   . GLU F 1 143 ? 37.506  -60.095  -49.097  1.00 78.36  ? 140 GLU F OE1   1 
ATOM 8125  O OE2   . GLU F 1 143 ? 35.325  -60.238  -49.307  1.00 65.26  ? 140 GLU F OE2   1 
ATOM 8126  N N     . LYS F 1 144 ? 38.039  -55.830  -51.531  1.00 46.34  ? 141 LYS F N     1 
ATOM 8127  C CA    . LYS F 1 144 ? 37.601  -54.528  -51.051  1.00 46.25  ? 141 LYS F CA    1 
ATOM 8128  C C     . LYS F 1 144 ? 37.392  -53.571  -52.215  1.00 50.28  ? 141 LYS F C     1 
ATOM 8129  O O     . LYS F 1 144 ? 36.373  -52.874  -52.279  1.00 51.45  ? 141 LYS F O     1 
ATOM 8130  C CB    . LYS F 1 144 ? 38.611  -53.973  -50.045  1.00 52.63  ? 141 LYS F CB    1 
ATOM 8131  C CG    . LYS F 1 144 ? 38.105  -52.793  -49.230  1.00 53.88  ? 141 LYS F CG    1 
ATOM 8132  C CD    . LYS F 1 144 ? 38.917  -51.538  -49.480  1.00 60.59  ? 141 LYS F CD    1 
ATOM 8133  C CE    . LYS F 1 144 ? 38.803  -50.593  -48.290  1.00 62.06  ? 141 LYS F CE    1 
ATOM 8134  N NZ    . LYS F 1 144 ? 39.372  -49.244  -48.572  1.00 65.23  ? 141 LYS F NZ    1 
ATOM 8135  N N     . ALA F 1 145 ? 38.327  -53.556  -53.170  1.00 49.32  ? 142 ALA F N     1 
ATOM 8136  C CA    . ALA F 1 145 ? 38.236  -52.598  -54.266  1.00 46.71  ? 142 ALA F CA    1 
ATOM 8137  C C     . ALA F 1 145 ? 37.026  -52.878  -55.146  1.00 41.47  ? 142 ALA F C     1 
ATOM 8138  O O     . ALA F 1 145 ? 36.274  -51.956  -55.481  1.00 48.14  ? 142 ALA F O     1 
ATOM 8139  C CB    . ALA F 1 145 ? 39.519  -52.624  -55.095  1.00 37.85  ? 142 ALA F CB    1 
ATOM 8140  N N     . ARG F 1 146 ? 36.787  -54.148  -55.483  1.00 38.15  ? 143 ARG F N     1 
ATOM 8141  C CA    . ARG F 1 146 ? 35.654  -54.487  -56.341  1.00 44.22  ? 143 ARG F CA    1 
ATOM 8142  C C     . ARG F 1 146 ? 34.328  -54.170  -55.655  1.00 47.86  ? 143 ARG F C     1 
ATOM 8143  O O     . ARG F 1 146 ? 33.450  -53.514  -56.243  1.00 48.01  ? 143 ARG F O     1 
ATOM 8144  C CB    . ARG F 1 146 ? 35.724  -55.964  -56.743  1.00 46.76  ? 143 ARG F CB    1 
ATOM 8145  C CG    . ARG F 1 146 ? 36.967  -56.347  -57.555  1.00 43.57  ? 143 ARG F CG    1 
ATOM 8146  C CD    . ARG F 1 146 ? 36.836  -57.730  -58.196  1.00 45.97  ? 143 ARG F CD    1 
ATOM 8147  N NE    . ARG F 1 146 ? 36.469  -57.643  -59.609  1.00 65.62  ? 143 ARG F NE    1 
ATOM 8148  C CZ    . ARG F 1 146 ? 37.275  -57.962  -60.618  1.00 51.49  ? 143 ARG F CZ    1 
ATOM 8149  N NH1   . ARG F 1 146 ? 38.500  -58.408  -60.375  1.00 53.44  ? 143 ARG F NH1   1 
ATOM 8150  N NH2   . ARG F 1 146 ? 36.854  -57.844  -61.872  1.00 73.32  ? 143 ARG F NH2   1 
ATOM 8151  N N     . LYS F 1 147 ? 34.164  -54.626  -54.406  1.00 48.05  ? 144 LYS F N     1 
ATOM 8152  C CA    . LYS F 1 147 ? 32.906  -54.396  -53.702  1.00 39.40  ? 144 LYS F CA    1 
ATOM 8153  C C     . LYS F 1 147 ? 32.648  -52.904  -53.502  1.00 42.45  ? 144 LYS F C     1 
ATOM 8154  O O     . LYS F 1 147 ? 31.519  -52.427  -53.696  1.00 35.32  ? 144 LYS F O     1 
ATOM 8155  C CB    . LYS F 1 147 ? 32.921  -55.135  -52.363  1.00 43.57  ? 144 LYS F CB    1 
ATOM 8156  C CG    . LYS F 1 147 ? 32.837  -56.653  -52.490  1.00 48.44  ? 144 LYS F CG    1 
ATOM 8157  C CD    . LYS F 1 147 ? 32.948  -57.327  -51.126  1.00 49.82  ? 144 LYS F CD    1 
ATOM 8158  C CE    . LYS F 1 147 ? 32.834  -58.840  -51.240  1.00 42.23  ? 144 LYS F CE    1 
ATOM 8159  N NZ    . LYS F 1 147 ? 32.808  -59.499  -49.905  1.00 43.15  ? 144 LYS F NZ    1 
ATOM 8160  N N     . GLU F 1 148 ? 33.683  -52.154  -53.105  1.00 43.75  ? 145 GLU F N     1 
ATOM 8161  C CA    . GLU F 1 148 ? 33.548  -50.712  -52.934  1.00 48.46  ? 145 GLU F CA    1 
ATOM 8162  C C     . GLU F 1 148 ? 33.159  -50.035  -54.242  1.00 52.23  ? 145 GLU F C     1 
ATOM 8163  O O     . GLU F 1 148 ? 32.307  -49.142  -54.254  1.00 51.06  ? 145 GLU F O     1 
ATOM 8164  C CB    . GLU F 1 148 ? 34.862  -50.135  -52.409  1.00 47.75  ? 145 GLU F CB    1 
ATOM 8165  C CG    . GLU F 1 148 ? 34.727  -48.994  -51.416  1.00 59.26  ? 145 GLU F CG    1 
ATOM 8166  C CD    . GLU F 1 148 ? 36.060  -48.642  -50.771  1.00 81.66  ? 145 GLU F CD    1 
ATOM 8167  O OE1   . GLU F 1 148 ? 36.887  -47.970  -51.429  1.00 74.94  ? 145 GLU F OE1   1 
ATOM 8168  O OE2   . GLU F 1 148 ? 36.284  -49.056  -49.611  1.00 80.64  ? 145 GLU F OE2   1 
ATOM 8169  N N     . ALA F 1 149 ? 33.788  -50.436  -55.352  1.00 45.29  ? 146 ALA F N     1 
ATOM 8170  C CA    . ALA F 1 149 ? 33.444  -49.866  -56.652  1.00 51.18  ? 146 ALA F CA    1 
ATOM 8171  C C     . ALA F 1 149 ? 31.973  -50.083  -56.972  1.00 48.95  ? 146 ALA F C     1 
ATOM 8172  O O     . ALA F 1 149 ? 31.273  -49.154  -57.396  1.00 41.53  ? 146 ALA F O     1 
ATOM 8173  C CB    . ALA F 1 149 ? 34.331  -50.473  -57.740  1.00 46.99  ? 146 ALA F CB    1 
ATOM 8174  N N     . VAL F 1 150 ? 31.479  -51.302  -56.749  1.00 39.64  ? 147 VAL F N     1 
ATOM 8175  C CA    . VAL F 1 150 ? 30.090  -51.606  -57.089  1.00 36.94  ? 147 VAL F CA    1 
ATOM 8176  C C     . VAL F 1 150 ? 29.136  -50.783  -56.225  1.00 51.07  ? 147 VAL F C     1 
ATOM 8177  O O     . VAL F 1 150 ? 28.188  -50.163  -56.729  1.00 53.47  ? 147 VAL F O     1 
ATOM 8178  C CB    . VAL F 1 150 ? 29.820  -53.114  -56.949  1.00 48.45  ? 147 VAL F CB    1 
ATOM 8179  C CG1   . VAL F 1 150 ? 28.318  -53.388  -56.913  1.00 31.33  ? 147 VAL F CG1   1 
ATOM 8180  C CG2   . VAL F 1 150 ? 30.486  -53.882  -58.080  1.00 50.73  ? 147 VAL F CG2   1 
ATOM 8181  N N     . THR F 1 151 ? 29.380  -50.757  -54.909  1.00 56.06  ? 148 THR F N     1 
ATOM 8182  C CA    . THR F 1 151 ? 28.491  -50.019  -54.012  1.00 40.73  ? 148 THR F CA    1 
ATOM 8183  C C     . THR F 1 151 ? 28.515  -48.521  -54.306  1.00 48.94  ? 148 THR F C     1 
ATOM 8184  O O     . THR F 1 151 ? 27.464  -47.866  -54.324  1.00 54.07  ? 148 THR F O     1 
ATOM 8185  C CB    . THR F 1 151 ? 28.868  -50.294  -52.554  1.00 50.69  ? 148 THR F CB    1 
ATOM 8186  O OG1   . THR F 1 151 ? 28.629  -51.675  -52.249  1.00 54.65  ? 148 THR F OG1   1 
ATOM 8187  C CG2   . THR F 1 151 ? 28.039  -49.432  -51.614  1.00 47.70  ? 148 THR F CG2   1 
ATOM 8188  N N     . ASP F 1 152 ? 29.707  -47.957  -54.518  1.00 44.69  ? 149 ASP F N     1 
ATOM 8189  C CA    . ASP F 1 152 ? 29.820  -46.545  -54.861  1.00 52.39  ? 149 ASP F CA    1 
ATOM 8190  C C     . ASP F 1 152 ? 29.076  -46.227  -56.152  1.00 56.33  ? 149 ASP F C     1 
ATOM 8191  O O     . ASP F 1 152 ? 28.398  -45.196  -56.249  1.00 56.36  ? 149 ASP F O     1 
ATOM 8192  C CB    . ASP F 1 152 ? 31.294  -46.156  -54.971  1.00 52.25  ? 149 ASP F CB    1 
ATOM 8193  C CG    . ASP F 1 152 ? 31.498  -44.659  -55.035  1.00 58.91  ? 149 ASP F CG    1 
ATOM 8194  O OD1   . ASP F 1 152 ? 31.005  -43.953  -54.130  1.00 71.77  ? 149 ASP F OD1   1 
ATOM 8195  O OD2   . ASP F 1 152 ? 32.160  -44.189  -55.982  1.00 56.49  ? 149 ASP F OD2   1 
ATOM 8196  N N     . GLY F 1 153 ? 29.209  -47.091  -57.164  1.00 54.36  ? 150 GLY F N     1 
ATOM 8197  C CA    . GLY F 1 153 ? 28.482  -46.872  -58.403  1.00 46.66  ? 150 GLY F CA    1 
ATOM 8198  C C     . GLY F 1 153 ? 26.982  -46.905  -58.203  1.00 47.60  ? 150 GLY F C     1 
ATOM 8199  O O     . GLY F 1 153 ? 26.248  -46.112  -58.798  1.00 43.88  ? 150 GLY F O     1 
ATOM 8200  N N     . LEU F 1 154 ? 26.507  -47.808  -57.341  1.00 49.22  ? 151 LEU F N     1 
ATOM 8201  C CA    . LEU F 1 154 ? 25.078  -47.857  -57.053  1.00 45.42  ? 151 LEU F CA    1 
ATOM 8202  C C     . LEU F 1 154 ? 24.617  -46.575  -56.370  1.00 48.06  ? 151 LEU F C     1 
ATOM 8203  O O     . LEU F 1 154 ? 23.566  -46.019  -56.715  1.00 48.08  ? 151 LEU F O     1 
ATOM 8204  C CB    . LEU F 1 154 ? 24.753  -49.073  -56.185  1.00 41.75  ? 151 LEU F CB    1 
ATOM 8205  C CG    . LEU F 1 154 ? 23.302  -49.176  -55.710  1.00 44.25  ? 151 LEU F CG    1 
ATOM 8206  C CD1   . LEU F 1 154 ? 22.335  -49.100  -56.880  1.00 53.93  ? 151 LEU F CD1   1 
ATOM 8207  C CD2   . LEU F 1 154 ? 23.082  -50.450  -54.914  1.00 55.02  ? 151 LEU F CD2   1 
ATOM 8208  N N     . LYS F 1 155 ? 25.401  -46.086  -55.406  1.00 53.37  ? 152 LYS F N     1 
ATOM 8209  C CA    . LYS F 1 155 ? 25.043  -44.842  -54.731  1.00 51.88  ? 152 LYS F CA    1 
ATOM 8210  C C     . LYS F 1 155 ? 24.989  -43.678  -55.713  1.00 53.53  ? 152 LYS F C     1 
ATOM 8211  O O     . LYS F 1 155 ? 24.043  -42.882  -55.690  1.00 61.62  ? 152 LYS F O     1 
ATOM 8212  C CB    . LYS F 1 155 ? 26.034  -44.538  -53.607  1.00 53.59  ? 152 LYS F CB    1 
ATOM 8213  C CG    . LYS F 1 155 ? 25.971  -45.489  -52.424  1.00 60.03  ? 152 LYS F CG    1 
ATOM 8214  C CD    . LYS F 1 155 ? 26.755  -44.933  -51.240  1.00 63.73  ? 152 LYS F CD    1 
ATOM 8215  C CE    . LYS F 1 155 ? 28.234  -44.787  -51.571  1.00 67.41  ? 152 LYS F CE    1 
ATOM 8216  N NZ    . LYS F 1 155 ? 29.022  -44.296  -50.409  1.00 67.00  ? 152 LYS F NZ    1 
ATOM 8217  N N     . ARG F 1 156 ? 25.986  -43.574  -56.598  1.00 57.40  ? 153 ARG F N     1 
ATOM 8218  C CA    . ARG F 1 156 ? 26.026  -42.450  -57.532  1.00 53.17  ? 153 ARG F CA    1 
ATOM 8219  C C     . ARG F 1 156 ? 24.951  -42.555  -58.606  1.00 52.20  ? 153 ARG F C     1 
ATOM 8220  O O     . ARG F 1 156 ? 24.494  -41.528  -59.122  1.00 50.40  ? 153 ARG F O     1 
ATOM 8221  C CB    . ARG F 1 156 ? 27.408  -42.332  -58.175  1.00 45.31  ? 153 ARG F CB    1 
ATOM 8222  C CG    . ARG F 1 156 ? 28.488  -41.859  -57.221  1.00 54.19  ? 153 ARG F CG    1 
ATOM 8223  C CD    . ARG F 1 156 ? 29.865  -41.979  -57.837  1.00 55.01  ? 153 ARG F CD    1 
ATOM 8224  N NE    . ARG F 1 156 ? 29.940  -41.349  -59.154  1.00 50.04  ? 153 ARG F NE    1 
ATOM 8225  C CZ    . ARG F 1 156 ? 30.183  -40.058  -59.357  1.00 63.06  ? 153 ARG F CZ    1 
ATOM 8226  N NH1   . ARG F 1 156 ? 30.372  -39.247  -58.325  1.00 73.02  ? 153 ARG F NH1   1 
ATOM 8227  N NH2   . ARG F 1 156 ? 30.237  -39.575  -60.593  1.00 72.22  ? 153 ARG F NH2   1 
ATOM 8228  N N     . ALA F 1 157 ? 24.546  -43.772  -58.970  1.00 55.64  ? 154 ALA F N     1 
ATOM 8229  C CA    . ALA F 1 157 ? 23.442  -43.914  -59.910  1.00 53.17  ? 154 ALA F CA    1 
ATOM 8230  C C     . ALA F 1 157 ? 22.114  -43.545  -59.258  1.00 60.86  ? 154 ALA F C     1 
ATOM 8231  O O     . ALA F 1 157 ? 21.270  -42.894  -59.885  1.00 53.17  ? 154 ALA F O     1 
ATOM 8232  C CB    . ALA F 1 157 ? 23.398  -45.336  -60.464  1.00 48.08  ? 154 ALA F CB    1 
ATOM 8233  N N     . LEU F 1 158 ? 21.910  -43.944  -57.996  1.00 58.92  ? 155 LEU F N     1 
ATOM 8234  C CA    . LEU F 1 158 ? 20.664  -43.596  -57.317  1.00 45.75  ? 155 LEU F CA    1 
ATOM 8235  C C     . LEU F 1 158 ? 20.597  -42.111  -56.986  1.00 51.98  ? 155 LEU F C     1 
ATOM 8236  O O     . LEU F 1 158 ? 19.502  -41.540  -56.922  1.00 51.35  ? 155 LEU F O     1 
ATOM 8237  C CB    . LEU F 1 158 ? 20.501  -44.429  -56.048  1.00 38.30  ? 155 LEU F CB    1 
ATOM 8238  C CG    . LEU F 1 158 ? 19.953  -45.830  -56.293  1.00 52.02  ? 155 LEU F CG    1 
ATOM 8239  C CD1   . LEU F 1 158 ? 19.948  -46.662  -55.023  1.00 53.01  ? 155 LEU F CD1   1 
ATOM 8240  C CD2   . LEU F 1 158 ? 18.551  -45.719  -56.859  1.00 51.69  ? 155 LEU F CD2   1 
ATOM 8241  N N     . ARG F 1 159 ? 21.755  -41.480  -56.778  1.00 51.71  ? 156 ARG F N     1 
ATOM 8242  C CA    . ARG F 1 159 ? 21.825  -40.047  -56.511  1.00 48.58  ? 156 ARG F CA    1 
ATOM 8243  C C     . ARG F 1 159 ? 21.056  -39.218  -57.532  1.00 57.16  ? 156 ARG F C     1 
ATOM 8244  O O     . ARG F 1 159 ? 20.433  -38.213  -57.170  1.00 70.89  ? 156 ARG F O     1 
ATOM 8245  C CB    . ARG F 1 159 ? 23.297  -39.628  -56.479  1.00 52.88  ? 156 ARG F CB    1 
ATOM 8246  C CG    . ARG F 1 159 ? 23.555  -38.139  -56.407  1.00 63.96  ? 156 ARG F CG    1 
ATOM 8247  C CD    . ARG F 1 159 ? 25.016  -37.838  -56.717  1.00 81.34  ? 156 ARG F CD    1 
ATOM 8248  N NE    . ARG F 1 159 ? 25.916  -38.455  -55.745  1.00 83.73  ? 156 ARG F NE    1 
ATOM 8249  C CZ    . ARG F 1 159 ? 27.243  -38.470  -55.848  1.00 89.35  ? 156 ARG F CZ    1 
ATOM 8250  N NH1   . ARG F 1 159 ? 27.841  -37.897  -56.886  1.00 79.13  ? 156 ARG F NH1   1 
ATOM 8251  N NH2   . ARG F 1 159 ? 27.972  -39.059  -54.908  1.00 91.46  ? 156 ARG F NH2   1 
ATOM 8252  N N     . SER F 1 160 ? 21.060  -39.631  -58.800  1.00 62.83  ? 157 SER F N     1 
ATOM 8253  C CA    . SER F 1 160 ? 20.527  -38.808  -59.881  1.00 68.59  ? 157 SER F CA    1 
ATOM 8254  C C     . SER F 1 160 ? 19.008  -38.672  -59.857  1.00 64.18  ? 157 SER F C     1 
ATOM 8255  O O     . SER F 1 160 ? 18.467  -37.935  -60.688  1.00 67.64  ? 157 SER F O     1 
ATOM 8256  C CB    . SER F 1 160 ? 20.963  -39.373  -61.236  1.00 65.57  ? 157 SER F CB    1 
ATOM 8257  O OG    . SER F 1 160 ? 22.374  -39.472  -61.328  1.00 65.62  ? 157 SER F OG    1 
ATOM 8258  N N     . PHE F 1 161 ? 18.302  -39.346  -58.949  1.00 59.53  ? 158 PHE F N     1 
ATOM 8259  C CA    . PHE F 1 161 ? 16.850  -39.234  -58.906  1.00 67.09  ? 158 PHE F CA    1 
ATOM 8260  C C     . PHE F 1 161 ? 16.344  -38.095  -58.032  1.00 74.04  ? 158 PHE F C     1 
ATOM 8261  O O     . PHE F 1 161 ? 15.174  -37.718  -58.158  1.00 73.28  ? 158 PHE F O     1 
ATOM 8262  C CB    . PHE F 1 161 ? 16.226  -40.545  -58.430  1.00 59.51  ? 158 PHE F CB    1 
ATOM 8263  C CG    . PHE F 1 161 ? 16.186  -41.605  -59.484  1.00 63.56  ? 158 PHE F CG    1 
ATOM 8264  C CD1   . PHE F 1 161 ? 15.403  -41.433  -60.614  1.00 70.31  ? 158 PHE F CD1   1 
ATOM 8265  C CD2   . PHE F 1 161 ? 16.923  -42.769  -59.355  1.00 68.12  ? 158 PHE F CD2   1 
ATOM 8266  C CE1   . PHE F 1 161 ? 15.355  -42.401  -61.594  1.00 64.37  ? 158 PHE F CE1   1 
ATOM 8267  C CE2   . PHE F 1 161 ? 16.881  -43.742  -60.334  1.00 63.99  ? 158 PHE F CE2   1 
ATOM 8268  C CZ    . PHE F 1 161 ? 16.095  -43.558  -61.455  1.00 54.07  ? 158 PHE F CZ    1 
ATOM 8269  N N     . GLY F 1 162 ? 17.170  -37.541  -57.162  1.00 73.77  ? 159 GLY F N     1 
ATOM 8270  C CA    . GLY F 1 162 ? 16.752  -36.401  -56.370  1.00 73.73  ? 159 GLY F CA    1 
ATOM 8271  C C     . GLY F 1 162 ? 17.442  -36.383  -55.021  1.00 80.40  ? 159 GLY F C     1 
ATOM 8272  O O     . GLY F 1 162 ? 18.251  -37.248  -54.690  1.00 74.06  ? 159 GLY F O     1 
ATOM 8273  N N     . ASN F 1 163 ? 17.093  -35.353  -54.243  1.00 79.16  ? 160 ASN F N     1 
ATOM 8274  C CA    . ASN F 1 163 ? 17.710  -35.154  -52.936  1.00 70.85  ? 160 ASN F CA    1 
ATOM 8275  C C     . ASN F 1 163 ? 17.423  -36.317  -51.993  1.00 75.31  ? 160 ASN F C     1 
ATOM 8276  O O     . ASN F 1 163 ? 18.299  -36.729  -51.224  1.00 75.71  ? 160 ASN F O     1 
ATOM 8277  C CB    . ASN F 1 163 ? 17.229  -33.836  -52.328  1.00 72.73  ? 160 ASN F CB    1 
ATOM 8278  C CG    . ASN F 1 163 ? 17.481  -32.653  -53.235  1.00 71.90  ? 160 ASN F CG    1 
ATOM 8279  O OD1   . ASN F 1 163 ? 18.606  -32.166  -53.337  1.00 77.95  ? 160 ASN F OD1   1 
ATOM 8280  N ND2   . ASN F 1 163 ? 16.432  -32.176  -53.895  1.00 64.09  ? 160 ASN F ND2   1 
ATOM 8281  N N     . ALA F 1 164 ? 16.201  -36.857  -52.031  1.00 69.31  ? 161 ALA F N     1 
ATOM 8282  C CA    . ALA F 1 164 ? 15.829  -37.901  -51.080  1.00 70.87  ? 161 ALA F CA    1 
ATOM 8283  C C     . ALA F 1 164 ? 16.708  -39.138  -51.219  1.00 71.22  ? 161 ALA F C     1 
ATOM 8284  O O     . ALA F 1 164 ? 16.866  -39.894  -50.254  1.00 73.92  ? 161 ALA F O     1 
ATOM 8285  C CB    . ALA F 1 164 ? 14.359  -38.277  -51.251  1.00 70.15  ? 161 ALA F CB    1 
ATOM 8286  N N     . LEU F 1 165 ? 17.279  -39.370  -52.401  1.00 69.20  ? 162 LEU F N     1 
ATOM 8287  C CA    . LEU F 1 165 ? 18.157  -40.512  -52.618  1.00 62.56  ? 162 LEU F CA    1 
ATOM 8288  C C     . LEU F 1 165 ? 19.633  -40.140  -52.581  1.00 63.00  ? 162 LEU F C     1 
ATOM 8289  O O     . LEU F 1 165 ? 20.482  -41.006  -52.808  1.00 58.80  ? 162 LEU F O     1 
ATOM 8290  C CB    . LEU F 1 165 ? 17.826  -41.191  -53.948  1.00 58.04  ? 162 LEU F CB    1 
ATOM 8291  C CG    . LEU F 1 165 ? 16.613  -42.121  -53.922  1.00 58.93  ? 162 LEU F CG    1 
ATOM 8292  C CD1   . LEU F 1 165 ? 16.315  -42.635  -55.319  1.00 60.65  ? 162 LEU F CD1   1 
ATOM 8293  C CD2   . LEU F 1 165 ? 16.840  -43.273  -52.950  1.00 62.27  ? 162 LEU F CD2   1 
ATOM 8294  N N     . GLY F 1 166 ? 19.962  -38.889  -52.263  1.00 56.45  ? 163 GLY F N     1 
ATOM 8295  C CA    . GLY F 1 166 ? 21.339  -38.547  -51.967  1.00 54.26  ? 163 GLY F CA    1 
ATOM 8296  C C     . GLY F 1 166 ? 21.944  -37.390  -52.735  1.00 58.31  ? 163 GLY F C     1 
ATOM 8297  O O     . GLY F 1 166 ? 23.132  -37.110  -52.566  1.00 55.53  ? 163 GLY F O     1 
ATOM 8298  N N     . ASN F 1 167 ? 21.163  -36.704  -53.573  1.00 60.15  ? 164 ASN F N     1 
ATOM 8299  C CA    . ASN F 1 167 ? 21.737  -35.611  -54.353  1.00 69.86  ? 164 ASN F CA    1 
ATOM 8300  C C     . ASN F 1 167 ? 22.101  -34.419  -53.472  1.00 72.15  ? 164 ASN F C     1 
ATOM 8301  O O     . ASN F 1 167 ? 23.110  -33.744  -53.725  1.00 74.25  ? 164 ASN F O     1 
ATOM 8302  C CB    . ASN F 1 167 ? 20.766  -35.191  -55.459  1.00 71.74  ? 164 ASN F CB    1 
ATOM 8303  C CG    . ASN F 1 167 ? 21.442  -34.396  -56.562  1.00 72.79  ? 164 ASN F CG    1 
ATOM 8304  O OD1   . ASN F 1 167 ? 22.333  -34.899  -57.248  1.00 71.00  ? 164 ASN F OD1   1 
ATOM 8305  N ND2   . ASN F 1 167 ? 21.004  -33.157  -56.753  1.00 69.10  ? 164 ASN F ND2   1 
ATOM 8306  N N     . CYS F 1 168 ? 21.333  -34.182  -52.403  1.00 78.67  ? 165 CYS F N     1 
ATOM 8307  C CA    . CYS F 1 168 ? 21.553  -33.004  -51.572  1.00 80.06  ? 165 CYS F CA    1 
ATOM 8308  C C     . CYS F 1 168 ? 22.938  -32.995  -50.943  1.00 76.52  ? 165 CYS F C     1 
ATOM 8309  O O     . CYS F 1 168 ? 23.442  -31.920  -50.602  1.00 69.79  ? 165 CYS F O     1 
ATOM 8310  C CB    . CYS F 1 168 ? 20.479  -32.918  -50.484  1.00 65.30  ? 165 CYS F CB    1 
ATOM 8311  S SG    . CYS F 1 168 ? 20.349  -34.373  -49.403  1.00 78.12  ? 165 CYS F SG    1 
ATOM 8312  N N     . ILE F 1 169 ? 23.569  -34.165  -50.800  1.00 77.05  ? 166 ILE F N     1 
ATOM 8313  C CA    . ILE F 1 169 ? 24.906  -34.253  -50.227  1.00 73.29  ? 166 ILE F CA    1 
ATOM 8314  C C     . ILE F 1 169 ? 25.920  -33.430  -51.011  1.00 72.54  ? 166 ILE F C     1 
ATOM 8315  O O     . ILE F 1 169 ? 26.994  -33.117  -50.485  1.00 66.68  ? 166 ILE F O     1 
ATOM 8316  C CB    . ILE F 1 169 ? 25.354  -35.729  -50.143  1.00 67.41  ? 166 ILE F CB    1 
ATOM 8317  C CG1   . ILE F 1 169 ? 26.433  -35.901  -49.076  1.00 71.63  ? 166 ILE F CG1   1 
ATOM 8318  C CG2   . ILE F 1 169 ? 25.895  -36.208  -51.477  1.00 74.74  ? 166 ILE F CG2   1 
ATOM 8319  C CD1   . ILE F 1 169 ? 25.954  -35.595  -47.682  1.00 98.75  ? 166 ILE F CD1   1 
ATOM 8320  N N     . LEU F 1 170 ? 25.616  -33.072  -52.262  1.00 73.72  ? 167 LEU F N     1 
ATOM 8321  C CA    . LEU F 1 170 ? 26.567  -32.311  -53.065  1.00 82.69  ? 167 LEU F CA    1 
ATOM 8322  C C     . LEU F 1 170 ? 26.421  -30.802  -52.910  1.00 85.75  ? 167 LEU F C     1 
ATOM 8323  O O     . LEU F 1 170 ? 27.256  -30.058  -53.440  1.00 86.18  ? 167 LEU F O     1 
ATOM 8324  C CB    . LEU F 1 170 ? 26.435  -32.684  -54.544  1.00 82.73  ? 167 LEU F CB    1 
ATOM 8325  C CG    . LEU F 1 170 ? 26.701  -34.146  -54.910  1.00 83.97  ? 167 LEU F CG    1 
ATOM 8326  C CD1   . LEU F 1 170 ? 26.242  -34.421  -56.336  1.00 88.53  ? 167 LEU F CD1   1 
ATOM 8327  C CD2   . LEU F 1 170 ? 28.172  -34.513  -54.733  1.00 76.73  ? 167 LEU F CD2   1 
ATOM 8328  N N     . ASP F 1 171 ? 25.388  -30.329  -52.218  1.00 83.90  ? 168 ASP F N     1 
ATOM 8329  C CA    . ASP F 1 171 ? 25.171  -28.896  -52.063  1.00 86.12  ? 168 ASP F CA    1 
ATOM 8330  C C     . ASP F 1 171 ? 25.981  -28.381  -50.881  1.00 88.43  ? 168 ASP F C     1 
ATOM 8331  O O     . ASP F 1 171 ? 25.751  -28.791  -49.739  1.00 92.84  ? 168 ASP F O     1 
ATOM 8332  C CB    . ASP F 1 171 ? 23.687  -28.591  -51.869  1.00 82.54  ? 168 ASP F CB    1 
ATOM 8333  C CG    . ASP F 1 171 ? 23.367  -27.113  -52.030  1.00 94.25  ? 168 ASP F CG    1 
ATOM 8334  O OD1   . ASP F 1 171 ? 24.295  -26.321  -52.297  1.00 93.76  ? 168 ASP F OD1   1 
ATOM 8335  O OD2   . ASP F 1 171 ? 22.184  -26.743  -51.886  1.00 96.91  ? 168 ASP F OD2   1 
ATOM 8336  N N     . LYS F 1 172 ? 26.945  -27.499  -51.156  1.00 94.09  ? 169 LYS F N     1 
ATOM 8337  C CA    . LYS F 1 172 ? 27.758  -26.948  -50.077  1.00 95.45  ? 169 LYS F CA    1 
ATOM 8338  C C     . LYS F 1 172 ? 26.918  -26.094  -49.133  1.00 95.79  ? 169 LYS F C     1 
ATOM 8339  O O     . LYS F 1 172 ? 27.222  -26.007  -47.937  1.00 97.81  ? 169 LYS F O     1 
ATOM 8340  C CB    . LYS F 1 172 ? 28.927  -26.157  -50.659  1.00 92.04  ? 169 LYS F CB    1 
ATOM 8341  C CG    . LYS F 1 172 ? 29.757  -26.972  -51.633  1.00 95.18  ? 169 LYS F CG    1 
ATOM 8342  C CD    . LYS F 1 172 ? 30.809  -26.133  -52.331  1.00 101.58 ? 169 LYS F CD    1 
ATOM 8343  C CE    . LYS F 1 172 ? 31.523  -26.947  -53.400  1.00 106.66 ? 169 LYS F CE    1 
ATOM 8344  N NZ    . LYS F 1 172 ? 32.504  -26.127  -54.158  1.00 101.63 ? 169 LYS F NZ    1 
ATOM 8345  N N     . ASP F 1 173 ? 25.859  -25.464  -49.651  1.00 95.52  ? 170 ASP F N     1 
ATOM 8346  C CA    . ASP F 1 173 ? 24.941  -24.711  -48.802  1.00 99.17  ? 170 ASP F CA    1 
ATOM 8347  C C     . ASP F 1 173 ? 24.162  -25.644  -47.885  1.00 97.36  ? 170 ASP F C     1 
ATOM 8348  O O     . ASP F 1 173 ? 23.933  -25.327  -46.712  1.00 104.51 ? 170 ASP F O     1 
ATOM 8349  C CB    . ASP F 1 173 ? 23.977  -23.893  -49.665  1.00 100.07 ? 170 ASP F CB    1 
ATOM 8350  C CG    . ASP F 1 173 ? 24.691  -22.990  -50.653  1.00 111.43 ? 170 ASP F CG    1 
ATOM 8351  O OD1   . ASP F 1 173 ? 25.755  -22.440  -50.304  1.00 114.80 ? 170 ASP F OD1   1 
ATOM 8352  O OD2   . ASP F 1 173 ? 24.183  -22.838  -51.785  1.00 112.41 ? 170 ASP F OD2   1 
ATOM 8353  N N     . TYR F 1 174 ? 23.727  -26.790  -48.413  1.00 86.68  ? 171 TYR F N     1 
ATOM 8354  C CA    . TYR F 1 174 ? 23.076  -27.799  -47.582  1.00 84.44  ? 171 TYR F CA    1 
ATOM 8355  C C     . TYR F 1 174 ? 24.005  -28.319  -46.494  1.00 87.64  ? 171 TYR F C     1 
ATOM 8356  O O     . TYR F 1 174 ? 23.553  -28.625  -45.385  1.00 90.96  ? 171 TYR F O     1 
ATOM 8357  C CB    . TYR F 1 174 ? 22.587  -28.957  -48.457  1.00 87.17  ? 171 TYR F CB    1 
ATOM 8358  C CG    . TYR F 1 174 ? 22.175  -30.210  -47.708  1.00 79.30  ? 171 TYR F CG    1 
ATOM 8359  C CD1   . TYR F 1 174 ? 20.881  -30.363  -47.229  1.00 75.71  ? 171 TYR F CD1   1 
ATOM 8360  C CD2   . TYR F 1 174 ? 23.076  -31.251  -47.501  1.00 80.33  ? 171 TYR F CD2   1 
ATOM 8361  C CE1   . TYR F 1 174 ? 20.496  -31.509  -46.554  1.00 77.20  ? 171 TYR F CE1   1 
ATOM 8362  C CE2   . TYR F 1 174 ? 22.699  -32.400  -46.823  1.00 69.56  ? 171 TYR F CE2   1 
ATOM 8363  C CZ    . TYR F 1 174 ? 21.409  -32.523  -46.353  1.00 75.69  ? 171 TYR F CZ    1 
ATOM 8364  O OH    . TYR F 1 174 ? 21.033  -33.664  -45.680  1.00 75.38  ? 171 TYR F OH    1 
ATOM 8365  N N     . LEU F 1 175 ? 25.303  -28.417  -46.789  1.00 90.29  ? 172 LEU F N     1 
ATOM 8366  C CA    . LEU F 1 175 ? 26.255  -28.945  -45.816  1.00 91.35  ? 172 LEU F CA    1 
ATOM 8367  C C     . LEU F 1 175 ? 26.425  -28.014  -44.620  1.00 100.70 ? 172 LEU F C     1 
ATOM 8368  O O     . LEU F 1 175 ? 26.491  -28.477  -43.475  1.00 103.35 ? 172 LEU F O     1 
ATOM 8369  C CB    . LEU F 1 175 ? 27.602  -29.199  -46.493  1.00 90.88  ? 172 LEU F CB    1 
ATOM 8370  C CG    . LEU F 1 175 ? 27.647  -30.342  -47.513  1.00 89.78  ? 172 LEU F CG    1 
ATOM 8371  C CD1   . LEU F 1 175 ? 29.057  -30.527  -48.066  1.00 83.40  ? 172 LEU F CD1   1 
ATOM 8372  C CD2   . LEU F 1 175 ? 27.118  -31.642  -46.912  1.00 75.54  ? 172 LEU F CD2   1 
ATOM 8373  N N     . ARG F 1 176 ? 26.510  -26.704  -44.863  1.00 104.09 ? 173 ARG F N     1 
ATOM 8374  C CA    . ARG F 1 176 ? 26.634  -25.752  -43.762  1.00 107.81 ? 173 ARG F CA    1 
ATOM 8375  C C     . ARG F 1 176 ? 25.423  -25.809  -42.836  1.00 106.52 ? 173 ARG F C     1 
ATOM 8376  O O     . ARG F 1 176 ? 25.569  -25.793  -41.608  1.00 106.50 ? 173 ARG F O     1 
ATOM 8377  C CB    . ARG F 1 176 ? 26.852  -24.338  -44.304  1.00 108.00 ? 173 ARG F CB    1 
ATOM 8378  C CG    . ARG F 1 176 ? 28.232  -24.142  -44.928  1.00 109.91 ? 173 ARG F CG    1 
ATOM 8379  C CD    . ARG F 1 176 ? 28.562  -22.680  -45.218  1.00 105.76 ? 173 ARG F CD    1 
ATOM 8380  N NE    . ARG F 1 176 ? 27.696  -22.098  -46.239  1.00 109.00 ? 173 ARG F NE    1 
ATOM 8381  C CZ    . ARG F 1 176 ? 26.620  -21.362  -45.978  1.00 112.21 ? 173 ARG F CZ    1 
ATOM 8382  N NH1   . ARG F 1 176 ? 26.277  -21.109  -44.721  1.00 121.86 ? 173 ARG F NH1   1 
ATOM 8383  N NH2   . ARG F 1 176 ? 25.891  -20.873  -46.973  1.00 108.44 ? 173 ARG F NH2   1 
ATOM 8384  N N     . SER F 1 177 ? 24.215  -25.866  -43.404  1.00 99.19  ? 174 SER F N     1 
ATOM 8385  C CA    . SER F 1 177 ? 23.015  -25.987  -42.580  1.00 93.95  ? 174 SER F CA    1 
ATOM 8386  C C     . SER F 1 177 ? 22.976  -27.293  -41.794  1.00 98.47  ? 174 SER F C     1 
ATOM 8387  O O     . SER F 1 177 ? 22.216  -27.400  -40.825  1.00 106.84 ? 174 SER F O     1 
ATOM 8388  C CB    . SER F 1 177 ? 21.767  -25.868  -43.456  1.00 97.40  ? 174 SER F CB    1 
ATOM 8389  O OG    . SER F 1 177 ? 21.684  -24.582  -44.050  1.00 101.47 ? 174 SER F OG    1 
ATOM 8390  N N     . LEU F 1 178 ? 23.775  -28.288  -42.188  1.00 100.62 ? 175 LEU F N     1 
ATOM 8391  C CA    . LEU F 1 178 ? 23.870  -29.525  -41.419  1.00 98.47  ? 175 LEU F CA    1 
ATOM 8392  C C     . LEU F 1 178 ? 24.826  -29.368  -40.246  1.00 99.94  ? 175 LEU F C     1 
ATOM 8393  O O     . LEU F 1 178 ? 24.601  -29.941  -39.174  1.00 100.19 ? 175 LEU F O     1 
ATOM 8394  C CB    . LEU F 1 178 ? 24.326  -30.678  -42.316  1.00 101.73 ? 175 LEU F CB    1 
ATOM 8395  C CG    . LEU F 1 178 ? 23.244  -31.650  -42.787  1.00 92.00  ? 175 LEU F CG    1 
ATOM 8396  C CD1   . LEU F 1 178 ? 23.886  -32.836  -43.481  1.00 90.18  ? 175 LEU F CD1   1 
ATOM 8397  C CD2   . LEU F 1 178 ? 22.413  -32.105  -41.606  1.00 90.77  ? 175 LEU F CD2   1 
ATOM 8398  N N     . ASN F 1 179 ? 25.898  -28.595  -40.435  1.00 103.01 ? 176 ASN F N     1 
ATOM 8399  C CA    . ASN F 1 179 ? 26.841  -28.350  -39.351  1.00 113.85 ? 176 ASN F CA    1 
ATOM 8400  C C     . ASN F 1 179 ? 26.212  -27.499  -38.256  1.00 116.24 ? 176 ASN F C     1 
ATOM 8401  O O     . ASN F 1 179 ? 26.518  -27.682  -37.072  1.00 115.78 ? 176 ASN F O     1 
ATOM 8402  C CB    . ASN F 1 179 ? 28.102  -27.672  -39.891  1.00 121.13 ? 176 ASN F CB    1 
ATOM 8403  C CG    . ASN F 1 179 ? 28.998  -28.625  -40.662  1.00 130.36 ? 176 ASN F CG    1 
ATOM 8404  O OD1   . ASN F 1 179 ? 29.534  -29.581  -40.099  1.00 133.65 ? 176 ASN F OD1   1 
ATOM 8405  N ND2   . ASN F 1 179 ? 29.166  -28.367  -41.956  1.00 116.61 ? 176 ASN F ND2   1 
ATOM 8406  N N     . LYS F 1 180 ? 25.347  -26.556  -38.635  1.00 111.35 ? 177 LYS F N     1 
ATOM 8407  C CA    . LYS F 1 180 ? 24.664  -25.700  -37.674  1.00 106.62 ? 177 LYS F CA    1 
ATOM 8408  C C     . LYS F 1 180 ? 23.663  -26.456  -36.810  1.00 113.13 ? 177 LYS F C     1 
ATOM 8409  O O     . LYS F 1 180 ? 23.188  -25.897  -35.816  1.00 125.24 ? 177 LYS F O     1 
ATOM 8410  C CB    . LYS F 1 180 ? 23.932  -24.582  -38.415  1.00 107.06 ? 177 LYS F CB    1 
ATOM 8411  C CG    . LYS F 1 180 ? 24.820  -23.713  -39.286  1.00 102.97 ? 177 LYS F CG    1 
ATOM 8412  C CD    . LYS F 1 180 ? 23.984  -22.716  -40.071  1.00 108.52 ? 177 LYS F CD    1 
ATOM 8413  C CE    . LYS F 1 180 ? 24.835  -21.907  -41.032  1.00 113.09 ? 177 LYS F CE    1 
ATOM 8414  N NZ    . LYS F 1 180 ? 24.009  -20.982  -41.856  1.00 104.09 ? 177 LYS F NZ    1 
ATOM 8415  N N     . LEU F 1 181 ? 23.332  -27.729  -37.162  1.00 112.84 ? 178 LEU F N     1 
ATOM 8416  C CA    . LEU F 1 181 ? 22.383  -28.536  -36.411  1.00 117.14 ? 178 LEU F CA    1 
ATOM 8417  C C     . LEU F 1 181 ? 23.077  -29.264  -35.263  1.00 115.52 ? 178 LEU F C     1 
ATOM 8418  O O     . LEU F 1 181 ? 24.259  -29.612  -35.363  1.00 107.58 ? 178 LEU F O     1 
ATOM 8419  C CB    . LEU F 1 181 ? 21.710  -29.556  -37.329  1.00 119.75 ? 178 LEU F CB    1 
ATOM 8420  C CG    . LEU F 1 181 ? 20.605  -29.025  -38.246  1.00 103.80 ? 178 LEU F CG    1 
ATOM 8421  C CD1   . LEU F 1 181 ? 20.091  -30.122  -39.166  1.00 100.41 ? 178 LEU F CD1   1 
ATOM 8422  C CD2   . LEU F 1 181 ? 19.472  -28.437  -37.424  1.00 109.24 ? 178 LEU F CD2   1 
ATOM 8423  N N     . PRO F 1 182 ? 22.369  -29.486  -34.155  1.00 122.41 ? 179 PRO F N     1 
ATOM 8424  C CA    . PRO F 1 182 ? 22.959  -30.233  -33.031  1.00 127.29 ? 179 PRO F CA    1 
ATOM 8425  C C     . PRO F 1 182 ? 23.211  -31.683  -33.420  1.00 131.35 ? 179 PRO F C     1 
ATOM 8426  O O     . PRO F 1 182 ? 22.300  -32.384  -33.867  1.00 136.57 ? 179 PRO F O     1 
ATOM 8427  C CB    . PRO F 1 182 ? 21.898  -30.120  -31.930  1.00 130.47 ? 179 PRO F CB    1 
ATOM 8428  C CG    . PRO F 1 182 ? 21.014  -28.987  -32.336  1.00 126.88 ? 179 PRO F CG    1 
ATOM 8429  C CD    . PRO F 1 182 ? 21.035  -28.952  -33.831  1.00 119.06 ? 179 PRO F CD    1 
ATOM 8430  N N     . ARG F 1 183 ? 24.451  -32.132  -33.244  1.00 133.35 ? 180 ARG F N     1 
ATOM 8431  C CA    . ARG F 1 183 ? 24.816  -33.516  -33.541  1.00 143.41 ? 180 ARG F CA    1 
ATOM 8432  C C     . ARG F 1 183 ? 24.133  -34.451  -32.547  1.00 145.26 ? 180 ARG F C     1 
ATOM 8433  O O     . ARG F 1 183 ? 24.521  -34.514  -31.376  1.00 138.81 ? 180 ARG F O     1 
ATOM 8434  C CB    . ARG F 1 183 ? 26.331  -33.691  -33.511  1.00 143.24 ? 180 ARG F CB    1 
ATOM 8435  C CG    . ARG F 1 183 ? 26.884  -34.470  -34.701  1.00 145.55 ? 180 ARG F CG    1 
ATOM 8436  C CD    . ARG F 1 183 ? 26.536  -35.954  -34.628  1.00 147.85 ? 180 ARG F CD    1 
ATOM 8437  N NE    . ARG F 1 183 ? 27.101  -36.602  -33.446  1.00 157.15 ? 180 ARG F NE    1 
ATOM 8438  C CZ    . ARG F 1 183 ? 26.825  -37.848  -33.070  1.00 148.98 ? 180 ARG F CZ    1 
ATOM 8439  N NH1   . ARG F 1 183 ? 25.984  -38.586  -33.782  1.00 147.91 ? 180 ARG F NH1   1 
ATOM 8440  N NH2   . ARG F 1 183 ? 27.384  -38.356  -31.979  1.00 134.86 ? 180 ARG F NH2   1 
ATOM 8441  N N     . GLN F 1 184 ? 23.113  -35.171  -33.006  1.00 152.83 ? 181 GLN F N     1 
ATOM 8442  C CA    . GLN F 1 184 ? 22.352  -36.060  -32.141  1.00 152.46 ? 181 GLN F CA    1 
ATOM 8443  C C     . GLN F 1 184 ? 23.103  -37.367  -31.919  1.00 147.44 ? 181 GLN F C     1 
ATOM 8444  O O     . GLN F 1 184 ? 23.848  -37.836  -32.785  1.00 147.93 ? 181 GLN F O     1 
ATOM 8445  C CB    . GLN F 1 184 ? 20.978  -36.357  -32.744  1.00 154.30 ? 181 GLN F CB    1 
ATOM 8446  C CG    . GLN F 1 184 ? 21.039  -36.969  -34.140  1.00 147.56 ? 181 GLN F CG    1 
ATOM 8447  C CD    . GLN F 1 184 ? 19.684  -37.426  -34.649  1.00 135.01 ? 181 GLN F CD    1 
ATOM 8448  O OE1   . GLN F 1 184 ? 18.866  -37.960  -33.899  1.00 133.32 ? 181 GLN F OE1   1 
ATOM 8449  N NE2   . GLN F 1 184 ? 19.438  -37.206  -35.933  1.00 124.94 ? 181 GLN F NE2   1 
ATOM 8450  N N     . LEU F 1 185 ? 22.884  -37.966  -30.752  1.00 141.64 ? 182 LEU F N     1 
ATOM 8451  C CA    . LEU F 1 185 ? 23.568  -39.207  -30.433  1.00 140.60 ? 182 LEU F CA    1 
ATOM 8452  C C     . LEU F 1 185 ? 22.935  -40.352  -31.226  1.00 134.33 ? 182 LEU F C     1 
ATOM 8453  O O     . LEU F 1 185 ? 21.739  -40.315  -31.527  1.00 127.35 ? 182 LEU F O     1 
ATOM 8454  C CB    . LEU F 1 185 ? 23.492  -39.478  -28.930  1.00 133.13 ? 182 LEU F CB    1 
ATOM 8455  C CG    . LEU F 1 185 ? 24.610  -40.271  -28.243  1.00 123.52 ? 182 LEU F CG    1 
ATOM 8456  C CD1   . LEU F 1 185 ? 25.951  -39.569  -28.422  1.00 115.45 ? 182 LEU F CD1   1 
ATOM 8457  C CD2   . LEU F 1 185 ? 24.309  -40.465  -26.764  1.00 113.09 ? 182 LEU F CD2   1 
ATOM 8458  N N     . PRO F 1 186 ? 23.734  -41.372  -31.607  1.00 128.75 ? 183 PRO F N     1 
ATOM 8459  C CA    . PRO F 1 186 ? 23.200  -42.487  -32.407  1.00 128.59 ? 183 PRO F CA    1 
ATOM 8460  C C     . PRO F 1 186 ? 21.876  -43.053  -31.922  1.00 122.67 ? 183 PRO F C     1 
ATOM 8461  O O     . PRO F 1 186 ? 21.752  -43.470  -30.766  1.00 115.38 ? 183 PRO F O     1 
ATOM 8462  C CB    . PRO F 1 186 ? 24.308  -43.542  -32.307  1.00 122.51 ? 183 PRO F CB    1 
ATOM 8463  C CG    . PRO F 1 186 ? 25.559  -42.755  -32.138  1.00 123.85 ? 183 PRO F CG    1 
ATOM 8464  C CD    . PRO F 1 186 ? 25.198  -41.453  -31.458  1.00 127.15 ? 183 PRO F CD    1 
ATOM 8465  N N     . LEU F 1 187 ? 20.875  -43.040  -32.803  1.00 123.22 ? 184 LEU F N     1 
ATOM 8466  C CA    . LEU F 1 187 ? 19.581  -43.612  -32.469  1.00 122.68 ? 184 LEU F CA    1 
ATOM 8467  C C     . LEU F 1 187 ? 19.743  -45.091  -32.139  1.00 122.02 ? 184 LEU F C     1 
ATOM 8468  O O     . LEU F 1 187 ? 20.600  -45.784  -32.695  1.00 124.26 ? 184 LEU F O     1 
ATOM 8469  C CB    . LEU F 1 187 ? 18.602  -43.442  -33.635  1.00 122.12 ? 184 LEU F CB    1 
ATOM 8470  C CG    . LEU F 1 187 ? 18.273  -42.040  -34.164  1.00 133.17 ? 184 LEU F CG    1 
ATOM 8471  C CD1   . LEU F 1 187 ? 18.164  -41.031  -33.024  1.00 127.50 ? 184 LEU F CD1   1 
ATOM 8472  C CD2   . LEU F 1 187 ? 19.274  -41.576  -35.229  1.00 117.82 ? 184 LEU F CD2   1 
ATOM 8473  N N     . GLU F 1 188 ? 18.910  -45.577  -31.230  1.00 118.05 ? 185 GLU F N     1 
ATOM 8474  C CA    . GLU F 1 188 ? 18.960  -46.973  -30.826  1.00 111.88 ? 185 GLU F CA    1 
ATOM 8475  C C     . GLU F 1 188 ? 17.849  -47.762  -31.510  1.00 110.50 ? 185 GLU F C     1 
ATOM 8476  O O     . GLU F 1 188 ? 16.768  -47.236  -31.786  1.00 101.29 ? 185 GLU F O     1 
ATOM 8477  C CB    . GLU F 1 188 ? 18.872  -47.098  -29.305  1.00 114.22 ? 185 GLU F CB    1 
ATOM 8478  C CG    . GLU F 1 188 ? 19.430  -48.401  -28.772  1.00 121.59 ? 185 GLU F CG    1 
ATOM 8479  C CD    . GLU F 1 188 ? 19.397  -48.466  -27.262  1.00 121.06 ? 185 GLU F CD    1 
ATOM 8480  O OE1   . GLU F 1 188 ? 18.345  -48.137  -26.677  1.00 129.87 ? 185 GLU F OE1   1 
ATOM 8481  O OE2   . GLU F 1 188 ? 20.426  -48.840  -26.660  1.00 109.18 ? 185 GLU F OE2   1 
ATOM 8482  N N     . VAL F 1 189 ? 18.130  -49.035  -31.783  1.00 111.27 ? 186 VAL F N     1 
ATOM 8483  C CA    . VAL F 1 189 ? 17.234  -49.900  -32.543  1.00 100.81 ? 186 VAL F CA    1 
ATOM 8484  C C     . VAL F 1 189 ? 16.520  -50.856  -31.599  1.00 95.23  ? 186 VAL F C     1 
ATOM 8485  O O     . VAL F 1 189 ? 17.151  -51.489  -30.744  1.00 95.95  ? 186 VAL F O     1 
ATOM 8486  C CB    . VAL F 1 189 ? 18.001  -50.679  -33.624  1.00 90.29  ? 186 VAL F CB    1 
ATOM 8487  C CG1   . VAL F 1 189 ? 17.052  -51.565  -34.408  1.00 90.18  ? 186 VAL F CG1   1 
ATOM 8488  C CG2   . VAL F 1 189 ? 18.724  -49.723  -34.552  1.00 86.55  ? 186 VAL F CG2   1 
ATOM 8489  N N     . ASP F 1 190 ? 15.205  -50.969  -31.765  1.00 93.43  ? 187 ASP F N     1 
ATOM 8490  C CA    . ASP F 1 190 ? 14.363  -51.822  -30.929  1.00 102.26 ? 187 ASP F CA    1 
ATOM 8491  C C     . ASP F 1 190 ? 14.173  -53.143  -31.668  1.00 102.30 ? 187 ASP F C     1 
ATOM 8492  O O     . ASP F 1 190 ? 13.348  -53.243  -32.579  1.00 106.89 ? 187 ASP F O     1 
ATOM 8493  C CB    . ASP F 1 190 ? 13.030  -51.141  -30.635  1.00 108.84 ? 187 ASP F CB    1 
ATOM 8494  C CG    . ASP F 1 190 ? 12.102  -52.004  -29.801  1.00 110.22 ? 187 ASP F CG    1 
ATOM 8495  O OD1   . ASP F 1 190 ? 12.504  -52.408  -28.690  1.00 104.70 ? 187 ASP F OD1   1 
ATOM 8496  O OD2   . ASP F 1 190 ? 10.969  -52.272  -30.253  1.00 110.36 ? 187 ASP F OD2   1 
ATOM 8497  N N     . LEU F 1 191 ? 14.942  -54.161  -31.275  1.00 93.81  ? 188 LEU F N     1 
ATOM 8498  C CA    . LEU F 1 191 ? 14.906  -55.458  -31.941  1.00 93.83  ? 188 LEU F CA    1 
ATOM 8499  C C     . LEU F 1 191 ? 13.805  -56.369  -31.421  1.00 90.89  ? 188 LEU F C     1 
ATOM 8500  O O     . LEU F 1 191 ? 13.882  -57.589  -31.614  1.00 96.77  ? 188 LEU F O     1 
ATOM 8501  C CB    . LEU F 1 191 ? 16.258  -56.161  -31.813  1.00 94.57  ? 188 LEU F CB    1 
ATOM 8502  C CG    . LEU F 1 191 ? 17.406  -55.445  -32.517  1.00 93.66  ? 188 LEU F CG    1 
ATOM 8503  C CD1   . LEU F 1 191 ? 18.673  -56.274  -32.444  1.00 93.21  ? 188 LEU F CD1   1 
ATOM 8504  C CD2   . LEU F 1 191 ? 17.017  -55.166  -33.958  1.00 87.99  ? 188 LEU F CD2   1 
ATOM 8505  N N     . THR F 1 192 ? 12.791  -55.812  -30.761  1.00 98.11  ? 189 THR F N     1 
ATOM 8506  C CA    . THR F 1 192 ? 11.697  -56.636  -30.261  1.00 107.46 ? 189 THR F CA    1 
ATOM 8507  C C     . THR F 1 192 ? 10.830  -57.151  -31.405  1.00 100.93 ? 189 THR F C     1 
ATOM 8508  O O     . THR F 1 192 ? 10.401  -58.311  -31.393  1.00 88.02  ? 189 THR F O     1 
ATOM 8509  C CB    . THR F 1 192 ? 10.861  -55.844  -29.255  1.00 108.10 ? 189 THR F CB    1 
ATOM 8510  O OG1   . THR F 1 192 ? 10.386  -54.638  -29.866  1.00 119.19 ? 189 THR F OG1   1 
ATOM 8511  C CG2   . THR F 1 192 ? 11.693  -55.493  -28.024  1.00 85.51  ? 189 THR F CG2   1 
ATOM 8512  N N     . LYS F 1 193 ? 10.578  -56.313  -32.411  1.00 103.74 ? 190 LYS F N     1 
ATOM 8513  C CA    . LYS F 1 193 ? 9.790   -56.698  -33.573  1.00 109.05 ? 190 LYS F CA    1 
ATOM 8514  C C     . LYS F 1 193 ? 10.646  -57.258  -34.707  1.00 108.45 ? 190 LYS F C     1 
ATOM 8515  O O     . LYS F 1 193 ? 10.238  -57.192  -35.873  1.00 106.92 ? 190 LYS F O     1 
ATOM 8516  C CB    . LYS F 1 193 ? 8.992   -55.495  -34.079  1.00 110.16 ? 190 LYS F CB    1 
ATOM 8517  C CG    . LYS F 1 193 ? 8.011   -54.921  -33.076  1.00 107.58 ? 190 LYS F CG    1 
ATOM 8518  C CD    . LYS F 1 193 ? 7.175   -53.820  -33.706  1.00 103.49 ? 190 LYS F CD    1 
ATOM 8519  C CE    . LYS F 1 193 ? 6.123   -53.306  -32.737  1.00 111.87 ? 190 LYS F CE    1 
ATOM 8520  N NZ    . LYS F 1 193 ? 5.418   -52.102  -33.262  1.00 102.36 ? 190 LYS F NZ    1 
ATOM 8521  N N     . ALA F 1 194 ? 11.819  -57.800  -34.392  1.00 105.18 ? 191 ALA F N     1 
ATOM 8522  C CA    . ALA F 1 194 ? 12.680  -58.396  -35.402  1.00 98.82  ? 191 ALA F CA    1 
ATOM 8523  C C     . ALA F 1 194 ? 12.133  -59.742  -35.867  1.00 96.25  ? 191 ALA F C     1 
ATOM 8524  O O     . ALA F 1 194 ? 11.477  -60.468  -35.115  1.00 84.57  ? 191 ALA F O     1 
ATOM 8525  C CB    . ALA F 1 194 ? 14.098  -58.569  -34.860  1.00 87.32  ? 191 ALA F CB    1 
ATOM 8526  N N     . LYS F 1 195 ? 12.402  -60.064  -37.130  1.00 98.19  ? 192 LYS F N     1 
ATOM 8527  C CA    . LYS F 1 195 ? 12.005  -61.354  -37.678  1.00 89.43  ? 192 LYS F CA    1 
ATOM 8528  C C     . LYS F 1 195 ? 12.816  -62.462  -37.019  1.00 86.13  ? 192 LYS F C     1 
ATOM 8529  O O     . LYS F 1 195 ? 14.048  -62.390  -36.954  1.00 84.48  ? 192 LYS F O     1 
ATOM 8530  C CB    . LYS F 1 195 ? 12.201  -61.377  -39.193  1.00 90.23  ? 192 LYS F CB    1 
ATOM 8531  C CG    . LYS F 1 195 ? 11.836  -62.706  -39.840  1.00 93.05  ? 192 LYS F CG    1 
ATOM 8532  C CD    . LYS F 1 195 ? 12.101  -62.686  -41.336  1.00 80.98  ? 192 LYS F CD    1 
ATOM 8533  C CE    . LYS F 1 195 ? 11.679  -63.993  -41.985  1.00 82.71  ? 192 LYS F CE    1 
ATOM 8534  N NZ    . LYS F 1 195 ? 10.238  -64.297  -41.768  1.00 76.51  ? 192 LYS F NZ    1 
ATOM 8535  N N     . ARG F 1 196 ? 12.124  -63.485  -36.514  1.00 87.76  ? 193 ARG F N     1 
ATOM 8536  C CA    . ARG F 1 196 ? 12.766  -64.531  -35.734  1.00 90.09  ? 193 ARG F CA    1 
ATOM 8537  C C     . ARG F 1 196 ? 12.637  -65.926  -36.326  1.00 85.81  ? 193 ARG F C     1 
ATOM 8538  O O     . ARG F 1 196 ? 13.418  -66.807  -35.947  1.00 89.78  ? 193 ARG F O     1 
ATOM 8539  C CB    . ARG F 1 196 ? 12.184  -64.558  -34.313  1.00 96.01  ? 193 ARG F CB    1 
ATOM 8540  C CG    . ARG F 1 196 ? 12.529  -63.344  -33.473  1.00 90.43  ? 193 ARG F CG    1 
ATOM 8541  C CD    . ARG F 1 196 ? 12.251  -63.614  -32.005  1.00 108.35 ? 193 ARG F CD    1 
ATOM 8542  N NE    . ARG F 1 196 ? 13.056  -62.782  -31.115  1.00 118.41 ? 193 ARG F NE    1 
ATOM 8543  C CZ    . ARG F 1 196 ? 12.755  -61.529  -30.789  1.00 115.65 ? 193 ARG F CZ    1 
ATOM 8544  N NH1   . ARG F 1 196 ? 11.663  -60.959  -31.283  1.00 115.31 ? 193 ARG F NH1   1 
ATOM 8545  N NH2   . ARG F 1 196 ? 13.542  -60.845  -29.967  1.00 103.12 ? 193 ARG F NH2   1 
ATOM 8546  N N     . GLN F 1 197 ? 11.691  -66.156  -37.231  1.00 84.63  ? 194 GLN F N     1 
ATOM 8547  C CA    . GLN F 1 197 ? 11.569  -67.436  -37.912  1.00 87.65  ? 194 GLN F CA    1 
ATOM 8548  C C     . GLN F 1 197 ? 11.211  -67.201  -39.375  1.00 88.38  ? 194 GLN F C     1 
ATOM 8549  O O     . GLN F 1 197 ? 10.726  -66.131  -39.752  1.00 83.94  ? 194 GLN F O     1 
ATOM 8550  C CB    . GLN F 1 197 ? 10.567  -68.343  -37.180  1.00 86.36  ? 194 GLN F CB    1 
ATOM 8551  C CG    . GLN F 1 197 ? 9.141   -67.830  -37.099  1.00 87.73  ? 194 GLN F CG    1 
ATOM 8552  C CD    . GLN F 1 197 ? 8.324   -68.155  -38.324  1.00 93.16  ? 194 GLN F CD    1 
ATOM 8553  O OE1   . GLN F 1 197 ? 8.132   -69.323  -38.660  1.00 87.67  ? 194 GLN F OE1   1 
ATOM 8554  N NE2   . GLN F 1 197 ? 7.819   -67.123  -38.992  1.00 97.39  ? 194 GLN F NE2   1 
ATOM 8555  N N     . ASP F 1 198 ? 11.456  -68.226  -40.199  1.00 95.19  ? 195 ASP F N     1 
ATOM 8556  C CA    . ASP F 1 198 ? 11.398  -68.057  -41.650  1.00 95.22  ? 195 ASP F CA    1 
ATOM 8557  C C     . ASP F 1 198 ? 9.987   -67.746  -42.137  1.00 83.84  ? 195 ASP F C     1 
ATOM 8558  O O     . ASP F 1 198 ? 9.789   -66.816  -42.929  1.00 76.23  ? 195 ASP F O     1 
ATOM 8559  C CB    . ASP F 1 198 ? 11.924  -69.316  -42.344  1.00 78.96  ? 195 ASP F CB    1 
ATOM 8560  C CG    . ASP F 1 198 ? 13.409  -69.529  -42.131  1.00 80.72  ? 195 ASP F CG    1 
ATOM 8561  O OD1   . ASP F 1 198 ? 14.135  -68.534  -41.926  1.00 87.52  ? 195 ASP F OD1   1 
ATOM 8562  O OD2   . ASP F 1 198 ? 13.850  -70.697  -42.171  1.00 79.10  ? 195 ASP F OD2   1 
ATOM 8563  N N     . LEU F 1 199 ? 8.997   -68.514  -41.683  1.00 86.32  ? 196 LEU F N     1 
ATOM 8564  C CA    . LEU F 1 199 ? 7.662   -68.449  -42.268  1.00 81.94  ? 196 LEU F CA    1 
ATOM 8565  C C     . LEU F 1 199 ? 7.087   -67.038  -42.213  1.00 86.58  ? 196 LEU F C     1 
ATOM 8566  O O     . LEU F 1 199 ? 7.223   -66.325  -41.215  1.00 88.10  ? 196 LEU F O     1 
ATOM 8567  C CB    . LEU F 1 199 ? 6.725   -69.425  -41.555  1.00 94.50  ? 196 LEU F CB    1 
ATOM 8568  C CG    . LEU F 1 199 ? 5.304   -69.527  -42.112  1.00 101.67 ? 196 LEU F CG    1 
ATOM 8569  C CD1   . LEU F 1 199 ? 5.342   -69.890  -43.589  1.00 97.66  ? 196 LEU F CD1   1 
ATOM 8570  C CD2   . LEU F 1 199 ? 4.483   -70.542  -41.330  1.00 103.97 ? 196 LEU F CD2   1 
ATOM 8571  N N     . GLU F 1 200 ? 6.437   -66.642  -43.307  1.00 90.21  ? 197 GLU F N     1 
ATOM 8572  C CA    . GLU F 1 200 ? 5.741   -65.361  -43.415  1.00 90.14  ? 197 GLU F CA    1 
ATOM 8573  C C     . GLU F 1 200 ? 4.315   -65.687  -43.834  1.00 98.84  ? 197 GLU F C     1 
ATOM 8574  O O     . GLU F 1 200 ? 4.005   -65.746  -45.033  1.00 96.53  ? 197 GLU F O     1 
ATOM 8575  C CB    . GLU F 1 200 ? 6.428   -64.427  -44.410  1.00 81.49  ? 197 GLU F CB    1 
ATOM 8576  C CG    . GLU F 1 200 ? 7.736   -63.818  -43.914  1.00 79.81  ? 197 GLU F CG    1 
ATOM 8577  C CD    . GLU F 1 200 ? 7.530   -62.741  -42.862  1.00 81.54  ? 197 GLU F CD    1 
ATOM 8578  O OE1   . GLU F 1 200 ? 6.441   -62.129  -42.839  1.00 79.74  ? 197 GLU F OE1   1 
ATOM 8579  O OE2   . GLU F 1 200 ? 8.462   -62.500  -42.064  1.00 85.43  ? 197 GLU F OE2   1 
ATOM 8580  N N     . PRO F 1 201 ? 3.421   -65.929  -42.870  1.00 103.26 ? 198 PRO F N     1 
ATOM 8581  C CA    . PRO F 1 201 ? 2.088   -66.449  -43.224  1.00 95.91  ? 198 PRO F CA    1 
ATOM 8582  C C     . PRO F 1 201 ? 1.259   -65.486  -44.056  1.00 97.52  ? 198 PRO F C     1 
ATOM 8583  O O     . PRO F 1 201 ? 0.591   -65.918  -45.004  1.00 102.72 ? 198 PRO F O     1 
ATOM 8584  C CB    . PRO F 1 201 ? 1.444   -66.726  -41.856  1.00 99.43  ? 198 PRO F CB    1 
ATOM 8585  C CG    . PRO F 1 201 ? 2.584   -66.758  -40.879  1.00 103.53 ? 198 PRO F CG    1 
ATOM 8586  C CD    . PRO F 1 201 ? 3.604   -65.810  -41.415  1.00 105.18 ? 198 PRO F CD    1 
ATOM 8587  N N     . SER F 1 202 ? 1.263   -64.195  -43.720  1.00 92.42  ? 199 SER F N     1 
ATOM 8588  C CA    . SER F 1 202 ? 0.516   -63.228  -44.519  1.00 95.52  ? 199 SER F CA    1 
ATOM 8589  C C     . SER F 1 202 ? 1.037   -63.180  -45.952  1.00 100.84 ? 199 SER F C     1 
ATOM 8590  O O     . SER F 1 202 ? 0.251   -63.113  -46.908  1.00 100.98 ? 199 SER F O     1 
ATOM 8591  C CB    . SER F 1 202 ? 0.581   -61.848  -43.864  1.00 104.06 ? 199 SER F CB    1 
ATOM 8592  O OG    . SER F 1 202 ? -0.060  -60.873  -44.667  1.00 109.96 ? 199 SER F OG    1 
ATOM 8593  N N     . VAL F 1 203 ? 2.360   -63.226  -46.121  1.00 105.99 ? 200 VAL F N     1 
ATOM 8594  C CA    . VAL F 1 203 ? 2.945   -63.212  -47.459  1.00 94.88  ? 200 VAL F CA    1 
ATOM 8595  C C     . VAL F 1 203 ? 2.569   -64.484  -48.214  1.00 86.81  ? 200 VAL F C     1 
ATOM 8596  O O     . VAL F 1 203 ? 2.184   -64.439  -49.390  1.00 88.39  ? 200 VAL F O     1 
ATOM 8597  C CB    . VAL F 1 203 ? 4.471   -63.027  -47.378  1.00 90.22  ? 200 VAL F CB    1 
ATOM 8598  C CG1   . VAL F 1 203 ? 5.075   -63.012  -48.769  1.00 84.88  ? 200 VAL F CG1   1 
ATOM 8599  C CG2   . VAL F 1 203 ? 4.821   -61.748  -46.625  1.00 90.23  ? 200 VAL F CG2   1 
ATOM 8600  N N     . GLU F 1 204 ? 2.701   -65.639  -47.557  1.00 86.86  ? 201 GLU F N     1 
ATOM 8601  C CA    . GLU F 1 204 ? 2.320   -66.901  -48.186  1.00 83.35  ? 201 GLU F CA    1 
ATOM 8602  C C     . GLU F 1 204 ? 0.860   -66.884  -48.625  1.00 86.00  ? 201 GLU F C     1 
ATOM 8603  O O     . GLU F 1 204 ? 0.524   -67.374  -49.710  1.00 72.98  ? 201 GLU F O     1 
ATOM 8604  C CB    . GLU F 1 204 ? 2.580   -68.061  -47.223  1.00 87.93  ? 201 GLU F CB    1 
ATOM 8605  C CG    . GLU F 1 204 ? 2.037   -69.406  -47.683  1.00 81.55  ? 201 GLU F CG    1 
ATOM 8606  C CD    . GLU F 1 204 ? 2.668   -69.883  -48.975  1.00 81.56  ? 201 GLU F CD    1 
ATOM 8607  O OE1   . GLU F 1 204 ? 3.887   -69.677  -49.157  1.00 90.36  ? 201 GLU F OE1   1 
ATOM 8608  O OE2   . GLU F 1 204 ? 1.945   -70.475  -49.804  1.00 86.84  ? 201 GLU F OE2   1 
ATOM 8609  N N     . GLU F 1 205 ? -0.015  -66.286  -47.811  1.00 96.52  ? 202 GLU F N     1 
ATOM 8610  C CA    . GLU F 1 205 ? -1.436  -66.218  -48.141  1.00 98.05  ? 202 GLU F CA    1 
ATOM 8611  C C     . GLU F 1 205 ? -1.677  -65.315  -49.346  1.00 91.55  ? 202 GLU F C     1 
ATOM 8612  O O     . GLU F 1 205 ? -2.383  -65.692  -50.294  1.00 92.97  ? 202 GLU F O     1 
ATOM 8613  C CB    . GLU F 1 205 ? -2.219  -65.726  -46.918  1.00 96.15  ? 202 GLU F CB    1 
ATOM 8614  C CG    . GLU F 1 205 ? -3.726  -65.576  -47.111  1.00 96.38  ? 202 GLU F CG    1 
ATOM 8615  C CD    . GLU F 1 205 ? -4.417  -65.039  -45.865  1.00 98.59  ? 202 GLU F CD    1 
ATOM 8616  O OE1   . GLU F 1 205 ? -3.931  -64.034  -45.304  1.00 104.25 ? 202 GLU F OE1   1 
ATOM 8617  O OE2   . GLU F 1 205 ? -5.445  -65.614  -45.450  1.00 107.03 ? 202 GLU F OE2   1 
ATOM 8618  N N     . ALA F 1 206 ? -1.114  -64.103  -49.310  1.00 87.82  ? 203 ALA F N     1 
ATOM 8619  C CA    . ALA F 1 206 ? -1.259  -63.178  -50.428  1.00 86.84  ? 203 ALA F CA    1 
ATOM 8620  C C     . ALA F 1 206 ? -0.735  -63.776  -51.729  1.00 93.26  ? 203 ALA F C     1 
ATOM 8621  O O     . ALA F 1 206 ? -1.276  -63.491  -52.803  1.00 90.80  ? 203 ALA F O     1 
ATOM 8622  C CB    . ALA F 1 206 ? -0.541  -61.866  -50.113  1.00 75.42  ? 203 ALA F CB    1 
ATOM 8623  N N     . ARG F 1 207 ? 0.314   -64.601  -51.657  1.00 94.60  ? 204 ARG F N     1 
ATOM 8624  C CA    . ARG F 1 207 ? 0.846   -65.217  -52.869  1.00 90.52  ? 204 ARG F CA    1 
ATOM 8625  C C     . ARG F 1 207 ? -0.025  -66.377  -53.338  1.00 89.06  ? 204 ARG F C     1 
ATOM 8626  O O     . ARG F 1 207 ? -0.224  -66.558  -54.545  1.00 90.21  ? 204 ARG F O     1 
ATOM 8627  C CB    . ARG F 1 207 ? 2.286   -65.673  -52.639  1.00 89.54  ? 204 ARG F CB    1 
ATOM 8628  C CG    . ARG F 1 207 ? 2.958   -66.288  -53.857  1.00 90.70  ? 204 ARG F CG    1 
ATOM 8629  C CD    . ARG F 1 207 ? 4.364   -66.721  -53.499  1.00 84.67  ? 204 ARG F CD    1 
ATOM 8630  N NE    . ARG F 1 207 ? 5.029   -65.722  -52.666  1.00 86.01  ? 204 ARG F NE    1 
ATOM 8631  C CZ    . ARG F 1 207 ? 5.814   -66.005  -51.632  1.00 82.09  ? 204 ARG F CZ    1 
ATOM 8632  N NH1   . ARG F 1 207 ? 6.035   -67.266  -51.283  1.00 78.90  ? 204 ARG F NH1   1 
ATOM 8633  N NH2   . ARG F 1 207 ? 6.373   -65.024  -50.940  1.00 77.45  ? 204 ARG F NH2   1 
ATOM 8634  N N     . TYR F 1 208 ? -0.531  -67.186  -52.403  1.00 92.53  ? 205 TYR F N     1 
ATOM 8635  C CA    . TYR F 1 208 ? -1.463  -68.246  -52.772  1.00 95.61  ? 205 TYR F CA    1 
ATOM 8636  C C     . TYR F 1 208 ? -2.682  -67.677  -53.485  1.00 93.28  ? 205 TYR F C     1 
ATOM 8637  O O     . TYR F 1 208 ? -3.204  -68.290  -54.425  1.00 80.37  ? 205 TYR F O     1 
ATOM 8638  C CB    . TYR F 1 208 ? -1.892  -69.039  -51.537  1.00 92.77  ? 205 TYR F CB    1 
ATOM 8639  C CG    . TYR F 1 208 ? -2.865  -70.149  -51.864  1.00 92.52  ? 205 TYR F CG    1 
ATOM 8640  C CD1   . TYR F 1 208 ? -2.430  -71.336  -52.438  1.00 83.74  ? 205 TYR F CD1   1 
ATOM 8641  C CD2   . TYR F 1 208 ? -4.224  -70.001  -51.614  1.00 92.07  ? 205 TYR F CD2   1 
ATOM 8642  C CE1   . TYR F 1 208 ? -3.319  -72.348  -52.747  1.00 83.95  ? 205 TYR F CE1   1 
ATOM 8643  C CE2   . TYR F 1 208 ? -5.121  -71.008  -51.919  1.00 93.98  ? 205 TYR F CE2   1 
ATOM 8644  C CZ    . TYR F 1 208 ? -4.663  -72.179  -52.485  1.00 92.87  ? 205 TYR F CZ    1 
ATOM 8645  O OH    . TYR F 1 208 ? -5.553  -73.185  -52.790  1.00 90.26  ? 205 TYR F OH    1 
ATOM 8646  N N     . ASN F 1 209 ? -3.147  -66.503  -53.054  1.00 101.72 ? 206 ASN F N     1 
ATOM 8647  C CA    . ASN F 1 209 ? -4.281  -65.870  -53.719  1.00 101.76 ? 206 ASN F CA    1 
ATOM 8648  C C     . ASN F 1 209 ? -3.928  -65.299  -55.086  1.00 100.74 ? 206 ASN F C     1 
ATOM 8649  O O     . ASN F 1 209 ? -4.829  -64.835  -55.791  1.00 105.07 ? 206 ASN F O     1 
ATOM 8650  C CB    . ASN F 1 209 ? -4.850  -64.748  -52.853  1.00 102.67 ? 206 ASN F CB    1 
ATOM 8651  C CG    . ASN F 1 209 ? -5.176  -65.202  -51.452  1.00 100.25 ? 206 ASN F CG    1 
ATOM 8652  O OD1   . ASN F 1 209 ? -5.707  -66.292  -51.244  1.00 98.91  ? 206 ASN F OD1   1 
ATOM 8653  N ND2   . ASN F 1 209 ? -4.858  -64.362  -50.475  1.00 93.31  ? 206 ASN F ND2   1 
ATOM 8654  N N     . SER F 1 210 ? -2.651  -65.294  -55.468  1.00 101.80 ? 207 SER F N     1 
ATOM 8655  C CA    . SER F 1 210 ? -2.234  -64.759  -56.758  1.00 96.77  ? 207 SER F CA    1 
ATOM 8656  C C     . SER F 1 210 ? -2.271  -65.781  -57.890  1.00 93.07  ? 207 SER F C     1 
ATOM 8657  O O     . SER F 1 210 ? -2.125  -65.395  -59.054  1.00 100.13 ? 207 SER F O     1 
ATOM 8658  C CB    . SER F 1 210 ? -0.824  -64.173  -56.648  1.00 95.30  ? 207 SER F CB    1 
ATOM 8659  O OG    . SER F 1 210 ? -0.867  -62.851  -56.141  1.00 97.79  ? 207 SER F OG    1 
ATOM 8660  N N     . CYS F 1 211 ? -2.476  -67.056  -57.588  1.00 89.94  ? 208 CYS F N     1 
ATOM 8661  C CA    . CYS F 1 211 ? -2.413  -68.118  -58.591  1.00 96.80  ? 208 CYS F CA    1 
ATOM 8662  C C     . CYS F 1 211 ? -3.778  -68.413  -59.212  1.00 104.23 ? 208 CYS F C     1 
ATOM 8663  O O     . CYS F 1 211 ? -4.604  -67.515  -59.392  1.00 109.69 ? 208 CYS F O     1 
ATOM 8664  C CB    . CYS F 1 211 ? -1.817  -69.391  -57.998  1.00 94.98  ? 208 CYS F CB    1 
ATOM 8665  S SG    . CYS F 1 211 ? -0.204  -69.163  -57.217  1.00 114.75 ? 208 CYS F SG    1 
ATOM 8666  N N     . CYS G 1 28  ? 4.783   -66.696  -67.316  1.00 96.75  ? 25  CYS G N     1 
ATOM 8667  C CA    . CYS G 1 28  ? 5.941   -67.417  -66.800  1.00 91.46  ? 25  CYS G CA    1 
ATOM 8668  C C     . CYS G 1 28  ? 6.776   -66.545  -65.864  1.00 92.89  ? 25  CYS G C     1 
ATOM 8669  O O     . CYS G 1 28  ? 6.272   -65.584  -65.279  1.00 93.14  ? 25  CYS G O     1 
ATOM 8670  C CB    . CYS G 1 28  ? 6.808   -67.913  -67.958  1.00 85.99  ? 25  CYS G CB    1 
ATOM 8671  S SG    . CYS G 1 28  ? 7.499   -66.589  -68.980  1.00 89.92  ? 25  CYS G SG    1 
ATOM 8672  N N     . PHE G 1 29  ? 8.059   -66.881  -65.734  1.00 80.42  ? 26  PHE G N     1 
ATOM 8673  C CA    . PHE G 1 29  ? 8.962   -66.119  -64.883  1.00 72.54  ? 26  PHE G CA    1 
ATOM 8674  C C     . PHE G 1 29  ? 9.423   -64.855  -65.592  1.00 65.08  ? 26  PHE G C     1 
ATOM 8675  O O     . PHE G 1 29  ? 9.627   -64.845  -66.808  1.00 73.16  ? 26  PHE G O     1 
ATOM 8676  C CB    . PHE G 1 29  ? 10.179  -66.950  -64.479  1.00 63.30  ? 26  PHE G CB    1 
ATOM 8677  C CG    . PHE G 1 29  ? 10.940  -66.374  -63.319  1.00 58.38  ? 26  PHE G CG    1 
ATOM 8678  C CD1   . PHE G 1 29  ? 10.595  -66.706  -62.022  1.00 59.62  ? 26  PHE G CD1   1 
ATOM 8679  C CD2   . PHE G 1 29  ? 11.986  -65.488  -63.522  1.00 62.88  ? 26  PHE G CD2   1 
ATOM 8680  C CE1   . PHE G 1 29  ? 11.280  -66.173  -60.949  1.00 61.17  ? 26  PHE G CE1   1 
ATOM 8681  C CE2   . PHE G 1 29  ? 12.675  -64.952  -62.450  1.00 65.95  ? 26  PHE G CE2   1 
ATOM 8682  C CZ    . PHE G 1 29  ? 12.321  -65.295  -61.163  1.00 60.50  ? 26  PHE G CZ    1 
ATOM 8683  N N     . GLY G 1 30  ? 9.560   -63.778  -64.823  1.00 66.02  ? 27  GLY G N     1 
ATOM 8684  C CA    . GLY G 1 30  ? 9.885   -62.484  -65.374  1.00 70.28  ? 27  GLY G CA    1 
ATOM 8685  C C     . GLY G 1 30  ? 8.718   -61.727  -65.959  1.00 69.73  ? 27  GLY G C     1 
ATOM 8686  O O     . GLY G 1 30  ? 8.876   -60.548  -66.297  1.00 58.55  ? 27  GLY G O     1 
ATOM 8687  N N     . GLN G 1 31  ? 7.554   -62.359  -66.102  1.00 71.84  ? 28  GLN G N     1 
ATOM 8688  C CA    . GLN G 1 31  ? 6.374   -61.685  -66.623  1.00 73.40  ? 28  GLN G CA    1 
ATOM 8689  C C     . GLN G 1 31  ? 5.286   -61.451  -65.587  1.00 79.97  ? 28  GLN G C     1 
ATOM 8690  O O     . GLN G 1 31  ? 4.563   -60.458  -65.696  1.00 85.81  ? 28  GLN G O     1 
ATOM 8691  C CB    . GLN G 1 31  ? 5.779   -62.468  -67.798  1.00 83.13  ? 28  GLN G CB    1 
ATOM 8692  C CG    . GLN G 1 31  ? 4.797   -61.661  -68.628  1.00 95.71  ? 28  GLN G CG    1 
ATOM 8693  C CD    . GLN G 1 31  ? 4.430   -62.363  -69.915  1.00 121.04 ? 28  GLN G CD    1 
ATOM 8694  O OE1   . GLN G 1 31  ? 4.957   -63.434  -70.216  1.00 118.50 ? 28  GLN G OE1   1 
ATOM 8695  N NE2   . GLN G 1 31  ? 3.522   -61.766  -70.684  1.00 128.80 ? 28  GLN G NE2   1 
ATOM 8696  N N     . CYS G 1 32  ? 5.150   -62.331  -64.588  1.00 79.96  ? 29  CYS G N     1 
ATOM 8697  C CA    . CYS G 1 32  ? 4.094   -62.177  -63.592  1.00 80.10  ? 29  CYS G CA    1 
ATOM 8698  C C     . CYS G 1 32  ? 4.240   -60.819  -62.925  1.00 85.09  ? 29  CYS G C     1 
ATOM 8699  O O     . CYS G 1 32  ? 5.338   -60.460  -62.500  1.00 81.67  ? 29  CYS G O     1 
ATOM 8700  C CB    . CYS G 1 32  ? 4.163   -63.285  -62.533  1.00 52.32  ? 29  CYS G CB    1 
ATOM 8701  S SG    . CYS G 1 32  ? 3.882   -64.970  -63.115  1.00 99.72  ? 29  CYS G SG    1 
ATOM 8702  N N     . GLN G 1 33  ? 3.151   -60.065  -62.810  1.00 88.35  ? 30  GLN G N     1 
ATOM 8703  C CA    . GLN G 1 33  ? 3.178   -58.783  -62.117  1.00 83.91  ? 30  GLN G CA    1 
ATOM 8704  C C     . GLN G 1 33  ? 2.585   -58.939  -60.721  1.00 83.68  ? 30  GLN G C     1 
ATOM 8705  O O     . GLN G 1 33  ? 1.527   -59.549  -60.549  1.00 88.88  ? 30  GLN G O     1 
ATOM 8706  C CB    . GLN G 1 33  ? 2.411   -57.722  -62.917  1.00 86.68  ? 30  GLN G CB    1 
ATOM 8707  C CG    . GLN G 1 33  ? 3.242   -56.986  -63.989  1.00 105.66 ? 30  GLN G CG    1 
ATOM 8708  C CD    . GLN G 1 33  ? 2.439   -55.921  -64.739  1.00 123.15 ? 30  GLN G CD    1 
ATOM 8709  O OE1   . GLN G 1 33  ? 1.838   -55.038  -64.123  1.00 127.39 ? 30  GLN G OE1   1 
ATOM 8710  N NE2   . GLN G 1 33  ? 2.437   -55.995  -66.072  1.00 100.52 ? 30  GLN G NE2   1 
ATOM 8711  N N     . TYR G 1 34  ? 3.252   -58.351  -59.729  1.00 83.66  ? 31  TYR G N     1 
ATOM 8712  C CA    . TYR G 1 34  ? 2.825   -58.543  -58.349  1.00 78.01  ? 31  TYR G CA    1 
ATOM 8713  C C     . TYR G 1 34  ? 1.433   -57.974  -58.113  1.00 85.70  ? 31  TYR G C     1 
ATOM 8714  O O     . TYR G 1 34  ? 1.131   -56.834  -58.481  1.00 85.74  ? 31  TYR G O     1 
ATOM 8715  C CB    . TYR G 1 34  ? 3.831   -57.914  -57.380  1.00 77.78  ? 31  TYR G CB    1 
ATOM 8716  C CG    . TYR G 1 34  ? 4.940   -58.865  -56.992  1.00 71.75  ? 31  TYR G CG    1 
ATOM 8717  C CD1   . TYR G 1 34  ? 4.674   -59.977  -56.203  1.00 78.18  ? 31  TYR G CD1   1 
ATOM 8718  C CD2   . TYR G 1 34  ? 6.244   -58.667  -57.423  1.00 66.63  ? 31  TYR G CD2   1 
ATOM 8719  C CE1   . TYR G 1 34  ? 5.674   -60.860  -55.847  1.00 76.42  ? 31  TYR G CE1   1 
ATOM 8720  C CE2   . TYR G 1 34  ? 7.255   -59.550  -57.072  1.00 72.50  ? 31  TYR G CE2   1 
ATOM 8721  C CZ    . TYR G 1 34  ? 6.962   -60.646  -56.284  1.00 77.72  ? 31  TYR G CZ    1 
ATOM 8722  O OH    . TYR G 1 34  ? 7.955   -61.530  -55.927  1.00 72.76  ? 31  TYR G OH    1 
ATOM 8723  N N     . THR G 1 35  ? 0.587   -58.791  -57.497  1.00 88.05  ? 32  THR G N     1 
ATOM 8724  C CA    . THR G 1 35  ? -0.728  -58.357  -57.069  1.00 87.36  ? 32  THR G CA    1 
ATOM 8725  C C     . THR G 1 35  ? -0.593  -57.454  -55.849  1.00 89.99  ? 32  THR G C     1 
ATOM 8726  O O     . THR G 1 35  ? 0.423   -57.463  -55.150  1.00 92.29  ? 32  THR G O     1 
ATOM 8727  C CB    . THR G 1 35  ? -1.605  -59.565  -56.743  1.00 84.46  ? 32  THR G CB    1 
ATOM 8728  O OG1   . THR G 1 35  ? -0.911  -60.424  -55.830  1.00 77.89  ? 32  THR G OG1   1 
ATOM 8729  C CG2   . THR G 1 35  ? -1.930  -60.345  -58.010  1.00 98.96  ? 32  THR G CG2   1 
ATOM 8730  N N     . ALA G 1 36  ? -1.621  -56.633  -55.625  1.00 91.66  ? 33  ALA G N     1 
ATOM 8731  C CA    . ALA G 1 36  ? -1.574  -55.671  -54.527  1.00 82.41  ? 33  ALA G CA    1 
ATOM 8732  C C     . ALA G 1 36  ? -1.309  -56.357  -53.193  1.00 82.85  ? 33  ALA G C     1 
ATOM 8733  O O     . ALA G 1 36  ? -0.482  -55.891  -52.400  1.00 79.61  ? 33  ALA G O     1 
ATOM 8734  C CB    . ALA G 1 36  ? -2.878  -54.876  -54.471  1.00 73.63  ? 33  ALA G CB    1 
ATOM 8735  N N     . GLU G 1 37  ? -1.985  -57.480  -52.939  1.00 81.33  ? 34  GLU G N     1 
ATOM 8736  C CA    . GLU G 1 37  ? -1.829  -58.171  -51.665  1.00 82.38  ? 34  GLU G CA    1 
ATOM 8737  C C     . GLU G 1 37  ? -0.407  -58.681  -51.488  1.00 82.84  ? 34  GLU G C     1 
ATOM 8738  O O     . GLU G 1 37  ? 0.228   -58.440  -50.453  1.00 88.23  ? 34  GLU G O     1 
ATOM 8739  C CB    . GLU G 1 37  ? -2.817  -59.336  -51.582  1.00 86.67  ? 34  GLU G CB    1 
ATOM 8740  C CG    . GLU G 1 37  ? -4.228  -59.017  -52.051  1.00 98.75  ? 34  GLU G CG    1 
ATOM 8741  C CD    . GLU G 1 37  ? -4.448  -59.406  -53.503  1.00 104.93 ? 34  GLU G CD    1 
ATOM 8742  O OE1   . GLU G 1 37  ? -3.972  -60.490  -53.905  1.00 117.89 ? 34  GLU G OE1   1 
ATOM 8743  O OE2   . GLU G 1 37  ? -5.103  -58.637  -54.238  1.00 100.52 ? 34  GLU G OE2   1 
ATOM 8744  N N     . GLU G 1 38  ? 0.122   -59.364  -52.506  1.00 85.17  ? 35  GLU G N     1 
ATOM 8745  C CA    . GLU G 1 38  ? 1.463   -59.922  -52.394  1.00 83.69  ? 35  GLU G CA    1 
ATOM 8746  C C     . GLU G 1 38  ? 2.513   -58.821  -52.376  1.00 79.40  ? 35  GLU G C     1 
ATOM 8747  O O     . GLU G 1 38  ? 3.481   -58.897  -51.607  1.00 76.64  ? 35  GLU G O     1 
ATOM 8748  C CB    . GLU G 1 38  ? 1.721   -60.908  -53.530  1.00 82.94  ? 35  GLU G CB    1 
ATOM 8749  C CG    . GLU G 1 38  ? 3.059   -61.610  -53.434  1.00 79.68  ? 35  GLU G CG    1 
ATOM 8750  C CD    . GLU G 1 38  ? 3.245   -62.648  -54.520  1.00 86.83  ? 35  GLU G CD    1 
ATOM 8751  O OE1   . GLU G 1 38  ? 4.229   -63.414  -54.447  1.00 78.40  ? 35  GLU G OE1   1 
ATOM 8752  O OE2   . GLU G 1 38  ? 2.411   -62.688  -55.452  1.00 85.11  ? 35  GLU G OE2   1 
ATOM 8753  N N     . TYR G 1 39  ? 2.331   -57.782  -53.196  1.00 75.60  ? 36  TYR G N     1 
ATOM 8754  C CA    . TYR G 1 39  ? 3.251   -56.652  -53.146  1.00 74.05  ? 36  TYR G CA    1 
ATOM 8755  C C     . TYR G 1 39  ? 3.321   -56.057  -51.747  1.00 76.23  ? 36  TYR G C     1 
ATOM 8756  O O     . TYR G 1 39  ? 4.411   -55.848  -51.210  1.00 78.50  ? 36  TYR G O     1 
ATOM 8757  C CB    . TYR G 1 39  ? 2.853   -55.551  -54.131  1.00 75.04  ? 36  TYR G CB    1 
ATOM 8758  C CG    . TYR G 1 39  ? 3.395   -54.217  -53.650  1.00 67.02  ? 36  TYR G CG    1 
ATOM 8759  C CD1   . TYR G 1 39  ? 4.755   -53.936  -53.709  1.00 66.91  ? 36  TYR G CD1   1 
ATOM 8760  C CD2   . TYR G 1 39  ? 2.557   -53.266  -53.077  1.00 71.29  ? 36  TYR G CD2   1 
ATOM 8761  C CE1   . TYR G 1 39  ? 5.261   -52.740  -53.232  1.00 67.61  ? 36  TYR G CE1   1 
ATOM 8762  C CE2   . TYR G 1 39  ? 3.055   -52.067  -52.600  1.00 78.93  ? 36  TYR G CE2   1 
ATOM 8763  C CZ    . TYR G 1 39  ? 4.405   -51.811  -52.682  1.00 70.68  ? 36  TYR G CZ    1 
ATOM 8764  O OH    . TYR G 1 39  ? 4.902   -50.622  -52.206  1.00 66.24  ? 36  TYR G OH    1 
ATOM 8765  N N     . GLN G 1 40  ? 2.167   -55.739  -51.155  1.00 81.46  ? 37  GLN G N     1 
ATOM 8766  C CA    . GLN G 1 40  ? 2.196   -55.053  -49.868  1.00 83.04  ? 37  GLN G CA    1 
ATOM 8767  C C     . GLN G 1 40  ? 2.736   -55.962  -48.774  1.00 80.58  ? 37  GLN G C     1 
ATOM 8768  O O     . GLN G 1 40  ? 3.522   -55.519  -47.925  1.00 77.84  ? 37  GLN G O     1 
ATOM 8769  C CB    . GLN G 1 40  ? 0.814   -54.523  -49.502  1.00 83.72  ? 37  GLN G CB    1 
ATOM 8770  C CG    . GLN G 1 40  ? 0.844   -53.617  -48.289  1.00 89.67  ? 37  GLN G CG    1 
ATOM 8771  C CD    . GLN G 1 40  ? -0.534  -53.217  -47.828  1.00 91.91  ? 37  GLN G CD    1 
ATOM 8772  O OE1   . GLN G 1 40  ? -1.530  -53.814  -48.232  1.00 83.87  ? 37  GLN G OE1   1 
ATOM 8773  N NE2   . GLN G 1 40  ? -0.604  -52.185  -46.995  1.00 96.61  ? 37  GLN G NE2   1 
ATOM 8774  N N     . ALA G 1 41  ? 2.320   -57.232  -48.774  1.00 71.57  ? 38  ALA G N     1 
ATOM 8775  C CA    . ALA G 1 41  ? 2.857   -58.191  -47.819  1.00 73.64  ? 38  ALA G CA    1 
ATOM 8776  C C     . ALA G 1 41  ? 4.379   -58.248  -47.897  1.00 77.98  ? 38  ALA G C     1 
ATOM 8777  O O     . ALA G 1 41  ? 5.068   -58.149  -46.874  1.00 78.34  ? 38  ALA G O     1 
ATOM 8778  C CB    . ALA G 1 41  ? 2.245   -59.569  -48.073  1.00 85.40  ? 38  ALA G CB    1 
ATOM 8779  N N     . ILE G 1 42  ? 4.926   -58.379  -49.111  1.00 74.91  ? 39  ILE G N     1 
ATOM 8780  C CA    . ILE G 1 42  ? 6.373   -58.514  -49.249  1.00 73.50  ? 39  ILE G CA    1 
ATOM 8781  C C     . ILE G 1 42  ? 7.071   -57.210  -48.877  1.00 69.04  ? 39  ILE G C     1 
ATOM 8782  O O     . ILE G 1 42  ? 8.099   -57.215  -48.189  1.00 70.23  ? 39  ILE G O     1 
ATOM 8783  C CB    . ILE G 1 42  ? 6.736   -58.967  -50.674  1.00 68.36  ? 39  ILE G CB    1 
ATOM 8784  C CG1   . ILE G 1 42  ? 6.345   -60.431  -50.875  1.00 72.24  ? 39  ILE G CG1   1 
ATOM 8785  C CG2   . ILE G 1 42  ? 8.225   -58.801  -50.917  1.00 64.17  ? 39  ILE G CG2   1 
ATOM 8786  C CD1   . ILE G 1 42  ? 6.495   -60.918  -52.299  1.00 84.70  ? 39  ILE G CD1   1 
ATOM 8787  N N     . GLN G 1 43  ? 6.523   -56.075  -49.318  1.00 71.71  ? 40  GLN G N     1 
ATOM 8788  C CA    . GLN G 1 43  ? 7.111   -54.779  -48.998  1.00 68.80  ? 40  GLN G CA    1 
ATOM 8789  C C     . GLN G 1 43  ? 7.203   -54.566  -47.493  1.00 76.12  ? 40  GLN G C     1 
ATOM 8790  O O     . GLN G 1 43  ? 8.230   -54.096  -46.989  1.00 72.04  ? 40  GLN G O     1 
ATOM 8791  C CB    . GLN G 1 43  ? 6.289   -53.667  -49.653  1.00 68.99  ? 40  GLN G CB    1 
ATOM 8792  C CG    . GLN G 1 43  ? 6.692   -52.241  -49.286  1.00 76.44  ? 40  GLN G CG    1 
ATOM 8793  C CD    . GLN G 1 43  ? 7.987   -51.794  -49.942  1.00 73.46  ? 40  GLN G CD    1 
ATOM 8794  O OE1   . GLN G 1 43  ? 8.822   -52.611  -50.330  1.00 77.49  ? 40  GLN G OE1   1 
ATOM 8795  N NE2   . GLN G 1 43  ? 8.154   -50.484  -50.075  1.00 65.36  ? 40  GLN G NE2   1 
ATOM 8796  N N     . LYS G 1 44  ? 6.142   -54.907  -46.756  1.00 86.88  ? 41  LYS G N     1 
ATOM 8797  C CA    . LYS G 1 44  ? 6.187   -54.793  -45.301  1.00 83.81  ? 41  LYS G CA    1 
ATOM 8798  C C     . LYS G 1 44  ? 7.165   -55.792  -44.693  1.00 80.09  ? 41  LYS G C     1 
ATOM 8799  O O     . LYS G 1 44  ? 7.963   -55.436  -43.818  1.00 79.22  ? 41  LYS G O     1 
ATOM 8800  C CB    . LYS G 1 44  ? 4.789   -54.965  -44.708  1.00 78.77  ? 41  LYS G CB    1 
ATOM 8801  C CG    . LYS G 1 44  ? 3.892   -53.750  -44.911  1.00 81.99  ? 41  LYS G CG    1 
ATOM 8802  C CD    . LYS G 1 44  ? 2.560   -53.931  -44.208  1.00 90.63  ? 41  LYS G CD    1 
ATOM 8803  C CE    . LYS G 1 44  ? 1.593   -52.811  -44.535  1.00 87.32  ? 41  LYS G CE    1 
ATOM 8804  N NZ    . LYS G 1 44  ? 1.980   -51.525  -43.895  1.00 91.28  ? 41  LYS G NZ    1 
ATOM 8805  N N     . ALA G 1 45  ? 7.110   -57.052  -45.134  1.00 72.33  ? 42  ALA G N     1 
ATOM 8806  C CA    . ALA G 1 45  ? 7.954   -58.081  -44.536  1.00 69.34  ? 42  ALA G CA    1 
ATOM 8807  C C     . ALA G 1 45  ? 9.436   -57.777  -44.714  1.00 72.30  ? 42  ALA G C     1 
ATOM 8808  O O     . ALA G 1 45  ? 10.238  -58.088  -43.828  1.00 70.77  ? 42  ALA G O     1 
ATOM 8809  C CB    . ALA G 1 45  ? 7.620   -59.448  -45.133  1.00 70.05  ? 42  ALA G CB    1 
ATOM 8810  N N     . LEU G 1 46  ? 9.818   -57.159  -45.834  1.00 78.83  ? 43  LEU G N     1 
ATOM 8811  C CA    . LEU G 1 46  ? 11.229  -56.884  -46.075  1.00 74.47  ? 43  LEU G CA    1 
ATOM 8812  C C     . LEU G 1 46  ? 11.792  -55.829  -45.134  1.00 76.78  ? 43  LEU G C     1 
ATOM 8813  O O     . LEU G 1 46  ? 13.014  -55.758  -44.971  1.00 71.17  ? 43  LEU G O     1 
ATOM 8814  C CB    . LEU G 1 46  ? 11.451  -56.456  -47.527  1.00 74.23  ? 43  LEU G CB    1 
ATOM 8815  C CG    . LEU G 1 46  ? 11.478  -57.624  -48.517  1.00 72.43  ? 43  LEU G CG    1 
ATOM 8816  C CD1   . LEU G 1 46  ? 11.488  -57.134  -49.950  1.00 64.57  ? 43  LEU G CD1   1 
ATOM 8817  C CD2   . LEU G 1 46  ? 12.672  -58.531  -48.242  1.00 70.51  ? 43  LEU G CD2   1 
ATOM 8818  N N     . ARG G 1 47  ? 10.937  -55.016  -44.509  1.00 81.36  ? 44  ARG G N     1 
ATOM 8819  C CA    . ARG G 1 47  ? 11.429  -54.010  -43.574  1.00 75.64  ? 44  ARG G CA    1 
ATOM 8820  C C     . ARG G 1 47  ? 11.936  -54.638  -42.282  1.00 74.26  ? 44  ARG G C     1 
ATOM 8821  O O     . ARG G 1 47  ? 12.780  -54.045  -41.600  1.00 79.27  ? 44  ARG G O     1 
ATOM 8822  C CB    . ARG G 1 47  ? 10.336  -52.988  -43.271  1.00 74.26  ? 44  ARG G CB    1 
ATOM 8823  C CG    . ARG G 1 47  ? 10.239  -51.878  -44.296  1.00 85.84  ? 44  ARG G CG    1 
ATOM 8824  C CD    . ARG G 1 47  ? 9.187   -50.865  -43.898  1.00 75.85  ? 44  ARG G CD    1 
ATOM 8825  N NE    . ARG G 1 47  ? 7.856   -51.282  -44.323  1.00 82.36  ? 44  ARG G NE    1 
ATOM 8826  C CZ    . ARG G 1 47  ? 7.205   -50.758  -45.356  1.00 80.92  ? 44  ARG G CZ    1 
ATOM 8827  N NH1   . ARG G 1 47  ? 7.763   -49.792  -46.073  1.00 73.89  ? 44  ARG G NH1   1 
ATOM 8828  N NH2   . ARG G 1 47  ? 5.994   -51.198  -45.671  1.00 83.57  ? 44  ARG G NH2   1 
ATOM 8829  N N     . GLN G 1 48  ? 11.404  -55.803  -41.914  1.00 65.44  ? 45  GLN G N     1 
ATOM 8830  C CA    . GLN G 1 48  ? 11.785  -56.465  -40.671  1.00 70.17  ? 45  GLN G CA    1 
ATOM 8831  C C     . GLN G 1 48  ? 13.294  -56.652  -40.584  1.00 70.83  ? 45  GLN G C     1 
ATOM 8832  O O     . GLN G 1 48  ? 13.933  -57.103  -41.538  1.00 76.94  ? 45  GLN G O     1 
ATOM 8833  C CB    . GLN G 1 48  ? 11.093  -57.826  -40.568  1.00 75.31  ? 45  GLN G CB    1 
ATOM 8834  C CG    . GLN G 1 48  ? 9.579   -57.776  -40.600  1.00 87.41  ? 45  GLN G CG    1 
ATOM 8835  C CD    . GLN G 1 48  ? 8.961   -59.159  -40.632  1.00 89.47  ? 45  GLN G CD    1 
ATOM 8836  O OE1   . GLN G 1 48  ? 9.656   -60.157  -40.832  1.00 90.93  ? 45  GLN G OE1   1 
ATOM 8837  N NE2   . GLN G 1 48  ? 7.649   -59.227  -40.436  1.00 88.08  ? 45  GLN G NE2   1 
ATOM 8838  N N     . ARG G 1 49  ? 13.862  -56.294  -39.439  1.00 74.16  ? 46  ARG G N     1 
ATOM 8839  C CA    . ARG G 1 49  ? 15.233  -56.682  -39.154  1.00 76.11  ? 46  ARG G CA    1 
ATOM 8840  C C     . ARG G 1 49  ? 15.269  -58.134  -38.682  1.00 74.57  ? 46  ARG G C     1 
ATOM 8841  O O     . ARG G 1 49  ? 14.261  -58.697  -38.249  1.00 79.71  ? 46  ARG G O     1 
ATOM 8842  C CB    . ARG G 1 49  ? 15.843  -55.755  -38.101  1.00 71.76  ? 46  ARG G CB    1 
ATOM 8843  C CG    . ARG G 1 49  ? 15.910  -54.286  -38.524  1.00 70.03  ? 46  ARG G CG    1 
ATOM 8844  C CD    . ARG G 1 49  ? 16.548  -53.425  -37.439  1.00 79.40  ? 46  ARG G CD    1 
ATOM 8845  N NE    . ARG G 1 49  ? 16.890  -52.079  -37.900  1.00 76.04  ? 46  ARG G NE    1 
ATOM 8846  C CZ    . ARG G 1 49  ? 16.072  -51.032  -37.849  1.00 82.66  ? 46  ARG G CZ    1 
ATOM 8847  N NH1   . ARG G 1 49  ? 14.848  -51.162  -37.355  1.00 76.43  ? 46  ARG G NH1   1 
ATOM 8848  N NH2   . ARG G 1 49  ? 16.479  -49.849  -38.291  1.00 88.13  ? 46  ARG G NH2   1 
ATOM 8849  N N     . LEU G 1 50  ? 16.448  -58.745  -38.764  1.00 75.08  ? 47  LEU G N     1 
ATOM 8850  C CA    . LEU G 1 50  ? 16.581  -60.152  -38.416  1.00 83.16  ? 47  LEU G CA    1 
ATOM 8851  C C     . LEU G 1 50  ? 16.892  -60.298  -36.934  1.00 82.51  ? 47  LEU G C     1 
ATOM 8852  O O     . LEU G 1 50  ? 17.666  -59.521  -36.368  1.00 78.39  ? 47  LEU G O     1 
ATOM 8853  C CB    . LEU G 1 50  ? 17.676  -60.838  -39.237  1.00 85.75  ? 47  LEU G CB    1 
ATOM 8854  C CG    . LEU G 1 50  ? 17.441  -61.096  -40.726  1.00 73.11  ? 47  LEU G CG    1 
ATOM 8855  C CD1   . LEU G 1 50  ? 15.962  -61.283  -41.041  1.00 67.83  ? 47  LEU G CD1   1 
ATOM 8856  C CD2   . LEU G 1 50  ? 18.048  -59.993  -41.558  1.00 68.17  ? 47  LEU G CD2   1 
ATOM 8857  N N     . GLY G 1 51  ? 16.266  -61.292  -36.310  1.00 83.87  ? 48  GLY G N     1 
ATOM 8858  C CA    . GLY G 1 51  ? 16.560  -61.637  -34.942  1.00 91.42  ? 48  GLY G CA    1 
ATOM 8859  C C     . GLY G 1 51  ? 17.920  -62.292  -34.807  1.00 95.56  ? 48  GLY G C     1 
ATOM 8860  O O     . GLY G 1 51  ? 18.593  -62.597  -35.797  1.00 97.73  ? 48  GLY G O     1 
ATOM 8861  N N     . PRO G 1 52  ? 18.351  -62.523  -33.563  1.00 92.75  ? 49  PRO G N     1 
ATOM 8862  C CA    . PRO G 1 52  ? 19.681  -63.117  -33.335  1.00 85.69  ? 49  PRO G CA    1 
ATOM 8863  C C     . PRO G 1 52  ? 19.812  -64.555  -33.816  1.00 85.55  ? 49  PRO G C     1 
ATOM 8864  O O     . PRO G 1 52  ? 20.942  -65.058  -33.892  1.00 82.65  ? 49  PRO G O     1 
ATOM 8865  C CB    . PRO G 1 52  ? 19.851  -63.035  -31.810  1.00 96.62  ? 49  PRO G CB    1 
ATOM 8866  C CG    . PRO G 1 52  ? 18.776  -62.104  -31.327  1.00 100.29 ? 49  PRO G CG    1 
ATOM 8867  C CD    . PRO G 1 52  ? 17.660  -62.186  -32.309  1.00 93.30  ? 49  PRO G CD    1 
ATOM 8868  N N     . GLU G 1 53  ? 18.706  -65.230  -34.140  1.00 82.58  ? 50  GLU G N     1 
ATOM 8869  C CA    . GLU G 1 53  ? 18.792  -66.609  -34.612  1.00 83.59  ? 50  GLU G CA    1 
ATOM 8870  C C     . GLU G 1 53  ? 19.545  -66.704  -35.932  1.00 87.07  ? 50  GLU G C     1 
ATOM 8871  O O     . GLU G 1 53  ? 20.163  -67.734  -36.224  1.00 89.70  ? 50  GLU G O     1 
ATOM 8872  C CB    . GLU G 1 53  ? 17.389  -67.203  -34.762  1.00 91.31  ? 50  GLU G CB    1 
ATOM 8873  C CG    . GLU G 1 53  ? 16.551  -67.178  -33.489  1.00 100.63 ? 50  GLU G CG    1 
ATOM 8874  C CD    . GLU G 1 53  ? 15.754  -65.893  -33.327  1.00 100.90 ? 50  GLU G CD    1 
ATOM 8875  O OE1   . GLU G 1 53  ? 16.231  -64.827  -33.772  1.00 92.58  ? 50  GLU G OE1   1 
ATOM 8876  O OE2   . GLU G 1 53  ? 14.648  -65.951  -32.749  1.00 107.22 ? 50  GLU G OE2   1 
ATOM 8877  N N     . TYR G 1 54  ? 19.514  -65.638  -36.731  1.00 88.26  ? 51  TYR G N     1 
ATOM 8878  C CA    . TYR G 1 54  ? 20.101  -65.633  -38.064  1.00 85.07  ? 51  TYR G CA    1 
ATOM 8879  C C     . TYR G 1 54  ? 21.566  -65.234  -38.063  1.00 83.69  ? 51  TYR G C     1 
ATOM 8880  O O     . TYR G 1 54  ? 22.339  -65.731  -38.891  1.00 90.47  ? 51  TYR G O     1 
ATOM 8881  C CB    . TYR G 1 54  ? 19.319  -64.677  -38.968  1.00 79.24  ? 51  TYR G CB    1 
ATOM 8882  C CG    . TYR G 1 54  ? 17.921  -65.145  -39.276  1.00 81.75  ? 51  TYR G CG    1 
ATOM 8883  C CD1   . TYR G 1 54  ? 17.674  -66.468  -39.608  1.00 91.20  ? 51  TYR G CD1   1 
ATOM 8884  C CD2   . TYR G 1 54  ? 16.847  -64.266  -39.235  1.00 81.86  ? 51  TYR G CD2   1 
ATOM 8885  C CE1   . TYR G 1 54  ? 16.399  -66.905  -39.894  1.00 94.61  ? 51  TYR G CE1   1 
ATOM 8886  C CE2   . TYR G 1 54  ? 15.564  -64.694  -39.522  1.00 82.56  ? 51  TYR G CE2   1 
ATOM 8887  C CZ    . TYR G 1 54  ? 15.347  -66.015  -39.851  1.00 89.11  ? 51  TYR G CZ    1 
ATOM 8888  O OH    . TYR G 1 54  ? 14.073  -66.449  -40.137  1.00 84.79  ? 51  TYR G OH    1 
ATOM 8889  N N     . ILE G 1 55  ? 21.960  -64.359  -37.155  1.00 73.39  ? 52  ILE G N     1 
ATOM 8890  C CA    . ILE G 1 55  ? 23.282  -63.751  -37.201  1.00 77.63  ? 52  ILE G CA    1 
ATOM 8891  C C     . ILE G 1 55  ? 24.307  -64.710  -36.616  1.00 77.47  ? 52  ILE G C     1 
ATOM 8892  O O     . ILE G 1 55  ? 24.061  -65.376  -35.604  1.00 88.35  ? 52  ILE G O     1 
ATOM 8893  C CB    . ILE G 1 55  ? 23.278  -62.409  -36.450  1.00 65.80  ? 52  ILE G CB    1 
ATOM 8894  C CG1   . ILE G 1 55  ? 22.039  -61.593  -36.829  1.00 77.61  ? 52  ILE G CG1   1 
ATOM 8895  C CG2   . ILE G 1 55  ? 24.530  -61.620  -36.772  1.00 68.99  ? 52  ILE G CG2   1 
ATOM 8896  C CD1   . ILE G 1 55  ? 21.910  -61.323  -38.311  1.00 73.84  ? 52  ILE G CD1   1 
ATOM 8897  N N     . SER G 1 56  ? 25.467  -64.778  -37.263  1.00 82.31  ? 53  SER G N     1 
ATOM 8898  C CA    . SER G 1 56  ? 26.610  -65.546  -36.796  1.00 87.49  ? 53  SER G CA    1 
ATOM 8899  C C     . SER G 1 56  ? 27.810  -64.612  -36.759  1.00 94.62  ? 53  SER G C     1 
ATOM 8900  O O     . SER G 1 56  ? 27.745  -63.469  -37.220  1.00 89.88  ? 53  SER G O     1 
ATOM 8901  C CB    . SER G 1 56  ? 26.883  -66.764  -37.690  1.00 88.83  ? 53  SER G CB    1 
ATOM 8902  O OG    . SER G 1 56  ? 25.694  -67.495  -37.934  1.00 86.14  ? 53  SER G OG    1 
ATOM 8903  N N     . SER G 1 57  ? 28.921  -65.097  -36.213  1.00 102.47 ? 54  SER G N     1 
ATOM 8904  C CA    . SER G 1 57  ? 30.056  -64.212  -36.018  1.00 107.44 ? 54  SER G CA    1 
ATOM 8905  C C     . SER G 1 57  ? 31.376  -64.955  -36.139  1.00 115.82 ? 54  SER G C     1 
ATOM 8906  O O     . SER G 1 57  ? 31.463  -66.161  -35.889  1.00 116.19 ? 54  SER G O     1 
ATOM 8907  C CB    . SER G 1 57  ? 29.981  -63.524  -34.651  1.00 114.46 ? 54  SER G CB    1 
ATOM 8908  O OG    . SER G 1 57  ? 30.248  -64.436  -33.598  1.00 121.01 ? 54  SER G OG    1 
ATOM 8909  N N     . ARG G 1 58  ? 32.402  -64.202  -36.529  1.00 118.28 ? 55  ARG G N     1 
ATOM 8910  C CA    . ARG G 1 58  ? 33.783  -64.654  -36.524  1.00 125.23 ? 55  ARG G CA    1 
ATOM 8911  C C     . ARG G 1 58  ? 34.583  -63.514  -35.915  1.00 129.50 ? 55  ARG G C     1 
ATOM 8912  O O     . ARG G 1 58  ? 34.028  -62.474  -35.550  1.00 123.30 ? 55  ARG G O     1 
ATOM 8913  C CB    . ARG G 1 58  ? 34.314  -64.995  -37.923  1.00 109.57 ? 55  ARG G CB    1 
ATOM 8914  C CG    . ARG G 1 58  ? 34.547  -63.776  -38.805  1.00 114.12 ? 55  ARG G CG    1 
ATOM 8915  C CD    . ARG G 1 58  ? 35.216  -64.143  -40.124  1.00 122.04 ? 55  ARG G CD    1 
ATOM 8916  N NE    . ARG G 1 58  ? 35.176  -63.033  -41.073  1.00 121.24 ? 55  ARG G NE    1 
ATOM 8917  C CZ    . ARG G 1 58  ? 34.225  -62.853  -41.981  1.00 125.67 ? 55  ARG G CZ    1 
ATOM 8918  N NH1   . ARG G 1 58  ? 33.318  -63.796  -42.194  1.00 113.15 ? 55  ARG G NH1   1 
ATOM 8919  N NH2   . ARG G 1 58  ? 34.271  -61.796  -42.782  1.00 125.63 ? 55  ARG G NH2   1 
ATOM 8920  N N     . MET G 1 59  ? 35.889  -63.695  -35.786  1.00 129.01 ? 56  MET G N     1 
ATOM 8921  C CA    . MET G 1 59  ? 36.730  -62.647  -35.234  1.00 125.38 ? 56  MET G CA    1 
ATOM 8922  C C     . MET G 1 59  ? 37.640  -62.039  -36.293  1.00 120.84 ? 56  MET G C     1 
ATOM 8923  O O     . MET G 1 59  ? 38.218  -62.751  -37.120  1.00 121.56 ? 56  MET G O     1 
ATOM 8924  C CB    . MET G 1 59  ? 37.552  -63.185  -34.070  1.00 133.13 ? 56  MET G CB    1 
ATOM 8925  C CG    . MET G 1 59  ? 36.711  -63.584  -32.861  1.00 130.48 ? 56  MET G CG    1 
ATOM 8926  S SD    . MET G 1 59  ? 35.659  -62.246  -32.253  1.00 143.24 ? 56  MET G SD    1 
ATOM 8927  C CE    . MET G 1 59  ? 34.180  -63.147  -31.780  1.00 123.99 ? 56  MET G CE    1 
ATOM 8928  N N     . ALA G 1 60  ? 37.754  -60.715  -36.259  1.00 116.50 ? 57  ALA G N     1 
ATOM 8929  C CA    . ALA G 1 60  ? 38.778  -60.002  -37.002  1.00 119.11 ? 57  ALA G CA    1 
ATOM 8930  C C     . ALA G 1 60  ? 39.995  -59.785  -36.108  1.00 128.51 ? 57  ALA G C     1 
ATOM 8931  O O     . ALA G 1 60  ? 39.907  -59.816  -34.878  1.00 134.25 ? 57  ALA G O     1 
ATOM 8932  C CB    . ALA G 1 60  ? 38.243  -58.668  -37.520  1.00 124.23 ? 57  ALA G CB    1 
ATOM 8933  N N     . GLY G 1 61  ? 41.144  -59.558  -36.749  1.00 123.78 ? 58  GLY G N     1 
ATOM 8934  C CA    . GLY G 1 61  ? 42.406  -59.574  -36.027  1.00 128.51 ? 58  GLY G CA    1 
ATOM 8935  C C     . GLY G 1 61  ? 42.583  -58.436  -35.041  1.00 136.02 ? 58  GLY G C     1 
ATOM 8936  O O     . GLY G 1 61  ? 43.227  -58.611  -34.002  1.00 132.21 ? 58  GLY G O     1 
ATOM 8937  N N     . GLY G 1 62  ? 42.025  -57.264  -35.343  1.00 133.77 ? 59  GLY G N     1 
ATOM 8938  C CA    . GLY G 1 62  ? 42.210  -56.104  -34.489  1.00 130.07 ? 59  GLY G CA    1 
ATOM 8939  C C     . GLY G 1 62  ? 41.448  -56.153  -33.179  1.00 136.29 ? 59  GLY G C     1 
ATOM 8940  O O     . GLY G 1 62  ? 41.430  -55.173  -32.427  1.00 122.04 ? 59  GLY G O     1 
ATOM 8941  N N     . GLY G 1 63  ? 40.825  -57.292  -32.888  1.00 138.38 ? 60  GLY G N     1 
ATOM 8942  C CA    . GLY G 1 63  ? 39.977  -57.431  -31.724  1.00 133.44 ? 60  GLY G CA    1 
ATOM 8943  C C     . GLY G 1 63  ? 38.524  -57.087  -31.955  1.00 137.47 ? 60  GLY G C     1 
ATOM 8944  O O     . GLY G 1 63  ? 37.770  -56.967  -30.981  1.00 136.23 ? 60  GLY G O     1 
ATOM 8945  N N     . GLN G 1 64  ? 38.107  -56.927  -33.208  1.00 137.94 ? 61  GLN G N     1 
ATOM 8946  C CA    . GLN G 1 64  ? 36.749  -56.548  -33.566  1.00 137.98 ? 61  GLN G CA    1 
ATOM 8947  C C     . GLN G 1 64  ? 35.950  -57.762  -34.031  1.00 143.43 ? 61  GLN G C     1 
ATOM 8948  O O     . GLN G 1 64  ? 36.505  -58.776  -34.463  1.00 142.69 ? 61  GLN G O     1 
ATOM 8949  C CB    . GLN G 1 64  ? 36.759  -55.471  -34.659  1.00 138.61 ? 61  GLN G CB    1 
ATOM 8950  C CG    . GLN G 1 64  ? 37.834  -55.666  -35.722  1.00 138.20 ? 61  GLN G CG    1 
ATOM 8951  C CD    . GLN G 1 64  ? 37.687  -54.713  -36.898  1.00 137.02 ? 61  GLN G CD    1 
ATOM 8952  O OE1   . GLN G 1 64  ? 36.662  -54.047  -37.048  1.00 135.09 ? 61  GLN G OE1   1 
ATOM 8953  N NE2   . GLN G 1 64  ? 38.715  -54.644  -37.738  1.00 122.24 ? 61  GLN G NE2   1 
ATOM 8954  N N     . LYS G 1 65  ? 34.628  -57.640  -33.940  1.00 140.10 ? 62  LYS G N     1 
ATOM 8955  C CA    . LYS G 1 65  ? 33.697  -58.709  -34.281  1.00 133.82 ? 62  LYS G CA    1 
ATOM 8956  C C     . LYS G 1 65  ? 33.060  -58.428  -35.637  1.00 125.07 ? 62  LYS G C     1 
ATOM 8957  O O     . LYS G 1 65  ? 32.740  -57.278  -35.954  1.00 118.88 ? 62  LYS G O     1 
ATOM 8958  C CB    . LYS G 1 65  ? 32.620  -58.834  -33.199  1.00 127.97 ? 62  LYS G CB    1 
ATOM 8959  C CG    . LYS G 1 65  ? 31.583  -59.934  -33.399  1.00 123.64 ? 62  LYS G CG    1 
ATOM 8960  C CD    . LYS G 1 65  ? 30.581  -59.910  -32.243  1.00 127.74 ? 62  LYS G CD    1 
ATOM 8961  C CE    . LYS G 1 65  ? 29.402  -60.846  -32.461  1.00 130.00 ? 62  LYS G CE    1 
ATOM 8962  N NZ    . LYS G 1 65  ? 28.407  -60.750  -31.352  1.00 113.25 ? 62  LYS G NZ    1 
ATOM 8963  N N     . VAL G 1 66  ? 32.881  -59.478  -36.439  1.00 122.18 ? 63  VAL G N     1 
ATOM 8964  C CA    . VAL G 1 66  ? 32.282  -59.353  -37.765  1.00 111.00 ? 63  VAL G CA    1 
ATOM 8965  C C     . VAL G 1 66  ? 31.060  -60.260  -37.833  1.00 99.31  ? 63  VAL G C     1 
ATOM 8966  O O     . VAL G 1 66  ? 31.175  -61.478  -37.650  1.00 103.19 ? 63  VAL G O     1 
ATOM 8967  C CB    . VAL G 1 66  ? 33.278  -59.707  -38.883  1.00 104.00 ? 63  VAL G CB    1 
ATOM 8968  C CG1   . VAL G 1 66  ? 32.579  -59.707  -40.236  1.00 100.97 ? 63  VAL G CG1   1 
ATOM 8969  C CG2   . VAL G 1 66  ? 34.454  -58.741  -38.875  1.00 110.10 ? 63  VAL G CG2   1 
ATOM 8970  N N     . CYS G 1 67  ? 29.902  -59.669  -38.110  1.00 93.13  ? 64  CYS G N     1 
ATOM 8971  C CA    . CYS G 1 67  ? 28.642  -60.384  -38.244  1.00 88.14  ? 64  CYS G CA    1 
ATOM 8972  C C     . CYS G 1 67  ? 28.382  -60.776  -39.697  1.00 91.95  ? 64  CYS G C     1 
ATOM 8973  O O     . CYS G 1 67  ? 28.900  -60.165  -40.635  1.00 98.29  ? 64  CYS G O     1 
ATOM 8974  C CB    . CYS G 1 67  ? 27.487  -59.532  -37.718  1.00 87.17  ? 64  CYS G CB    1 
ATOM 8975  S SG    . CYS G 1 67  ? 27.607  -59.139  -35.961  1.00 87.76  ? 64  CYS G SG    1 
ATOM 8976  N N     . TYR G 1 68  ? 27.552  -61.803  -39.869  1.00 82.40  ? 65  TYR G N     1 
ATOM 8977  C CA    . TYR G 1 68  ? 27.157  -62.287  -41.187  1.00 74.62  ? 65  TYR G CA    1 
ATOM 8978  C C     . TYR G 1 68  ? 25.969  -63.224  -41.024  1.00 79.79  ? 65  TYR G C     1 
ATOM 8979  O O     . TYR G 1 68  ? 25.682  -63.703  -39.924  1.00 90.12  ? 65  TYR G O     1 
ATOM 8980  C CB    . TYR G 1 68  ? 28.319  -62.989  -41.908  1.00 82.13  ? 65  TYR G CB    1 
ATOM 8981  C CG    . TYR G 1 68  ? 28.759  -64.296  -41.282  1.00 81.64  ? 65  TYR G CG    1 
ATOM 8982  C CD1   . TYR G 1 68  ? 28.163  -65.500  -41.635  1.00 79.36  ? 65  TYR G CD1   1 
ATOM 8983  C CD2   . TYR G 1 68  ? 29.786  -64.323  -40.346  1.00 95.37  ? 65  TYR G CD2   1 
ATOM 8984  C CE1   . TYR G 1 68  ? 28.567  -66.691  -41.063  1.00 91.27  ? 65  TYR G CE1   1 
ATOM 8985  C CE2   . TYR G 1 68  ? 30.197  -65.509  -39.771  1.00 100.04 ? 65  TYR G CE2   1 
ATOM 8986  C CZ    . TYR G 1 68  ? 29.585  -66.691  -40.134  1.00 90.21  ? 65  TYR G CZ    1 
ATOM 8987  O OH    . TYR G 1 68  ? 29.987  -67.878  -39.569  1.00 91.53  ? 65  TYR G OH    1 
ATOM 8988  N N     . ILE G 1 69  ? 25.281  -63.476  -42.136  1.00 83.96  ? 66  ILE G N     1 
ATOM 8989  C CA    . ILE G 1 69  ? 24.189  -64.442  -42.195  1.00 80.59  ? 66  ILE G CA    1 
ATOM 8990  C C     . ILE G 1 69  ? 24.667  -65.638  -43.003  1.00 75.12  ? 66  ILE G C     1 
ATOM 8991  O O     . ILE G 1 69  ? 25.226  -65.475  -44.095  1.00 80.56  ? 66  ILE G O     1 
ATOM 8992  C CB    . ILE G 1 69  ? 22.915  -63.834  -42.805  1.00 65.43  ? 66  ILE G CB    1 
ATOM 8993  C CG1   . ILE G 1 69  ? 22.602  -62.490  -42.151  1.00 60.50  ? 66  ILE G CG1   1 
ATOM 8994  C CG2   . ILE G 1 69  ? 21.742  -64.785  -42.625  1.00 67.07  ? 66  ILE G CG2   1 
ATOM 8995  C CD1   . ILE G 1 69  ? 21.381  -61.801  -42.723  1.00 46.10  ? 66  ILE G CD1   1 
ATOM 8996  N N     . GLU G 1 70  ? 24.444  -66.835  -42.471  1.00 74.03  ? 67  GLU G N     1 
ATOM 8997  C CA    . GLU G 1 70  ? 24.907  -68.045  -43.134  1.00 77.98  ? 67  GLU G CA    1 
ATOM 8998  C C     . GLU G 1 70  ? 24.145  -68.277  -44.435  1.00 78.70  ? 67  GLU G C     1 
ATOM 8999  O O     . GLU G 1 70  ? 23.000  -67.850  -44.594  1.00 75.01  ? 67  GLU G O     1 
ATOM 9000  C CB    . GLU G 1 70  ? 24.769  -69.242  -42.196  1.00 85.08  ? 67  GLU G CB    1 
ATOM 9001  C CG    . GLU G 1 70  ? 25.660  -69.120  -40.968  1.00 91.96  ? 67  GLU G CG    1 
ATOM 9002  C CD    . GLU G 1 70  ? 25.730  -70.388  -40.141  1.00 102.51 ? 67  GLU G CD    1 
ATOM 9003  O OE1   . GLU G 1 70  ? 24.930  -71.313  -40.384  1.00 103.91 ? 67  GLU G OE1   1 
ATOM 9004  O OE2   . GLU G 1 70  ? 26.604  -70.463  -39.253  1.00 110.35 ? 67  GLU G OE2   1 
ATOM 9005  N N     . GLY G 1 71  ? 24.825  -68.928  -45.384  1.00 78.76  ? 68  GLY G N     1 
ATOM 9006  C CA    . GLY G 1 71  ? 24.272  -69.071  -46.725  1.00 65.57  ? 68  GLY G CA    1 
ATOM 9007  C C     . GLY G 1 71  ? 22.896  -69.696  -46.743  1.00 71.30  ? 68  GLY G C     1 
ATOM 9008  O O     . GLY G 1 71  ? 21.950  -69.132  -47.305  1.00 70.20  ? 68  GLY G O     1 
ATOM 9009  N N     . HIS G 1 72  ? 22.745  -70.871  -46.114  1.00 60.67  ? 69  HIS G N     1 
ATOM 9010  C CA    . HIS G 1 72  ? 21.464  -71.565  -46.141  1.00 68.64  ? 69  HIS G CA    1 
ATOM 9011  C C     . HIS G 1 72  ? 20.375  -70.725  -45.494  1.00 65.85  ? 69  HIS G C     1 
ATOM 9012  O O     . HIS G 1 72  ? 19.212  -70.804  -45.896  1.00 64.97  ? 69  HIS G O     1 
ATOM 9013  C CB    . HIS G 1 72  ? 21.576  -72.924  -45.448  1.00 77.93  ? 69  HIS G CB    1 
ATOM 9014  C CG    . HIS G 1 72  ? 21.713  -72.837  -43.962  1.00 85.64  ? 69  HIS G CG    1 
ATOM 9015  N ND1   . HIS G 1 72  ? 22.914  -72.577  -43.341  1.00 91.27  ? 69  HIS G ND1   1 
ATOM 9016  C CD2   . HIS G 1 72  ? 20.801  -72.985  -42.971  1.00 80.92  ? 69  HIS G CD2   1 
ATOM 9017  C CE1   . HIS G 1 72  ? 22.737  -72.562  -42.032  1.00 87.21  ? 69  HIS G CE1   1 
ATOM 9018  N NE2   . HIS G 1 72  ? 21.464  -72.807  -41.781  1.00 85.53  ? 69  HIS G NE2   1 
ATOM 9019  N N     . ARG G 1 73  ? 20.737  -69.911  -44.498  1.00 69.97  ? 70  ARG G N     1 
ATOM 9020  C CA    . ARG G 1 73  ? 19.759  -69.031  -43.869  1.00 74.88  ? 70  ARG G CA    1 
ATOM 9021  C C     . ARG G 1 73  ? 19.235  -67.999  -44.859  1.00 72.62  ? 70  ARG G C     1 
ATOM 9022  O O     . ARG G 1 73  ? 18.028  -67.738  -44.909  1.00 67.97  ? 70  ARG G O     1 
ATOM 9023  C CB    . ARG G 1 73  ? 20.381  -68.349  -42.650  1.00 82.17  ? 70  ARG G CB    1 
ATOM 9024  C CG    . ARG G 1 73  ? 20.913  -69.326  -41.608  1.00 89.82  ? 70  ARG G CG    1 
ATOM 9025  C CD    . ARG G 1 73  ? 20.106  -69.307  -40.317  1.00 92.36  ? 70  ARG G CD    1 
ATOM 9026  N NE    . ARG G 1 73  ? 20.495  -70.399  -39.425  1.00 90.67  ? 70  ARG G NE    1 
ATOM 9027  C CZ    . ARG G 1 73  ? 21.615  -70.429  -38.708  1.00 91.60  ? 70  ARG G CZ    1 
ATOM 9028  N NH1   . ARG G 1 73  ? 22.473  -69.419  -38.764  1.00 82.24  ? 70  ARG G NH1   1 
ATOM 9029  N NH2   . ARG G 1 73  ? 21.877  -71.474  -37.933  1.00 96.82  ? 70  ARG G NH2   1 
ATOM 9030  N N     . VAL G 1 74  ? 20.123  -67.415  -45.669  1.00 78.17  ? 71  VAL G N     1 
ATOM 9031  C CA    . VAL G 1 74  ? 19.691  -66.436  -46.663  1.00 65.90  ? 71  VAL G CA    1 
ATOM 9032  C C     . VAL G 1 74  ? 18.849  -67.110  -47.738  1.00 59.72  ? 71  VAL G C     1 
ATOM 9033  O O     . VAL G 1 74  ? 17.854  -66.547  -48.215  1.00 60.20  ? 71  VAL G O     1 
ATOM 9034  C CB    . VAL G 1 74  ? 20.908  -65.716  -47.272  1.00 55.28  ? 71  VAL G CB    1 
ATOM 9035  C CG1   . VAL G 1 74  ? 20.453  -64.623  -48.222  1.00 55.46  ? 71  VAL G CG1   1 
ATOM 9036  C CG2   . VAL G 1 74  ? 21.794  -65.141  -46.183  1.00 62.52  ? 71  VAL G CG2   1 
ATOM 9037  N N     . ILE G 1 75  ? 19.238  -68.322  -48.139  1.00 58.54  ? 72  ILE G N     1 
ATOM 9038  C CA    . ILE G 1 75  ? 18.462  -69.067  -49.129  1.00 53.87  ? 72  ILE G CA    1 
ATOM 9039  C C     . ILE G 1 75  ? 17.052  -69.326  -48.609  1.00 60.04  ? 72  ILE G C     1 
ATOM 9040  O O     . ILE G 1 75  ? 16.062  -69.149  -49.330  1.00 64.68  ? 72  ILE G O     1 
ATOM 9041  C CB    . ILE G 1 75  ? 19.183  -70.376  -49.500  1.00 63.87  ? 72  ILE G CB    1 
ATOM 9042  C CG1   . ILE G 1 75  ? 20.453  -70.076  -50.298  1.00 71.73  ? 72  ILE G CG1   1 
ATOM 9043  C CG2   . ILE G 1 75  ? 18.270  -71.274  -50.312  1.00 56.95  ? 72  ILE G CG2   1 
ATOM 9044  C CD1   . ILE G 1 75  ? 21.262  -71.311  -50.645  1.00 83.06  ? 72  ILE G CD1   1 
ATOM 9045  N N     . ASN G 1 76  ? 16.941  -69.763  -47.351  1.00 75.10  ? 73  ASN G N     1 
ATOM 9046  C CA    . ASN G 1 76  ? 15.630  -70.028  -46.767  1.00 67.76  ? 73  ASN G CA    1 
ATOM 9047  C C     . ASN G 1 76  ? 14.822  -68.743  -46.626  1.00 63.29  ? 73  ASN G C     1 
ATOM 9048  O O     . ASN G 1 76  ? 13.608  -68.734  -46.872  1.00 63.44  ? 73  ASN G O     1 
ATOM 9049  C CB    . ASN G 1 76  ? 15.796  -70.708  -45.407  1.00 74.50  ? 73  ASN G CB    1 
ATOM 9050  C CG    . ASN G 1 76  ? 16.192  -72.167  -45.526  1.00 81.00  ? 73  ASN G CG    1 
ATOM 9051  O OD1   . ASN G 1 76  ? 15.789  -72.858  -46.463  1.00 72.82  ? 73  ASN G OD1   1 
ATOM 9052  N ND2   . ASN G 1 76  ? 16.983  -72.646  -44.569  1.00 89.50  ? 73  ASN G ND2   1 
ATOM 9053  N N     . LEU G 1 77  ? 15.482  -67.649  -46.235  1.00 59.52  ? 74  LEU G N     1 
ATOM 9054  C CA    . LEU G 1 77  ? 14.819  -66.351  -46.166  1.00 62.21  ? 74  LEU G CA    1 
ATOM 9055  C C     . LEU G 1 77  ? 14.217  -65.975  -47.513  1.00 69.43  ? 74  LEU G C     1 
ATOM 9056  O O     . LEU G 1 77  ? 13.061  -65.545  -47.591  1.00 67.19  ? 74  LEU G O     1 
ATOM 9057  C CB    . LEU G 1 77  ? 15.810  -65.280  -45.707  1.00 66.49  ? 74  LEU G CB    1 
ATOM 9058  C CG    . LEU G 1 77  ? 16.120  -65.181  -44.212  1.00 67.29  ? 74  LEU G CG    1 
ATOM 9059  C CD1   . LEU G 1 77  ? 17.339  -64.301  -43.967  1.00 72.68  ? 74  LEU G CD1   1 
ATOM 9060  C CD2   . LEU G 1 77  ? 14.915  -64.657  -43.448  1.00 60.95  ? 74  LEU G CD2   1 
ATOM 9061  N N     . ALA G 1 78  ? 14.989  -66.141  -48.589  1.00 69.77  ? 75  ALA G N     1 
ATOM 9062  C CA    . ALA G 1 78  ? 14.495  -65.778  -49.914  1.00 69.51  ? 75  ALA G CA    1 
ATOM 9063  C C     . ALA G 1 78  ? 13.377  -66.710  -50.364  1.00 63.17  ? 75  ALA G C     1 
ATOM 9064  O O     . ALA G 1 78  ? 12.389  -66.260  -50.959  1.00 60.35  ? 75  ALA G O     1 
ATOM 9065  C CB    . ALA G 1 78  ? 15.643  -65.788  -50.924  1.00 66.60  ? 75  ALA G CB    1 
ATOM 9066  N N     . ASN G 1 79  ? 13.514  -68.010  -50.092  1.00 59.71  ? 76  ASN G N     1 
ATOM 9067  C CA    . ASN G 1 79  ? 12.468  -68.958  -50.457  1.00 62.26  ? 76  ASN G CA    1 
ATOM 9068  C C     . ASN G 1 79  ? 11.160  -68.652  -49.744  1.00 71.96  ? 76  ASN G C     1 
ATOM 9069  O O     . ASN G 1 79  ? 10.082  -68.847  -50.315  1.00 70.18  ? 76  ASN G O     1 
ATOM 9070  C CB    . ASN G 1 79  ? 12.917  -70.384  -50.143  1.00 64.82  ? 76  ASN G CB    1 
ATOM 9071  C CG    . ASN G 1 79  ? 13.849  -70.943  -51.196  1.00 68.34  ? 76  ASN G CG    1 
ATOM 9072  O OD1   . ASN G 1 79  ? 13.632  -70.755  -52.393  1.00 84.29  ? 76  ASN G OD1   1 
ATOM 9073  N ND2   . ASN G 1 79  ? 14.896  -71.630  -50.757  1.00 68.18  ? 76  ASN G ND2   1 
ATOM 9074  N N     . GLU G 1 80  ? 11.227  -68.178  -48.501  1.00 77.35  ? 77  GLU G N     1 
ATOM 9075  C CA    . GLU G 1 80  ? 9.994   -67.831  -47.806  1.00 76.69  ? 77  GLU G CA    1 
ATOM 9076  C C     . GLU G 1 80  ? 9.460   -66.473  -48.250  1.00 76.79  ? 77  GLU G C     1 
ATOM 9077  O O     . GLU G 1 80  ? 8.241   -66.280  -48.322  1.00 81.62  ? 77  GLU G O     1 
ATOM 9078  C CB    . GLU G 1 80  ? 10.215  -67.873  -46.294  1.00 79.85  ? 77  GLU G CB    1 
ATOM 9079  C CG    . GLU G 1 80  ? 10.471  -69.281  -45.762  1.00 78.97  ? 77  GLU G CG    1 
ATOM 9080  C CD    . GLU G 1 80  ? 9.346   -70.255  -46.088  1.00 83.24  ? 77  GLU G CD    1 
ATOM 9081  O OE1   . GLU G 1 80  ? 8.180   -69.816  -46.181  1.00 86.26  ? 77  GLU G OE1   1 
ATOM 9082  O OE2   . GLU G 1 80  ? 9.630   -71.459  -46.265  1.00 76.38  ? 77  GLU G OE2   1 
ATOM 9083  N N     . MET G 1 81  ? 10.346  -65.523  -48.556  1.00 79.47  ? 78  MET G N     1 
ATOM 9084  C CA    . MET G 1 81  ? 9.888   -64.193  -48.944  1.00 72.22  ? 78  MET G CA    1 
ATOM 9085  C C     . MET G 1 81  ? 9.229   -64.208  -50.317  1.00 81.22  ? 78  MET G C     1 
ATOM 9086  O O     . MET G 1 81  ? 8.184   -63.577  -50.515  1.00 86.46  ? 78  MET G O     1 
ATOM 9087  C CB    . MET G 1 81  ? 11.055  -63.205  -48.915  1.00 63.00  ? 78  MET G CB    1 
ATOM 9088  C CG    . MET G 1 81  ? 11.423  -62.742  -47.515  1.00 91.45  ? 78  MET G CG    1 
ATOM 9089  S SD    . MET G 1 81  ? 10.216  -61.637  -46.754  1.00 91.37  ? 78  MET G SD    1 
ATOM 9090  C CE    . MET G 1 81  ? 9.617   -60.734  -48.178  1.00 82.10  ? 78  MET G CE    1 
ATOM 9091  N N     . PHE G 1 82  ? 9.815   -64.923  -51.277  1.00 75.06  ? 79  PHE G N     1 
ATOM 9092  C CA    . PHE G 1 82  ? 9.333   -64.883  -52.648  1.00 74.18  ? 79  PHE G CA    1 
ATOM 9093  C C     . PHE G 1 82  ? 8.758   -66.200  -53.144  1.00 68.24  ? 79  PHE G C     1 
ATOM 9094  O O     . PHE G 1 82  ? 8.140   -66.215  -54.214  1.00 77.14  ? 79  PHE G O     1 
ATOM 9095  C CB    . PHE G 1 82  ? 10.459  -64.440  -53.597  1.00 63.78  ? 79  PHE G CB    1 
ATOM 9096  C CG    . PHE G 1 82  ? 11.174  -63.194  -53.151  1.00 51.65  ? 79  PHE G CG    1 
ATOM 9097  C CD1   . PHE G 1 82  ? 10.579  -61.949  -53.282  1.00 49.11  ? 79  PHE G CD1   1 
ATOM 9098  C CD2   . PHE G 1 82  ? 12.444  -63.269  -52.603  1.00 50.94  ? 79  PHE G CD2   1 
ATOM 9099  C CE1   . PHE G 1 82  ? 11.237  -60.805  -52.874  1.00 45.61  ? 79  PHE G CE1   1 
ATOM 9100  C CE2   . PHE G 1 82  ? 13.105  -62.129  -52.194  1.00 46.66  ? 79  PHE G CE2   1 
ATOM 9101  C CZ    . PHE G 1 82  ? 12.501  -60.895  -52.328  1.00 43.48  ? 79  PHE G CZ    1 
ATOM 9102  N N     . GLY G 1 83  ? 8.923   -67.288  -52.410  1.00 67.24  ? 80  GLY G N     1 
ATOM 9103  C CA    . GLY G 1 83  ? 8.521   -68.569  -52.969  1.00 70.50  ? 80  GLY G CA    1 
ATOM 9104  C C     . GLY G 1 83  ? 9.666   -69.261  -53.676  1.00 71.94  ? 80  GLY G C     1 
ATOM 9105  O O     . GLY G 1 83  ? 10.605  -68.637  -54.165  1.00 71.87  ? 80  GLY G O     1 
ATOM 9106  N N     . TYR G 1 84  ? 9.600   -70.595  -53.702  1.00 69.54  ? 81  TYR G N     1 
ATOM 9107  C CA    . TYR G 1 84  ? 10.635  -71.364  -54.388  1.00 68.89  ? 81  TYR G CA    1 
ATOM 9108  C C     . TYR G 1 84  ? 10.737  -70.985  -55.859  1.00 78.02  ? 81  TYR G C     1 
ATOM 9109  O O     . TYR G 1 84  ? 11.797  -71.152  -56.474  1.00 80.42  ? 81  TYR G O     1 
ATOM 9110  C CB    . TYR G 1 84  ? 10.359  -72.860  -54.269  1.00 64.77  ? 81  TYR G CB    1 
ATOM 9111  C CG    . TYR G 1 84  ? 9.205   -73.327  -55.126  1.00 71.50  ? 81  TYR G CG    1 
ATOM 9112  C CD1   . TYR G 1 84  ? 9.433   -73.996  -56.323  1.00 76.43  ? 81  TYR G CD1   1 
ATOM 9113  C CD2   . TYR G 1 84  ? 7.891   -73.080  -54.755  1.00 72.80  ? 81  TYR G CD2   1 
ATOM 9114  C CE1   . TYR G 1 84  ? 8.387   -74.419  -57.120  1.00 78.58  ? 81  TYR G CE1   1 
ATOM 9115  C CE2   . TYR G 1 84  ? 6.836   -73.504  -55.548  1.00 74.41  ? 81  TYR G CE2   1 
ATOM 9116  C CZ    . TYR G 1 84  ? 7.090   -74.171  -56.728  1.00 74.03  ? 81  TYR G CZ    1 
ATOM 9117  O OH    . TYR G 1 84  ? 6.048   -74.595  -57.522  1.00 59.24  ? 81  TYR G OH    1 
ATOM 9118  N N     . ASN G 1 85  ? 9.646   -70.483  -56.440  1.00 72.52  ? 82  ASN G N     1 
ATOM 9119  C CA    . ASN G 1 85  ? 9.588   -70.127  -57.853  1.00 68.76  ? 82  ASN G CA    1 
ATOM 9120  C C     . ASN G 1 85  ? 9.342   -68.637  -58.061  1.00 68.92  ? 82  ASN G C     1 
ATOM 9121  O O     . ASN G 1 85  ? 8.873   -68.230  -59.130  1.00 75.23  ? 82  ASN G O     1 
ATOM 9122  C CB    . ASN G 1 85  ? 8.506   -70.946  -58.558  1.00 69.70  ? 82  ASN G CB    1 
ATOM 9123  C CG    . ASN G 1 85  ? 7.102   -70.499  -58.186  1.00 71.44  ? 82  ASN G CG    1 
ATOM 9124  O OD1   . ASN G 1 85  ? 6.861   -70.050  -57.066  1.00 75.20  ? 82  ASN G OD1   1 
ATOM 9125  N ND2   . ASN G 1 85  ? 6.168   -70.624  -59.124  1.00 74.80  ? 82  ASN G ND2   1 
ATOM 9126  N N     . GLY G 1 86  ? 9.646   -67.815  -57.064  1.00 62.04  ? 83  GLY G N     1 
ATOM 9127  C CA    . GLY G 1 86  ? 9.386   -66.393  -57.164  1.00 57.22  ? 83  GLY G CA    1 
ATOM 9128  C C     . GLY G 1 86  ? 10.648  -65.559  -57.228  1.00 54.81  ? 83  GLY G C     1 
ATOM 9129  O O     . GLY G 1 86  ? 10.588  -64.355  -57.491  1.00 60.99  ? 83  GLY G O     1 
ATOM 9130  N N     . TRP G 1 87  ? 11.796  -66.187  -56.981  1.00 58.32  ? 84  TRP G N     1 
ATOM 9131  C CA    . TRP G 1 87  ? 13.091  -65.539  -57.120  1.00 55.33  ? 84  TRP G CA    1 
ATOM 9132  C C     . TRP G 1 87  ? 14.041  -66.462  -57.869  1.00 57.69  ? 84  TRP G C     1 
ATOM 9133  O O     . TRP G 1 87  ? 13.877  -67.685  -57.879  1.00 54.53  ? 84  TRP G O     1 
ATOM 9134  C CB    . TRP G 1 87  ? 13.705  -65.170  -55.761  1.00 52.65  ? 84  TRP G CB    1 
ATOM 9135  C CG    . TRP G 1 87  ? 14.229  -66.351  -54.996  1.00 53.29  ? 84  TRP G CG    1 
ATOM 9136  C CD1   . TRP G 1 87  ? 13.492  -67.316  -54.374  1.00 63.90  ? 84  TRP G CD1   1 
ATOM 9137  C CD2   . TRP G 1 87  ? 15.605  -66.705  -54.793  1.00 55.84  ? 84  TRP G CD2   1 
ATOM 9138  N NE1   . TRP G 1 87  ? 14.321  -68.241  -53.786  1.00 67.67  ? 84  TRP G NE1   1 
ATOM 9139  C CE2   . TRP G 1 87  ? 15.623  -67.891  -54.029  1.00 64.43  ? 84  TRP G CE2   1 
ATOM 9140  C CE3   . TRP G 1 87  ? 16.822  -66.133  -55.178  1.00 57.28  ? 84  TRP G CE3   1 
ATOM 9141  C CZ2   . TRP G 1 87  ? 16.808  -68.516  -53.642  1.00 63.76  ? 84  TRP G CZ2   1 
ATOM 9142  C CZ3   . TRP G 1 87  ? 17.999  -66.756  -54.793  1.00 62.59  ? 84  TRP G CZ3   1 
ATOM 9143  C CH2   . TRP G 1 87  ? 17.982  -67.935  -54.033  1.00 63.83  ? 84  TRP G CH2   1 
ATOM 9144  N N     . ALA G 1 88  ? 15.041  -65.855  -58.502  1.00 55.78  ? 85  ALA G N     1 
ATOM 9145  C CA    . ALA G 1 88  ? 16.026  -66.596  -59.273  1.00 51.21  ? 85  ALA G CA    1 
ATOM 9146  C C     . ALA G 1 88  ? 17.352  -65.856  -59.207  1.00 51.28  ? 85  ALA G C     1 
ATOM 9147  O O     . ALA G 1 88  ? 17.394  -64.645  -58.980  1.00 47.19  ? 85  ALA G O     1 
ATOM 9148  C CB    . ALA G 1 88  ? 15.580  -66.777  -60.727  1.00 48.70  ? 85  ALA G CB    1 
ATOM 9149  N N     . HIS G 1 89  ? 18.441  -66.594  -59.417  1.00 44.90  ? 86  HIS G N     1 
ATOM 9150  C CA    . HIS G 1 89  ? 19.761  -65.988  -59.508  1.00 49.83  ? 86  HIS G CA    1 
ATOM 9151  C C     . HIS G 1 89  ? 20.587  -66.722  -60.552  1.00 52.06  ? 86  HIS G C     1 
ATOM 9152  O O     . HIS G 1 89  ? 20.371  -67.906  -60.822  1.00 54.37  ? 86  HIS G O     1 
ATOM 9153  C CB    . HIS G 1 89  ? 20.490  -65.985  -58.150  1.00 46.99  ? 86  HIS G CB    1 
ATOM 9154  C CG    . HIS G 1 89  ? 21.087  -67.305  -57.771  1.00 47.97  ? 86  HIS G CG    1 
ATOM 9155  N ND1   . HIS G 1 89  ? 20.335  -68.453  -57.640  1.00 55.54  ? 86  HIS G ND1   1 
ATOM 9156  C CD2   . HIS G 1 89  ? 22.359  -67.654  -57.465  1.00 44.00  ? 86  HIS G CD2   1 
ATOM 9157  C CE1   . HIS G 1 89  ? 21.121  -69.456  -57.291  1.00 55.66  ? 86  HIS G CE1   1 
ATOM 9158  N NE2   . HIS G 1 89  ? 22.354  -68.998  -57.177  1.00 51.18  ? 86  HIS G NE2   1 
ATOM 9159  N N     . SER G 1 90  ? 21.532  -65.994  -61.142  1.00 47.89  ? 87  SER G N     1 
ATOM 9160  C CA    . SER G 1 90  ? 22.393  -66.522  -62.187  1.00 47.11  ? 87  SER G CA    1 
ATOM 9161  C C     . SER G 1 90  ? 23.784  -65.930  -62.028  1.00 45.77  ? 87  SER G C     1 
ATOM 9162  O O     . SER G 1 90  ? 23.955  -64.856  -61.446  1.00 47.55  ? 87  SER G O     1 
ATOM 9163  C CB    . SER G 1 90  ? 21.843  -66.217  -63.590  1.00 52.92  ? 87  SER G CB    1 
ATOM 9164  O OG    . SER G 1 90  ? 21.618  -64.828  -63.776  1.00 46.27  ? 87  SER G OG    1 
ATOM 9165  N N     . ILE G 1 91  ? 24.776  -66.643  -62.546  1.00 47.04  ? 88  ILE G N     1 
ATOM 9166  C CA    . ILE G 1 91  ? 26.161  -66.191  -62.518  1.00 55.85  ? 88  ILE G CA    1 
ATOM 9167  C C     . ILE G 1 91  ? 26.420  -65.493  -63.848  1.00 49.22  ? 88  ILE G C     1 
ATOM 9168  O O     . ILE G 1 91  ? 26.550  -66.139  -64.892  1.00 46.92  ? 88  ILE G O     1 
ATOM 9169  C CB    . ILE G 1 91  ? 27.128  -67.352  -62.278  1.00 54.93  ? 88  ILE G CB    1 
ATOM 9170  C CG1   . ILE G 1 91  ? 26.764  -68.074  -60.979  1.00 45.38  ? 88  ILE G CG1   1 
ATOM 9171  C CG2   . ILE G 1 91  ? 28.567  -66.852  -62.226  1.00 46.84  ? 88  ILE G CG2   1 
ATOM 9172  C CD1   . ILE G 1 91  ? 27.495  -69.371  -60.780  1.00 53.88  ? 88  ILE G CD1   1 
ATOM 9173  N N     . THR G 1 92  ? 26.467  -64.159  -63.815  1.00 40.85  ? 89  THR G N     1 
ATOM 9174  C CA    . THR G 1 92  ? 26.738  -63.399  -65.030  1.00 43.17  ? 89  THR G CA    1 
ATOM 9175  C C     . THR G 1 92  ? 28.149  -63.658  -65.533  1.00 39.87  ? 89  THR G C     1 
ATOM 9176  O O     . THR G 1 92  ? 28.364  -63.869  -66.733  1.00 48.91  ? 89  THR G O     1 
ATOM 9177  C CB    . THR G 1 92  ? 26.537  -61.903  -64.782  1.00 41.64  ? 89  THR G CB    1 
ATOM 9178  O OG1   . THR G 1 92  ? 25.193  -61.661  -64.349  1.00 50.23  ? 89  THR G OG1   1 
ATOM 9179  C CG2   . THR G 1 92  ? 26.813  -61.105  -66.056  1.00 33.22  ? 89  THR G CG2   1 
ATOM 9180  N N     . GLN G 1 93  ? 29.124  -63.638  -64.632  1.00 44.13  ? 90  GLN G N     1 
ATOM 9181  C CA    . GLN G 1 93  ? 30.508  -63.879  -65.000  1.00 46.32  ? 90  GLN G CA    1 
ATOM 9182  C C     . GLN G 1 93  ? 31.275  -64.217  -63.731  1.00 48.40  ? 90  GLN G C     1 
ATOM 9183  O O     . GLN G 1 93  ? 31.027  -63.626  -62.677  1.00 48.87  ? 90  GLN G O     1 
ATOM 9184  C CB    . GLN G 1 93  ? 31.110  -62.649  -65.692  1.00 47.62  ? 90  GLN G CB    1 
ATOM 9185  C CG    . GLN G 1 93  ? 32.457  -62.872  -66.354  1.00 46.85  ? 90  GLN G CG    1 
ATOM 9186  C CD    . GLN G 1 93  ? 33.052  -61.575  -66.875  1.00 59.51  ? 90  GLN G CD    1 
ATOM 9187  O OE1   . GLN G 1 93  ? 33.827  -60.920  -66.178  1.00 65.78  ? 90  GLN G OE1   1 
ATOM 9188  N NE2   . GLN G 1 93  ? 32.678  -61.187  -68.094  1.00 79.33  ? 90  GLN G NE2   1 
ATOM 9189  N N     . GLN G 1 94  ? 32.177  -65.187  -63.831  1.00 45.58  ? 91  GLN G N     1 
ATOM 9190  C CA    . GLN G 1 94  ? 33.149  -65.473  -62.787  1.00 37.65  ? 91  GLN G CA    1 
ATOM 9191  C C     . GLN G 1 94  ? 34.542  -65.363  -63.381  1.00 41.48  ? 91  GLN G C     1 
ATOM 9192  O O     . GLN G 1 94  ? 34.827  -65.966  -64.421  1.00 40.51  ? 91  GLN G O     1 
ATOM 9193  C CB    . GLN G 1 94  ? 32.948  -66.863  -62.176  1.00 44.54  ? 91  GLN G CB    1 
ATOM 9194  C CG    . GLN G 1 94  ? 34.185  -67.383  -61.461  1.00 57.09  ? 91  GLN G CG    1 
ATOM 9195  C CD    . GLN G 1 94  ? 33.878  -68.449  -60.429  1.00 47.79  ? 91  GLN G CD    1 
ATOM 9196  O OE1   . GLN G 1 94  ? 34.288  -69.600  -60.574  1.00 53.96  ? 91  GLN G OE1   1 
ATOM 9197  N NE2   . GLN G 1 94  ? 33.177  -68.067  -59.367  1.00 42.63  ? 91  GLN G NE2   1 
ATOM 9198  N N     . ASN G 1 95  ? 35.411  -64.617  -62.707  1.00 46.86  ? 92  ASN G N     1 
ATOM 9199  C CA    . ASN G 1 95  ? 36.750  -64.335  -63.201  1.00 55.66  ? 92  ASN G CA    1 
ATOM 9200  C C     . ASN G 1 95  ? 37.742  -64.637  -62.090  1.00 46.52  ? 92  ASN G C     1 
ATOM 9201  O O     . ASN G 1 95  ? 37.643  -64.073  -60.997  1.00 54.33  ? 92  ASN G O     1 
ATOM 9202  C CB    . ASN G 1 95  ? 36.866  -62.874  -63.652  1.00 41.67  ? 92  ASN G CB    1 
ATOM 9203  C CG    . ASN G 1 95  ? 38.239  -62.532  -64.203  1.00 61.60  ? 92  ASN G CG    1 
ATOM 9204  O OD1   . ASN G 1 95  ? 38.956  -63.397  -64.706  1.00 68.13  ? 92  ASN G OD1   1 
ATOM 9205  N ND2   . ASN G 1 95  ? 38.611  -61.258  -64.109  1.00 82.91  ? 92  ASN G ND2   1 
ATOM 9206  N N     . VAL G 1 96  ? 38.678  -65.541  -62.362  1.00 41.05  ? 93  VAL G N     1 
ATOM 9207  C CA    . VAL G 1 96  ? 39.758  -65.826  -61.424  1.00 38.46  ? 93  VAL G CA    1 
ATOM 9208  C C     . VAL G 1 96  ? 40.779  -64.703  -61.571  1.00 46.16  ? 93  VAL G C     1 
ATOM 9209  O O     . VAL G 1 96  ? 41.395  -64.548  -62.625  1.00 56.74  ? 93  VAL G O     1 
ATOM 9210  C CB    . VAL G 1 96  ? 40.393  -67.195  -61.683  1.00 40.15  ? 93  VAL G CB    1 
ATOM 9211  C CG1   . VAL G 1 96  ? 41.581  -67.409  -60.761  1.00 50.95  ? 93  VAL G CG1   1 
ATOM 9212  C CG2   . VAL G 1 96  ? 39.367  -68.301  -61.498  1.00 47.39  ? 93  VAL G CG2   1 
ATOM 9213  N N     . ASP G 1 97  ? 40.947  -63.909  -60.513  1.00 40.02  ? 94  ASP G N     1 
ATOM 9214  C CA    . ASP G 1 97  ? 41.841  -62.760  -60.609  1.00 43.16  ? 94  ASP G CA    1 
ATOM 9215  C C     . ASP G 1 97  ? 43.297  -63.200  -60.672  1.00 40.99  ? 94  ASP G C     1 
ATOM 9216  O O     . ASP G 1 97  ? 44.070  -62.680  -61.485  1.00 46.11  ? 94  ASP G O     1 
ATOM 9217  C CB    . ASP G 1 97  ? 41.611  -61.816  -59.427  1.00 50.71  ? 94  ASP G CB    1 
ATOM 9218  C CG    . ASP G 1 97  ? 40.372  -60.952  -59.598  1.00 49.49  ? 94  ASP G CG    1 
ATOM 9219  O OD1   . ASP G 1 97  ? 39.900  -60.800  -60.746  1.00 60.49  ? 94  ASP G OD1   1 
ATOM 9220  O OD2   . ASP G 1 97  ? 39.872  -60.417  -58.585  1.00 51.81  ? 94  ASP G OD2   1 
ATOM 9221  N N     . PHE G 1 98  ? 43.684  -64.167  -59.842  1.00 47.17  ? 95  PHE G N     1 
ATOM 9222  C CA    . PHE G 1 98  ? 45.063  -64.636  -59.798  1.00 44.32  ? 95  PHE G CA    1 
ATOM 9223  C C     . PHE G 1 98  ? 45.107  -65.986  -59.099  1.00 47.49  ? 95  PHE G C     1 
ATOM 9224  O O     . PHE G 1 98  ? 44.237  -66.318  -58.294  1.00 47.76  ? 95  PHE G O     1 
ATOM 9225  C CB    . PHE G 1 98  ? 45.979  -63.640  -59.075  1.00 44.32  ? 95  PHE G CB    1 
ATOM 9226  C CG    . PHE G 1 98  ? 45.607  -63.408  -57.636  1.00 50.67  ? 95  PHE G CG    1 
ATOM 9227  C CD1   . PHE G 1 98  ? 46.167  -64.169  -56.621  1.00 55.44  ? 95  PHE G CD1   1 
ATOM 9228  C CD2   . PHE G 1 98  ? 44.695  -62.425  -57.299  1.00 46.33  ? 95  PHE G CD2   1 
ATOM 9229  C CE1   . PHE G 1 98  ? 45.818  -63.951  -55.301  1.00 55.17  ? 95  PHE G CE1   1 
ATOM 9230  C CE2   . PHE G 1 98  ? 44.346  -62.204  -55.983  1.00 51.52  ? 95  PHE G CE2   1 
ATOM 9231  C CZ    . PHE G 1 98  ? 44.908  -62.965  -54.985  1.00 61.69  ? 95  PHE G CZ    1 
ATOM 9232  N N     . VAL G 1 99  ? 46.138  -66.759  -59.428  1.00 49.32  ? 96  VAL G N     1 
ATOM 9233  C CA    . VAL G 1 99  ? 46.504  -67.969  -58.698  1.00 45.70  ? 96  VAL G CA    1 
ATOM 9234  C C     . VAL G 1 99  ? 48.020  -67.930  -58.569  1.00 51.70  ? 96  VAL G C     1 
ATOM 9235  O O     . VAL G 1 99  ? 48.736  -68.179  -59.542  1.00 59.47  ? 96  VAL G O     1 
ATOM 9236  C CB    . VAL G 1 99  ? 46.057  -69.259  -59.405  1.00 41.25  ? 96  VAL G CB    1 
ATOM 9237  C CG1   . VAL G 1 99  ? 46.577  -70.478  -58.663  1.00 39.43  ? 96  VAL G CG1   1 
ATOM 9238  C CG2   . VAL G 1 99  ? 44.538  -69.315  -59.517  1.00 47.20  ? 96  VAL G CG2   1 
ATOM 9239  N N     . ASP G 1 100 ? 48.512  -67.632  -57.367  1.00 50.28  ? 97  ASP G N     1 
ATOM 9240  C CA    . ASP G 1 100 ? 49.935  -67.476  -57.124  1.00 50.26  ? 97  ASP G CA    1 
ATOM 9241  C C     . ASP G 1 100 ? 50.453  -68.584  -56.218  1.00 49.20  ? 97  ASP G C     1 
ATOM 9242  O O     . ASP G 1 100 ? 49.730  -69.108  -55.366  1.00 44.66  ? 97  ASP G O     1 
ATOM 9243  C CB    . ASP G 1 100 ? 50.244  -66.112  -56.500  1.00 54.08  ? 97  ASP G CB    1 
ATOM 9244  C CG    . ASP G 1 100 ? 49.987  -64.962  -57.453  1.00 64.71  ? 97  ASP G CG    1 
ATOM 9245  O OD1   . ASP G 1 100 ? 50.358  -65.079  -58.640  1.00 86.37  ? 97  ASP G OD1   1 
ATOM 9246  O OD2   . ASP G 1 100 ? 49.412  -63.945  -57.016  1.00 65.14  ? 97  ASP G OD2   1 
ATOM 9247  N N     . LEU G 1 101 ? 51.719  -68.937  -56.425  1.00 58.08  ? 98  LEU G N     1 
ATOM 9248  C CA    . LEU G 1 101 ? 52.399  -69.985  -55.672  1.00 64.98  ? 98  LEU G CA    1 
ATOM 9249  C C     . LEU G 1 101 ? 53.557  -69.333  -54.931  1.00 66.56  ? 98  LEU G C     1 
ATOM 9250  O O     . LEU G 1 101 ? 54.507  -68.849  -55.557  1.00 71.61  ? 98  LEU G O     1 
ATOM 9251  C CB    . LEU G 1 101 ? 52.891  -71.096  -56.601  1.00 60.13  ? 98  LEU G CB    1 
ATOM 9252  C CG    . LEU G 1 101 ? 53.685  -72.265  -56.008  1.00 60.01  ? 98  LEU G CG    1 
ATOM 9253  C CD1   . LEU G 1 101 ? 52.905  -72.959  -54.903  1.00 64.48  ? 98  LEU G CD1   1 
ATOM 9254  C CD2   . LEU G 1 101 ? 54.066  -73.256  -57.099  1.00 38.42  ? 98  LEU G CD2   1 
ATOM 9255  N N     . ASN G 1 102 ? 53.470  -69.299  -53.603  1.00 67.54  ? 99  ASN G N     1 
ATOM 9256  C CA    . ASN G 1 102 ? 54.500  -68.708  -52.753  1.00 68.82  ? 99  ASN G CA    1 
ATOM 9257  C C     . ASN G 1 102 ? 55.022  -69.781  -51.807  1.00 71.09  ? 99  ASN G C     1 
ATOM 9258  O O     . ASN G 1 102 ? 54.323  -70.178  -50.869  1.00 72.71  ? 99  ASN G O     1 
ATOM 9259  C CB    . ASN G 1 102 ? 53.950  -67.510  -51.978  1.00 80.80  ? 99  ASN G CB    1 
ATOM 9260  C CG    . ASN G 1 102 ? 55.033  -66.528  -51.567  1.00 97.08  ? 99  ASN G CG    1 
ATOM 9261  O OD1   . ASN G 1 102 ? 56.059  -66.917  -51.009  1.00 87.64  ? 99  ASN G OD1   1 
ATOM 9262  N ND2   . ASN G 1 102 ? 54.806  -65.246  -51.839  1.00 113.39 ? 99  ASN G ND2   1 
ATOM 9263  N N     . ASN G 1 103 ? 56.261  -70.209  -52.034  1.00 79.20  ? 100 ASN G N     1 
ATOM 9264  C CA    . ASN G 1 103 ? 56.928  -71.262  -51.267  1.00 85.46  ? 100 ASN G CA    1 
ATOM 9265  C C     . ASN G 1 103 ? 55.981  -72.416  -50.935  1.00 82.46  ? 100 ASN G C     1 
ATOM 9266  O O     . ASN G 1 103 ? 55.781  -72.783  -49.779  1.00 88.60  ? 100 ASN G O     1 
ATOM 9267  C CB    . ASN G 1 103 ? 57.542  -70.696  -49.985  1.00 82.03  ? 100 ASN G CB    1 
ATOM 9268  C CG    . ASN G 1 103 ? 58.884  -70.030  -50.222  1.00 97.63  ? 100 ASN G CG    1 
ATOM 9269  O OD1   . ASN G 1 103 ? 59.864  -70.687  -50.568  1.00 115.17 ? 100 ASN G OD1   1 
ATOM 9270  N ND2   . ASN G 1 103 ? 58.935  -68.718  -50.026  1.00 85.00  ? 100 ASN G ND2   1 
ATOM 9271  N N     . GLY G 1 104 ? 55.382  -72.982  -51.983  1.00 82.11  ? 101 GLY G N     1 
ATOM 9272  C CA    . GLY G 1 104 ? 54.619  -74.207  -51.851  1.00 62.26  ? 101 GLY G CA    1 
ATOM 9273  C C     . GLY G 1 104 ? 53.187  -74.029  -51.404  1.00 61.53  ? 101 GLY G C     1 
ATOM 9274  O O     . GLY G 1 104 ? 52.461  -75.026  -51.296  1.00 56.21  ? 101 GLY G O     1 
ATOM 9275  N N     . LYS G 1 105 ? 52.758  -72.798  -51.144  1.00 62.69  ? 102 LYS G N     1 
ATOM 9276  C CA    . LYS G 1 105 ? 51.410  -72.492  -50.692  1.00 63.89  ? 102 LYS G CA    1 
ATOM 9277  C C     . LYS G 1 105 ? 50.716  -71.665  -51.767  1.00 63.51  ? 102 LYS G C     1 
ATOM 9278  O O     . LYS G 1 105 ? 51.349  -70.822  -52.410  1.00 62.69  ? 102 LYS G O     1 
ATOM 9279  C CB    . LYS G 1 105 ? 51.466  -71.707  -49.370  1.00 71.93  ? 102 LYS G CB    1 
ATOM 9280  C CG    . LYS G 1 105 ? 52.241  -72.424  -48.261  1.00 75.19  ? 102 LYS G CG    1 
ATOM 9281  C CD    . LYS G 1 105 ? 52.306  -71.623  -46.964  1.00 87.86  ? 102 LYS G CD    1 
ATOM 9282  C CE    . LYS G 1 105 ? 51.358  -72.174  -45.906  1.00 102.92 ? 102 LYS G CE    1 
ATOM 9283  N NZ    . LYS G 1 105 ? 51.442  -71.415  -44.622  1.00 82.37  ? 102 LYS G NZ    1 
ATOM 9284  N N     . PHE G 1 106 ? 49.418  -71.891  -51.959  1.00 65.09  ? 103 PHE G N     1 
ATOM 9285  C CA    . PHE G 1 106 ? 48.662  -71.222  -53.012  1.00 58.34  ? 103 PHE G CA    1 
ATOM 9286  C C     . PHE G 1 106 ? 47.769  -70.130  -52.440  1.00 62.57  ? 103 PHE G C     1 
ATOM 9287  O O     . PHE G 1 106 ? 47.118  -70.316  -51.408  1.00 57.54  ? 103 PHE G O     1 
ATOM 9288  C CB    . PHE G 1 106 ? 47.803  -72.213  -53.798  1.00 57.10  ? 103 PHE G CB    1 
ATOM 9289  C CG    . PHE G 1 106 ? 48.573  -73.033  -54.786  1.00 63.86  ? 103 PHE G CG    1 
ATOM 9290  C CD1   . PHE G 1 106 ? 49.063  -72.458  -55.948  1.00 60.95  ? 103 PHE G CD1   1 
ATOM 9291  C CD2   . PHE G 1 106 ? 48.821  -74.374  -54.550  1.00 62.11  ? 103 PHE G CD2   1 
ATOM 9292  C CE1   . PHE G 1 106 ? 49.777  -73.208  -56.859  1.00 65.14  ? 103 PHE G CE1   1 
ATOM 9293  C CE2   . PHE G 1 106 ? 49.538  -75.131  -55.457  1.00 63.57  ? 103 PHE G CE2   1 
ATOM 9294  C CZ    . PHE G 1 106 ? 50.016  -74.547  -56.614  1.00 62.06  ? 103 PHE G CZ    1 
ATOM 9295  N N     . TYR G 1 107 ? 47.744  -68.988  -53.125  1.00 58.45  ? 104 TYR G N     1 
ATOM 9296  C CA    . TYR G 1 107 ? 46.949  -67.834  -52.721  1.00 54.93  ? 104 TYR G CA    1 
ATOM 9297  C C     . TYR G 1 107 ? 46.116  -67.424  -53.928  1.00 51.97  ? 104 TYR G C     1 
ATOM 9298  O O     . TYR G 1 107 ? 46.669  -67.049  -54.968  1.00 52.53  ? 104 TYR G O     1 
ATOM 9299  C CB    . TYR G 1 107 ? 47.832  -66.675  -52.217  1.00 53.04  ? 104 TYR G CB    1 
ATOM 9300  C CG    . TYR G 1 107 ? 48.784  -67.022  -51.068  1.00 62.33  ? 104 TYR G CG    1 
ATOM 9301  C CD1   . TYR G 1 107 ? 49.760  -68.004  -51.208  1.00 61.33  ? 104 TYR G CD1   1 
ATOM 9302  C CD2   . TYR G 1 107 ? 48.696  -66.373  -49.841  1.00 60.22  ? 104 TYR G CD2   1 
ATOM 9303  C CE1   . TYR G 1 107 ? 50.617  -68.329  -50.173  1.00 59.95  ? 104 TYR G CE1   1 
ATOM 9304  C CE2   . TYR G 1 107 ? 49.553  -66.695  -48.791  1.00 69.86  ? 104 TYR G CE2   1 
ATOM 9305  C CZ    . TYR G 1 107 ? 50.513  -67.674  -48.965  1.00 71.38  ? 104 TYR G CZ    1 
ATOM 9306  O OH    . TYR G 1 107 ? 51.373  -68.002  -47.934  1.00 72.96  ? 104 TYR G OH    1 
ATOM 9307  N N     . VAL G 1 108 ? 44.793  -67.517  -53.796  1.00 46.30  ? 105 VAL G N     1 
ATOM 9308  C CA    . VAL G 1 108 ? 43.872  -67.429  -54.923  1.00 49.53  ? 105 VAL G CA    1 
ATOM 9309  C C     . VAL G 1 108 ? 42.795  -66.402  -54.610  1.00 50.51  ? 105 VAL G C     1 
ATOM 9310  O O     . VAL G 1 108 ? 42.194  -66.436  -53.530  1.00 50.07  ? 105 VAL G O     1 
ATOM 9311  C CB    . VAL G 1 108 ? 43.233  -68.796  -55.232  1.00 55.39  ? 105 VAL G CB    1 
ATOM 9312  C CG1   . VAL G 1 108 ? 42.194  -68.666  -56.337  1.00 51.22  ? 105 VAL G CG1   1 
ATOM 9313  C CG2   . VAL G 1 108 ? 44.301  -69.813  -55.605  1.00 54.19  ? 105 VAL G CG2   1 
ATOM 9314  N N     . GLY G 1 109 ? 42.543  -65.504  -55.558  1.00 57.40  ? 106 GLY G N     1 
ATOM 9315  C CA    . GLY G 1 109 ? 41.415  -64.600  -55.469  1.00 52.33  ? 106 GLY G CA    1 
ATOM 9316  C C     . GLY G 1 109 ? 40.488  -64.775  -56.652  1.00 48.29  ? 106 GLY G C     1 
ATOM 9317  O O     . GLY G 1 109 ? 40.940  -64.803  -57.800  1.00 56.17  ? 106 GLY G O     1 
ATOM 9318  N N     . VAL G 1 110 ? 39.189  -64.904  -56.388  1.00 46.55  ? 107 VAL G N     1 
ATOM 9319  C CA    . VAL G 1 110 ? 38.196  -65.152  -57.429  1.00 52.06  ? 107 VAL G CA    1 
ATOM 9320  C C     . VAL G 1 110 ? 36.995  -64.257  -57.166  1.00 58.81  ? 107 VAL G C     1 
ATOM 9321  O O     . VAL G 1 110 ? 36.475  -64.222  -56.047  1.00 54.97  ? 107 VAL G O     1 
ATOM 9322  C CB    . VAL G 1 110 ? 37.766  -66.633  -57.478  1.00 44.08  ? 107 VAL G CB    1 
ATOM 9323  C CG1   . VAL G 1 110 ? 36.569  -66.812  -58.399  1.00 46.12  ? 107 VAL G CG1   1 
ATOM 9324  C CG2   . VAL G 1 110 ? 38.927  -67.512  -57.931  1.00 51.02  ? 107 VAL G CG2   1 
ATOM 9325  N N     . CYS G 1 111 ? 36.557  -63.533  -58.192  1.00 53.84  ? 108 CYS G N     1 
ATOM 9326  C CA    . CYS G 1 111 ? 35.357  -62.715  -58.121  1.00 56.96  ? 108 CYS G CA    1 
ATOM 9327  C C     . CYS G 1 111 ? 34.237  -63.366  -58.920  1.00 49.01  ? 108 CYS G C     1 
ATOM 9328  O O     . CYS G 1 111 ? 34.482  -64.119  -59.867  1.00 44.49  ? 108 CYS G O     1 
ATOM 9329  C CB    . CYS G 1 111 ? 35.614  -61.298  -58.646  1.00 53.46  ? 108 CYS G CB    1 
ATOM 9330  S SG    . CYS G 1 111 ? 35.902  -61.185  -60.427  1.00 56.76  ? 108 CYS G SG    1 
ATOM 9331  N N     . ALA G 1 112 ? 33.002  -63.096  -58.501  1.00 47.37  ? 109 ALA G N     1 
ATOM 9332  C CA    . ALA G 1 112 ? 31.817  -63.582  -59.189  1.00 43.92  ? 109 ALA G CA    1 
ATOM 9333  C C     . ALA G 1 112 ? 30.769  -62.479  -59.215  1.00 44.78  ? 109 ALA G C     1 
ATOM 9334  O O     . ALA G 1 112 ? 30.654  -61.690  -58.273  1.00 54.46  ? 109 ALA G O     1 
ATOM 9335  C CB    . ALA G 1 112 ? 31.251  -64.841  -58.522  1.00 36.13  ? 109 ALA G CB    1 
ATOM 9336  N N     . PHE G 1 113 ? 30.006  -62.432  -60.307  1.00 42.64  ? 110 PHE G N     1 
ATOM 9337  C CA    . PHE G 1 113 ? 28.952  -61.441  -60.499  1.00 46.70  ? 110 PHE G CA    1 
ATOM 9338  C C     . PHE G 1 113 ? 27.625  -62.186  -60.539  1.00 48.77  ? 110 PHE G C     1 
ATOM 9339  O O     . PHE G 1 113 ? 27.319  -62.865  -61.524  1.00 45.92  ? 110 PHE G O     1 
ATOM 9340  C CB    . PHE G 1 113 ? 29.174  -60.641  -61.784  1.00 45.97  ? 110 PHE G CB    1 
ATOM 9341  C CG    . PHE G 1 113 ? 30.433  -59.814  -61.778  1.00 44.38  ? 110 PHE G CG    1 
ATOM 9342  C CD1   . PHE G 1 113 ? 31.675  -60.418  -61.703  1.00 45.17  ? 110 PHE G CD1   1 
ATOM 9343  C CD2   . PHE G 1 113 ? 30.376  -58.440  -61.909  1.00 47.12  ? 110 PHE G CD2   1 
ATOM 9344  C CE1   . PHE G 1 113 ? 32.830  -59.678  -61.701  1.00 47.16  ? 110 PHE G CE1   1 
ATOM 9345  C CE2   . PHE G 1 113 ? 31.542  -57.683  -61.925  1.00 50.90  ? 110 PHE G CE2   1 
ATOM 9346  C CZ    . PHE G 1 113 ? 32.771  -58.306  -61.820  1.00 51.06  ? 110 PHE G CZ    1 
ATOM 9347  N N     . VAL G 1 114 ? 26.830  -62.034  -59.484  1.00 40.87  ? 111 VAL G N     1 
ATOM 9348  C CA    . VAL G 1 114 ? 25.577  -62.762  -59.320  1.00 47.48  ? 111 VAL G CA    1 
ATOM 9349  C C     . VAL G 1 114 ? 24.434  -61.774  -59.481  1.00 49.06  ? 111 VAL G C     1 
ATOM 9350  O O     . VAL G 1 114 ? 24.468  -60.678  -58.908  1.00 48.92  ? 111 VAL G O     1 
ATOM 9351  C CB    . VAL G 1 114 ? 25.509  -63.471  -57.956  1.00 42.95  ? 111 VAL G CB    1 
ATOM 9352  C CG1   . VAL G 1 114 ? 24.194  -64.218  -57.811  1.00 40.10  ? 111 VAL G CG1   1 
ATOM 9353  C CG2   . VAL G 1 114 ? 26.691  -64.419  -57.791  1.00 45.01  ? 111 VAL G CG2   1 
ATOM 9354  N N     . ARG G 1 115 ? 23.432  -62.159  -60.266  1.00 48.93  ? 112 ARG G N     1 
ATOM 9355  C CA    . ARG G 1 115 ? 22.258  -61.337  -60.528  1.00 52.28  ? 112 ARG G CA    1 
ATOM 9356  C C     . ARG G 1 115 ? 21.021  -62.075  -60.041  1.00 51.94  ? 112 ARG G C     1 
ATOM 9357  O O     . ARG G 1 115 ? 20.696  -63.151  -60.556  1.00 51.38  ? 112 ARG G O     1 
ATOM 9358  C CB    . ARG G 1 115 ? 22.118  -61.014  -62.017  1.00 51.61  ? 112 ARG G CB    1 
ATOM 9359  C CG    . ARG G 1 115 ? 20.769  -60.396  -62.349  1.00 53.64  ? 112 ARG G CG    1 
ATOM 9360  C CD    . ARG G 1 115 ? 20.583  -60.128  -63.834  1.00 54.85  ? 112 ARG G CD    1 
ATOM 9361  N NE    . ARG G 1 115 ? 19.179  -60.263  -64.219  1.00 61.95  ? 112 ARG G NE    1 
ATOM 9362  C CZ    . ARG G 1 115 ? 18.551  -59.456  -65.069  1.00 70.57  ? 112 ARG G CZ    1 
ATOM 9363  N NH1   . ARG G 1 115 ? 19.201  -58.441  -65.626  1.00 66.04  ? 112 ARG G NH1   1 
ATOM 9364  N NH2   . ARG G 1 115 ? 17.270  -59.663  -65.358  1.00 63.91  ? 112 ARG G NH2   1 
ATOM 9365  N N     . VAL G 1 116 ? 20.335  -61.499  -59.058  1.00 46.71  ? 113 VAL G N     1 
ATOM 9366  C CA    . VAL G 1 116 ? 19.080  -62.049  -58.558  1.00 52.75  ? 113 VAL G CA    1 
ATOM 9367  C C     . VAL G 1 116 ? 17.934  -61.395  -59.312  1.00 54.96  ? 113 VAL G C     1 
ATOM 9368  O O     . VAL G 1 116 ? 17.945  -60.183  -59.551  1.00 55.71  ? 113 VAL G O     1 
ATOM 9369  C CB    . VAL G 1 116 ? 18.943  -61.831  -57.040  1.00 57.19  ? 113 VAL G CB    1 
ATOM 9370  C CG1   . VAL G 1 116 ? 17.584  -62.304  -56.551  1.00 52.82  ? 113 VAL G CG1   1 
ATOM 9371  C CG2   . VAL G 1 116 ? 20.045  -62.562  -56.304  1.00 51.84  ? 113 VAL G CG2   1 
ATOM 9372  N N     . GLN G 1 117 ? 16.935  -62.192  -59.685  1.00 52.32  ? 114 GLN G N     1 
ATOM 9373  C CA    . GLN G 1 117 ? 15.774  -61.687  -60.402  1.00 56.56  ? 114 GLN G CA    1 
ATOM 9374  C C     . GLN G 1 117 ? 14.498  -62.194  -59.748  1.00 59.67  ? 114 GLN G C     1 
ATOM 9375  O O     . GLN G 1 117 ? 14.426  -63.349  -59.314  1.00 58.13  ? 114 GLN G O     1 
ATOM 9376  C CB    . GLN G 1 117 ? 15.819  -62.109  -61.877  1.00 57.18  ? 114 GLN G CB    1 
ATOM 9377  C CG    . GLN G 1 117 ? 14.758  -61.468  -62.758  1.00 56.95  ? 114 GLN G CG    1 
ATOM 9378  C CD    . GLN G 1 117 ? 14.741  -62.048  -64.161  1.00 58.19  ? 114 GLN G CD    1 
ATOM 9379  O OE1   . GLN G 1 117 ? 14.982  -63.240  -64.361  1.00 60.68  ? 114 GLN G OE1   1 
ATOM 9380  N NE2   . GLN G 1 117 ? 14.470  -61.200  -65.143  1.00 67.52  ? 114 GLN G NE2   1 
ATOM 9381  N N     . LEU G 1 118 ? 13.494  -61.326  -59.680  1.00 51.75  ? 115 LEU G N     1 
ATOM 9382  C CA    . LEU G 1 118 ? 12.184  -61.688  -59.164  1.00 59.20  ? 115 LEU G CA    1 
ATOM 9383  C C     . LEU G 1 118 ? 11.253  -62.066  -60.310  1.00 59.45  ? 115 LEU G C     1 
ATOM 9384  O O     . LEU G 1 118 ? 11.537  -61.825  -61.485  1.00 72.95  ? 115 LEU G O     1 
ATOM 9385  C CB    . LEU G 1 118 ? 11.583  -60.542  -58.344  1.00 64.31  ? 115 LEU G CB    1 
ATOM 9386  C CG    . LEU G 1 118 ? 12.385  -60.093  -57.123  1.00 60.22  ? 115 LEU G CG    1 
ATOM 9387  C CD1   . LEU G 1 118 ? 11.638  -59.012  -56.360  1.00 54.38  ? 115 LEU G CD1   1 
ATOM 9388  C CD2   . LEU G 1 118 ? 12.704  -61.281  -56.227  1.00 52.91  ? 115 LEU G CD2   1 
ATOM 9389  N N     . LYS G 1 119 ? 10.119  -62.669  -59.948  1.00 60.19  ? 116 LYS G N     1 
ATOM 9390  C CA    . LYS G 1 119 ? 9.178   -63.149  -60.951  1.00 59.13  ? 116 LYS G CA    1 
ATOM 9391  C C     . LYS G 1 119 ? 8.499   -62.023  -61.722  1.00 65.76  ? 116 LYS G C     1 
ATOM 9392  O O     . LYS G 1 119 ? 7.745   -62.312  -62.657  1.00 70.55  ? 116 LYS G O     1 
ATOM 9393  C CB    . LYS G 1 119 ? 8.120   -64.053  -60.310  1.00 65.00  ? 116 LYS G CB    1 
ATOM 9394  C CG    . LYS G 1 119 ? 7.160   -63.356  -59.357  1.00 67.86  ? 116 LYS G CG    1 
ATOM 9395  C CD    . LYS G 1 119 ? 6.033   -64.304  -58.945  1.00 78.74  ? 116 LYS G CD    1 
ATOM 9396  C CE    . LYS G 1 119 ? 5.199   -63.744  -57.802  1.00 76.01  ? 116 LYS G CE    1 
ATOM 9397  N NZ    . LYS G 1 119 ? 4.155   -64.706  -57.341  1.00 73.10  ? 116 LYS G NZ    1 
ATOM 9398  N N     . ASP G 1 120 ? 8.722   -60.761  -61.353  1.00 66.47  ? 117 ASP G N     1 
ATOM 9399  C CA    . ASP G 1 120 ? 8.162   -59.634  -62.087  1.00 61.70  ? 117 ASP G CA    1 
ATOM 9400  C C     . ASP G 1 120 ? 9.185   -58.931  -62.967  1.00 65.52  ? 117 ASP G C     1 
ATOM 9401  O O     . ASP G 1 120 ? 8.858   -57.914  -63.586  1.00 69.91  ? 117 ASP G O     1 
ATOM 9402  C CB    . ASP G 1 120 ? 7.511   -58.632  -61.126  1.00 58.48  ? 117 ASP G CB    1 
ATOM 9403  C CG    . ASP G 1 120 ? 8.519   -57.803  -60.362  1.00 56.64  ? 117 ASP G CG    1 
ATOM 9404  O OD1   . ASP G 1 120 ? 9.566   -58.350  -59.962  1.00 61.81  ? 117 ASP G OD1   1 
ATOM 9405  O OD2   . ASP G 1 120 ? 8.263   -56.594  -60.170  1.00 55.45  ? 117 ASP G OD2   1 
ATOM 9406  N N     . GLY G 1 121 ? 10.404  -59.459  -63.057  1.00 57.61  ? 118 GLY G N     1 
ATOM 9407  C CA    . GLY G 1 121 ? 11.460  -58.854  -63.831  1.00 62.67  ? 118 GLY G CA    1 
ATOM 9408  C C     . GLY G 1 121 ? 12.417  -58.000  -63.026  1.00 59.47  ? 118 GLY G C     1 
ATOM 9409  O O     . GLY G 1 121 ? 13.501  -57.675  -63.526  1.00 66.84  ? 118 GLY G O     1 
ATOM 9410  N N     . SER G 1 122 ? 12.037  -57.613  -61.808  1.00 58.08  ? 119 SER G N     1 
ATOM 9411  C CA    . SER G 1 122 ? 12.935  -56.863  -60.941  1.00 55.16  ? 119 SER G CA    1 
ATOM 9412  C C     . SER G 1 122 ? 14.218  -57.647  -60.696  1.00 48.80  ? 119 SER G C     1 
ATOM 9413  O O     . SER G 1 122 ? 14.199  -58.870  -60.532  1.00 52.08  ? 119 SER G O     1 
ATOM 9414  C CB    . SER G 1 122 ? 12.251  -56.547  -59.611  1.00 62.65  ? 119 SER G CB    1 
ATOM 9415  O OG    . SER G 1 122 ? 13.125  -55.847  -58.743  1.00 80.96  ? 119 SER G OG    1 
ATOM 9416  N N     . TYR G 1 123 ? 15.338  -56.930  -60.644  1.00 42.71  ? 120 TYR G N     1 
ATOM 9417  C CA    . TYR G 1 123 ? 16.636  -57.580  -60.569  1.00 47.97  ? 120 TYR G CA    1 
ATOM 9418  C C     . TYR G 1 123 ? 17.580  -56.762  -59.699  1.00 45.50  ? 120 TYR G C     1 
ATOM 9419  O O     . TYR G 1 123 ? 17.430  -55.547  -59.560  1.00 47.57  ? 120 TYR G O     1 
ATOM 9420  C CB    . TYR G 1 123 ? 17.232  -57.785  -61.972  1.00 56.95  ? 120 TYR G CB    1 
ATOM 9421  C CG    . TYR G 1 123 ? 17.422  -56.511  -62.776  1.00 44.96  ? 120 TYR G CG    1 
ATOM 9422  C CD1   . TYR G 1 123 ? 16.412  -56.023  -63.600  1.00 41.70  ? 120 TYR G CD1   1 
ATOM 9423  C CD2   . TYR G 1 123 ? 18.616  -55.805  -62.721  1.00 43.24  ? 120 TYR G CD2   1 
ATOM 9424  C CE1   . TYR G 1 123 ? 16.586  -54.861  -64.338  1.00 36.83  ? 120 TYR G CE1   1 
ATOM 9425  C CE2   . TYR G 1 123 ? 18.799  -54.644  -63.455  1.00 47.76  ? 120 TYR G CE2   1 
ATOM 9426  C CZ    . TYR G 1 123 ? 17.782  -54.177  -64.261  1.00 49.40  ? 120 TYR G CZ    1 
ATOM 9427  O OH    . TYR G 1 123 ? 17.966  -53.021  -64.988  1.00 46.67  ? 120 TYR G OH    1 
ATOM 9428  N N     . HIS G 1 124 ? 18.550  -57.453  -59.105  1.00 41.50  ? 121 HIS G N     1 
ATOM 9429  C CA    . HIS G 1 124 ? 19.657  -56.829  -58.393  1.00 47.99  ? 121 HIS G CA    1 
ATOM 9430  C C     . HIS G 1 124 ? 20.899  -57.672  -58.634  1.00 54.28  ? 121 HIS G C     1 
ATOM 9431  O O     . HIS G 1 124 ? 20.862  -58.895  -58.464  1.00 50.88  ? 121 HIS G O     1 
ATOM 9432  C CB    . HIS G 1 124 ? 19.376  -56.703  -56.888  1.00 55.72  ? 121 HIS G CB    1 
ATOM 9433  C CG    . HIS G 1 124 ? 18.403  -55.619  -56.531  1.00 54.56  ? 121 HIS G CG    1 
ATOM 9434  N ND1   . HIS G 1 124 ? 17.074  -55.864  -56.262  1.00 61.78  ? 121 HIS G ND1   1 
ATOM 9435  C CD2   . HIS G 1 124 ? 18.576  -54.285  -56.372  1.00 52.06  ? 121 HIS G CD2   1 
ATOM 9436  C CE1   . HIS G 1 124 ? 16.467  -54.728  -55.967  1.00 59.54  ? 121 HIS G CE1   1 
ATOM 9437  N NE2   . HIS G 1 124 ? 17.357  -53.754  -56.028  1.00 52.57  ? 121 HIS G NE2   1 
ATOM 9438  N N     . GLU G 1 125 ? 21.983  -57.025  -59.049  1.00 53.44  ? 122 GLU G N     1 
ATOM 9439  C CA    . GLU G 1 125 ? 23.238  -57.695  -59.352  1.00 51.57  ? 122 GLU G CA    1 
ATOM 9440  C C     . GLU G 1 125 ? 24.348  -57.083  -58.512  1.00 53.10  ? 122 GLU G C     1 
ATOM 9441  O O     . GLU G 1 125 ? 24.429  -55.858  -58.374  1.00 54.94  ? 122 GLU G O     1 
ATOM 9442  C CB    . GLU G 1 125 ? 23.570  -57.586  -60.851  1.00 55.42  ? 122 GLU G CB    1 
ATOM 9443  C CG    . GLU G 1 125 ? 24.883  -58.230  -61.267  1.00 51.34  ? 122 GLU G CG    1 
ATOM 9444  C CD    . GLU G 1 125 ? 25.127  -58.153  -62.767  1.00 58.30  ? 122 GLU G CD    1 
ATOM 9445  O OE1   . GLU G 1 125 ? 24.518  -57.289  -63.433  1.00 59.96  ? 122 GLU G OE1   1 
ATOM 9446  O OE2   . GLU G 1 125 ? 25.929  -58.962  -63.280  1.00 61.16  ? 122 GLU G OE2   1 
ATOM 9447  N N     . ASP G 1 126 ? 25.206  -57.936  -57.957  1.00 45.04  ? 123 ASP G N     1 
ATOM 9448  C CA    . ASP G 1 126 ? 26.309  -57.481  -57.123  1.00 50.45  ? 123 ASP G CA    1 
ATOM 9449  C C     . ASP G 1 126 ? 27.489  -58.426  -57.314  1.00 46.40  ? 123 ASP G C     1 
ATOM 9450  O O     . ASP G 1 126 ? 27.398  -59.436  -58.017  1.00 49.13  ? 123 ASP G O     1 
ATOM 9451  C CB    . ASP G 1 126 ? 25.898  -57.393  -55.647  1.00 55.06  ? 123 ASP G CB    1 
ATOM 9452  C CG    . ASP G 1 126 ? 26.547  -56.219  -54.925  1.00 57.41  ? 123 ASP G CG    1 
ATOM 9453  O OD1   . ASP G 1 126 ? 26.029  -55.089  -55.033  1.00 58.56  ? 123 ASP G OD1   1 
ATOM 9454  O OD2   . ASP G 1 126 ? 27.580  -56.427  -54.254  1.00 50.60  ? 123 ASP G OD2   1 
ATOM 9455  N N     . VAL G 1 127 ? 28.596  -58.097  -56.654  1.00 51.17  ? 124 VAL G N     1 
ATOM 9456  C CA    . VAL G 1 127 ? 29.858  -58.816  -56.784  1.00 47.44  ? 124 VAL G CA    1 
ATOM 9457  C C     . VAL G 1 127 ? 30.102  -59.625  -55.519  1.00 57.51  ? 124 VAL G C     1 
ATOM 9458  O O     . VAL G 1 127 ? 29.904  -59.125  -54.404  1.00 58.20  ? 124 VAL G O     1 
ATOM 9459  C CB    . VAL G 1 127 ? 31.017  -57.830  -57.043  1.00 49.90  ? 124 VAL G CB    1 
ATOM 9460  C CG1   . VAL G 1 127 ? 32.343  -58.395  -56.560  1.00 64.50  ? 124 VAL G CG1   1 
ATOM 9461  C CG2   . VAL G 1 127 ? 31.103  -57.491  -58.518  1.00 69.85  ? 124 VAL G CG2   1 
ATOM 9462  N N     . GLY G 1 128 ? 30.533  -60.875  -55.689  1.00 51.01  ? 125 GLY G N     1 
ATOM 9463  C CA    . GLY G 1 128 ? 31.042  -61.642  -54.570  1.00 51.01  ? 125 GLY G CA    1 
ATOM 9464  C C     . GLY G 1 128 ? 32.504  -61.979  -54.753  1.00 52.57  ? 125 GLY G C     1 
ATOM 9465  O O     . GLY G 1 128 ? 32.984  -62.035  -55.891  1.00 50.91  ? 125 GLY G O     1 
ATOM 9466  N N     . TYR G 1 129 ? 33.227  -62.208  -53.656  1.00 56.52  ? 126 TYR G N     1 
ATOM 9467  C CA    . TYR G 1 129 ? 34.625  -62.604  -53.755  1.00 56.36  ? 126 TYR G CA    1 
ATOM 9468  C C     . TYR G 1 129 ? 34.878  -63.867  -52.954  1.00 48.88  ? 126 TYR G C     1 
ATOM 9469  O O     . TYR G 1 129 ? 34.168  -64.161  -51.995  1.00 53.97  ? 126 TYR G O     1 
ATOM 9470  C CB    . TYR G 1 129 ? 35.580  -61.504  -53.268  1.00 43.10  ? 126 TYR G CB    1 
ATOM 9471  C CG    . TYR G 1 129 ? 36.874  -61.435  -54.063  1.00 46.51  ? 126 TYR G CG    1 
ATOM 9472  C CD1   . TYR G 1 129 ? 36.880  -61.027  -55.393  1.00 49.08  ? 126 TYR G CD1   1 
ATOM 9473  C CD2   . TYR G 1 129 ? 38.080  -61.840  -53.503  1.00 53.45  ? 126 TYR G CD2   1 
ATOM 9474  C CE1   . TYR G 1 129 ? 38.064  -60.982  -56.124  1.00 46.56  ? 126 TYR G CE1   1 
ATOM 9475  C CE2   . TYR G 1 129 ? 39.259  -61.800  -54.223  1.00 55.37  ? 126 TYR G CE2   1 
ATOM 9476  C CZ    . TYR G 1 129 ? 39.250  -61.375  -55.529  1.00 47.64  ? 126 TYR G CZ    1 
ATOM 9477  O OH    . TYR G 1 129 ? 40.448  -61.351  -56.212  1.00 48.03  ? 126 TYR G OH    1 
ATOM 9478  N N     . GLY G 1 130 ? 35.892  -64.613  -53.377  1.00 49.01  ? 127 GLY G N     1 
ATOM 9479  C CA    . GLY G 1 130 ? 36.283  -65.838  -52.716  1.00 47.37  ? 127 GLY G CA    1 
ATOM 9480  C C     . GLY G 1 130 ? 37.788  -65.891  -52.556  1.00 55.84  ? 127 GLY G C     1 
ATOM 9481  O O     . GLY G 1 130 ? 38.530  -65.637  -53.510  1.00 57.55  ? 127 GLY G O     1 
ATOM 9482  N N     . VAL G 1 131 ? 38.254  -66.224  -51.356  1.00 56.43  ? 128 VAL G N     1 
ATOM 9483  C CA    . VAL G 1 131 ? 39.662  -66.133  -51.002  1.00 41.82  ? 128 VAL G CA    1 
ATOM 9484  C C     . VAL G 1 131 ? 40.122  -67.480  -50.463  1.00 50.29  ? 128 VAL G C     1 
ATOM 9485  O O     . VAL G 1 131 ? 39.377  -68.164  -49.750  1.00 58.63  ? 128 VAL G O     1 
ATOM 9486  C CB    . VAL G 1 131 ? 39.888  -65.010  -49.964  1.00 48.58  ? 128 VAL G CB    1 
ATOM 9487  C CG1   . VAL G 1 131 ? 41.358  -64.876  -49.618  1.00 44.97  ? 128 VAL G CG1   1 
ATOM 9488  C CG2   . VAL G 1 131 ? 39.334  -63.689  -50.476  1.00 56.81  ? 128 VAL G CG2   1 
ATOM 9489  N N     . SER G 1 132 ? 41.349  -67.864  -50.813  1.00 44.80  ? 129 SER G N     1 
ATOM 9490  C CA    . SER G 1 132 ? 41.996  -69.035  -50.229  1.00 43.50  ? 129 SER G CA    1 
ATOM 9491  C C     . SER G 1 132 ? 43.492  -68.765  -50.206  1.00 52.66  ? 129 SER G C     1 
ATOM 9492  O O     . SER G 1 132 ? 44.136  -68.794  -51.257  1.00 55.77  ? 129 SER G O     1 
ATOM 9493  C CB    . SER G 1 132 ? 41.680  -70.300  -51.023  1.00 42.68  ? 129 SER G CB    1 
ATOM 9494  O OG    . SER G 1 132 ? 42.532  -71.363  -50.627  1.00 47.07  ? 129 SER G OG    1 
ATOM 9495  N N     . GLU G 1 133 ? 44.045  -68.507  -49.026  1.00 57.98  ? 130 GLU G N     1 
ATOM 9496  C CA    . GLU G 1 133 ? 45.465  -68.225  -48.878  1.00 64.60  ? 130 GLU G CA    1 
ATOM 9497  C C     . GLU G 1 133 ? 46.082  -69.228  -47.915  1.00 66.46  ? 130 GLU G C     1 
ATOM 9498  O O     . GLU G 1 133 ? 45.547  -69.457  -46.825  1.00 69.16  ? 130 GLU G O     1 
ATOM 9499  C CB    . GLU G 1 133 ? 45.685  -66.800  -48.373  1.00 59.45  ? 130 GLU G CB    1 
ATOM 9500  C CG    . GLU G 1 133 ? 44.696  -65.795  -48.904  1.00 61.70  ? 130 GLU G CG    1 
ATOM 9501  C CD    . GLU G 1 133 ? 45.112  -64.352  -48.673  1.00 61.47  ? 130 GLU G CD    1 
ATOM 9502  O OE1   . GLU G 1 133 ? 46.324  -64.061  -48.724  1.00 67.27  ? 130 GLU G OE1   1 
ATOM 9503  O OE2   . GLU G 1 133 ? 44.224  -63.524  -48.386  1.00 62.30  ? 130 GLU G OE2   1 
ATOM 9504  N N     . GLY G 1 134 ? 47.194  -69.831  -48.329  1.00 63.07  ? 131 GLY G N     1 
ATOM 9505  C CA    . GLY G 1 134 ? 48.002  -70.677  -47.481  1.00 65.21  ? 131 GLY G CA    1 
ATOM 9506  C C     . GLY G 1 134 ? 47.917  -72.152  -47.802  1.00 66.28  ? 131 GLY G C     1 
ATOM 9507  O O     . GLY G 1 134 ? 48.861  -72.892  -47.497  1.00 73.66  ? 131 GLY G O     1 
ATOM 9508  N N     . LEU G 1 135 ? 46.837  -72.598  -48.434  1.00 69.56  ? 132 LEU G N     1 
ATOM 9509  C CA    . LEU G 1 135 ? 46.656  -74.020  -48.680  1.00 57.24  ? 132 LEU G CA    1 
ATOM 9510  C C     . LEU G 1 135 ? 47.684  -74.531  -49.685  1.00 59.84  ? 132 LEU G C     1 
ATOM 9511  O O     . LEU G 1 135 ? 48.116  -73.812  -50.591  1.00 59.33  ? 132 LEU G O     1 
ATOM 9512  C CB    . LEU G 1 135 ? 45.241  -74.294  -49.189  1.00 64.85  ? 132 LEU G CB    1 
ATOM 9513  C CG    . LEU G 1 135 ? 44.136  -74.172  -48.135  1.00 69.70  ? 132 LEU G CG    1 
ATOM 9514  C CD1   . LEU G 1 135 ? 42.763  -74.441  -48.738  1.00 63.08  ? 132 LEU G CD1   1 
ATOM 9515  C CD2   . LEU G 1 135 ? 44.409  -75.100  -46.961  1.00 70.47  ? 132 LEU G CD2   1 
ATOM 9516  N N     . LYS G 1 136 ? 48.081  -75.793  -49.509  1.00 65.12  ? 133 LYS G N     1 
ATOM 9517  C CA    . LYS G 1 136 ? 49.027  -76.430  -50.415  1.00 64.37  ? 133 LYS G CA    1 
ATOM 9518  C C     . LYS G 1 136 ? 48.357  -77.087  -51.612  1.00 70.48  ? 133 LYS G C     1 
ATOM 9519  O O     . LYS G 1 136 ? 49.038  -77.373  -52.602  1.00 70.76  ? 133 LYS G O     1 
ATOM 9520  C CB    . LYS G 1 136 ? 49.855  -77.491  -49.682  1.00 62.64  ? 133 LYS G CB    1 
ATOM 9521  C CG    . LYS G 1 136 ? 50.700  -76.974  -48.529  1.00 77.88  ? 133 LYS G CG    1 
ATOM 9522  C CD    . LYS G 1 136 ? 51.336  -78.138  -47.784  1.00 86.59  ? 133 LYS G CD    1 
ATOM 9523  C CE    . LYS G 1 136 ? 52.572  -78.655  -48.515  1.00 88.67  ? 133 LYS G CE    1 
ATOM 9524  N NZ    . LYS G 1 136 ? 53.652  -77.635  -48.602  1.00 79.51  ? 133 LYS G NZ    1 
ATOM 9525  N N     . SER G 1 137 ? 47.052  -77.338  -51.548  1.00 67.43  ? 134 SER G N     1 
ATOM 9526  C CA    . SER G 1 137 ? 46.331  -77.954  -52.654  1.00 63.49  ? 134 SER G CA    1 
ATOM 9527  C C     . SER G 1 137 ? 45.752  -76.867  -53.548  1.00 63.90  ? 134 SER G C     1 
ATOM 9528  O O     . SER G 1 137 ? 44.888  -76.096  -53.116  1.00 65.92  ? 134 SER G O     1 
ATOM 9529  C CB    . SER G 1 137 ? 45.219  -78.870  -52.143  1.00 75.03  ? 134 SER G CB    1 
ATOM 9530  O OG    . SER G 1 137 ? 44.386  -79.288  -53.213  1.00 86.11  ? 134 SER G OG    1 
ATOM 9531  N N     . LYS G 1 138 ? 46.229  -76.807  -54.794  1.00 61.42  ? 135 LYS G N     1 
ATOM 9532  C CA    . LYS G 1 138 ? 45.674  -75.855  -55.748  1.00 59.59  ? 135 LYS G CA    1 
ATOM 9533  C C     . LYS G 1 138 ? 44.193  -76.120  -55.985  1.00 62.06  ? 135 LYS G C     1 
ATOM 9534  O O     . LYS G 1 138 ? 43.394  -75.181  -56.081  1.00 63.67  ? 135 LYS G O     1 
ATOM 9535  C CB    . LYS G 1 138 ? 46.447  -75.908  -57.066  1.00 55.56  ? 135 LYS G CB    1 
ATOM 9536  C CG    . LYS G 1 138 ? 45.973  -74.887  -58.090  1.00 61.36  ? 135 LYS G CG    1 
ATOM 9537  C CD    . LYS G 1 138 ? 47.104  -74.447  -59.010  1.00 55.76  ? 135 LYS G CD    1 
ATOM 9538  C CE    . LYS G 1 138 ? 47.563  -75.585  -59.905  1.00 51.20  ? 135 LYS G CE    1 
ATOM 9539  N NZ    . LYS G 1 138 ? 48.609  -75.159  -60.878  1.00 61.45  ? 135 LYS G NZ    1 
ATOM 9540  N N     . ALA G 1 139 ? 43.810  -77.396  -56.090  1.00 63.46  ? 136 ALA G N     1 
ATOM 9541  C CA    . ALA G 1 139 ? 42.416  -77.728  -56.364  1.00 65.77  ? 136 ALA G CA    1 
ATOM 9542  C C     . ALA G 1 139 ? 41.509  -77.232  -55.248  1.00 63.36  ? 136 ALA G C     1 
ATOM 9543  O O     . ALA G 1 139 ? 40.445  -76.659  -55.510  1.00 70.76  ? 136 ALA G O     1 
ATOM 9544  C CB    . ALA G 1 139 ? 42.261  -79.237  -56.553  1.00 73.71  ? 136 ALA G CB    1 
ATOM 9545  N N     . LEU G 1 140 ? 41.922  -77.424  -53.994  1.00 60.81  ? 137 LEU G N     1 
ATOM 9546  C CA    . LEU G 1 140 ? 41.093  -76.968  -52.885  1.00 59.78  ? 137 LEU G CA    1 
ATOM 9547  C C     . LEU G 1 140 ? 41.047  -75.450  -52.828  1.00 52.47  ? 137 LEU G C     1 
ATOM 9548  O O     . LEU G 1 140 ? 39.997  -74.869  -52.536  1.00 51.64  ? 137 LEU G O     1 
ATOM 9549  C CB    . LEU G 1 140 ? 41.622  -77.517  -51.562  1.00 64.55  ? 137 LEU G CB    1 
ATOM 9550  C CG    . LEU G 1 140 ? 40.973  -78.777  -50.998  1.00 72.39  ? 137 LEU G CG    1 
ATOM 9551  C CD1   . LEU G 1 140 ? 41.081  -79.915  -51.995  1.00 75.22  ? 137 LEU G CD1   1 
ATOM 9552  C CD2   . LEU G 1 140 ? 41.619  -79.141  -49.676  1.00 80.01  ? 137 LEU G CD2   1 
ATOM 9553  N N     . SER G 1 141 ? 42.165  -74.794  -53.139  1.00 46.03  ? 138 SER G N     1 
ATOM 9554  C CA    . SER G 1 141 ? 42.184  -73.336  -53.174  1.00 51.36  ? 138 SER G CA    1 
ATOM 9555  C C     . SER G 1 141 ? 41.199  -72.800  -54.204  1.00 56.97  ? 138 SER G C     1 
ATOM 9556  O O     . SER G 1 141 ? 40.365  -71.937  -53.898  1.00 57.52  ? 138 SER G O     1 
ATOM 9557  C CB    . SER G 1 141 ? 43.601  -72.842  -53.469  1.00 52.45  ? 138 SER G CB    1 
ATOM 9558  O OG    . SER G 1 141 ? 44.507  -73.235  -52.453  1.00 57.71  ? 138 SER G OG    1 
ATOM 9559  N N     . LEU G 1 142 ? 41.269  -73.318  -55.435  1.00 60.39  ? 139 LEU G N     1 
ATOM 9560  C CA    . LEU G 1 142 ? 40.370  -72.859  -56.488  1.00 45.77  ? 139 LEU G CA    1 
ATOM 9561  C C     . LEU G 1 142 ? 38.915  -73.174  -56.166  1.00 47.43  ? 139 LEU G C     1 
ATOM 9562  O O     . LEU G 1 142 ? 38.038  -72.322  -56.345  1.00 50.71  ? 139 LEU G O     1 
ATOM 9563  C CB    . LEU G 1 142 ? 40.765  -73.479  -57.826  1.00 46.01  ? 139 LEU G CB    1 
ATOM 9564  C CG    . LEU G 1 142 ? 41.905  -72.755  -58.536  1.00 52.66  ? 139 LEU G CG    1 
ATOM 9565  C CD1   . LEU G 1 142 ? 42.444  -73.592  -59.680  1.00 47.29  ? 139 LEU G CD1   1 
ATOM 9566  C CD2   . LEU G 1 142 ? 41.436  -71.387  -59.019  1.00 52.60  ? 139 LEU G CD2   1 
ATOM 9567  N N     . GLU G 1 143 ? 38.635  -74.391  -55.691  1.00 50.13  ? 140 GLU G N     1 
ATOM 9568  C CA    . GLU G 1 143 ? 37.263  -74.752  -55.352  1.00 49.48  ? 140 GLU G CA    1 
ATOM 9569  C C     . GLU G 1 143 ? 36.708  -73.832  -54.273  1.00 52.78  ? 140 GLU G C     1 
ATOM 9570  O O     . GLU G 1 143 ? 35.598  -73.293  -54.402  1.00 59.56  ? 140 GLU G O     1 
ATOM 9571  C CB    . GLU G 1 143 ? 37.207  -76.209  -54.894  1.00 50.93  ? 140 GLU G CB    1 
ATOM 9572  C CG    . GLU G 1 143 ? 35.928  -76.585  -54.174  1.00 49.47  ? 140 GLU G CG    1 
ATOM 9573  C CD    . GLU G 1 143 ? 35.905  -78.042  -53.763  1.00 62.90  ? 140 GLU G CD    1 
ATOM 9574  O OE1   . GLU G 1 143 ? 36.987  -78.590  -53.463  1.00 73.03  ? 140 GLU G OE1   1 
ATOM 9575  O OE2   . GLU G 1 143 ? 34.809  -78.642  -53.740  1.00 55.44  ? 140 GLU G OE2   1 
ATOM 9576  N N     . LYS G 1 144 ? 37.488  -73.622  -53.208  1.00 56.74  ? 141 LYS G N     1 
ATOM 9577  C CA    . LYS G 1 144 ? 37.054  -72.772  -52.109  1.00 53.78  ? 141 LYS G CA    1 
ATOM 9578  C C     . LYS G 1 144 ? 36.785  -71.359  -52.600  1.00 51.92  ? 141 LYS G C     1 
ATOM 9579  O O     . LYS G 1 144 ? 35.731  -70.780  -52.312  1.00 49.76  ? 141 LYS G O     1 
ATOM 9580  C CB    . LYS G 1 144 ? 38.117  -72.788  -51.006  1.00 48.18  ? 141 LYS G CB    1 
ATOM 9581  C CG    . LYS G 1 144 ? 37.706  -72.206  -49.654  1.00 57.02  ? 141 LYS G CG    1 
ATOM 9582  C CD    . LYS G 1 144 ? 38.940  -71.718  -48.887  1.00 70.87  ? 141 LYS G CD    1 
ATOM 9583  C CE    . LYS G 1 144 ? 38.605  -71.219  -47.485  1.00 65.17  ? 141 LYS G CE    1 
ATOM 9584  N NZ    . LYS G 1 144 ? 38.107  -69.818  -47.492  1.00 74.10  ? 141 LYS G NZ    1 
ATOM 9585  N N     . ALA G 1 145 ? 37.704  -70.808  -53.399  1.00 42.59  ? 142 ALA G N     1 
ATOM 9586  C CA    . ALA G 1 145 ? 37.556  -69.426  -53.835  1.00 44.82  ? 142 ALA G CA    1 
ATOM 9587  C C     . ALA G 1 145 ? 36.357  -69.259  -54.761  1.00 53.70  ? 142 ALA G C     1 
ATOM 9588  O O     . ALA G 1 145 ? 35.566  -68.326  -54.591  1.00 51.97  ? 142 ALA G O     1 
ATOM 9589  C CB    . ALA G 1 145 ? 38.836  -68.952  -54.522  1.00 44.06  ? 142 ALA G CB    1 
ATOM 9590  N N     . ARG G 1 146 ? 36.176  -70.177  -55.714  1.00 47.68  ? 143 ARG G N     1 
ATOM 9591  C CA    . ARG G 1 146 ? 35.067  -70.060  -56.659  1.00 40.80  ? 143 ARG G CA    1 
ATOM 9592  C C     . ARG G 1 146 ? 33.720  -70.188  -55.954  1.00 45.59  ? 143 ARG G C     1 
ATOM 9593  O O     . ARG G 1 146 ? 32.824  -69.345  -56.137  1.00 44.51  ? 143 ARG G O     1 
ATOM 9594  C CB    . ARG G 1 146 ? 35.214  -71.117  -57.755  1.00 47.56  ? 143 ARG G CB    1 
ATOM 9595  C CG    . ARG G 1 146 ? 36.484  -70.980  -58.594  1.00 46.27  ? 143 ARG G CG    1 
ATOM 9596  C CD    . ARG G 1 146 ? 36.435  -71.868  -59.833  1.00 46.15  ? 143 ARG G CD    1 
ATOM 9597  N NE    . ARG G 1 146 ? 36.086  -71.134  -61.048  1.00 62.98  ? 143 ARG G NE    1 
ATOM 9598  C CZ    . ARG G 1 146 ? 36.926  -70.912  -62.055  1.00 44.84  ? 143 ARG G CZ    1 
ATOM 9599  N NH1   . ARG G 1 146 ? 38.165  -71.379  -62.001  1.00 52.41  ? 143 ARG G NH1   1 
ATOM 9600  N NH2   . ARG G 1 146 ? 36.525  -70.235  -63.123  1.00 62.43  ? 143 ARG G NH2   1 
ATOM 9601  N N     . LYS G 1 147 ? 33.555  -71.238  -55.139  1.00 48.71  ? 144 LYS G N     1 
ATOM 9602  C CA    . LYS G 1 147 ? 32.282  -71.436  -54.455  1.00 42.68  ? 144 LYS G CA    1 
ATOM 9603  C C     . LYS G 1 147 ? 31.983  -70.287  -53.497  1.00 49.70  ? 144 LYS G C     1 
ATOM 9604  O O     . LYS G 1 147 ? 30.842  -69.800  -53.435  1.00 49.71  ? 144 LYS G O     1 
ATOM 9605  C CB    . LYS G 1 147 ? 32.287  -72.775  -53.719  1.00 39.69  ? 144 LYS G CB    1 
ATOM 9606  C CG    . LYS G 1 147 ? 32.229  -73.981  -54.646  1.00 43.96  ? 144 LYS G CG    1 
ATOM 9607  C CD    . LYS G 1 147 ? 32.336  -75.286  -53.872  1.00 44.55  ? 144 LYS G CD    1 
ATOM 9608  C CE    . LYS G 1 147 ? 32.253  -76.485  -54.805  1.00 44.84  ? 144 LYS G CE    1 
ATOM 9609  N NZ    . LYS G 1 147 ? 32.233  -77.778  -54.064  1.00 48.69  ? 144 LYS G NZ    1 
ATOM 9610  N N     . GLU G 1 148 ? 32.989  -69.847  -52.730  1.00 48.85  ? 145 GLU G N     1 
ATOM 9611  C CA    . GLU G 1 148 ? 32.786  -68.722  -51.825  1.00 42.25  ? 145 GLU G CA    1 
ATOM 9612  C C     . GLU G 1 148 ? 32.395  -67.463  -52.585  1.00 48.67  ? 145 GLU G C     1 
ATOM 9613  O O     . GLU G 1 148 ? 31.508  -66.723  -52.151  1.00 45.12  ? 145 GLU G O     1 
ATOM 9614  C CB    . GLU G 1 148 ? 34.050  -68.470  -51.003  1.00 55.06  ? 145 GLU G CB    1 
ATOM 9615  C CG    . GLU G 1 148 ? 34.105  -69.229  -49.693  1.00 76.12  ? 145 GLU G CG    1 
ATOM 9616  C CD    . GLU G 1 148 ? 35.392  -68.977  -48.934  1.00 81.93  ? 145 GLU G CD    1 
ATOM 9617  O OE1   . GLU G 1 148 ? 35.958  -67.868  -49.064  1.00 80.60  ? 145 GLU G OE1   1 
ATOM 9618  O OE2   . GLU G 1 148 ? 35.834  -69.889  -48.203  1.00 76.15  ? 145 GLU G OE2   1 
ATOM 9619  N N     . ALA G 1 149 ? 33.059  -67.195  -53.713  1.00 50.74  ? 146 ALA G N     1 
ATOM 9620  C CA    . ALA G 1 149 ? 32.720  -66.028  -54.519  1.00 48.63  ? 146 ALA G CA    1 
ATOM 9621  C C     . ALA G 1 149 ? 31.263  -66.067  -54.952  1.00 47.82  ? 146 ALA G C     1 
ATOM 9622  O O     . ALA G 1 149 ? 30.545  -65.068  -54.840  1.00 45.14  ? 146 ALA G O     1 
ATOM 9623  C CB    . ALA G 1 149 ? 33.642  -65.945  -55.736  1.00 52.42  ? 146 ALA G CB    1 
ATOM 9624  N N     . VAL G 1 150 ? 30.802  -67.223  -55.434  1.00 43.50  ? 147 VAL G N     1 
ATOM 9625  C CA    . VAL G 1 150 ? 29.426  -67.311  -55.920  1.00 41.86  ? 147 VAL G CA    1 
ATOM 9626  C C     . VAL G 1 150 ? 28.433  -67.116  -54.774  1.00 51.24  ? 147 VAL G C     1 
ATOM 9627  O O     . VAL G 1 150 ? 27.465  -66.352  -54.892  1.00 47.83  ? 147 VAL G O     1 
ATOM 9628  C CB    . VAL G 1 150 ? 29.199  -68.642  -56.659  1.00 47.61  ? 147 VAL G CB    1 
ATOM 9629  C CG1   . VAL G 1 150 ? 27.711  -68.924  -56.810  1.00 35.92  ? 147 VAL G CG1   1 
ATOM 9630  C CG2   . VAL G 1 150 ? 29.865  -68.588  -58.019  1.00 52.38  ? 147 VAL G CG2   1 
ATOM 9631  N N     . THR G 1 151 ? 28.660  -67.798  -53.645  1.00 52.94  ? 148 THR G N     1 
ATOM 9632  C CA    . THR G 1 151 ? 27.731  -67.675  -52.521  1.00 43.99  ? 148 THR G CA    1 
ATOM 9633  C C     . THR G 1 151 ? 27.704  -66.248  -51.976  1.00 45.87  ? 148 THR G C     1 
ATOM 9634  O O     . THR G 1 151 ? 26.629  -65.702  -51.686  1.00 46.38  ? 148 THR G O     1 
ATOM 9635  C CB    . THR G 1 151 ? 28.099  -68.671  -51.419  1.00 51.75  ? 148 THR G CB    1 
ATOM 9636  O OG1   . THR G 1 151 ? 27.921  -70.008  -51.906  1.00 67.53  ? 148 THR G OG1   1 
ATOM 9637  C CG2   . THR G 1 151 ? 27.213  -68.471  -50.196  1.00 33.50  ? 148 THR G CG2   1 
ATOM 9638  N N     . ASP G 1 152 ? 28.879  -65.635  -51.815  1.00 39.33  ? 149 ASP G N     1 
ATOM 9639  C CA    . ASP G 1 152 ? 28.957  -64.252  -51.360  1.00 38.27  ? 149 ASP G CA    1 
ATOM 9640  C C     . ASP G 1 152 ? 28.247  -63.307  -52.323  1.00 55.07  ? 149 ASP G C     1 
ATOM 9641  O O     . ASP G 1 152 ? 27.568  -62.368  -51.892  1.00 51.31  ? 149 ASP G O     1 
ATOM 9642  C CB    . ASP G 1 152 ? 30.417  -63.845  -51.179  1.00 36.59  ? 149 ASP G CB    1 
ATOM 9643  C CG    . ASP G 1 152 ? 30.567  -62.532  -50.444  1.00 52.22  ? 149 ASP G CG    1 
ATOM 9644  O OD1   . ASP G 1 152 ? 30.016  -62.413  -49.328  1.00 62.91  ? 149 ASP G OD1   1 
ATOM 9645  O OD2   . ASP G 1 152 ? 31.236  -61.624  -50.976  1.00 45.66  ? 149 ASP G OD2   1 
ATOM 9646  N N     . GLY G 1 153 ? 28.431  -63.510  -53.631  1.00 62.20  ? 150 GLY G N     1 
ATOM 9647  C CA    . GLY G 1 153 ? 27.737  -62.675  -54.598  1.00 50.34  ? 150 GLY G CA    1 
ATOM 9648  C C     . GLY G 1 153 ? 26.234  -62.812  -54.494  1.00 49.63  ? 150 GLY G C     1 
ATOM 9649  O O     . GLY G 1 153 ? 25.503  -61.825  -54.598  1.00 54.53  ? 150 GLY G O     1 
ATOM 9650  N N     . LEU G 1 154 ? 25.754  -64.033  -54.252  1.00 42.22  ? 151 LEU G N     1 
ATOM 9651  C CA    . LEU G 1 154 ? 24.319  -64.226  -54.073  1.00 45.91  ? 151 LEU G CA    1 
ATOM 9652  C C     . LEU G 1 154 ? 23.823  -63.497  -52.831  1.00 57.47  ? 151 LEU G C     1 
ATOM 9653  O O     . LEU G 1 154 ? 22.778  -62.834  -52.865  1.00 55.60  ? 151 LEU G O     1 
ATOM 9654  C CB    . LEU G 1 154 ? 23.993  -65.716  -53.986  1.00 37.74  ? 151 LEU G CB    1 
ATOM 9655  C CG    . LEU G 1 154 ? 22.535  -66.060  -53.672  1.00 41.48  ? 151 LEU G CG    1 
ATOM 9656  C CD1   . LEU G 1 154 ? 21.588  -65.380  -54.649  1.00 38.88  ? 151 LEU G CD1   1 
ATOM 9657  C CD2   . LEU G 1 154 ? 22.326  -67.570  -53.667  1.00 51.53  ? 151 LEU G CD2   1 
ATOM 9658  N N     . LYS G 1 155 ? 24.571  -63.592  -51.729  1.00 55.07  ? 152 LYS G N     1 
ATOM 9659  C CA    . LYS G 1 155 ? 24.175  -62.898  -50.506  1.00 53.39  ? 152 LYS G CA    1 
ATOM 9660  C C     . LYS G 1 155 ? 24.136  -61.387  -50.714  1.00 59.48  ? 152 LYS G C     1 
ATOM 9661  O O     . LYS G 1 155 ? 23.182  -60.715  -50.303  1.00 62.05  ? 152 LYS G O     1 
ATOM 9662  C CB    . LYS G 1 155 ? 25.126  -63.253  -49.362  1.00 61.26  ? 152 LYS G CB    1 
ATOM 9663  C CG    . LYS G 1 155 ? 25.037  -64.691  -48.879  1.00 61.57  ? 152 LYS G CG    1 
ATOM 9664  C CD    . LYS G 1 155 ? 25.772  -64.865  -47.553  1.00 68.17  ? 152 LYS G CD    1 
ATOM 9665  C CE    . LYS G 1 155 ? 27.262  -64.577  -47.688  1.00 69.11  ? 152 LYS G CE    1 
ATOM 9666  N NZ    . LYS G 1 155 ? 27.995  -64.793  -46.408  1.00 74.57  ? 152 LYS G NZ    1 
ATOM 9667  N N     . ARG G 1 156 ? 25.163  -60.835  -51.368  1.00 61.51  ? 153 ARG G N     1 
ATOM 9668  C CA    . ARG G 1 156 ? 25.224  -59.387  -51.548  1.00 59.28  ? 153 ARG G CA    1 
ATOM 9669  C C     . ARG G 1 156 ? 24.184  -58.894  -52.547  1.00 62.00  ? 153 ARG G C     1 
ATOM 9670  O O     . ARG G 1 156 ? 23.728  -57.749  -52.447  1.00 53.87  ? 153 ARG G O     1 
ATOM 9671  C CB    . ARG G 1 156 ? 26.627  -58.956  -51.983  1.00 55.90  ? 153 ARG G CB    1 
ATOM 9672  C CG    . ARG G 1 156 ? 27.683  -59.106  -50.900  1.00 59.28  ? 153 ARG G CG    1 
ATOM 9673  C CD    . ARG G 1 156 ? 29.088  -58.866  -51.430  1.00 60.07  ? 153 ARG G CD    1 
ATOM 9674  N NE    . ARG G 1 156 ? 29.201  -57.591  -52.138  1.00 54.74  ? 153 ARG G NE    1 
ATOM 9675  C CZ    . ARG G 1 156 ? 29.438  -56.423  -51.546  1.00 59.34  ? 153 ARG G CZ    1 
ATOM 9676  N NH1   . ARG G 1 156 ? 29.586  -56.363  -50.229  1.00 72.61  ? 153 ARG G NH1   1 
ATOM 9677  N NH2   . ARG G 1 156 ? 29.525  -55.313  -52.269  1.00 52.08  ? 153 ARG G NH2   1 
ATOM 9678  N N     . ALA G 1 157 ? 23.810  -59.725  -53.522  1.00 66.30  ? 154 ALA G N     1 
ATOM 9679  C CA    . ALA G 1 157 ? 22.740  -59.345  -54.435  1.00 57.10  ? 154 ALA G CA    1 
ATOM 9680  C C     . ALA G 1 157 ? 21.382  -59.393  -53.746  1.00 60.98  ? 154 ALA G C     1 
ATOM 9681  O O     . ALA G 1 157 ? 20.530  -58.528  -53.983  1.00 59.13  ? 154 ALA G O     1 
ATOM 9682  C CB    . ALA G 1 157 ? 22.755  -60.247  -55.668  1.00 52.91  ? 154 ALA G CB    1 
ATOM 9683  N N     . LEU G 1 158 ? 21.155  -60.403  -52.899  1.00 63.44  ? 155 LEU G N     1 
ATOM 9684  C CA    . LEU G 1 158 ? 19.878  -60.507  -52.200  1.00 52.64  ? 155 LEU G CA    1 
ATOM 9685  C C     . LEU G 1 158 ? 19.724  -59.437  -51.125  1.00 59.96  ? 155 LEU G C     1 
ATOM 9686  O O     . LEU G 1 158 ? 18.597  -59.027  -50.825  1.00 57.82  ? 155 LEU G O     1 
ATOM 9687  C CB    . LEU G 1 158 ? 19.737  -61.895  -51.580  1.00 42.61  ? 155 LEU G CB    1 
ATOM 9688  C CG    . LEU G 1 158 ? 19.288  -63.020  -52.504  1.00 50.02  ? 155 LEU G CG    1 
ATOM 9689  C CD1   . LEU G 1 158 ? 19.344  -64.360  -51.796  1.00 42.29  ? 155 LEU G CD1   1 
ATOM 9690  C CD2   . LEU G 1 158 ? 17.877  -62.730  -52.975  1.00 58.92  ? 155 LEU G CD2   1 
ATOM 9691  N N     . ARG G 1 159 ? 20.835  -58.988  -50.529  1.00 64.04  ? 156 ARG G N     1 
ATOM 9692  C CA    . ARG G 1 159 ? 20.788  -57.923  -49.527  1.00 62.44  ? 156 ARG G CA    1 
ATOM 9693  C C     . ARG G 1 159 ? 20.036  -56.688  -50.012  1.00 65.25  ? 156 ARG G C     1 
ATOM 9694  O O     . ARG G 1 159 ? 19.369  -56.017  -49.217  1.00 71.21  ? 156 ARG G O     1 
ATOM 9695  C CB    . ARG G 1 159 ? 22.209  -57.552  -49.087  1.00 59.21  ? 156 ARG G CB    1 
ATOM 9696  C CG    . ARG G 1 159 ? 22.720  -58.413  -47.925  1.00 81.81  ? 156 ARG G CG    1 
ATOM 9697  C CD    . ARG G 1 159 ? 24.050  -57.929  -47.351  1.00 91.23  ? 156 ARG G CD    1 
ATOM 9698  N NE    . ARG G 1 159 ? 25.107  -58.933  -47.483  1.00 101.71 ? 156 ARG G NE    1 
ATOM 9699  C CZ    . ARG G 1 159 ? 26.402  -58.651  -47.590  1.00 99.63  ? 156 ARG G CZ    1 
ATOM 9700  N NH1   . ARG G 1 159 ? 26.804  -57.385  -47.587  1.00 84.77  ? 156 ARG G NH1   1 
ATOM 9701  N NH2   . ARG G 1 159 ? 27.293  -59.633  -47.698  1.00 87.04  ? 156 ARG G NH2   1 
ATOM 9702  N N     . SER G 1 160 ? 20.129  -56.369  -51.303  1.00 65.33  ? 157 SER G N     1 
ATOM 9703  C CA    . SER G 1 160 ? 19.609  -55.108  -51.823  1.00 64.32  ? 157 SER G CA    1 
ATOM 9704  C C     . SER G 1 160 ? 18.083  -55.031  -51.826  1.00 60.76  ? 157 SER G C     1 
ATOM 9705  O O     . SER G 1 160 ? 17.545  -53.978  -52.186  1.00 63.70  ? 157 SER G O     1 
ATOM 9706  C CB    . SER G 1 160 ? 20.141  -54.872  -53.239  1.00 64.20  ? 157 SER G CB    1 
ATOM 9707  O OG    . SER G 1 160 ? 21.559  -54.886  -53.272  1.00 71.20  ? 157 SER G OG    1 
ATOM 9708  N N     . PHE G 1 161 ? 17.373  -56.093  -51.434  1.00 57.34  ? 158 PHE G N     1 
ATOM 9709  C CA    . PHE G 1 161 ? 15.914  -56.086  -51.422  1.00 60.81  ? 158 PHE G CA    1 
ATOM 9710  C C     . PHE G 1 161 ? 15.309  -55.564  -50.127  1.00 71.24  ? 158 PHE G C     1 
ATOM 9711  O O     . PHE G 1 161 ? 14.118  -55.233  -50.111  1.00 71.67  ? 158 PHE G O     1 
ATOM 9712  C CB    . PHE G 1 161 ? 15.374  -57.495  -51.670  1.00 58.27  ? 158 PHE G CB    1 
ATOM 9713  C CG    . PHE G 1 161 ? 15.440  -57.924  -53.100  1.00 60.63  ? 158 PHE G CG    1 
ATOM 9714  C CD1   . PHE G 1 161 ? 14.674  -57.285  -54.059  1.00 61.60  ? 158 PHE G CD1   1 
ATOM 9715  C CD2   . PHE G 1 161 ? 16.263  -58.966  -53.490  1.00 60.48  ? 158 PHE G CD2   1 
ATOM 9716  C CE1   . PHE G 1 161 ? 14.723  -57.677  -55.377  1.00 58.96  ? 158 PHE G CE1   1 
ATOM 9717  C CE2   . PHE G 1 161 ? 16.319  -59.361  -54.810  1.00 51.39  ? 158 PHE G CE2   1 
ATOM 9718  C CZ    . PHE G 1 161 ? 15.550  -58.715  -55.754  1.00 58.40  ? 158 PHE G CZ    1 
ATOM 9719  N N     . GLY G 1 162 ? 16.080  -55.490  -49.057  1.00 79.09  ? 159 GLY G N     1 
ATOM 9720  C CA    . GLY G 1 162 ? 15.591  -54.931  -47.811  1.00 74.29  ? 159 GLY G CA    1 
ATOM 9721  C C     . GLY G 1 162 ? 16.282  -55.571  -46.625  1.00 74.20  ? 159 GLY G C     1 
ATOM 9722  O O     . GLY G 1 162 ? 17.121  -56.459  -46.763  1.00 65.58  ? 159 GLY G O     1 
ATOM 9723  N N     . ASN G 1 163 ? 15.897  -55.090  -45.438  1.00 75.66  ? 160 ASN G N     1 
ATOM 9724  C CA    . ASN G 1 163 ? 16.513  -55.559  -44.201  1.00 67.87  ? 160 ASN G CA    1 
ATOM 9725  C C     . ASN G 1 163 ? 16.284  -57.048  -43.986  1.00 62.93  ? 160 ASN G C     1 
ATOM 9726  O O     . ASN G 1 163 ? 17.183  -57.756  -43.521  1.00 60.06  ? 160 ASN G O     1 
ATOM 9727  C CB    . ASN G 1 163 ? 15.974  -54.765  -43.011  1.00 71.66  ? 160 ASN G CB    1 
ATOM 9728  C CG    . ASN G 1 163 ? 16.174  -53.274  -43.167  1.00 76.34  ? 160 ASN G CG    1 
ATOM 9729  O OD1   . ASN G 1 163 ? 17.272  -52.757  -42.953  1.00 77.13  ? 160 ASN G OD1   1 
ATOM 9730  N ND2   . ASN G 1 163 ? 15.114  -52.572  -43.545  1.00 80.52  ? 160 ASN G ND2   1 
ATOM 9731  N N     . ALA G 1 164 ? 15.085  -57.542  -44.313  1.00 59.75  ? 161 ALA G N     1 
ATOM 9732  C CA    . ALA G 1 164 ? 14.750  -58.932  -44.013  1.00 52.33  ? 161 ALA G CA    1 
ATOM 9733  C C     . ALA G 1 164 ? 15.672  -59.909  -44.731  1.00 56.33  ? 161 ALA G C     1 
ATOM 9734  O O     . ALA G 1 164 ? 15.839  -61.048  -44.279  1.00 67.52  ? 161 ALA G O     1 
ATOM 9735  C CB    . ALA G 1 164 ? 13.295  -59.217  -44.378  1.00 58.32  ? 161 ALA G CB    1 
ATOM 9736  N N     . LEU G 1 165 ? 16.260  -59.501  -45.855  1.00 62.96  ? 162 LEU G N     1 
ATOM 9737  C CA    . LEU G 1 165 ? 17.169  -60.360  -46.601  1.00 61.13  ? 162 LEU G CA    1 
ATOM 9738  C C     . LEU G 1 165 ? 18.635  -60.038  -46.341  1.00 65.99  ? 162 LEU G C     1 
ATOM 9739  O O     . LEU G 1 165 ? 19.508  -60.611  -46.998  1.00 61.93  ? 162 LEU G O     1 
ATOM 9740  C CB    . LEU G 1 165 ? 16.877  -60.274  -48.099  1.00 61.25  ? 162 LEU G CB    1 
ATOM 9741  C CG    . LEU G 1 165 ? 15.696  -61.096  -48.612  1.00 60.35  ? 162 LEU G CG    1 
ATOM 9742  C CD1   . LEU G 1 165 ? 15.474  -60.816  -50.084  1.00 57.63  ? 162 LEU G CD1   1 
ATOM 9743  C CD2   . LEU G 1 165 ? 15.926  -62.581  -48.371  1.00 61.63  ? 162 LEU G CD2   1 
ATOM 9744  N N     . GLY G 1 166 ? 18.925  -59.145  -45.398  1.00 59.29  ? 163 GLY G N     1 
ATOM 9745  C CA    . GLY G 1 166 ? 20.286  -58.980  -44.931  1.00 51.42  ? 163 GLY G CA    1 
ATOM 9746  C C     . GLY G 1 166 ? 20.836  -57.570  -44.950  1.00 59.30  ? 163 GLY G C     1 
ATOM 9747  O O     . GLY G 1 166 ? 22.013  -57.372  -44.639  1.00 54.30  ? 163 GLY G O     1 
ATOM 9748  N N     . ASN G 1 167 ? 20.014  -56.581  -45.308  1.00 64.70  ? 164 ASN G N     1 
ATOM 9749  C CA    . ASN G 1 167 ? 20.513  -55.211  -45.375  1.00 69.42  ? 164 ASN G CA    1 
ATOM 9750  C C     . ASN G 1 167 ? 20.816  -54.649  -43.989  1.00 77.19  ? 164 ASN G C     1 
ATOM 9751  O O     . ASN G 1 167 ? 21.753  -53.857  -43.833  1.00 72.24  ? 164 ASN G O     1 
ATOM 9752  C CB    . ASN G 1 167 ? 19.497  -54.321  -46.093  1.00 62.71  ? 164 ASN G CB    1 
ATOM 9753  C CG    . ASN G 1 167 ? 20.101  -53.021  -46.581  1.00 67.67  ? 164 ASN G CG    1 
ATOM 9754  O OD1   . ASN G 1 167 ? 21.318  -52.842  -46.563  1.00 66.15  ? 164 ASN G OD1   1 
ATOM 9755  N ND2   . ASN G 1 167 ? 19.248  -52.099  -47.009  1.00 72.95  ? 164 ASN G ND2   1 
ATOM 9756  N N     . CYS G 1 168 ? 20.041  -55.047  -42.976  1.00 74.24  ? 165 CYS G N     1 
ATOM 9757  C CA    . CYS G 1 168 ? 20.204  -54.485  -41.638  1.00 74.31  ? 165 CYS G CA    1 
ATOM 9758  C C     . CYS G 1 168 ? 21.556  -54.835  -41.026  1.00 73.43  ? 165 CYS G C     1 
ATOM 9759  O O     . CYS G 1 168 ? 22.039  -54.115  -40.144  1.00 75.60  ? 165 CYS G O     1 
ATOM 9760  C CB    . CYS G 1 168 ? 19.066  -54.960  -40.734  1.00 68.60  ? 165 CYS G CB    1 
ATOM 9761  S SG    . CYS G 1 168 ? 18.902  -56.759  -40.609  1.00 67.69  ? 165 CYS G SG    1 
ATOM 9762  N N     . ILE G 1 169 ? 22.183  -55.926  -41.481  1.00 63.05  ? 166 ILE G N     1 
ATOM 9763  C CA    . ILE G 1 169 ? 23.469  -56.362  -40.939  1.00 70.57  ? 166 ILE G CA    1 
ATOM 9764  C C     . ILE G 1 169 ? 24.543  -55.287  -41.052  1.00 67.85  ? 166 ILE G C     1 
ATOM 9765  O O     . ILE G 1 169 ? 25.563  -55.359  -40.358  1.00 79.46  ? 166 ILE G O     1 
ATOM 9766  C CB    . ILE G 1 169 ? 23.929  -57.661  -41.635  1.00 66.19  ? 166 ILE G CB    1 
ATOM 9767  C CG1   . ILE G 1 169 ? 24.919  -58.420  -40.753  1.00 71.91  ? 166 ILE G CG1   1 
ATOM 9768  C CG2   . ILE G 1 169 ? 24.598  -57.356  -42.962  1.00 81.68  ? 166 ILE G CG2   1 
ATOM 9769  C CD1   . ILE G 1 169 ? 24.327  -58.903  -39.461  1.00 89.91  ? 166 ILE G CD1   1 
ATOM 9770  N N     . LEU G 1 170 ? 24.351  -54.296  -41.920  1.00 71.23  ? 167 LEU G N     1 
ATOM 9771  C CA    . LEU G 1 170 ? 25.327  -53.232  -42.102  1.00 73.82  ? 167 LEU G CA    1 
ATOM 9772  C C     . LEU G 1 170 ? 25.091  -52.050  -41.169  1.00 76.52  ? 167 LEU G C     1 
ATOM 9773  O O     . LEU G 1 170 ? 25.925  -51.139  -41.122  1.00 81.62  ? 167 LEU G O     1 
ATOM 9774  C CB    . LEU G 1 170 ? 25.315  -52.756  -43.561  1.00 83.25  ? 167 LEU G CB    1 
ATOM 9775  C CG    . LEU G 1 170 ? 25.644  -53.819  -44.618  1.00 78.20  ? 167 LEU G CG    1 
ATOM 9776  C CD1   . LEU G 1 170 ? 25.313  -53.345  -46.032  1.00 86.14  ? 167 LEU G CD1   1 
ATOM 9777  C CD2   . LEU G 1 170 ? 27.099  -54.257  -44.527  1.00 74.06  ? 167 LEU G CD2   1 
ATOM 9778  N N     . ASP G 1 171 ? 23.981  -52.044  -40.432  1.00 73.90  ? 168 ASP G N     1 
ATOM 9779  C CA    . ASP G 1 171 ? 23.638  -50.935  -39.549  1.00 74.61  ? 168 ASP G CA    1 
ATOM 9780  C C     . ASP G 1 171 ? 24.327  -51.117  -38.201  1.00 86.49  ? 168 ASP G C     1 
ATOM 9781  O O     . ASP G 1 171 ? 24.083  -52.106  -37.501  1.00 91.57  ? 168 ASP G O     1 
ATOM 9782  C CB    . ASP G 1 171 ? 22.125  -50.837  -39.372  1.00 74.61  ? 168 ASP G CB    1 
ATOM 9783  C CG    . ASP G 1 171 ? 21.692  -49.513  -38.769  1.00 79.01  ? 168 ASP G CG    1 
ATOM 9784  O OD1   . ASP G 1 171 ? 22.569  -48.667  -38.498  1.00 69.62  ? 168 ASP G OD1   1 
ATOM 9785  O OD2   . ASP G 1 171 ? 20.475  -49.317  -38.570  1.00 79.36  ? 168 ASP G OD2   1 
ATOM 9786  N N     . LYS G 1 172 ? 25.198  -50.169  -37.848  1.00 80.79  ? 169 LYS G N     1 
ATOM 9787  C CA    . LYS G 1 172 ? 25.942  -50.267  -36.596  1.00 84.63  ? 169 LYS G CA    1 
ATOM 9788  C C     . LYS G 1 172 ? 25.021  -50.201  -35.380  1.00 85.45  ? 169 LYS G C     1 
ATOM 9789  O O     . LYS G 1 172 ? 25.280  -50.864  -34.368  1.00 88.48  ? 169 LYS G O     1 
ATOM 9790  C CB    . LYS G 1 172 ? 26.976  -49.141  -36.540  1.00 84.21  ? 169 LYS G CB    1 
ATOM 9791  C CG    . LYS G 1 172 ? 27.867  -49.076  -37.779  1.00 100.68 ? 169 LYS G CG    1 
ATOM 9792  C CD    . LYS G 1 172 ? 28.749  -47.828  -37.810  1.00 105.79 ? 169 LYS G CD    1 
ATOM 9793  C CE    . LYS G 1 172 ? 29.498  -47.716  -39.140  1.00 102.80 ? 169 LYS G CE    1 
ATOM 9794  N NZ    . LYS G 1 172 ? 30.303  -46.465  -39.268  1.00 114.95 ? 169 LYS G NZ    1 
ATOM 9795  N N     . ASP G 1 173 ? 23.923  -49.444  -35.474  1.00 81.42  ? 170 ASP G N     1 
ATOM 9796  C CA    . ASP G 1 173 ? 22.971  -49.377  -34.368  1.00 85.13  ? 170 ASP G CA    1 
ATOM 9797  C C     . ASP G 1 173 ? 22.270  -50.713  -34.179  1.00 83.05  ? 170 ASP G C     1 
ATOM 9798  O O     . ASP G 1 173 ? 22.029  -51.148  -33.044  1.00 93.19  ? 170 ASP G O     1 
ATOM 9799  C CB    . ASP G 1 173 ? 21.953  -48.264  -34.616  1.00 83.76  ? 170 ASP G CB    1 
ATOM 9800  C CG    . ASP G 1 173 ? 22.605  -46.919  -34.870  1.00 92.73  ? 170 ASP G CG    1 
ATOM 9801  O OD1   . ASP G 1 173 ? 23.638  -46.619  -34.235  1.00 98.55  ? 170 ASP G OD1   1 
ATOM 9802  O OD2   . ASP G 1 173 ? 22.079  -46.162  -35.711  1.00 91.82  ? 170 ASP G OD2   1 
ATOM 9803  N N     . TYR G 1 174 ? 21.922  -51.369  -35.287  1.00 78.49  ? 171 TYR G N     1 
ATOM 9804  C CA    . TYR G 1 174 ? 21.385  -52.720  -35.217  1.00 80.30  ? 171 TYR G CA    1 
ATOM 9805  C C     . TYR G 1 174 ? 22.397  -53.667  -34.587  1.00 87.97  ? 171 TYR G C     1 
ATOM 9806  O O     . TYR G 1 174 ? 22.023  -54.558  -33.816  1.00 87.06  ? 171 TYR G O     1 
ATOM 9807  C CB    . TYR G 1 174 ? 20.997  -53.179  -36.624  1.00 76.98  ? 171 TYR G CB    1 
ATOM 9808  C CG    . TYR G 1 174 ? 20.676  -54.647  -36.772  1.00 74.79  ? 171 TYR G CG    1 
ATOM 9809  C CD1   . TYR G 1 174 ? 19.416  -55.132  -36.455  1.00 73.96  ? 171 TYR G CD1   1 
ATOM 9810  C CD2   . TYR G 1 174 ? 21.622  -55.544  -37.250  1.00 74.55  ? 171 TYR G CD2   1 
ATOM 9811  C CE1   . TYR G 1 174 ? 19.105  -56.468  -36.595  1.00 68.46  ? 171 TYR G CE1   1 
ATOM 9812  C CE2   . TYR G 1 174 ? 21.320  -56.887  -37.395  1.00 69.70  ? 171 TYR G CE2   1 
ATOM 9813  C CZ    . TYR G 1 174 ? 20.059  -57.343  -37.065  1.00 72.95  ? 171 TYR G CZ    1 
ATOM 9814  O OH    . TYR G 1 174 ? 19.748  -58.678  -37.206  1.00 76.29  ? 171 TYR G OH    1 
ATOM 9815  N N     . LEU G 1 175 ? 23.688  -53.451  -34.855  1.00 89.14  ? 172 LEU G N     1 
ATOM 9816  C CA    . LEU G 1 175 ? 24.718  -54.301  -34.265  1.00 93.77  ? 172 LEU G CA    1 
ATOM 9817  C C     . LEU G 1 175 ? 24.805  -54.097  -32.757  1.00 91.29  ? 172 LEU G C     1 
ATOM 9818  O O     . LEU G 1 175 ? 24.929  -55.070  -32.000  1.00 99.75  ? 172 LEU G O     1 
ATOM 9819  C CB    . LEU G 1 175 ? 26.069  -54.028  -34.929  1.00 93.48  ? 172 LEU G CB    1 
ATOM 9820  C CG    . LEU G 1 175 ? 26.210  -54.482  -36.385  1.00 89.59  ? 172 LEU G CG    1 
ATOM 9821  C CD1   . LEU G 1 175 ? 27.618  -54.218  -36.915  1.00 82.79  ? 172 LEU G CD1   1 
ATOM 9822  C CD2   . LEU G 1 175 ? 25.839  -55.953  -36.531  1.00 81.22  ? 172 LEU G CD2   1 
ATOM 9823  N N     . ARG G 1 176 ? 24.747  -52.842  -32.300  1.00 84.92  ? 173 ARG G N     1 
ATOM 9824  C CA    . ARG G 1 176 ? 24.745  -52.586  -30.863  1.00 94.92  ? 173 ARG G CA    1 
ATOM 9825  C C     . ARG G 1 176 ? 23.523  -53.207  -30.197  1.00 92.58  ? 173 ARG G C     1 
ATOM 9826  O O     . ARG G 1 176 ? 23.636  -53.860  -29.153  1.00 95.83  ? 173 ARG G O     1 
ATOM 9827  C CB    . ARG G 1 176 ? 24.800  -51.085  -30.575  1.00 97.27  ? 173 ARG G CB    1 
ATOM 9828  C CG    . ARG G 1 176 ? 26.131  -50.414  -30.889  1.00 103.76 ? 173 ARG G CG    1 
ATOM 9829  C CD    . ARG G 1 176 ? 26.213  -49.007  -30.294  1.00 102.89 ? 173 ARG G CD    1 
ATOM 9830  N NE    . ARG G 1 176 ? 25.242  -48.088  -30.880  1.00 106.45 ? 173 ARG G NE    1 
ATOM 9831  C CZ    . ARG G 1 176 ? 24.063  -47.796  -30.337  1.00 107.37 ? 173 ARG G CZ    1 
ATOM 9832  N NH1   . ARG G 1 176 ? 23.700  -48.348  -29.186  1.00 106.31 ? 173 ARG G NH1   1 
ATOM 9833  N NH2   . ARG G 1 176 ? 23.245  -46.948  -30.945  1.00 107.11 ? 173 ARG G NH2   1 
ATOM 9834  N N     . SER G 1 177 ? 22.340  -53.012  -30.786  1.00 85.85  ? 174 SER G N     1 
ATOM 9835  C CA    . SER G 1 177 ? 21.138  -53.622  -30.226  1.00 83.71  ? 174 SER G CA    1 
ATOM 9836  C C     . SER G 1 177 ? 21.168  -55.146  -30.287  1.00 91.70  ? 174 SER G C     1 
ATOM 9837  O O     . SER G 1 177 ? 20.434  -55.799  -29.538  1.00 96.07  ? 174 SER G O     1 
ATOM 9838  C CB    . SER G 1 177 ? 19.900  -53.095  -30.954  1.00 94.24  ? 174 SER G CB    1 
ATOM 9839  O OG    . SER G 1 177 ? 19.743  -51.699  -30.746  1.00 99.07  ? 174 SER G OG    1 
ATOM 9840  N N     . LEU G 1 178 ? 22.004  -55.727  -31.151  1.00 99.19  ? 175 LEU G N     1 
ATOM 9841  C CA    . LEU G 1 178 ? 22.143  -57.180  -31.190  1.00 99.96  ? 175 LEU G CA    1 
ATOM 9842  C C     . LEU G 1 178 ? 23.120  -57.697  -30.141  1.00 98.28  ? 175 LEU G C     1 
ATOM 9843  O O     . LEU G 1 178 ? 22.907  -58.771  -29.567  1.00 90.44  ? 175 LEU G O     1 
ATOM 9844  C CB    . LEU G 1 178 ? 22.619  -57.627  -32.571  1.00 90.40  ? 175 LEU G CB    1 
ATOM 9845  C CG    . LEU G 1 178 ? 21.628  -58.225  -33.559  1.00 90.54  ? 175 LEU G CG    1 
ATOM 9846  C CD1   . LEU G 1 178 ? 22.422  -58.784  -34.720  1.00 95.70  ? 175 LEU G CD1   1 
ATOM 9847  C CD2   . LEU G 1 178 ? 20.806  -59.303  -32.891  1.00 92.78  ? 175 LEU G CD2   1 
ATOM 9848  N N     . ASN G 1 179 ? 24.198  -56.953  -29.887  1.00 100.56 ? 176 ASN G N     1 
ATOM 9849  C CA    . ASN G 1 179 ? 25.201  -57.406  -28.926  1.00 108.51 ? 176 ASN G CA    1 
ATOM 9850  C C     . ASN G 1 179 ? 24.668  -57.391  -27.498  1.00 112.30 ? 176 ASN G C     1 
ATOM 9851  O O     . ASN G 1 179 ? 25.011  -58.263  -26.690  1.00 108.99 ? 176 ASN G O     1 
ATOM 9852  C CB    . ASN G 1 179 ? 26.456  -56.543  -29.037  1.00 104.70 ? 176 ASN G CB    1 
ATOM 9853  C CG    . ASN G 1 179 ? 27.271  -56.860  -30.276  1.00 120.28 ? 176 ASN G CG    1 
ATOM 9854  O OD1   . ASN G 1 179 ? 27.798  -57.966  -30.417  1.00 132.15 ? 176 ASN G OD1   1 
ATOM 9855  N ND2   . ASN G 1 179 ? 27.365  -55.899  -31.191  1.00 106.17 ? 176 ASN G ND2   1 
ATOM 9856  N N     . LYS G 1 180 ? 23.833  -56.407  -27.166  1.00 109.17 ? 177 LYS G N     1 
ATOM 9857  C CA    . LYS G 1 180 ? 23.274  -56.311  -25.823  1.00 102.47 ? 177 LYS G CA    1 
ATOM 9858  C C     . LYS G 1 180 ? 22.306  -57.440  -25.490  1.00 100.54 ? 177 LYS G C     1 
ATOM 9859  O O     . LYS G 1 180 ? 21.892  -57.555  -24.332  1.00 108.96 ? 177 LYS G O     1 
ATOM 9860  C CB    . LYS G 1 180 ? 22.576  -54.965  -25.643  1.00 93.25  ? 177 LYS G CB    1 
ATOM 9861  C CG    . LYS G 1 180 ? 23.487  -53.765  -25.847  1.00 90.96  ? 177 LYS G CG    1 
ATOM 9862  C CD    . LYS G 1 180 ? 22.712  -52.468  -25.720  1.00 82.78  ? 177 LYS G CD    1 
ATOM 9863  C CE    . LYS G 1 180 ? 23.588  -51.263  -26.001  1.00 92.67  ? 177 LYS G CE    1 
ATOM 9864  N NZ    . LYS G 1 180 ? 22.805  -50.000  -25.922  1.00 103.41 ? 177 LYS G NZ    1 
ATOM 9865  N N     . LEU G 1 181 ? 21.950  -58.278  -26.459  1.00 96.44  ? 178 LEU G N     1 
ATOM 9866  C CA    . LEU G 1 181 ? 20.997  -59.352  -26.239  1.00 96.48  ? 178 LEU G CA    1 
ATOM 9867  C C     . LEU G 1 181 ? 21.673  -60.588  -25.645  1.00 102.41 ? 178 LEU G C     1 
ATOM 9868  O O     . LEU G 1 181 ? 22.849  -60.853  -25.913  1.00 102.96 ? 178 LEU G O     1 
ATOM 9869  C CB    . LEU G 1 181 ? 20.321  -59.720  -27.555  1.00 108.80 ? 178 LEU G CB    1 
ATOM 9870  C CG    . LEU G 1 181 ? 19.243  -58.733  -28.005  1.00 110.25 ? 178 LEU G CG    1 
ATOM 9871  C CD1   . LEU G 1 181 ? 18.694  -59.112  -29.371  1.00 111.82 ? 178 LEU G CD1   1 
ATOM 9872  C CD2   . LEU G 1 181 ? 18.132  -58.660  -26.973  1.00 106.62 ? 178 LEU G CD2   1 
ATOM 9873  N N     . PRO G 1 182 ? 20.944  -61.358  -24.837  1.00 114.18 ? 179 PRO G N     1 
ATOM 9874  C CA    . PRO G 1 182 ? 21.519  -62.574  -24.244  1.00 116.80 ? 179 PRO G CA    1 
ATOM 9875  C C     . PRO G 1 182 ? 21.877  -63.606  -25.306  1.00 117.80 ? 179 PRO G C     1 
ATOM 9876  O O     . PRO G 1 182 ? 21.073  -63.923  -26.185  1.00 126.18 ? 179 PRO G O     1 
ATOM 9877  C CB    . PRO G 1 182 ? 20.408  -63.080  -23.315  1.00 119.65 ? 179 PRO G CB    1 
ATOM 9878  C CG    . PRO G 1 182 ? 19.494  -61.914  -23.108  1.00 107.90 ? 179 PRO G CG    1 
ATOM 9879  C CD    . PRO G 1 182 ? 19.577  -61.093  -24.354  1.00 108.42 ? 179 PRO G CD    1 
ATOM 9880  N N     . ARG G 1 183 ? 23.107  -64.119  -25.224  1.00 118.65 ? 180 ARG G N     1 
ATOM 9881  C CA    . ARG G 1 183 ? 23.600  -65.136  -26.148  1.00 130.17 ? 180 ARG G CA    1 
ATOM 9882  C C     . ARG G 1 183 ? 22.804  -66.432  -26.010  1.00 125.65 ? 180 ARG G C     1 
ATOM 9883  O O     . ARG G 1 183 ? 22.969  -67.167  -25.031  1.00 130.54 ? 180 ARG G O     1 
ATOM 9884  C CB    . ARG G 1 183 ? 25.091  -65.396  -25.902  1.00 125.97 ? 180 ARG G CB    1 
ATOM 9885  C CG    . ARG G 1 183 ? 26.031  -64.777  -26.933  1.00 132.48 ? 180 ARG G CG    1 
ATOM 9886  C CD    . ARG G 1 183 ? 25.761  -65.285  -28.345  1.00 129.13 ? 180 ARG G CD    1 
ATOM 9887  N NE    . ARG G 1 183 ? 25.926  -66.732  -28.464  1.00 138.46 ? 180 ARG G NE    1 
ATOM 9888  C CZ    . ARG G 1 183 ? 25.498  -67.448  -29.500  1.00 132.42 ? 180 ARG G CZ    1 
ATOM 9889  N NH1   . ARG G 1 183 ? 24.874  -66.851  -30.505  1.00 129.80 ? 180 ARG G NH1   1 
ATOM 9890  N NH2   . ARG G 1 183 ? 25.689  -68.760  -29.531  1.00 128.39 ? 180 ARG G NH2   1 
ATOM 9891  N N     . GLN G 1 184 ? 21.938  -66.714  -26.982  1.00 120.72 ? 181 GLN G N     1 
ATOM 9892  C CA    . GLN G 1 184 ? 21.067  -67.883  -26.939  1.00 115.85 ? 181 GLN G CA    1 
ATOM 9893  C C     . GLN G 1 184 ? 21.813  -69.144  -27.359  1.00 122.53 ? 181 GLN G C     1 
ATOM 9894  O O     . GLN G 1 184 ? 22.745  -69.102  -28.167  1.00 128.95 ? 181 GLN G O     1 
ATOM 9895  C CB    . GLN G 1 184 ? 19.860  -67.690  -27.859  1.00 126.15 ? 181 GLN G CB    1 
ATOM 9896  C CG    . GLN G 1 184 ? 20.243  -67.425  -29.315  1.00 136.00 ? 181 GLN G CG    1 
ATOM 9897  C CD    . GLN G 1 184 ? 19.053  -67.413  -30.261  1.00 121.32 ? 181 GLN G CD    1 
ATOM 9898  O OE1   . GLN G 1 184 ? 18.796  -66.414  -30.929  1.00 114.13 ? 181 GLN G OE1   1 
ATOM 9899  N NE2   . GLN G 1 184 ? 18.329  -68.527  -30.328  1.00 124.19 ? 181 GLN G NE2   1 
ATOM 9900  N N     . LEU G 1 185 ? 21.392  -70.278  -26.797  1.00 117.96 ? 182 LEU G N     1 
ATOM 9901  C CA    . LEU G 1 185 ? 22.023  -71.540  -27.145  1.00 127.55 ? 182 LEU G CA    1 
ATOM 9902  C C     . LEU G 1 185 ? 21.523  -72.024  -28.508  1.00 127.25 ? 182 LEU G C     1 
ATOM 9903  O O     . LEU G 1 185 ? 20.372  -71.773  -28.876  1.00 116.58 ? 182 LEU G O     1 
ATOM 9904  C CB    . LEU G 1 185 ? 21.728  -72.591  -26.076  1.00 119.25 ? 182 LEU G CB    1 
ATOM 9905  C CG    . LEU G 1 185 ? 22.735  -73.725  -25.861  1.00 119.99 ? 182 LEU G CG    1 
ATOM 9906  C CD1   . LEU G 1 185 ? 24.096  -73.168  -25.464  1.00 119.15 ? 182 LEU G CD1   1 
ATOM 9907  C CD2   . LEU G 1 185 ? 22.233  -74.714  -24.816  1.00 117.53 ? 182 LEU G CD2   1 
ATOM 9908  N N     . PRO G 1 186 ? 22.390  -72.699  -29.292  1.00 129.09 ? 183 PRO G N     1 
ATOM 9909  C CA    . PRO G 1 186 ? 21.967  -73.226  -30.600  1.00 123.91 ? 183 PRO G CA    1 
ATOM 9910  C C     . PRO G 1 186 ? 20.659  -74.004  -30.557  1.00 119.98 ? 183 PRO G C     1 
ATOM 9911  O O     . PRO G 1 186 ? 20.526  -74.981  -29.812  1.00 118.58 ? 183 PRO G O     1 
ATOM 9912  C CB    . PRO G 1 186 ? 23.138  -74.127  -31.006  1.00 124.97 ? 183 PRO G CB    1 
ATOM 9913  C CG    . PRO G 1 186 ? 24.325  -73.512  -30.350  1.00 124.68 ? 183 PRO G CG    1 
ATOM 9914  C CD    . PRO G 1 186 ? 23.848  -72.801  -29.100  1.00 133.53 ? 183 PRO G CD    1 
ATOM 9915  N N     . LEU G 1 187 ? 19.686  -73.555  -31.347  1.00 125.63 ? 184 LEU G N     1 
ATOM 9916  C CA    . LEU G 1 187 ? 18.393  -74.221  -31.429  1.00 125.13 ? 184 LEU G CA    1 
ATOM 9917  C C     . LEU G 1 187 ? 18.547  -75.659  -31.917  1.00 118.50 ? 184 LEU G C     1 
ATOM 9918  O O     . LEU G 1 187 ? 19.469  -75.992  -32.668  1.00 118.24 ? 184 LEU G O     1 
ATOM 9919  C CB    . LEU G 1 187 ? 17.460  -73.454  -32.371  1.00 127.37 ? 184 LEU G CB    1 
ATOM 9920  C CG    . LEU G 1 187 ? 17.129  -71.985  -32.073  1.00 129.80 ? 184 LEU G CG    1 
ATOM 9921  C CD1   . LEU G 1 187 ? 16.956  -71.743  -30.572  1.00 131.26 ? 184 LEU G CD1   1 
ATOM 9922  C CD2   . LEU G 1 187 ? 18.162  -71.029  -32.680  1.00 117.58 ? 184 LEU G CD2   1 
ATOM 9923  N N     . GLU G 1 188 ? 17.629  -76.516  -31.481  1.00 120.41 ? 185 GLU G N     1 
ATOM 9924  C CA    . GLU G 1 188 ? 17.605  -77.915  -31.880  1.00 122.95 ? 185 GLU G CA    1 
ATOM 9925  C C     . GLU G 1 188 ? 16.582  -78.137  -32.987  1.00 119.63 ? 185 GLU G C     1 
ATOM 9926  O O     . GLU G 1 188 ? 15.547  -77.467  -33.050  1.00 120.41 ? 185 GLU G O     1 
ATOM 9927  C CB    . GLU G 1 188 ? 17.289  -78.829  -30.694  1.00 120.01 ? 185 GLU G CB    1 
ATOM 9928  C CG    . GLU G 1 188 ? 17.705  -80.281  -30.914  1.00 125.43 ? 185 GLU G CG    1 
ATOM 9929  C CD    . GLU G 1 188 ? 17.403  -81.169  -29.723  1.00 136.08 ? 185 GLU G CD    1 
ATOM 9930  O OE1   . GLU G 1 188 ? 16.275  -81.091  -29.192  1.00 152.85 ? 185 GLU G OE1   1 
ATOM 9931  O OE2   . GLU G 1 188 ? 18.290  -81.953  -29.324  1.00 128.97 ? 185 GLU G OE2   1 
ATOM 9932  N N     . VAL G 1 189 ? 16.885  -79.091  -33.864  1.00 108.73 ? 186 VAL G N     1 
ATOM 9933  C CA    . VAL G 1 189 ? 16.070  -79.397  -35.033  1.00 110.54 ? 186 VAL G CA    1 
ATOM 9934  C C     . VAL G 1 189 ? 15.298  -80.681  -34.764  1.00 99.21  ? 186 VAL G C     1 
ATOM 9935  O O     . VAL G 1 189 ? 15.872  -81.669  -34.290  1.00 96.01  ? 186 VAL G O     1 
ATOM 9936  C CB    . VAL G 1 189 ? 16.934  -79.531  -36.299  1.00 107.92 ? 186 VAL G CB    1 
ATOM 9937  C CG1   . VAL G 1 189 ? 16.062  -79.843  -37.499  1.00 97.25  ? 186 VAL G CG1   1 
ATOM 9938  C CG2   . VAL G 1 189 ? 17.735  -78.259  -36.534  1.00 92.57  ? 186 VAL G CG2   1 
ATOM 9939  N N     . ASP G 1 190 ? 13.996  -80.664  -35.054  1.00 95.35  ? 187 ASP G N     1 
ATOM 9940  C CA    . ASP G 1 190 ? 13.112  -81.807  -34.816  1.00 100.52 ? 187 ASP G CA    1 
ATOM 9941  C C     . ASP G 1 190 ? 12.944  -82.583  -36.121  1.00 100.17 ? 187 ASP G C     1 
ATOM 9942  O O     . ASP G 1 190 ? 12.124  -82.223  -36.968  1.00 104.67 ? 187 ASP G O     1 
ATOM 9943  C CB    . ASP G 1 190 ? 11.766  -81.340  -34.272  1.00 105.01 ? 187 ASP G CB    1 
ATOM 9944  C CG    . ASP G 1 190 ? 10.800  -82.485  -34.051  1.00 111.95 ? 187 ASP G CG    1 
ATOM 9945  O OD1   . ASP G 1 190 ? 11.255  -83.584  -33.672  1.00 104.95 ? 187 ASP G OD1   1 
ATOM 9946  O OD2   . ASP G 1 190 ? 9.585   -82.288  -34.259  1.00 112.98 ? 187 ASP G OD2   1 
ATOM 9947  N N     . LEU G 1 191 ? 13.708  -83.666  -36.271  1.00 97.37  ? 188 LEU G N     1 
ATOM 9948  C CA    . LEU G 1 191 ? 13.715  -84.469  -37.487  1.00 88.55  ? 188 LEU G CA    1 
ATOM 9949  C C     . LEU G 1 191 ? 12.643  -85.559  -37.503  1.00 97.46  ? 188 LEU G C     1 
ATOM 9950  O O     . LEU G 1 191 ? 12.766  -86.519  -38.271  1.00 98.16  ? 188 LEU G O     1 
ATOM 9951  C CB    . LEU G 1 191 ? 15.100  -85.089  -37.696  1.00 87.87  ? 188 LEU G CB    1 
ATOM 9952  C CG    . LEU G 1 191 ? 16.231  -84.086  -37.934  1.00 96.47  ? 188 LEU G CG    1 
ATOM 9953  C CD1   . LEU G 1 191 ? 17.549  -84.789  -38.231  1.00 97.19  ? 188 LEU G CD1   1 
ATOM 9954  C CD2   . LEU G 1 191 ? 15.864  -83.140  -39.068  1.00 101.76 ? 188 LEU G CD2   1 
ATOM 9955  N N     . THR G 1 192 ? 11.604  -85.442  -36.673  1.00 104.50 ? 189 THR G N     1 
ATOM 9956  C CA    . THR G 1 192 ? 10.563  -86.466  -36.665  1.00 110.65 ? 189 THR G CA    1 
ATOM 9957  C C     . THR G 1 192 ? 9.712   -86.404  -37.928  1.00 100.46 ? 189 THR G C     1 
ATOM 9958  O O     . THR G 1 192 ? 9.367   -87.445  -38.498  1.00 107.69 ? 189 THR G O     1 
ATOM 9959  C CB    . THR G 1 192 ? 9.687   -86.328  -35.421  1.00 112.88 ? 189 THR G CB    1 
ATOM 9960  O OG1   . THR G 1 192 ? 9.140   -85.004  -35.360  1.00 119.21 ? 189 THR G OG1   1 
ATOM 9961  C CG2   . THR G 1 192 ? 10.492  -86.613  -34.159  1.00 97.27  ? 189 THR G CG2   1 
ATOM 9962  N N     . LYS G 1 193 ? 9.356   -85.199  -38.378  1.00 94.96  ? 190 LYS G N     1 
ATOM 9963  C CA    . LYS G 1 193 ? 8.613   -85.024  -39.621  1.00 107.28 ? 190 LYS G CA    1 
ATOM 9964  C C     . LYS G 1 193 ? 9.525   -84.773  -40.818  1.00 101.23 ? 190 LYS G C     1 
ATOM 9965  O O     . LYS G 1 193 ? 9.106   -84.133  -41.793  1.00 86.95  ? 190 LYS G O     1 
ATOM 9966  C CB    . LYS G 1 193 ? 7.591   -83.896  -39.472  1.00 102.98 ? 190 LYS G CB    1 
ATOM 9967  C CG    . LYS G 1 193 ? 6.529   -84.156  -38.418  1.00 97.95  ? 190 LYS G CG    1 
ATOM 9968  C CD    . LYS G 1 193 ? 5.455   -83.082  -38.453  1.00 111.68 ? 190 LYS G CD    1 
ATOM 9969  C CE    . LYS G 1 193 ? 4.320   -83.389  -37.487  1.00 117.87 ? 190 LYS G CE    1 
ATOM 9970  N NZ    . LYS G 1 193 ? 3.353   -82.256  -37.397  1.00 104.73 ? 190 LYS G NZ    1 
ATOM 9971  N N     . ALA G 1 194 ? 10.763  -85.258  -40.765  1.00 94.69  ? 191 ALA G N     1 
ATOM 9972  C CA    . ALA G 1 194 ? 11.693  -85.100  -41.873  1.00 97.78  ? 191 ALA G CA    1 
ATOM 9973  C C     . ALA G 1 194 ? 11.305  -85.997  -43.044  1.00 97.89  ? 191 ALA G C     1 
ATOM 9974  O O     . ALA G 1 194 ? 10.764  -87.092  -42.867  1.00 94.36  ? 191 ALA G O     1 
ATOM 9975  C CB    . ALA G 1 194 ? 13.118  -85.418  -41.423  1.00 85.07  ? 191 ALA G CB    1 
ATOM 9976  N N     . LYS G 1 195 ? 11.610  -85.526  -44.251  1.00 93.00  ? 192 LYS G N     1 
ATOM 9977  C CA    . LYS G 1 195 ? 11.322  -86.297  -45.452  1.00 95.96  ? 192 LYS G CA    1 
ATOM 9978  C C     . LYS G 1 195 ? 12.179  -87.555  -45.477  1.00 94.87  ? 192 LYS G C     1 
ATOM 9979  O O     . LYS G 1 195 ? 13.402  -87.492  -45.317  1.00 92.92  ? 192 LYS G O     1 
ATOM 9980  C CB    . LYS G 1 195 ? 11.576  -85.457  -46.701  1.00 96.13  ? 192 LYS G CB    1 
ATOM 9981  C CG    . LYS G 1 195 ? 11.329  -86.198  -48.005  1.00 96.16  ? 192 LYS G CG    1 
ATOM 9982  C CD    . LYS G 1 195 ? 11.656  -85.326  -49.202  1.00 88.17  ? 192 LYS G CD    1 
ATOM 9983  C CE    . LYS G 1 195 ? 11.347  -86.045  -50.500  1.00 88.04  ? 192 LYS G CE    1 
ATOM 9984  N NZ    . LYS G 1 195 ? 9.919   -86.454  -50.577  1.00 89.65  ? 192 LYS G NZ    1 
ATOM 9985  N N     . ARG G 1 196 ? 11.527  -88.704  -45.652  1.00 91.73  ? 193 ARG G N     1 
ATOM 9986  C CA    . ARG G 1 196 ? 12.197  -89.990  -45.564  1.00 100.86 ? 193 ARG G CA    1 
ATOM 9987  C C     . ARG G 1 196 ? 12.098  -90.836  -46.824  1.00 105.26 ? 193 ARG G C     1 
ATOM 9988  O O     . ARG G 1 196 ? 12.861  -91.799  -46.954  1.00 109.62 ? 193 ARG G O     1 
ATOM 9989  C CB    . ARG G 1 196 ? 11.647  -90.793  -44.376  1.00 103.67 ? 193 ARG G CB    1 
ATOM 9990  C CG    . ARG G 1 196 ? 12.026  -90.191  -43.036  1.00 104.37 ? 193 ARG G CG    1 
ATOM 9991  C CD    . ARG G 1 196 ? 11.812  -91.167  -41.895  1.00 111.08 ? 193 ARG G CD    1 
ATOM 9992  N NE    . ARG G 1 196 ? 12.678  -90.867  -40.758  1.00 108.27 ? 193 ARG G NE    1 
ATOM 9993  C CZ    . ARG G 1 196 ? 12.415  -89.927  -39.857  1.00 108.51 ? 193 ARG G CZ    1 
ATOM 9994  N NH1   . ARG G 1 196 ? 11.313  -89.197  -39.970  1.00 103.00 ? 193 ARG G NH1   1 
ATOM 9995  N NH2   . ARG G 1 196 ? 13.248  -89.712  -38.847  1.00 105.25 ? 193 ARG G NH2   1 
ATOM 9996  N N     . GLN G 1 197 ? 11.187  -90.523  -47.741  1.00 107.06 ? 194 GLN G N     1 
ATOM 9997  C CA    . GLN G 1 197 ? 11.109  -91.229  -49.010  1.00 107.16 ? 194 GLN G CA    1 
ATOM 9998  C C     . GLN G 1 197 ? 10.865  -90.230  -50.132  1.00 103.26 ? 194 GLN G C     1 
ATOM 9999  O O     . GLN G 1 197 ? 10.428  -89.099  -49.904  1.00 93.09  ? 194 GLN G O     1 
ATOM 10000 C CB    . GLN G 1 197 ? 10.024  -92.318  -48.981  1.00 100.21 ? 194 GLN G CB    1 
ATOM 10001 C CG    . GLN G 1 197 ? 8.830   -92.009  -48.084  1.00 103.85 ? 194 GLN G CG    1 
ATOM 10002 C CD    . GLN G 1 197 ? 7.710   -91.288  -48.809  1.00 101.91 ? 194 GLN G CD    1 
ATOM 10003 O OE1   . GLN G 1 197 ? 7.097   -91.837  -49.726  1.00 108.41 ? 194 GLN G OE1   1 
ATOM 10004 N NE2   . GLN G 1 197 ? 7.434   -90.056  -48.400  1.00 95.65  ? 194 GLN G NE2   1 
ATOM 10005 N N     . ASP G 1 198 ? 11.174  -90.669  -51.356  1.00 101.62 ? 195 ASP G N     1 
ATOM 10006 C CA    . ASP G 1 198 ? 11.190  -89.763  -52.500  1.00 99.41  ? 195 ASP G CA    1 
ATOM 10007 C C     . ASP G 1 198 ? 9.792   -89.247  -52.827  1.00 94.73  ? 195 ASP G C     1 
ATOM 10008 O O     . ASP G 1 198 ? 9.603   -88.048  -53.060  1.00 93.36  ? 195 ASP G O     1 
ATOM 10009 C CB    . ASP G 1 198 ? 11.799  -90.468  -53.718  1.00 96.54  ? 195 ASP G CB    1 
ATOM 10010 C CG    . ASP G 1 198 ? 13.282  -90.775  -53.548  1.00 105.68 ? 195 ASP G CG    1 
ATOM 10011 O OD1   . ASP G 1 198 ? 13.965  -90.055  -52.789  1.00 101.46 ? 195 ASP G OD1   1 
ATOM 10012 O OD2   . ASP G 1 198 ? 13.768  -91.731  -54.191  1.00 109.27 ? 195 ASP G OD2   1 
ATOM 10013 N N     . LEU G 1 199 ? 8.807   -90.146  -52.876  1.00 88.66  ? 196 LEU G N     1 
ATOM 10014 C CA    . LEU G 1 199 ? 7.477   -89.802  -53.367  1.00 82.90  ? 196 LEU G CA    1 
ATOM 10015 C C     . LEU G 1 199 ? 6.852   -88.663  -52.564  1.00 91.80  ? 196 LEU G C     1 
ATOM 10016 O O     . LEU G 1 199 ? 6.958   -88.608  -51.336  1.00 96.57  ? 196 LEU G O     1 
ATOM 10017 C CB    . LEU G 1 199 ? 6.568   -91.033  -53.328  1.00 92.35  ? 196 LEU G CB    1 
ATOM 10018 C CG    . LEU G 1 199 ? 5.155   -90.878  -53.897  1.00 101.84 ? 196 LEU G CG    1 
ATOM 10019 C CD1   . LEU G 1 199 ? 5.217   -90.398  -55.339  1.00 93.93  ? 196 LEU G CD1   1 
ATOM 10020 C CD2   . LEU G 1 199 ? 4.379   -92.182  -53.799  1.00 96.57  ? 196 LEU G CD2   1 
ATOM 10021 N N     . GLU G 1 200 ? 6.183   -87.755  -53.276  1.00 93.19  ? 197 GLU G N     1 
ATOM 10022 C CA    . GLU G 1 200 ? 5.451   -86.640  -52.675  1.00 93.29  ? 197 GLU G CA    1 
ATOM 10023 C C     . GLU G 1 200 ? 4.021   -86.711  -53.191  1.00 98.58  ? 197 GLU G C     1 
ATOM 10024 O O     . GLU G 1 200 ? 3.689   -86.112  -54.224  1.00 95.64  ? 197 GLU G O     1 
ATOM 10025 C CB    . GLU G 1 200 ? 6.101   -85.297  -53.000  1.00 89.47  ? 197 GLU G CB    1 
ATOM 10026 C CG    . GLU G 1 200 ? 7.394   -85.033  -52.241  1.00 90.70  ? 197 GLU G CG    1 
ATOM 10027 C CD    . GLU G 1 200 ? 7.161   -84.735  -50.768  1.00 94.23  ? 197 GLU G CD    1 
ATOM 10028 O OE1   . GLU G 1 200 ? 6.055   -84.270  -50.417  1.00 98.32  ? 197 GLU G OE1   1 
ATOM 10029 O OE2   . GLU G 1 200 ? 8.087   -84.965  -49.960  1.00 90.53  ? 197 GLU G OE2   1 
ATOM 10030 N N     . PRO G 1 201 ? 3.143   -87.443  -52.494  1.00 106.50 ? 198 PRO G N     1 
ATOM 10031 C CA    . PRO G 1 201 ? 1.812   -87.728  -53.062  1.00 102.12 ? 198 PRO G CA    1 
ATOM 10032 C C     . PRO G 1 201 ? 0.947   -86.496  -53.266  1.00 94.38  ? 198 PRO G C     1 
ATOM 10033 O O     . PRO G 1 201 ? 0.285   -86.383  -54.305  1.00 92.49  ? 198 PRO G O     1 
ATOM 10034 C CB    . PRO G 1 201 ? 1.195   -88.697  -52.040  1.00 104.55 ? 198 PRO G CB    1 
ATOM 10035 C CG    . PRO G 1 201 ? 2.352   -89.212  -51.232  1.00 107.62 ? 198 PRO G CG    1 
ATOM 10036 C CD    . PRO G 1 201 ? 3.348   -88.101  -51.195  1.00 104.16 ? 198 PRO G CD    1 
ATOM 10037 N N     . SER G 1 202 ? 0.918   -85.570  -52.303  1.00 90.23  ? 199 SER G N     1 
ATOM 10038 C CA    . SER G 1 202 ? 0.134   -84.351  -52.484  1.00 88.98  ? 199 SER G CA    1 
ATOM 10039 C C     . SER G 1 202 ? 0.627   -83.560  -53.689  1.00 92.43  ? 199 SER G C     1 
ATOM 10040 O O     . SER G 1 202 ? -0.175  -83.038  -54.475  1.00 95.44  ? 199 SER G O     1 
ATOM 10041 C CB    . SER G 1 202 ? 0.190   -83.497  -51.217  1.00 92.20  ? 199 SER G CB    1 
ATOM 10042 O OG    . SER G 1 202 ? -0.476  -82.261  -51.406  1.00 94.87  ? 199 SER G OG    1 
ATOM 10043 N N     . VAL G 1 203 ? 1.948   -83.482  -53.858  1.00 97.73  ? 200 VAL G N     1 
ATOM 10044 C CA    . VAL G 1 203 ? 2.522   -82.773  -54.996  1.00 92.06  ? 200 VAL G CA    1 
ATOM 10045 C C     . VAL G 1 203 ? 2.161   -83.479  -56.299  1.00 87.47  ? 200 VAL G C     1 
ATOM 10046 O O     . VAL G 1 203 ? 1.782   -82.838  -57.286  1.00 83.08  ? 200 VAL G O     1 
ATOM 10047 C CB    . VAL G 1 203 ? 4.044   -82.635  -54.824  1.00 82.30  ? 200 VAL G CB    1 
ATOM 10048 C CG1   . VAL G 1 203 ? 4.646   -81.935  -56.016  1.00 79.28  ? 200 VAL G CG1   1 
ATOM 10049 C CG2   . VAL G 1 203 ? 4.367   -81.874  -53.542  1.00 80.96  ? 200 VAL G CG2   1 
ATOM 10050 N N     . GLU G 1 204 ? 2.306   -84.806  -56.332  1.00 86.88  ? 201 GLU G N     1 
ATOM 10051 C CA    . GLU G 1 204 ? 1.953   -85.568  -57.528  1.00 80.59  ? 201 GLU G CA    1 
ATOM 10052 C C     . GLU G 1 204 ? 0.492   -85.362  -57.914  1.00 86.00  ? 201 GLU G C     1 
ATOM 10053 O O     . GLU G 1 204 ? 0.171   -85.209  -59.101  1.00 89.78  ? 201 GLU G O     1 
ATOM 10054 C CB    . GLU G 1 204 ? 2.239   -87.052  -57.295  1.00 82.79  ? 201 GLU G CB    1 
ATOM 10055 C CG    . GLU G 1 204 ? 1.749   -87.976  -58.397  1.00 83.87  ? 201 GLU G CG    1 
ATOM 10056 C CD    . GLU G 1 204 ? 2.434   -87.716  -59.722  1.00 97.43  ? 201 GLU G CD    1 
ATOM 10057 O OE1   . GLU G 1 204 ? 3.651   -87.432  -59.715  1.00 95.03  ? 201 GLU G OE1   1 
ATOM 10058 O OE2   . GLU G 1 204 ? 1.758   -87.805  -60.769  1.00 101.81 ? 201 GLU G OE2   1 
ATOM 10059 N N     . GLU G 1 205 ? -0.404  -85.323  -56.923  1.00 93.30  ? 202 GLU G N     1 
ATOM 10060 C CA    . GLU G 1 205 ? -1.821  -85.124  -57.214  1.00 96.21  ? 202 GLU G CA    1 
ATOM 10061 C C     . GLU G 1 205 ? -2.076  -83.718  -57.738  1.00 89.14  ? 202 GLU G C     1 
ATOM 10062 O O     . GLU G 1 205 ? -2.758  -83.537  -58.754  1.00 94.74  ? 202 GLU G O     1 
ATOM 10063 C CB    . GLU G 1 205 ? -2.671  -85.394  -55.969  1.00 103.51 ? 202 GLU G CB    1 
ATOM 10064 C CG    . GLU G 1 205 ? -4.169  -85.169  -56.191  1.00 103.84 ? 202 GLU G CG    1 
ATOM 10065 C CD    . GLU G 1 205 ? -4.994  -85.390  -54.938  1.00 91.21  ? 202 GLU G CD    1 
ATOM 10066 O OE1   . GLU G 1 205 ? -4.619  -84.851  -53.875  1.00 105.27 ? 202 GLU G OE1   1 
ATOM 10067 O OE2   . GLU G 1 205 ? -6.027  -86.089  -55.017  1.00 99.38  ? 202 GLU G OE2   1 
ATOM 10068 N N     . ALA G 1 206 ? -1.557  -82.706  -57.037  1.00 85.19  ? 203 ALA G N     1 
ATOM 10069 C CA    . ALA G 1 206 ? -1.733  -81.329  -57.484  1.00 89.83  ? 203 ALA G CA    1 
ATOM 10070 C C     . ALA G 1 206 ? -1.173  -81.105  -58.884  1.00 95.13  ? 203 ALA G C     1 
ATOM 10071 O O     . ALA G 1 206 ? -1.730  -80.312  -59.652  1.00 99.70  ? 203 ALA G O     1 
ATOM 10072 C CB    . ALA G 1 206 ? -1.081  -80.372  -56.487  1.00 75.22  ? 203 ALA G CB    1 
ATOM 10073 N N     . ARG G 1 207 ? -0.084  -81.790  -59.240  1.00 91.35  ? 204 ARG G N     1 
ATOM 10074 C CA    . ARG G 1 207 ? 0.477   -81.610  -60.575  1.00 91.32  ? 204 ARG G CA    1 
ATOM 10075 C C     . ARG G 1 207 ? -0.338  -82.357  -61.627  1.00 95.11  ? 204 ARG G C     1 
ATOM 10076 O O     . ARG G 1 207 ? -0.503  -81.864  -62.748  1.00 99.58  ? 204 ARG G O     1 
ATOM 10077 C CB    . ARG G 1 207 ? 1.944   -82.043  -60.614  1.00 91.39  ? 204 ARG G CB    1 
ATOM 10078 C CG    . ARG G 1 207 ? 2.601   -81.792  -61.969  1.00 90.81  ? 204 ARG G CG    1 
ATOM 10079 C CD    . ARG G 1 207 ? 4.040   -82.268  -62.010  1.00 85.25  ? 204 ARG G CD    1 
ATOM 10080 N NE    . ARG G 1 207 ? 4.783   -81.958  -60.791  1.00 81.85  ? 204 ARG G NE    1 
ATOM 10081 C CZ    . ARG G 1 207 ? 5.305   -82.879  -59.986  1.00 82.47  ? 204 ARG G CZ    1 
ATOM 10082 N NH1   . ARG G 1 207 ? 5.160   -84.167  -60.267  1.00 80.58  ? 204 ARG G NH1   1 
ATOM 10083 N NH2   . ARG G 1 207 ? 5.973   -82.514  -58.901  1.00 79.39  ? 204 ARG G NH2   1 
ATOM 10084 N N     . TYR G 1 208 ? -0.836  -83.555  -61.295  1.00 93.35  ? 205 TYR G N     1 
ATOM 10085 C CA    . TYR G 1 208 ? -1.699  -84.273  -62.232  1.00 95.21  ? 205 TYR G CA    1 
ATOM 10086 C C     . TYR G 1 208 ? -2.906  -83.430  -62.626  1.00 99.38  ? 205 TYR G C     1 
ATOM 10087 O O     . TYR G 1 208 ? -3.332  -83.447  -63.786  1.00 98.56  ? 205 TYR G O     1 
ATOM 10088 C CB    . TYR G 1 208 ? -2.152  -85.604  -61.629  1.00 91.58  ? 205 TYR G CB    1 
ATOM 10089 C CG    . TYR G 1 208 ? -3.049  -86.412  -62.547  1.00 93.70  ? 205 TYR G CG    1 
ATOM 10090 C CD1   . TYR G 1 208 ? -4.433  -86.316  -62.459  1.00 96.00  ? 205 TYR G CD1   1 
ATOM 10091 C CD2   . TYR G 1 208 ? -2.512  -87.263  -63.504  1.00 89.93  ? 205 TYR G CD2   1 
ATOM 10092 C CE1   . TYR G 1 208 ? -5.258  -87.048  -63.299  1.00 93.10  ? 205 TYR G CE1   1 
ATOM 10093 C CE2   . TYR G 1 208 ? -3.329  -87.998  -64.347  1.00 95.30  ? 205 TYR G CE2   1 
ATOM 10094 C CZ    . TYR G 1 208 ? -4.699  -87.888  -64.239  1.00 93.28  ? 205 TYR G CZ    1 
ATOM 10095 O OH    . TYR G 1 208 ? -5.511  -88.619  -65.076  1.00 86.76  ? 205 TYR G OH    1 
ATOM 10096 N N     . ASN G 1 209 ? -3.478  -82.694  -61.671  1.00 97.27  ? 206 ASN G N     1 
ATOM 10097 C CA    . ASN G 1 209 ? -4.583  -81.793  -61.976  1.00 101.09 ? 206 ASN G CA    1 
ATOM 10098 C C     . ASN G 1 209 ? -4.128  -80.525  -62.686  1.00 101.90 ? 206 ASN G C     1 
ATOM 10099 O O     . ASN G 1 209 ? -4.980  -79.742  -63.120  1.00 105.72 ? 206 ASN G O     1 
ATOM 10100 C CB    . ASN G 1 209 ? -5.332  -81.428  -60.691  1.00 111.29 ? 206 ASN G CB    1 
ATOM 10101 C CG    . ASN G 1 209 ? -5.778  -82.650  -59.906  1.00 102.86 ? 206 ASN G CG    1 
ATOM 10102 O OD1   . ASN G 1 209 ? -5.560  -82.739  -58.696  1.00 96.04  ? 206 ASN G OD1   1 
ATOM 10103 N ND2   . ASN G 1 209 ? -6.397  -83.604  -60.594  1.00 103.37 ? 206 ASN G ND2   1 
ATOM 10104 N N     . SER G 1 210 ? -2.820  -80.300  -62.806  1.00 103.56 ? 207 SER G N     1 
ATOM 10105 C CA    . SER G 1 210 ? -2.278  -79.114  -63.456  1.00 103.68 ? 207 SER G CA    1 
ATOM 10106 C C     . SER G 1 210 ? -2.111  -79.269  -64.964  1.00 103.28 ? 207 SER G C     1 
ATOM 10107 O O     . SER G 1 210 ? -1.812  -78.278  -65.640  1.00 105.51 ? 207 SER G O     1 
ATOM 10108 C CB    . SER G 1 210 ? -0.926  -78.746  -62.828  1.00 100.55 ? 207 SER G CB    1 
ATOM 10109 O OG    . SER G 1 210 ? -0.457  -77.492  -63.297  1.00 101.98 ? 207 SER G OG    1 
ATOM 10110 N N     . CYS G 1 211 ? -2.293  -80.470  -65.508  1.00 100.03 ? 208 CYS G N     1 
ATOM 10111 C CA    . CYS G 1 211 ? -2.037  -80.713  -66.927  1.00 108.30 ? 208 CYS G CA    1 
ATOM 10112 C C     . CYS G 1 211 ? -3.297  -80.504  -67.762  1.00 114.87 ? 208 CYS G C     1 
ATOM 10113 O O     . CYS G 1 211 ? -4.261  -79.890  -67.309  1.00 103.81 ? 208 CYS G O     1 
ATOM 10114 C CB    . CYS G 1 211 ? -1.506  -82.132  -67.146  1.00 105.42 ? 208 CYS G CB    1 
ATOM 10115 S SG    . CYS G 1 211 ? -0.068  -82.583  -66.145  1.00 108.89 ? 208 CYS G SG    1 
ATOM 10116 N N     . CYS H 1 28  ? 4.612   -74.897  -73.188  1.00 78.09  ? 25  CYS H N     1 
ATOM 10117 C CA    . CYS H 1 28  ? 5.752   -75.808  -73.138  1.00 86.03  ? 25  CYS H CA    1 
ATOM 10118 C C     . CYS H 1 28  ? 6.599   -75.568  -71.888  1.00 88.78  ? 25  CYS H C     1 
ATOM 10119 O O     . CYS H 1 28  ? 6.100   -75.067  -70.881  1.00 93.24  ? 25  CYS H O     1 
ATOM 10120 C CB    . CYS H 1 28  ? 6.610   -75.651  -74.394  1.00 82.91  ? 25  CYS H CB    1 
ATOM 10121 S SG    . CYS H 1 28  ? 7.347   -74.012  -74.591  1.00 84.24  ? 25  CYS H SG    1 
ATOM 10122 N N     . PHE H 1 29  ? 7.879   -75.930  -71.952  1.00 77.96  ? 26  PHE H N     1 
ATOM 10123 C CA    . PHE H 1 29  ? 8.773   -75.727  -70.821  1.00 65.91  ? 26  PHE H CA    1 
ATOM 10124 C C     . PHE H 1 29  ? 9.232   -74.277  -70.764  1.00 60.69  ? 26  PHE H C     1 
ATOM 10125 O O     . PHE H 1 29  ? 9.490   -73.649  -71.794  1.00 72.73  ? 26  PHE H O     1 
ATOM 10126 C CB    . PHE H 1 29  ? 9.988   -76.653  -70.904  1.00 63.29  ? 26  PHE H CB    1 
ATOM 10127 C CG    . PHE H 1 29  ? 10.743  -76.778  -69.606  1.00 65.70  ? 26  PHE H CG    1 
ATOM 10128 C CD1   . PHE H 1 29  ? 11.779  -75.908  -69.297  1.00 65.46  ? 26  PHE H CD1   1 
ATOM 10129 C CD2   . PHE H 1 29  ? 10.408  -77.761  -68.690  1.00 72.09  ? 26  PHE H CD2   1 
ATOM 10130 C CE1   . PHE H 1 29  ? 12.467  -76.024  -68.101  1.00 66.55  ? 26  PHE H CE1   1 
ATOM 10131 C CE2   . PHE H 1 29  ? 11.092  -77.881  -67.494  1.00 68.24  ? 26  PHE H CE2   1 
ATOM 10132 C CZ    . PHE H 1 29  ? 12.122  -77.011  -67.199  1.00 63.77  ? 26  PHE H CZ    1 
ATOM 10133 N N     . GLY H 1 30  ? 9.324   -73.747  -69.547  1.00 54.98  ? 27  GLY H N     1 
ATOM 10134 C CA    . GLY H 1 30  ? 9.629   -72.352  -69.335  1.00 52.50  ? 27  GLY H CA    1 
ATOM 10135 C C     . GLY H 1 30  ? 8.459   -71.408  -69.488  1.00 64.11  ? 27  GLY H C     1 
ATOM 10136 O O     . GLY H 1 30  ? 8.594   -70.226  -69.146  1.00 64.26  ? 27  GLY H O     1 
ATOM 10137 N N     . GLN H 1 31  ? 7.319   -71.878  -69.996  1.00 65.56  ? 28  GLN H N     1 
ATOM 10138 C CA    . GLN H 1 31  ? 6.130   -71.048  -70.139  1.00 71.95  ? 28  GLN H CA    1 
ATOM 10139 C C     . GLN H 1 31  ? 4.999   -71.422  -69.192  1.00 70.75  ? 28  GLN H C     1 
ATOM 10140 O O     . GLN H 1 31  ? 4.251   -70.536  -68.774  1.00 77.80  ? 28  GLN H O     1 
ATOM 10141 C CB    . GLN H 1 31  ? 5.607   -71.094  -71.582  1.00 75.88  ? 28  GLN H CB    1 
ATOM 10142 C CG    . GLN H 1 31  ? 6.690   -70.987  -72.647  1.00 85.71  ? 28  GLN H CG    1 
ATOM 10143 C CD    . GLN H 1 31  ? 6.282   -70.083  -73.799  1.00 98.77  ? 28  GLN H CD    1 
ATOM 10144 O OE1   . GLN H 1 31  ? 5.400   -69.235  -73.657  1.00 108.39 ? 28  GLN H OE1   1 
ATOM 10145 N NE2   . GLN H 1 31  ? 6.908   -70.278  -74.952  1.00 90.36  ? 28  GLN H NE2   1 
ATOM 10146 N N     . CYS H 1 32  ? 4.854   -72.704  -68.851  1.00 61.09  ? 29  CYS H N     1 
ATOM 10147 C CA    . CYS H 1 32  ? 3.786   -73.131  -67.952  1.00 68.99  ? 29  CYS H CA    1 
ATOM 10148 C C     . CYS H 1 32  ? 3.932   -72.424  -66.612  1.00 74.44  ? 29  CYS H C     1 
ATOM 10149 O O     . CYS H 1 32  ? 5.025   -72.373  -66.047  1.00 74.18  ? 29  CYS H O     1 
ATOM 10150 C CB    . CYS H 1 32  ? 3.834   -74.648  -67.747  1.00 65.30  ? 29  CYS H CB    1 
ATOM 10151 S SG    . CYS H 1 32  ? 3.528   -75.670  -69.209  1.00 112.28 ? 29  CYS H SG    1 
ATOM 10152 N N     . GLN H 1 33  ? 2.830   -71.897  -66.087  1.00 74.99  ? 30  GLN H N     1 
ATOM 10153 C CA    . GLN H 1 33  ? 2.833   -71.276  -64.770  1.00 82.76  ? 30  GLN H CA    1 
ATOM 10154 C C     . GLN H 1 33  ? 2.254   -72.239  -63.743  1.00 89.07  ? 30  GLN H C     1 
ATOM 10155 O O     . GLN H 1 33  ? 1.239   -72.895  -63.995  1.00 89.97  ? 30  GLN H O     1 
ATOM 10156 C CB    . GLN H 1 33  ? 2.038   -69.966  -64.770  1.00 82.40  ? 30  GLN H CB    1 
ATOM 10157 C CG    . GLN H 1 33  ? 2.857   -68.736  -65.160  1.00 101.96 ? 30  GLN H CG    1 
ATOM 10158 C CD    . GLN H 1 33  ? 2.044   -67.452  -65.117  1.00 114.34 ? 30  GLN H CD    1 
ATOM 10159 O OE1   . GLN H 1 33  ? 1.430   -67.125  -64.099  1.00 106.99 ? 30  GLN H OE1   1 
ATOM 10160 N NE2   . GLN H 1 33  ? 2.040   -66.714  -66.225  1.00 109.75 ? 30  GLN H NE2   1 
ATOM 10161 N N     . TYR H 1 34  ? 2.902   -72.316  -62.582  1.00 86.21  ? 31  TYR H N     1 
ATOM 10162 C CA    . TYR H 1 34  ? 2.473   -73.260  -61.559  1.00 82.60  ? 31  TYR H CA    1 
ATOM 10163 C C     . TYR H 1 34  ? 1.075   -72.909  -61.071  1.00 88.60  ? 31  TYR H C     1 
ATOM 10164 O O     . TYR H 1 34  ? 0.777   -71.750  -60.767  1.00 97.98  ? 31  TYR H O     1 
ATOM 10165 C CB    . TYR H 1 34  ? 3.467   -73.274  -60.393  1.00 66.08  ? 31  TYR H CB    1 
ATOM 10166 C CG    . TYR H 1 34  ? 4.619   -74.238  -60.589  1.00 63.81  ? 31  TYR H CG    1 
ATOM 10167 C CD1   . TYR H 1 34  ? 4.407   -75.611  -60.578  1.00 68.30  ? 31  TYR H CD1   1 
ATOM 10168 C CD2   . TYR H 1 34  ? 5.915   -73.779  -60.793  1.00 62.22  ? 31  TYR H CD2   1 
ATOM 10169 C CE1   . TYR H 1 34  ? 5.449   -76.499  -60.760  1.00 69.35  ? 31  TYR H CE1   1 
ATOM 10170 C CE2   . TYR H 1 34  ? 6.967   -74.664  -60.976  1.00 66.46  ? 31  TYR H CE2   1 
ATOM 10171 C CZ    . TYR H 1 34  ? 6.726   -76.023  -60.959  1.00 68.40  ? 31  TYR H CZ    1 
ATOM 10172 O OH    . TYR H 1 34  ? 7.759   -76.914  -61.141  1.00 70.66  ? 31  TYR H OH    1 
ATOM 10173 N N     . THR H 1 35  ? 0.214   -73.921  -61.012  1.00 90.10  ? 32  THR H N     1 
ATOM 10174 C CA    . THR H 1 35  ? -1.122  -73.753  -60.467  1.00 92.16  ? 32  THR H CA    1 
ATOM 10175 C C     . THR H 1 35  ? -1.062  -73.627  -58.948  1.00 86.97  ? 32  THR H C     1 
ATOM 10176 O O     . THR H 1 35  ? -0.094  -74.036  -58.302  1.00 86.09  ? 32  THR H O     1 
ATOM 10177 C CB    . THR H 1 35  ? -2.017  -74.930  -60.861  1.00 90.92  ? 32  THR H CB    1 
ATOM 10178 O OG1   . THR H 1 35  ? -1.374  -76.164  -60.516  1.00 94.82  ? 32  THR H OG1   1 
ATOM 10179 C CG2   . THR H 1 35  ? -2.292  -74.911  -62.357  1.00 91.01  ? 32  THR H CG2   1 
ATOM 10180 N N     . ALA H 1 36  ? -2.112  -73.024  -58.382  1.00 81.36  ? 33  ALA H N     1 
ATOM 10181 C CA    . ALA H 1 36  ? -2.145  -72.774  -56.944  1.00 85.99  ? 33  ALA H CA    1 
ATOM 10182 C C     . ALA H 1 36  ? -1.937  -74.055  -56.148  1.00 86.32  ? 33  ALA H C     1 
ATOM 10183 O O     . ALA H 1 36  ? -1.153  -74.083  -55.189  1.00 81.26  ? 33  ALA H O     1 
ATOM 10184 C CB    . ALA H 1 36  ? -3.471  -72.120  -56.557  1.00 82.59  ? 33  ALA H CB    1 
ATOM 10185 N N     . GLU H 1 37  ? -2.603  -75.137  -56.555  1.00 85.81  ? 34  GLU H N     1 
ATOM 10186 C CA    . GLU H 1 37  ? -2.489  -76.394  -55.827  1.00 92.69  ? 34  GLU H CA    1 
ATOM 10187 C C     . GLU H 1 37  ? -1.058  -76.903  -55.867  1.00 91.20  ? 34  GLU H C     1 
ATOM 10188 O O     . GLU H 1 37  ? -0.465  -77.216  -54.827  1.00 81.56  ? 34  GLU H O     1 
ATOM 10189 C CB    . GLU H 1 37  ? -3.430  -77.436  -56.436  1.00 98.11  ? 34  GLU H CB    1 
ATOM 10190 C CG    . GLU H 1 37  ? -4.819  -76.926  -56.790  1.00 99.78  ? 34  GLU H CG    1 
ATOM 10191 C CD    . GLU H 1 37  ? -4.919  -76.518  -58.252  1.00 118.32 ? 34  GLU H CD    1 
ATOM 10192 O OE1   . GLU H 1 37  ? -4.372  -77.244  -59.113  1.00 116.22 ? 34  GLU H OE1   1 
ATOM 10193 O OE2   . GLU H 1 37  ? -5.547  -75.476  -58.542  1.00 116.43 ? 34  GLU H OE2   1 
ATOM 10194 N N     . GLU H 1 38  ? -0.470  -76.939  -57.066  1.00 90.91  ? 35  GLU H N     1 
ATOM 10195 C CA    . GLU H 1 38  ? 0.887   -77.447  -57.219  1.00 82.31  ? 35  GLU H CA    1 
ATOM 10196 C C     . GLU H 1 38  ? 1.902   -76.508  -56.586  1.00 73.80  ? 35  GLU H C     1 
ATOM 10197 O O     . GLU H 1 38  ? 2.862   -76.966  -55.956  1.00 68.02  ? 35  GLU H O     1 
ATOM 10198 C CB    . GLU H 1 38  ? 1.205   -77.672  -58.696  1.00 87.37  ? 35  GLU H CB    1 
ATOM 10199 C CG    . GLU H 1 38  ? 2.569   -78.291  -58.936  1.00 82.35  ? 35  GLU H CG    1 
ATOM 10200 C CD    . GLU H 1 38  ? 2.843   -78.570  -60.402  1.00 89.93  ? 35  GLU H CD    1 
ATOM 10201 O OE1   . GLU H 1 38  ? 3.860   -79.235  -60.695  1.00 88.40  ? 35  GLU H OE1   1 
ATOM 10202 O OE2   . GLU H 1 38  ? 2.054   -78.110  -61.257  1.00 93.23  ? 35  GLU H OE2   1 
ATOM 10203 N N     . TYR H 1 39  ? 1.709   -75.194  -56.735  1.00 71.85  ? 36  TYR H N     1 
ATOM 10204 C CA    . TYR H 1 39  ? 2.614   -74.256  -56.078  1.00 69.68  ? 36  TYR H CA    1 
ATOM 10205 C C     . TYR H 1 39  ? 2.652   -74.486  -54.575  1.00 81.64  ? 36  TYR H C     1 
ATOM 10206 O O     . TYR H 1 39  ? 3.731   -74.602  -53.986  1.00 81.36  ? 36  TYR H O     1 
ATOM 10207 C CB    . TYR H 1 39  ? 2.216   -72.804  -56.352  1.00 81.92  ? 36  TYR H CB    1 
ATOM 10208 C CG    . TYR H 1 39  ? 2.754   -71.893  -55.265  1.00 73.09  ? 36  TYR H CG    1 
ATOM 10209 C CD1   . TYR H 1 39  ? 4.110   -71.609  -55.183  1.00 77.01  ? 36  TYR H CD1   1 
ATOM 10210 C CD2   . TYR H 1 39  ? 1.914   -71.357  -54.295  1.00 76.38  ? 36  TYR H CD2   1 
ATOM 10211 C CE1   . TYR H 1 39  ? 4.614   -70.807  -54.180  1.00 77.60  ? 36  TYR H CE1   1 
ATOM 10212 C CE2   . TYR H 1 39  ? 2.411   -70.551  -53.288  1.00 81.97  ? 36  TYR H CE2   1 
ATOM 10213 C CZ    . TYR H 1 39  ? 3.762   -70.279  -53.238  1.00 72.99  ? 36  TYR H CZ    1 
ATOM 10214 O OH    . TYR H 1 39  ? 4.266   -69.480  -52.239  1.00 75.68  ? 36  TYR H OH    1 
ATOM 10215 N N     . GLN H 1 40  ? 1.483   -74.530  -53.931  1.00 87.14  ? 37  GLN H N     1 
ATOM 10216 C CA    . GLN H 1 40  ? 1.479   -74.637  -52.475  1.00 86.39  ? 37  GLN H CA    1 
ATOM 10217 C C     . GLN H 1 40  ? 1.994   -75.999  -52.026  1.00 80.35  ? 37  GLN H C     1 
ATOM 10218 O O     . GLN H 1 40  ? 2.748   -76.088  -51.048  1.00 76.87  ? 37  GLN H O     1 
ATOM 10219 C CB    . GLN H 1 40  ? 0.087   -74.343  -51.914  1.00 95.65  ? 37  GLN H CB    1 
ATOM 10220 C CG    . GLN H 1 40  ? 0.067   -74.214  -50.396  1.00 102.23 ? 37  GLN H CG    1 
ATOM 10221 C CD    . GLN H 1 40  ? -1.330  -74.047  -49.828  1.00 101.38 ? 37  GLN H CD    1 
ATOM 10222 O OE1   . GLN H 1 40  ? -2.323  -74.293  -50.511  1.00 95.11  ? 37  GLN H OE1   1 
ATOM 10223 N NE2   . GLN H 1 40  ? -1.411  -73.607  -48.575  1.00 95.37  ? 37  GLN H NE2   1 
ATOM 10224 N N     . ALA H 1 41  ? 1.587   -77.072  -52.716  1.00 75.09  ? 38  ALA H N     1 
ATOM 10225 C CA    . ALA H 1 41  ? 2.104   -78.402  -52.408  1.00 70.87  ? 38  ALA H CA    1 
ATOM 10226 C C     . ALA H 1 41  ? 3.629   -78.436  -52.477  1.00 77.30  ? 38  ALA H C     1 
ATOM 10227 O O     . ALA H 1 41  ? 4.292   -78.955  -51.570  1.00 76.05  ? 38  ALA H O     1 
ATOM 10228 C CB    . ALA H 1 41  ? 1.489   -79.431  -53.356  1.00 63.49  ? 38  ALA H CB    1 
ATOM 10229 N N     . ILE H 1 42  ? 4.208   -77.889  -53.552  1.00 86.49  ? 39  ILE H N     1 
ATOM 10230 C CA    . ILE H 1 42  ? 5.660   -77.935  -53.708  1.00 77.17  ? 39  ILE H CA    1 
ATOM 10231 C C     . ILE H 1 42  ? 6.337   -77.048  -52.667  1.00 81.05  ? 39  ILE H C     1 
ATOM 10232 O O     . ILE H 1 42  ? 7.375   -77.415  -52.101  1.00 80.92  ? 39  ILE H O     1 
ATOM 10233 C CB    . ILE H 1 42  ? 6.067   -77.543  -55.142  1.00 77.28  ? 39  ILE H CB    1 
ATOM 10234 C CG1   . ILE H 1 42  ? 5.712   -78.657  -56.126  1.00 74.29  ? 39  ILE H CG1   1 
ATOM 10235 C CG2   . ILE H 1 42  ? 7.556   -77.278  -55.223  1.00 66.74  ? 39  ILE H CG2   1 
ATOM 10236 C CD1   . ILE H 1 42  ? 5.926   -78.291  -57.582  1.00 72.97  ? 39  ILE H CD1   1 
ATOM 10237 N N     . GLN H 1 43  ? 5.783   -75.858  -52.420  1.00 79.81  ? 40  GLN H N     1 
ATOM 10238 C CA    . GLN H 1 43  ? 6.342   -74.971  -51.406  1.00 75.61  ? 40  GLN H CA    1 
ATOM 10239 C C     . GLN H 1 43  ? 6.373   -75.646  -50.041  1.00 83.94  ? 40  GLN H C     1 
ATOM 10240 O O     . GLN H 1 43  ? 7.361   -75.534  -49.308  1.00 88.06  ? 40  GLN H O     1 
ATOM 10241 C CB    . GLN H 1 43  ? 5.538   -73.673  -51.340  1.00 74.54  ? 40  GLN H CB    1 
ATOM 10242 C CG    . GLN H 1 43  ? 5.947   -72.749  -50.205  1.00 72.95  ? 40  GLN H CG    1 
ATOM 10243 C CD    . GLN H 1 43  ? 7.282   -72.078  -50.452  1.00 75.52  ? 40  GLN H CD    1 
ATOM 10244 O OE1   . GLN H 1 43  ? 7.347   -71.003  -51.047  1.00 79.95  ? 40  GLN H OE1   1 
ATOM 10245 N NE2   . GLN H 1 43  ? 8.359   -72.710  -49.994  1.00 71.84  ? 40  GLN H NE2   1 
ATOM 10246 N N     . LYS H 1 44  ? 5.299   -76.354  -49.684  1.00 89.60  ? 41  LYS H N     1 
ATOM 10247 C CA    . LYS H 1 44  ? 5.281   -77.077  -48.417  1.00 85.50  ? 41  LYS H CA    1 
ATOM 10248 C C     . LYS H 1 44  ? 6.306   -78.205  -48.420  1.00 76.86  ? 41  LYS H C     1 
ATOM 10249 O O     . LYS H 1 44  ? 7.084   -78.348  -47.470  1.00 86.65  ? 41  LYS H O     1 
ATOM 10250 C CB    . LYS H 1 44  ? 3.877   -77.618  -48.142  1.00 84.36  ? 41  LYS H CB    1 
ATOM 10251 C CG    . LYS H 1 44  ? 2.875   -76.545  -47.735  1.00 90.91  ? 41  LYS H CG    1 
ATOM 10252 C CD    . LYS H 1 44  ? 1.525   -77.146  -47.389  1.00 94.87  ? 41  LYS H CD    1 
ATOM 10253 C CE    . LYS H 1 44  ? 0.477   -76.071  -47.168  1.00 97.12  ? 41  LYS H CE    1 
ATOM 10254 N NZ    . LYS H 1 44  ? 0.699   -75.324  -45.900  1.00 96.44  ? 41  LYS H NZ    1 
ATOM 10255 N N     . ALA H 1 45  ? 6.331   -79.008  -49.489  1.00 67.66  ? 42  ALA H N     1 
ATOM 10256 C CA    . ALA H 1 45  ? 7.224   -80.162  -49.524  1.00 72.77  ? 42  ALA H CA    1 
ATOM 10257 C C     . ALA H 1 45  ? 8.692   -79.758  -49.463  1.00 77.43  ? 42  ALA H C     1 
ATOM 10258 O O     . ALA H 1 45  ? 9.500   -80.471  -48.860  1.00 81.65  ? 42  ALA H O     1 
ATOM 10259 C CB    . ALA H 1 45  ? 6.957   -80.997  -50.777  1.00 81.87  ? 42  ALA H CB    1 
ATOM 10260 N N     . LEU H 1 46  ? 9.055   -78.620  -50.061  1.00 80.87  ? 43  LEU H N     1 
ATOM 10261 C CA    . LEU H 1 46  ? 10.456  -78.208  -50.082  1.00 83.00  ? 43  LEU H CA    1 
ATOM 10262 C C     . LEU H 1 46  ? 10.976  -77.801  -48.710  1.00 81.86  ? 43  LEU H C     1 
ATOM 10263 O O     . LEU H 1 46  ? 12.196  -77.754  -48.517  1.00 79.36  ? 43  LEU H O     1 
ATOM 10264 C CB    . LEU H 1 46  ? 10.662  -77.060  -51.072  1.00 80.83  ? 43  LEU H CB    1 
ATOM 10265 C CG    . LEU H 1 46  ? 10.748  -77.484  -52.538  1.00 77.74  ? 43  LEU H CG    1 
ATOM 10266 C CD1   . LEU H 1 46  ? 10.737  -76.282  -53.457  1.00 73.03  ? 43  LEU H CD1   1 
ATOM 10267 C CD2   . LEU H 1 46  ? 11.991  -78.328  -52.772  1.00 81.27  ? 43  LEU H CD2   1 
ATOM 10268 N N     . ARG H 1 47  ? 10.087  -77.495  -47.762  1.00 78.30  ? 44  ARG H N     1 
ATOM 10269 C CA    . ARG H 1 47  ? 10.534  -77.122  -46.425  1.00 72.18  ? 44  ARG H CA    1 
ATOM 10270 C C     . ARG H 1 47  ? 11.090  -78.317  -45.660  1.00 66.50  ? 44  ARG H C     1 
ATOM 10271 O O     . ARG H 1 47  ? 11.937  -78.144  -44.775  1.00 69.85  ? 44  ARG H O     1 
ATOM 10272 C CB    . ARG H 1 47  ? 9.382   -76.475  -45.657  1.00 61.73  ? 44  ARG H CB    1 
ATOM 10273 C CG    . ARG H 1 47  ? 9.216   -74.991  -45.945  1.00 75.94  ? 44  ARG H CG    1 
ATOM 10274 C CD    . ARG H 1 47  ? 8.098   -74.380  -45.117  1.00 75.61  ? 44  ARG H CD    1 
ATOM 10275 N NE    . ARG H 1 47  ? 6.790   -74.543  -45.748  1.00 77.72  ? 44  ARG H NE    1 
ATOM 10276 C CZ    . ARG H 1 47  ? 6.124   -73.565  -46.355  1.00 87.98  ? 44  ARG H CZ    1 
ATOM 10277 N NH1   . ARG H 1 47  ? 6.639   -72.343  -46.412  1.00 77.10  ? 44  ARG H NH1   1 
ATOM 10278 N NH2   . ARG H 1 47  ? 4.940   -73.809  -46.904  1.00 88.47  ? 44  ARG H NH2   1 
ATOM 10279 N N     . GLN H 1 48  ? 10.611  -79.522  -45.968  1.00 65.21  ? 45  GLN H N     1 
ATOM 10280 C CA    . GLN H 1 48  ? 11.037  -80.730  -45.272  1.00 79.88  ? 45  GLN H CA    1 
ATOM 10281 C C     . GLN H 1 48  ? 12.551  -80.886  -45.303  1.00 78.72  ? 45  GLN H C     1 
ATOM 10282 O O     . GLN H 1 48  ? 13.183  -80.722  -46.349  1.00 84.72  ? 45  GLN H O     1 
ATOM 10283 C CB    . GLN H 1 48  ? 10.381  -81.958  -45.906  1.00 80.34  ? 45  GLN H CB    1 
ATOM 10284 C CG    . GLN H 1 48  ? 8.866   -81.934  -45.891  1.00 82.46  ? 45  GLN H CG    1 
ATOM 10285 C CD    . GLN H 1 48  ? 8.258   -83.099  -46.647  1.00 91.80  ? 45  GLN H CD    1 
ATOM 10286 O OE1   . GLN H 1 48  ? 7.232   -83.645  -46.244  1.00 98.87  ? 45  GLN H OE1   1 
ATOM 10287 N NE2   . GLN H 1 48  ? 8.888   -83.485  -47.753  1.00 90.12  ? 45  GLN H NE2   1 
ATOM 10288 N N     . ARG H 1 49  ? 13.133  -81.173  -44.144  1.00 78.14  ? 46  ARG H N     1 
ATOM 10289 C CA    . ARG H 1 49  ? 14.513  -81.624  -44.102  1.00 77.80  ? 46  ARG H CA    1 
ATOM 10290 C C     . ARG H 1 49  ? 14.586  -83.118  -44.420  1.00 78.06  ? 46  ARG H C     1 
ATOM 10291 O O     . ARG H 1 49  ? 13.593  -83.846  -44.335  1.00 77.43  ? 46  ARG H O     1 
ATOM 10292 C CB    . ARG H 1 49  ? 15.130  -81.331  -42.736  1.00 83.24  ? 46  ARG H CB    1 
ATOM 10293 C CG    . ARG H 1 49  ? 15.173  -79.850  -42.374  1.00 83.91  ? 46  ARG H CG    1 
ATOM 10294 C CD    . ARG H 1 49  ? 15.825  -79.666  -41.015  1.00 100.69 ? 46  ARG H CD    1 
ATOM 10295 N NE    . ARG H 1 49  ? 16.157  -78.278  -40.703  1.00 99.39  ? 46  ARG H NE    1 
ATOM 10296 C CZ    . ARG H 1 49  ? 15.336  -77.425  -40.097  1.00 101.77 ? 46  ARG H CZ    1 
ATOM 10297 N NH1   . ARG H 1 49  ? 14.121  -77.811  -39.732  1.00 89.51  ? 46  ARG H NH1   1 
ATOM 10298 N NH2   . ARG H 1 49  ? 15.734  -76.183  -39.852  1.00 110.13 ? 46  ARG H NH2   1 
ATOM 10299 N N     . LEU H 1 50  ? 15.779  -83.578  -44.788  1.00 73.58  ? 47  LEU H N     1 
ATOM 10300 C CA    . LEU H 1 50  ? 15.957  -84.967  -45.194  1.00 91.43  ? 47  LEU H CA    1 
ATOM 10301 C C     . LEU H 1 50  ? 16.298  -85.851  -44.003  1.00 89.26  ? 47  LEU H C     1 
ATOM 10302 O O     . LEU H 1 50  ? 17.060  -85.458  -43.115  1.00 93.82  ? 47  LEU H O     1 
ATOM 10303 C CB    . LEU H 1 50  ? 17.054  -85.105  -46.253  1.00 92.97  ? 47  LEU H CB    1 
ATOM 10304 C CG    . LEU H 1 50  ? 16.784  -84.593  -47.669  1.00 75.02  ? 47  LEU H CG    1 
ATOM 10305 C CD1   . LEU H 1 50  ? 15.301  -84.659  -48.007  1.00 79.78  ? 47  LEU H CD1   1 
ATOM 10306 C CD2   . LEU H 1 50  ? 17.330  -83.197  -47.854  1.00 70.30  ? 47  LEU H CD2   1 
ATOM 10307 N N     . GLY H 1 51  ? 15.705  -87.042  -43.984  1.00 94.68  ? 48  GLY H N     1 
ATOM 10308 C CA    . GLY H 1 51  ? 16.038  -88.059  -43.018  1.00 100.78 ? 48  GLY H CA    1 
ATOM 10309 C C     . GLY H 1 51  ? 17.399  -88.672  -43.290  1.00 102.62 ? 48  GLY H C     1 
ATOM 10310 O O     . GLY H 1 51  ? 18.044  -88.386  -44.304  1.00 105.83 ? 48  GLY H O     1 
ATOM 10311 N N     . PRO H 1 52  ? 17.858  -89.541  -42.384  1.00 105.36 ? 49  PRO H N     1 
ATOM 10312 C CA    . PRO H 1 52  ? 19.191  -90.149  -42.548  1.00 106.50 ? 49  PRO H CA    1 
ATOM 10313 C C     . PRO H 1 52  ? 19.308  -91.076  -43.749  1.00 105.39 ? 49  PRO H C     1 
ATOM 10314 O O     . PRO H 1 52  ? 20.433  -91.458  -44.100  1.00 100.67 ? 49  PRO H O     1 
ATOM 10315 C CB    . PRO H 1 52  ? 19.390  -90.929  -41.239  1.00 109.46 ? 49  PRO H CB    1 
ATOM 10316 C CG    . PRO H 1 52  ? 18.326  -90.438  -40.301  1.00 117.98 ? 49  PRO H CG    1 
ATOM 10317 C CD    . PRO H 1 52  ? 17.190  -89.968  -41.145  1.00 114.31 ? 49  PRO H CD    1 
ATOM 10318 N N     . GLU H 1 53  ? 18.195  -91.455  -44.383  1.00 104.80 ? 50  GLU H N     1 
ATOM 10319 C CA    . GLU H 1 53  ? 18.266  -92.343  -45.539  1.00 101.96 ? 50  GLU H CA    1 
ATOM 10320 C C     . GLU H 1 53  ? 19.013  -91.698  -46.701  1.00 104.63 ? 50  GLU H C     1 
ATOM 10321 O O     . GLU H 1 53  ? 19.621  -92.403  -47.516  1.00 97.37  ? 50  GLU H O     1 
ATOM 10322 C CB    . GLU H 1 53  ? 16.857  -92.746  -45.979  1.00 101.88 ? 50  GLU H CB    1 
ATOM 10323 C CG    . GLU H 1 53  ? 16.027  -93.425  -44.898  1.00 116.94 ? 50  GLU H CG    1 
ATOM 10324 C CD    . GLU H 1 53  ? 15.257  -92.438  -44.037  1.00 111.64 ? 50  GLU H CD    1 
ATOM 10325 O OE1   . GLU H 1 53  ? 15.757  -91.314  -43.815  1.00 109.37 ? 50  GLU H OE1   1 
ATOM 10326 O OE2   . GLU H 1 53  ? 14.148  -92.786  -43.582  1.00 107.83 ? 50  GLU H OE2   1 
ATOM 10327 N N     . TYR H 1 54  ? 18.980  -90.368  -46.792  1.00 103.60 ? 51  TYR H N     1 
ATOM 10328 C CA    . TYR H 1 54  ? 19.586  -89.641  -47.902  1.00 95.11  ? 51  TYR H CA    1 
ATOM 10329 C C     . TYR H 1 54  ? 21.037  -89.270  -47.650  1.00 92.40  ? 51  TYR H C     1 
ATOM 10330 O O     . TYR H 1 54  ? 21.827  -89.206  -48.600  1.00 92.64  ? 51  TYR H O     1 
ATOM 10331 C CB    . TYR H 1 54  ? 18.778  -88.378  -48.202  1.00 88.80  ? 51  TYR H CB    1 
ATOM 10332 C CG    . TYR H 1 54  ? 17.429  -88.688  -48.793  1.00 93.91  ? 51  TYR H CG    1 
ATOM 10333 C CD1   . TYR H 1 54  ? 17.301  -89.644  -49.791  1.00 95.84  ? 51  TYR H CD1   1 
ATOM 10334 C CD2   . TYR H 1 54  ? 16.284  -88.046  -48.347  1.00 87.81  ? 51  TYR H CD2   1 
ATOM 10335 C CE1   . TYR H 1 54  ? 16.075  -89.943  -50.337  1.00 94.64  ? 51  TYR H CE1   1 
ATOM 10336 C CE2   . TYR H 1 54  ? 15.049  -88.339  -48.889  1.00 86.61  ? 51  TYR H CE2   1 
ATOM 10337 C CZ    . TYR H 1 54  ? 14.954  -89.289  -49.883  1.00 88.66  ? 51  TYR H CZ    1 
ATOM 10338 O OH    . TYR H 1 54  ? 13.729  -89.584  -50.426  1.00 96.10  ? 51  TYR H OH    1 
ATOM 10339 N N     . ILE H 1 55  ? 21.402  -89.022  -46.402  1.00 92.90  ? 52  ILE H N     1 
ATOM 10340 C CA    . ILE H 1 55  ? 22.708  -88.462  -46.083  1.00 93.50  ? 52  ILE H CA    1 
ATOM 10341 C C     . ILE H 1 55  ? 23.760  -89.562  -46.100  1.00 88.61  ? 52  ILE H C     1 
ATOM 10342 O O     . ILE H 1 55  ? 23.531  -90.678  -45.615  1.00 92.01  ? 52  ILE H O     1 
ATOM 10343 C CB    . ILE H 1 55  ? 22.666  -87.756  -44.715  1.00 85.97  ? 52  ILE H CB    1 
ATOM 10344 C CG1   . ILE H 1 55  ? 21.412  -86.886  -44.593  1.00 79.02  ? 52  ILE H CG1   1 
ATOM 10345 C CG2   . ILE H 1 55  ? 23.919  -86.918  -44.509  1.00 91.02  ? 52  ILE H CG2   1 
ATOM 10346 C CD1   . ILE H 1 55  ? 21.277  -85.841  -45.678  1.00 91.91  ? 52  ILE H CD1   1 
ATOM 10347 N N     . SER H 1 56  ? 24.922  -89.242  -46.664  1.00 82.96  ? 53  SER H N     1 
ATOM 10348 C CA    . SER H 1 56  ? 26.091  -90.107  -46.646  1.00 87.77  ? 53  SER H CA    1 
ATOM 10349 C C     . SER H 1 56  ? 27.258  -89.291  -46.106  1.00 93.52  ? 53  SER H C     1 
ATOM 10350 O O     . SER H 1 56  ? 27.165  -88.069  -45.959  1.00 89.69  ? 53  SER H O     1 
ATOM 10351 C CB    . SER H 1 56  ? 26.403  -90.671  -48.041  1.00 92.79  ? 53  SER H CB    1 
ATOM 10352 O OG    . SER H 1 56  ? 25.240  -91.202  -48.656  1.00 89.07  ? 53  SER H OG    1 
ATOM 10353 N N     . SER H 1 57  ? 28.372  -89.961  -45.816  1.00 100.64 ? 54  SER H N     1 
ATOM 10354 C CA    . SER H 1 57  ? 29.489  -89.273  -45.183  1.00 99.81  ? 54  SER H CA    1 
ATOM 10355 C C     . SER H 1 57  ? 30.816  -89.901  -45.578  1.00 100.88 ? 54  SER H C     1 
ATOM 10356 O O     . SER H 1 57  ? 30.896  -91.094  -45.882  1.00 98.23  ? 54  SER H O     1 
ATOM 10357 C CB    . SER H 1 57  ? 29.357  -89.289  -43.655  1.00 97.03  ? 54  SER H CB    1 
ATOM 10358 O OG    . SER H 1 57  ? 29.606  -90.584  -43.134  1.00 102.85 ? 54  SER H OG    1 
ATOM 10359 N N     . ARG H 1 58  ? 31.862  -89.074  -45.556  1.00 107.62 ? 55  ARG H N     1 
ATOM 10360 C CA    . ARG H 1 58  ? 33.235  -89.522  -45.739  1.00 117.57 ? 55  ARG H CA    1 
ATOM 10361 C C     . ARG H 1 58  ? 34.090  -88.794  -44.710  1.00 123.94 ? 55  ARG H C     1 
ATOM 10362 O O     . ARG H 1 58  ? 33.588  -88.000  -43.908  1.00 118.24 ? 55  ARG H O     1 
ATOM 10363 C CB    . ARG H 1 58  ? 33.761  -89.260  -47.160  1.00 115.13 ? 55  ARG H CB    1 
ATOM 10364 C CG    . ARG H 1 58  ? 33.992  -87.786  -47.485  1.00 117.41 ? 55  ARG H CG    1 
ATOM 10365 C CD    . ARG H 1 58  ? 34.663  -87.583  -48.846  1.00 124.15 ? 55  ARG H CD    1 
ATOM 10366 N NE    . ARG H 1 58  ? 34.591  -86.189  -49.277  1.00 129.78 ? 55  ARG H NE    1 
ATOM 10367 C CZ    . ARG H 1 58  ? 33.638  -85.689  -50.056  1.00 122.36 ? 55  ARG H CZ    1 
ATOM 10368 N NH1   . ARG H 1 58  ? 32.772  -86.499  -50.649  1.00 105.83 ? 55  ARG H NH1   1 
ATOM 10369 N NH2   . ARG H 1 58  ? 33.647  -84.400  -50.368  1.00 124.95 ? 55  ARG H NH2   1 
ATOM 10370 N N     . MET H 1 59  ? 35.390  -89.067  -44.725  1.00 130.84 ? 56  MET H N     1 
ATOM 10371 C CA    . MET H 1 59  ? 36.341  -88.390  -43.852  1.00 131.81 ? 56  MET H CA    1 
ATOM 10372 C C     . MET H 1 59  ? 37.163  -87.424  -44.692  1.00 137.32 ? 56  MET H C     1 
ATOM 10373 O O     . MET H 1 59  ? 37.796  -87.829  -45.674  1.00 131.95 ? 56  MET H O     1 
ATOM 10374 C CB    . MET H 1 59  ? 37.246  -89.386  -43.125  1.00 129.37 ? 56  MET H CB    1 
ATOM 10375 C CG    . MET H 1 59  ? 36.520  -90.237  -42.105  1.00 130.29 ? 56  MET H CG    1 
ATOM 10376 S SD    . MET H 1 59  ? 35.654  -89.238  -40.877  1.00 136.42 ? 56  MET H SD    1 
ATOM 10377 C CE    . MET H 1 59  ? 34.161  -90.196  -40.620  1.00 126.47 ? 56  MET H CE    1 
ATOM 10378 N N     . ALA H 1 60  ? 37.140  -86.149  -44.310  1.00 143.07 ? 57  ALA H N     1 
ATOM 10379 C CA    . ALA H 1 60  ? 37.922  -85.146  -45.008  1.00 149.27 ? 57  ALA H CA    1 
ATOM 10380 C C     . ALA H 1 60  ? 39.414  -85.435  -44.851  1.00 151.16 ? 57  ALA H C     1 
ATOM 10381 O O     . ALA H 1 60  ? 39.834  -86.332  -44.114  1.00 152.11 ? 57  ALA H O     1 
ATOM 10382 C CB    . ALA H 1 60  ? 37.594  -83.750  -44.482  1.00 132.00 ? 57  ALA H CB    1 
ATOM 10383 N N     . GLY H 1 61  ? 40.221  -84.646  -45.552  1.00 135.82 ? 58  GLY H N     1 
ATOM 10384 C CA    . GLY H 1 61  ? 41.659  -84.804  -45.493  1.00 130.13 ? 58  GLY H CA    1 
ATOM 10385 C C     . GLY H 1 61  ? 42.256  -84.437  -44.149  1.00 134.46 ? 58  GLY H C     1 
ATOM 10386 O O     . GLY H 1 61  ? 43.472  -84.526  -43.962  1.00 127.99 ? 58  GLY H O     1 
ATOM 10387 N N     . GLY H 1 62  ? 41.413  -84.018  -43.207  1.00 140.44 ? 59  GLY H N     1 
ATOM 10388 C CA    . GLY H 1 62  ? 41.868  -83.661  -41.878  1.00 137.94 ? 59  GLY H CA    1 
ATOM 10389 C C     . GLY H 1 62  ? 41.206  -84.460  -40.774  1.00 134.68 ? 59  GLY H C     1 
ATOM 10390 O O     . GLY H 1 62  ? 41.189  -84.032  -39.615  1.00 129.14 ? 59  GLY H O     1 
ATOM 10391 N N     . GLY H 1 63  ? 40.650  -85.619  -41.121  1.00 137.64 ? 60  GLY H N     1 
ATOM 10392 C CA    . GLY H 1 63  ? 40.065  -86.493  -40.123  1.00 143.43 ? 60  GLY H CA    1 
ATOM 10393 C C     . GLY H 1 63  ? 38.760  -86.019  -39.526  1.00 145.20 ? 60  GLY H C     1 
ATOM 10394 O O     . GLY H 1 63  ? 38.375  -86.491  -38.453  1.00 130.21 ? 60  GLY H O     1 
ATOM 10395 N N     . GLN H 1 64  ? 38.065  -85.098  -40.184  1.00 143.34 ? 61  GLN H N     1 
ATOM 10396 C CA    . GLN H 1 64  ? 36.774  -84.615  -39.722  1.00 134.57 ? 61  GLN H CA    1 
ATOM 10397 C C     . GLN H 1 64  ? 35.651  -85.222  -40.556  1.00 127.98 ? 61  GLN H C     1 
ATOM 10398 O O     . GLN H 1 64  ? 35.859  -85.687  -41.680  1.00 128.25 ? 61  GLN H O     1 
ATOM 10399 C CB    . GLN H 1 64  ? 36.717  -83.085  -39.777  1.00 128.61 ? 61  GLN H CB    1 
ATOM 10400 C CG    . GLN H 1 64  ? 37.270  -82.492  -41.060  1.00 137.32 ? 61  GLN H CG    1 
ATOM 10401 C CD    . GLN H 1 64  ? 37.421  -80.986  -40.987  1.00 134.28 ? 61  GLN H CD    1 
ATOM 10402 O OE1   . GLN H 1 64  ? 37.042  -80.360  -39.997  1.00 125.77 ? 61  GLN H OE1   1 
ATOM 10403 N NE2   . GLN H 1 64  ? 37.980  -80.396  -42.037  1.00 139.31 ? 61  GLN H NE2   1 
ATOM 10404 N N     . LYS H 1 65  ? 34.448  -85.220  -39.985  1.00 119.51 ? 62  LYS H N     1 
ATOM 10405 C CA    . LYS H 1 65  ? 33.288  -85.836  -40.617  1.00 122.90 ? 62  LYS H CA    1 
ATOM 10406 C C     . LYS H 1 65  ? 32.652  -84.851  -41.590  1.00 114.71 ? 62  LYS H C     1 
ATOM 10407 O O     . LYS H 1 65  ? 32.313  -83.725  -41.209  1.00 115.78 ? 62  LYS H O     1 
ATOM 10408 C CB    . LYS H 1 65  ? 32.269  -86.283  -39.569  1.00 118.95 ? 62  LYS H CB    1 
ATOM 10409 C CG    . LYS H 1 65  ? 31.094  -87.062  -40.148  1.00 108.02 ? 62  LYS H CG    1 
ATOM 10410 C CD    . LYS H 1 65  ? 30.042  -87.367  -39.092  1.00 105.03 ? 62  LYS H CD    1 
ATOM 10411 C CE    . LYS H 1 65  ? 28.863  -88.119  -39.690  1.00 93.84  ? 62  LYS H CE    1 
ATOM 10412 N NZ    . LYS H 1 65  ? 27.778  -88.353  -38.696  1.00 91.37  ? 62  LYS H NZ    1 
ATOM 10413 N N     . VAL H 1 66  ? 32.480  -85.277  -42.839  1.00 109.47 ? 63  VAL H N     1 
ATOM 10414 C CA    . VAL H 1 66  ? 31.889  -84.448  -43.881  1.00 109.90 ? 63  VAL H CA    1 
ATOM 10415 C C     . VAL H 1 66  ? 30.669  -85.171  -44.432  1.00 104.57 ? 63  VAL H C     1 
ATOM 10416 O O     . VAL H 1 66  ? 30.773  -86.315  -44.891  1.00 97.90  ? 63  VAL H O     1 
ATOM 10417 C CB    . VAL H 1 66  ? 32.895  -84.137  -45.000  1.00 108.27 ? 63  VAL H CB    1 
ATOM 10418 C CG1   . VAL H 1 66  ? 32.208  -83.418  -46.148  1.00 104.71 ? 63  VAL H CG1   1 
ATOM 10419 C CG2   . VAL H 1 66  ? 34.036  -83.297  -44.455  1.00 114.85 ? 63  VAL H CG2   1 
ATOM 10420 N N     . CYS H 1 67  ? 29.518  -84.510  -44.373  1.00 102.90 ? 64  CYS H N     1 
ATOM 10421 C CA    . CYS H 1 67  ? 28.275  -85.040  -44.911  1.00 102.87 ? 64  CYS H CA    1 
ATOM 10422 C C     . CYS H 1 67  ? 28.083  -84.596  -46.360  1.00 107.00 ? 64  CYS H C     1 
ATOM 10423 O O     . CYS H 1 67  ? 28.609  -83.570  -46.798  1.00 108.57 ? 64  CYS H O     1 
ATOM 10424 C CB    . CYS H 1 67  ? 27.083  -84.591  -44.063  1.00 99.80  ? 64  CYS H CB    1 
ATOM 10425 S SG    . CYS H 1 67  ? 27.097  -85.185  -42.355  1.00 105.44 ? 64  CYS H SG    1 
ATOM 10426 N N     . TYR H 1 68  ? 27.295  -85.378  -47.096  1.00 95.86  ? 65  TYR H N     1 
ATOM 10427 C CA    . TYR H 1 68  ? 26.966  -85.079  -48.485  1.00 87.41  ? 65  TYR H CA    1 
ATOM 10428 C C     . TYR H 1 68  ? 25.803  -85.966  -48.906  1.00 89.50  ? 65  TYR H C     1 
ATOM 10429 O O     . TYR H 1 68  ? 25.510  -86.978  -48.264  1.00 101.02 ? 65  TYR H O     1 
ATOM 10430 C CB    . TYR H 1 68  ? 28.175  -85.276  -49.415  1.00 93.24  ? 65  TYR H CB    1 
ATOM 10431 C CG    . TYR H 1 68  ? 28.626  -86.713  -49.595  1.00 93.84  ? 65  TYR H CG    1 
ATOM 10432 C CD1   . TYR H 1 68  ? 28.103  -87.505  -50.609  1.00 90.85  ? 65  TYR H CD1   1 
ATOM 10433 C CD2   . TYR H 1 68  ? 29.592  -87.268  -48.763  1.00 93.89  ? 65  TYR H CD2   1 
ATOM 10434 C CE1   . TYR H 1 68  ? 28.514  -88.812  -50.780  1.00 95.00  ? 65  TYR H CE1   1 
ATOM 10435 C CE2   . TYR H 1 68  ? 30.011  -88.576  -48.929  1.00 96.40  ? 65  TYR H CE2   1 
ATOM 10436 C CZ    . TYR H 1 68  ? 29.468  -89.343  -49.939  1.00 93.05  ? 65  TYR H CZ    1 
ATOM 10437 O OH    . TYR H 1 68  ? 29.877  -90.645  -50.113  1.00 86.36  ? 65  TYR H OH    1 
ATOM 10438 N N     . ILE H 1 69  ? 25.143  -85.569  -49.993  1.00 84.08  ? 66  ILE H N     1 
ATOM 10439 C CA    . ILE H 1 69  ? 24.062  -86.337  -50.604  1.00 80.31  ? 66  ILE H CA    1 
ATOM 10440 C C     . ILE H 1 69  ? 24.547  -86.870  -51.945  1.00 84.17  ? 66  ILE H C     1 
ATOM 10441 O O     . ILE H 1 69  ? 25.132  -86.124  -52.740  1.00 88.77  ? 66  ILE H O     1 
ATOM 10442 C CB    . ILE H 1 69  ? 22.791  -85.486  -50.768  1.00 69.39  ? 66  ILE H CB    1 
ATOM 10443 C CG1   . ILE H 1 69  ? 22.478  -84.751  -49.464  1.00 81.75  ? 66  ILE H CG1   1 
ATOM 10444 C CG2   . ILE H 1 69  ? 21.615  -86.362  -51.162  1.00 64.90  ? 66  ILE H CG2   1 
ATOM 10445 C CD1   . ILE H 1 69  ? 21.262  -83.846  -49.540  1.00 75.10  ? 66  ILE H CD1   1 
ATOM 10446 N N     . GLU H 1 70  ? 24.320  -88.159  -52.192  1.00 86.08  ? 67  GLU H N     1 
ATOM 10447 C CA    . GLU H 1 70  ? 24.771  -88.773  -53.434  1.00 85.10  ? 67  GLU H CA    1 
ATOM 10448 C C     . GLU H 1 70  ? 23.973  -88.247  -54.625  1.00 81.45  ? 67  GLU H C     1 
ATOM 10449 O O     . GLU H 1 70  ? 22.808  -87.863  -54.497  1.00 80.71  ? 67  GLU H O     1 
ATOM 10450 C CB    . GLU H 1 70  ? 24.668  -90.294  -53.336  1.00 87.90  ? 67  GLU H CB    1 
ATOM 10451 C CG    . GLU H 1 70  ? 25.582  -90.857  -52.253  1.00 92.60  ? 67  GLU H CG    1 
ATOM 10452 C CD    . GLU H 1 70  ? 25.718  -92.368  -52.269  1.00 107.38 ? 67  GLU H CD    1 
ATOM 10453 O OE1   . GLU H 1 70  ? 25.843  -92.959  -53.361  1.00 112.01 ? 67  GLU H OE1   1 
ATOM 10454 O OE2   . GLU H 1 70  ? 25.707  -92.964  -51.171  1.00 109.72 ? 67  GLU H OE2   1 
ATOM 10455 N N     . GLY H 1 71  ? 24.631  -88.218  -55.789  1.00 62.26  ? 68  GLY H N     1 
ATOM 10456 C CA    . GLY H 1 71  ? 24.035  -87.579  -56.957  1.00 57.95  ? 68  GLY H CA    1 
ATOM 10457 C C     . GLY H 1 71  ? 22.666  -88.123  -57.305  1.00 66.60  ? 68  GLY H C     1 
ATOM 10458 O O     . GLY H 1 71  ? 21.686  -87.371  -57.381  1.00 68.02  ? 68  GLY H O     1 
ATOM 10459 N N     . HIS H 1 72  ? 22.549  -89.452  -57.465  1.00 66.02  ? 69  HIS H N     1 
ATOM 10460 C CA    . HIS H 1 72  ? 21.292  -90.053  -57.895  1.00 75.27  ? 69  HIS H CA    1 
ATOM 10461 C C     . HIS H 1 72  ? 20.171  -89.745  -56.918  1.00 77.11  ? 69  HIS H C     1 
ATOM 10462 O O     . HIS H 1 72  ? 19.015  -89.599  -57.328  1.00 71.46  ? 69  HIS H O     1 
ATOM 10463 C CB    . HIS H 1 72  ? 21.459  -91.566  -58.059  1.00 90.74  ? 69  HIS H C