data_5Y1Z
# 
_entry.id   5Y1Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5Y1Z         
WWPDB D_1300002900 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5Y1Z 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yao, N.'   1 ? 
'Li, J.'    2 ? 
'Liu, H.'   3 ? 
'Wan, J.'   4 ? 
'Liu, W.'   5 ? 
'Zhang, M.' 6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                1657 
_citation.page_last                 1666.e3 
_citation.title                     
'The Structure of the ZMYND8/Drebrin Complex Suggests a Cytoplasmic Sequestering Mechanism of ZMYND8 by Drebrin' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2017.08.014 
_citation.pdbx_database_id_PubMed   28966017 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yao, N.'   1 
primary 'Li, J.'    2 
primary 'Liu, H.'   3 
primary 'Wan, J.'   4 
primary 'Liu, W.'   5 
primary 'Zhang, M.' 6 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5Y1Z 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     54.183 
_cell.length_a_esd                 ? 
_cell.length_b                     138.095 
_cell.length_b_esd                 ? 
_cell.length_c                     161.164 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5Y1Z 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Drebrin                              14677.229 2  ? ? 'UNP residues 1-135'  ? 
2 polymer     man 'Protein kinase C-binding protein 1' 37615.461 2  ? ? 'UNP residues 83-406' ? 
3 non-polymer syn 'SULFATE ION'                        96.063    6  ? ? ?                     ? 
4 non-polymer syn 'ZINC ION'                           65.409    6  ? ? ?                     ? 
5 non-polymer syn GLYCEROL                             92.094    1  ? ? ?                     ? 
6 water       nat water                                18.015    48 ? ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Developmentally-regulated brain protein' 
2 
;Cutaneous T-cell lymphoma-associated antigen se14-3,CTCL-associated antigen se14-3,Rack7,Zinc finger MYND domain-containing protein 8
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSMAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALP
KYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSN
;
;GSMAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALP
KYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSN
;
A,B ? 
2 'polypeptide(L)' no no 
;QDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKFAI
QKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVI
KICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDRAWVPINNCY
LMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNSQYQMLLDPTNPSAGTAKIDKQEKVKLNFD
MTAS
;
;QDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKFAI
QKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVI
KICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDRAWVPINNCY
LMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNSQYQMLLDPTNPSAGTAKIDKQEKVKLNFD
MTAS
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   MET n 
1 4   ALA n 
1 5   GLY n 
1 6   VAL n 
1 7   SER n 
1 8   PHE n 
1 9   SER n 
1 10  GLY n 
1 11  HIS n 
1 12  ARG n 
1 13  LEU n 
1 14  GLU n 
1 15  LEU n 
1 16  LEU n 
1 17  ALA n 
1 18  ALA n 
1 19  TYR n 
1 20  GLU n 
1 21  GLU n 
1 22  VAL n 
1 23  ILE n 
1 24  ARG n 
1 25  GLU n 
1 26  GLU n 
1 27  SER n 
1 28  ALA n 
1 29  ALA n 
1 30  ASP n 
1 31  TRP n 
1 32  ALA n 
1 33  LEU n 
1 34  TYR n 
1 35  THR n 
1 36  TYR n 
1 37  GLU n 
1 38  ASP n 
1 39  GLY n 
1 40  SER n 
1 41  ASP n 
1 42  ASP n 
1 43  LEU n 
1 44  LYS n 
1 45  LEU n 
1 46  ALA n 
1 47  ALA n 
1 48  SER n 
1 49  GLY n 
1 50  GLU n 
1 51  GLY n 
1 52  GLY n 
1 53  LEU n 
1 54  GLN n 
1 55  GLU n 
1 56  LEU n 
1 57  SER n 
1 58  GLY n 
1 59  HIS n 
1 60  PHE n 
1 61  GLU n 
1 62  ASN n 
1 63  GLN n 
1 64  LYS n 
1 65  VAL n 
1 66  MET n 
1 67  TYR n 
1 68  GLY n 
1 69  PHE n 
1 70  CYS n 
1 71  SER n 
1 72  VAL n 
1 73  LYS n 
1 74  ASP n 
1 75  SER n 
1 76  GLN n 
1 77  ALA n 
1 78  ALA n 
1 79  LEU n 
1 80  PRO n 
1 81  LYS n 
1 82  TYR n 
1 83  VAL n 
1 84  LEU n 
1 85  ILE n 
1 86  ASN n 
1 87  TRP n 
1 88  VAL n 
1 89  GLY n 
1 90  GLU n 
1 91  ASP n 
1 92  VAL n 
1 93  PRO n 
1 94  ASP n 
1 95  ALA n 
1 96  ARG n 
1 97  LYS n 
1 98  CYS n 
1 99  ALA n 
1 100 CYS n 
1 101 ALA n 
1 102 SER n 
1 103 HIS n 
1 104 VAL n 
1 105 ALA n 
1 106 LYS n 
1 107 VAL n 
1 108 ALA n 
1 109 GLU n 
1 110 PHE n 
1 111 PHE n 
1 112 GLN n 
1 113 GLY n 
1 114 VAL n 
1 115 ASP n 
1 116 VAL n 
1 117 ILE n 
1 118 VAL n 
1 119 ASN n 
1 120 ALA n 
1 121 SER n 
1 122 SER n 
1 123 VAL n 
1 124 GLU n 
1 125 ASP n 
1 126 ILE n 
1 127 ASP n 
1 128 ALA n 
1 129 GLY n 
1 130 ALA n 
1 131 ILE n 
1 132 GLY n 
1 133 GLN n 
1 134 ARG n 
1 135 LEU n 
1 136 SER n 
1 137 ASN n 
2 1   GLN n 
2 2   ASP n 
2 3   GLY n 
2 4   ARG n 
2 5   ASN n 
2 6   ASP n 
2 7   PHE n 
2 8   TYR n 
2 9   CYS n 
2 10  TRP n 
2 11  VAL n 
2 12  CYS n 
2 13  HIS n 
2 14  ARG n 
2 15  GLU n 
2 16  GLY n 
2 17  GLN n 
2 18  VAL n 
2 19  LEU n 
2 20  CYS n 
2 21  CYS n 
2 22  GLU n 
2 23  LEU n 
2 24  CYS n 
2 25  PRO n 
2 26  ARG n 
2 27  VAL n 
2 28  TYR n 
2 29  HIS n 
2 30  ALA n 
2 31  LYS n 
2 32  CYS n 
2 33  LEU n 
2 34  ARG n 
2 35  LEU n 
2 36  THR n 
2 37  SER n 
2 38  GLU n 
2 39  PRO n 
2 40  GLU n 
2 41  GLY n 
2 42  ASP n 
2 43  TRP n 
2 44  PHE n 
2 45  CYS n 
2 46  PRO n 
2 47  GLU n 
2 48  CYS n 
2 49  GLU n 
2 50  LYS n 
2 51  ILE n 
2 52  THR n 
2 53  VAL n 
2 54  ALA n 
2 55  GLU n 
2 56  CYS n 
2 57  ILE n 
2 58  GLU n 
2 59  THR n 
2 60  GLN n 
2 61  SER n 
2 62  LYS n 
2 63  ALA n 
2 64  MET n 
2 65  THR n 
2 66  MET n 
2 67  LEU n 
2 68  THR n 
2 69  ILE n 
2 70  GLU n 
2 71  GLN n 
2 72  LEU n 
2 73  SER n 
2 74  TYR n 
2 75  LEU n 
2 76  LEU n 
2 77  LYS n 
2 78  PHE n 
2 79  ALA n 
2 80  ILE n 
2 81  GLN n 
2 82  LYS n 
2 83  MET n 
2 84  LYS n 
2 85  GLN n 
2 86  PRO n 
2 87  GLY n 
2 88  THR n 
2 89  ASP n 
2 90  ALA n 
2 91  PHE n 
2 92  GLN n 
2 93  LYS n 
2 94  PRO n 
2 95  VAL n 
2 96  PRO n 
2 97  LEU n 
2 98  GLU n 
2 99  GLN n 
2 100 HIS n 
2 101 PRO n 
2 102 ASP n 
2 103 TYR n 
2 104 ALA n 
2 105 GLU n 
2 106 TYR n 
2 107 ILE n 
2 108 PHE n 
2 109 HIS n 
2 110 PRO n 
2 111 MET n 
2 112 ASP n 
2 113 LEU n 
2 114 CYS n 
2 115 THR n 
2 116 LEU n 
2 117 GLU n 
2 118 LYS n 
2 119 ASN n 
2 120 ALA n 
2 121 LYS n 
2 122 LYS n 
2 123 LYS n 
2 124 MET n 
2 125 TYR n 
2 126 GLY n 
2 127 CYS n 
2 128 THR n 
2 129 GLU n 
2 130 ALA n 
2 131 PHE n 
2 132 LEU n 
2 133 ALA n 
2 134 ASP n 
2 135 ALA n 
2 136 LYS n 
2 137 TRP n 
2 138 ILE n 
2 139 LEU n 
2 140 HIS n 
2 141 ASN n 
2 142 CYS n 
2 143 ILE n 
2 144 ILE n 
2 145 TYR n 
2 146 ASN n 
2 147 GLY n 
2 148 GLY n 
2 149 ASN n 
2 150 HIS n 
2 151 LYS n 
2 152 LEU n 
2 153 THR n 
2 154 GLN n 
2 155 ILE n 
2 156 ALA n 
2 157 LYS n 
2 158 VAL n 
2 159 VAL n 
2 160 ILE n 
2 161 LYS n 
2 162 ILE n 
2 163 CYS n 
2 164 GLU n 
2 165 HIS n 
2 166 GLU n 
2 167 MET n 
2 168 ASN n 
2 169 GLU n 
2 170 ILE n 
2 171 GLU n 
2 172 VAL n 
2 173 CYS n 
2 174 PRO n 
2 175 GLU n 
2 176 CYS n 
2 177 TYR n 
2 178 LEU n 
2 179 ALA n 
2 180 ALA n 
2 181 CYS n 
2 182 GLN n 
2 183 LYS n 
2 184 ARG n 
2 185 ASP n 
2 186 ASN n 
2 187 TRP n 
2 188 PHE n 
2 189 CYS n 
2 190 GLU n 
2 191 PRO n 
2 192 CYS n 
2 193 SER n 
2 194 ASN n 
2 195 PRO n 
2 196 HIS n 
2 197 PRO n 
2 198 LEU n 
2 199 VAL n 
2 200 TRP n 
2 201 ALA n 
2 202 LYS n 
2 203 LEU n 
2 204 LYS n 
2 205 GLY n 
2 206 PHE n 
2 207 PRO n 
2 208 PHE n 
2 209 TRP n 
2 210 PRO n 
2 211 ALA n 
2 212 LYS n 
2 213 ALA n 
2 214 LEU n 
2 215 ARG n 
2 216 ASP n 
2 217 LYS n 
2 218 ASP n 
2 219 GLY n 
2 220 GLN n 
2 221 VAL n 
2 222 ASP n 
2 223 ALA n 
2 224 ARG n 
2 225 PHE n 
2 226 PHE n 
2 227 GLY n 
2 228 GLN n 
2 229 HIS n 
2 230 ASP n 
2 231 ARG n 
2 232 ALA n 
2 233 TRP n 
2 234 VAL n 
2 235 PRO n 
2 236 ILE n 
2 237 ASN n 
2 238 ASN n 
2 239 CYS n 
2 240 TYR n 
2 241 LEU n 
2 242 MET n 
2 243 SER n 
2 244 LYS n 
2 245 GLU n 
2 246 ILE n 
2 247 PRO n 
2 248 PHE n 
2 249 SER n 
2 250 VAL n 
2 251 LYS n 
2 252 LYS n 
2 253 THR n 
2 254 LYS n 
2 255 SER n 
2 256 ILE n 
2 257 PHE n 
2 258 ASN n 
2 259 SER n 
2 260 ALA n 
2 261 MET n 
2 262 GLN n 
2 263 GLU n 
2 264 MET n 
2 265 GLU n 
2 266 VAL n 
2 267 TYR n 
2 268 VAL n 
2 269 GLU n 
2 270 ASN n 
2 271 ILE n 
2 272 ARG n 
2 273 ARG n 
2 274 LYS n 
2 275 PHE n 
2 276 GLY n 
2 277 VAL n 
2 278 PHE n 
2 279 ASN n 
2 280 TYR n 
2 281 SER n 
2 282 PRO n 
2 283 PHE n 
2 284 ARG n 
2 285 THR n 
2 286 PRO n 
2 287 TYR n 
2 288 THR n 
2 289 PRO n 
2 290 ASN n 
2 291 SER n 
2 292 GLN n 
2 293 TYR n 
2 294 GLN n 
2 295 MET n 
2 296 LEU n 
2 297 LEU n 
2 298 ASP n 
2 299 PRO n 
2 300 THR n 
2 301 ASN n 
2 302 PRO n 
2 303 SER n 
2 304 ALA n 
2 305 GLY n 
2 306 THR n 
2 307 ALA n 
2 308 LYS n 
2 309 ILE n 
2 310 ASP n 
2 311 LYS n 
2 312 GLN n 
2 313 GLU n 
2 314 LYS n 
2 315 VAL n 
2 316 LYS n 
2 317 LEU n 
2 318 ASN n 
2 319 PHE n 
2 320 ASP n 
2 321 MET n 
2 322 THR n 
2 323 ALA n 
2 324 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 137 Human ? 'DBN1, D0S117E'                    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 324 Human ? 'ZMYND8, KIAA1125, PRKCBP1, RACK7' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DREB_HUMAN  Q16643 ? 1 
;MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSVKDSQAALPKY
VLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSN
;
1  
2 UNP PKCB1_HUMAN Q9ULU4 ? 2 
;QDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKFAI
QKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVI
KICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDRAWVPINNCY
LMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNSQYQMLLDPTNPSAGTAKIDKQEKVKLNFD
MTAS
;
83 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5Y1Z A 3 ? 137 ? Q16643 1  ? 135 ? 1  135 
2 1 5Y1Z B 3 ? 137 ? Q16643 1  ? 135 ? 1  135 
3 2 5Y1Z C 1 ? 324 ? Q9ULU4 83 ? 406 ? 83 406 
4 2 5Y1Z D 1 ? 324 ? Q9ULU4 83 ? 406 ? 83 406 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5Y1Z GLY A 1 ? UNP Q16643 ? ? 'see sequence details' -1 1 
1 5Y1Z SER A 2 ? UNP Q16643 ? ? 'see sequence details' 0  2 
2 5Y1Z GLY B 1 ? UNP Q16643 ? ? 'see sequence details' -1 3 
2 5Y1Z SER B 2 ? UNP Q16643 ? ? 'see sequence details' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5Y1Z 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.11 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M ammonium sulfate, 0.1 M Bis-Tris, pH 6.0 and 23% w/v polyethylene glycol 3,350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-01-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Double Crystal' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9780 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9780 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            53.360 
_reflns.entry_id                         5Y1Z 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.650 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       34299 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.500 
_reflns.pdbx_Rmerge_I_obs                0.092 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.100 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.768 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.100 
_reflns.pdbx_Rpim_I_all                  0.038 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.650 2.700  ? ? ? ? ? ? 1638 94.500  ? ? ? ? 0.951 ? ? ? ? ? ? ? ? 6.300 ? 1.389 ? ? 1.031 0.392 ? 1  1 0.758 ? 
2.700 2.740  ? ? ? ? ? ? ?    97.800  ? ? ? ? 0.889 ? ? ? ? ? ? ? ? 6.200 ? 1.400 ? ? 0.964 0.368 ? 2  1 0.777 ? 
2.740 2.800  ? ? ? ? ? ? ?    97.100  ? ? ? ? 0.735 ? ? ? ? ? ? ? ? 6.100 ? 1.427 ? ? 0.798 0.305 ? 3  1 0.840 ? 
2.800 2.850  ? ? ? ? ? ? ?    97.500  ? ? ? ? 0.594 ? ? ? ? ? ? ? ? 6.200 ? 1.415 ? ? 0.644 0.246 ? 4  1 0.873 ? 
2.850 2.920  ? ? ? ? ? ? ?    98.400  ? ? ? ? 0.487 ? ? ? ? ? ? ? ? 6.200 ? 1.491 ? ? 0.528 0.202 ? 5  1 0.911 ? 
2.920 2.980  ? ? ? ? ? ? ?    98.400  ? ? ? ? 0.419 ? ? ? ? ? ? ? ? 6.100 ? 1.487 ? ? 0.456 0.176 ? 6  1 0.930 ? 
2.980 3.060  ? ? ? ? ? ? ?    98.900  ? ? ? ? 0.336 ? ? ? ? ? ? ? ? 6.200 ? 1.540 ? ? 0.365 0.140 ? 7  1 0.944 ? 
3.060 3.140  ? ? ? ? ? ? ?    99.100  ? ? ? ? 0.265 ? ? ? ? ? ? ? ? 6.100 ? 1.555 ? ? 0.288 0.111 ? 8  1 0.963 ? 
3.140 3.230  ? ? ? ? ? ? ?    99.400  ? ? ? ? 0.206 ? ? ? ? ? ? ? ? 6.200 ? 1.639 ? ? 0.224 0.086 ? 9  1 0.978 ? 
3.230 3.340  ? ? ? ? ? ? ?    99.200  ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 6.200 ? 1.684 ? ? 0.183 0.071 ? 10 1 0.984 ? 
3.340 3.460  ? ? ? ? ? ? ?    99.800  ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 6.300 ? 1.736 ? ? 0.138 0.053 ? 11 1 0.993 ? 
3.460 3.600  ? ? ? ? ? ? ?    99.500  ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 6.400 ? 1.981 ? ? 0.121 0.047 ? 12 1 0.992 ? 
3.600 3.760  ? ? ? ? ? ? ?    99.400  ? ? ? ? 0.094 ? ? ? ? ? ? ? ? 6.100 ? 2.114 ? ? 0.103 0.041 ? 13 1 0.994 ? 
3.760 3.960  ? ? ? ? ? ? ?    99.800  ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 6.900 ? 2.001 ? ? 0.081 0.030 ? 14 1 0.997 ? 
3.960 4.210  ? ? ? ? ? ? ?    100.000 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 7.200 ? 2.024 ? ? 0.069 0.026 ? 15 1 0.997 ? 
4.210 4.530  ? ? ? ? ? ? ?    100.000 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 7.100 ? 2.201 ? ? 0.060 0.022 ? 16 1 0.998 ? 
4.530 4.990  ? ? ? ? ? ? ?    100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 7.300 ? 1.982 ? ? 0.053 0.019 ? 17 1 0.999 ? 
4.990 5.710  ? ? ? ? ? ? ?    100.000 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 7.200 ? 1.956 ? ? 0.056 0.021 ? 18 1 0.999 ? 
5.710 7.190  ? ? ? ? ? ? ?    100.000 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 7.100 ? 1.936 ? ? 0.052 0.019 ? 19 1 0.999 ? 
7.190 50.000 ? ? ? ? ? ? ?    98.800  ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 6.600 ? 1.965 ? ? 0.039 0.015 ? 20 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                164.250 
_refine.B_iso_mean                               58.0754 
_refine.B_iso_min                                25.870 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5Y1Z 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.6760 
_refine.ls_d_res_low                             14.9880 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     34002 
_refine.ls_number_reflns_R_free                  1648 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.7000 
_refine.ls_percent_reflns_R_free                 4.8500 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1808 
_refine.ls_R_factor_R_free                       0.2338 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1781 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4COS, 1X67' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.4100 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.6760 
_refine_hist.d_res_low                        14.9880 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             48 
_refine_hist.number_atoms_total               6771 
_refine_hist.pdbx_number_residues_total       874 
_refine_hist.pdbx_B_iso_mean_ligand           115.66 
_refine_hist.pdbx_B_iso_mean_solvent          45.87 
_refine_hist.pdbx_number_atoms_protein        6681 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009 ? 6910 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.941 ? 9413 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.053 ? 1020 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006 ? 1219 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 5.497 ? 4605 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 966 11.122 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 966 11.122 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.6757 2.7539  2307 . 110 2197 81.0000  . . . 0.3542 0.0000 0.2799 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.7539 2.8423  2819 . 148 2671 97.0000  . . . 0.3227 0.0000 0.2676 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.8423 2.9431  2776 . 146 2630 98.0000  . . . 0.3731 0.0000 0.2602 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.9431 3.0600  2810 . 118 2692 99.0000  . . . 0.2944 0.0000 0.2480 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.0600 3.1980  2859 . 141 2718 99.0000  . . . 0.2550 0.0000 0.2368 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.1980 3.3648  2860 . 139 2721 99.0000  . . . 0.2547 0.0000 0.2161 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.3648 3.5729  2848 . 138 2710 100.0000 . . . 0.2546 0.0000 0.1902 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.5729 3.8445  2878 . 153 2725 99.0000  . . . 0.2330 0.0000 0.1676 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.8445 4.2235  2898 . 144 2754 100.0000 . . . 0.2282 0.0000 0.1478 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 4.2235 4.8168  2910 . 139 2771 100.0000 . . . 0.1636 0.0000 0.1259 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 4.8168 6.0031  2972 . 128 2844 100.0000 . . . 0.1935 0.0000 0.1568 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 6.0031 14.9881 3065 . 144 2921 100.0000 . . . 0.2102 0.0000 0.1560 . . . . . . 12 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
1 2 
;(chain B and (resid 2 through 11 or (resid 12 and (name N or name CA or name C or name O or name CB )) or resid 13 through 16 or resid 18 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 51 or resid 53 through 66 or resid 68 through 71 or resid 77 through 94 or resid 96 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 2  A 16  
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 1 2 ? A 18 A 51  
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 1 3 ? A 53 A 60  
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 1 4 ? A 61 A 61  
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 1 5 ? A 1  A 133 
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 1 6 ? A 1  A 133 
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 1 7 ? A 1  A 133 
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 1 8 ? A 1  A 133 
;(chain A and (resid 2 through 16 or resid 18 through 51 or resid 53 through 60 or (resid 61 and (name N or name CA or name C or name O or name CB )) or resid 62 through 66 or resid 68 through 71 or (resid 77 and (name N or name CA or name C or name O or name CB )) or resid 78 or (resid 79 and (name N or name CA or name C or name O or name CB )) or resid 80 through 94 or resid 96 through 121 or (resid 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 2 1 ? B 2  B 11  
;(chain B and (resid 2 through 11 or (resid 12 and (name N or name CA or name C or name O or name CB )) or resid 13 through 16 or resid 18 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 51 or resid 53 through 66 or resid 68 through 71 or resid 77 through 94 or resid 96 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 2 2 ? B 12 B 12  
;(chain B and (resid 2 through 11 or (resid 12 and (name N or name CA or name C or name O or name CB )) or resid 13 through 16 or resid 18 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 51 or resid 53 through 66 or resid 68 through 71 or resid 77 through 94 or resid 96 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 2 3 ? B -1 B 133 
;(chain B and (resid 2 through 11 or (resid 12 and (name N or name CA or name C or name O or name CB )) or resid 13 through 16 or resid 18 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 51 or resid 53 through 66 or resid 68 through 71 or resid 77 through 94 or resid 96 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 2 4 ? B -1 B 133 
;(chain B and (resid 2 through 11 or (resid 12 and (name N or name CA or name C or name O or name CB )) or resid 13 through 16 or resid 18 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 51 or resid 53 through 66 or resid 68 through 71 or resid 77 through 94 or resid 96 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 2 5 ? B -1 B 133 
;(chain B and (resid 2 through 11 or (resid 12 and (name N or name CA or name C or name O or name CB )) or resid 13 through 16 or resid 18 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 51 or resid 53 through 66 or resid 68 through 71 or resid 77 through 94 or resid 96 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
1 2 6 ? B -1 B 133 
;(chain B and (resid 2 through 11 or (resid 12 and (name N or name CA or name C or name O or name CB )) or resid 13 through 16 or resid 18 through 39 or (resid 40 and (name N or name CA or name C or name O or name CB )) or resid 41 through 51 or resid 53 through 66 or resid 68 through 71 or resid 77 through 94 or resid 96 through 131 or (resid 132 and (name N or name CA or name C or name O or name CB )) or resid 133))
;
? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     5Y1Z 
_struct.title                        'Crystal structure of ZMYND8 PHD-BROMO-PWWP tandem in complex with Drebrin ADF-H domain' 
_struct.pdbx_descriptor              'Drebrin, Protein kinase C-binding protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5Y1Z 
_struct_keywords.text            'TRANSCRIPTION, NUCLEAR PROTEIN, PROTEIN BINDING, ACTIN BINDING' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 5 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
U N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 11  ? ARG A 24  ? HIS A 9   ARG A 22  1 ? 14 
HELX_P HELX_P2  AA2 GLY A 51  ? SER A 57  ? GLY A 49  SER A 55  1 ? 7  
HELX_P HELX_P3  AA3 GLY A 58  ? PHE A 60  ? GLY A 56  PHE A 58  5 ? 3  
HELX_P HELX_P4  AA4 PRO A 93  ? SER A 102 ? PRO A 91  SER A 100 1 ? 10 
HELX_P HELX_P5  AA5 HIS A 103 ? PHE A 111 ? HIS A 101 PHE A 109 1 ? 9  
HELX_P HELX_P6  AA6 SER A 122 ? ILE A 126 ? SER A 120 ILE A 124 5 ? 5  
HELX_P HELX_P7  AA7 ASP A 127 ? LEU A 135 ? ASP A 125 LEU A 133 1 ? 9  
HELX_P HELX_P8  AA8 HIS B 11  ? ARG B 24  ? HIS B 9   ARG B 22  1 ? 14 
HELX_P HELX_P9  AA9 GLY B 51  ? SER B 57  ? GLY B 49  SER B 55  1 ? 7  
HELX_P HELX_P10 AB1 GLY B 58  ? PHE B 60  ? GLY B 56  PHE B 58  5 ? 3  
HELX_P HELX_P11 AB2 PRO B 93  ? SER B 102 ? PRO B 91  SER B 100 1 ? 10 
HELX_P HELX_P12 AB3 HIS B 103 ? PHE B 111 ? HIS B 101 PHE B 109 1 ? 9  
HELX_P HELX_P13 AB4 SER B 122 ? ILE B 126 ? SER B 120 ILE B 124 5 ? 5  
HELX_P HELX_P14 AB5 ASP B 127 ? LEU B 135 ? ASP B 125 LEU B 133 1 ? 9  
HELX_P HELX_P15 AB6 ALA C 30  ? ARG C 34  ? ALA C 112 ARG C 116 5 ? 5  
HELX_P HELX_P16 AB7 CYS C 45  ? GLU C 55  ? CYS C 127 GLU C 137 1 ? 11 
HELX_P HELX_P17 AB8 CYS C 56  ? GLN C 60  ? CYS C 138 GLN C 142 5 ? 5  
HELX_P HELX_P18 AB9 SER C 61  ? MET C 66  ? SER C 143 MET C 148 1 ? 6  
HELX_P HELX_P19 AC1 THR C 68  ? LYS C 84  ? THR C 150 LYS C 166 1 ? 17 
HELX_P HELX_P20 AC2 THR C 88  ? GLN C 92  ? THR C 170 GLN C 174 5 ? 5  
HELX_P HELX_P21 AC3 ASP C 102 ? TYR C 106 ? ASP C 184 TYR C 188 5 ? 5  
HELX_P HELX_P22 AC4 ASP C 112 ? LYS C 122 ? ASP C 194 LYS C 204 1 ? 11 
HELX_P HELX_P23 AC5 CYS C 127 ? GLY C 147 ? CYS C 209 GLY C 229 1 ? 21 
HELX_P HELX_P24 AC6 HIS C 150 ? CYS C 173 ? HIS C 232 CYS C 255 1 ? 24 
HELX_P HELX_P25 AC7 CYS C 173 ? LYS C 183 ? CYS C 255 LYS C 265 1 ? 11 
HELX_P HELX_P26 AC8 ASN C 186 ? GLU C 190 ? ASN C 268 GLU C 272 5 ? 5  
HELX_P HELX_P27 AC9 ASN C 237 ? CYS C 239 ? ASN C 319 CYS C 321 5 ? 3  
HELX_P HELX_P28 AD1 THR C 253 ? GLY C 276 ? THR C 335 GLY C 358 1 ? 24 
HELX_P HELX_P29 AD2 GLN C 292 ? LEU C 296 ? GLN C 374 LEU C 378 5 ? 5  
HELX_P HELX_P30 AD3 ASN C 301 ? GLY C 305 ? ASN C 383 GLY C 387 5 ? 5  
HELX_P HELX_P31 AD4 HIS D 29  ? ARG D 34  ? HIS D 111 ARG D 116 5 ? 6  
HELX_P HELX_P32 AD5 CYS D 45  ? CYS D 56  ? CYS D 127 CYS D 138 1 ? 12 
HELX_P HELX_P33 AD6 SER D 61  ? MET D 66  ? SER D 143 MET D 148 1 ? 6  
HELX_P HELX_P34 AD7 THR D 68  ? LYS D 84  ? THR D 150 LYS D 166 1 ? 17 
HELX_P HELX_P35 AD8 THR D 88  ? GLN D 92  ? THR D 170 GLN D 174 5 ? 5  
HELX_P HELX_P36 AD9 HIS D 100 ? TYR D 106 ? HIS D 182 TYR D 188 5 ? 7  
HELX_P HELX_P37 AE1 ASP D 112 ? LYS D 122 ? ASP D 194 LYS D 204 1 ? 11 
HELX_P HELX_P38 AE2 CYS D 127 ? GLY D 147 ? CYS D 209 GLY D 229 1 ? 21 
HELX_P HELX_P39 AE3 HIS D 150 ? CYS D 173 ? HIS D 232 CYS D 255 1 ? 24 
HELX_P HELX_P40 AE4 CYS D 173 ? LYS D 183 ? CYS D 255 LYS D 265 1 ? 11 
HELX_P HELX_P41 AE5 ASN D 186 ? GLU D 190 ? ASN D 268 GLU D 272 5 ? 5  
HELX_P HELX_P42 AE6 VAL D 250 ? LYS D 252 ? VAL D 332 LYS D 334 5 ? 3  
HELX_P HELX_P43 AE7 THR D 253 ? GLY D 276 ? THR D 335 GLY D 358 1 ? 24 
HELX_P HELX_P44 AE8 GLN D 292 ? LEU D 296 ? GLN D 374 LEU D 378 5 ? 5  
HELX_P HELX_P45 AE9 ASN D 301 ? GLY D 305 ? ASN D 383 GLY D 387 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C CYS 9   SG  ? ? ? 1_555 F ZN . ZN ? ? C CYS 91  C ZN 501 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc2  metalc ? ? C CYS 12  SG  ? ? ? 1_555 F ZN . ZN ? ? C CYS 94  C ZN 501 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc3  metalc ? ? C CYS 21  SG  ? ? ? 1_555 H ZN . ZN ? ? C CYS 103 C ZN 503 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc4  metalc ? ? C CYS 24  SG  ? ? ? 1_555 H ZN . ZN ? ? C CYS 106 C ZN 503 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc5  metalc ? ? C HIS 29  ND1 ? ? ? 1_555 F ZN . ZN ? ? C HIS 111 C ZN 501 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc6  metalc ? ? C CYS 32  SG  ? ? ? 1_555 F ZN . ZN ? ? C CYS 114 C ZN 501 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc7  metalc ? ? C CYS 45  SG  ? ? ? 1_555 H ZN . ZN ? ? C CYS 127 C ZN 503 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc8  metalc ? ? C CYS 48  SG  ? ? ? 1_555 H ZN . ZN ? ? C CYS 130 C ZN 503 1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc9  metalc ? ? C CYS 173 SG  ? ? ? 1_555 G ZN . ZN ? ? C CYS 255 C ZN 502 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc10 metalc ? ? C CYS 176 SG  ? ? ? 1_555 G ZN . ZN ? ? C CYS 258 C ZN 502 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc11 metalc ? ? C CYS 192 SG  ? ? ? 1_555 G ZN . ZN ? ? C CYS 274 C ZN 502 1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc12 metalc ? ? C HIS 196 NE2 ? ? ? 1_555 G ZN . ZN ? ? C HIS 278 C ZN 502 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc13 metalc ? ? D CYS 9   SG  ? ? ? 1_555 M ZN . ZN ? ? D CYS 91  D ZN 502 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc14 metalc ? ? D CYS 12  SG  ? ? ? 1_555 M ZN . ZN ? ? D CYS 94  D ZN 502 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc15 metalc ? ? D CYS 21  SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 103 D ZN 501 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc16 metalc ? ? D CYS 24  SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 106 D ZN 501 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc17 metalc ? ? D HIS 29  ND1 ? ? ? 1_555 M ZN . ZN ? ? D HIS 111 D ZN 502 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc18 metalc ? ? D CYS 32  SG  ? ? ? 1_555 M ZN . ZN ? ? D CYS 114 D ZN 502 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc19 metalc ? ? D CYS 45  SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 127 D ZN 501 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc20 metalc ? ? D CYS 48  SG  ? ? ? 1_555 L ZN . ZN ? ? D CYS 130 D ZN 501 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc21 metalc ? ? D CYS 173 SG  ? ? ? 1_555 N ZN . ZN ? ? D CYS 255 D ZN 503 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc22 metalc ? ? D CYS 176 SG  ? ? ? 1_555 N ZN . ZN ? ? D CYS 258 D ZN 503 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc23 metalc ? ? D CYS 192 SG  ? ? ? 1_555 N ZN . ZN ? ? D CYS 274 D ZN 503 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc24 metalc ? ? D HIS 196 NE2 ? ? ? 1_555 N ZN . ZN ? ? D HIS 278 D ZN 503 1_555 ? ? ? ? ? ? ? 2.222 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 43  ? GLY A 49  ? LEU A 41  GLY A 47  
AA1 2 TRP A 31  ? TYR A 36  ? TRP A 29  TYR A 34  
AA1 3 VAL A 65  ? VAL A 72  ? VAL A 63  VAL A 70  
AA1 4 LYS A 81  ? VAL A 88  ? LYS A 79  VAL A 86  
AA1 5 VAL A 116 ? ALA A 120 ? VAL A 114 ALA A 118 
AA2 1 LEU B 43  ? GLY B 49  ? LEU B 41  GLY B 47  
AA2 2 TRP B 31  ? TYR B 36  ? TRP B 29  TYR B 34  
AA2 3 VAL B 65  ? LYS B 73  ? VAL B 63  LYS B 71  
AA2 4 PRO B 80  ? VAL B 88  ? PRO B 78  VAL B 86  
AA2 5 VAL B 116 ? ALA B 120 ? VAL B 114 ALA B 118 
AA3 1 LEU C 19  ? CYS C 20  ? LEU C 101 CYS C 102 
AA3 2 VAL C 27  ? TYR C 28  ? VAL C 109 TYR C 110 
AA4 1 ARG C 231 ? PRO C 235 ? ARG C 313 PRO C 317 
AA4 2 GLN C 220 ? PHE C 225 ? GLN C 302 PHE C 307 
AA4 3 TRP C 209 ? LYS C 217 ? TRP C 291 LYS C 299 
AA4 4 LEU C 198 ? ALA C 201 ? LEU C 280 ALA C 283 
AA4 5 TYR C 240 ? LEU C 241 ? TYR C 322 LEU C 323 
AA5 1 LEU D 19  ? CYS D 20  ? LEU D 101 CYS D 102 
AA5 2 VAL D 27  ? TYR D 28  ? VAL D 109 TYR D 110 
AA6 1 ARG D 231 ? PRO D 235 ? ARG D 313 PRO D 317 
AA6 2 GLN D 220 ? PHE D 225 ? GLN D 302 PHE D 307 
AA6 3 TRP D 209 ? LYS D 217 ? TRP D 291 LYS D 299 
AA6 4 LEU D 198 ? ALA D 201 ? LEU D 280 ALA D 283 
AA6 5 CYS D 239 ? LEU D 241 ? CYS D 321 LEU D 323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ALA A 46  ? O ALA A 44  N LEU A 33  ? N LEU A 31  
AA1 2 3 N ALA A 32  ? N ALA A 30  O PHE A 69  ? O PHE A 67  
AA1 3 4 N VAL A 72  ? N VAL A 70  O LYS A 81  ? O LYS A 79  
AA1 4 5 N LEU A 84  ? N LEU A 82  O VAL A 116 ? O VAL A 114 
AA2 1 2 O ALA B 46  ? O ALA B 44  N LEU B 33  ? N LEU B 31  
AA2 2 3 N ALA B 32  ? N ALA B 30  O PHE B 69  ? O PHE B 67  
AA2 3 4 N VAL B 72  ? N VAL B 70  O LYS B 81  ? O LYS B 79  
AA2 4 5 N LEU B 84  ? N LEU B 82  O VAL B 118 ? O VAL B 116 
AA3 1 2 N LEU C 19  ? N LEU C 101 O TYR C 28  ? O TYR C 110 
AA4 1 2 O ALA C 232 ? O ALA C 314 N ALA C 223 ? N ALA C 305 
AA4 2 3 O ASP C 222 ? O ASP C 304 N LEU C 214 ? N LEU C 296 
AA4 3 4 O TRP C 209 ? O TRP C 291 N ALA C 201 ? N ALA C 283 
AA4 4 5 N TRP C 200 ? N TRP C 282 O TYR C 240 ? O TYR C 322 
AA5 1 2 N LEU D 19  ? N LEU D 101 O TYR D 28  ? O TYR D 110 
AA6 1 2 O VAL D 234 ? O VAL D 316 N VAL D 221 ? N VAL D 303 
AA6 2 3 O ASP D 222 ? O ASP D 304 N LEU D 214 ? N LEU D 296 
AA6 3 4 O ALA D 211 ? O ALA D 293 N VAL D 199 ? N VAL D 281 
AA6 4 5 N TRP D 200 ? N TRP D 282 O TYR D 240 ? O TYR D 322 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 201 ? 3 'binding site for residue SO4 A 201' 
AC2 Software C ZN  501 ? 4 'binding site for residue ZN C 501'  
AC3 Software C ZN  502 ? 4 'binding site for residue ZN C 502'  
AC4 Software C ZN  503 ? 4 'binding site for residue ZN C 503'  
AC5 Software C SO4 504 ? 4 'binding site for residue SO4 C 504' 
AC6 Software C SO4 505 ? 3 'binding site for residue SO4 C 505' 
AC7 Software C SO4 506 ? 2 'binding site for residue SO4 C 506' 
AC8 Software D ZN  501 ? 4 'binding site for residue ZN D 501'  
AC9 Software D ZN  502 ? 4 'binding site for residue ZN D 502'  
AD1 Software D ZN  503 ? 4 'binding site for residue ZN D 503'  
AD2 Software D SO4 504 ? 4 'binding site for residue SO4 D 504' 
AD3 Software D SO4 505 ? 3 'binding site for residue SO4 D 505' 
AD4 Software D GOL 506 ? 4 'binding site for residue GOL D 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 PRO A 93  ? PRO A 91  . ? 1_555 ? 
2  AC1 3 ASP A 94  ? ASP A 92  . ? 1_555 ? 
3  AC1 3 LYS C 151 ? LYS C 233 . ? 1_555 ? 
4  AC2 4 CYS C 9   ? CYS C 91  . ? 1_555 ? 
5  AC2 4 CYS C 12  ? CYS C 94  . ? 1_555 ? 
6  AC2 4 HIS C 29  ? HIS C 111 . ? 1_555 ? 
7  AC2 4 CYS C 32  ? CYS C 114 . ? 1_555 ? 
8  AC3 4 CYS C 173 ? CYS C 255 . ? 1_555 ? 
9  AC3 4 CYS C 176 ? CYS C 258 . ? 1_555 ? 
10 AC3 4 CYS C 192 ? CYS C 274 . ? 1_555 ? 
11 AC3 4 HIS C 196 ? HIS C 278 . ? 1_555 ? 
12 AC4 4 CYS C 21  ? CYS C 103 . ? 1_555 ? 
13 AC4 4 CYS C 24  ? CYS C 106 . ? 1_555 ? 
14 AC4 4 CYS C 45  ? CYS C 127 . ? 1_555 ? 
15 AC4 4 CYS C 48  ? CYS C 130 . ? 1_555 ? 
16 AC5 4 ARG C 272 ? ARG C 354 . ? 1_555 ? 
17 AC5 4 TYR C 280 ? TYR C 362 . ? 1_555 ? 
18 AC5 4 SO4 J .   ? SO4 C 505 . ? 1_555 ? 
19 AC5 4 HOH T .   ? HOH C 608 . ? 1_555 ? 
20 AC6 3 ARG C 272 ? ARG C 354 . ? 1_555 ? 
21 AC6 3 SO4 I .   ? SO4 C 504 . ? 1_555 ? 
22 AC6 3 ARG D 14  ? ARG D 96  . ? 1_555 ? 
23 AC7 2 LYS C 202 ? LYS C 284 . ? 1_555 ? 
24 AC7 2 GLY C 205 ? GLY C 287 . ? 1_555 ? 
25 AC8 4 CYS D 21  ? CYS D 103 . ? 1_555 ? 
26 AC8 4 CYS D 24  ? CYS D 106 . ? 1_555 ? 
27 AC8 4 CYS D 45  ? CYS D 127 . ? 1_555 ? 
28 AC8 4 CYS D 48  ? CYS D 130 . ? 1_555 ? 
29 AC9 4 CYS D 9   ? CYS D 91  . ? 1_555 ? 
30 AC9 4 CYS D 12  ? CYS D 94  . ? 1_555 ? 
31 AC9 4 HIS D 29  ? HIS D 111 . ? 1_555 ? 
32 AC9 4 CYS D 32  ? CYS D 114 . ? 1_555 ? 
33 AD1 4 CYS D 173 ? CYS D 255 . ? 1_555 ? 
34 AD1 4 CYS D 176 ? CYS D 258 . ? 1_555 ? 
35 AD1 4 CYS D 192 ? CYS D 274 . ? 1_555 ? 
36 AD1 4 HIS D 196 ? HIS D 278 . ? 1_555 ? 
37 AD2 4 ASN D 168 ? ASN D 250 . ? 1_555 ? 
38 AD2 4 ARG D 215 ? ARG D 297 . ? 1_555 ? 
39 AD2 4 ARG D 231 ? ARG D 313 . ? 1_555 ? 
40 AD2 4 TRP D 233 ? TRP D 315 . ? 1_555 ? 
41 AD3 3 LYS D 217 ? LYS D 299 . ? 1_555 ? 
42 AD3 3 ASP D 218 ? ASP D 300 . ? 1_555 ? 
43 AD3 3 TRP D 233 ? TRP D 315 . ? 1_555 ? 
44 AD4 4 ARG C 273 ? ARG C 355 . ? 1_555 ? 
45 AD4 4 GLN D 17  ? GLN D 99  . ? 1_555 ? 
46 AD4 4 HOH U .   ? HOH D 623 . ? 1_555 ? 
47 AD4 4 HOH U .   ? HOH D 624 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5Y1Z 
_atom_sites.fract_transf_matrix[1][1]   0.018456 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007241 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006205 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 3   ? 28.730  20.054  55.834  1.00 88.68  ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 3   ? 28.572  21.423  56.337  1.00 87.23  ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 3   ? 28.070  22.343  55.231  1.00 83.84  ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 3   ? 28.530  22.285  54.096  1.00 85.30  ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 3   ? 29.891  21.971  56.917  1.00 85.24  ? 1   MET A CB  1 
ATOM   6    N  N   . ALA A 1 4   ? 27.107  23.192  55.576  1.00 80.23  ? 2   ALA A N   1 
ATOM   7    C  CA  . ALA A 1 4   ? 26.602  24.159  54.612  1.00 75.71  ? 2   ALA A CA  1 
ATOM   8    C  C   . ALA A 1 4   ? 27.710  25.055  54.087  1.00 72.44  ? 2   ALA A C   1 
ATOM   9    O  O   . ALA A 1 4   ? 27.620  25.552  52.958  1.00 73.59  ? 2   ALA A O   1 
ATOM   10   C  CB  . ALA A 1 4   ? 25.487  25.003  55.240  1.00 77.24  ? 2   ALA A CB  1 
ATOM   11   N  N   . GLY A 1 5   ? 28.744  25.299  54.887  1.00 69.24  ? 3   GLY A N   1 
ATOM   12   C  CA  . GLY A 1 5   ? 29.811  26.188  54.464  1.00 63.17  ? 3   GLY A CA  1 
ATOM   13   C  C   . GLY A 1 5   ? 29.481  27.631  54.793  1.00 55.16  ? 3   GLY A C   1 
ATOM   14   O  O   . GLY A 1 5   ? 28.628  27.927  55.634  1.00 54.21  ? 3   GLY A O   1 
ATOM   15   N  N   . VAL A 1 6   ? 30.163  28.546  54.098  1.00 52.72  ? 4   VAL A N   1 
ATOM   16   C  CA  . VAL A 1 6   ? 29.873  29.965  54.267  1.00 49.81  ? 4   VAL A CA  1 
ATOM   17   C  C   . VAL A 1 6   ? 28.382  30.225  54.089  1.00 48.58  ? 4   VAL A C   1 
ATOM   18   O  O   . VAL A 1 6   ? 27.732  29.657  53.211  1.00 53.48  ? 4   VAL A O   1 
ATOM   19   C  CB  . VAL A 1 6   ? 30.731  30.813  53.313  1.00 49.48  ? 4   VAL A CB  1 
ATOM   20   C  CG1 . VAL A 1 6   ? 30.277  30.667  51.887  1.00 44.94  ? 4   VAL A CG1 1 
ATOM   21   C  CG2 . VAL A 1 6   ? 30.663  32.301  53.753  1.00 50.72  ? 4   VAL A CG2 1 
ATOM   22   N  N   . SER A 1 7   ? 27.824  31.019  54.980  1.00 44.83  ? 5   SER A N   1 
ATOM   23   C  CA  . SER A 1 7   ? 26.432  31.415  54.929  1.00 45.53  ? 5   SER A CA  1 
ATOM   24   C  C   . SER A 1 7   ? 26.309  32.927  54.774  1.00 46.33  ? 5   SER A C   1 
ATOM   25   O  O   . SER A 1 7   ? 27.078  33.694  55.365  1.00 49.15  ? 5   SER A O   1 
ATOM   26   C  CB  . SER A 1 7   ? 25.711  30.977  56.186  1.00 49.39  ? 5   SER A CB  1 
ATOM   27   O  OG  . SER A 1 7   ? 24.627  31.851  56.442  1.00 55.25  ? 5   SER A OG  1 
ATOM   28   N  N   . PHE A 1 8   ? 25.347  33.361  53.969  1.00 44.17  ? 6   PHE A N   1 
ATOM   29   C  CA  . PHE A 1 8   ? 25.054  34.781  53.860  1.00 43.67  ? 6   PHE A CA  1 
ATOM   30   C  C   . PHE A 1 8   ? 23.654  35.124  54.352  1.00 48.36  ? 6   PHE A C   1 
ATOM   31   O  O   . PHE A 1 8   ? 23.130  36.180  53.994  1.00 52.83  ? 6   PHE A O   1 
ATOM   32   C  CB  . PHE A 1 8   ? 25.234  35.262  52.426  1.00 43.39  ? 6   PHE A CB  1 
ATOM   33   C  CG  . PHE A 1 8   ? 26.508  34.804  51.784  1.00 45.51  ? 6   PHE A CG  1 
ATOM   34   C  CD1 . PHE A 1 8   ? 27.681  35.508  51.958  1.00 47.42  ? 6   PHE A CD1 1 
ATOM   35   C  CD2 . PHE A 1 8   ? 26.538  33.669  51.008  1.00 43.87  ? 6   PHE A CD2 1 
ATOM   36   C  CE1 . PHE A 1 8   ? 28.853  35.066  51.347  1.00 48.35  ? 6   PHE A CE1 1 
ATOM   37   C  CE2 . PHE A 1 8   ? 27.714  33.231  50.407  1.00 41.51  ? 6   PHE A CE2 1 
ATOM   38   C  CZ  . PHE A 1 8   ? 28.855  33.911  50.573  1.00 41.98  ? 6   PHE A CZ  1 
ATOM   39   N  N   . SER A 1 9   ? 23.032  34.271  55.169  1.00 48.64  ? 7   SER A N   1 
ATOM   40   C  CA  . SER A 1 9   ? 21.629  34.498  55.503  1.00 50.77  ? 7   SER A CA  1 
ATOM   41   C  C   . SER A 1 9   ? 21.497  35.521  56.613  1.00 52.69  ? 7   SER A C   1 
ATOM   42   O  O   . SER A 1 9   ? 20.947  36.609  56.407  1.00 53.93  ? 7   SER A O   1 
ATOM   43   C  CB  . SER A 1 9   ? 20.966  33.191  55.931  1.00 55.26  ? 7   SER A CB  1 
ATOM   44   O  OG  . SER A 1 9   ? 21.053  32.240  54.903  1.00 59.10  ? 7   SER A OG  1 
ATOM   45   N  N   . GLY A 1 10  ? 22.028  35.205  57.790  1.00 54.44  ? 8   GLY A N   1 
ATOM   46   C  CA  . GLY A 1 10  ? 22.057  36.191  58.842  1.00 56.20  ? 8   GLY A CA  1 
ATOM   47   C  C   . GLY A 1 10  ? 22.978  37.306  58.403  1.00 60.75  ? 8   GLY A C   1 
ATOM   48   O  O   . GLY A 1 10  ? 24.037  37.066  57.815  1.00 66.79  ? 8   GLY A O   1 
ATOM   49   N  N   . HIS A 1 11  ? 22.535  38.538  58.625  1.00 61.37  ? 9   HIS A N   1 
ATOM   50   C  CA  . HIS A 1 11  ? 23.245  39.754  58.219  1.00 61.10  ? 9   HIS A CA  1 
ATOM   51   C  C   . HIS A 1 11  ? 23.216  40.003  56.724  1.00 57.41  ? 9   HIS A C   1 
ATOM   52   O  O   . HIS A 1 11  ? 24.046  40.762  56.227  1.00 59.94  ? 9   HIS A O   1 
ATOM   53   C  CB  . HIS A 1 11  ? 24.729  39.753  58.623  1.00 63.67  ? 9   HIS A CB  1 
ATOM   54   C  CG  . HIS A 1 11  ? 24.983  39.488  60.068  1.00 69.43  ? 9   HIS A CG  1 
ATOM   55   N  ND1 . HIS A 1 11  ? 25.154  38.214  60.569  1.00 71.11  ? 9   HIS A ND1 1 
ATOM   56   C  CD2 . HIS A 1 11  ? 25.133  40.332  61.115  1.00 71.87  ? 9   HIS A CD2 1 
ATOM   57   C  CE1 . HIS A 1 11  ? 25.377  38.284  61.868  1.00 74.04  ? 9   HIS A CE1 1 
ATOM   58   N  NE2 . HIS A 1 11  ? 25.377  39.559  62.223  1.00 74.82  ? 9   HIS A NE2 1 
ATOM   59   N  N   . ARG A 1 12  ? 22.325  39.373  55.966  1.00 51.90  ? 10  ARG A N   1 
ATOM   60   C  CA  . ARG A 1 12  ? 22.416  39.522  54.520  1.00 48.09  ? 10  ARG A CA  1 
ATOM   61   C  C   . ARG A 1 12  ? 22.324  40.991  54.127  1.00 49.08  ? 10  ARG A C   1 
ATOM   62   O  O   . ARG A 1 12  ? 23.138  41.495  53.334  1.00 51.11  ? 10  ARG A O   1 
ATOM   63   C  CB  . ARG A 1 12  ? 21.333  38.706  53.816  1.00 48.53  ? 10  ARG A CB  1 
ATOM   64   C  CG  . ARG A 1 12  ? 21.433  38.822  52.299  1.00 43.87  ? 10  ARG A CG  1 
ATOM   65   C  CD  . ARG A 1 12  ? 20.355  38.062  51.632  1.00 47.81  ? 10  ARG A CD  1 
ATOM   66   N  NE  . ARG A 1 12  ? 20.865  36.752  51.273  1.00 52.22  ? 10  ARG A NE  1 
ATOM   67   C  CZ  . ARG A 1 12  ? 21.153  36.371  50.039  1.00 53.50  ? 10  ARG A CZ  1 
ATOM   68   N  NH1 . ARG A 1 12  ? 20.973  37.189  49.021  1.00 55.53  ? 10  ARG A NH1 1 
ATOM   69   N  NH2 . ARG A 1 12  ? 21.619  35.164  49.831  1.00 54.01  ? 10  ARG A NH2 1 
ATOM   70   N  N   . LEU A 1 13  ? 21.359  41.704  54.713  1.00 48.11  ? 11  LEU A N   1 
ATOM   71   C  CA  . LEU A 1 13  ? 21.122  43.086  54.321  1.00 49.37  ? 11  LEU A CA  1 
ATOM   72   C  C   . LEU A 1 13  ? 22.344  43.956  54.587  1.00 48.36  ? 11  LEU A C   1 
ATOM   73   O  O   . LEU A 1 13  ? 22.686  44.821  53.769  1.00 49.56  ? 11  LEU A O   1 
ATOM   74   C  CB  . LEU A 1 13  ? 19.891  43.625  55.047  1.00 55.23  ? 11  LEU A CB  1 
ATOM   75   C  CG  . LEU A 1 13  ? 19.494  45.060  54.694  1.00 56.37  ? 11  LEU A CG  1 
ATOM   76   C  CD1 . LEU A 1 13  ? 19.274  45.102  53.229  1.00 55.15  ? 11  LEU A CD1 1 
ATOM   77   C  CD2 . LEU A 1 13  ? 18.243  45.500  55.443  1.00 57.59  ? 11  LEU A CD2 1 
ATOM   78   N  N   . GLU A 1 14  ? 23.032  43.734  55.712  1.00 47.34  ? 12  GLU A N   1 
ATOM   79   C  CA  . GLU A 1 14  ? 24.220  44.535  55.982  1.00 46.49  ? 12  GLU A CA  1 
ATOM   80   C  C   . GLU A 1 14  ? 25.315  44.239  54.964  1.00 48.51  ? 12  GLU A C   1 
ATOM   81   O  O   . GLU A 1 14  ? 25.966  45.167  54.451  1.00 50.99  ? 12  GLU A O   1 
ATOM   82   C  CB  . GLU A 1 14  ? 24.720  44.301  57.412  1.00 45.51  ? 12  GLU A CB  1 
ATOM   83   N  N   . LEU A 1 15  ? 25.511  42.956  54.634  1.00 45.71  ? 13  LEU A N   1 
ATOM   84   C  CA  . LEU A 1 15  ? 26.555  42.592  53.683  1.00 43.44  ? 13  LEU A CA  1 
ATOM   85   C  C   . LEU A 1 15  ? 26.319  43.246  52.329  1.00 43.65  ? 13  LEU A C   1 
ATOM   86   O  O   . LEU A 1 15  ? 27.231  43.849  51.734  1.00 42.52  ? 13  LEU A O   1 
ATOM   87   C  CB  . LEU A 1 15  ? 26.623  41.071  53.532  1.00 45.65  ? 13  LEU A CB  1 
ATOM   88   C  CG  . LEU A 1 15  ? 26.584  40.149  54.760  1.00 45.08  ? 13  LEU A CG  1 
ATOM   89   C  CD1 . LEU A 1 15  ? 26.387  38.696  54.328  1.00 46.00  ? 13  LEU A CD1 1 
ATOM   90   C  CD2 . LEU A 1 15  ? 27.832  40.312  55.610  1.00 40.44  ? 13  LEU A CD2 1 
ATOM   91   N  N   . LEU A 1 16  ? 25.092  43.142  51.819  1.00 44.90  ? 14  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 16  ? 24.847  43.720  50.511  1.00 44.64  ? 14  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 16  ? 24.793  45.240  50.552  1.00 48.06  ? 14  LEU A C   1 
ATOM   94   O  O   . LEU A 1 16  ? 25.091  45.873  49.544  1.00 48.67  ? 14  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 16  ? 23.573  43.145  49.931  1.00 44.66  ? 14  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 16  ? 23.861  41.694  49.539  1.00 48.87  ? 14  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 16  ? 22.581  40.967  49.094  1.00 43.26  ? 14  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 16  ? 24.963  41.584  48.488  1.00 40.49  ? 14  LEU A CD2 1 
ATOM   99   N  N   . ALA A 1 17  ? 24.469  45.840  51.701  1.00 48.26  ? 15  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 17  ? 24.471  47.295  51.801  1.00 48.29  ? 15  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 17  ? 25.889  47.846  51.721  1.00 47.95  ? 15  ALA A C   1 
ATOM   102  O  O   . ALA A 1 17  ? 26.132  48.877  51.072  1.00 50.92  ? 15  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 17  ? 23.782  47.722  53.092  1.00 46.03  ? 15  ALA A CB  1 
ATOM   104  N  N   . ALA A 1 18  ? 26.840  47.185  52.386  1.00 46.02  ? 16  ALA A N   1 
ATOM   105  C  CA  . ALA A 1 18  ? 28.232  47.602  52.261  1.00 43.82  ? 16  ALA A CA  1 
ATOM   106  C  C   . ALA A 1 18  ? 28.721  47.432  50.834  1.00 46.48  ? 16  ALA A C   1 
ATOM   107  O  O   . ALA A 1 18  ? 29.362  48.331  50.269  1.00 46.13  ? 16  ALA A O   1 
ATOM   108  C  CB  . ALA A 1 18  ? 29.100  46.796  53.211  1.00 42.61  ? 16  ALA A CB  1 
ATOM   109  N  N   . TYR A 1 19  ? 28.413  46.281  50.229  1.00 46.69  ? 17  TYR A N   1 
ATOM   110  C  CA  . TYR A 1 19  ? 28.874  46.020  48.872  1.00 43.96  ? 17  TYR A CA  1 
ATOM   111  C  C   . TYR A 1 19  ? 28.276  47.013  47.880  1.00 45.28  ? 17  TYR A C   1 
ATOM   112  O  O   . TYR A 1 19  ? 28.969  47.510  46.976  1.00 43.94  ? 17  TYR A O   1 
ATOM   113  C  CB  . TYR A 1 19  ? 28.513  44.583  48.515  1.00 45.73  ? 17  TYR A CB  1 
ATOM   114  C  CG  . TYR A 1 19  ? 28.433  44.254  47.051  1.00 46.38  ? 17  TYR A CG  1 
ATOM   115  C  CD1 . TYR A 1 19  ? 29.577  43.973  46.319  1.00 46.67  ? 17  TYR A CD1 1 
ATOM   116  C  CD2 . TYR A 1 19  ? 27.207  44.180  46.418  1.00 47.14  ? 17  TYR A CD2 1 
ATOM   117  C  CE1 . TYR A 1 19  ? 29.496  43.648  44.982  1.00 52.47  ? 17  TYR A CE1 1 
ATOM   118  C  CE2 . TYR A 1 19  ? 27.109  43.843  45.093  1.00 52.27  ? 17  TYR A CE2 1 
ATOM   119  C  CZ  . TYR A 1 19  ? 28.253  43.577  44.372  1.00 55.42  ? 17  TYR A CZ  1 
ATOM   120  O  OH  . TYR A 1 19  ? 28.140  43.245  43.039  1.00 58.65  ? 17  TYR A OH  1 
ATOM   121  N  N   . GLU A 1 20  ? 26.992  47.323  48.041  1.00 46.20  ? 18  GLU A N   1 
ATOM   122  C  CA  . GLU A 1 20  ? 26.347  48.303  47.180  1.00 47.10  ? 18  GLU A CA  1 
ATOM   123  C  C   . GLU A 1 20  ? 27.000  49.670  47.343  1.00 46.98  ? 18  GLU A C   1 
ATOM   124  O  O   . GLU A 1 20  ? 27.192  50.389  46.357  1.00 47.69  ? 18  GLU A O   1 
ATOM   125  C  CB  . GLU A 1 20  ? 24.848  48.345  47.476  1.00 50.00  ? 18  GLU A CB  1 
ATOM   126  C  CG  . GLU A 1 20  ? 24.086  49.407  46.719  1.00 64.28  ? 18  GLU A CG  1 
ATOM   127  C  CD  . GLU A 1 20  ? 22.583  49.190  46.775  1.00 79.43  ? 18  GLU A CD  1 
ATOM   128  O  OE1 . GLU A 1 20  ? 22.006  49.244  47.892  1.00 84.11  ? 18  GLU A OE1 1 
ATOM   129  O  OE2 . GLU A 1 20  ? 21.970  48.972  45.704  1.00 85.17  ? 18  GLU A OE2 1 
ATOM   130  N  N   . GLU A 1 21  ? 27.358  50.043  48.583  1.00 51.79  ? 19  GLU A N   1 
ATOM   131  C  CA  . GLU A 1 21  ? 28.098  51.290  48.793  1.00 55.52  ? 19  GLU A CA  1 
ATOM   132  C  C   . GLU A 1 21  ? 29.416  51.287  48.034  1.00 53.85  ? 19  GLU A C   1 
ATOM   133  O  O   . GLU A 1 21  ? 29.814  52.307  47.458  1.00 53.72  ? 19  GLU A O   1 
ATOM   134  C  CB  . GLU A 1 21  ? 28.370  51.507  50.276  1.00 63.82  ? 19  GLU A CB  1 
ATOM   135  C  CG  . GLU A 1 21  ? 27.405  52.425  50.951  1.00 76.73  ? 19  GLU A CG  1 
ATOM   136  C  CD  . GLU A 1 21  ? 27.865  53.873  50.904  1.00 90.28  ? 19  GLU A CD  1 
ATOM   137  O  OE1 . GLU A 1 21  ? 28.979  54.165  51.415  1.00 91.76  ? 19  GLU A OE1 1 
ATOM   138  O  OE2 . GLU A 1 21  ? 27.108  54.723  50.362  1.00 96.97  ? 19  GLU A OE2 1 
ATOM   139  N  N   . VAL A 1 22  ? 30.106  50.144  48.009  1.00 54.06  ? 20  VAL A N   1 
ATOM   140  C  CA  . VAL A 1 22  ? 31.374  50.092  47.285  1.00 54.57  ? 20  VAL A CA  1 
ATOM   141  C  C   . VAL A 1 22  ? 31.157  50.196  45.775  1.00 58.17  ? 20  VAL A C   1 
ATOM   142  O  O   . VAL A 1 22  ? 31.952  50.828  45.070  1.00 59.47  ? 20  VAL A O   1 
ATOM   143  C  CB  . VAL A 1 22  ? 32.144  48.813  47.657  1.00 49.98  ? 20  VAL A CB  1 
ATOM   144  C  CG1 . VAL A 1 22  ? 33.304  48.609  46.711  1.00 49.51  ? 20  VAL A CG1 1 
ATOM   145  C  CG2 . VAL A 1 22  ? 32.629  48.881  49.094  1.00 46.22  ? 20  VAL A CG2 1 
ATOM   146  N  N   . ILE A 1 23  ? 30.069  49.622  45.255  1.00 61.35  ? 21  ILE A N   1 
ATOM   147  C  CA  . ILE A 1 23  ? 29.844  49.644  43.809  1.00 62.60  ? 21  ILE A CA  1 
ATOM   148  C  C   . ILE A 1 23  ? 29.435  51.037  43.339  1.00 64.18  ? 21  ILE A C   1 
ATOM   149  O  O   . ILE A 1 23  ? 29.783  51.459  42.231  1.00 64.70  ? 21  ILE A O   1 
ATOM   150  C  CB  . ILE A 1 23  ? 28.786  48.597  43.408  1.00 66.71  ? 21  ILE A CB  1 
ATOM   151  C  CG1 . ILE A 1 23  ? 29.202  47.196  43.828  1.00 65.33  ? 21  ILE A CG1 1 
ATOM   152  C  CG2 . ILE A 1 23  ? 28.589  48.605  41.921  1.00 72.94  ? 21  ILE A CG2 1 
ATOM   153  C  CD1 . ILE A 1 23  ? 30.554  46.791  43.315  1.00 64.28  ? 21  ILE A CD1 1 
ATOM   154  N  N   . ARG A 1 24  ? 28.663  51.758  44.149  1.00 65.52  ? 22  ARG A N   1 
ATOM   155  C  CA  . ARG A 1 24  ? 28.149  53.058  43.726  1.00 70.67  ? 22  ARG A CA  1 
ATOM   156  C  C   . ARG A 1 24  ? 29.276  54.058  43.482  1.00 72.67  ? 22  ARG A C   1 
ATOM   157  O  O   . ARG A 1 24  ? 30.154  54.257  44.329  1.00 71.07  ? 22  ARG A O   1 
ATOM   158  C  CB  . ARG A 1 24  ? 27.164  53.606  44.765  1.00 68.37  ? 22  ARG A CB  1 
ATOM   159  N  N   . GLU A 1 25  ? 29.236  54.707  42.320  1.00 80.44  ? 23  GLU A N   1 
ATOM   160  C  CA  . GLU A 1 25  ? 30.233  55.725  42.011  1.00 86.49  ? 23  GLU A CA  1 
ATOM   161  C  C   . GLU A 1 25  ? 30.093  56.940  42.921  1.00 90.66  ? 23  GLU A C   1 
ATOM   162  O  O   . GLU A 1 25  ? 31.099  57.568  43.265  1.00 89.43  ? 23  GLU A O   1 
ATOM   163  C  CB  . GLU A 1 25  ? 30.122  56.150  40.546  1.00 93.01  ? 23  GLU A CB  1 
ATOM   164  N  N   . GLU A 1 26  ? 28.862  57.291  43.312  1.00 94.58  ? 24  GLU A N   1 
ATOM   165  C  CA  . GLU A 1 26  ? 28.649  58.496  44.110  1.00 97.10  ? 24  GLU A CA  1 
ATOM   166  C  C   . GLU A 1 26  ? 29.089  58.329  45.566  1.00 93.96  ? 24  GLU A C   1 
ATOM   167  O  O   . GLU A 1 26  ? 29.479  59.312  46.205  1.00 96.23  ? 24  GLU A O   1 
ATOM   168  C  CB  . GLU A 1 26  ? 27.178  58.911  44.044  1.00 101.07 ? 24  GLU A CB  1 
ATOM   169  N  N   . SER A 1 27  ? 29.061  57.113  46.103  1.00 87.85  ? 25  SER A N   1 
ATOM   170  C  CA  . SER A 1 27  ? 29.424  56.900  47.501  1.00 82.50  ? 25  SER A CA  1 
ATOM   171  C  C   . SER A 1 27  ? 30.932  56.984  47.693  1.00 78.69  ? 25  SER A C   1 
ATOM   172  O  O   . SER A 1 27  ? 31.699  56.472  46.876  1.00 79.27  ? 25  SER A O   1 
ATOM   173  C  CB  . SER A 1 27  ? 28.929  55.541  47.973  1.00 78.22  ? 25  SER A CB  1 
ATOM   174  O  OG  . SER A 1 27  ? 27.594  55.324  47.565  1.00 79.74  ? 25  SER A OG  1 
ATOM   175  N  N   . ALA A 1 28  ? 31.361  57.634  48.780  1.00 76.12  ? 26  ALA A N   1 
ATOM   176  C  CA  . ALA A 1 28  ? 32.797  57.806  48.993  1.00 73.07  ? 26  ALA A CA  1 
ATOM   177  C  C   . ALA A 1 28  ? 33.474  56.477  49.297  1.00 70.96  ? 26  ALA A C   1 
ATOM   178  O  O   . ALA A 1 28  ? 34.581  56.217  48.812  1.00 71.37  ? 26  ALA A O   1 
ATOM   179  C  CB  . ALA A 1 28  ? 33.059  58.800  50.124  1.00 72.07  ? 26  ALA A CB  1 
ATOM   180  N  N   . ALA A 1 29  ? 32.821  55.624  50.083  1.00 66.75  ? 27  ALA A N   1 
ATOM   181  C  CA  . ALA A 1 29  ? 33.416  54.355  50.470  1.00 61.66  ? 27  ALA A CA  1 
ATOM   182  C  C   . ALA A 1 29  ? 33.827  53.555  49.244  1.00 58.88  ? 27  ALA A C   1 
ATOM   183  O  O   . ALA A 1 29  ? 33.072  53.430  48.277  1.00 61.71  ? 27  ALA A O   1 
ATOM   184  C  CB  . ALA A 1 29  ? 32.438  53.538  51.309  1.00 60.35  ? 27  ALA A CB  1 
ATOM   185  N  N   . ASP A 1 30  ? 35.031  52.994  49.300  1.00 54.28  ? 28  ASP A N   1 
ATOM   186  C  CA  . ASP A 1 30  ? 35.516  52.132  48.237  1.00 51.09  ? 28  ASP A CA  1 
ATOM   187  C  C   . ASP A 1 30  ? 36.047  50.819  48.785  1.00 48.28  ? 28  ASP A C   1 
ATOM   188  O  O   . ASP A 1 30  ? 36.669  50.057  48.030  1.00 47.06  ? 28  ASP A O   1 
ATOM   189  C  CB  . ASP A 1 30  ? 36.598  52.828  47.393  1.00 52.30  ? 28  ASP A CB  1 
ATOM   190  C  CG  . ASP A 1 30  ? 37.823  53.262  48.205  1.00 54.62  ? 28  ASP A CG  1 
ATOM   191  O  OD1 . ASP A 1 30  ? 37.863  53.071  49.436  1.00 53.30  ? 28  ASP A OD1 1 
ATOM   192  O  OD2 . ASP A 1 30  ? 38.760  53.814  47.588  1.00 58.55  ? 28  ASP A OD2 1 
ATOM   193  N  N   . TRP A 1 31  ? 35.806  50.518  50.061  1.00 43.45  ? 29  TRP A N   1 
ATOM   194  C  CA  . TRP A 1 31  ? 36.130  49.173  50.501  1.00 44.05  ? 29  TRP A CA  1 
ATOM   195  C  C   . TRP A 1 31  ? 35.165  48.732  51.586  1.00 44.92  ? 29  TRP A C   1 
ATOM   196  O  O   . TRP A 1 31  ? 34.621  49.550  52.337  1.00 45.73  ? 29  TRP A O   1 
ATOM   197  C  CB  . TRP A 1 31  ? 37.578  49.050  51.000  1.00 41.87  ? 29  TRP A CB  1 
ATOM   198  C  CG  . TRP A 1 31  ? 37.897  49.833  52.245  1.00 39.32  ? 29  TRP A CG  1 
ATOM   199  C  CD1 . TRP A 1 31  ? 38.458  51.071  52.304  1.00 41.11  ? 29  TRP A CD1 1 
ATOM   200  C  CD2 . TRP A 1 31  ? 37.695  49.420  53.602  1.00 38.85  ? 29  TRP A CD2 1 
ATOM   201  N  NE1 . TRP A 1 31  ? 38.607  51.470  53.616  1.00 42.00  ? 29  TRP A NE1 1 
ATOM   202  C  CE2 . TRP A 1 31  ? 38.149  50.475  54.434  1.00 40.27  ? 29  TRP A CE2 1 
ATOM   203  C  CE3 . TRP A 1 31  ? 37.162  48.270  54.197  1.00 39.89  ? 29  TRP A CE3 1 
ATOM   204  C  CZ2 . TRP A 1 31  ? 38.101  50.411  55.827  1.00 39.50  ? 29  TRP A CZ2 1 
ATOM   205  C  CZ3 . TRP A 1 31  ? 37.109  48.204  55.589  1.00 41.86  ? 29  TRP A CZ3 1 
ATOM   206  C  CH2 . TRP A 1 31  ? 37.581  49.274  56.389  1.00 41.86  ? 29  TRP A CH2 1 
ATOM   207  N  N   . ALA A 1 32  ? 34.954  47.416  51.633  1.00 41.63  ? 30  ALA A N   1 
ATOM   208  C  CA  . ALA A 1 32  ? 34.193  46.752  52.676  1.00 40.14  ? 30  ALA A CA  1 
ATOM   209  C  C   . ALA A 1 32  ? 34.969  45.507  53.103  1.00 41.04  ? 30  ALA A C   1 
ATOM   210  O  O   . ALA A 1 32  ? 35.714  44.920  52.318  1.00 40.97  ? 30  ALA A O   1 
ATOM   211  C  CB  . ALA A 1 32  ? 32.763  46.424  52.209  1.00 37.64  ? 30  ALA A CB  1 
ATOM   212  N  N   . LEU A 1 33  ? 34.857  45.159  54.382  1.00 41.36  ? 31  LEU A N   1 
ATOM   213  C  CA  . LEU A 1 33  ? 35.628  44.079  54.982  1.00 38.80  ? 31  LEU A CA  1 
ATOM   214  C  C   . LEU A 1 33  ? 34.665  43.176  55.738  1.00 39.05  ? 31  LEU A C   1 
ATOM   215  O  O   . LEU A 1 33  ? 34.008  43.624  56.698  1.00 41.25  ? 31  LEU A O   1 
ATOM   216  C  CB  . LEU A 1 33  ? 36.702  44.641  55.929  1.00 38.74  ? 31  LEU A CB  1 
ATOM   217  C  CG  . LEU A 1 33  ? 37.499  43.602  56.694  1.00 35.19  ? 31  LEU A CG  1 
ATOM   218  C  CD1 . LEU A 1 33  ? 38.312  42.782  55.695  1.00 31.76  ? 31  LEU A CD1 1 
ATOM   219  C  CD2 . LEU A 1 33  ? 38.378  44.298  57.721  1.00 33.35  ? 31  LEU A CD2 1 
ATOM   220  N  N   . TYR A 1 34  ? 34.643  41.899  55.361  1.00 38.32  ? 32  TYR A N   1 
ATOM   221  C  CA  . TYR A 1 34  ? 33.786  40.879  55.968  1.00 41.54  ? 32  TYR A CA  1 
ATOM   222  C  C   . TYR A 1 34  ? 34.599  39.777  56.645  1.00 43.89  ? 32  TYR A C   1 
ATOM   223  O  O   . TYR A 1 34  ? 35.779  39.575  56.353  1.00 45.25  ? 32  TYR A O   1 
ATOM   224  C  CB  . TYR A 1 34  ? 32.861  40.230  54.924  1.00 41.25  ? 32  TYR A CB  1 
ATOM   225  C  CG  . TYR A 1 34  ? 32.151  41.198  54.006  1.00 42.17  ? 32  TYR A CG  1 
ATOM   226  C  CD1 . TYR A 1 34  ? 30.919  41.731  54.374  1.00 42.81  ? 32  TYR A CD1 1 
ATOM   227  C  CD2 . TYR A 1 34  ? 32.690  41.572  52.776  1.00 40.83  ? 32  TYR A CD2 1 
ATOM   228  C  CE1 . TYR A 1 34  ? 30.241  42.603  53.567  1.00 42.60  ? 32  TYR A CE1 1 
ATOM   229  C  CE2 . TYR A 1 34  ? 32.004  42.463  51.947  1.00 41.23  ? 32  TYR A CE2 1 
ATOM   230  C  CZ  . TYR A 1 34  ? 30.775  42.969  52.360  1.00 42.29  ? 32  TYR A CZ  1 
ATOM   231  O  OH  . TYR A 1 34  ? 30.051  43.851  51.595  1.00 43.47  ? 32  TYR A OH  1 
ATOM   232  N  N   . THR A 1 35  ? 33.960  39.074  57.576  1.00 43.04  ? 33  THR A N   1 
ATOM   233  C  CA  . THR A 1 35  ? 34.627  38.022  58.340  1.00 44.32  ? 33  THR A CA  1 
ATOM   234  C  C   . THR A 1 35  ? 33.563  37.085  58.899  1.00 45.47  ? 33  THR A C   1 
ATOM   235  O  O   . THR A 1 35  ? 32.362  37.363  58.823  1.00 45.42  ? 33  THR A O   1 
ATOM   236  C  CB  . THR A 1 35  ? 35.510  38.591  59.460  1.00 44.25  ? 33  THR A CB  1 
ATOM   237  O  OG1 . THR A 1 35  ? 36.290  37.534  60.041  1.00 42.89  ? 33  THR A OG1 1 
ATOM   238  C  CG2 . THR A 1 35  ? 34.659  39.254  60.541  1.00 41.89  ? 33  THR A CG2 1 
ATOM   239  N  N   . TYR A 1 36  ? 34.009  35.986  59.500  1.00 44.17  ? 34  TYR A N   1 
ATOM   240  C  CA  . TYR A 1 36  ? 33.044  35.063  60.081  1.00 47.34  ? 34  TYR A CA  1 
ATOM   241  C  C   . TYR A 1 36  ? 32.650  35.469  61.496  1.00 49.32  ? 34  TYR A C   1 
ATOM   242  O  O   . TYR A 1 36  ? 33.448  36.028  62.253  1.00 47.39  ? 34  TYR A O   1 
ATOM   243  C  CB  . TYR A 1 36  ? 33.593  33.632  60.088  1.00 44.94  ? 34  TYR A CB  1 
ATOM   244  C  CG  . TYR A 1 36  ? 33.967  33.117  58.717  1.00 42.56  ? 34  TYR A CG  1 
ATOM   245  C  CD1 . TYR A 1 36  ? 35.216  33.354  58.176  1.00 35.46  ? 34  TYR A CD1 1 
ATOM   246  C  CD2 . TYR A 1 36  ? 33.052  32.394  57.952  1.00 46.75  ? 34  TYR A CD2 1 
ATOM   247  C  CE1 . TYR A 1 36  ? 35.546  32.899  56.918  1.00 33.48  ? 34  TYR A CE1 1 
ATOM   248  C  CE2 . TYR A 1 36  ? 33.390  31.925  56.685  1.00 42.47  ? 34  TYR A CE2 1 
ATOM   249  C  CZ  . TYR A 1 36  ? 34.630  32.193  56.181  1.00 37.93  ? 34  TYR A CZ  1 
ATOM   250  O  OH  . TYR A 1 36  ? 34.941  31.714  54.934  1.00 42.02  ? 34  TYR A OH  1 
ATOM   251  N  N   . GLU A 1 37  ? 31.399  35.173  61.845  1.00 57.13  ? 35  GLU A N   1 
ATOM   252  C  CA  . GLU A 1 37  ? 30.981  35.289  63.231  1.00 63.98  ? 35  GLU A CA  1 
ATOM   253  C  C   . GLU A 1 37  ? 31.544  34.129  64.034  1.00 67.37  ? 35  GLU A C   1 
ATOM   254  O  O   . GLU A 1 37  ? 31.724  33.025  63.519  1.00 71.17  ? 35  GLU A O   1 
ATOM   255  C  CB  . GLU A 1 37  ? 29.466  35.324  63.352  1.00 75.21  ? 35  GLU A CB  1 
ATOM   256  C  CG  . GLU A 1 37  ? 29.009  36.221  64.479  1.00 87.93  ? 35  GLU A CG  1 
ATOM   257  C  CD  . GLU A 1 37  ? 27.740  36.972  64.152  1.00 96.66  ? 35  GLU A CD  1 
ATOM   258  O  OE1 . GLU A 1 37  ? 26.818  36.347  63.579  1.00 99.50  ? 35  GLU A OE1 1 
ATOM   259  O  OE2 . GLU A 1 37  ? 27.655  38.175  64.498  1.00 100.01 ? 35  GLU A OE2 1 
ATOM   260  N  N   . ASP A 1 38  ? 31.843  34.396  65.303  1.00 71.42  ? 36  ASP A N   1 
ATOM   261  C  CA  . ASP A 1 38  ? 32.569  33.434  66.123  1.00 74.84  ? 36  ASP A CA  1 
ATOM   262  C  C   . ASP A 1 38  ? 31.817  32.114  66.205  1.00 74.26  ? 36  ASP A C   1 
ATOM   263  O  O   . ASP A 1 38  ? 30.596  32.084  66.386  1.00 75.41  ? 36  ASP A O   1 
ATOM   264  C  CB  . ASP A 1 38  ? 32.792  33.996  67.521  1.00 81.73  ? 36  ASP A CB  1 
ATOM   265  C  CG  . ASP A 1 38  ? 33.300  35.428  67.499  1.00 86.57  ? 36  ASP A CG  1 
ATOM   266  O  OD1 . ASP A 1 38  ? 34.013  35.830  66.535  1.00 85.30  ? 36  ASP A OD1 1 
ATOM   267  O  OD2 . ASP A 1 38  ? 32.960  36.159  68.456  1.00 90.76  ? 36  ASP A OD2 1 
ATOM   268  N  N   . GLY A 1 39  ? 32.561  31.021  66.072  1.00 73.51  ? 37  GLY A N   1 
ATOM   269  C  CA  . GLY A 1 39  ? 31.966  29.697  66.112  1.00 75.08  ? 37  GLY A CA  1 
ATOM   270  C  C   . GLY A 1 39  ? 30.873  29.476  65.090  1.00 74.47  ? 37  GLY A C   1 
ATOM   271  O  O   . GLY A 1 39  ? 29.870  28.817  65.391  1.00 78.10  ? 37  GLY A O   1 
ATOM   272  N  N   . SER A 1 40  ? 31.037  30.024  63.888  1.00 67.61  ? 38  SER A N   1 
ATOM   273  C  CA  . SER A 1 40  ? 29.984  29.956  62.890  1.00 64.61  ? 38  SER A CA  1 
ATOM   274  C  C   . SER A 1 40  ? 30.581  30.193  61.509  1.00 62.57  ? 38  SER A C   1 
ATOM   275  O  O   . SER A 1 40  ? 31.640  30.810  61.358  1.00 63.95  ? 38  SER A O   1 
ATOM   276  C  CB  . SER A 1 40  ? 28.885  30.966  63.197  1.00 64.40  ? 38  SER A CB  1 
ATOM   277  O  OG  . SER A 1 40  ? 27.970  31.053  62.128  1.00 68.15  ? 38  SER A OG  1 
ATOM   278  N  N   . ASP A 1 41  ? 29.866  29.725  60.495  1.00 60.50  ? 39  ASP A N   1 
ATOM   279  C  CA  . ASP A 1 41  ? 30.247  29.966  59.114  1.00 55.44  ? 39  ASP A CA  1 
ATOM   280  C  C   . ASP A 1 41  ? 29.447  31.089  58.481  1.00 52.66  ? 39  ASP A C   1 
ATOM   281  O  O   . ASP A 1 41  ? 29.484  31.244  57.257  1.00 51.87  ? 39  ASP A O   1 
ATOM   282  C  CB  . ASP A 1 41  ? 30.075  28.693  58.286  1.00 60.48  ? 39  ASP A CB  1 
ATOM   283  C  CG  . ASP A 1 41  ? 31.279  27.778  58.357  1.00 64.06  ? 39  ASP A CG  1 
ATOM   284  O  OD1 . ASP A 1 41  ? 31.168  26.621  57.919  1.00 64.72  ? 39  ASP A OD1 1 
ATOM   285  O  OD2 . ASP A 1 41  ? 32.340  28.211  58.858  1.00 65.65  ? 39  ASP A OD2 1 
ATOM   286  N  N   . ASP A 1 42  ? 28.733  31.883  59.278  1.00 50.90  ? 40  ASP A N   1 
ATOM   287  C  CA  . ASP A 1 42  ? 27.926  32.969  58.745  1.00 47.27  ? 40  ASP A CA  1 
ATOM   288  C  C   . ASP A 1 42  ? 28.787  34.216  58.609  1.00 44.96  ? 40  ASP A C   1 
ATOM   289  O  O   . ASP A 1 42  ? 29.449  34.635  59.560  1.00 47.48  ? 40  ASP A O   1 
ATOM   290  C  CB  . ASP A 1 42  ? 26.710  33.241  59.637  1.00 50.92  ? 40  ASP A CB  1 
ATOM   291  N  N   . LEU A 1 43  ? 28.783  34.797  57.420  1.00 41.81  ? 41  LEU A N   1 
ATOM   292  C  CA  . LEU A 1 43  ? 29.559  35.992  57.158  1.00 40.08  ? 41  LEU A CA  1 
ATOM   293  C  C   . LEU A 1 43  ? 28.919  37.223  57.804  1.00 44.16  ? 41  LEU A C   1 
ATOM   294  O  O   . LEU A 1 43  ? 27.696  37.339  57.906  1.00 48.97  ? 41  LEU A O   1 
ATOM   295  C  CB  . LEU A 1 43  ? 29.678  36.184  55.654  1.00 40.82  ? 41  LEU A CB  1 
ATOM   296  C  CG  . LEU A 1 43  ? 31.013  36.654  55.109  1.00 39.11  ? 41  LEU A CG  1 
ATOM   297  C  CD1 . LEU A 1 43  ? 32.150  35.750  55.602  1.00 37.77  ? 41  LEU A CD1 1 
ATOM   298  C  CD2 . LEU A 1 43  ? 30.928  36.614  53.623  1.00 38.66  ? 41  LEU A CD2 1 
ATOM   299  N  N   . LYS A 1 44  ? 29.755  38.131  58.283  1.00 44.67  ? 42  LYS A N   1 
ATOM   300  C  CA  . LYS A 1 44  ? 29.277  39.378  58.865  1.00 45.28  ? 42  LYS A CA  1 
ATOM   301  C  C   . LYS A 1 44  ? 30.155  40.526  58.372  1.00 43.12  ? 42  LYS A C   1 
ATOM   302  O  O   . LYS A 1 44  ? 31.286  40.333  57.909  1.00 37.28  ? 42  LYS A O   1 
ATOM   303  C  CB  . LYS A 1 44  ? 29.228  39.292  60.404  1.00 46.46  ? 42  LYS A CB  1 
ATOM   304  C  CG  . LYS A 1 44  ? 30.585  39.390  61.103  1.00 50.08  ? 42  LYS A CG  1 
ATOM   305  C  CD  . LYS A 1 44  ? 30.450  39.326  62.635  1.00 54.74  ? 42  LYS A CD  1 
ATOM   306  C  CE  . LYS A 1 44  ? 30.929  40.564  63.342  1.00 57.16  ? 42  LYS A CE  1 
ATOM   307  N  NZ  . LYS A 1 44  ? 31.381  40.135  64.698  1.00 60.18  ? 42  LYS A NZ  1 
ATOM   308  N  N   . LEU A 1 45  ? 29.601  41.727  58.433  1.00 44.03  ? 43  LEU A N   1 
ATOM   309  C  CA  . LEU A 1 45  ? 30.359  42.891  58.040  1.00 41.31  ? 43  LEU A CA  1 
ATOM   310  C  C   . LEU A 1 45  ? 31.248  43.292  59.209  1.00 43.52  ? 43  LEU A C   1 
ATOM   311  O  O   . LEU A 1 45  ? 30.795  43.355  60.357  1.00 46.20  ? 43  LEU A O   1 
ATOM   312  C  CB  . LEU A 1 45  ? 29.417  44.023  57.637  1.00 41.64  ? 43  LEU A CB  1 
ATOM   313  C  CG  . LEU A 1 45  ? 30.051  45.402  57.628  1.00 41.19  ? 43  LEU A CG  1 
ATOM   314  C  CD1 . LEU A 1 45  ? 30.866  45.426  56.349  1.00 37.27  ? 43  LEU A CD1 1 
ATOM   315  C  CD2 . LEU A 1 45  ? 29.000  46.482  57.571  1.00 41.75  ? 43  LEU A CD2 1 
ATOM   316  N  N   . ALA A 1 46  ? 32.536  43.468  58.934  1.00 42.13  ? 44  ALA A N   1 
ATOM   317  C  CA  . ALA A 1 46  ? 33.488  43.846  59.966  1.00 38.64  ? 44  ALA A CA  1 
ATOM   318  C  C   . ALA A 1 46  ? 33.727  45.334  59.973  1.00 42.26  ? 44  ALA A C   1 
ATOM   319  O  O   . ALA A 1 46  ? 33.751  45.957  61.038  1.00 43.53  ? 44  ALA A O   1 
ATOM   320  C  CB  . ALA A 1 46  ? 34.821  43.140  59.753  1.00 34.66  ? 44  ALA A CB  1 
ATOM   321  N  N   . ALA A 1 47  ? 33.904  45.906  58.789  1.00 40.32  ? 45  ALA A N   1 
ATOM   322  C  CA  . ALA A 1 47  ? 34.133  47.337  58.698  1.00 42.53  ? 45  ALA A CA  1 
ATOM   323  C  C   . ALA A 1 47  ? 33.966  47.741  57.240  1.00 42.03  ? 45  ALA A C   1 
ATOM   324  O  O   . ALA A 1 47  ? 33.817  46.900  56.355  1.00 37.53  ? 45  ALA A O   1 
ATOM   325  C  CB  . ALA A 1 47  ? 35.517  47.706  59.233  1.00 36.92  ? 45  ALA A CB  1 
ATOM   326  N  N   . SER A 1 48  ? 34.041  49.043  56.996  1.00 45.18  ? 46  SER A N   1 
ATOM   327  C  CA  . SER A 1 48  ? 33.929  49.571  55.649  1.00 41.72  ? 46  SER A CA  1 
ATOM   328  C  C   . SER A 1 48  ? 34.406  51.015  55.696  1.00 42.98  ? 46  SER A C   1 
ATOM   329  O  O   . SER A 1 48  ? 34.420  51.640  56.761  1.00 41.37  ? 46  SER A O   1 
ATOM   330  C  CB  . SER A 1 48  ? 32.486  49.487  55.146  1.00 43.62  ? 46  SER A CB  1 
ATOM   331  O  OG  . SER A 1 48  ? 31.628  50.251  55.987  1.00 48.20  ? 46  SER A OG  1 
ATOM   332  N  N   . GLY A 1 49  ? 34.841  51.526  54.552  1.00 44.56  ? 47  GLY A N   1 
ATOM   333  C  CA  . GLY A 1 49  ? 35.317  52.889  54.558  1.00 40.77  ? 47  GLY A CA  1 
ATOM   334  C  C   . GLY A 1 49  ? 35.884  53.316  53.222  1.00 41.03  ? 47  GLY A C   1 
ATOM   335  O  O   . GLY A 1 49  ? 35.707  52.660  52.184  1.00 40.15  ? 47  GLY A O   1 
ATOM   336  N  N   . GLU A 1 50  ? 36.568  54.451  53.285  1.00 50.20  ? 48  GLU A N   1 
ATOM   337  C  CA  . GLU A 1 50  ? 37.206  55.074  52.144  1.00 47.26  ? 48  GLU A CA  1 
ATOM   338  C  C   . GLU A 1 50  ? 38.706  54.972  52.365  1.00 45.23  ? 48  GLU A C   1 
ATOM   339  O  O   . GLU A 1 50  ? 39.169  54.454  53.381  1.00 42.58  ? 48  GLU A O   1 
ATOM   340  C  CB  . GLU A 1 50  ? 36.739  56.531  51.944  1.00 48.02  ? 48  GLU A CB  1 
ATOM   341  C  CG  . GLU A 1 50  ? 36.751  57.416  53.165  1.00 53.03  ? 48  GLU A CG  1 
ATOM   342  C  CD  . GLU A 1 50  ? 36.031  58.771  52.950  1.00 64.72  ? 48  GLU A CD  1 
ATOM   343  O  OE1 . GLU A 1 50  ? 34.770  58.833  53.033  1.00 66.93  ? 48  GLU A OE1 1 
ATOM   344  O  OE2 . GLU A 1 50  ? 36.730  59.790  52.719  1.00 68.60  ? 48  GLU A OE2 1 
ATOM   345  N  N   . GLY A 1 51  ? 39.464  55.410  51.373  1.00 49.82  ? 49  GLY A N   1 
ATOM   346  C  CA  . GLY A 1 51  ? 40.901  55.275  51.401  1.00 45.03  ? 49  GLY A CA  1 
ATOM   347  C  C   . GLY A 1 51  ? 41.461  54.074  50.682  1.00 47.46  ? 49  GLY A C   1 
ATOM   348  O  O   . GLY A 1 51  ? 42.667  53.837  50.783  1.00 51.73  ? 49  GLY A O   1 
ATOM   349  N  N   . GLY A 1 52  ? 40.630  53.275  50.016  1.00 44.22  ? 50  GLY A N   1 
ATOM   350  C  CA  . GLY A 1 52  ? 41.152  52.163  49.236  1.00 43.68  ? 50  GLY A CA  1 
ATOM   351  C  C   . GLY A 1 52  ? 42.021  51.156  49.988  1.00 44.88  ? 50  GLY A C   1 
ATOM   352  O  O   . GLY A 1 52  ? 42.018  51.048  51.223  1.00 42.55  ? 50  GLY A O   1 
ATOM   353  N  N   . LEU A 1 53  ? 42.841  50.466  49.186  1.00 45.65  ? 51  LEU A N   1 
ATOM   354  C  CA  . LEU A 1 53  ? 43.658  49.361  49.680  1.00 44.94  ? 51  LEU A CA  1 
ATOM   355  C  C   . LEU A 1 53  ? 44.546  49.793  50.837  1.00 45.34  ? 51  LEU A C   1 
ATOM   356  O  O   . LEU A 1 53  ? 44.805  49.011  51.763  1.00 41.72  ? 51  LEU A O   1 
ATOM   357  C  CB  . LEU A 1 53  ? 44.511  48.825  48.544  1.00 39.84  ? 51  LEU A CB  1 
ATOM   358  C  CG  . LEU A 1 53  ? 43.784  48.003  47.495  1.00 44.83  ? 51  LEU A CG  1 
ATOM   359  C  CD1 . LEU A 1 53  ? 44.749  47.743  46.354  1.00 44.34  ? 51  LEU A CD1 1 
ATOM   360  C  CD2 . LEU A 1 53  ? 43.307  46.694  48.122  1.00 40.42  ? 51  LEU A CD2 1 
ATOM   361  N  N   . GLN A 1 54  ? 45.038  51.033  50.794  1.00 50.48  ? 52  GLN A N   1 
ATOM   362  C  CA  . GLN A 1 54  ? 45.966  51.472  51.827  1.00 53.54  ? 52  GLN A CA  1 
ATOM   363  C  C   . GLN A 1 54  ? 45.286  51.454  53.179  1.00 53.21  ? 52  GLN A C   1 
ATOM   364  O  O   . GLN A 1 54  ? 45.836  50.944  54.158  1.00 52.64  ? 52  GLN A O   1 
ATOM   365  C  CB  . GLN A 1 54  ? 46.497  52.861  51.505  1.00 59.42  ? 52  GLN A CB  1 
ATOM   366  C  CG  . GLN A 1 54  ? 47.381  53.475  52.577  1.00 66.99  ? 52  GLN A CG  1 
ATOM   367  C  CD  . GLN A 1 54  ? 47.304  55.001  52.548  1.00 74.93  ? 52  GLN A CD  1 
ATOM   368  O  OE1 . GLN A 1 54  ? 46.230  55.568  52.289  1.00 77.51  ? 52  GLN A OE1 1 
ATOM   369  N  NE2 . GLN A 1 54  ? 48.436  55.669  52.784  1.00 75.15  ? 52  GLN A NE2 1 
ATOM   370  N  N   . GLU A 1 55  ? 44.065  51.982  53.238  1.00 52.19  ? 53  GLU A N   1 
ATOM   371  C  CA  . GLU A 1 55  ? 43.316  51.961  54.482  1.00 52.56  ? 53  GLU A CA  1 
ATOM   372  C  C   . GLU A 1 55  ? 42.870  50.550  54.822  1.00 51.20  ? 53  GLU A C   1 
ATOM   373  O  O   . GLU A 1 55  ? 43.012  50.107  55.965  1.00 37.97  ? 53  GLU A O   1 
ATOM   374  C  CB  . GLU A 1 55  ? 42.117  52.896  54.376  1.00 56.99  ? 53  GLU A CB  1 
ATOM   375  C  CG  . GLU A 1 55  ? 41.150  52.831  55.542  1.00 61.72  ? 53  GLU A CG  1 
ATOM   376  C  CD  . GLU A 1 55  ? 41.728  53.413  56.827  1.00 69.71  ? 53  GLU A CD  1 
ATOM   377  O  OE1 . GLU A 1 55  ? 41.231  53.052  57.915  1.00 72.06  ? 53  GLU A OE1 1 
ATOM   378  O  OE2 . GLU A 1 55  ? 42.656  54.247  56.750  1.00 73.87  ? 53  GLU A OE2 1 
ATOM   379  N  N   . LEU A 1 56  ? 42.347  49.817  53.832  1.00 48.03  ? 54  LEU A N   1 
ATOM   380  C  CA  . LEU A 1 56  ? 41.790  48.504  54.122  1.00 40.35  ? 54  LEU A CA  1 
ATOM   381  C  C   . LEU A 1 56  ? 42.837  47.596  54.763  1.00 40.40  ? 54  LEU A C   1 
ATOM   382  O  O   . LEU A 1 56  ? 42.566  46.958  55.790  1.00 38.36  ? 54  LEU A O   1 
ATOM   383  C  CB  . LEU A 1 56  ? 41.224  47.885  52.850  1.00 36.97  ? 54  LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 56  ? 40.983  46.363  52.889  1.00 36.67  ? 54  LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 56  ? 39.850  45.967  53.832  1.00 31.65  ? 54  LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 56  ? 40.708  45.882  51.491  1.00 34.75  ? 54  LEU A CD2 1 
ATOM   387  N  N   . SER A 1 57  ? 44.073  47.617  54.255  1.00 43.77  ? 55  SER A N   1 
ATOM   388  C  CA  . SER A 1 57  ? 45.101  46.749  54.834  1.00 44.37  ? 55  SER A CA  1 
ATOM   389  C  C   . SER A 1 57  ? 45.279  46.966  56.342  1.00 43.17  ? 55  SER A C   1 
ATOM   390  O  O   . SER A 1 57  ? 45.768  46.064  57.029  1.00 43.41  ? 55  SER A O   1 
ATOM   391  C  CB  . SER A 1 57  ? 46.415  46.951  54.106  1.00 45.27  ? 55  SER A CB  1 
ATOM   392  O  OG  . SER A 1 57  ? 46.528  48.316  53.814  1.00 53.73  ? 55  SER A OG  1 
ATOM   393  N  N   . GLY A 1 58  ? 44.869  48.121  56.875  1.00 37.59  ? 56  GLY A N   1 
ATOM   394  C  CA  . GLY A 1 58  ? 44.977  48.391  58.299  1.00 38.88  ? 56  GLY A CA  1 
ATOM   395  C  C   . GLY A 1 58  ? 43.961  47.683  59.193  1.00 50.62  ? 56  GLY A C   1 
ATOM   396  O  O   . GLY A 1 58  ? 44.097  47.742  60.421  1.00 44.51  ? 56  GLY A O   1 
ATOM   397  N  N   . HIS A 1 59  ? 42.918  47.074  58.625  1.00 36.00  ? 57  HIS A N   1 
ATOM   398  C  CA  . HIS A 1 59  ? 41.886  46.446  59.430  1.00 35.54  ? 57  HIS A CA  1 
ATOM   399  C  C   . HIS A 1 59  ? 41.962  44.942  59.447  1.00 37.56  ? 57  HIS A C   1 
ATOM   400  O  O   . HIS A 1 59  ? 41.107  44.323  60.081  1.00 39.57  ? 57  HIS A O   1 
ATOM   401  C  CB  . HIS A 1 59  ? 40.480  46.864  58.952  1.00 37.12  ? 57  HIS A CB  1 
ATOM   402  C  CG  . HIS A 1 59  ? 40.227  48.334  59.069  1.00 43.18  ? 57  HIS A CG  1 
ATOM   403  N  ND1 . HIS A 1 59  ? 40.679  49.246  58.138  1.00 43.74  ? 57  HIS A ND1 1 
ATOM   404  C  CD2 . HIS A 1 59  ? 39.594  49.052  60.023  1.00 38.22  ? 57  HIS A CD2 1 
ATOM   405  C  CE1 . HIS A 1 59  ? 40.344  50.464  58.521  1.00 44.30  ? 57  HIS A CE1 1 
ATOM   406  N  NE2 . HIS A 1 59  ? 39.685  50.373  59.660  1.00 46.86  ? 57  HIS A NE2 1 
ATOM   407  N  N   . PHE A 1 60  ? 42.962  44.338  58.801  1.00 35.16  ? 58  PHE A N   1 
ATOM   408  C  CA  . PHE A 1 60  ? 43.039  42.883  58.757  1.00 35.46  ? 58  PHE A CA  1 
ATOM   409  C  C   . PHE A 1 60  ? 43.533  42.353  60.095  1.00 35.54  ? 58  PHE A C   1 
ATOM   410  O  O   . PHE A 1 60  ? 44.442  42.925  60.698  1.00 38.73  ? 58  PHE A O   1 
ATOM   411  C  CB  . PHE A 1 60  ? 43.951  42.414  57.616  1.00 34.97  ? 58  PHE A CB  1 
ATOM   412  C  CG  . PHE A 1 60  ? 43.352  42.587  56.222  1.00 35.16  ? 58  PHE A CG  1 
ATOM   413  C  CD1 . PHE A 1 60  ? 42.238  41.875  55.830  1.00 32.40  ? 58  PHE A CD1 1 
ATOM   414  C  CD2 . PHE A 1 60  ? 43.921  43.472  55.305  1.00 36.94  ? 58  PHE A CD2 1 
ATOM   415  C  CE1 . PHE A 1 60  ? 41.692  42.021  54.556  1.00 34.03  ? 58  PHE A CE1 1 
ATOM   416  C  CE2 . PHE A 1 60  ? 43.383  43.638  54.041  1.00 34.83  ? 58  PHE A CE2 1 
ATOM   417  C  CZ  . PHE A 1 60  ? 42.265  42.918  53.662  1.00 34.87  ? 58  PHE A CZ  1 
ATOM   418  N  N   . GLU A 1 61  ? 42.965  41.237  60.542  1.00 35.66  ? 59  GLU A N   1 
ATOM   419  C  CA  . GLU A 1 61  ? 43.279  40.689  61.858  1.00 44.29  ? 59  GLU A CA  1 
ATOM   420  C  C   . GLU A 1 61  ? 43.980  39.340  61.708  1.00 47.30  ? 59  GLU A C   1 
ATOM   421  O  O   . GLU A 1 61  ? 43.606  38.521  60.859  1.00 47.43  ? 59  GLU A O   1 
ATOM   422  C  CB  . GLU A 1 61  ? 42.010  40.563  62.726  1.00 49.66  ? 59  GLU A CB  1 
ATOM   423  C  CG  . GLU A 1 61  ? 41.180  41.857  62.775  1.00 50.90  ? 59  GLU A CG  1 
ATOM   424  C  CD  . GLU A 1 61  ? 39.919  41.804  63.661  1.00 52.40  ? 59  GLU A CD  1 
ATOM   425  O  OE1 . GLU A 1 61  ? 39.834  40.968  64.617  1.00 52.10  ? 59  GLU A OE1 1 
ATOM   426  O  OE2 . GLU A 1 61  ? 39.004  42.634  63.389  1.00 51.33  ? 59  GLU A OE2 1 
ATOM   427  N  N   . ASN A 1 62  ? 45.012  39.123  62.535  1.00 46.04  ? 60  ASN A N   1 
ATOM   428  C  CA  . ASN A 1 62  ? 45.904  37.986  62.361  1.00 49.37  ? 60  ASN A CA  1 
ATOM   429  C  C   . ASN A 1 62  ? 45.296  36.678  62.844  1.00 50.45  ? 60  ASN A C   1 
ATOM   430  O  O   . ASN A 1 62  ? 45.830  35.601  62.550  1.00 48.80  ? 60  ASN A O   1 
ATOM   431  C  CB  . ASN A 1 62  ? 47.198  38.243  63.129  1.00 53.31  ? 60  ASN A CB  1 
ATOM   432  C  CG  . ASN A 1 62  ? 47.998  39.348  62.520  1.00 58.46  ? 60  ASN A CG  1 
ATOM   433  O  OD1 . ASN A 1 62  ? 48.147  39.415  61.304  1.00 62.48  ? 60  ASN A OD1 1 
ATOM   434  N  ND2 . ASN A 1 62  ? 48.523  40.237  63.359  1.00 60.95  ? 60  ASN A ND2 1 
ATOM   435  N  N   . GLN A 1 63  ? 44.216  36.757  63.603  1.00 50.51  ? 61  GLN A N   1 
ATOM   436  C  CA  . GLN A 1 63  ? 43.551  35.593  64.143  1.00 50.93  ? 61  GLN A CA  1 
ATOM   437  C  C   . GLN A 1 63  ? 42.326  35.205  63.336  1.00 48.25  ? 61  GLN A C   1 
ATOM   438  O  O   . GLN A 1 63  ? 41.593  34.304  63.746  1.00 49.70  ? 61  GLN A O   1 
ATOM   439  C  CB  . GLN A 1 63  ? 43.182  35.846  65.605  1.00 57.69  ? 61  GLN A CB  1 
ATOM   440  C  CG  . GLN A 1 63  ? 44.397  36.134  66.531  1.00 71.79  ? 61  GLN A CG  1 
ATOM   441  C  CD  . GLN A 1 63  ? 44.890  37.613  66.518  1.00 81.47  ? 61  GLN A CD  1 
ATOM   442  O  OE1 . GLN A 1 63  ? 45.244  38.157  65.460  1.00 84.53  ? 61  GLN A OE1 1 
ATOM   443  N  NE2 . GLN A 1 63  ? 44.928  38.253  67.708  1.00 83.37  ? 61  GLN A NE2 1 
ATOM   444  N  N   . LYS A 1 64  ? 42.067  35.879  62.219  1.00 39.88  ? 62  LYS A N   1 
ATOM   445  C  CA  . LYS A 1 64  ? 40.819  35.696  61.494  1.00 41.34  ? 62  LYS A CA  1 
ATOM   446  C  C   . LYS A 1 64  ? 41.038  35.473  60.004  1.00 40.38  ? 62  LYS A C   1 
ATOM   447  O  O   . LYS A 1 64  ? 42.011  35.942  59.415  1.00 39.39  ? 62  LYS A O   1 
ATOM   448  C  CB  . LYS A 1 64  ? 39.869  36.895  61.696  1.00 44.19  ? 62  LYS A CB  1 
ATOM   449  C  CG  . LYS A 1 64  ? 39.398  37.044  63.148  1.00 49.47  ? 62  LYS A CG  1 
ATOM   450  C  CD  . LYS A 1 64  ? 38.065  37.775  63.251  1.00 56.09  ? 62  LYS A CD  1 
ATOM   451  C  CE  . LYS A 1 64  ? 36.937  36.831  63.684  1.00 65.03  ? 62  LYS A CE  1 
ATOM   452  N  NZ  . LYS A 1 64  ? 36.451  35.851  62.597  1.00 66.53  ? 62  LYS A NZ  1 
ATOM   453  N  N   . VAL A 1 65  ? 40.116  34.722  59.418  1.00 40.30  ? 63  VAL A N   1 
ATOM   454  C  CA  . VAL A 1 65  ? 39.894  34.689  57.979  1.00 35.68  ? 63  VAL A CA  1 
ATOM   455  C  C   . VAL A 1 65  ? 38.935  35.817  57.628  1.00 37.84  ? 63  VAL A C   1 
ATOM   456  O  O   . VAL A 1 65  ? 37.870  35.945  58.235  1.00 40.35  ? 63  VAL A O   1 
ATOM   457  C  CB  . VAL A 1 65  ? 39.326  33.325  57.558  1.00 35.62  ? 63  VAL A CB  1 
ATOM   458  C  CG1 . VAL A 1 65  ? 39.007  33.316  56.086  1.00 36.47  ? 63  VAL A CG1 1 
ATOM   459  C  CG2 . VAL A 1 65  ? 40.317  32.218  57.909  1.00 34.58  ? 63  VAL A CG2 1 
ATOM   460  N  N   . MET A 1 66  ? 39.321  36.670  56.684  1.00 42.49  ? 64  MET A N   1 
ATOM   461  C  CA  . MET A 1 66  ? 38.496  37.818  56.310  1.00 43.08  ? 64  MET A CA  1 
ATOM   462  C  C   . MET A 1 66  ? 38.512  37.999  54.790  1.00 43.12  ? 64  MET A C   1 
ATOM   463  O  O   . MET A 1 66  ? 39.422  37.531  54.091  1.00 47.18  ? 64  MET A O   1 
ATOM   464  C  CB  . MET A 1 66  ? 38.965  39.099  57.028  1.00 42.52  ? 64  MET A CB  1 
ATOM   465  C  CG  . MET A 1 66  ? 39.153  38.941  58.538  1.00 43.17  ? 64  MET A CG  1 
ATOM   466  S  SD  . MET A 1 66  ? 39.502  40.465  59.480  1.00 48.48  ? 64  MET A SD  1 
ATOM   467  C  CE  . MET A 1 66  ? 40.136  41.463  58.226  1.00 50.40  ? 64  MET A CE  1 
ATOM   468  N  N   . TYR A 1 67  ? 37.496  38.694  54.275  1.00 38.52  ? 65  TYR A N   1 
ATOM   469  C  CA  . TYR A 1 67  ? 37.355  38.944  52.841  1.00 38.42  ? 65  TYR A CA  1 
ATOM   470  C  C   . TYR A 1 67  ? 37.227  40.442  52.605  1.00 42.15  ? 65  TYR A C   1 
ATOM   471  O  O   . TYR A 1 67  ? 36.300  41.079  53.118  1.00 47.41  ? 65  TYR A O   1 
ATOM   472  C  CB  . TYR A 1 67  ? 36.151  38.178  52.264  1.00 34.95  ? 65  TYR A CB  1 
ATOM   473  C  CG  . TYR A 1 67  ? 36.258  36.694  52.507  1.00 37.22  ? 65  TYR A CG  1 
ATOM   474  C  CD1 . TYR A 1 67  ? 37.187  35.930  51.804  1.00 39.08  ? 65  TYR A CD1 1 
ATOM   475  C  CD2 . TYR A 1 67  ? 35.476  36.060  53.466  1.00 38.35  ? 65  TYR A CD2 1 
ATOM   476  C  CE1 . TYR A 1 67  ? 37.329  34.579  52.028  1.00 40.63  ? 65  TYR A CE1 1 
ATOM   477  C  CE2 . TYR A 1 67  ? 35.609  34.693  53.702  1.00 39.93  ? 65  TYR A CE2 1 
ATOM   478  C  CZ  . TYR A 1 67  ? 36.541  33.958  52.978  1.00 42.18  ? 65  TYR A CZ  1 
ATOM   479  O  OH  . TYR A 1 67  ? 36.706  32.596  53.192  1.00 44.42  ? 65  TYR A OH  1 
ATOM   480  N  N   . GLY A 1 68  ? 38.155  41.001  51.829  1.00 42.15  ? 66  GLY A N   1 
ATOM   481  C  CA  . GLY A 1 68  ? 38.156  42.430  51.566  1.00 43.50  ? 66  GLY A CA  1 
ATOM   482  C  C   . GLY A 1 68  ? 37.706  42.773  50.164  1.00 46.31  ? 66  GLY A C   1 
ATOM   483  O  O   . GLY A 1 68  ? 38.265  42.284  49.188  1.00 48.89  ? 66  GLY A O   1 
ATOM   484  N  N   . PHE A 1 69  ? 36.666  43.567  50.033  1.00 43.96  ? 67  PHE A N   1 
ATOM   485  C  CA  . PHE A 1 69  ? 36.115  43.890  48.728  1.00 44.86  ? 67  PHE A CA  1 
ATOM   486  C  C   . PHE A 1 69  ? 36.395  45.364  48.508  1.00 45.47  ? 67  PHE A C   1 
ATOM   487  O  O   . PHE A 1 69  ? 35.770  46.227  49.140  1.00 44.89  ? 67  PHE A O   1 
ATOM   488  C  CB  . PHE A 1 69  ? 34.624  43.575  48.649  1.00 45.57  ? 67  PHE A CB  1 
ATOM   489  C  CG  . PHE A 1 69  ? 34.021  43.824  47.294  1.00 49.40  ? 67  PHE A CG  1 
ATOM   490  C  CD1 . PHE A 1 69  ? 34.107  42.876  46.293  1.00 50.93  ? 67  PHE A CD1 1 
ATOM   491  C  CD2 . PHE A 1 69  ? 33.361  45.019  47.016  1.00 50.16  ? 67  PHE A CD2 1 
ATOM   492  C  CE1 . PHE A 1 69  ? 33.522  43.117  45.036  1.00 52.39  ? 67  PHE A CE1 1 
ATOM   493  C  CE2 . PHE A 1 69  ? 32.792  45.257  45.771  1.00 49.79  ? 67  PHE A CE2 1 
ATOM   494  C  CZ  . PHE A 1 69  ? 32.875  44.314  44.785  1.00 50.09  ? 67  PHE A CZ  1 
ATOM   495  N  N   . CYS A 1 70  ? 37.338  45.642  47.620  1.00 44.76  ? 68  CYS A N   1 
ATOM   496  C  CA  . CYS A 1 70  ? 37.799  46.994  47.388  1.00 46.99  ? 68  CYS A CA  1 
ATOM   497  C  C   . CYS A 1 70  ? 37.643  47.373  45.918  1.00 50.44  ? 68  CYS A C   1 
ATOM   498  O  O   . CYS A 1 70  ? 38.046  46.622  45.019  1.00 53.04  ? 68  CYS A O   1 
ATOM   499  C  CB  . CYS A 1 70  ? 39.246  47.122  47.839  1.00 50.77  ? 68  CYS A CB  1 
ATOM   500  S  SG  . CYS A 1 70  ? 39.897  48.785  47.700  1.00 61.47  ? 68  CYS A SG  1 
ATOM   501  N  N   . SER A 1 71  ? 37.085  48.554  45.688  1.00 51.93  ? 69  SER A N   1 
ATOM   502  C  CA  . SER A 1 71  ? 36.966  49.146  44.367  1.00 52.99  ? 69  SER A CA  1 
ATOM   503  C  C   . SER A 1 71  ? 38.209  49.965  44.068  1.00 53.93  ? 69  SER A C   1 
ATOM   504  O  O   . SER A 1 71  ? 38.673  50.728  44.923  1.00 59.34  ? 69  SER A O   1 
ATOM   505  C  CB  . SER A 1 71  ? 35.741  50.047  44.302  1.00 59.72  ? 69  SER A CB  1 
ATOM   506  O  OG  . SER A 1 71  ? 35.782  50.841  43.135  1.00 68.80  ? 69  SER A OG  1 
ATOM   507  N  N   . VAL A 1 72  ? 38.743  49.817  42.861  1.00 50.25  ? 70  VAL A N   1 
ATOM   508  C  CA  . VAL A 1 72  ? 40.002  50.451  42.486  1.00 53.52  ? 70  VAL A CA  1 
ATOM   509  C  C   . VAL A 1 72  ? 39.844  51.149  41.138  1.00 57.84  ? 70  VAL A C   1 
ATOM   510  O  O   . VAL A 1 72  ? 39.470  50.509  40.146  1.00 60.72  ? 70  VAL A O   1 
ATOM   511  C  CB  . VAL A 1 72  ? 41.144  49.420  42.416  1.00 52.86  ? 70  VAL A CB  1 
ATOM   512  C  CG1 . VAL A 1 72  ? 42.338  50.037  41.779  1.00 56.57  ? 70  VAL A CG1 1 
ATOM   513  C  CG2 . VAL A 1 72  ? 41.493  48.941  43.792  1.00 51.11  ? 70  VAL A CG2 1 
ATOM   514  N  N   . LYS A 1 73  ? 40.160  52.451  41.102  1.00 57.55  ? 71  LYS A N   1 
ATOM   515  C  CA  . LYS A 1 73  ? 40.083  53.267  39.879  1.00 61.81  ? 71  LYS A CA  1 
ATOM   516  C  C   . LYS A 1 73  ? 41.467  53.662  39.381  1.00 68.29  ? 71  LYS A C   1 
ATOM   517  O  O   . LYS A 1 73  ? 42.190  52.838  38.822  1.00 72.73  ? 71  LYS A O   1 
ATOM   518  C  CB  . LYS A 1 73  ? 39.241  54.523  40.098  1.00 60.51  ? 71  LYS A CB  1 
ATOM   519  N  N   . ALA A 1 77  ? 41.175  56.244  36.646  1.00 99.58  ? 75  ALA A N   1 
ATOM   520  C  CA  . ALA A 1 77  ? 40.668  57.336  35.808  1.00 107.94 ? 75  ALA A CA  1 
ATOM   521  C  C   . ALA A 1 77  ? 39.545  56.883  34.846  1.00 111.06 ? 75  ALA A C   1 
ATOM   522  O  O   . ALA A 1 77  ? 38.864  57.726  34.247  1.00 113.27 ? 75  ALA A O   1 
ATOM   523  C  CB  . ALA A 1 77  ? 41.820  57.982  35.014  1.00 110.16 ? 75  ALA A CB  1 
ATOM   524  N  N   . ALA A 1 78  ? 39.360  55.562  34.706  1.00 109.65 ? 76  ALA A N   1 
ATOM   525  C  CA  . ALA A 1 78  ? 38.310  54.945  33.904  1.00 108.79 ? 76  ALA A CA  1 
ATOM   526  C  C   . ALA A 1 78  ? 37.362  54.168  34.830  1.00 103.11 ? 76  ALA A C   1 
ATOM   527  O  O   . ALA A 1 78  ? 37.293  54.448  36.038  1.00 99.03  ? 76  ALA A O   1 
ATOM   528  C  CB  . ALA A 1 78  ? 38.941  54.069  32.815  1.00 111.53 ? 76  ALA A CB  1 
ATOM   529  N  N   . LEU A 1 79  ? 36.625  53.209  34.265  1.00 101.30 ? 77  LEU A N   1 
ATOM   530  C  CA  . LEU A 1 79  ? 35.682  52.421  35.056  1.00 94.62  ? 77  LEU A CA  1 
ATOM   531  C  C   . LEU A 1 79  ? 36.427  51.597  36.107  1.00 86.89  ? 77  LEU A C   1 
ATOM   532  O  O   . LEU A 1 79  ? 37.492  51.041  35.815  1.00 87.11  ? 77  LEU A O   1 
ATOM   533  C  CB  . LEU A 1 79  ? 34.867  51.492  34.156  1.00 94.70  ? 77  LEU A CB  1 
ATOM   534  C  CG  . LEU A 1 79  ? 33.592  52.039  33.522  1.00 95.30  ? 77  LEU A CG  1 
ATOM   535  C  CD1 . LEU A 1 79  ? 32.893  50.928  32.749  1.00 95.14  ? 77  LEU A CD1 1 
ATOM   536  C  CD2 . LEU A 1 79  ? 32.674  52.627  34.590  1.00 92.05  ? 77  LEU A CD2 1 
ATOM   537  N  N   . PRO A 1 80  ? 35.888  51.471  37.321  1.00 79.65  ? 78  PRO A N   1 
ATOM   538  C  CA  . PRO A 1 80  ? 36.608  50.774  38.402  1.00 72.66  ? 78  PRO A CA  1 
ATOM   539  C  C   . PRO A 1 80  ? 36.602  49.257  38.274  1.00 64.33  ? 78  PRO A C   1 
ATOM   540  O  O   . PRO A 1 80  ? 35.640  48.650  37.803  1.00 65.25  ? 78  PRO A O   1 
ATOM   541  C  CB  . PRO A 1 80  ? 35.835  51.189  39.662  1.00 72.84  ? 78  PRO A CB  1 
ATOM   542  C  CG  . PRO A 1 80  ? 34.437  51.462  39.159  1.00 75.61  ? 78  PRO A CG  1 
ATOM   543  C  CD  . PRO A 1 80  ? 34.609  52.046  37.773  1.00 78.84  ? 78  PRO A CD  1 
ATOM   544  N  N   . LYS A 1 81  ? 37.691  48.642  38.727  1.00 59.69  ? 79  LYS A N   1 
ATOM   545  C  CA  . LYS A 1 81  ? 37.774  47.189  38.835  1.00 62.46  ? 79  LYS A CA  1 
ATOM   546  C  C   . LYS A 1 81  ? 37.718  46.761  40.299  1.00 59.97  ? 79  LYS A C   1 
ATOM   547  O  O   . LYS A 1 81  ? 37.935  47.565  41.212  1.00 60.89  ? 79  LYS A O   1 
ATOM   548  C  CB  . LYS A 1 81  ? 39.042  46.654  38.164  1.00 68.51  ? 79  LYS A CB  1 
ATOM   549  C  CG  . LYS A 1 81  ? 39.475  47.471  36.964  1.00 75.75  ? 79  LYS A CG  1 
ATOM   550  C  CD  . LYS A 1 81  ? 40.254  46.639  35.956  1.00 81.31  ? 79  LYS A CD  1 
ATOM   551  C  CE  . LYS A 1 81  ? 39.356  45.968  34.937  1.00 84.34  ? 79  LYS A CE  1 
ATOM   552  N  NZ  . LYS A 1 81  ? 40.006  44.729  34.424  1.00 86.90  ? 79  LYS A NZ  1 
ATOM   553  N  N   . TYR A 1 82  ? 37.409  45.484  40.533  1.00 56.20  ? 80  TYR A N   1 
ATOM   554  C  CA  . TYR A 1 82  ? 37.088  45.026  41.883  1.00 50.22  ? 80  TYR A CA  1 
ATOM   555  C  C   . TYR A 1 82  ? 38.016  43.904  42.332  1.00 48.42  ? 80  TYR A C   1 
ATOM   556  O  O   . TYR A 1 82  ? 38.208  42.900  41.626  1.00 49.60  ? 80  TYR A O   1 
ATOM   557  C  CB  . TYR A 1 82  ? 35.628  44.619  41.975  1.00 46.91  ? 80  TYR A CB  1 
ATOM   558  C  CG  . TYR A 1 82  ? 34.740  45.824  41.778  1.00 50.22  ? 80  TYR A CG  1 
ATOM   559  C  CD1 . TYR A 1 82  ? 34.539  46.731  42.801  1.00 49.71  ? 80  TYR A CD1 1 
ATOM   560  C  CD2 . TYR A 1 82  ? 34.140  46.084  40.546  1.00 51.27  ? 80  TYR A CD2 1 
ATOM   561  C  CE1 . TYR A 1 82  ? 33.736  47.842  42.619  1.00 50.75  ? 80  TYR A CE1 1 
ATOM   562  C  CE2 . TYR A 1 82  ? 33.338  47.198  40.352  1.00 52.54  ? 80  TYR A CE2 1 
ATOM   563  C  CZ  . TYR A 1 82  ? 33.140  48.076  41.391  1.00 54.78  ? 80  TYR A CZ  1 
ATOM   564  O  OH  . TYR A 1 82  ? 32.345  49.196  41.219  1.00 58.97  ? 80  TYR A OH  1 
ATOM   565  N  N   . VAL A 1 83  ? 38.618  44.113  43.496  1.00 47.79  ? 81  VAL A N   1 
ATOM   566  C  CA  . VAL A 1 83  ? 39.566  43.186  44.091  1.00 49.61  ? 81  VAL A CA  1 
ATOM   567  C  C   . VAL A 1 83  ? 38.895  42.540  45.288  1.00 50.43  ? 81  VAL A C   1 
ATOM   568  O  O   . VAL A 1 83  ? 38.269  43.232  46.105  1.00 51.93  ? 81  VAL A O   1 
ATOM   569  C  CB  . VAL A 1 83  ? 40.852  43.905  44.529  1.00 50.32  ? 81  VAL A CB  1 
ATOM   570  C  CG1 . VAL A 1 83  ? 41.828  42.905  45.146  1.00 48.89  ? 81  VAL A CG1 1 
ATOM   571  C  CG2 . VAL A 1 83  ? 41.459  44.644  43.361  1.00 53.77  ? 81  VAL A CG2 1 
ATOM   572  N  N   . LEU A 1 84  ? 39.024  41.227  45.396  1.00 47.69  ? 82  LEU A N   1 
ATOM   573  C  CA  . LEU A 1 84  ? 38.657  40.520  46.610  1.00 47.56  ? 82  LEU A CA  1 
ATOM   574  C  C   . LEU A 1 84  ? 39.943  40.006  47.242  1.00 49.94  ? 82  LEU A C   1 
ATOM   575  O  O   . LEU A 1 84  ? 40.659  39.201  46.641  1.00 55.22  ? 82  LEU A O   1 
ATOM   576  C  CB  . LEU A 1 84  ? 37.689  39.374  46.314  1.00 47.55  ? 82  LEU A CB  1 
ATOM   577  C  CG  . LEU A 1 84  ? 37.270  38.543  47.527  1.00 45.59  ? 82  LEU A CG  1 
ATOM   578  C  CD1 . LEU A 1 84  ? 36.381  39.412  48.382  1.00 45.54  ? 82  LEU A CD1 1 
ATOM   579  C  CD2 . LEU A 1 84  ? 36.557  37.290  47.108  1.00 46.07  ? 82  LEU A CD2 1 
ATOM   580  N  N   . ILE A 1 85  ? 40.227  40.454  48.453  1.00 51.42  ? 83  ILE A N   1 
ATOM   581  C  CA  . ILE A 1 85  ? 41.378  39.990  49.212  1.00 48.32  ? 83  ILE A CA  1 
ATOM   582  C  C   . ILE A 1 85  ? 40.932  38.817  50.067  1.00 47.55  ? 83  ILE A C   1 
ATOM   583  O  O   . ILE A 1 85  ? 40.049  38.959  50.922  1.00 46.60  ? 83  ILE A O   1 
ATOM   584  C  CB  . ILE A 1 85  ? 41.957  41.106  50.081  1.00 46.42  ? 83  ILE A CB  1 
ATOM   585  C  CG1 . ILE A 1 85  ? 42.560  42.169  49.173  1.00 48.21  ? 83  ILE A CG1 1 
ATOM   586  C  CG2 . ILE A 1 85  ? 43.038  40.525  50.974  1.00 46.84  ? 83  ILE A CG2 1 
ATOM   587  C  CD1 . ILE A 1 85  ? 42.662  43.496  49.804  1.00 47.55  ? 83  ILE A CD1 1 
ATOM   588  N  N   . ASN A 1 86  ? 41.505  37.650  49.787  1.00 45.21  ? 84  ASN A N   1 
ATOM   589  C  CA  . ASN A 1 86  ? 41.304  36.439  50.564  1.00 44.60  ? 84  ASN A CA  1 
ATOM   590  C  C   . ASN A 1 86  ? 42.333  36.450  51.682  1.00 45.04  ? 84  ASN A C   1 
ATOM   591  O  O   . ASN A 1 86  ? 43.460  35.966  51.525  1.00 51.40  ? 84  ASN A O   1 
ATOM   592  C  CB  . ASN A 1 86  ? 41.447  35.226  49.661  1.00 49.37  ? 84  ASN A CB  1 
ATOM   593  C  CG  . ASN A 1 86  ? 41.376  33.936  50.413  1.00 53.78  ? 84  ASN A CG  1 
ATOM   594  O  OD1 . ASN A 1 86  ? 40.603  33.804  51.363  1.00 56.16  ? 84  ASN A OD1 1 
ATOM   595  N  ND2 . ASN A 1 86  ? 42.169  32.959  49.986  1.00 55.37  ? 84  ASN A ND2 1 
ATOM   596  N  N   . TRP A 1 87  ? 41.949  37.019  52.823  1.00 39.04  ? 85  TRP A N   1 
ATOM   597  C  CA  . TRP A 1 87  ? 42.852  37.162  53.956  1.00 38.30  ? 85  TRP A CA  1 
ATOM   598  C  C   . TRP A 1 87  ? 42.780  35.971  54.909  1.00 41.15  ? 85  TRP A C   1 
ATOM   599  O  O   . TRP A 1 87  ? 41.711  35.636  55.446  1.00 39.74  ? 85  TRP A O   1 
ATOM   600  C  CB  . TRP A 1 87  ? 42.540  38.442  54.723  1.00 36.14  ? 85  TRP A CB  1 
ATOM   601  C  CG  . TRP A 1 87  ? 43.346  38.581  55.984  1.00 34.09  ? 85  TRP A CG  1 
ATOM   602  C  CD1 . TRP A 1 87  ? 43.014  38.127  57.220  1.00 33.23  ? 85  TRP A CD1 1 
ATOM   603  C  CD2 . TRP A 1 87  ? 44.629  39.215  56.116  1.00 35.13  ? 85  TRP A CD2 1 
ATOM   604  N  NE1 . TRP A 1 87  ? 43.994  38.445  58.119  1.00 36.23  ? 85  TRP A NE1 1 
ATOM   605  C  CE2 . TRP A 1 87  ? 44.998  39.119  57.471  1.00 35.82  ? 85  TRP A CE2 1 
ATOM   606  C  CE3 . TRP A 1 87  ? 45.487  39.884  55.225  1.00 32.61  ? 85  TRP A CE3 1 
ATOM   607  C  CZ2 . TRP A 1 87  ? 46.201  39.653  57.962  1.00 37.46  ? 85  TRP A CZ2 1 
ATOM   608  C  CZ3 . TRP A 1 87  ? 46.684  40.412  55.714  1.00 34.22  ? 85  TRP A CZ3 1 
ATOM   609  C  CH2 . TRP A 1 87  ? 47.027  40.289  57.063  1.00 35.13  ? 85  TRP A CH2 1 
ATOM   610  N  N   . VAL A 1 88  ? 43.930  35.369  55.168  1.00 40.19  ? 86  VAL A N   1 
ATOM   611  C  CA  . VAL A 1 88  ? 44.036  34.349  56.185  1.00 41.43  ? 86  VAL A CA  1 
ATOM   612  C  C   . VAL A 1 88  ? 45.140  34.773  57.129  1.00 45.61  ? 86  VAL A C   1 
ATOM   613  O  O   . VAL A 1 88  ? 46.311  34.836  56.736  1.00 50.01  ? 86  VAL A O   1 
ATOM   614  C  CB  . VAL A 1 88  ? 44.309  32.961  55.597  1.00 41.97  ? 86  VAL A CB  1 
ATOM   615  C  CG1 . VAL A 1 88  ? 44.298  31.924  56.696  1.00 43.42  ? 86  VAL A CG1 1 
ATOM   616  C  CG2 . VAL A 1 88  ? 43.244  32.632  54.566  1.00 39.98  ? 86  VAL A CG2 1 
ATOM   617  N  N   . GLY A 1 89  ? 44.771  35.091  58.362  1.00 44.11  ? 87  GLY A N   1 
ATOM   618  C  CA  . GLY A 1 89  ? 45.763  35.523  59.316  1.00 42.22  ? 87  GLY A CA  1 
ATOM   619  C  C   . GLY A 1 89  ? 46.756  34.417  59.602  1.00 44.50  ? 87  GLY A C   1 
ATOM   620  O  O   . GLY A 1 89  ? 46.416  33.234  59.609  1.00 46.61  ? 87  GLY A O   1 
ATOM   621  N  N   . GLU A 1 90  ? 48.009  34.821  59.817  1.00 48.21  ? 88  GLU A N   1 
ATOM   622  C  CA  . GLU A 1 90  ? 49.087  33.894  60.160  1.00 50.17  ? 88  GLU A CA  1 
ATOM   623  C  C   . GLU A 1 90  ? 48.765  33.048  61.384  1.00 52.78  ? 88  GLU A C   1 
ATOM   624  O  O   . GLU A 1 90  ? 49.411  32.017  61.598  1.00 58.48  ? 88  GLU A O   1 
ATOM   625  C  CB  . GLU A 1 90  ? 50.401  34.659  60.392  1.00 49.41  ? 88  GLU A CB  1 
ATOM   626  N  N   . ASP A 1 91  ? 47.809  33.463  62.211  1.00 53.33  ? 89  ASP A N   1 
ATOM   627  C  CA  . ASP A 1 91  ? 47.480  32.715  63.415  1.00 57.69  ? 89  ASP A CA  1 
ATOM   628  C  C   . ASP A 1 91  ? 46.183  31.937  63.281  1.00 53.99  ? 89  ASP A C   1 
ATOM   629  O  O   . ASP A 1 91  ? 45.734  31.328  64.259  1.00 53.48  ? 89  ASP A O   1 
ATOM   630  C  CB  . ASP A 1 91  ? 47.394  33.661  64.621  1.00 63.84  ? 89  ASP A CB  1 
ATOM   631  C  CG  . ASP A 1 91  ? 48.738  34.276  64.977  1.00 71.01  ? 89  ASP A CG  1 
ATOM   632  O  OD1 . ASP A 1 91  ? 49.706  33.494  65.095  1.00 76.59  ? 89  ASP A OD1 1 
ATOM   633  O  OD2 . ASP A 1 91  ? 48.829  35.518  65.166  1.00 70.48  ? 89  ASP A OD2 1 
ATOM   634  N  N   . VAL A 1 92  ? 45.641  31.842  62.076  1.00 51.04  ? 90  VAL A N   1 
ATOM   635  C  CA  . VAL A 1 92  ? 44.492  30.972  61.829  1.00 49.24  ? 90  VAL A CA  1 
ATOM   636  C  C   . VAL A 1 92  ? 44.985  29.521  61.775  1.00 48.76  ? 90  VAL A C   1 
ATOM   637  O  O   . VAL A 1 92  ? 45.998  29.253  61.126  1.00 51.63  ? 90  VAL A O   1 
ATOM   638  C  CB  . VAL A 1 92  ? 43.796  31.359  60.525  1.00 48.00  ? 90  VAL A CB  1 
ATOM   639  C  CG1 . VAL A 1 92  ? 42.674  30.375  60.195  1.00 47.88  ? 90  VAL A CG1 1 
ATOM   640  C  CG2 . VAL A 1 92  ? 43.277  32.791  60.589  1.00 43.79  ? 90  VAL A CG2 1 
ATOM   641  N  N   . PRO A 1 93  ? 44.310  28.592  62.433  1.00 51.68  ? 91  PRO A N   1 
ATOM   642  C  CA  . PRO A 1 93  ? 44.716  27.179  62.330  1.00 54.09  ? 91  PRO A CA  1 
ATOM   643  C  C   . PRO A 1 93  ? 44.659  26.664  60.894  1.00 55.21  ? 91  PRO A C   1 
ATOM   644  O  O   . PRO A 1 93  ? 43.804  27.060  60.100  1.00 54.29  ? 91  PRO A O   1 
ATOM   645  C  CB  . PRO A 1 93  ? 43.700  26.453  63.222  1.00 52.56  ? 91  PRO A CB  1 
ATOM   646  C  CG  . PRO A 1 93  ? 43.173  27.518  64.157  1.00 52.84  ? 91  PRO A CG  1 
ATOM   647  C  CD  . PRO A 1 93  ? 43.222  28.807  63.402  1.00 52.44  ? 91  PRO A CD  1 
ATOM   648  N  N   . ASP A 1 94  ? 45.580  25.748  60.575  1.00 59.12  ? 92  ASP A N   1 
ATOM   649  C  CA  . ASP A 1 94  ? 45.686  25.235  59.213  1.00 58.91  ? 92  ASP A CA  1 
ATOM   650  C  C   . ASP A 1 94  ? 44.390  24.574  58.771  1.00 58.49  ? 92  ASP A C   1 
ATOM   651  O  O   . ASP A 1 94  ? 43.971  24.729  57.615  1.00 60.41  ? 92  ASP A O   1 
ATOM   652  C  CB  . ASP A 1 94  ? 46.842  24.248  59.108  1.00 68.12  ? 92  ASP A CB  1 
ATOM   653  C  CG  . ASP A 1 94  ? 48.195  24.931  59.123  1.00 76.35  ? 92  ASP A CG  1 
ATOM   654  O  OD1 . ASP A 1 94  ? 48.257  26.179  58.979  1.00 72.91  ? 92  ASP A OD1 1 
ATOM   655  O  OD2 . ASP A 1 94  ? 49.203  24.206  59.306  1.00 83.99  ? 92  ASP A OD2 1 
ATOM   656  N  N   . ALA A 1 95  ? 43.738  23.840  59.677  1.00 56.17  ? 93  ALA A N   1 
ATOM   657  C  CA  . ALA A 1 95  ? 42.481  23.193  59.328  1.00 57.95  ? 93  ALA A CA  1 
ATOM   658  C  C   . ALA A 1 95  ? 41.424  24.216  58.946  1.00 56.00  ? 93  ALA A C   1 
ATOM   659  O  O   . ALA A 1 95  ? 40.648  24.002  58.002  1.00 53.84  ? 93  ALA A O   1 
ATOM   660  C  CB  . ALA A 1 95  ? 41.985  22.342  60.494  1.00 60.36  ? 93  ALA A CB  1 
ATOM   661  N  N   . ARG A 1 96  ? 41.406  25.360  59.630  1.00 55.27  ? 94  ARG A N   1 
ATOM   662  C  CA  . ARG A 1 96  ? 40.386  26.338  59.286  1.00 53.69  ? 94  ARG A CA  1 
ATOM   663  C  C   . ARG A 1 96  ? 40.769  27.083  58.023  1.00 55.62  ? 94  ARG A C   1 
ATOM   664  O  O   . ARG A 1 96  ? 39.891  27.476  57.245  1.00 59.40  ? 94  ARG A O   1 
ATOM   665  C  CB  . ARG A 1 96  ? 40.140  27.320  60.435  1.00 50.47  ? 94  ARG A CB  1 
ATOM   666  C  CG  . ARG A 1 96  ? 39.186  28.467  60.074  1.00 51.15  ? 94  ARG A CG  1 
ATOM   667  C  CD  . ARG A 1 96  ? 37.710  28.059  60.275  1.00 56.34  ? 94  ARG A CD  1 
ATOM   668  N  NE  . ARG A 1 96  ? 36.775  29.168  60.065  1.00 57.18  ? 94  ARG A NE  1 
ATOM   669  C  CZ  . ARG A 1 96  ? 35.486  29.028  59.767  1.00 57.83  ? 94  ARG A CZ  1 
ATOM   670  N  NH1 . ARG A 1 96  ? 34.963  27.822  59.661  1.00 60.97  ? 94  ARG A NH1 1 
ATOM   671  N  NH2 . ARG A 1 96  ? 34.715  30.093  59.601  1.00 55.24  ? 94  ARG A NH2 1 
ATOM   672  N  N   . LYS A 1 97  ? 42.064  27.257  57.778  1.00 54.14  ? 95  LYS A N   1 
ATOM   673  C  CA  . LYS A 1 97  ? 42.456  27.787  56.482  1.00 56.21  ? 95  LYS A CA  1 
ATOM   674  C  C   . LYS A 1 97  ? 41.949  26.869  55.389  1.00 55.99  ? 95  LYS A C   1 
ATOM   675  O  O   . LYS A 1 97  ? 41.418  27.320  54.365  1.00 52.26  ? 95  LYS A O   1 
ATOM   676  C  CB  . LYS A 1 97  ? 43.974  27.947  56.394  1.00 58.06  ? 95  LYS A CB  1 
ATOM   677  C  CG  . LYS A 1 97  ? 44.449  28.207  54.975  1.00 59.79  ? 95  LYS A CG  1 
ATOM   678  C  CD  . LYS A 1 97  ? 45.799  28.878  54.938  1.00 63.29  ? 95  LYS A CD  1 
ATOM   679  C  CE  . LYS A 1 97  ? 46.091  29.385  53.537  1.00 66.17  ? 95  LYS A CE  1 
ATOM   680  N  NZ  . LYS A 1 97  ? 47.487  29.907  53.403  1.00 69.72  ? 95  LYS A NZ  1 
ATOM   681  N  N   . CYS A 1 98  ? 42.046  25.569  55.631  1.00 55.61  ? 96  CYS A N   1 
ATOM   682  C  CA  . CYS A 1 98  ? 41.669  24.610  54.612  1.00 55.89  ? 96  CYS A CA  1 
ATOM   683  C  C   . CYS A 1 98  ? 40.168  24.654  54.362  1.00 55.84  ? 96  CYS A C   1 
ATOM   684  O  O   . CYS A 1 98  ? 39.726  24.695  53.206  1.00 55.66  ? 96  CYS A O   1 
ATOM   685  C  CB  . CYS A 1 98  ? 42.130  23.221  55.047  1.00 57.73  ? 96  CYS A CB  1 
ATOM   686  S  SG  . CYS A 1 98  ? 42.071  22.009  53.783  1.00 59.66  ? 96  CYS A SG  1 
ATOM   687  N  N   . ALA A 1 99  ? 39.370  24.683  55.444  1.00 53.42  ? 97  ALA A N   1 
ATOM   688  C  CA  . ALA A 1 99  ? 37.916  24.718  55.298  1.00 49.25  ? 97  ALA A CA  1 
ATOM   689  C  C   . ALA A 1 99  ? 37.469  26.006  54.636  1.00 50.65  ? 97  ALA A C   1 
ATOM   690  O  O   . ALA A 1 99  ? 36.631  25.985  53.722  1.00 52.08  ? 97  ALA A O   1 
ATOM   691  C  CB  . ALA A 1 99  ? 37.234  24.558  56.649  1.00 45.77  ? 97  ALA A CB  1 
ATOM   692  N  N   . CYS A 1 100 ? 38.032  27.135  55.072  1.00 45.80  ? 98  CYS A N   1 
ATOM   693  C  CA  . CYS A 1 100 ? 37.628  28.411  54.507  1.00 43.22  ? 98  CYS A CA  1 
ATOM   694  C  C   . CYS A 1 100 ? 38.029  28.537  53.052  1.00 41.36  ? 98  CYS A C   1 
ATOM   695  O  O   . CYS A 1 100 ? 37.357  29.240  52.296  1.00 41.09  ? 98  CYS A O   1 
ATOM   696  C  CB  . CYS A 1 100 ? 38.224  29.558  55.307  1.00 45.00  ? 98  CYS A CB  1 
ATOM   697  S  SG  . CYS A 1 100 ? 37.393  29.767  56.854  1.00 53.56  ? 98  CYS A SG  1 
ATOM   698  N  N   . ALA A 1 101 ? 39.099  27.854  52.638  1.00 40.52  ? 99  ALA A N   1 
ATOM   699  C  CA  . ALA A 1 101 ? 39.544  27.958  51.256  1.00 41.25  ? 99  ALA A CA  1 
ATOM   700  C  C   . ALA A 1 101 ? 38.440  27.566  50.286  1.00 45.13  ? 99  ALA A C   1 
ATOM   701  O  O   . ALA A 1 101 ? 38.314  28.160  49.212  1.00 46.70  ? 99  ALA A O   1 
ATOM   702  C  CB  . ALA A 1 101 ? 40.773  27.076  51.042  1.00 41.22  ? 99  ALA A CB  1 
ATOM   703  N  N   . SER A 1 102 ? 37.620  26.591  50.663  1.00 46.44  ? 100 SER A N   1 
ATOM   704  C  CA  . SER A 1 102 ? 36.514  26.161  49.834  1.00 52.07  ? 100 SER A CA  1 
ATOM   705  C  C   . SER A 1 102 ? 35.348  27.144  49.820  1.00 54.59  ? 100 SER A C   1 
ATOM   706  O  O   . SER A 1 102 ? 34.386  26.910  49.080  1.00 60.82  ? 100 SER A O   1 
ATOM   707  C  CB  . SER A 1 102 ? 36.066  24.774  50.295  1.00 57.48  ? 100 SER A CB  1 
ATOM   708  O  OG  . SER A 1 102 ? 35.551  24.826  51.613  1.00 60.06  ? 100 SER A OG  1 
ATOM   709  N  N   . HIS A 1 103 ? 35.388  28.205  50.630  1.00 50.15  ? 101 HIS A N   1 
ATOM   710  C  CA  . HIS A 1 103 ? 34.350  29.239  50.607  1.00 49.64  ? 101 HIS A CA  1 
ATOM   711  C  C   . HIS A 1 103 ? 34.640  30.379  49.636  1.00 47.99  ? 101 HIS A C   1 
ATOM   712  O  O   . HIS A 1 103 ? 33.697  31.056  49.196  1.00 50.77  ? 101 HIS A O   1 
ATOM   713  C  CB  . HIS A 1 103 ? 34.155  29.860  52.007  1.00 47.71  ? 101 HIS A CB  1 
ATOM   714  C  CG  . HIS A 1 103 ? 33.888  28.859  53.081  1.00 49.30  ? 101 HIS A CG  1 
ATOM   715  N  ND1 . HIS A 1 103 ? 34.072  29.137  54.418  1.00 49.00  ? 101 HIS A ND1 1 
ATOM   716  C  CD2 . HIS A 1 103 ? 33.461  27.575  53.017  1.00 50.79  ? 101 HIS A CD2 1 
ATOM   717  C  CE1 . HIS A 1 103 ? 33.768  28.068  55.133  1.00 50.35  ? 101 HIS A CE1 1 
ATOM   718  N  NE2 . HIS A 1 103 ? 33.391  27.107  54.307  1.00 52.22  ? 101 HIS A NE2 1 
ATOM   719  N  N   . VAL A 1 104 ? 35.908  30.599  49.284  1.00 42.51  ? 102 VAL A N   1 
ATOM   720  C  CA  . VAL A 1 104 ? 36.290  31.825  48.590  1.00 42.17  ? 102 VAL A CA  1 
ATOM   721  C  C   . VAL A 1 104 ? 35.437  32.022  47.343  1.00 48.15  ? 102 VAL A C   1 
ATOM   722  O  O   . VAL A 1 104 ? 34.855  33.092  47.132  1.00 52.59  ? 102 VAL A O   1 
ATOM   723  C  CB  . VAL A 1 104 ? 37.790  31.797  48.254  1.00 42.31  ? 102 VAL A CB  1 
ATOM   724  C  CG1 . VAL A 1 104 ? 38.176  33.006  47.416  1.00 43.42  ? 102 VAL A CG1 1 
ATOM   725  C  CG2 . VAL A 1 104 ? 38.607  31.717  49.530  1.00 41.12  ? 102 VAL A CG2 1 
ATOM   726  N  N   . ALA A 1 105 ? 35.310  30.972  46.523  1.00 51.14  ? 103 ALA A N   1 
ATOM   727  C  CA  . ALA A 1 105 ? 34.557  31.088  45.276  1.00 54.48  ? 103 ALA A CA  1 
ATOM   728  C  C   . ALA A 1 105 ? 33.108  31.489  45.528  1.00 57.60  ? 103 ALA A C   1 
ATOM   729  O  O   . ALA A 1 105 ? 32.528  32.281  44.773  1.00 59.59  ? 103 ALA A O   1 
ATOM   730  C  CB  . ALA A 1 105 ? 34.605  29.772  44.517  1.00 54.87  ? 103 ALA A CB  1 
ATOM   731  N  N   . LYS A 1 106 ? 32.497  30.911  46.557  1.00 56.00  ? 104 LYS A N   1 
ATOM   732  C  CA  . LYS A 1 106 ? 31.132  31.258  46.920  1.00 57.84  ? 104 LYS A CA  1 
ATOM   733  C  C   . LYS A 1 106 ? 31.028  32.721  47.378  1.00 53.32  ? 104 LYS A C   1 
ATOM   734  O  O   . LYS A 1 106 ? 30.049  33.408  47.058  1.00 49.20  ? 104 LYS A O   1 
ATOM   735  C  CB  . LYS A 1 106 ? 30.671  30.264  47.982  1.00 63.07  ? 104 LYS A CB  1 
ATOM   736  C  CG  . LYS A 1 106 ? 29.193  30.048  48.121  1.00 69.68  ? 104 LYS A CG  1 
ATOM   737  C  CD  . LYS A 1 106 ? 29.001  28.719  48.787  1.00 76.09  ? 104 LYS A CD  1 
ATOM   738  C  CE  . LYS A 1 106 ? 27.858  28.726  49.765  1.00 83.18  ? 104 LYS A CE  1 
ATOM   739  N  NZ  . LYS A 1 106 ? 28.020  27.556  50.701  1.00 86.36  ? 104 LYS A NZ  1 
ATOM   740  N  N   . VAL A 1 107 ? 32.040  33.229  48.098  1.00 50.94  ? 105 VAL A N   1 
ATOM   741  C  CA  . VAL A 1 107 ? 32.052  34.648  48.464  1.00 47.53  ? 105 VAL A CA  1 
ATOM   742  C  C   . VAL A 1 107 ? 32.168  35.535  47.220  1.00 48.36  ? 105 VAL A C   1 
ATOM   743  O  O   . VAL A 1 107 ? 31.458  36.541  47.090  1.00 47.59  ? 105 VAL A O   1 
ATOM   744  C  CB  . VAL A 1 107 ? 33.186  34.936  49.462  1.00 47.49  ? 105 VAL A CB  1 
ATOM   745  C  CG1 . VAL A 1 107 ? 33.410  36.445  49.583  1.00 48.44  ? 105 VAL A CG1 1 
ATOM   746  C  CG2 . VAL A 1 107 ? 32.856  34.339  50.829  1.00 47.75  ? 105 VAL A CG2 1 
ATOM   747  N  N   . ALA A 1 108 ? 33.061  35.187  46.287  1.00 47.91  ? 106 ALA A N   1 
ATOM   748  C  CA  . ALA A 1 108 ? 33.174  35.968  45.057  1.00 47.79  ? 106 ALA A CA  1 
ATOM   749  C  C   . ALA A 1 108 ? 31.885  35.925  44.266  1.00 50.98  ? 106 ALA A C   1 
ATOM   750  O  O   . ALA A 1 108 ? 31.521  36.899  43.594  1.00 54.14  ? 106 ALA A O   1 
ATOM   751  C  CB  . ALA A 1 108 ? 34.330  35.464  44.197  1.00 46.54  ? 106 ALA A CB  1 
ATOM   752  N  N   . GLU A 1 109 ? 31.179  34.808  44.334  1.00 53.87  ? 107 GLU A N   1 
ATOM   753  C  CA  . GLU A 1 109 ? 29.924  34.724  43.615  1.00 58.29  ? 107 GLU A CA  1 
ATOM   754  C  C   . GLU A 1 109 ? 28.869  35.575  44.290  1.00 58.79  ? 107 GLU A C   1 
ATOM   755  O  O   . GLU A 1 109 ? 27.986  36.122  43.617  1.00 57.17  ? 107 GLU A O   1 
ATOM   756  C  CB  . GLU A 1 109 ? 29.471  33.266  43.549  1.00 60.01  ? 107 GLU A CB  1 
ATOM   757  C  CG  . GLU A 1 109 ? 28.344  33.019  42.613  1.00 66.47  ? 107 GLU A CG  1 
ATOM   758  C  CD  . GLU A 1 109 ? 28.715  33.341  41.190  1.00 72.91  ? 107 GLU A CD  1 
ATOM   759  O  OE1 . GLU A 1 109 ? 29.926  33.356  40.889  1.00 72.39  ? 107 GLU A OE1 1 
ATOM   760  O  OE2 . GLU A 1 109 ? 27.799  33.565  40.367  1.00 78.97  ? 107 GLU A OE2 1 
ATOM   761  N  N   . PHE A 1 110 ? 28.974  35.728  45.613  1.00 57.63  ? 108 PHE A N   1 
ATOM   762  C  CA  . PHE A 1 110 ? 27.992  36.522  46.331  1.00 53.60  ? 108 PHE A CA  1 
ATOM   763  C  C   . PHE A 1 110 ? 28.150  38.001  46.010  1.00 55.78  ? 108 PHE A C   1 
ATOM   764  O  O   . PHE A 1 110 ? 27.164  38.688  45.708  1.00 59.55  ? 108 PHE A O   1 
ATOM   765  C  CB  . PHE A 1 110 ? 28.095  36.247  47.832  1.00 44.70  ? 108 PHE A CB  1 
ATOM   766  C  CG  . PHE A 1 110 ? 27.060  36.968  48.649  1.00 47.23  ? 108 PHE A CG  1 
ATOM   767  C  CD1 . PHE A 1 110 ? 25.783  36.421  48.815  1.00 47.54  ? 108 PHE A CD1 1 
ATOM   768  C  CD2 . PHE A 1 110 ? 27.364  38.158  49.294  1.00 47.65  ? 108 PHE A CD2 1 
ATOM   769  C  CE1 . PHE A 1 110 ? 24.812  37.066  49.557  1.00 47.33  ? 108 PHE A CE1 1 
ATOM   770  C  CE2 . PHE A 1 110 ? 26.392  38.805  50.052  1.00 49.50  ? 108 PHE A CE2 1 
ATOM   771  C  CZ  . PHE A 1 110 ? 25.115  38.244  50.179  1.00 49.14  ? 108 PHE A CZ  1 
ATOM   772  N  N   . PHE A 1 111 ? 29.390  38.497  46.018  1.00 51.87  ? 109 PHE A N   1 
ATOM   773  C  CA  . PHE A 1 111 ? 29.657  39.906  45.732  1.00 53.61  ? 109 PHE A CA  1 
ATOM   774  C  C   . PHE A 1 111 ? 29.985  40.107  44.257  1.00 56.03  ? 109 PHE A C   1 
ATOM   775  O  O   . PHE A 1 111 ? 31.123  40.401  43.883  1.00 56.88  ? 109 PHE A O   1 
ATOM   776  C  CB  . PHE A 1 111 ? 30.775  40.425  46.624  1.00 51.44  ? 109 PHE A CB  1 
ATOM   777  C  CG  . PHE A 1 111 ? 30.479  40.314  48.089  1.00 49.69  ? 109 PHE A CG  1 
ATOM   778  C  CD1 . PHE A 1 111 ? 29.525  41.144  48.675  1.00 50.16  ? 109 PHE A CD1 1 
ATOM   779  C  CD2 . PHE A 1 111 ? 31.196  39.451  48.896  1.00 48.93  ? 109 PHE A CD2 1 
ATOM   780  C  CE1 . PHE A 1 111 ? 29.254  41.079  50.029  1.00 49.14  ? 109 PHE A CE1 1 
ATOM   781  C  CE2 . PHE A 1 111 ? 30.928  39.373  50.257  1.00 49.86  ? 109 PHE A CE2 1 
ATOM   782  C  CZ  . PHE A 1 111 ? 29.952  40.198  50.822  1.00 49.57  ? 109 PHE A CZ  1 
ATOM   783  N  N   . GLN A 1 112 ? 28.942  40.003  43.420  1.00 57.09  ? 110 GLN A N   1 
ATOM   784  C  CA  . GLN A 1 112 ? 29.102  39.904  41.970  1.00 61.87  ? 110 GLN A CA  1 
ATOM   785  C  C   . GLN A 1 112 ? 30.063  40.954  41.432  1.00 66.36  ? 110 GLN A C   1 
ATOM   786  O  O   . GLN A 1 112 ? 30.094  42.098  41.901  1.00 66.93  ? 110 GLN A O   1 
ATOM   787  C  CB  . GLN A 1 112 ? 27.758  40.074  41.271  1.00 63.43  ? 110 GLN A CB  1 
ATOM   788  C  CG  . GLN A 1 112 ? 26.826  38.926  41.464  1.00 65.19  ? 110 GLN A CG  1 
ATOM   789  C  CD  . GLN A 1 112 ? 27.113  37.780  40.521  1.00 65.85  ? 110 GLN A CD  1 
ATOM   790  O  OE1 . GLN A 1 112 ? 26.799  37.846  39.337  1.00 69.06  ? 110 GLN A OE1 1 
ATOM   791  N  NE2 . GLN A 1 112 ? 27.709  36.715  41.047  1.00 63.29  ? 110 GLN A NE2 1 
ATOM   792  N  N   . GLY A 1 113 ? 30.883  40.546  40.472  1.00 65.83  ? 111 GLY A N   1 
ATOM   793  C  CA  . GLY A 1 113 ? 31.758  41.478  39.803  1.00 64.10  ? 111 GLY A CA  1 
ATOM   794  C  C   . GLY A 1 113 ? 33.183  41.512  40.305  1.00 59.18  ? 111 GLY A C   1 
ATOM   795  O  O   . GLY A 1 113 ? 33.884  42.494  40.041  1.00 58.88  ? 111 GLY A O   1 
ATOM   796  N  N   . VAL A 1 114 ? 33.631  40.488  41.028  1.00 55.21  ? 112 VAL A N   1 
ATOM   797  C  CA  . VAL A 1 114 ? 35.021  40.448  41.450  1.00 54.81  ? 112 VAL A CA  1 
ATOM   798  C  C   . VAL A 1 114 ? 35.905  40.326  40.222  1.00 55.40  ? 112 VAL A C   1 
ATOM   799  O  O   . VAL A 1 114 ? 35.742  39.417  39.398  1.00 55.64  ? 112 VAL A O   1 
ATOM   800  C  CB  . VAL A 1 114 ? 35.255  39.281  42.417  1.00 55.51  ? 112 VAL A CB  1 
ATOM   801  C  CG1 . VAL A 1 114 ? 36.726  39.046  42.605  1.00 52.29  ? 112 VAL A CG1 1 
ATOM   802  C  CG2 . VAL A 1 114 ? 34.600  39.577  43.746  1.00 54.75  ? 112 VAL A CG2 1 
ATOM   803  N  N   . ASP A 1 115 ? 36.856  41.235  40.094  1.00 57.26  ? 113 ASP A N   1 
ATOM   804  C  CA  . ASP A 1 115 ? 37.733  41.167  38.941  1.00 64.71  ? 113 ASP A CA  1 
ATOM   805  C  C   . ASP A 1 115 ? 39.007  40.381  39.220  1.00 65.31  ? 113 ASP A C   1 
ATOM   806  O  O   . ASP A 1 115 ? 39.478  39.659  38.338  1.00 66.63  ? 113 ASP A O   1 
ATOM   807  C  CB  . ASP A 1 115 ? 38.067  42.583  38.450  1.00 70.47  ? 113 ASP A CB  1 
ATOM   808  C  CG  . ASP A 1 115 ? 36.894  43.237  37.738  1.00 74.73  ? 113 ASP A CG  1 
ATOM   809  O  OD1 . ASP A 1 115 ? 36.305  42.581  36.855  1.00 78.38  ? 113 ASP A OD1 1 
ATOM   810  O  OD2 . ASP A 1 115 ? 36.561  44.400  38.051  1.00 75.96  ? 113 ASP A OD2 1 
ATOM   811  N  N   . VAL A 1 116 ? 39.547  40.437  40.436  1.00 63.15  ? 114 VAL A N   1 
ATOM   812  C  CA  . VAL A 1 116 ? 40.718  39.623  40.756  1.00 64.03  ? 114 VAL A CA  1 
ATOM   813  C  C   . VAL A 1 116 ? 40.654  39.226  42.220  1.00 63.46  ? 114 VAL A C   1 
ATOM   814  O  O   . VAL A 1 116 ? 40.178  39.990  43.065  1.00 64.79  ? 114 VAL A O   1 
ATOM   815  C  CB  . VAL A 1 116 ? 42.050  40.351  40.442  1.00 65.50  ? 114 VAL A CB  1 
ATOM   816  C  CG1 . VAL A 1 116 ? 42.191  41.584  41.279  1.00 64.39  ? 114 VAL A CG1 1 
ATOM   817  C  CG2 . VAL A 1 116 ? 43.228  39.440  40.747  1.00 67.25  ? 114 VAL A CG2 1 
ATOM   818  N  N   . ILE A 1 117 ? 41.124  38.015  42.521  1.00 59.40  ? 115 ILE A N   1 
ATOM   819  C  CA  . ILE A 1 117 ? 41.207  37.534  43.891  1.00 54.27  ? 115 ILE A CA  1 
ATOM   820  C  C   . ILE A 1 117 ? 42.672  37.474  44.275  1.00 55.29  ? 115 ILE A C   1 
ATOM   821  O  O   . ILE A 1 117 ? 43.482  36.879  43.555  1.00 60.54  ? 115 ILE A O   1 
ATOM   822  C  CB  . ILE A 1 117 ? 40.546  36.163  44.069  1.00 51.56  ? 115 ILE A CB  1 
ATOM   823  C  CG1 . ILE A 1 117 ? 39.066  36.257  43.740  1.00 51.12  ? 115 ILE A CG1 1 
ATOM   824  C  CG2 . ILE A 1 117 ? 40.720  35.705  45.516  1.00 48.49  ? 115 ILE A CG2 1 
ATOM   825  C  CD1 . ILE A 1 117 ? 38.302  35.040  44.164  1.00 51.83  ? 115 ILE A CD1 1 
ATOM   826  N  N   . VAL A 1 118 ? 43.005  38.079  45.411  1.00 50.94  ? 116 VAL A N   1 
ATOM   827  C  CA  . VAL A 1 118 ? 44.376  38.189  45.898  1.00 53.33  ? 116 VAL A CA  1 
ATOM   828  C  C   . VAL A 1 118 ? 44.470  37.504  47.262  1.00 54.71  ? 116 VAL A C   1 
ATOM   829  O  O   . VAL A 1 118 ? 43.823  37.938  48.220  1.00 55.64  ? 116 VAL A O   1 
ATOM   830  C  CB  . VAL A 1 118 ? 44.791  39.664  45.992  1.00 52.56  ? 116 VAL A CB  1 
ATOM   831  C  CG1 . VAL A 1 118 ? 46.152  39.817  46.614  1.00 50.79  ? 116 VAL A CG1 1 
ATOM   832  C  CG2 . VAL A 1 118 ? 44.728  40.301  44.622  1.00 56.63  ? 116 VAL A CG2 1 
ATOM   833  N  N   . ASN A 1 119 ? 45.295  36.461  47.365  1.00 55.34  ? 117 ASN A N   1 
ATOM   834  C  CA  . ASN A 1 119 ? 45.488  35.790  48.649  1.00 54.11  ? 117 ASN A CA  1 
ATOM   835  C  C   . ASN A 1 119 ? 46.510  36.529  49.503  1.00 52.68  ? 117 ASN A C   1 
ATOM   836  O  O   . ASN A 1 119 ? 47.587  36.896  49.033  1.00 54.64  ? 117 ASN A O   1 
ATOM   837  C  CB  . ASN A 1 119 ? 45.945  34.346  48.447  1.00 56.44  ? 117 ASN A CB  1 
ATOM   838  C  CG  . ASN A 1 119 ? 44.978  33.523  47.619  1.00 61.47  ? 117 ASN A CG  1 
ATOM   839  O  OD1 . ASN A 1 119 ? 43.757  33.633  47.771  1.00 60.34  ? 117 ASN A OD1 1 
ATOM   840  N  ND2 . ASN A 1 119 ? 45.517  32.681  46.739  1.00 66.67  ? 117 ASN A ND2 1 
ATOM   841  N  N   . ALA A 1 120 ? 46.198  36.698  50.782  1.00 49.20  ? 118 ALA A N   1 
ATOM   842  C  CA  . ALA A 1 120 ? 47.003  37.564  51.632  1.00 48.04  ? 118 ALA A CA  1 
ATOM   843  C  C   . ALA A 1 120 ? 47.049  37.021  53.047  1.00 45.55  ? 118 ALA A C   1 
ATOM   844  O  O   . ALA A 1 120 ? 46.046  36.511  53.557  1.00 44.93  ? 118 ALA A O   1 
ATOM   845  C  CB  . ALA A 1 120 ? 46.452  38.990  51.653  1.00 47.98  ? 118 ALA A CB  1 
ATOM   846  N  N   . SER A 1 121 ? 48.237  37.092  53.656  1.00 46.21  ? 119 SER A N   1 
ATOM   847  C  CA  . SER A 1 121 ? 48.417  36.755  55.064  1.00 46.22  ? 119 SER A CA  1 
ATOM   848  C  C   . SER A 1 121 ? 49.214  37.775  55.858  1.00 47.26  ? 119 SER A C   1 
ATOM   849  O  O   . SER A 1 121 ? 49.381  37.593  57.071  1.00 50.55  ? 119 SER A O   1 
ATOM   850  C  CB  . SER A 1 121 ? 49.084  35.388  55.204  1.00 52.24  ? 119 SER A CB  1 
ATOM   851  O  OG  . SER A 1 121 ? 48.258  34.425  54.581  1.00 57.17  ? 119 SER A OG  1 
ATOM   852  N  N   . SER A 1 122 ? 49.802  38.768  55.213  1.00 44.08  ? 120 SER A N   1 
ATOM   853  C  CA  . SER A 1 122 ? 50.373  39.889  55.927  1.00 50.01  ? 120 SER A CA  1 
ATOM   854  C  C   . SER A 1 122 ? 49.956  41.123  55.148  1.00 52.29  ? 120 SER A C   1 
ATOM   855  O  O   . SER A 1 122 ? 49.523  41.030  54.001  1.00 51.51  ? 120 SER A O   1 
ATOM   856  C  CB  . SER A 1 122 ? 51.887  39.763  56.104  1.00 53.55  ? 120 SER A CB  1 
ATOM   857  O  OG  . SER A 1 122 ? 52.564  40.139  54.940  1.00 58.79  ? 120 SER A OG  1 
ATOM   858  N  N   . VAL A 1 123 ? 50.062  42.291  55.771  1.00 53.61  ? 121 VAL A N   1 
ATOM   859  C  CA  . VAL A 1 123 ? 49.801  43.499  54.999  1.00 53.95  ? 121 VAL A CA  1 
ATOM   860  C  C   . VAL A 1 123 ? 50.733  43.582  53.805  1.00 58.16  ? 121 VAL A C   1 
ATOM   861  O  O   . VAL A 1 123 ? 50.353  44.099  52.750  1.00 62.03  ? 121 VAL A O   1 
ATOM   862  C  CB  . VAL A 1 123 ? 49.891  44.739  55.898  1.00 48.52  ? 121 VAL A CB  1 
ATOM   863  C  CG1 . VAL A 1 123 ? 49.120  44.490  57.164  1.00 47.37  ? 121 VAL A CG1 1 
ATOM   864  C  CG2 . VAL A 1 123 ? 51.319  45.032  56.223  1.00 47.19  ? 121 VAL A CG2 1 
ATOM   865  N  N   . GLU A 1 124 ? 51.948  43.055  53.933  1.00 62.53  ? 122 GLU A N   1 
ATOM   866  C  CA  . GLU A 1 124 ? 52.912  43.153  52.848  1.00 67.54  ? 122 GLU A CA  1 
ATOM   867  C  C   . GLU A 1 124 ? 52.455  42.439  51.583  1.00 67.31  ? 122 GLU A C   1 
ATOM   868  O  O   . GLU A 1 124 ? 53.002  42.713  50.510  1.00 72.38  ? 122 GLU A O   1 
ATOM   869  C  CB  . GLU A 1 124 ? 54.255  42.599  53.298  1.00 79.08  ? 122 GLU A CB  1 
ATOM   870  C  CG  . GLU A 1 124 ? 54.726  43.164  54.613  1.00 87.19  ? 122 GLU A CG  1 
ATOM   871  C  CD  . GLU A 1 124 ? 55.780  42.300  55.258  1.00 95.43  ? 122 GLU A CD  1 
ATOM   872  O  OE1 . GLU A 1 124 ? 55.388  41.336  55.962  1.00 95.42  ? 122 GLU A OE1 1 
ATOM   873  O  OE2 . GLU A 1 124 ? 56.991  42.581  55.056  1.00 100.94 ? 122 GLU A OE2 1 
ATOM   874  N  N   . ASP A 1 125 ? 51.489  41.519  51.675  1.00 59.14  ? 123 ASP A N   1 
ATOM   875  C  CA  . ASP A 1 125 ? 50.950  40.902  50.468  1.00 55.76  ? 123 ASP A CA  1 
ATOM   876  C  C   . ASP A 1 125 ? 50.024  41.841  49.710  1.00 55.28  ? 123 ASP A C   1 
ATOM   877  O  O   . ASP A 1 125 ? 49.627  41.525  48.582  1.00 56.98  ? 123 ASP A O   1 
ATOM   878  C  CB  . ASP A 1 125 ? 50.190  39.616  50.810  1.00 55.19  ? 123 ASP A CB  1 
ATOM   879  C  CG  . ASP A 1 125 ? 51.067  38.558  51.464  1.00 61.46  ? 123 ASP A CG  1 
ATOM   880  O  OD1 . ASP A 1 125 ? 50.547  37.779  52.296  1.00 61.92  ? 123 ASP A OD1 1 
ATOM   881  O  OD2 . ASP A 1 125 ? 52.279  38.512  51.176  1.00 65.48  ? 123 ASP A OD2 1 
ATOM   882  N  N   . ILE A 1 126 ? 49.702  42.997  50.282  1.00 54.54  ? 124 ILE A N   1 
ATOM   883  C  CA  . ILE A 1 126 ? 48.711  43.899  49.710  1.00 57.32  ? 124 ILE A CA  1 
ATOM   884  C  C   . ILE A 1 126 ? 49.376  45.167  49.205  1.00 64.04  ? 124 ILE A C   1 
ATOM   885  O  O   . ILE A 1 126 ? 49.311  46.221  49.847  1.00 65.31  ? 124 ILE A O   1 
ATOM   886  C  CB  . ILE A 1 126 ? 47.619  44.190  50.750  1.00 53.00  ? 124 ILE A CB  1 
ATOM   887  C  CG1 . ILE A 1 126 ? 47.014  42.853  51.185  1.00 47.69  ? 124 ILE A CG1 1 
ATOM   888  C  CG2 . ILE A 1 126 ? 46.567  45.166  50.225  1.00 51.43  ? 124 ILE A CG2 1 
ATOM   889  C  CD1 . ILE A 1 126 ? 46.032  42.974  52.245  1.00 44.62  ? 124 ILE A CD1 1 
ATOM   890  N  N   . ASP A 1 127 ? 50.018  45.058  48.043  1.00 69.70  ? 125 ASP A N   1 
ATOM   891  C  CA  . ASP A 1 127 ? 50.717  46.159  47.383  1.00 73.01  ? 125 ASP A CA  1 
ATOM   892  C  C   . ASP A 1 127 ? 49.827  46.755  46.297  1.00 68.22  ? 125 ASP A C   1 
ATOM   893  O  O   . ASP A 1 127 ? 49.594  46.119  45.261  1.00 66.37  ? 125 ASP A O   1 
ATOM   894  C  CB  . ASP A 1 127 ? 52.040  45.671  46.798  1.00 80.70  ? 125 ASP A CB  1 
ATOM   895  C  CG  . ASP A 1 127 ? 52.832  46.775  46.173  1.00 88.08  ? 125 ASP A CG  1 
ATOM   896  O  OD1 . ASP A 1 127 ? 52.483  47.187  45.049  1.00 91.79  ? 125 ASP A OD1 1 
ATOM   897  O  OD2 . ASP A 1 127 ? 53.794  47.244  46.810  1.00 91.90  ? 125 ASP A OD2 1 
ATOM   898  N  N   . ALA A 1 128 ? 49.369  47.991  46.526  1.00 67.43  ? 126 ALA A N   1 
ATOM   899  C  CA  . ALA A 1 128 ? 48.479  48.669  45.585  1.00 66.19  ? 126 ALA A CA  1 
ATOM   900  C  C   . ALA A 1 128 ? 49.033  48.669  44.159  1.00 67.85  ? 126 ALA A C   1 
ATOM   901  O  O   . ALA A 1 128 ? 48.279  48.484  43.191  1.00 65.74  ? 126 ALA A O   1 
ATOM   902  C  CB  . ALA A 1 128 ? 48.219  50.095  46.068  1.00 65.18  ? 126 ALA A CB  1 
ATOM   903  N  N   . GLY A 1 129 ? 50.346  48.871  44.009  1.00 70.11  ? 127 GLY A N   1 
ATOM   904  C  CA  . GLY A 1 129 ? 50.946  48.789  42.686  1.00 71.42  ? 127 GLY A CA  1 
ATOM   905  C  C   . GLY A 1 129 ? 50.792  47.414  42.058  1.00 71.16  ? 127 GLY A C   1 
ATOM   906  O  O   . GLY A 1 129 ? 50.249  47.281  40.961  1.00 73.28  ? 127 GLY A O   1 
ATOM   907  N  N   . ALA A 1 130 ? 51.230  46.366  42.763  1.00 68.24  ? 128 ALA A N   1 
ATOM   908  C  CA  . ALA A 1 130 ? 51.190  45.019  42.199  1.00 68.36  ? 128 ALA A CA  1 
ATOM   909  C  C   . ALA A 1 130 ? 49.775  44.635  41.789  1.00 70.34  ? 128 ALA A C   1 
ATOM   910  O  O   . ALA A 1 130 ? 49.550  44.102  40.692  1.00 73.76  ? 128 ALA A O   1 
ATOM   911  C  CB  . ALA A 1 130 ? 51.755  44.019  43.202  1.00 64.08  ? 128 ALA A CB  1 
ATOM   912  N  N   . ILE A 1 131 ? 48.803  44.903  42.661  1.00 68.90  ? 129 ILE A N   1 
ATOM   913  C  CA  . ILE A 1 131 ? 47.406  44.654  42.315  1.00 65.94  ? 129 ILE A CA  1 
ATOM   914  C  C   . ILE A 1 131 ? 47.003  45.463  41.078  1.00 69.27  ? 129 ILE A C   1 
ATOM   915  O  O   . ILE A 1 131 ? 46.332  44.947  40.175  1.00 67.13  ? 129 ILE A O   1 
ATOM   916  C  CB  . ILE A 1 131 ? 46.500  44.955  43.523  1.00 59.30  ? 129 ILE A CB  1 
ATOM   917  C  CG1 . ILE A 1 131 ? 46.670  43.869  44.590  1.00 56.71  ? 129 ILE A CG1 1 
ATOM   918  C  CG2 . ILE A 1 131 ? 45.045  45.075  43.093  1.00 55.80  ? 129 ILE A CG2 1 
ATOM   919  C  CD1 . ILE A 1 131 ? 46.059  44.200  45.922  1.00 52.34  ? 129 ILE A CD1 1 
ATOM   920  N  N   . GLY A 1 132 ? 47.416  46.734  41.008  1.00 72.50  ? 130 GLY A N   1 
ATOM   921  C  CA  . GLY A 1 132 ? 47.062  47.542  39.850  1.00 78.30  ? 130 GLY A CA  1 
ATOM   922  C  C   . GLY A 1 132 ? 47.584  46.962  38.549  1.00 87.04  ? 130 GLY A C   1 
ATOM   923  O  O   . GLY A 1 132 ? 46.843  46.833  37.570  1.00 90.36  ? 130 GLY A O   1 
ATOM   924  N  N   . GLN A 1 133 ? 48.860  46.557  38.535  1.00 90.95  ? 131 GLN A N   1 
ATOM   925  C  CA  . GLN A 1 133 ? 49.426  45.937  37.341  1.00 95.30  ? 131 GLN A CA  1 
ATOM   926  C  C   . GLN A 1 133 ? 48.676  44.661  36.987  1.00 97.82  ? 131 GLN A C   1 
ATOM   927  O  O   . GLN A 1 133 ? 48.510  44.340  35.805  1.00 103.01 ? 131 GLN A O   1 
ATOM   928  C  CB  . GLN A 1 133 ? 50.919  45.657  37.534  1.00 95.73  ? 131 GLN A CB  1 
ATOM   929  N  N   . ARG A 1 134 ? 48.212  43.920  38.000  1.00 95.69  ? 132 ARG A N   1 
ATOM   930  C  CA  . ARG A 1 134 ? 47.453  42.699  37.728  1.00 94.86  ? 132 ARG A CA  1 
ATOM   931  C  C   . ARG A 1 134 ? 46.202  42.978  36.903  1.00 95.18  ? 132 ARG A C   1 
ATOM   932  O  O   . ARG A 1 134 ? 45.808  42.160  36.064  1.00 98.38  ? 132 ARG A O   1 
ATOM   933  C  CB  . ARG A 1 134 ? 47.059  42.021  39.035  1.00 91.85  ? 132 ARG A CB  1 
ATOM   934  C  CG  . ARG A 1 134 ? 47.749  40.706  39.267  1.00 93.63  ? 132 ARG A CG  1 
ATOM   935  C  CD  . ARG A 1 134 ? 47.366  40.141  40.609  1.00 91.77  ? 132 ARG A CD  1 
ATOM   936  N  NE  . ARG A 1 134 ? 47.423  38.687  40.614  1.00 94.43  ? 132 ARG A NE  1 
ATOM   937  C  CZ  . ARG A 1 134 ? 47.314  37.948  41.710  1.00 93.57  ? 132 ARG A CZ  1 
ATOM   938  N  NH1 . ARG A 1 134 ? 47.383  36.625  41.633  1.00 96.65  ? 132 ARG A NH1 1 
ATOM   939  N  NH2 . ARG A 1 134 ? 47.137  38.536  42.881  1.00 89.35  ? 132 ARG A NH2 1 
ATOM   940  N  N   . LEU A 1 135 ? 45.556  44.115  37.132  1.00 89.70  ? 133 LEU A N   1 
ATOM   941  C  CA  . LEU A 1 135 ? 44.321  44.433  36.433  1.00 86.16  ? 133 LEU A CA  1 
ATOM   942  C  C   . LEU A 1 135 ? 44.543  44.942  35.000  1.00 91.96  ? 133 LEU A C   1 
ATOM   943  O  O   . LEU A 1 135 ? 45.651  45.324  34.605  1.00 96.06  ? 133 LEU A O   1 
ATOM   944  C  CB  . LEU A 1 135 ? 43.524  45.447  37.252  1.00 79.27  ? 133 LEU A CB  1 
ATOM   945  C  CG  . LEU A 1 135 ? 43.150  44.981  38.669  1.00 70.28  ? 133 LEU A CG  1 
ATOM   946  C  CD1 . LEU A 1 135 ? 43.030  46.138  39.651  1.00 63.79  ? 133 LEU A CD1 1 
ATOM   947  C  CD2 . LEU A 1 135 ? 41.867  44.178  38.662  1.00 69.23  ? 133 LEU A CD2 1 
ATOM   948  N  N   . GLY B 1 1   ? 0.374   11.793  18.033  1.00 98.01  ? -1  GLY B N   1 
ATOM   949  C  CA  . GLY B 1 1   ? 0.653   11.153  19.303  1.00 106.40 ? -1  GLY B CA  1 
ATOM   950  C  C   . GLY B 1 1   ? 2.113   10.766  19.462  1.00 116.65 ? -1  GLY B C   1 
ATOM   951  O  O   . GLY B 1 1   ? 2.755   11.121  20.447  1.00 120.42 ? -1  GLY B O   1 
ATOM   952  N  N   . SER B 1 2   ? 2.630   10.022  18.488  1.00 126.53 ? 0   SER B N   1 
ATOM   953  C  CA  . SER B 1 2   ? 4.027   9.608   18.453  1.00 127.14 ? 0   SER B CA  1 
ATOM   954  C  C   . SER B 1 2   ? 4.377   9.285   17.007  1.00 124.68 ? 0   SER B C   1 
ATOM   955  O  O   . SER B 1 2   ? 3.525   8.793   16.260  1.00 124.35 ? 0   SER B O   1 
ATOM   956  C  CB  . SER B 1 2   ? 4.288   8.397   19.365  1.00 125.90 ? 0   SER B CB  1 
ATOM   957  O  OG  . SER B 1 2   ? 3.717   7.204   18.846  1.00 121.97 ? 0   SER B OG  1 
ATOM   958  N  N   . MET B 1 3   ? 5.623   9.578   16.611  1.00 116.83 ? 1   MET B N   1 
ATOM   959  C  CA  . MET B 1 3   ? 6.007   9.415   15.209  1.00 104.00 ? 1   MET B CA  1 
ATOM   960  C  C   . MET B 1 3   ? 5.836   7.971   14.750  1.00 90.18  ? 1   MET B C   1 
ATOM   961  O  O   . MET B 1 3   ? 5.433   7.719   13.605  1.00 84.83  ? 1   MET B O   1 
ATOM   962  C  CB  . MET B 1 3   ? 7.447   9.881   14.995  1.00 104.14 ? 1   MET B CB  1 
ATOM   963  C  CG  . MET B 1 3   ? 7.940   9.759   13.552  1.00 101.69 ? 1   MET B CG  1 
ATOM   964  S  SD  . MET B 1 3   ? 9.008   8.329   13.223  1.00 99.08  ? 1   MET B SD  1 
ATOM   965  C  CE  . MET B 1 3   ? 10.522  9.136   12.690  1.00 100.65 ? 1   MET B CE  1 
ATOM   966  N  N   . ALA B 1 4   ? 6.107   7.009   15.641  1.00 82.55  ? 2   ALA B N   1 
ATOM   967  C  CA  . ALA B 1 4   ? 6.039   5.605   15.254  1.00 74.98  ? 2   ALA B CA  1 
ATOM   968  C  C   . ALA B 1 4   ? 4.620   5.181   14.887  1.00 69.43  ? 2   ALA B C   1 
ATOM   969  O  O   . ALA B 1 4   ? 4.437   4.320   14.020  1.00 68.16  ? 2   ALA B O   1 
ATOM   970  C  CB  . ALA B 1 4   ? 6.591   4.731   16.376  1.00 68.87  ? 2   ALA B CB  1 
ATOM   971  N  N   . GLY B 1 5   ? 3.615   5.782   15.507  1.00 64.82  ? 3   GLY B N   1 
ATOM   972  C  CA  . GLY B 1 5   ? 2.237   5.428   15.241  1.00 62.04  ? 3   GLY B CA  1 
ATOM   973  C  C   . GLY B 1 5   ? 1.728   4.291   16.109  1.00 60.45  ? 3   GLY B C   1 
ATOM   974  O  O   . GLY B 1 5   ? 2.274   3.955   17.168  1.00 60.26  ? 3   GLY B O   1 
ATOM   975  N  N   . VAL B 1 6   ? 0.625   3.705   15.644  1.00 56.05  ? 4   VAL B N   1 
ATOM   976  C  CA  . VAL B 1 6   ? 0.034   2.563   16.327  1.00 53.43  ? 4   VAL B CA  1 
ATOM   977  C  C   . VAL B 1 6   ? 1.057   1.441   16.477  1.00 53.13  ? 4   VAL B C   1 
ATOM   978  O  O   . VAL B 1 6   ? 1.775   1.090   15.537  1.00 53.26  ? 4   VAL B O   1 
ATOM   979  C  CB  . VAL B 1 6   ? -1.258  2.128   15.608  1.00 50.71  ? 4   VAL B CB  1 
ATOM   980  C  CG1 . VAL B 1 6   ? -0.953  1.434   14.289  1.00 53.08  ? 4   VAL B CG1 1 
ATOM   981  C  CG2 . VAL B 1 6   ? -2.060  1.224   16.534  1.00 48.49  ? 4   VAL B CG2 1 
ATOM   982  N  N   . SER B 1 7   ? 1.137   0.892   17.679  1.00 53.05  ? 5   SER B N   1 
ATOM   983  C  CA  . SER B 1 7   ? 2.050   -0.193  18.013  1.00 59.14  ? 5   SER B CA  1 
ATOM   984  C  C   . SER B 1 7   ? 1.300   -1.449  18.457  1.00 56.66  ? 5   SER B C   1 
ATOM   985  O  O   . SER B 1 7   ? 0.329   -1.379  19.218  1.00 54.20  ? 5   SER B O   1 
ATOM   986  C  CB  . SER B 1 7   ? 3.000   0.247   19.118  1.00 56.37  ? 5   SER B CB  1 
ATOM   987  O  OG  . SER B 1 7   ? 3.430   -0.868  19.864  1.00 57.75  ? 5   SER B OG  1 
ATOM   988  N  N   . PHE B 1 8   ? 1.784   -2.609  18.019  1.00 59.43  ? 6   PHE B N   1 
ATOM   989  C  CA  . PHE B 1 8   ? 1.204   -3.881  18.419  1.00 58.61  ? 6   PHE B CA  1 
ATOM   990  C  C   . PHE B 1 8   ? 2.163   -4.692  19.267  1.00 63.68  ? 6   PHE B C   1 
ATOM   991  O  O   . PHE B 1 8   ? 2.035   -5.917  19.338  1.00 64.66  ? 6   PHE B O   1 
ATOM   992  C  CB  . PHE B 1 8   ? 0.796   -4.689  17.192  1.00 57.10  ? 6   PHE B CB  1 
ATOM   993  C  CG  . PHE B 1 8   ? 0.089   -3.889  16.146  1.00 54.70  ? 6   PHE B CG  1 
ATOM   994  C  CD1 . PHE B 1 8   ? -1.250  -3.601  16.267  1.00 53.94  ? 6   PHE B CD1 1 
ATOM   995  C  CD2 . PHE B 1 8   ? 0.752   -3.471  15.024  1.00 54.71  ? 6   PHE B CD2 1 
ATOM   996  C  CE1 . PHE B 1 8   ? -1.908  -2.871  15.296  1.00 54.50  ? 6   PHE B CE1 1 
ATOM   997  C  CE2 . PHE B 1 8   ? 0.094   -2.743  14.044  1.00 57.20  ? 6   PHE B CE2 1 
ATOM   998  C  CZ  . PHE B 1 8   ? -1.240  -2.443  14.181  1.00 54.72  ? 6   PHE B CZ  1 
ATOM   999  N  N   . SER B 1 9   ? 3.128   -4.024  19.904  1.00 66.31  ? 7   SER B N   1 
ATOM   1000 C  CA  . SER B 1 9   ? 4.249   -4.700  20.549  1.00 65.45  ? 7   SER B CA  1 
ATOM   1001 C  C   . SER B 1 9   ? 3.881   -5.230  21.930  1.00 65.29  ? 7   SER B C   1 
ATOM   1002 O  O   . SER B 1 9   ? 4.191   -6.379  22.255  1.00 65.21  ? 7   SER B O   1 
ATOM   1003 C  CB  . SER B 1 9   ? 5.452   -3.760  20.631  1.00 68.32  ? 7   SER B CB  1 
ATOM   1004 O  OG  . SER B 1 9   ? 5.403   -2.944  21.789  1.00 69.53  ? 7   SER B OG  1 
ATOM   1005 N  N   . GLY B 1 10  ? 3.256   -4.395  22.768  1.00 64.62  ? 8   GLY B N   1 
ATOM   1006 C  CA  . GLY B 1 10  ? 2.916   -4.762  24.141  1.00 61.66  ? 8   GLY B CA  1 
ATOM   1007 C  C   . GLY B 1 10  ? 1.909   -5.885  24.330  1.00 56.12  ? 8   GLY B C   1 
ATOM   1008 O  O   . GLY B 1 10  ? 1.947   -6.551  25.363  1.00 53.13  ? 8   GLY B O   1 
ATOM   1009 N  N   . HIS B 1 11  ? 1.010   -6.119  23.381  1.00 52.51  ? 9   HIS B N   1 
ATOM   1010 C  CA  . HIS B 1 11  ? -0.033  -7.122  23.603  1.00 53.88  ? 9   HIS B CA  1 
ATOM   1011 C  C   . HIS B 1 11  ? -0.198  -8.056  22.410  1.00 56.18  ? 9   HIS B C   1 
ATOM   1012 O  O   . HIS B 1 11  ? -1.287  -8.614  22.207  1.00 55.78  ? 9   HIS B O   1 
ATOM   1013 C  CB  . HIS B 1 11  ? -1.372  -6.464  23.956  1.00 54.09  ? 9   HIS B CB  1 
ATOM   1014 C  CG  . HIS B 1 11  ? -1.293  -5.538  25.131  1.00 57.79  ? 9   HIS B CG  1 
ATOM   1015 N  ND1 . HIS B 1 11  ? -1.510  -5.958  26.425  1.00 59.49  ? 9   HIS B ND1 1 
ATOM   1016 C  CD2 . HIS B 1 11  ? -0.991  -4.220  25.212  1.00 60.36  ? 9   HIS B CD2 1 
ATOM   1017 C  CE1 . HIS B 1 11  ? -1.356  -4.935  27.251  1.00 61.44  ? 9   HIS B CE1 1 
ATOM   1018 N  NE2 . HIS B 1 11  ? -1.041  -3.869  26.540  1.00 61.16  ? 9   HIS B NE2 1 
ATOM   1019 N  N   . ARG B 1 12  ? 0.871   -8.236  21.618  1.00 44.87  ? 10  ARG B N   1 
ATOM   1020 C  CA  . ARG B 1 12  ? 0.736   -8.863  20.304  1.00 44.14  ? 10  ARG B CA  1 
ATOM   1021 C  C   . ARG B 1 12  ? 0.051   -10.231 20.374  1.00 45.21  ? 10  ARG B C   1 
ATOM   1022 O  O   . ARG B 1 12  ? -0.887  -10.510 19.609  1.00 44.57  ? 10  ARG B O   1 
ATOM   1023 C  CB  . ARG B 1 12  ? 2.106   -8.986  19.642  1.00 41.13  ? 10  ARG B CB  1 
ATOM   1024 C  CG  . ARG B 1 12  ? 2.013   -9.514  18.221  1.00 41.88  ? 10  ARG B CG  1 
ATOM   1025 C  CD  . ARG B 1 12  ? 3.375   -9.664  17.565  1.00 41.48  ? 10  ARG B CD  1 
ATOM   1026 N  NE  . ARG B 1 12  ? 3.246   -9.650  16.116  1.00 39.63  ? 10  ARG B NE  1 
ATOM   1027 C  CZ  . ARG B 1 12  ? 3.344   -8.549  15.375  1.00 39.50  ? 10  ARG B CZ  1 
ATOM   1028 N  NH1 . ARG B 1 12  ? 3.577   -7.381  15.954  1.00 33.51  ? 10  ARG B NH1 1 
ATOM   1029 N  NH2 . ARG B 1 12  ? 3.197   -8.615  14.062  1.00 35.05  ? 10  ARG B NH2 1 
ATOM   1030 N  N   . LEU B 1 13  ? 0.495   -11.098 21.284  1.00 46.45  ? 11  LEU B N   1 
ATOM   1031 C  CA  . LEU B 1 13  ? -0.088  -12.435 21.321  1.00 49.90  ? 11  LEU B CA  1 
ATOM   1032 C  C   . LEU B 1 13  ? -1.570  -12.377 21.681  1.00 52.89  ? 11  LEU B C   1 
ATOM   1033 O  O   . LEU B 1 13  ? -2.394  -13.063 21.066  1.00 52.89  ? 11  LEU B O   1 
ATOM   1034 C  CB  . LEU B 1 13  ? 0.673   -13.339 22.286  1.00 46.49  ? 11  LEU B CB  1 
ATOM   1035 C  CG  . LEU B 1 13  ? 0.038   -14.733 22.250  1.00 49.22  ? 11  LEU B CG  1 
ATOM   1036 C  CD1 . LEU B 1 13  ? 0.034   -15.283 20.827  1.00 47.31  ? 11  LEU B CD1 1 
ATOM   1037 C  CD2 . LEU B 1 13  ? 0.701   -15.691 23.205  1.00 45.41  ? 11  LEU B CD2 1 
ATOM   1038 N  N   . GLU B 1 14  ? -1.937  -11.526 22.633  1.00 53.92  ? 12  GLU B N   1 
ATOM   1039 C  CA  . GLU B 1 14  ? -3.339  -11.439 23.013  1.00 56.95  ? 12  GLU B CA  1 
ATOM   1040 C  C   . GLU B 1 14  ? -4.189  -10.865 21.877  1.00 56.69  ? 12  GLU B C   1 
ATOM   1041 O  O   . GLU B 1 14  ? -5.274  -11.392 21.579  1.00 60.49  ? 12  GLU B O   1 
ATOM   1042 C  CB  . GLU B 1 14  ? -3.466  -10.607 24.285  1.00 64.49  ? 12  GLU B CB  1 
ATOM   1043 C  CG  . GLU B 1 14  ? -4.832  -10.628 24.904  1.00 76.14  ? 12  GLU B CG  1 
ATOM   1044 C  CD  . GLU B 1 14  ? -4.917  -9.722  26.119  1.00 84.90  ? 12  GLU B CD  1 
ATOM   1045 O  OE1 . GLU B 1 14  ? -4.018  -8.863  26.278  1.00 85.62  ? 12  GLU B OE1 1 
ATOM   1046 O  OE2 . GLU B 1 14  ? -5.879  -9.875  26.912  1.00 90.09  ? 12  GLU B OE2 1 
ATOM   1047 N  N   . LEU B 1 15  ? -3.704  -9.813  21.206  1.00 48.49  ? 13  LEU B N   1 
ATOM   1048 C  CA  . LEU B 1 15  ? -4.480  -9.222  20.123  1.00 48.91  ? 13  LEU B CA  1 
ATOM   1049 C  C   . LEU B 1 15  ? -4.740  -10.248 19.031  1.00 48.64  ? 13  LEU B C   1 
ATOM   1050 O  O   . LEU B 1 15  ? -5.884  -10.433 18.582  1.00 49.11  ? 13  LEU B O   1 
ATOM   1051 C  CB  . LEU B 1 15  ? -3.750  -8.007  19.546  1.00 48.25  ? 13  LEU B CB  1 
ATOM   1052 C  CG  . LEU B 1 15  ? -3.188  -6.932  20.467  1.00 45.89  ? 13  LEU B CG  1 
ATOM   1053 C  CD1 . LEU B 1 15  ? -2.246  -6.033  19.684  1.00 43.64  ? 13  LEU B CD1 1 
ATOM   1054 C  CD2 . LEU B 1 15  ? -4.337  -6.127  21.062  1.00 46.05  ? 13  LEU B CD2 1 
ATOM   1055 N  N   . LEU B 1 16  ? -3.688  -10.960 18.620  1.00 47.07  ? 14  LEU B N   1 
ATOM   1056 C  CA  . LEU B 1 16  ? -3.868  -11.940 17.563  1.00 46.13  ? 14  LEU B CA  1 
ATOM   1057 C  C   . LEU B 1 16  ? -4.617  -13.179 18.032  1.00 50.12  ? 14  LEU B C   1 
ATOM   1058 O  O   . LEU B 1 16  ? -5.255  -13.841 17.213  1.00 52.09  ? 14  LEU B O   1 
ATOM   1059 C  CB  . LEU B 1 16  ? -2.517  -12.301 16.956  1.00 45.09  ? 14  LEU B CB  1 
ATOM   1060 C  CG  . LEU B 1 16  ? -2.036  -11.190 16.008  1.00 43.00  ? 14  LEU B CG  1 
ATOM   1061 C  CD1 . LEU B 1 16  ? -0.598  -11.403 15.519  1.00 43.02  ? 14  LEU B CD1 1 
ATOM   1062 C  CD2 . LEU B 1 16  ? -2.987  -11.107 14.812  1.00 40.33  ? 14  LEU B CD2 1 
ATOM   1063 N  N   . ALA B 1 17  ? -4.592  -13.490 19.329  1.00 51.62  ? 15  ALA B N   1 
ATOM   1064 C  CA  . ALA B 1 17  ? -5.368  -14.625 19.826  1.00 50.25  ? 15  ALA B CA  1 
ATOM   1065 C  C   . ALA B 1 17  ? -6.864  -14.339 19.763  1.00 49.60  ? 15  ALA B C   1 
ATOM   1066 O  O   . ALA B 1 17  ? -7.643  -15.186 19.296  1.00 54.42  ? 15  ALA B O   1 
ATOM   1067 C  CB  . ALA B 1 17  ? -4.937  -14.980 21.252  1.00 44.31  ? 15  ALA B CB  1 
ATOM   1068 N  N   . ALA B 1 18  ? -7.287  -13.140 20.178  1.00 45.01  ? 16  ALA B N   1 
ATOM   1069 C  CA  . ALA B 1 18  ? -8.698  -12.801 20.034  1.00 46.06  ? 16  ALA B CA  1 
ATOM   1070 C  C   . ALA B 1 18  ? -9.109  -12.774 18.559  1.00 54.76  ? 16  ALA B C   1 
ATOM   1071 O  O   . ALA B 1 18  ? -10.186 -13.278 18.203  1.00 60.84  ? 16  ALA B O   1 
ATOM   1072 C  CB  . ALA B 1 18  ? -9.004  -11.474 20.723  1.00 46.70  ? 16  ALA B CB  1 
ATOM   1073 N  N   . TYR B 1 19  ? -8.249  -12.247 17.665  1.00 47.27  ? 17  TYR B N   1 
ATOM   1074 C  CA  . TYR B 1 19  ? -8.643  -12.269 16.253  1.00 47.58  ? 17  TYR B CA  1 
ATOM   1075 C  C   . TYR B 1 19  ? -8.744  -13.696 15.719  1.00 51.83  ? 17  TYR B C   1 
ATOM   1076 O  O   . TYR B 1 19  ? -9.677  -14.022 14.965  1.00 56.29  ? 17  TYR B O   1 
ATOM   1077 C  CB  . TYR B 1 19  ? -7.702  -11.447 15.365  1.00 48.12  ? 17  TYR B CB  1 
ATOM   1078 C  CG  . TYR B 1 19  ? -8.458  -10.976 14.136  1.00 54.49  ? 17  TYR B CG  1 
ATOM   1079 C  CD1 . TYR B 1 19  ? -9.623  -10.198 14.275  1.00 62.22  ? 17  TYR B CD1 1 
ATOM   1080 C  CD2 . TYR B 1 19  ? -8.071  -11.347 12.850  1.00 56.26  ? 17  TYR B CD2 1 
ATOM   1081 C  CE1 . TYR B 1 19  ? -10.381 -9.765  13.157  1.00 63.47  ? 17  TYR B CE1 1 
ATOM   1082 C  CE2 . TYR B 1 19  ? -8.821  -10.922 11.722  1.00 62.88  ? 17  TYR B CE2 1 
ATOM   1083 C  CZ  . TYR B 1 19  ? -9.978  -10.129 11.892  1.00 63.54  ? 17  TYR B CZ  1 
ATOM   1084 O  OH  . TYR B 1 19  ? -10.720 -9.706  10.815  1.00 62.09  ? 17  TYR B OH  1 
ATOM   1085 N  N   . GLU B 1 20  ? -7.797  -14.558 16.088  1.00 50.86  ? 18  GLU B N   1 
ATOM   1086 C  CA  . GLU B 1 20  ? -7.890  -15.958 15.693  1.00 53.06  ? 18  GLU B CA  1 
ATOM   1087 C  C   . GLU B 1 20  ? -9.216  -16.563 16.118  1.00 56.51  ? 18  GLU B C   1 
ATOM   1088 O  O   . GLU B 1 20  ? -9.862  -17.279 15.344  1.00 57.51  ? 18  GLU B O   1 
ATOM   1089 C  CB  . GLU B 1 20  ? -6.735  -16.752 16.304  1.00 53.49  ? 18  GLU B CB  1 
ATOM   1090 C  CG  . GLU B 1 20  ? -6.873  -18.263 16.163  1.00 58.86  ? 18  GLU B CG  1 
ATOM   1091 C  CD  . GLU B 1 20  ? -6.232  -18.833 14.911  1.00 61.61  ? 18  GLU B CD  1 
ATOM   1092 O  OE1 . GLU B 1 20  ? -6.303  -20.068 14.712  1.00 64.99  ? 18  GLU B OE1 1 
ATOM   1093 O  OE2 . GLU B 1 20  ? -5.642  -18.057 14.136  1.00 60.75  ? 18  GLU B OE2 1 
ATOM   1094 N  N   . GLU B 1 21  ? -9.650  -16.266 17.345  1.00 59.41  ? 19  GLU B N   1 
ATOM   1095 C  CA  . GLU B 1 21  ? -10.938 -16.772 17.802  1.00 61.07  ? 19  GLU B CA  1 
ATOM   1096 C  C   . GLU B 1 21  ? -12.069 -16.289 16.914  1.00 59.67  ? 19  GLU B C   1 
ATOM   1097 O  O   . GLU B 1 21  ? -13.013 -17.041 16.638  1.00 62.49  ? 19  GLU B O   1 
ATOM   1098 C  CB  . GLU B 1 21  ? -11.178 -16.352 19.240  1.00 68.01  ? 19  GLU B CB  1 
ATOM   1099 C  CG  . GLU B 1 21  ? -10.824 -17.406 20.222  1.00 77.06  ? 19  GLU B CG  1 
ATOM   1100 C  CD  . GLU B 1 21  ? -11.275 -17.022 21.606  1.00 87.83  ? 19  GLU B CD  1 
ATOM   1101 O  OE1 . GLU B 1 21  ? -12.491 -16.750 21.796  1.00 92.54  ? 19  GLU B OE1 1 
ATOM   1102 O  OE2 . GLU B 1 21  ? -10.403 -16.966 22.500  1.00 90.85  ? 19  GLU B OE2 1 
ATOM   1103 N  N   . VAL B 1 22  ? -11.996 -15.035 16.453  1.00 57.69  ? 20  VAL B N   1 
ATOM   1104 C  CA  . VAL B 1 22  ? -13.063 -14.534 15.589  1.00 57.81  ? 20  VAL B CA  1 
ATOM   1105 C  C   . VAL B 1 22  ? -13.070 -15.266 14.253  1.00 58.71  ? 20  VAL B C   1 
ATOM   1106 O  O   . VAL B 1 22  ? -14.133 -15.541 13.690  1.00 57.62  ? 20  VAL B O   1 
ATOM   1107 C  CB  . VAL B 1 22  ? -12.931 -13.015 15.405  1.00 54.06  ? 20  VAL B CB  1 
ATOM   1108 C  CG1 . VAL B 1 22  ? -13.790 -12.523 14.228  1.00 54.68  ? 20  VAL B CG1 1 
ATOM   1109 C  CG2 . VAL B 1 22  ? -13.359 -12.339 16.680  1.00 54.37  ? 20  VAL B CG2 1 
ATOM   1110 N  N   . ILE B 1 23  ? -11.891 -15.614 13.735  1.00 57.37  ? 21  ILE B N   1 
ATOM   1111 C  CA  . ILE B 1 23  ? -11.821 -16.308 12.448  1.00 56.97  ? 21  ILE B CA  1 
ATOM   1112 C  C   . ILE B 1 23  ? -12.235 -17.775 12.550  1.00 61.13  ? 21  ILE B C   1 
ATOM   1113 O  O   . ILE B 1 23  ? -12.822 -18.313 11.608  1.00 66.70  ? 21  ILE B O   1 
ATOM   1114 C  CB  . ILE B 1 23  ? -10.413 -16.186 11.854  1.00 57.54  ? 21  ILE B CB  1 
ATOM   1115 C  CG1 . ILE B 1 23  ? -10.050 -14.716 11.678  1.00 56.19  ? 21  ILE B CG1 1 
ATOM   1116 C  CG2 . ILE B 1 23  ? -10.337 -16.949 10.546  1.00 60.29  ? 21  ILE B CG2 1 
ATOM   1117 C  CD1 . ILE B 1 23  ? -8.629  -14.516 11.245  1.00 53.34  ? 21  ILE B CD1 1 
ATOM   1118 N  N   . ARG B 1 24  ? -11.931 -18.459 13.656  1.00 69.15  ? 22  ARG B N   1 
ATOM   1119 C  CA  . ARG B 1 24  ? -12.218 -19.895 13.746  1.00 76.28  ? 22  ARG B CA  1 
ATOM   1120 C  C   . ARG B 1 24  ? -13.714 -20.164 13.582  1.00 74.55  ? 22  ARG B C   1 
ATOM   1121 O  O   . ARG B 1 24  ? -14.550 -19.531 14.233  1.00 64.08  ? 22  ARG B O   1 
ATOM   1122 C  CB  . ARG B 1 24  ? -11.725 -20.464 15.080  1.00 70.26  ? 22  ARG B CB  1 
ATOM   1123 N  N   . GLU B 1 25  ? -14.047 -21.104 12.688  1.00 74.56  ? 23  GLU B N   1 
ATOM   1124 C  CA  . GLU B 1 25  ? -15.453 -21.423 12.442  1.00 74.02  ? 23  GLU B CA  1 
ATOM   1125 C  C   . GLU B 1 25  ? -16.094 -22.110 13.643  1.00 77.47  ? 23  GLU B C   1 
ATOM   1126 O  O   . GLU B 1 25  ? -17.245 -21.818 13.990  1.00 74.58  ? 23  GLU B O   1 
ATOM   1127 C  CB  . GLU B 1 25  ? -15.582 -22.297 11.193  1.00 74.41  ? 23  GLU B CB  1 
ATOM   1128 N  N   . GLU B 1 26  ? -15.358 -22.995 14.317  1.00 84.22  ? 24  GLU B N   1 
ATOM   1129 C  CA  . GLU B 1 26  ? -15.957 -23.722 15.429  1.00 89.21  ? 24  GLU B CA  1 
ATOM   1130 C  C   . GLU B 1 26  ? -16.132 -22.828 16.652  1.00 89.37  ? 24  GLU B C   1 
ATOM   1131 O  O   . GLU B 1 26  ? -17.011 -23.085 17.482  1.00 92.36  ? 24  GLU B O   1 
ATOM   1132 C  CB  . GLU B 1 26  ? -15.123 -24.959 15.761  1.00 95.16  ? 24  GLU B CB  1 
ATOM   1133 N  N   . SER B 1 27  ? -15.322 -21.778 16.782  1.00 85.81  ? 25  SER B N   1 
ATOM   1134 C  CA  . SER B 1 27  ? -15.411 -20.899 17.939  1.00 82.80  ? 25  SER B CA  1 
ATOM   1135 C  C   . SER B 1 27  ? -16.624 -19.991 17.815  1.00 78.35  ? 25  SER B C   1 
ATOM   1136 O  O   . SER B 1 27  ? -16.872 -19.411 16.758  1.00 76.80  ? 25  SER B O   1 
ATOM   1137 C  CB  . SER B 1 27  ? -14.144 -20.058 18.067  1.00 82.18  ? 25  SER B CB  1 
ATOM   1138 O  OG  . SER B 1 27  ? -14.166 -19.280 19.251  1.00 82.24  ? 25  SER B OG  1 
ATOM   1139 N  N   . ALA B 1 28  ? -17.368 -19.846 18.911  1.00 78.23  ? 26  ALA B N   1 
ATOM   1140 C  CA  . ALA B 1 28  ? -18.595 -19.056 18.866  1.00 77.36  ? 26  ALA B CA  1 
ATOM   1141 C  C   . ALA B 1 28  ? -18.299 -17.569 18.674  1.00 74.76  ? 26  ALA B C   1 
ATOM   1142 O  O   . ALA B 1 28  ? -19.056 -16.860 17.992  1.00 73.11  ? 26  ALA B O   1 
ATOM   1143 C  CB  . ALA B 1 28  ? -19.414 -19.281 20.135  1.00 70.67  ? 26  ALA B CB  1 
ATOM   1144 N  N   . ALA B 1 29  ? -17.215 -17.078 19.279  1.00 71.74  ? 27  ALA B N   1 
ATOM   1145 C  CA  . ALA B 1 29  ? -16.905 -15.658 19.230  1.00 67.45  ? 27  ALA B CA  1 
ATOM   1146 C  C   . ALA B 1 29  ? -16.873 -15.159 17.789  1.00 62.47  ? 27  ALA B C   1 
ATOM   1147 O  O   . ALA B 1 29  ? -16.365 -15.832 16.891  1.00 65.57  ? 27  ALA B O   1 
ATOM   1148 C  CB  . ALA B 1 29  ? -15.567 -15.397 19.919  1.00 59.88  ? 27  ALA B CB  1 
ATOM   1149 N  N   . ASP B 1 30  ? -17.493 -14.010 17.560  1.00 55.92  ? 28  ASP B N   1 
ATOM   1150 C  CA  . ASP B 1 30  ? -17.446 -13.376 16.253  1.00 53.91  ? 28  ASP B CA  1 
ATOM   1151 C  C   . ASP B 1 30  ? -17.156 -11.882 16.325  1.00 51.46  ? 28  ASP B C   1 
ATOM   1152 O  O   . ASP B 1 30  ? -17.329 -11.192 15.316  1.00 50.29  ? 28  ASP B O   1 
ATOM   1153 C  CB  . ASP B 1 30  ? -18.749 -13.618 15.477  1.00 58.89  ? 28  ASP B CB  1 
ATOM   1154 C  CG  . ASP B 1 30  ? -19.996 -13.108 16.217  1.00 63.01  ? 28  ASP B CG  1 
ATOM   1155 O  OD1 . ASP B 1 30  ? -19.887 -12.616 17.372  1.00 59.57  ? 28  ASP B OD1 1 
ATOM   1156 O  OD2 . ASP B 1 30  ? -21.098 -13.196 15.622  1.00 66.87  ? 28  ASP B OD2 1 
ATOM   1157 N  N   . TRP B 1 31  ? -16.748 -11.348 17.480  1.00 51.10  ? 29  TRP B N   1 
ATOM   1158 C  CA  . TRP B 1 31  ? -16.251 -9.977  17.463  1.00 49.81  ? 29  TRP B CA  1 
ATOM   1159 C  C   . TRP B 1 31  ? -15.177 -9.776  18.521  1.00 49.95  ? 29  TRP B C   1 
ATOM   1160 O  O   . TRP B 1 31  ? -15.224 -10.354 19.608  1.00 51.80  ? 29  TRP B O   1 
ATOM   1161 C  CB  . TRP B 1 31  ? -17.380 -8.946  17.662  1.00 47.83  ? 29  TRP B CB  1 
ATOM   1162 C  CG  . TRP B 1 31  ? -18.031 -9.007  19.000  1.00 48.10  ? 29  TRP B CG  1 
ATOM   1163 C  CD1 . TRP B 1 31  ? -19.160 -9.691  19.320  1.00 47.47  ? 29  TRP B CD1 1 
ATOM   1164 C  CD2 . TRP B 1 31  ? -17.612 -8.333  20.197  1.00 49.60  ? 29  TRP B CD2 1 
ATOM   1165 N  NE1 . TRP B 1 31  ? -19.464 -9.517  20.655  1.00 54.15  ? 29  TRP B NE1 1 
ATOM   1166 C  CE2 . TRP B 1 31  ? -18.537 -8.686  21.220  1.00 50.90  ? 29  TRP B CE2 1 
ATOM   1167 C  CE3 . TRP B 1 31  ? -16.542 -7.478  20.511  1.00 45.56  ? 29  TRP B CE3 1 
ATOM   1168 C  CZ2 . TRP B 1 31  ? -18.430 -8.211  22.535  1.00 50.15  ? 29  TRP B CZ2 1 
ATOM   1169 C  CZ3 . TRP B 1 31  ? -16.430 -7.000  21.818  1.00 50.11  ? 29  TRP B CZ3 1 
ATOM   1170 C  CH2 . TRP B 1 31  ? -17.370 -7.373  22.821  1.00 52.80  ? 29  TRP B CH2 1 
ATOM   1171 N  N   . ALA B 1 32  ? -14.240 -8.889  18.209  1.00 48.77  ? 30  ALA B N   1 
ATOM   1172 C  CA  . ALA B 1 32  ? -13.199 -8.494  19.137  1.00 49.80  ? 30  ALA B CA  1 
ATOM   1173 C  C   . ALA B 1 32  ? -13.031 -6.984  19.046  1.00 50.21  ? 30  ALA B C   1 
ATOM   1174 O  O   . ALA B 1 32  ? -13.033 -6.424  17.953  1.00 48.47  ? 30  ALA B O   1 
ATOM   1175 C  CB  . ALA B 1 32  ? -11.885 -9.199  18.809  1.00 51.41  ? 30  ALA B CB  1 
ATOM   1176 N  N   . LEU B 1 33  ? -12.804 -6.333  20.179  1.00 48.51  ? 31  LEU B N   1 
ATOM   1177 C  CA  . LEU B 1 33  ? -12.763 -4.880  20.233  1.00 45.14  ? 31  LEU B CA  1 
ATOM   1178 C  C   . LEU B 1 33  ? -11.464 -4.439  20.882  1.00 46.54  ? 31  LEU B C   1 
ATOM   1179 O  O   . LEU B 1 33  ? -11.171 -4.826  22.028  1.00 49.51  ? 31  LEU B O   1 
ATOM   1180 C  CB  . LEU B 1 33  ? -13.953 -4.326  21.010  1.00 45.86  ? 31  LEU B CB  1 
ATOM   1181 C  CG  . LEU B 1 33  ? -13.919 -2.827  21.312  1.00 44.15  ? 31  LEU B CG  1 
ATOM   1182 C  CD1 . LEU B 1 33  ? -14.118 -2.069  19.981  1.00 40.14  ? 31  LEU B CD1 1 
ATOM   1183 C  CD2 . LEU B 1 33  ? -14.998 -2.453  22.335  1.00 44.13  ? 31  LEU B CD2 1 
ATOM   1184 N  N   . TYR B 1 34  ? -10.709 -3.622  20.141  1.00 41.97  ? 32  TYR B N   1 
ATOM   1185 C  CA  . TYR B 1 34  ? -9.420  -3.089  20.527  1.00 42.67  ? 32  TYR B CA  1 
ATOM   1186 C  C   . TYR B 1 34  ? -9.468  -1.579  20.711  1.00 49.12  ? 32  TYR B C   1 
ATOM   1187 O  O   . TYR B 1 34  ? -10.344 -0.897  20.190  1.00 48.77  ? 32  TYR B O   1 
ATOM   1188 C  CB  . TYR B 1 34  ? -8.364  -3.448  19.479  1.00 42.30  ? 32  TYR B CB  1 
ATOM   1189 C  CG  . TYR B 1 34  ? -8.355  -4.895  19.052  1.00 43.20  ? 32  TYR B CG  1 
ATOM   1190 C  CD1 . TYR B 1 34  ? -9.176  -5.375  18.051  1.00 52.64  ? 32  TYR B CD1 1 
ATOM   1191 C  CD2 . TYR B 1 34  ? -7.535  -5.801  19.712  1.00 48.30  ? 32  TYR B CD2 1 
ATOM   1192 C  CE1 . TYR B 1 34  ? -9.155  -6.729  17.698  1.00 52.67  ? 32  TYR B CE1 1 
ATOM   1193 C  CE2 . TYR B 1 34  ? -7.504  -7.142  19.369  1.00 50.24  ? 32  TYR B CE2 1 
ATOM   1194 C  CZ  . TYR B 1 34  ? -8.322  -7.606  18.357  1.00 53.98  ? 32  TYR B CZ  1 
ATOM   1195 O  OH  . TYR B 1 34  ? -8.330  -8.937  17.993  1.00 47.59  ? 32  TYR B OH  1 
ATOM   1196 N  N   . THR B 1 35  ? -8.537  -1.077  21.512  1.00 43.16  ? 33  THR B N   1 
ATOM   1197 C  CA  . THR B 1 35  ? -8.439  0.336   21.836  1.00 43.59  ? 33  THR B CA  1 
ATOM   1198 C  C   . THR B 1 35  ? -6.999  0.609   22.260  1.00 46.22  ? 33  THR B C   1 
ATOM   1199 O  O   . THR B 1 35  ? -6.209  -0.312  22.496  1.00 47.40  ? 33  THR B O   1 
ATOM   1200 C  CB  . THR B 1 35  ? -9.435  0.751   22.919  1.00 47.42  ? 33  THR B CB  1 
ATOM   1201 O  OG1 . THR B 1 35  ? -9.423  2.175   22.998  1.00 49.80  ? 33  THR B OG1 1 
ATOM   1202 C  CG2 . THR B 1 35  ? -9.061  0.185   24.282  1.00 49.29  ? 33  THR B CG2 1 
ATOM   1203 N  N   . TYR B 1 36  ? -6.674  1.882   22.413  1.00 47.17  ? 34  TYR B N   1 
ATOM   1204 C  CA  . TYR B 1 36  ? -5.320  2.206   22.841  1.00 52.93  ? 34  TYR B CA  1 
ATOM   1205 C  C   . TYR B 1 36  ? -5.208  2.159   24.353  1.00 59.88  ? 34  TYR B C   1 
ATOM   1206 O  O   . TYR B 1 36  ? -6.186  2.334   25.088  1.00 63.64  ? 34  TYR B O   1 
ATOM   1207 C  CB  . TYR B 1 36  ? -4.886  3.589   22.352  1.00 51.06  ? 34  TYR B CB  1 
ATOM   1208 C  CG  . TYR B 1 36  ? -4.997  3.771   20.862  1.00 49.54  ? 34  TYR B CG  1 
ATOM   1209 C  CD1 . TYR B 1 36  ? -3.900  3.595   20.041  1.00 50.38  ? 34  TYR B CD1 1 
ATOM   1210 C  CD2 . TYR B 1 36  ? -6.212  4.123   20.279  1.00 47.53  ? 34  TYR B CD2 1 
ATOM   1211 C  CE1 . TYR B 1 36  ? -3.999  3.777   18.681  1.00 50.75  ? 34  TYR B CE1 1 
ATOM   1212 C  CE2 . TYR B 1 36  ? -6.323  4.298   18.935  1.00 48.50  ? 34  TYR B CE2 1 
ATOM   1213 C  CZ  . TYR B 1 36  ? -5.213  4.124   18.132  1.00 50.01  ? 34  TYR B CZ  1 
ATOM   1214 O  OH  . TYR B 1 36  ? -5.321  4.285   16.774  1.00 49.31  ? 34  TYR B OH  1 
ATOM   1215 N  N   . GLU B 1 37  ? -4.002  1.871   24.807  1.00 64.42  ? 35  GLU B N   1 
ATOM   1216 C  CA  . GLU B 1 37  ? -3.669  2.008   26.209  1.00 69.53  ? 35  GLU B CA  1 
ATOM   1217 C  C   . GLU B 1 37  ? -3.490  3.489   26.547  1.00 69.58  ? 35  GLU B C   1 
ATOM   1218 O  O   . GLU B 1 37  ? -3.070  4.292   25.707  1.00 67.01  ? 35  GLU B O   1 
ATOM   1219 C  CB  . GLU B 1 37  ? -2.407  1.212   26.510  1.00 73.44  ? 35  GLU B CB  1 
ATOM   1220 C  CG  . GLU B 1 37  ? -2.468  0.520   27.843  1.00 80.96  ? 35  GLU B CG  1 
ATOM   1221 C  CD  . GLU B 1 37  ? -1.846  -0.854  27.782  1.00 86.14  ? 35  GLU B CD  1 
ATOM   1222 O  OE1 . GLU B 1 37  ? -2.473  -1.811  28.285  1.00 87.76  ? 35  GLU B OE1 1 
ATOM   1223 O  OE2 . GLU B 1 37  ? -0.750  -0.983  27.192  1.00 88.82  ? 35  GLU B OE2 1 
ATOM   1224 N  N   . ASP B 1 38  ? -3.838  3.849   27.784  1.00 72.69  ? 36  ASP B N   1 
ATOM   1225 C  CA  . ASP B 1 38  ? -3.885  5.255   28.181  1.00 73.78  ? 36  ASP B CA  1 
ATOM   1226 C  C   . ASP B 1 38  ? -2.535  5.936   27.988  1.00 73.70  ? 36  ASP B C   1 
ATOM   1227 O  O   . ASP B 1 38  ? -1.487  5.376   28.324  1.00 75.95  ? 36  ASP B O   1 
ATOM   1228 C  CB  . ASP B 1 38  ? -4.324  5.377   29.636  1.00 81.54  ? 36  ASP B CB  1 
ATOM   1229 C  CG  . ASP B 1 38  ? -5.545  4.548   29.936  1.00 87.57  ? 36  ASP B CG  1 
ATOM   1230 O  OD1 . ASP B 1 38  ? -6.362  4.342   29.006  1.00 88.56  ? 36  ASP B OD1 1 
ATOM   1231 O  OD2 . ASP B 1 38  ? -5.693  4.107   31.099  1.00 89.80  ? 36  ASP B OD2 1 
ATOM   1232 N  N   . GLY B 1 39  ? -2.575  7.149   27.439  1.00 69.20  ? 37  GLY B N   1 
ATOM   1233 C  CA  . GLY B 1 39  ? -1.354  7.913   27.178  1.00 72.01  ? 37  GLY B CA  1 
ATOM   1234 C  C   . GLY B 1 39  ? -0.339  7.166   26.343  1.00 71.47  ? 37  GLY B C   1 
ATOM   1235 O  O   . GLY B 1 39  ? 0.871   7.267   26.587  1.00 76.80  ? 37  GLY B O   1 
ATOM   1236 N  N   . SER B 1 40  ? -0.808  6.410   25.356  1.00 66.56  ? 38  SER B N   1 
ATOM   1237 C  CA  . SER B 1 40  ? 0.043   5.481   24.633  1.00 66.12  ? 38  SER B CA  1 
ATOM   1238 C  C   . SER B 1 40  ? -0.594  5.187   23.293  1.00 60.74  ? 38  SER B C   1 
ATOM   1239 O  O   . SER B 1 40  ? -1.786  5.418   23.094  1.00 56.87  ? 38  SER B O   1 
ATOM   1240 C  CB  . SER B 1 40  ? 0.235   4.175   25.409  1.00 73.08  ? 38  SER B CB  1 
ATOM   1241 O  OG  . SER B 1 40  ? 0.849   3.188   24.597  1.00 77.14  ? 38  SER B OG  1 
ATOM   1242 N  N   . ASP B 1 41  ? 0.231   4.712   22.363  1.00 60.78  ? 39  ASP B N   1 
ATOM   1243 C  CA  . ASP B 1 41  ? -0.251  4.244   21.077  1.00 56.41  ? 39  ASP B CA  1 
ATOM   1244 C  C   . ASP B 1 41  ? -0.261  2.732   20.977  1.00 50.91  ? 39  ASP B C   1 
ATOM   1245 O  O   . ASP B 1 41  ? -0.431  2.195   19.877  1.00 48.87  ? 39  ASP B O   1 
ATOM   1246 C  CB  . ASP B 1 41  ? 0.584   4.835   19.942  1.00 60.90  ? 39  ASP B CB  1 
ATOM   1247 C  CG  . ASP B 1 41  ? 0.115   6.218   19.545  1.00 65.32  ? 39  ASP B CG  1 
ATOM   1248 O  OD1 . ASP B 1 41  ? -0.980  6.633   20.008  1.00 63.34  ? 39  ASP B OD1 1 
ATOM   1249 O  OD2 . ASP B 1 41  ? 0.837   6.884   18.771  1.00 68.80  ? 39  ASP B OD2 1 
ATOM   1250 N  N   . ASP B 1 42  ? -0.093  2.023   22.085  1.00 52.85  ? 40  ASP B N   1 
ATOM   1251 C  CA  . ASP B 1 42  ? -0.086  0.579   21.999  1.00 59.13  ? 40  ASP B CA  1 
ATOM   1252 C  C   . ASP B 1 42  ? -1.515  0.072   22.094  1.00 57.64  ? 40  ASP B C   1 
ATOM   1253 O  O   . ASP B 1 42  ? -2.273  0.462   22.984  1.00 58.12  ? 40  ASP B O   1 
ATOM   1254 C  CB  . ASP B 1 42  ? 0.785   -0.081  23.064  1.00 71.77  ? 40  ASP B CB  1 
ATOM   1255 C  CG  . ASP B 1 42  ? 1.261   -1.487  22.624  1.00 81.67  ? 40  ASP B CG  1 
ATOM   1256 O  OD1 . ASP B 1 42  ? 0.425   -2.427  22.495  1.00 83.43  ? 40  ASP B OD1 1 
ATOM   1257 O  OD2 . ASP B 1 42  ? 2.470   -1.654  22.367  1.00 85.64  ? 40  ASP B OD2 1 
ATOM   1258 N  N   . LEU B 1 43  ? -1.880  -0.766  21.141  1.00 46.86  ? 41  LEU B N   1 
ATOM   1259 C  CA  . LEU B 1 43  ? -3.208  -1.338  21.095  1.00 45.16  ? 41  LEU B CA  1 
ATOM   1260 C  C   . LEU B 1 43  ? -3.329  -2.403  22.181  1.00 52.01  ? 41  LEU B C   1 
ATOM   1261 O  O   . LEU B 1 43  ? -2.375  -3.141  22.470  1.00 53.24  ? 41  LEU B O   1 
ATOM   1262 C  CB  . LEU B 1 43  ? -3.450  -1.940  19.712  1.00 41.25  ? 41  LEU B CB  1 
ATOM   1263 C  CG  . LEU B 1 43  ? -4.804  -1.798  19.002  1.00 43.93  ? 41  LEU B CG  1 
ATOM   1264 C  CD1 . LEU B 1 43  ? -5.268  -0.339  18.915  1.00 44.90  ? 41  LEU B CD1 1 
ATOM   1265 C  CD2 . LEU B 1 43  ? -4.710  -2.422  17.592  1.00 38.08  ? 41  LEU B CD2 1 
ATOM   1266 N  N   . LYS B 1 44  ? -4.510  -2.465  22.790  1.00 49.39  ? 42  LYS B N   1 
ATOM   1267 C  CA  . LYS B 1 44  ? -4.836  -3.467  23.783  1.00 46.66  ? 42  LYS B CA  1 
ATOM   1268 C  C   . LYS B 1 44  ? -6.205  -4.041  23.444  1.00 51.42  ? 42  LYS B C   1 
ATOM   1269 O  O   . LYS B 1 44  ? -7.043  -3.385  22.796  1.00 50.11  ? 42  LYS B O   1 
ATOM   1270 C  CB  . LYS B 1 44  ? -4.825  -2.890  25.190  1.00 47.48  ? 42  LYS B CB  1 
ATOM   1271 C  CG  . LYS B 1 44  ? -6.030  -2.050  25.601  1.00 53.87  ? 42  LYS B CG  1 
ATOM   1272 C  CD  . LYS B 1 44  ? -5.935  -1.689  27.101  1.00 63.23  ? 42  LYS B CD  1 
ATOM   1273 C  CE  . LYS B 1 44  ? -7.237  -1.119  27.685  1.00 69.29  ? 42  LYS B CE  1 
ATOM   1274 N  NZ  . LYS B 1 44  ? -7.289  0.382   27.734  1.00 72.33  ? 42  LYS B NZ  1 
ATOM   1275 N  N   . LEU B 1 45  ? -6.426  -5.281  23.869  1.00 51.13  ? 43  LEU B N   1 
ATOM   1276 C  CA  . LEU B 1 45  ? -7.712  -5.909  23.619  1.00 49.71  ? 43  LEU B CA  1 
ATOM   1277 C  C   . LEU B 1 45  ? -8.664  -5.436  24.696  1.00 49.32  ? 43  LEU B C   1 
ATOM   1278 O  O   . LEU B 1 45  ? -8.377  -5.577  25.885  1.00 50.34  ? 43  LEU B O   1 
ATOM   1279 C  CB  . LEU B 1 45  ? -7.595  -7.431  23.617  1.00 48.99  ? 43  LEU B CB  1 
ATOM   1280 C  CG  . LEU B 1 45  ? -8.862  -8.244  23.877  1.00 48.72  ? 43  LEU B CG  1 
ATOM   1281 C  CD1 . LEU B 1 45  ? -9.676  -8.255  22.614  1.00 42.46  ? 43  LEU B CD1 1 
ATOM   1282 C  CD2 . LEU B 1 45  ? -8.559  -9.662  24.317  1.00 47.17  ? 43  LEU B CD2 1 
ATOM   1283 N  N   . ALA B 1 46  ? -9.803  -4.895  24.283  1.00 50.53  ? 44  ALA B N   1 
ATOM   1284 C  CA  . ALA B 1 46  ? -10.767 -4.359  25.232  1.00 52.46  ? 44  ALA B CA  1 
ATOM   1285 C  C   . ALA B 1 46  ? -11.819 -5.391  25.590  1.00 54.65  ? 44  ALA B C   1 
ATOM   1286 O  O   . ALA B 1 46  ? -12.146 -5.555  26.769  1.00 62.00  ? 44  ALA B O   1 
ATOM   1287 C  CB  . ALA B 1 46  ? -11.439 -3.106  24.659  1.00 45.58  ? 44  ALA B CB  1 
ATOM   1288 N  N   . ALA B 1 47  ? -12.356 -6.097  24.604  1.00 51.73  ? 45  ALA B N   1 
ATOM   1289 C  CA  . ALA B 1 47  ? -13.359 -7.116  24.903  1.00 54.77  ? 45  ALA B CA  1 
ATOM   1290 C  C   . ALA B 1 47  ? -13.514 -7.973  23.659  1.00 54.47  ? 45  ALA B C   1 
ATOM   1291 O  O   . ALA B 1 47  ? -12.861 -7.738  22.637  1.00 50.41  ? 45  ALA B O   1 
ATOM   1292 C  CB  . ALA B 1 47  ? -14.695 -6.510  25.353  1.00 55.66  ? 45  ALA B CB  1 
ATOM   1293 N  N   . SER B 1 48  ? -14.342 -9.006  23.774  1.00 55.48  ? 46  SER B N   1 
ATOM   1294 C  CA  . SER B 1 48  ? -14.630 -9.889  22.655  1.00 56.24  ? 46  SER B CA  1 
ATOM   1295 C  C   . SER B 1 48  ? -15.811 -10.719 23.078  1.00 59.40  ? 46  SER B C   1 
ATOM   1296 O  O   . SER B 1 48  ? -16.050 -10.899 24.269  1.00 66.40  ? 46  SER B O   1 
ATOM   1297 C  CB  . SER B 1 48  ? -13.436 -10.772 22.258  1.00 61.75  ? 46  SER B CB  1 
ATOM   1298 O  OG  . SER B 1 48  ? -13.014 -11.576 23.332  1.00 66.51  ? 46  SER B OG  1 
ATOM   1299 N  N   . GLY B 1 49  ? -16.533 -11.238 22.099  1.00 57.95  ? 47  GLY B N   1 
ATOM   1300 C  CA  . GLY B 1 49  ? -17.766 -11.924 22.418  1.00 58.59  ? 47  GLY B CA  1 
ATOM   1301 C  C   . GLY B 1 49  ? -18.416 -12.499 21.185  1.00 58.25  ? 47  GLY B C   1 
ATOM   1302 O  O   . GLY B 1 49  ? -17.825 -12.536 20.094  1.00 46.53  ? 47  GLY B O   1 
ATOM   1303 N  N   . GLU B 1 50  ? -19.658 -12.949 21.394  1.00 61.41  ? 48  GLU B N   1 
ATOM   1304 C  CA  . GLU B 1 50  ? -20.375 -13.756 20.424  1.00 63.01  ? 48  GLU B CA  1 
ATOM   1305 C  C   . GLU B 1 50  ? -21.630 -13.130 19.840  1.00 67.13  ? 48  GLU B C   1 
ATOM   1306 O  O   . GLU B 1 50  ? -22.297 -13.783 19.022  1.00 73.23  ? 48  GLU B O   1 
ATOM   1307 C  CB  . GLU B 1 50  ? -20.755 -15.093 21.068  1.00 68.08  ? 48  GLU B CB  1 
ATOM   1308 C  CG  . GLU B 1 50  ? -19.796 -15.502 22.154  1.00 76.87  ? 48  GLU B CG  1 
ATOM   1309 C  CD  . GLU B 1 50  ? -20.208 -16.781 22.848  1.00 86.12  ? 48  GLU B CD  1 
ATOM   1310 O  OE1 . GLU B 1 50  ? -19.397 -17.309 23.641  1.00 89.03  ? 48  GLU B OE1 1 
ATOM   1311 O  OE2 . GLU B 1 50  ? -21.343 -17.255 22.607  1.00 89.26  ? 48  GLU B OE2 1 
ATOM   1312 N  N   . GLY B 1 51  ? -21.992 -11.920 20.219  1.00 61.44  ? 49  GLY B N   1 
ATOM   1313 C  CA  . GLY B 1 51  ? -23.294 -11.501 19.738  1.00 59.50  ? 49  GLY B CA  1 
ATOM   1314 C  C   . GLY B 1 51  ? -23.346 -10.825 18.384  1.00 52.62  ? 49  GLY B C   1 
ATOM   1315 O  O   . GLY B 1 51  ? -24.390 -10.285 18.029  1.00 50.71  ? 49  GLY B O   1 
ATOM   1316 N  N   . GLY B 1 52  ? -22.266 -10.824 17.620  1.00 50.21  ? 50  GLY B N   1 
ATOM   1317 C  CA  . GLY B 1 52  ? -22.201 -10.076 16.382  1.00 47.80  ? 50  GLY B CA  1 
ATOM   1318 C  C   . GLY B 1 52  ? -22.237 -8.562  16.594  1.00 48.72  ? 50  GLY B C   1 
ATOM   1319 O  O   . GLY B 1 52  ? -21.867 -8.030  17.652  1.00 49.85  ? 50  GLY B O   1 
ATOM   1320 N  N   . LEU B 1 53  ? -22.658 -7.865  15.530  1.00 47.54  ? 51  LEU B N   1 
ATOM   1321 C  CA  . LEU B 1 53  ? -22.624 -6.406  15.520  1.00 48.76  ? 51  LEU B CA  1 
ATOM   1322 C  C   . LEU B 1 53  ? -23.415 -5.808  16.672  1.00 50.83  ? 51  LEU B C   1 
ATOM   1323 O  O   . LEU B 1 53  ? -22.995 -4.804  17.267  1.00 50.91  ? 51  LEU B O   1 
ATOM   1324 C  CB  . LEU B 1 53  ? -23.169 -5.871  14.203  1.00 43.41  ? 51  LEU B CB  1 
ATOM   1325 C  CG  . LEU B 1 53  ? -22.217 -5.996  13.028  1.00 42.75  ? 51  LEU B CG  1 
ATOM   1326 C  CD1 . LEU B 1 53  ? -22.923 -5.529  11.754  1.00 42.60  ? 51  LEU B CD1 1 
ATOM   1327 C  CD2 . LEU B 1 53  ? -20.921 -5.235  13.293  1.00 39.08  ? 51  LEU B CD2 1 
ATOM   1328 N  N   . GLN B 1 54  ? -24.578 -6.392  16.979  1.00 53.20  ? 52  GLN B N   1 
ATOM   1329 C  CA  . GLN B 1 54  ? -25.464 -5.782  17.956  1.00 56.66  ? 52  GLN B CA  1 
ATOM   1330 C  C   . GLN B 1 54  ? -24.855 -5.847  19.349  1.00 58.03  ? 52  GLN B C   1 
ATOM   1331 O  O   . GLN B 1 54  ? -24.965 -4.889  20.126  1.00 58.45  ? 52  GLN B O   1 
ATOM   1332 C  CB  . GLN B 1 54  ? -26.841 -6.459  17.906  1.00 60.80  ? 52  GLN B CB  1 
ATOM   1333 C  CG  . GLN B 1 54  ? -28.040 -5.561  18.241  1.00 68.44  ? 52  GLN B CG  1 
ATOM   1334 C  CD  . GLN B 1 54  ? -28.081 -4.263  17.433  1.00 77.00  ? 52  GLN B CD  1 
ATOM   1335 O  OE1 . GLN B 1 54  ? -28.092 -3.179  18.016  1.00 76.07  ? 52  GLN B OE1 1 
ATOM   1336 N  NE2 . GLN B 1 54  ? -28.087 -4.366  16.089  1.00 86.97  ? 52  GLN B NE2 1 
ATOM   1337 N  N   . GLU B 1 55  ? -24.191 -6.959  19.680  1.00 56.74  ? 53  GLU B N   1 
ATOM   1338 C  CA  . GLU B 1 55  ? -23.503 -7.031  20.960  1.00 53.02  ? 53  GLU B CA  1 
ATOM   1339 C  C   . GLU B 1 55  ? -22.325 -6.082  20.968  1.00 53.67  ? 53  GLU B C   1 
ATOM   1340 O  O   . GLU B 1 55  ? -22.112 -5.361  21.948  1.00 58.11  ? 53  GLU B O   1 
ATOM   1341 C  CB  . GLU B 1 55  ? -23.051 -8.461  21.233  1.00 53.00  ? 53  GLU B CB  1 
ATOM   1342 C  CG  . GLU B 1 55  ? -22.169 -8.672  22.466  1.00 64.42  ? 53  GLU B CG  1 
ATOM   1343 C  CD  . GLU B 1 55  ? -22.900 -8.525  23.805  1.00 72.57  ? 53  GLU B CD  1 
ATOM   1344 O  OE1 . GLU B 1 55  ? -24.149 -8.738  23.869  1.00 76.44  ? 53  GLU B OE1 1 
ATOM   1345 O  OE2 . GLU B 1 55  ? -22.204 -8.202  24.805  1.00 74.69  ? 53  GLU B OE2 1 
ATOM   1346 N  N   . LEU B 1 56  ? -21.553 -6.074  19.871  1.00 48.53  ? 54  LEU B N   1 
ATOM   1347 C  CA  . LEU B 1 56  ? -20.355 -5.253  19.789  1.00 48.44  ? 54  LEU B CA  1 
ATOM   1348 C  C   . LEU B 1 56  ? -20.671 -3.771  19.986  1.00 51.85  ? 54  LEU B C   1 
ATOM   1349 O  O   . LEU B 1 56  ? -19.888 -3.048  20.612  1.00 53.79  ? 54  LEU B O   1 
ATOM   1350 C  CB  . LEU B 1 56  ? -19.670 -5.485  18.451  1.00 44.83  ? 54  LEU B CB  1 
ATOM   1351 C  CG  . LEU B 1 56  ? -18.639 -4.432  18.035  1.00 42.23  ? 54  LEU B CG  1 
ATOM   1352 C  CD1 . LEU B 1 56  ? -17.457 -4.498  18.960  1.00 40.53  ? 54  LEU B CD1 1 
ATOM   1353 C  CD2 . LEU B 1 56  ? -18.210 -4.661  16.590  1.00 38.38  ? 54  LEU B CD2 1 
ATOM   1354 N  N   . SER B 1 57  ? -21.807 -3.298  19.449  1.00 51.48  ? 55  SER B N   1 
ATOM   1355 C  CA  . SER B 1 57  ? -22.179 -1.889  19.583  1.00 57.08  ? 55  SER B CA  1 
ATOM   1356 C  C   . SER B 1 57  ? -22.299 -1.431  21.026  1.00 60.00  ? 55  SER B C   1 
ATOM   1357 O  O   . SER B 1 57  ? -22.167 -0.231  21.290  1.00 61.47  ? 55  SER B O   1 
ATOM   1358 C  CB  . SER B 1 57  ? -23.513 -1.612  18.901  1.00 65.76  ? 55  SER B CB  1 
ATOM   1359 O  OG  . SER B 1 57  ? -23.420 -1.904  17.529  1.00 68.65  ? 55  SER B OG  1 
ATOM   1360 N  N   . GLY B 1 58  ? -22.553 -2.345  21.965  1.00 60.39  ? 56  GLY B N   1 
ATOM   1361 C  CA  . GLY B 1 58  ? -22.706 -1.937  23.345  1.00 57.46  ? 56  GLY B CA  1 
ATOM   1362 C  C   . GLY B 1 58  ? -21.424 -1.605  24.065  1.00 57.61  ? 56  GLY B C   1 
ATOM   1363 O  O   . GLY B 1 58  ? -21.465 -0.923  25.089  1.00 63.29  ? 56  GLY B O   1 
ATOM   1364 N  N   . HIS B 1 59  ? -20.280 -1.984  23.514  1.00 53.41  ? 57  HIS B N   1 
ATOM   1365 C  CA  . HIS B 1 59  ? -19.013 -1.816  24.202  1.00 53.94  ? 57  HIS B CA  1 
ATOM   1366 C  C   . HIS B 1 59  ? -18.213 -0.611  23.713  1.00 53.78  ? 57  HIS B C   1 
ATOM   1367 O  O   . HIS B 1 59  ? -17.093 -0.396  24.194  1.00 53.12  ? 57  HIS B O   1 
ATOM   1368 C  CB  . HIS B 1 59  ? -18.181 -3.092  24.046  1.00 53.32  ? 57  HIS B CB  1 
ATOM   1369 C  CG  . HIS B 1 59  ? -18.858 -4.313  24.579  1.00 58.16  ? 57  HIS B CG  1 
ATOM   1370 N  ND1 . HIS B 1 59  ? -18.539 -4.868  25.799  1.00 62.82  ? 57  HIS B ND1 1 
ATOM   1371 C  CD2 . HIS B 1 59  ? -19.852 -5.076  24.070  1.00 60.11  ? 57  HIS B CD2 1 
ATOM   1372 C  CE1 . HIS B 1 59  ? -19.301 -5.925  26.018  1.00 64.19  ? 57  HIS B CE1 1 
ATOM   1373 N  NE2 . HIS B 1 59  ? -20.107 -6.072  24.984  1.00 63.35  ? 57  HIS B NE2 1 
ATOM   1374 N  N   . PHE B 1 60  ? -18.761 0.191   22.796  1.00 53.14  ? 58  PHE B N   1 
ATOM   1375 C  CA  . PHE B 1 60  ? -18.067 1.388   22.344  1.00 53.29  ? 58  PHE B CA  1 
ATOM   1376 C  C   . PHE B 1 60  ? -18.191 2.485   23.387  1.00 59.32  ? 58  PHE B C   1 
ATOM   1377 O  O   . PHE B 1 60  ? -19.181 2.565   24.118  1.00 63.44  ? 58  PHE B O   1 
ATOM   1378 C  CB  . PHE B 1 60  ? -18.606 1.879   21.005  1.00 51.83  ? 58  PHE B CB  1 
ATOM   1379 C  CG  . PHE B 1 60  ? -18.233 1.001   19.862  1.00 49.97  ? 58  PHE B CG  1 
ATOM   1380 C  CD1 . PHE B 1 60  ? -16.902 0.794   19.546  1.00 45.75  ? 58  PHE B CD1 1 
ATOM   1381 C  CD2 . PHE B 1 60  ? -19.212 0.394   19.083  1.00 50.48  ? 58  PHE B CD2 1 
ATOM   1382 C  CE1 . PHE B 1 60  ? -16.550 -0.019  18.500  1.00 42.39  ? 58  PHE B CE1 1 
ATOM   1383 C  CE2 . PHE B 1 60  ? -18.859 -0.421  18.020  1.00 46.26  ? 58  PHE B CE2 1 
ATOM   1384 C  CZ  . PHE B 1 60  ? -17.531 -0.625  17.732  1.00 43.36  ? 58  PHE B CZ  1 
ATOM   1385 N  N   . GLU B 1 61  ? -17.139 3.273   23.514  1.00 62.40  ? 59  GLU B N   1 
ATOM   1386 C  CA  . GLU B 1 61  ? -17.057 4.343   24.492  1.00 66.08  ? 59  GLU B CA  1 
ATOM   1387 C  C   . GLU B 1 61  ? -16.833 5.672   23.781  1.00 65.39  ? 59  GLU B C   1 
ATOM   1388 O  O   . GLU B 1 61  ? -16.058 5.751   22.826  1.00 67.18  ? 59  GLU B O   1 
ATOM   1389 C  CB  . GLU B 1 61  ? -15.932 4.038   25.479  1.00 68.74  ? 59  GLU B CB  1 
ATOM   1390 C  CG  . GLU B 1 61  ? -16.032 2.624   26.028  1.00 72.48  ? 59  GLU B CG  1 
ATOM   1391 C  CD  . GLU B 1 61  ? -14.882 2.259   26.944  1.00 79.56  ? 59  GLU B CD  1 
ATOM   1392 O  OE1 . GLU B 1 61  ? -14.208 3.172   27.460  1.00 83.28  ? 59  GLU B OE1 1 
ATOM   1393 O  OE2 . GLU B 1 61  ? -14.652 1.049   27.154  1.00 81.82  ? 59  GLU B OE2 1 
ATOM   1394 N  N   . ASN B 1 62  ? -17.510 6.712   24.250  1.00 69.54  ? 60  ASN B N   1 
ATOM   1395 C  CA  . ASN B 1 62  ? -17.482 8.024   23.619  1.00 71.22  ? 60  ASN B CA  1 
ATOM   1396 C  C   . ASN B 1 62  ? -16.204 8.797   23.915  1.00 72.12  ? 60  ASN B C   1 
ATOM   1397 O  O   . ASN B 1 62  ? -15.945 9.815   23.269  1.00 74.01  ? 60  ASN B O   1 
ATOM   1398 C  CB  . ASN B 1 62  ? -18.702 8.827   24.064  1.00 75.63  ? 60  ASN B CB  1 
ATOM   1399 C  CG  . ASN B 1 62  ? -19.976 8.358   23.387  1.00 76.47  ? 60  ASN B CG  1 
ATOM   1400 O  OD1 . ASN B 1 62  ? -20.020 8.178   22.165  1.00 75.34  ? 60  ASN B OD1 1 
ATOM   1401 N  ND2 . ASN B 1 62  ? -21.006 8.125   24.177  1.00 78.60  ? 60  ASN B ND2 1 
ATOM   1402 N  N   . GLN B 1 63  ? -15.398 8.349   24.863  1.00 71.49  ? 61  GLN B N   1 
ATOM   1403 C  CA  . GLN B 1 63  ? -14.158 9.028   25.179  1.00 70.74  ? 61  GLN B CA  1 
ATOM   1404 C  C   . GLN B 1 63  ? -12.952 8.389   24.495  1.00 67.23  ? 61  GLN B C   1 
ATOM   1405 O  O   . GLN B 1 63  ? -11.839 8.908   24.623  1.00 70.02  ? 61  GLN B O   1 
ATOM   1406 C  CB  . GLN B 1 63  ? -13.958 9.038   26.702  1.00 73.85  ? 61  GLN B CB  1 
ATOM   1407 N  N   . LYS B 1 64  ? -13.151 7.330   23.708  1.00 60.26  ? 62  LYS B N   1 
ATOM   1408 C  CA  . LYS B 1 64  ? -12.051 6.523   23.199  1.00 55.67  ? 62  LYS B CA  1 
ATOM   1409 C  C   . LYS B 1 64  ? -12.157 6.372   21.690  1.00 55.77  ? 62  LYS B C   1 
ATOM   1410 O  O   . LYS B 1 64  ? -13.250 6.398   21.118  1.00 56.44  ? 62  LYS B O   1 
ATOM   1411 C  CB  . LYS B 1 64  ? -12.044 5.112   23.822  1.00 54.34  ? 62  LYS B CB  1 
ATOM   1412 C  CG  . LYS B 1 64  ? -11.866 5.059   25.328  1.00 59.75  ? 62  LYS B CG  1 
ATOM   1413 C  CD  . LYS B 1 64  ? -10.519 4.490   25.712  1.00 64.19  ? 62  LYS B CD  1 
ATOM   1414 C  CE  . LYS B 1 64  ? -10.533 3.865   27.101  1.00 69.56  ? 62  LYS B CE  1 
ATOM   1415 N  NZ  . LYS B 1 64  ? -11.319 2.604   27.134  1.00 70.89  ? 62  LYS B NZ  1 
ATOM   1416 N  N   . VAL B 1 65  ? -11.001 6.245   21.052  1.00 39.51  ? 63  VAL B N   1 
ATOM   1417 C  CA  . VAL B 1 65  ? -10.892 5.709   19.702  1.00 40.82  ? 63  VAL B CA  1 
ATOM   1418 C  C   . VAL B 1 65  ? -10.785 4.197   19.824  1.00 43.21  ? 63  VAL B C   1 
ATOM   1419 O  O   . VAL B 1 65  ? -10.000 3.692   20.638  1.00 43.14  ? 63  VAL B O   1 
ATOM   1420 C  CB  . VAL B 1 65  ? -9.680  6.309   18.969  1.00 40.62  ? 63  VAL B CB  1 
ATOM   1421 C  CG1 . VAL B 1 65  ? -9.469  5.649   17.609  1.00 40.91  ? 63  VAL B CG1 1 
ATOM   1422 C  CG2 . VAL B 1 65  ? -9.891  7.785   18.783  1.00 33.42  ? 63  VAL B CG2 1 
ATOM   1423 N  N   . MET B 1 66  ? -11.625 3.468   19.090  1.00 43.45  ? 64  MET B N   1 
ATOM   1424 C  CA  . MET B 1 66  ? -11.653 2.016   19.210  1.00 44.85  ? 64  MET B CA  1 
ATOM   1425 C  C   . MET B 1 66  ? -11.816 1.380   17.839  1.00 47.63  ? 64  MET B C   1 
ATOM   1426 O  O   . MET B 1 66  ? -12.347 1.986   16.911  1.00 51.58  ? 64  MET B O   1 
ATOM   1427 C  CB  . MET B 1 66  ? -12.801 1.549   20.128  1.00 45.18  ? 64  MET B CB  1 
ATOM   1428 C  CG  . MET B 1 66  ? -12.890 2.285   21.461  1.00 46.61  ? 64  MET B CG  1 
ATOM   1429 S  SD  . MET B 1 66  ? -14.112 1.596   22.600  1.00 53.33  ? 64  MET B SD  1 
ATOM   1430 C  CE  . MET B 1 66  ? -13.039 0.658   23.679  1.00 51.50  ? 64  MET B CE  1 
ATOM   1431 N  N   . TYR B 1 67  ? -11.387 0.129   17.730  1.00 46.58  ? 65  TYR B N   1 
ATOM   1432 C  CA  . TYR B 1 67  ? -11.500 -0.634  16.494  1.00 43.50  ? 65  TYR B CA  1 
ATOM   1433 C  C   . TYR B 1 67  ? -12.228 -1.925  16.821  1.00 43.71  ? 65  TYR B C   1 
ATOM   1434 O  O   . TYR B 1 67  ? -11.748 -2.702  17.643  1.00 45.68  ? 65  TYR B O   1 
ATOM   1435 C  CB  . TYR B 1 67  ? -10.112 -0.921  15.920  1.00 39.97  ? 65  TYR B CB  1 
ATOM   1436 C  CG  . TYR B 1 67  ? -9.318  0.325   15.714  1.00 40.45  ? 65  TYR B CG  1 
ATOM   1437 C  CD1 . TYR B 1 67  ? -9.620  1.192   14.673  1.00 42.21  ? 65  TYR B CD1 1 
ATOM   1438 C  CD2 . TYR B 1 67  ? -8.335  0.703   16.636  1.00 40.97  ? 65  TYR B CD2 1 
ATOM   1439 C  CE1 . TYR B 1 67  ? -8.901  2.367   14.496  1.00 46.92  ? 65  TYR B CE1 1 
ATOM   1440 C  CE2 . TYR B 1 67  ? -7.613  1.882   16.482  1.00 43.44  ? 65  TYR B CE2 1 
ATOM   1441 C  CZ  . TYR B 1 67  ? -7.899  2.712   15.400  1.00 47.33  ? 65  TYR B CZ  1 
ATOM   1442 O  OH  . TYR B 1 67  ? -7.193  3.883   15.217  1.00 46.09  ? 65  TYR B OH  1 
ATOM   1443 N  N   . GLY B 1 68  ? -13.384 -2.148  16.200  1.00 42.51  ? 66  GLY B N   1 
ATOM   1444 C  CA  . GLY B 1 68  ? -14.164 -3.347  16.427  1.00 42.96  ? 66  GLY B CA  1 
ATOM   1445 C  C   . GLY B 1 68  ? -14.103 -4.251  15.199  1.00 46.67  ? 66  GLY B C   1 
ATOM   1446 O  O   . GLY B 1 68  ? -14.453 -3.833  14.105  1.00 54.72  ? 66  GLY B O   1 
ATOM   1447 N  N   . PHE B 1 69  ? -13.666 -5.476  15.407  1.00 45.22  ? 67  PHE B N   1 
ATOM   1448 C  CA  . PHE B 1 69  ? -13.696 -6.470  14.343  1.00 51.30  ? 67  PHE B CA  1 
ATOM   1449 C  C   . PHE B 1 69  ? -14.882 -7.395  14.523  1.00 54.19  ? 67  PHE B C   1 
ATOM   1450 O  O   . PHE B 1 69  ? -15.108 -7.928  15.615  1.00 56.44  ? 67  PHE B O   1 
ATOM   1451 C  CB  . PHE B 1 69  ? -12.412 -7.277  14.300  1.00 58.13  ? 67  PHE B CB  1 
ATOM   1452 C  CG  . PHE B 1 69  ? -11.341 -6.565  13.636  1.00 66.07  ? 67  PHE B CG  1 
ATOM   1453 C  CD1 . PHE B 1 69  ? -10.598 -5.613  14.342  1.00 72.43  ? 67  PHE B CD1 1 
ATOM   1454 C  CD2 . PHE B 1 69  ? -11.112 -6.753  12.292  1.00 68.90  ? 67  PHE B CD2 1 
ATOM   1455 C  CE1 . PHE B 1 69  ? -9.585  -4.899  13.725  1.00 75.43  ? 67  PHE B CE1 1 
ATOM   1456 C  CE2 . PHE B 1 69  ? -10.116 -6.053  11.667  1.00 75.69  ? 67  PHE B CE2 1 
ATOM   1457 C  CZ  . PHE B 1 69  ? -9.344  -5.110  12.379  1.00 78.56  ? 67  PHE B CZ  1 
ATOM   1458 N  N   . CYS B 1 70  ? -15.635 -7.587  13.453  1.00 52.46  ? 68  CYS B N   1 
ATOM   1459 C  CA  . CYS B 1 70  ? -16.809 -8.423  13.550  1.00 52.48  ? 68  CYS B CA  1 
ATOM   1460 C  C   . CYS B 1 70  ? -16.890 -9.325  12.340  1.00 54.26  ? 68  CYS B C   1 
ATOM   1461 O  O   . CYS B 1 70  ? -16.747 -8.863  11.203  1.00 56.68  ? 68  CYS B O   1 
ATOM   1462 C  CB  . CYS B 1 70  ? -18.067 -7.586  13.661  1.00 54.08  ? 68  CYS B CB  1 
ATOM   1463 S  SG  . CYS B 1 70  ? -19.465 -8.660  13.862  1.00 61.50  ? 68  CYS B SG  1 
ATOM   1464 N  N   . SER B 1 71  ? -17.120 -10.607 12.591  1.00 54.24  ? 69  SER B N   1 
ATOM   1465 C  CA  . SER B 1 71  ? -17.325 -11.560 11.516  1.00 55.58  ? 69  SER B CA  1 
ATOM   1466 C  C   . SER B 1 71  ? -18.824 -11.639 11.239  1.00 57.67  ? 69  SER B C   1 
ATOM   1467 O  O   . SER B 1 71  ? -19.630 -11.743 12.172  1.00 56.28  ? 69  SER B O   1 
ATOM   1468 C  CB  . SER B 1 71  ? -16.740 -12.921 11.890  1.00 56.77  ? 69  SER B CB  1 
ATOM   1469 O  OG  . SER B 1 71  ? -17.032 -13.888 10.904  1.00 59.71  ? 69  SER B OG  1 
ATOM   1470 N  N   . VAL B 1 72  ? -19.191 -11.552 9.962   1.00 59.98  ? 70  VAL B N   1 
ATOM   1471 C  CA  . VAL B 1 72  ? -20.583 -11.445 9.519   1.00 64.95  ? 70  VAL B CA  1 
ATOM   1472 C  C   . VAL B 1 72  ? -20.786 -12.393 8.345   1.00 65.93  ? 70  VAL B C   1 
ATOM   1473 O  O   . VAL B 1 72  ? -19.970 -12.400 7.420   1.00 63.59  ? 70  VAL B O   1 
ATOM   1474 C  CB  . VAL B 1 72  ? -20.934 -10.000 9.114   1.00 53.97  ? 70  VAL B CB  1 
ATOM   1475 C  CG1 . VAL B 1 72  ? -22.232 -9.971  8.423   1.00 55.47  ? 70  VAL B CG1 1 
ATOM   1476 C  CG2 . VAL B 1 72  ? -20.963 -9.098  10.325  1.00 52.61  ? 70  VAL B CG2 1 
ATOM   1477 N  N   . LYS B 1 73  ? -21.853 -13.194 8.370   1.00 68.05  ? 71  LYS B N   1 
ATOM   1478 C  CA  . LYS B 1 73  ? -22.102 -14.148 7.294   1.00 76.77  ? 71  LYS B CA  1 
ATOM   1479 C  C   . LYS B 1 73  ? -23.238 -13.648 6.416   1.00 85.40  ? 71  LYS B C   1 
ATOM   1480 O  O   . LYS B 1 73  ? -24.232 -13.121 6.918   1.00 84.12  ? 71  LYS B O   1 
ATOM   1481 C  CB  . LYS B 1 73  ? -22.430 -15.541 7.837   1.00 75.13  ? 71  LYS B CB  1 
ATOM   1482 N  N   . ASP B 1 74  ? -23.072 -13.809 5.094   1.00 98.31  ? 72  ASP B N   1 
ATOM   1483 C  CA  . ASP B 1 74  ? -24.013 -13.278 4.108   1.00 105.52 ? 72  ASP B CA  1 
ATOM   1484 C  C   . ASP B 1 74  ? -25.191 -14.207 3.842   1.00 116.35 ? 72  ASP B C   1 
ATOM   1485 O  O   . ASP B 1 74  ? -26.228 -13.747 3.347   1.00 119.95 ? 72  ASP B O   1 
ATOM   1486 C  CB  . ASP B 1 74  ? -23.287 -12.993 2.791   1.00 105.82 ? 72  ASP B CB  1 
ATOM   1487 N  N   . SER B 1 75  ? -25.053 -15.493 4.146   1.00 121.53 ? 73  SER B N   1 
ATOM   1488 C  CA  . SER B 1 75  ? -26.137 -16.464 4.009   1.00 126.89 ? 73  SER B CA  1 
ATOM   1489 C  C   . SER B 1 75  ? -26.020 -17.453 5.172   1.00 127.75 ? 73  SER B C   1 
ATOM   1490 O  O   . SER B 1 75  ? -25.379 -17.178 6.194   1.00 125.31 ? 73  SER B O   1 
ATOM   1491 C  CB  . SER B 1 75  ? -26.088 -17.138 2.624   1.00 128.43 ? 73  SER B CB  1 
ATOM   1492 O  OG  . SER B 1 75  ? -26.024 -16.178 1.579   1.00 126.44 ? 73  SER B OG  1 
ATOM   1493 N  N   . GLN B 1 76  ? -26.649 -18.624 5.026   1.00 131.13 ? 74  GLN B N   1 
ATOM   1494 C  CA  . GLN B 1 76  ? -26.556 -19.655 6.059   1.00 130.83 ? 74  GLN B CA  1 
ATOM   1495 C  C   . GLN B 1 76  ? -25.170 -20.292 6.064   1.00 128.33 ? 74  GLN B C   1 
ATOM   1496 O  O   . GLN B 1 76  ? -24.438 -20.210 7.058   1.00 125.66 ? 74  GLN B O   1 
ATOM   1497 C  CB  . GLN B 1 76  ? -27.647 -20.713 5.854   1.00 137.02 ? 74  GLN B CB  1 
ATOM   1498 N  N   . ALA B 1 77  ? -24.788 -20.921 4.950   1.00 125.96 ? 75  ALA B N   1 
ATOM   1499 C  CA  . ALA B 1 77  ? -23.442 -21.462 4.810   1.00 118.94 ? 75  ALA B CA  1 
ATOM   1500 C  C   . ALA B 1 77  ? -22.674 -20.786 3.671   1.00 110.14 ? 75  ALA B C   1 
ATOM   1501 O  O   . ALA B 1 77  ? -22.279 -21.444 2.702   1.00 111.57 ? 75  ALA B O   1 
ATOM   1502 C  CB  . ALA B 1 77  ? -23.505 -22.979 4.608   1.00 118.42 ? 75  ALA B CB  1 
ATOM   1503 N  N   . ALA B 1 78  ? -22.463 -19.473 3.771   1.00 103.67 ? 76  ALA B N   1 
ATOM   1504 C  CA  . ALA B 1 78  ? -21.516 -18.765 2.919   1.00 97.77  ? 76  ALA B CA  1 
ATOM   1505 C  C   . ALA B 1 78  ? -20.280 -18.417 3.733   1.00 90.95  ? 76  ALA B C   1 
ATOM   1506 O  O   . ALA B 1 78  ? -20.329 -18.347 4.966   1.00 90.23  ? 76  ALA B O   1 
ATOM   1507 C  CB  . ALA B 1 78  ? -22.124 -17.488 2.324   1.00 97.68  ? 76  ALA B CB  1 
ATOM   1508 N  N   . LEU B 1 79  ? -19.168 -18.208 3.033   1.00 83.87  ? 77  LEU B N   1 
ATOM   1509 C  CA  . LEU B 1 79  ? -17.954 -17.765 3.704   1.00 73.63  ? 77  LEU B CA  1 
ATOM   1510 C  C   . LEU B 1 79  ? -18.210 -16.432 4.408   1.00 67.59  ? 77  LEU B C   1 
ATOM   1511 O  O   . LEU B 1 79  ? -18.948 -15.582 3.894   1.00 64.16  ? 77  LEU B O   1 
ATOM   1512 C  CB  . LEU B 1 79  ? -16.798 -17.627 2.711   1.00 64.56  ? 77  LEU B CB  1 
ATOM   1513 N  N   . PRO B 1 80  ? -17.679 -16.236 5.602   1.00 65.97  ? 78  PRO B N   1 
ATOM   1514 C  CA  . PRO B 1 80  ? -17.941 -14.986 6.316   1.00 63.25  ? 78  PRO B CA  1 
ATOM   1515 C  C   . PRO B 1 80  ? -17.120 -13.836 5.758   1.00 61.88  ? 78  PRO B C   1 
ATOM   1516 O  O   . PRO B 1 80  ? -16.010 -14.014 5.247   1.00 64.05  ? 78  PRO B O   1 
ATOM   1517 C  CB  . PRO B 1 80  ? -17.545 -15.314 7.760   1.00 64.00  ? 78  PRO B CB  1 
ATOM   1518 C  CG  . PRO B 1 80  ? -16.544 -16.408 7.624   1.00 65.72  ? 78  PRO B CG  1 
ATOM   1519 C  CD  . PRO B 1 80  ? -16.970 -17.219 6.434   1.00 66.16  ? 78  PRO B CD  1 
ATOM   1520 N  N   . LYS B 1 81  ? -17.705 -12.648 5.847   1.00 57.47  ? 79  LYS B N   1 
ATOM   1521 C  CA  . LYS B 1 81  ? -17.062 -11.387 5.528   1.00 55.20  ? 79  LYS B CA  1 
ATOM   1522 C  C   . LYS B 1 81  ? -16.707 -10.651 6.826   1.00 52.24  ? 79  LYS B C   1 
ATOM   1523 O  O   . LYS B 1 81  ? -17.260 -10.923 7.896   1.00 51.69  ? 79  LYS B O   1 
ATOM   1524 C  CB  . LYS B 1 81  ? -17.982 -10.542 4.637   1.00 53.17  ? 79  LYS B CB  1 
ATOM   1525 N  N   . TYR B 1 82  ? -15.753 -9.727  6.730   1.00 49.39  ? 80  TYR B N   1 
ATOM   1526 C  CA  . TYR B 1 82  ? -15.161 -9.124  7.917   1.00 47.00  ? 80  TYR B CA  1 
ATOM   1527 C  C   . TYR B 1 82  ? -15.296 -7.611  7.903   1.00 46.22  ? 80  TYR B C   1 
ATOM   1528 O  O   . TYR B 1 82  ? -14.883 -6.932  6.948   1.00 46.50  ? 80  TYR B O   1 
ATOM   1529 C  CB  . TYR B 1 82  ? -13.701 -9.542  8.079   1.00 45.39  ? 80  TYR B CB  1 
ATOM   1530 C  CG  . TYR B 1 82  ? -13.585 -11.012 8.425   1.00 46.76  ? 80  TYR B CG  1 
ATOM   1531 C  CD1 . TYR B 1 82  ? -13.811 -11.457 9.714   1.00 43.61  ? 80  TYR B CD1 1 
ATOM   1532 C  CD2 . TYR B 1 82  ? -13.304 -11.956 7.447   1.00 44.20  ? 80  TYR B CD2 1 
ATOM   1533 C  CE1 . TYR B 1 82  ? -13.730 -12.808 10.022  1.00 48.33  ? 80  TYR B CE1 1 
ATOM   1534 C  CE2 . TYR B 1 82  ? -13.208 -13.303 7.747   1.00 48.74  ? 80  TYR B CE2 1 
ATOM   1535 C  CZ  . TYR B 1 82  ? -13.424 -13.734 9.028   1.00 50.05  ? 80  TYR B CZ  1 
ATOM   1536 O  OH  . TYR B 1 82  ? -13.336 -15.089 9.315   1.00 55.77  ? 80  TYR B OH  1 
ATOM   1537 N  N   . VAL B 1 83  ? -15.875 -7.099  8.983   1.00 46.23  ? 81  VAL B N   1 
ATOM   1538 C  CA  . VAL B 1 83  ? -16.117 -5.679  9.159   1.00 43.31  ? 81  VAL B CA  1 
ATOM   1539 C  C   . VAL B 1 83  ? -15.155 -5.167  10.212  1.00 42.30  ? 81  VAL B C   1 
ATOM   1540 O  O   . VAL B 1 83  ? -14.962 -5.800  11.262  1.00 40.22  ? 81  VAL B O   1 
ATOM   1541 C  CB  . VAL B 1 83  ? -17.570 -5.393  9.564   1.00 43.35  ? 81  VAL B CB  1 
ATOM   1542 C  CG1 . VAL B 1 83  ? -17.763 -3.910  9.805   1.00 44.13  ? 81  VAL B CG1 1 
ATOM   1543 C  CG2 . VAL B 1 83  ? -18.509 -5.866  8.485   1.00 43.63  ? 81  VAL B CG2 1 
ATOM   1544 N  N   . LEU B 1 84  ? -14.523 -4.045  9.904   1.00 44.14  ? 82  LEU B N   1 
ATOM   1545 C  CA  . LEU B 1 84  ? -13.790 -3.260  10.875  1.00 44.54  ? 82  LEU B CA  1 
ATOM   1546 C  C   . LEU B 1 84  ? -14.562 -1.974  11.109  1.00 46.12  ? 82  LEU B C   1 
ATOM   1547 O  O   . LEU B 1 84  ? -14.829 -1.217  10.168  1.00 49.61  ? 82  LEU B O   1 
ATOM   1548 C  CB  . LEU B 1 84  ? -12.366 -2.972  10.410  1.00 48.22  ? 82  LEU B CB  1 
ATOM   1549 C  CG  . LEU B 1 84  ? -11.722 -1.926  11.325  1.00 50.83  ? 82  LEU B CG  1 
ATOM   1550 C  CD1 . LEU B 1 84  ? -11.549 -2.466  12.722  1.00 50.38  ? 82  LEU B CD1 1 
ATOM   1551 C  CD2 . LEU B 1 84  ? -10.398 -1.438  10.765  1.00 48.52  ? 82  LEU B CD2 1 
ATOM   1552 N  N   . ILE B 1 85  ? -14.972 -1.765  12.348  1.00 41.75  ? 83  ILE B N   1 
ATOM   1553 C  CA  . ILE B 1 85  ? -15.577 -0.520  12.767  1.00 41.28  ? 83  ILE B CA  1 
ATOM   1554 C  C   . ILE B 1 85  ? -14.486 0.365   13.344  1.00 43.16  ? 83  ILE B C   1 
ATOM   1555 O  O   . ILE B 1 85  ? -13.918 0.071   14.406  1.00 43.54  ? 83  ILE B O   1 
ATOM   1556 C  CB  . ILE B 1 85  ? -16.692 -0.758  13.778  1.00 42.35  ? 83  ILE B CB  1 
ATOM   1557 C  CG1 . ILE B 1 85  ? -17.875 -1.385  13.051  1.00 42.63  ? 83  ILE B CG1 1 
ATOM   1558 C  CG2 . ILE B 1 85  ? -17.068 0.551   14.436  1.00 43.98  ? 83  ILE B CG2 1 
ATOM   1559 C  CD1 . ILE B 1 85  ? -18.761 -2.088  13.937  1.00 44.68  ? 83  ILE B CD1 1 
ATOM   1560 N  N   . ASN B 1 86  ? -14.202 1.454   12.628  1.00 43.07  ? 84  ASN B N   1 
ATOM   1561 C  CA  . ASN B 1 86  ? -13.320 2.530   13.064  1.00 42.30  ? 84  ASN B CA  1 
ATOM   1562 C  C   . ASN B 1 86  ? -14.187 3.492   13.858  1.00 47.15  ? 84  ASN B C   1 
ATOM   1563 O  O   . ASN B 1 86  ? -14.839 4.395   13.312  1.00 49.19  ? 84  ASN B O   1 
ATOM   1564 C  CB  . ASN B 1 86  ? -12.667 3.210   11.872  1.00 42.78  ? 84  ASN B CB  1 
ATOM   1565 C  CG  . ASN B 1 86  ? -11.913 4.468   12.251  1.00 40.81  ? 84  ASN B CG  1 
ATOM   1566 O  OD1 . ASN B 1 86  ? -11.260 4.529   13.287  1.00 42.22  ? 84  ASN B OD1 1 
ATOM   1567 N  ND2 . ASN B 1 86  ? -12.056 5.501   11.435  1.00 34.68  ? 84  ASN B ND2 1 
ATOM   1568 N  N   . TRP B 1 87  ? -14.225 3.255   15.159  1.00 46.38  ? 85  TRP B N   1 
ATOM   1569 C  CA  . TRP B 1 87  ? -14.992 4.060   16.089  1.00 47.12  ? 85  TRP B CA  1 
ATOM   1570 C  C   . TRP B 1 87  ? -14.123 5.220   16.581  1.00 48.32  ? 85  TRP B C   1 
ATOM   1571 O  O   . TRP B 1 87  ? -13.044 5.010   17.151  1.00 46.93  ? 85  TRP B O   1 
ATOM   1572 C  CB  . TRP B 1 87  ? -15.467 3.197   17.256  1.00 44.86  ? 85  TRP B CB  1 
ATOM   1573 C  CG  . TRP B 1 87  ? -16.085 3.979   18.364  1.00 45.57  ? 85  TRP B CG  1 
ATOM   1574 C  CD1 . TRP B 1 87  ? -15.432 4.560   19.413  1.00 46.11  ? 85  TRP B CD1 1 
ATOM   1575 C  CD2 . TRP B 1 87  ? -17.479 4.239   18.564  1.00 47.81  ? 85  TRP B CD2 1 
ATOM   1576 N  NE1 . TRP B 1 87  ? -16.327 5.190   20.242  1.00 47.24  ? 85  TRP B NE1 1 
ATOM   1577 C  CE2 . TRP B 1 87  ? -17.593 4.998   19.752  1.00 49.58  ? 85  TRP B CE2 1 
ATOM   1578 C  CE3 . TRP B 1 87  ? -18.644 3.912   17.854  1.00 47.06  ? 85  TRP B CE3 1 
ATOM   1579 C  CZ2 . TRP B 1 87  ? -18.828 5.443   20.240  1.00 49.11  ? 85  TRP B CZ2 1 
ATOM   1580 C  CZ3 . TRP B 1 87  ? -19.871 4.348   18.345  1.00 47.52  ? 85  TRP B CZ3 1 
ATOM   1581 C  CH2 . TRP B 1 87  ? -19.950 5.108   19.518  1.00 48.61  ? 85  TRP B CH2 1 
ATOM   1582 N  N   . VAL B 1 88  ? -14.626 6.436   16.406  1.00 46.33  ? 86  VAL B N   1 
ATOM   1583 C  CA  . VAL B 1 88  ? -14.022 7.645   16.937  1.00 46.10  ? 86  VAL B CA  1 
ATOM   1584 C  C   . VAL B 1 88  ? -15.073 8.311   17.804  1.00 50.22  ? 86  VAL B C   1 
ATOM   1585 O  O   . VAL B 1 88  ? -16.067 8.828   17.280  1.00 53.23  ? 86  VAL B O   1 
ATOM   1586 C  CB  . VAL B 1 88  ? -13.576 8.584   15.812  1.00 44.31  ? 86  VAL B CB  1 
ATOM   1587 C  CG1 . VAL B 1 88  ? -12.882 9.772   16.376  1.00 44.20  ? 86  VAL B CG1 1 
ATOM   1588 C  CG2 . VAL B 1 88  ? -12.678 7.838   14.845  1.00 40.26  ? 86  VAL B CG2 1 
ATOM   1589 N  N   . GLY B 1 89  ? -14.849 8.322   19.116  1.00 50.48  ? 87  GLY B N   1 
ATOM   1590 C  CA  . GLY B 1 89  ? -15.842 8.859   20.030  1.00 56.82  ? 87  GLY B CA  1 
ATOM   1591 C  C   . GLY B 1 89  ? -16.051 10.352  19.834  1.00 61.00  ? 87  GLY B C   1 
ATOM   1592 O  O   . GLY B 1 89  ? -15.110 11.111  19.598  1.00 61.33  ? 87  GLY B O   1 
ATOM   1593 N  N   . GLU B 1 90  ? -17.304 10.786  19.976  1.00 66.93  ? 88  GLU B N   1 
ATOM   1594 C  CA  . GLU B 1 90  ? -17.591 12.203  19.774  1.00 73.34  ? 88  GLU B CA  1 
ATOM   1595 C  C   . GLU B 1 90  ? -16.766 13.096  20.693  1.00 77.50  ? 88  GLU B C   1 
ATOM   1596 O  O   . GLU B 1 90  ? -16.505 14.254  20.354  1.00 79.85  ? 88  GLU B O   1 
ATOM   1597 C  CB  . GLU B 1 90  ? -19.083 12.477  19.972  1.00 77.55  ? 88  GLU B CB  1 
ATOM   1598 N  N   . ASP B 1 91  ? -16.308 12.568  21.828  1.00 78.38  ? 89  ASP B N   1 
ATOM   1599 C  CA  . ASP B 1 91  ? -15.592 13.358  22.821  1.00 80.02  ? 89  ASP B CA  1 
ATOM   1600 C  C   . ASP B 1 91  ? -14.090 13.075  22.848  1.00 75.19  ? 89  ASP B C   1 
ATOM   1601 O  O   . ASP B 1 91  ? -13.418 13.396  23.832  1.00 77.61  ? 89  ASP B O   1 
ATOM   1602 C  CB  . ASP B 1 91  ? -16.224 13.156  24.196  1.00 87.83  ? 89  ASP B CB  1 
ATOM   1603 C  CG  . ASP B 1 91  ? -17.642 13.736  24.271  1.00 97.54  ? 89  ASP B CG  1 
ATOM   1604 O  OD1 . ASP B 1 91  ? -17.825 14.919  23.895  1.00 100.71 ? 89  ASP B OD1 1 
ATOM   1605 O  OD2 . ASP B 1 91  ? -18.580 13.023  24.692  1.00 101.30 ? 89  ASP B OD2 1 
ATOM   1606 N  N   . VAL B 1 92  ? -13.552 12.474  21.793  1.00 67.48  ? 90  VAL B N   1 
ATOM   1607 C  CA  . VAL B 1 92  ? -12.108 12.377  21.595  1.00 60.48  ? 90  VAL B CA  1 
ATOM   1608 C  C   . VAL B 1 92  ? -11.641 13.751  21.125  1.00 60.03  ? 90  VAL B C   1 
ATOM   1609 O  O   . VAL B 1 92  ? -12.328 14.382  20.310  1.00 62.57  ? 90  VAL B O   1 
ATOM   1610 C  CB  . VAL B 1 92  ? -11.762 11.272  20.579  1.00 55.97  ? 90  VAL B CB  1 
ATOM   1611 C  CG1 . VAL B 1 92  ? -10.265 11.231  20.258  1.00 54.56  ? 90  VAL B CG1 1 
ATOM   1612 C  CG2 . VAL B 1 92  ? -12.248 9.926   21.076  1.00 54.65  ? 90  VAL B CG2 1 
ATOM   1613 N  N   . PRO B 1 93  ? -10.524 14.277  21.623  1.00 58.43  ? 91  PRO B N   1 
ATOM   1614 C  CA  . PRO B 1 93  ? -10.014 15.552  21.098  1.00 56.31  ? 91  PRO B CA  1 
ATOM   1615 C  C   . PRO B 1 93  ? -9.720  15.464  19.606  1.00 54.06  ? 91  PRO B C   1 
ATOM   1616 O  O   . PRO B 1 93  ? -9.334  14.415  19.089  1.00 52.39  ? 91  PRO B O   1 
ATOM   1617 C  CB  . PRO B 1 93  ? -8.732  15.780  21.903  1.00 54.94  ? 91  PRO B CB  1 
ATOM   1618 C  CG  . PRO B 1 93  ? -8.889  14.960  23.121  1.00 55.20  ? 91  PRO B CG  1 
ATOM   1619 C  CD  . PRO B 1 93  ? -9.718  13.775  22.745  1.00 57.99  ? 91  PRO B CD  1 
ATOM   1620 N  N   . ASP B 1 94  ? -9.906  16.592  18.913  1.00 56.94  ? 92  ASP B N   1 
ATOM   1621 C  CA  . ASP B 1 94  ? -9.798  16.603  17.454  1.00 55.81  ? 92  ASP B CA  1 
ATOM   1622 C  C   . ASP B 1 94  ? -8.412  16.199  16.968  1.00 53.39  ? 92  ASP B C   1 
ATOM   1623 O  O   . ASP B 1 94  ? -8.288  15.414  16.021  1.00 51.82  ? 92  ASP B O   1 
ATOM   1624 C  CB  . ASP B 1 94  ? -10.160 17.983  16.926  1.00 63.09  ? 92  ASP B CB  1 
ATOM   1625 C  CG  . ASP B 1 94  ? -11.647 18.236  16.944  1.00 71.58  ? 92  ASP B CG  1 
ATOM   1626 O  OD1 . ASP B 1 94  ? -12.414 17.260  17.120  1.00 73.69  ? 92  ASP B OD1 1 
ATOM   1627 O  OD2 . ASP B 1 94  ? -12.048 19.410  16.786  1.00 75.67  ? 92  ASP B OD2 1 
ATOM   1628 N  N   . ALA B 1 95  ? -7.358  16.709  17.608  1.00 53.55  ? 93  ALA B N   1 
ATOM   1629 C  CA  . ALA B 1 95  ? -6.005  16.360  17.188  1.00 49.42  ? 93  ALA B CA  1 
ATOM   1630 C  C   . ALA B 1 95  ? -5.756  14.875  17.337  1.00 45.89  ? 93  ALA B C   1 
ATOM   1631 O  O   . ALA B 1 95  ? -5.009  14.283  16.551  1.00 50.04  ? 93  ALA B O   1 
ATOM   1632 C  CB  . ALA B 1 95  ? -4.972  17.152  17.985  1.00 48.81  ? 93  ALA B CB  1 
ATOM   1633 N  N   . ARG B 1 96  ? -6.366  14.256  18.334  1.00 44.42  ? 94  ARG B N   1 
ATOM   1634 C  CA  . ARG B 1 96  ? -6.152  12.837  18.511  1.00 48.71  ? 94  ARG B CA  1 
ATOM   1635 C  C   . ARG B 1 96  ? -6.980  12.029  17.513  1.00 49.08  ? 94  ARG B C   1 
ATOM   1636 O  O   . ARG B 1 96  ? -6.506  10.991  17.031  1.00 48.38  ? 94  ARG B O   1 
ATOM   1637 C  CB  . ARG B 1 96  ? -6.452  12.449  19.966  1.00 52.86  ? 94  ARG B CB  1 
ATOM   1638 C  CG  . ARG B 1 96  ? -6.381  10.977  20.208  1.00 51.81  ? 94  ARG B CG  1 
ATOM   1639 C  CD  . ARG B 1 96  ? -4.930  10.580  20.309  1.00 53.14  ? 94  ARG B CD  1 
ATOM   1640 N  NE  . ARG B 1 96  ? -4.752  9.168   20.628  1.00 53.65  ? 94  ARG B NE  1 
ATOM   1641 C  CZ  . ARG B 1 96  ? -3.642  8.479   20.367  1.00 52.06  ? 94  ARG B CZ  1 
ATOM   1642 N  NH1 . ARG B 1 96  ? -2.612  9.068   19.769  1.00 48.07  ? 94  ARG B NH1 1 
ATOM   1643 N  NH2 . ARG B 1 96  ? -3.565  7.194   20.693  1.00 53.30  ? 94  ARG B NH2 1 
ATOM   1644 N  N   . LYS B 1 97  ? -8.189  12.493  17.159  1.00 50.74  ? 95  LYS B N   1 
ATOM   1645 C  CA  . LYS B 1 97  ? -8.898  11.912  16.021  1.00 49.55  ? 95  LYS B CA  1 
ATOM   1646 C  C   . LYS B 1 97  ? -7.991  11.907  14.807  1.00 48.44  ? 95  LYS B C   1 
ATOM   1647 O  O   . LYS B 1 97  ? -7.756  10.866  14.179  1.00 46.34  ? 95  LYS B O   1 
ATOM   1648 C  CB  . LYS B 1 97  ? -10.160 12.708  15.701  1.00 55.34  ? 95  LYS B CB  1 
ATOM   1649 C  CG  . LYS B 1 97  ? -11.244 12.751  16.781  1.00 63.12  ? 95  LYS B CG  1 
ATOM   1650 C  CD  . LYS B 1 97  ? -12.467 13.544  16.249  1.00 65.68  ? 95  LYS B CD  1 
ATOM   1651 C  CE  . LYS B 1 97  ? -13.357 14.089  17.345  1.00 67.52  ? 95  LYS B CE  1 
ATOM   1652 N  NZ  . LYS B 1 97  ? -14.661 13.358  17.404  1.00 67.70  ? 95  LYS B NZ  1 
ATOM   1653 N  N   . CYS B 1 98  ? -7.437  13.079  14.502  1.00 50.03  ? 96  CYS B N   1 
ATOM   1654 C  CA  . CYS B 1 98  ? -6.585  13.245  13.339  1.00 51.14  ? 96  CYS B CA  1 
ATOM   1655 C  C   . CYS B 1 98  ? -5.382  12.301  13.372  1.00 53.55  ? 96  CYS B C   1 
ATOM   1656 O  O   . CYS B 1 98  ? -5.044  11.676  12.361  1.00 52.96  ? 96  CYS B O   1 
ATOM   1657 C  CB  . CYS B 1 98  ? -6.153  14.695  13.271  1.00 52.98  ? 96  CYS B CB  1 
ATOM   1658 S  SG  . CYS B 1 98  ? -5.427  15.093  11.745  1.00 58.01  ? 96  CYS B SG  1 
ATOM   1659 N  N   . ALA B 1 99  ? -4.726  12.173  14.525  1.00 55.18  ? 97  ALA B N   1 
ATOM   1660 C  CA  . ALA B 1 99  ? -3.588  11.262  14.629  1.00 50.97  ? 97  ALA B CA  1 
ATOM   1661 C  C   . ALA B 1 99  ? -4.015  9.805   14.437  1.00 50.39  ? 97  ALA B C   1 
ATOM   1662 O  O   . ALA B 1 99  ? -3.373  9.043   13.698  1.00 51.37  ? 97  ALA B O   1 
ATOM   1663 C  CB  . ALA B 1 99  ? -2.913  11.447  15.984  1.00 51.06  ? 97  ALA B CB  1 
ATOM   1664 N  N   . CYS B 1 100 ? -5.098  9.396   15.092  1.00 45.54  ? 98  CYS B N   1 
ATOM   1665 C  CA  . CYS B 1 100 ? -5.498  7.999   15.029  1.00 44.45  ? 98  CYS B CA  1 
ATOM   1666 C  C   . CYS B 1 100 ? -5.955  7.609   13.630  1.00 46.25  ? 98  CYS B C   1 
ATOM   1667 O  O   . CYS B 1 100 ? -5.873  6.433   13.256  1.00 48.28  ? 98  CYS B O   1 
ATOM   1668 C  CB  . CYS B 1 100 ? -6.588  7.737   16.065  1.00 47.37  ? 98  CYS B CB  1 
ATOM   1669 S  SG  . CYS B 1 100 ? -5.950  7.717   17.785  1.00 54.58  ? 98  CYS B SG  1 
ATOM   1670 N  N   . ALA B 1 101 ? -6.456  8.572   12.853  1.00 45.06  ? 99  ALA B N   1 
ATOM   1671 C  CA  . ALA B 1 101 ? -6.892  8.275   11.497  1.00 39.82  ? 99  ALA B CA  1 
ATOM   1672 C  C   . ALA B 1 101 ? -5.752  7.723   10.649  1.00 43.36  ? 99  ALA B C   1 
ATOM   1673 O  O   . ALA B 1 101 ? -5.976  6.840   9.809   1.00 45.10  ? 99  ALA B O   1 
ATOM   1674 C  CB  . ALA B 1 101 ? -7.477  9.530   10.859  1.00 39.31  ? 99  ALA B CB  1 
ATOM   1675 N  N   . SER B 1 102 ? -4.517  8.199   10.865  1.00 42.78  ? 100 SER B N   1 
ATOM   1676 C  CA  . SER B 1 102 ? -3.415  7.638   10.093  1.00 42.00  ? 100 SER B CA  1 
ATOM   1677 C  C   . SER B 1 102 ? -3.065  6.232   10.534  1.00 42.03  ? 100 SER B C   1 
ATOM   1678 O  O   . SER B 1 102 ? -2.309  5.562   9.826   1.00 47.14  ? 100 SER B O   1 
ATOM   1679 C  CB  . SER B 1 102 ? -2.160  8.500   10.192  1.00 44.41  ? 100 SER B CB  1 
ATOM   1680 O  OG  . SER B 1 102 ? -1.611  8.463   11.494  1.00 45.07  ? 100 SER B OG  1 
ATOM   1681 N  N   . HIS B 1 103 ? -3.645  5.747   11.638  1.00 40.15  ? 101 HIS B N   1 
ATOM   1682 C  CA  . HIS B 1 103 ? -3.428  4.375   12.085  1.00 39.62  ? 101 HIS B CA  1 
ATOM   1683 C  C   . HIS B 1 103 ? -4.373  3.367   11.443  1.00 40.45  ? 101 HIS B C   1 
ATOM   1684 O  O   . HIS B 1 103 ? -4.058  2.169   11.464  1.00 42.70  ? 101 HIS B O   1 
ATOM   1685 C  CB  . HIS B 1 103 ? -3.583  4.237   13.611  1.00 37.76  ? 101 HIS B CB  1 
ATOM   1686 C  CG  . HIS B 1 103 ? -2.743  5.183   14.404  1.00 39.80  ? 101 HIS B CG  1 
ATOM   1687 N  ND1 . HIS B 1 103 ? -2.996  5.467   15.727  1.00 41.51  ? 101 HIS B ND1 1 
ATOM   1688 C  CD2 . HIS B 1 103 ? -1.654  5.912   14.066  1.00 41.78  ? 101 HIS B CD2 1 
ATOM   1689 C  CE1 . HIS B 1 103 ? -2.098  6.325   16.171  1.00 43.31  ? 101 HIS B CE1 1 
ATOM   1690 N  NE2 . HIS B 1 103 ? -1.267  6.604   15.185  1.00 43.95  ? 101 HIS B NE2 1 
ATOM   1691 N  N   . VAL B 1 104 ? -5.525  3.805   10.909  1.00 39.26  ? 102 VAL B N   1 
ATOM   1692 C  CA  . VAL B 1 104 ? -6.573  2.850   10.536  1.00 39.78  ? 102 VAL B CA  1 
ATOM   1693 C  C   . VAL B 1 104 ? -6.034  1.808   9.572   1.00 40.47  ? 102 VAL B C   1 
ATOM   1694 O  O   . VAL B 1 104 ? -6.229  0.606   9.756   1.00 42.08  ? 102 VAL B O   1 
ATOM   1695 C  CB  . VAL B 1 104 ? -7.802  3.562   9.950   1.00 38.07  ? 102 VAL B CB  1 
ATOM   1696 C  CG1 . VAL B 1 104 ? -8.766  2.518   9.413   1.00 38.78  ? 102 VAL B CG1 1 
ATOM   1697 C  CG2 . VAL B 1 104 ? -8.502  4.387   11.021  1.00 35.04  ? 102 VAL B CG2 1 
ATOM   1698 N  N   . ALA B 1 105 ? -5.336  2.246   8.540   1.00 42.24  ? 103 ALA B N   1 
ATOM   1699 C  CA  . ALA B 1 105 ? -4.864  1.285   7.555   1.00 40.04  ? 103 ALA B CA  1 
ATOM   1700 C  C   . ALA B 1 105 ? -3.931  0.263   8.186   1.00 40.69  ? 103 ALA B C   1 
ATOM   1701 O  O   . ALA B 1 105 ? -4.062  -0.941  7.936   1.00 44.70  ? 103 ALA B O   1 
ATOM   1702 C  CB  . ALA B 1 105 ? -4.179  2.022   6.403   1.00 39.78  ? 103 ALA B CB  1 
ATOM   1703 N  N   . LYS B 1 106 ? -3.014  0.714   9.043   1.00 40.09  ? 104 LYS B N   1 
ATOM   1704 C  CA  . LYS B 1 106 ? -2.102  -0.221  9.700   1.00 40.47  ? 104 LYS B CA  1 
ATOM   1705 C  C   . LYS B 1 106 ? -2.874  -1.225  10.550  1.00 40.20  ? 104 LYS B C   1 
ATOM   1706 O  O   . LYS B 1 106 ? -2.551  -2.421  10.566  1.00 38.64  ? 104 LYS B O   1 
ATOM   1707 C  CB  . LYS B 1 106 ? -1.091  0.544   10.567  1.00 42.95  ? 104 LYS B CB  1 
ATOM   1708 C  CG  . LYS B 1 106 ? 0.196   -0.235  10.865  1.00 53.91  ? 104 LYS B CG  1 
ATOM   1709 C  CD  . LYS B 1 106 ? 1.350   0.637   11.379  1.00 61.91  ? 104 LYS B CD  1 
ATOM   1710 C  CE  . LYS B 1 106 ? 2.220   -0.087  12.428  1.00 69.39  ? 104 LYS B CE  1 
ATOM   1711 N  NZ  . LYS B 1 106 ? 3.580   -0.577  11.919  1.00 75.63  ? 104 LYS B NZ  1 
ATOM   1712 N  N   . VAL B 1 107 ? -3.932  -0.761  11.226  1.00 39.75  ? 105 VAL B N   1 
ATOM   1713 C  CA  . VAL B 1 107 ? -4.761  -1.657  12.021  1.00 37.50  ? 105 VAL B CA  1 
ATOM   1714 C  C   . VAL B 1 107 ? -5.487  -2.660  11.131  1.00 37.84  ? 105 VAL B C   1 
ATOM   1715 O  O   . VAL B 1 107 ? -5.474  -3.869  11.399  1.00 40.04  ? 105 VAL B O   1 
ATOM   1716 C  CB  . VAL B 1 107 ? -5.735  -0.837  12.882  1.00 36.12  ? 105 VAL B CB  1 
ATOM   1717 C  CG1 . VAL B 1 107 ? -6.792  -1.730  13.493  1.00 34.07  ? 105 VAL B CG1 1 
ATOM   1718 C  CG2 . VAL B 1 107 ? -4.975  -0.113  13.981  1.00 35.22  ? 105 VAL B CG2 1 
ATOM   1719 N  N   . ALA B 1 108 ? -6.075  -2.193  10.032  1.00 33.16  ? 106 ALA B N   1 
ATOM   1720 C  CA  . ALA B 1 108 ? -6.765  -3.107  9.127   1.00 37.80  ? 106 ALA B CA  1 
ATOM   1721 C  C   . ALA B 1 108 ? -5.810  -4.146  8.546   1.00 41.08  ? 106 ALA B C   1 
ATOM   1722 O  O   . ALA B 1 108 ? -6.192  -5.309  8.353   1.00 45.96  ? 106 ALA B O   1 
ATOM   1723 C  CB  . ALA B 1 108 ? -7.462  -2.322  8.013   1.00 32.59  ? 106 ALA B CB  1 
ATOM   1724 N  N   . GLU B 1 109 ? -4.559  -3.760  8.283   1.00 39.38  ? 107 GLU B N   1 
ATOM   1725 C  CA  . GLU B 1 109 ? -3.605  -4.737  7.770   1.00 41.00  ? 107 GLU B CA  1 
ATOM   1726 C  C   . GLU B 1 109 ? -3.122  -5.690  8.849   1.00 44.26  ? 107 GLU B C   1 
ATOM   1727 O  O   . GLU B 1 109 ? -2.853  -6.857  8.552   1.00 45.33  ? 107 GLU B O   1 
ATOM   1728 C  CB  . GLU B 1 109 ? -2.387  -4.050  7.146   1.00 42.90  ? 107 GLU B CB  1 
ATOM   1729 C  CG  . GLU B 1 109 ? -2.690  -3.452  5.822   1.00 50.44  ? 107 GLU B CG  1 
ATOM   1730 C  CD  . GLU B 1 109 ? -2.435  -4.423  4.712   1.00 61.72  ? 107 GLU B CD  1 
ATOM   1731 O  OE1 . GLU B 1 109 ? -1.541  -5.277  4.890   1.00 66.16  ? 107 GLU B OE1 1 
ATOM   1732 O  OE2 . GLU B 1 109 ? -3.162  -4.364  3.685   1.00 66.31  ? 107 GLU B OE2 1 
ATOM   1733 N  N   . PHE B 1 110 ? -3.060  -5.238  10.105  1.00 45.90  ? 108 PHE B N   1 
ATOM   1734 C  CA  . PHE B 1 110 ? -2.580  -6.117  11.158  1.00 46.20  ? 108 PHE B CA  1 
ATOM   1735 C  C   . PHE B 1 110 ? -3.546  -7.273  11.369  1.00 48.75  ? 108 PHE B C   1 
ATOM   1736 O  O   . PHE B 1 110 ? -3.117  -8.426  11.524  1.00 49.78  ? 108 PHE B O   1 
ATOM   1737 C  CB  . PHE B 1 110 ? -2.375  -5.329  12.454  1.00 45.32  ? 108 PHE B CB  1 
ATOM   1738 C  CG  . PHE B 1 110 ? -1.775  -6.144  13.580  1.00 43.59  ? 108 PHE B CG  1 
ATOM   1739 C  CD1 . PHE B 1 110 ? -0.406  -6.344  13.656  1.00 46.17  ? 108 PHE B CD1 1 
ATOM   1740 C  CD2 . PHE B 1 110 ? -2.579  -6.711  14.546  1.00 44.10  ? 108 PHE B CD2 1 
ATOM   1741 C  CE1 . PHE B 1 110 ? 0.156   -7.084  14.667  1.00 49.36  ? 108 PHE B CE1 1 
ATOM   1742 C  CE2 . PHE B 1 110 ? -2.020  -7.461  15.578  1.00 50.90  ? 108 PHE B CE2 1 
ATOM   1743 C  CZ  . PHE B 1 110 ? -0.653  -7.650  15.633  1.00 50.39  ? 108 PHE B CZ  1 
ATOM   1744 N  N   . PHE B 1 111 ? -4.854  -6.989  11.389  1.00 54.02  ? 109 PHE B N   1 
ATOM   1745 C  CA  . PHE B 1 111 ? -5.840  -8.059  11.489  1.00 51.72  ? 109 PHE B CA  1 
ATOM   1746 C  C   . PHE B 1 111 ? -6.263  -8.425  10.076  1.00 56.50  ? 109 PHE B C   1 
ATOM   1747 O  O   . PHE B 1 111 ? -7.421  -8.310  9.688   1.00 57.44  ? 109 PHE B O   1 
ATOM   1748 C  CB  . PHE B 1 111 ? -7.020  -7.635  12.343  1.00 48.13  ? 109 PHE B CB  1 
ATOM   1749 C  CG  . PHE B 1 111 ? -6.637  -7.241  13.713  1.00 52.06  ? 109 PHE B CG  1 
ATOM   1750 C  CD1 . PHE B 1 111 ? -6.596  -5.912  14.075  1.00 55.38  ? 109 PHE B CD1 1 
ATOM   1751 C  CD2 . PHE B 1 111 ? -6.272  -8.200  14.641  1.00 52.65  ? 109 PHE B CD2 1 
ATOM   1752 C  CE1 . PHE B 1 111 ? -6.230  -5.541  15.348  1.00 55.07  ? 109 PHE B CE1 1 
ATOM   1753 C  CE2 . PHE B 1 111 ? -5.900  -7.836  15.907  1.00 52.60  ? 109 PHE B CE2 1 
ATOM   1754 C  CZ  . PHE B 1 111 ? -5.884  -6.502  16.263  1.00 53.15  ? 109 PHE B CZ  1 
ATOM   1755 N  N   . GLN B 1 112 ? -5.295  -8.997  9.366   1.00 62.04  ? 110 GLN B N   1 
ATOM   1756 C  CA  . GLN B 1 112 ? -5.351  -9.122  7.923   1.00 66.80  ? 110 GLN B CA  1 
ATOM   1757 C  C   . GLN B 1 112 ? -6.694  -9.649  7.465   1.00 70.00  ? 110 GLN B C   1 
ATOM   1758 O  O   . GLN B 1 112 ? -7.248  -10.578 8.060   1.00 71.70  ? 110 GLN B O   1 
ATOM   1759 C  CB  . GLN B 1 112 ? -4.243  -10.064 7.460   1.00 67.16  ? 110 GLN B CB  1 
ATOM   1760 C  CG  . GLN B 1 112 ? -4.027  -10.116 5.954   1.00 68.11  ? 110 GLN B CG  1 
ATOM   1761 C  CD  . GLN B 1 112 ? -3.637  -8.778  5.349   1.00 65.04  ? 110 GLN B CD  1 
ATOM   1762 O  OE1 . GLN B 1 112 ? -3.904  -8.528  4.176   1.00 69.36  ? 110 GLN B OE1 1 
ATOM   1763 N  NE2 . GLN B 1 112 ? -2.988  -7.923  6.136   1.00 59.30  ? 110 GLN B NE2 1 
ATOM   1764 N  N   . GLY B 1 113 ? -7.200  -9.055  6.394   1.00 74.63  ? 111 GLY B N   1 
ATOM   1765 C  CA  . GLY B 1 113 ? -8.403  -9.517  5.755   1.00 75.47  ? 111 GLY B CA  1 
ATOM   1766 C  C   . GLY B 1 113 ? -9.699  -8.738  5.959   1.00 74.41  ? 111 GLY B C   1 
ATOM   1767 O  O   . GLY B 1 113 ? -10.771 -9.314  5.735   1.00 75.15  ? 111 GLY B O   1 
ATOM   1768 N  N   . VAL B 1 114 ? -9.643  -7.462  6.348   1.00 66.80  ? 112 VAL B N   1 
ATOM   1769 C  CA  . VAL B 1 114 ? -10.876 -6.685  6.482   1.00 63.23  ? 112 VAL B CA  1 
ATOM   1770 C  C   . VAL B 1 114 ? -11.540 -6.489  5.125   1.00 62.43  ? 112 VAL B C   1 
ATOM   1771 O  O   . VAL B 1 114 ? -10.899 -6.067  4.153   1.00 65.09  ? 112 VAL B O   1 
ATOM   1772 C  CB  . VAL B 1 114 ? -10.611 -5.327  7.136   1.00 59.50  ? 112 VAL B CB  1 
ATOM   1773 C  CG1 . VAL B 1 114 ? -11.873 -4.449  7.068   1.00 52.23  ? 112 VAL B CG1 1 
ATOM   1774 C  CG2 . VAL B 1 114 ? -10.167 -5.528  8.532   1.00 59.21  ? 112 VAL B CG2 1 
ATOM   1775 N  N   . ASP B 1 115 ? -12.841 -6.782  5.061   1.00 58.46  ? 113 ASP B N   1 
ATOM   1776 C  CA  . ASP B 1 115 ? -13.630 -6.625  3.846   1.00 58.83  ? 113 ASP B CA  1 
ATOM   1777 C  C   . ASP B 1 115 ? -14.293 -5.264  3.743   1.00 58.19  ? 113 ASP B C   1 
ATOM   1778 O  O   . ASP B 1 115 ? -14.578 -4.821  2.630   1.00 61.52  ? 113 ASP B O   1 
ATOM   1779 C  CB  . ASP B 1 115 ? -14.723 -7.703  3.748   1.00 60.93  ? 113 ASP B CB  1 
ATOM   1780 C  CG  . ASP B 1 115 ? -14.180 -9.070  3.357   1.00 62.91  ? 113 ASP B CG  1 
ATOM   1781 O  OD1 . ASP B 1 115 ? -13.434 -9.142  2.342   1.00 66.04  ? 113 ASP B OD1 1 
ATOM   1782 O  OD2 . ASP B 1 115 ? -14.498 -10.058 4.072   1.00 59.41  ? 113 ASP B OD2 1 
ATOM   1783 N  N   . VAL B 1 116 ? -14.644 -4.620  4.856   1.00 57.19  ? 114 VAL B N   1 
ATOM   1784 C  CA  . VAL B 1 116 ? -15.172 -3.258  4.766   1.00 52.67  ? 114 VAL B CA  1 
ATOM   1785 C  C   . VAL B 1 116 ? -14.846 -2.482  6.043   1.00 51.89  ? 114 VAL B C   1 
ATOM   1786 O  O   . VAL B 1 116 ? -14.859 -3.034  7.150   1.00 49.56  ? 114 VAL B O   1 
ATOM   1787 C  CB  . VAL B 1 116 ? -16.693 -3.272  4.475   1.00 51.12  ? 114 VAL B CB  1 
ATOM   1788 C  CG1 . VAL B 1 116 ? -17.462 -3.906  5.610   1.00 47.62  ? 114 VAL B CG1 1 
ATOM   1789 C  CG2 . VAL B 1 116 ? -17.204 -1.856  4.201   1.00 54.93  ? 114 VAL B CG2 1 
ATOM   1790 N  N   . ILE B 1 117 ? -14.577 -1.181  5.885   1.00 50.89  ? 115 ILE B N   1 
ATOM   1791 C  CA  . ILE B 1 117 ? -14.312 -0.280  7.003   1.00 48.40  ? 115 ILE B CA  1 
ATOM   1792 C  C   . ILE B 1 117 ? -15.486 0.673   7.168   1.00 47.90  ? 115 ILE B C   1 
ATOM   1793 O  O   . ILE B 1 117 ? -15.878 1.345   6.215   1.00 49.00  ? 115 ILE B O   1 
ATOM   1794 C  CB  . ILE B 1 117 ? -13.013 0.519   6.809   1.00 49.46  ? 115 ILE B CB  1 
ATOM   1795 C  CG1 . ILE B 1 117 ? -11.789 -0.399  6.805   1.00 50.29  ? 115 ILE B CG1 1 
ATOM   1796 C  CG2 . ILE B 1 117 ? -12.883 1.563   7.907   1.00 50.47  ? 115 ILE B CG2 1 
ATOM   1797 C  CD1 . ILE B 1 117 ? -10.469 0.366   6.924   1.00 46.21  ? 115 ILE B CD1 1 
ATOM   1798 N  N   . VAL B 1 118 ? -16.008 0.764   8.389   1.00 48.74  ? 116 VAL B N   1 
ATOM   1799 C  CA  . VAL B 1 118 ? -17.170 1.580   8.730   1.00 48.86  ? 116 VAL B CA  1 
ATOM   1800 C  C   . VAL B 1 118 ? -16.735 2.596   9.768   1.00 53.30  ? 116 VAL B C   1 
ATOM   1801 O  O   . VAL B 1 118 ? -16.334 2.218   10.878  1.00 56.17  ? 116 VAL B O   1 
ATOM   1802 C  CB  . VAL B 1 118 ? -18.319 0.730   9.300   1.00 46.64  ? 116 VAL B CB  1 
ATOM   1803 C  CG1 . VAL B 1 118 ? -19.441 1.630   9.783   1.00 43.42  ? 116 VAL B CG1 1 
ATOM   1804 C  CG2 . VAL B 1 118 ? -18.815 -0.318  8.278   1.00 48.87  ? 116 VAL B CG2 1 
ATOM   1805 N  N   . ASN B 1 119 ? -16.838 3.875   9.436   1.00 52.59  ? 117 ASN B N   1 
ATOM   1806 C  CA  . ASN B 1 119 ? -16.527 4.912   10.407  1.00 53.73  ? 117 ASN B CA  1 
ATOM   1807 C  C   . ASN B 1 119 ? -17.758 5.174   11.251  1.00 52.82  ? 117 ASN B C   1 
ATOM   1808 O  O   . ASN B 1 119 ? -18.878 5.178   10.743  1.00 54.65  ? 117 ASN B O   1 
ATOM   1809 C  CB  . ASN B 1 119 ? -16.064 6.200   9.728   1.00 57.43  ? 117 ASN B CB  1 
ATOM   1810 C  CG  . ASN B 1 119 ? -14.936 5.966   8.733   1.00 60.68  ? 117 ASN B CG  1 
ATOM   1811 O  OD1 . ASN B 1 119 ? -14.047 5.143   8.958   1.00 61.72  ? 117 ASN B OD1 1 
ATOM   1812 N  ND2 . ASN B 1 119 ? -14.965 6.694   7.630   1.00 65.82  ? 117 ASN B ND2 1 
ATOM   1813 N  N   . ALA B 1 120 ? -17.556 5.313   12.555  1.00 50.76  ? 118 ALA B N   1 
ATOM   1814 C  CA  . ALA B 1 120 ? -18.699 5.403   13.448  1.00 46.77  ? 118 ALA B CA  1 
ATOM   1815 C  C   . ALA B 1 120 ? -18.341 6.238   14.659  1.00 49.93  ? 118 ALA B C   1 
ATOM   1816 O  O   . ALA B 1 120 ? -17.275 6.062   15.255  1.00 52.60  ? 118 ALA B O   1 
ATOM   1817 C  CB  . ALA B 1 120 ? -19.183 4.022   13.906  1.00 44.00  ? 118 ALA B CB  1 
ATOM   1818 N  N   . SER B 1 121 ? -19.263 7.104   15.051  1.00 61.03  ? 119 SER B N   1 
ATOM   1819 C  CA  . SER B 1 121 ? -19.136 7.877   16.273  1.00 61.28  ? 119 SER B CA  1 
ATOM   1820 C  C   . SER B 1 121 ? -20.356 7.748   17.148  1.00 66.02  ? 119 SER B C   1 
ATOM   1821 O  O   . SER B 1 121 ? -20.345 8.256   18.276  1.00 69.34  ? 119 SER B O   1 
ATOM   1822 C  CB  . SER B 1 121 ? -18.899 9.354   15.958  1.00 62.70  ? 119 SER B CB  1 
ATOM   1823 O  OG  . SER B 1 121 ? -17.722 9.488   15.192  1.00 68.03  ? 119 SER B OG  1 
ATOM   1824 N  N   . SER B 1 122 ? -21.402 7.087   16.662  1.00 65.53  ? 120 SER B N   1 
ATOM   1825 C  CA  . SER B 1 122 ? -22.597 6.802   17.419  1.00 69.21  ? 120 SER B CA  1 
ATOM   1826 C  C   . SER B 1 122 ? -22.948 5.341   17.214  1.00 71.43  ? 120 SER B C   1 
ATOM   1827 O  O   . SER B 1 122 ? -22.491 4.689   16.271  1.00 69.72  ? 120 SER B O   1 
ATOM   1828 C  CB  . SER B 1 122 ? -23.770 7.649   16.960  1.00 71.45  ? 120 SER B CB  1 
ATOM   1829 O  OG  . SER B 1 122 ? -24.281 7.121   15.752  1.00 73.49  ? 120 SER B OG  1 
ATOM   1830 N  N   . VAL B 1 123 ? -23.796 4.833   18.100  1.00 76.18  ? 121 VAL B N   1 
ATOM   1831 C  CA  . VAL B 1 123 ? -24.378 3.523   17.858  1.00 78.39  ? 121 VAL B CA  1 
ATOM   1832 C  C   . VAL B 1 123 ? -25.157 3.528   16.544  1.00 80.38  ? 121 VAL B C   1 
ATOM   1833 O  O   . VAL B 1 123 ? -25.087 2.576   15.759  1.00 78.78  ? 121 VAL B O   1 
ATOM   1834 C  CB  . VAL B 1 123 ? -25.271 3.127   19.049  1.00 87.36  ? 121 VAL B CB  1 
ATOM   1835 C  CG1 . VAL B 1 123 ? -25.476 1.628   19.074  1.00 89.24  ? 121 VAL B CG1 1 
ATOM   1836 C  CG2 . VAL B 1 123 ? -24.651 3.619   20.353  1.00 88.90  ? 121 VAL B CG2 1 
ATOM   1837 N  N   . GLU B 1 124 ? -25.848 4.633   16.249  1.00 82.57  ? 122 GLU B N   1 
ATOM   1838 C  CA  . GLU B 1 124 ? -26.707 4.691   15.070  1.00 86.63  ? 122 GLU B CA  1 
ATOM   1839 C  C   . GLU B 1 124 ? -25.941 4.548   13.758  1.00 84.68  ? 122 GLU B C   1 
ATOM   1840 O  O   . GLU B 1 124 ? -26.551 4.219   12.736  1.00 88.00  ? 122 GLU B O   1 
ATOM   1841 C  CB  . GLU B 1 124 ? -27.507 6.001   15.060  1.00 90.97  ? 122 GLU B CB  1 
ATOM   1842 N  N   . ASP B 1 125 ? -24.625 4.784   13.752  1.00 82.07  ? 123 ASP B N   1 
ATOM   1843 C  CA  . ASP B 1 125 ? -23.839 4.603   12.533  1.00 78.38  ? 123 ASP B CA  1 
ATOM   1844 C  C   . ASP B 1 125 ? -23.613 3.140   12.194  1.00 74.63  ? 123 ASP B C   1 
ATOM   1845 O  O   . ASP B 1 125 ? -23.056 2.847   11.133  1.00 73.36  ? 123 ASP B O   1 
ATOM   1846 C  CB  . ASP B 1 125 ? -22.490 5.306   12.644  1.00 77.58  ? 123 ASP B CB  1 
ATOM   1847 C  CG  . ASP B 1 125 ? -22.625 6.793   12.828  1.00 85.03  ? 123 ASP B CG  1 
ATOM   1848 O  OD1 . ASP B 1 125 ? -23.645 7.350   12.376  1.00 91.68  ? 123 ASP B OD1 1 
ATOM   1849 O  OD2 . ASP B 1 125 ? -21.702 7.416   13.395  1.00 86.05  ? 123 ASP B OD2 1 
ATOM   1850 N  N   . ILE B 1 126 ? -24.034 2.225   13.058  1.00 72.71  ? 124 ILE B N   1 
ATOM   1851 C  CA  . ILE B 1 126 ? -23.755 0.809   12.872  1.00 71.42  ? 124 ILE B CA  1 
ATOM   1852 C  C   . ILE B 1 126 ? -25.042 0.055   12.552  1.00 74.77  ? 124 ILE B C   1 
ATOM   1853 O  O   . ILE B 1 126 ? -25.613 -0.616  13.419  1.00 76.95  ? 124 ILE B O   1 
ATOM   1854 C  CB  . ILE B 1 126 ? -23.082 0.233   14.126  1.00 67.57  ? 124 ILE B CB  1 
ATOM   1855 C  CG1 . ILE B 1 126 ? -21.865 1.070   14.477  1.00 65.71  ? 124 ILE B CG1 1 
ATOM   1856 C  CG2 . ILE B 1 126 ? -22.675 -1.211  13.902  1.00 66.53  ? 124 ILE B CG2 1 
ATOM   1857 C  CD1 . ILE B 1 126 ? -21.221 0.652   15.746  1.00 63.88  ? 124 ILE B CD1 1 
ATOM   1858 N  N   . ASP B 1 127 ? -25.499 0.130   11.305  1.00 74.85  ? 125 ASP B N   1 
ATOM   1859 C  CA  . ASP B 1 127 ? -26.699 -0.584  10.884  1.00 79.10  ? 125 ASP B CA  1 
ATOM   1860 C  C   . ASP B 1 127 ? -26.284 -1.917  10.268  1.00 75.78  ? 125 ASP B C   1 
ATOM   1861 O  O   . ASP B 1 127 ? -25.724 -1.957  9.166   1.00 74.29  ? 125 ASP B O   1 
ATOM   1862 C  CB  . ASP B 1 127 ? -27.532 0.232   9.895   1.00 85.77  ? 125 ASP B CB  1 
ATOM   1863 C  CG  . ASP B 1 127 ? -28.827 -0.477  9.509   1.00 95.07  ? 125 ASP B CG  1 
ATOM   1864 O  OD1 . ASP B 1 127 ? -29.268 -1.389  10.265  1.00 96.66  ? 125 ASP B OD1 1 
ATOM   1865 O  OD2 . ASP B 1 127 ? -29.398 -0.135  8.446   1.00 100.20 ? 125 ASP B OD2 1 
ATOM   1866 N  N   . ALA B 1 128 ? -26.581 -3.006  10.986  1.00 75.13  ? 126 ALA B N   1 
ATOM   1867 C  CA  . ALA B 1 128 ? -26.252 -4.340  10.499  1.00 76.02  ? 126 ALA B CA  1 
ATOM   1868 C  C   . ALA B 1 128 ? -26.788 -4.563  9.087   1.00 80.37  ? 126 ALA B C   1 
ATOM   1869 O  O   . ALA B 1 128 ? -26.087 -5.108  8.225   1.00 81.51  ? 126 ALA B O   1 
ATOM   1870 C  CB  . ALA B 1 128 ? -26.803 -5.395  11.465  1.00 74.33  ? 126 ALA B CB  1 
ATOM   1871 N  N   . GLY B 1 129 ? -28.020 -4.117  8.821   1.00 82.16  ? 127 GLY B N   1 
ATOM   1872 C  CA  . GLY B 1 129 ? -28.546 -4.225  7.471   1.00 82.59  ? 127 GLY B CA  1 
ATOM   1873 C  C   . GLY B 1 129 ? -27.710 -3.439  6.477   1.00 82.60  ? 127 GLY B C   1 
ATOM   1874 O  O   . GLY B 1 129 ? -27.264 -3.973  5.457   1.00 82.57  ? 127 GLY B O   1 
ATOM   1875 N  N   . ALA B 1 130 ? -27.475 -2.158  6.774   1.00 80.51  ? 128 ALA B N   1 
ATOM   1876 C  CA  . ALA B 1 130 ? -26.706 -1.306  5.875   1.00 80.85  ? 128 ALA B CA  1 
ATOM   1877 C  C   . ALA B 1 130 ? -25.327 -1.899  5.607   1.00 77.33  ? 128 ALA B C   1 
ATOM   1878 O  O   . ALA B 1 130 ? -24.886 -2.002  4.452   1.00 78.85  ? 128 ALA B O   1 
ATOM   1879 C  CB  . ALA B 1 130 ? -26.587 0.086   6.488   1.00 73.94  ? 128 ALA B CB  1 
ATOM   1880 N  N   . ILE B 1 131 ? -24.652 -2.335  6.670   1.00 71.78  ? 129 ILE B N   1 
ATOM   1881 C  CA  . ILE B 1 131 ? -23.334 -2.944  6.536   1.00 71.02  ? 129 ILE B CA  1 
ATOM   1882 C  C   . ILE B 1 131 ? -23.396 -4.182  5.642   1.00 76.93  ? 129 ILE B C   1 
ATOM   1883 O  O   . ILE B 1 131 ? -22.576 -4.355  4.731   1.00 76.02  ? 129 ILE B O   1 
ATOM   1884 C  CB  . ILE B 1 131 ? -22.778 -3.265  7.935   1.00 69.25  ? 129 ILE B CB  1 
ATOM   1885 C  CG1 . ILE B 1 131 ? -22.378 -1.959  8.643   1.00 67.44  ? 129 ILE B CG1 1 
ATOM   1886 C  CG2 . ILE B 1 131 ? -21.652 -4.303  7.861   1.00 68.70  ? 129 ILE B CG2 1 
ATOM   1887 C  CD1 . ILE B 1 131 ? -22.113 -2.105  10.130  1.00 63.88  ? 129 ILE B CD1 1 
ATOM   1888 N  N   . GLY B 1 132 ? -24.389 -5.048  5.864   1.00 81.40  ? 130 GLY B N   1 
ATOM   1889 C  CA  . GLY B 1 132 ? -24.524 -6.220  5.018   1.00 86.71  ? 130 GLY B CA  1 
ATOM   1890 C  C   . GLY B 1 132 ? -24.717 -5.861  3.557   1.00 94.04  ? 130 GLY B C   1 
ATOM   1891 O  O   . GLY B 1 132 ? -24.112 -6.474  2.674   1.00 94.75  ? 130 GLY B O   1 
ATOM   1892 N  N   . GLN B 1 133 ? -25.561 -4.857  3.284   1.00 105.92 ? 131 GLN B N   1 
ATOM   1893 C  CA  . GLN B 1 133 ? -25.774 -4.407  1.909   1.00 110.94 ? 131 GLN B CA  1 
ATOM   1894 C  C   . GLN B 1 133 ? -24.478 -3.902  1.285   1.00 111.08 ? 131 GLN B C   1 
ATOM   1895 O  O   . GLN B 1 133 ? -24.225 -4.128  0.096   1.00 115.76 ? 131 GLN B O   1 
ATOM   1896 C  CB  . GLN B 1 133 ? -26.850 -3.316  1.869   1.00 114.01 ? 131 GLN B CB  1 
ATOM   1897 N  N   . ARG B 1 134 ? -23.638 -3.229  2.076   1.00 105.01 ? 132 ARG B N   1 
ATOM   1898 C  CA  . ARG B 1 134 ? -22.364 -2.753  1.547   1.00 103.18 ? 132 ARG B CA  1 
ATOM   1899 C  C   . ARG B 1 134 ? -21.506 -3.900  1.028   1.00 101.66 ? 132 ARG B C   1 
ATOM   1900 O  O   . ARG B 1 134 ? -20.738 -3.717  0.079   1.00 108.17 ? 132 ARG B O   1 
ATOM   1901 C  CB  . ARG B 1 134 ? -21.607 -1.949  2.606   1.00 100.20 ? 132 ARG B CB  1 
ATOM   1902 C  CG  . ARG B 1 134 ? -22.228 -0.591  2.905   1.00 100.46 ? 132 ARG B CG  1 
ATOM   1903 C  CD  . ARG B 1 134 ? -21.532 0.136   4.054   1.00 96.44  ? 132 ARG B CD  1 
ATOM   1904 N  NE  . ARG B 1 134 ? -20.236 0.694   3.667   1.00 96.08  ? 132 ARG B NE  1 
ATOM   1905 C  CZ  . ARG B 1 134 ? -19.466 1.421   4.473   1.00 92.29  ? 132 ARG B CZ  1 
ATOM   1906 N  NH1 . ARG B 1 134 ? -18.296 1.884   4.045   1.00 91.46  ? 132 ARG B NH1 1 
ATOM   1907 N  NH2 . ARG B 1 134 ? -19.865 1.680   5.713   1.00 88.78  ? 132 ARG B NH2 1 
ATOM   1908 N  N   . LEU B 1 135 ? -21.606 -5.072  1.638   1.00 92.76  ? 133 LEU B N   1 
ATOM   1909 C  CA  . LEU B 1 135 ? -20.796 -6.216  1.242   1.00 88.69  ? 133 LEU B CA  1 
ATOM   1910 C  C   . LEU B 1 135 ? -21.298 -6.885  -0.044  1.00 90.24  ? 133 LEU B C   1 
ATOM   1911 O  O   . LEU B 1 135 ? -22.433 -7.379  -0.116  1.00 89.83  ? 133 LEU B O   1 
ATOM   1912 C  CB  . LEU B 1 135 ? -20.755 -7.223  2.392   1.00 85.73  ? 133 LEU B CB  1 
ATOM   1913 C  CG  . LEU B 1 135 ? -20.174 -6.630  3.684   1.00 83.78  ? 133 LEU B CG  1 
ATOM   1914 C  CD1 . LEU B 1 135 ? -20.769 -7.221  4.977   1.00 68.78  ? 133 LEU B CD1 1 
ATOM   1915 C  CD2 . LEU B 1 135 ? -18.648 -6.731  3.661   1.00 80.52  ? 133 LEU B CD2 1 
ATOM   1916 N  N   . ASN C 2 5   ? 39.314  -8.415  55.931  1.00 81.00  ? 87  ASN C N   1 
ATOM   1917 C  CA  . ASN C 2 5   ? 38.541  -7.446  56.698  1.00 78.28  ? 87  ASN C CA  1 
ATOM   1918 C  C   . ASN C 2 5   ? 39.378  -6.526  57.603  1.00 75.27  ? 87  ASN C C   1 
ATOM   1919 O  O   . ASN C 2 5   ? 40.412  -6.920  58.133  1.00 77.34  ? 87  ASN C O   1 
ATOM   1920 C  CB  . ASN C 2 5   ? 37.495  -8.179  57.535  1.00 80.38  ? 87  ASN C CB  1 
ATOM   1921 C  CG  . ASN C 2 5   ? 36.220  -8.423  56.764  1.00 83.30  ? 87  ASN C CG  1 
ATOM   1922 O  OD1 . ASN C 2 5   ? 35.148  -7.930  57.136  1.00 81.18  ? 87  ASN C OD1 1 
ATOM   1923 N  ND2 . ASN C 2 5   ? 36.332  -9.161  55.653  1.00 86.60  ? 87  ASN C ND2 1 
ATOM   1924 N  N   . ASP C 2 6   ? 38.894  -5.295  57.762  1.00 69.93  ? 88  ASP C N   1 
ATOM   1925 C  CA  . ASP C 2 6   ? 39.506  -4.294  58.630  1.00 65.60  ? 88  ASP C CA  1 
ATOM   1926 C  C   . ASP C 2 6   ? 39.500  -4.750  60.095  1.00 63.63  ? 88  ASP C C   1 
ATOM   1927 O  O   . ASP C 2 6   ? 38.630  -5.499  60.539  1.00 63.21  ? 88  ASP C O   1 
ATOM   1928 C  CB  . ASP C 2 6   ? 38.740  -2.972  58.464  1.00 62.93  ? 88  ASP C CB  1 
ATOM   1929 C  CG  . ASP C 2 6   ? 39.381  -1.801  59.190  1.00 62.26  ? 88  ASP C CG  1 
ATOM   1930 O  OD1 . ASP C 2 6   ? 40.421  -1.972  59.862  1.00 64.68  ? 88  ASP C OD1 1 
ATOM   1931 O  OD2 . ASP C 2 6   ? 38.822  -0.689  59.084  1.00 59.64  ? 88  ASP C OD2 1 
ATOM   1932 N  N   . PHE C 2 7   ? 40.491  -4.297  60.857  1.00 60.61  ? 89  PHE C N   1 
ATOM   1933 C  CA  . PHE C 2 7   ? 40.550  -4.631  62.273  1.00 58.32  ? 89  PHE C CA  1 
ATOM   1934 C  C   . PHE C 2 7   ? 40.009  -3.514  63.153  1.00 55.44  ? 89  PHE C C   1 
ATOM   1935 O  O   . PHE C 2 7   ? 39.696  -3.752  64.322  1.00 53.97  ? 89  PHE C O   1 
ATOM   1936 C  CB  . PHE C 2 7   ? 41.994  -4.983  62.695  1.00 55.68  ? 89  PHE C CB  1 
ATOM   1937 N  N   . TYR C 2 8   ? 39.853  -2.315  62.623  1.00 55.97  ? 90  TYR C N   1 
ATOM   1938 C  CA  . TYR C 2 8   ? 39.379  -1.192  63.412  1.00 54.32  ? 90  TYR C CA  1 
ATOM   1939 C  C   . TYR C 2 8   ? 37.937  -0.860  63.063  1.00 51.55  ? 90  TYR C C   1 
ATOM   1940 O  O   . TYR C 2 8   ? 37.551  -0.867  61.889  1.00 51.46  ? 90  TYR C O   1 
ATOM   1941 C  CB  . TYR C 2 8   ? 40.258  0.024   63.182  1.00 56.82  ? 90  TYR C CB  1 
ATOM   1942 C  CG  . TYR C 2 8   ? 41.669  -0.162  63.672  1.00 59.47  ? 90  TYR C CG  1 
ATOM   1943 C  CD1 . TYR C 2 8   ? 42.625  -0.793  62.884  1.00 61.17  ? 90  TYR C CD1 1 
ATOM   1944 C  CD2 . TYR C 2 8   ? 42.047  0.301   64.920  1.00 57.83  ? 90  TYR C CD2 1 
ATOM   1945 C  CE1 . TYR C 2 8   ? 43.920  -0.950  63.335  1.00 62.73  ? 90  TYR C CE1 1 
ATOM   1946 C  CE2 . TYR C 2 8   ? 43.323  0.145   65.372  1.00 59.95  ? 90  TYR C CE2 1 
ATOM   1947 C  CZ  . TYR C 2 8   ? 44.255  -0.472  64.583  1.00 62.74  ? 90  TYR C CZ  1 
ATOM   1948 O  OH  . TYR C 2 8   ? 45.529  -0.601  65.070  1.00 66.11  ? 90  TYR C OH  1 
ATOM   1949 N  N   . CYS C 2 9   ? 37.159  -0.538  64.092  1.00 49.56  ? 91  CYS C N   1 
ATOM   1950 C  CA  . CYS C 2 9   ? 35.744  -0.247  63.919  1.00 48.36  ? 91  CYS C CA  1 
ATOM   1951 C  C   . CYS C 2 9   ? 35.531  0.969   63.019  1.00 49.07  ? 91  CYS C C   1 
ATOM   1952 O  O   . CYS C 2 9   ? 36.262  1.959   63.092  1.00 52.57  ? 91  CYS C O   1 
ATOM   1953 C  CB  . CYS C 2 9   ? 35.112  -0.020  65.286  1.00 50.06  ? 91  CYS C CB  1 
ATOM   1954 S  SG  . CYS C 2 9   ? 33.442  0.590   65.231  1.00 57.39  ? 91  CYS C SG  1 
ATOM   1955 N  N   . TRP C 2 10  ? 34.505  0.900   62.173  1.00 46.78  ? 92  TRP C N   1 
ATOM   1956 C  CA  . TRP C 2 10  ? 34.228  1.986   61.237  1.00 43.28  ? 92  TRP C CA  1 
ATOM   1957 C  C   . TRP C 2 10  ? 33.735  3.260   61.923  1.00 41.24  ? 92  TRP C C   1 
ATOM   1958 O  O   . TRP C 2 10  ? 33.880  4.348   61.363  1.00 42.81  ? 92  TRP C O   1 
ATOM   1959 C  CB  . TRP C 2 10  ? 33.204  1.504   60.204  1.00 42.45  ? 92  TRP C CB  1 
ATOM   1960 C  CG  . TRP C 2 10  ? 32.862  2.489   59.130  1.00 43.62  ? 92  TRP C CG  1 
ATOM   1961 C  CD1 . TRP C 2 10  ? 31.680  3.157   58.975  1.00 40.79  ? 92  TRP C CD1 1 
ATOM   1962 C  CD2 . TRP C 2 10  ? 33.696  2.894   58.034  1.00 46.61  ? 92  TRP C CD2 1 
ATOM   1963 N  NE1 . TRP C 2 10  ? 31.729  3.954   57.853  1.00 40.06  ? 92  TRP C NE1 1 
ATOM   1964 C  CE2 . TRP C 2 10  ? 32.957  3.816   57.263  1.00 44.24  ? 92  TRP C CE2 1 
ATOM   1965 C  CE3 . TRP C 2 10  ? 34.999  2.570   57.633  1.00 46.85  ? 92  TRP C CE3 1 
ATOM   1966 C  CZ2 . TRP C 2 10  ? 33.477  4.417   56.121  1.00 45.52  ? 92  TRP C CZ2 1 
ATOM   1967 C  CZ3 . TRP C 2 10  ? 35.511  3.166   56.498  1.00 44.36  ? 92  TRP C CZ3 1 
ATOM   1968 C  CH2 . TRP C 2 10  ? 34.753  4.077   55.757  1.00 46.07  ? 92  TRP C CH2 1 
ATOM   1969 N  N   . VAL C 2 11  ? 33.163  3.167   63.114  1.00 42.70  ? 93  VAL C N   1 
ATOM   1970 C  CA  . VAL C 2 11  ? 32.535  4.317   63.766  1.00 42.98  ? 93  VAL C CA  1 
ATOM   1971 C  C   . VAL C 2 11  ? 33.478  5.002   64.755  1.00 43.82  ? 93  VAL C C   1 
ATOM   1972 O  O   . VAL C 2 11  ? 33.667  6.213   64.695  1.00 40.31  ? 93  VAL C O   1 
ATOM   1973 C  CB  . VAL C 2 11  ? 31.217  3.893   64.453  1.00 39.09  ? 93  VAL C CB  1 
ATOM   1974 C  CG1 . VAL C 2 11  ? 30.705  5.020   65.259  1.00 32.54  ? 93  VAL C CG1 1 
ATOM   1975 C  CG2 . VAL C 2 11  ? 30.197  3.465   63.417  1.00 34.40  ? 93  VAL C CG2 1 
ATOM   1976 N  N   . CYS C 2 12  ? 34.076  4.237   65.673  1.00 46.11  ? 94  CYS C N   1 
ATOM   1977 C  CA  . CYS C 2 12  ? 34.971  4.765   66.697  1.00 46.71  ? 94  CYS C CA  1 
ATOM   1978 C  C   . CYS C 2 12  ? 36.451  4.599   66.363  1.00 53.57  ? 94  CYS C C   1 
ATOM   1979 O  O   . CYS C 2 12  ? 37.291  5.142   67.086  1.00 54.95  ? 94  CYS C O   1 
ATOM   1980 C  CB  . CYS C 2 12  ? 34.683  4.085   68.044  1.00 46.68  ? 94  CYS C CB  1 
ATOM   1981 S  SG  . CYS C 2 12  ? 35.279  2.333   68.222  1.00 50.89  ? 94  CYS C SG  1 
ATOM   1982 N  N   . HIS C 2 13  ? 36.794  3.831   65.320  1.00 54.74  ? 95  HIS C N   1 
ATOM   1983 C  CA  . HIS C 2 13  ? 38.165  3.631   64.856  1.00 50.19  ? 95  HIS C CA  1 
ATOM   1984 C  C   . HIS C 2 13  ? 39.046  2.930   65.883  1.00 51.87  ? 95  HIS C C   1 
ATOM   1985 O  O   . HIS C 2 13  ? 40.274  2.936   65.760  1.00 51.62  ? 95  HIS C O   1 
ATOM   1986 C  CB  . HIS C 2 13  ? 38.775  4.969   64.417  1.00 48.45  ? 95  HIS C CB  1 
ATOM   1987 C  CG  . HIS C 2 13  ? 37.796  5.850   63.695  1.00 49.04  ? 95  HIS C CG  1 
ATOM   1988 N  ND1 . HIS C 2 13  ? 37.287  5.535   62.453  1.00 48.04  ? 95  HIS C ND1 1 
ATOM   1989 C  CD2 . HIS C 2 13  ? 37.204  7.016   64.054  1.00 47.76  ? 95  HIS C CD2 1 
ATOM   1990 C  CE1 . HIS C 2 13  ? 36.437  6.472   62.073  1.00 46.30  ? 95  HIS C CE1 1 
ATOM   1991 N  NE2 . HIS C 2 13  ? 36.365  7.382   63.027  1.00 45.53  ? 95  HIS C NE2 1 
ATOM   1992 N  N   . ARG C 2 14  ? 38.452  2.306   66.893  1.00 54.58  ? 96  ARG C N   1 
ATOM   1993 C  CA  . ARG C 2 14  ? 39.189  1.530   67.882  1.00 54.61  ? 96  ARG C CA  1 
ATOM   1994 C  C   . ARG C 2 14  ? 39.028  0.031   67.610  1.00 52.24  ? 96  ARG C C   1 
ATOM   1995 O  O   . ARG C 2 14  ? 38.193  -0.391  66.808  1.00 49.64  ? 96  ARG C O   1 
ATOM   1996 C  CB  . ARG C 2 14  ? 38.716  1.897   69.293  1.00 52.55  ? 96  ARG C CB  1 
ATOM   1997 C  CG  . ARG C 2 14  ? 39.112  3.306   69.753  1.00 51.81  ? 96  ARG C CG  1 
ATOM   1998 C  CD  . ARG C 2 14  ? 38.606  3.615   71.185  1.00 52.16  ? 96  ARG C CD  1 
ATOM   1999 N  N   . GLU C 2 15  ? 39.852  -0.778  68.277  1.00 58.56  ? 97  GLU C N   1 
ATOM   2000 C  CA  . GLU C 2 15  ? 39.817  -2.228  68.090  1.00 61.13  ? 97  GLU C CA  1 
ATOM   2001 C  C   . GLU C 2 15  ? 38.804  -2.860  69.049  1.00 60.40  ? 97  GLU C C   1 
ATOM   2002 O  O   . GLU C 2 15  ? 37.899  -2.184  69.543  1.00 60.02  ? 97  GLU C O   1 
ATOM   2003 C  CB  . GLU C 2 15  ? 41.210  -2.816  68.283  1.00 69.09  ? 97  GLU C CB  1 
ATOM   2004 C  CG  . GLU C 2 15  ? 42.119  -2.619  67.112  1.00 76.84  ? 97  GLU C CG  1 
ATOM   2005 C  CD  . GLU C 2 15  ? 43.561  -2.889  67.473  1.00 84.83  ? 97  GLU C CD  1 
ATOM   2006 O  OE1 . GLU C 2 15  ? 44.015  -4.052  67.299  1.00 88.08  ? 97  GLU C OE1 1 
ATOM   2007 O  OE2 . GLU C 2 15  ? 44.226  -1.936  67.944  1.00 85.72  ? 97  GLU C OE2 1 
ATOM   2008 N  N   . GLY C 2 16  ? 38.958  -4.148  69.346  1.00 57.38  ? 98  GLY C N   1 
ATOM   2009 C  CA  . GLY C 2 16  ? 38.005  -4.884  70.156  1.00 58.91  ? 98  GLY C CA  1 
ATOM   2010 C  C   . GLY C 2 16  ? 37.206  -5.858  69.307  1.00 57.52  ? 98  GLY C C   1 
ATOM   2011 O  O   . GLY C 2 16  ? 37.400  -5.973  68.098  1.00 61.57  ? 98  GLY C O   1 
ATOM   2012 N  N   . GLN C 2 17  ? 36.289  -6.567  69.953  1.00 59.27  ? 99  GLN C N   1 
ATOM   2013 C  CA  . GLN C 2 17  ? 35.468  -7.498  69.193  1.00 61.32  ? 99  GLN C CA  1 
ATOM   2014 C  C   . GLN C 2 17  ? 34.473  -6.731  68.330  1.00 61.26  ? 99  GLN C C   1 
ATOM   2015 O  O   . GLN C 2 17  ? 33.884  -5.733  68.760  1.00 61.96  ? 99  GLN C O   1 
ATOM   2016 C  CB  . GLN C 2 17  ? 34.759  -8.496  70.107  1.00 70.36  ? 99  GLN C CB  1 
ATOM   2017 C  CG  . GLN C 2 17  ? 33.964  -7.906  71.249  1.00 79.95  ? 99  GLN C CG  1 
ATOM   2018 C  CD  . GLN C 2 17  ? 32.864  -8.853  71.740  1.00 88.78  ? 99  GLN C CD  1 
ATOM   2019 O  OE1 . GLN C 2 17  ? 32.678  -9.949  71.190  1.00 93.09  ? 99  GLN C OE1 1 
ATOM   2020 N  NE2 . GLN C 2 17  ? 32.154  -8.447  72.803  1.00 89.39  ? 99  GLN C NE2 1 
ATOM   2021 N  N   . VAL C 2 18  ? 34.327  -7.183  67.081  1.00 60.05  ? 100 VAL C N   1 
ATOM   2022 C  CA  . VAL C 2 18  ? 33.598  -6.464  66.045  1.00 54.57  ? 100 VAL C CA  1 
ATOM   2023 C  C   . VAL C 2 18  ? 32.822  -7.464  65.194  1.00 54.93  ? 100 VAL C C   1 
ATOM   2024 O  O   . VAL C 2 18  ? 33.133  -8.661  65.140  1.00 55.58  ? 100 VAL C O   1 
ATOM   2025 C  CB  . VAL C 2 18  ? 34.538  -5.634  65.130  1.00 50.65  ? 100 VAL C CB  1 
ATOM   2026 C  CG1 . VAL C 2 18  ? 35.131  -4.432  65.861  1.00 43.63  ? 100 VAL C CG1 1 
ATOM   2027 C  CG2 . VAL C 2 18  ? 35.637  -6.518  64.509  1.00 46.48  ? 100 VAL C CG2 1 
ATOM   2028 N  N   . LEU C 2 19  ? 31.800  -6.947  64.525  1.00 54.76  ? 101 LEU C N   1 
ATOM   2029 C  CA  . LEU C 2 19  ? 31.111  -7.660  63.459  1.00 56.08  ? 101 LEU C CA  1 
ATOM   2030 C  C   . LEU C 2 19  ? 31.744  -7.289  62.128  1.00 57.96  ? 101 LEU C C   1 
ATOM   2031 O  O   . LEU C 2 19  ? 32.084  -6.122  61.898  1.00 56.98  ? 101 LEU C O   1 
ATOM   2032 C  CB  . LEU C 2 19  ? 29.625  -7.307  63.435  1.00 53.19  ? 101 LEU C CB  1 
ATOM   2033 C  CG  . LEU C 2 19  ? 28.696  -7.955  64.452  1.00 51.16  ? 101 LEU C CG  1 
ATOM   2034 C  CD1 . LEU C 2 19  ? 28.610  -7.171  65.751  1.00 45.58  ? 101 LEU C CD1 1 
ATOM   2035 C  CD2 . LEU C 2 19  ? 27.353  -8.038  63.792  1.00 53.50  ? 101 LEU C CD2 1 
ATOM   2036 N  N   . CYS C 2 20  ? 31.900  -8.287  61.258  1.00 59.98  ? 102 CYS C N   1 
ATOM   2037 C  CA  . CYS C 2 20  ? 32.563  -8.143  59.967  1.00 59.62  ? 102 CYS C CA  1 
ATOM   2038 C  C   . CYS C 2 20  ? 31.534  -8.163  58.853  1.00 59.00  ? 102 CYS C C   1 
ATOM   2039 O  O   . CYS C 2 20  ? 30.830  -9.163  58.676  1.00 59.80  ? 102 CYS C O   1 
ATOM   2040 C  CB  . CYS C 2 20  ? 33.569  -9.264  59.732  1.00 65.99  ? 102 CYS C CB  1 
ATOM   2041 S  SG  . CYS C 2 20  ? 34.903  -9.289  60.889  1.00 73.49  ? 102 CYS C SG  1 
ATOM   2042 N  N   . CYS C 2 21  ? 31.480  -7.078  58.089  1.00 57.98  ? 103 CYS C N   1 
ATOM   2043 C  CA  . CYS C 2 21  ? 30.684  -7.055  56.877  1.00 57.27  ? 103 CYS C CA  1 
ATOM   2044 C  C   . CYS C 2 21  ? 31.121  -8.171  55.944  1.00 62.04  ? 103 CYS C C   1 
ATOM   2045 O  O   . CYS C 2 21  ? 32.304  -8.522  55.866  1.00 61.03  ? 103 CYS C O   1 
ATOM   2046 C  CB  . CYS C 2 21  ? 30.819  -5.710  56.167  1.00 55.81  ? 103 CYS C CB  1 
ATOM   2047 S  SG  . CYS C 2 21  ? 29.527  -5.470  54.934  1.00 59.37  ? 103 CYS C SG  1 
ATOM   2048 N  N   . GLU C 2 22  ? 30.143  -8.723  55.223  1.00 72.03  ? 104 GLU C N   1 
ATOM   2049 C  CA  . GLU C 2 22  ? 30.373  -9.801  54.274  1.00 77.06  ? 104 GLU C CA  1 
ATOM   2050 C  C   . GLU C 2 22  ? 30.700  -9.315  52.876  1.00 78.56  ? 104 GLU C C   1 
ATOM   2051 O  O   . GLU C 2 22  ? 31.334  -10.054 52.122  1.00 82.42  ? 104 GLU C O   1 
ATOM   2052 C  CB  . GLU C 2 22  ? 29.147  -10.707 54.202  1.00 85.33  ? 104 GLU C CB  1 
ATOM   2053 C  CG  . GLU C 2 22  ? 29.154  -11.761 55.276  1.00 93.03  ? 104 GLU C CG  1 
ATOM   2054 C  CD  . GLU C 2 22  ? 29.686  -13.071 54.762  1.00 100.49 ? 104 GLU C CD  1 
ATOM   2055 O  OE1 . GLU C 2 22  ? 30.047  -13.128 53.563  1.00 103.24 ? 104 GLU C OE1 1 
ATOM   2056 O  OE2 . GLU C 2 22  ? 29.764  -14.033 55.558  1.00 103.66 ? 104 GLU C OE2 1 
ATOM   2057 N  N   . LEU C 2 23  ? 30.277  -8.103  52.507  1.00 76.57  ? 105 LEU C N   1 
ATOM   2058 C  CA  . LEU C 2 23  ? 30.552  -7.541  51.190  1.00 74.42  ? 105 LEU C CA  1 
ATOM   2059 C  C   . LEU C 2 23  ? 31.813  -6.685  51.175  1.00 68.87  ? 105 LEU C C   1 
ATOM   2060 O  O   . LEU C 2 23  ? 32.705  -6.898  50.349  1.00 70.77  ? 105 LEU C O   1 
ATOM   2061 C  CB  . LEU C 2 23  ? 29.351  -6.717  50.710  1.00 79.51  ? 105 LEU C CB  1 
ATOM   2062 C  CG  . LEU C 2 23  ? 29.315  -6.381  49.209  1.00 88.41  ? 105 LEU C CG  1 
ATOM   2063 C  CD1 . LEU C 2 23  ? 30.110  -5.089  48.828  1.00 88.06  ? 105 LEU C CD1 1 
ATOM   2064 C  CD2 . LEU C 2 23  ? 29.779  -7.582  48.358  1.00 93.30  ? 105 LEU C CD2 1 
ATOM   2065 N  N   . CYS C 2 24  ? 31.909  -5.732  52.071  1.00 61.48  ? 106 CYS C N   1 
ATOM   2066 C  CA  . CYS C 2 24  ? 33.010  -4.787  52.134  1.00 56.66  ? 106 CYS C CA  1 
ATOM   2067 C  C   . CYS C 2 24  ? 33.995  -5.186  53.241  1.00 55.35  ? 106 CYS C C   1 
ATOM   2068 O  O   . CYS C 2 24  ? 33.786  -6.171  53.956  1.00 53.28  ? 106 CYS C O   1 
ATOM   2069 C  CB  . CYS C 2 24  ? 32.447  -3.376  52.344  1.00 49.98  ? 106 CYS C CB  1 
ATOM   2070 S  SG  . CYS C 2 24  ? 32.012  -3.031  54.027  1.00 55.30  ? 106 CYS C SG  1 
ATOM   2071 N  N   . PRO C 2 25  ? 35.123  -4.472  53.375  1.00 56.63  ? 107 PRO C N   1 
ATOM   2072 C  CA  . PRO C 2 25  ? 36.078  -4.810  54.446  1.00 59.87  ? 107 PRO C CA  1 
ATOM   2073 C  C   . PRO C 2 25  ? 35.691  -4.338  55.842  1.00 62.37  ? 107 PRO C C   1 
ATOM   2074 O  O   . PRO C 2 25  ? 36.267  -4.848  56.815  1.00 63.75  ? 107 PRO C O   1 
ATOM   2075 C  CB  . PRO C 2 25  ? 37.373  -4.106  54.001  1.00 58.79  ? 107 PRO C CB  1 
ATOM   2076 C  CG  . PRO C 2 25  ? 37.214  -3.870  52.565  1.00 58.93  ? 107 PRO C CG  1 
ATOM   2077 C  CD  . PRO C 2 25  ? 35.757  -3.627  52.348  1.00 56.60  ? 107 PRO C CD  1 
ATOM   2078 N  N   . ARG C 2 26  ? 34.746  -3.402  55.978  1.00 59.29  ? 108 ARG C N   1 
ATOM   2079 C  CA  . ARG C 2 26  ? 34.533  -2.707  57.246  1.00 56.22  ? 108 ARG C CA  1 
ATOM   2080 C  C   . ARG C 2 26  ? 34.137  -3.643  58.396  1.00 54.82  ? 108 ARG C C   1 
ATOM   2081 O  O   . ARG C 2 26  ? 33.615  -4.747  58.208  1.00 54.56  ? 108 ARG C O   1 
ATOM   2082 C  CB  . ARG C 2 26  ? 33.451  -1.650  57.089  1.00 56.54  ? 108 ARG C CB  1 
ATOM   2083 C  CG  . ARG C 2 26  ? 33.889  -0.385  56.386  1.00 57.31  ? 108 ARG C CG  1 
ATOM   2084 C  CD  . ARG C 2 26  ? 32.682  0.159   55.696  1.00 56.35  ? 108 ARG C CD  1 
ATOM   2085 N  NE  . ARG C 2 26  ? 32.932  1.354   54.928  1.00 55.19  ? 108 ARG C NE  1 
ATOM   2086 C  CZ  . ARG C 2 26  ? 32.631  1.417   53.640  1.00 58.26  ? 108 ARG C CZ  1 
ATOM   2087 N  NH1 . ARG C 2 26  ? 32.144  0.321   53.054  1.00 57.71  ? 108 ARG C NH1 1 
ATOM   2088 N  NH2 . ARG C 2 26  ? 32.843  2.533   52.936  1.00 58.73  ? 108 ARG C NH2 1 
ATOM   2089 N  N   . VAL C 2 27  ? 34.373  -3.167  59.614  1.00 52.26  ? 109 VAL C N   1 
ATOM   2090 C  CA  . VAL C 2 27  ? 33.964  -3.879  60.817  1.00 53.40  ? 109 VAL C CA  1 
ATOM   2091 C  C   . VAL C 2 27  ? 33.373  -2.878  61.800  1.00 53.83  ? 109 VAL C C   1 
ATOM   2092 O  O   . VAL C 2 27  ? 33.750  -1.703  61.811  1.00 52.83  ? 109 VAL C O   1 
ATOM   2093 C  CB  . VAL C 2 27  ? 35.140  -4.644  61.448  1.00 51.84  ? 109 VAL C CB  1 
ATOM   2094 C  CG1 . VAL C 2 27  ? 35.491  -5.837  60.609  1.00 45.75  ? 109 VAL C CG1 1 
ATOM   2095 C  CG2 . VAL C 2 27  ? 36.331  -3.737  61.570  1.00 48.63  ? 109 VAL C CG2 1 
ATOM   2096 N  N   . TYR C 2 28  ? 32.431  -3.349  62.628  1.00 53.60  ? 110 TYR C N   1 
ATOM   2097 C  CA  . TYR C 2 28  ? 31.723  -2.500  63.586  1.00 47.55  ? 110 TYR C CA  1 
ATOM   2098 C  C   . TYR C 2 28  ? 31.614  -3.172  64.946  1.00 49.76  ? 110 TYR C C   1 
ATOM   2099 O  O   . TYR C 2 28  ? 31.410  -4.385  65.031  1.00 51.44  ? 110 TYR C O   1 
ATOM   2100 C  CB  . TYR C 2 28  ? 30.304  -2.190  63.130  1.00 49.14  ? 110 TYR C CB  1 
ATOM   2101 C  CG  . TYR C 2 28  ? 30.157  -1.361  61.876  1.00 52.23  ? 110 TYR C CG  1 
ATOM   2102 C  CD1 . TYR C 2 28  ? 30.408  -1.905  60.623  1.00 53.76  ? 110 TYR C CD1 1 
ATOM   2103 C  CD2 . TYR C 2 28  ? 29.715  -0.042  61.940  1.00 49.87  ? 110 TYR C CD2 1 
ATOM   2104 C  CE1 . TYR C 2 28  ? 30.240  -1.152  59.477  1.00 53.15  ? 110 TYR C CE1 1 
ATOM   2105 C  CE2 . TYR C 2 28  ? 29.539  0.707   60.801  1.00 47.81  ? 110 TYR C CE2 1 
ATOM   2106 C  CZ  . TYR C 2 28  ? 29.802  0.147   59.575  1.00 50.79  ? 110 TYR C CZ  1 
ATOM   2107 O  OH  . TYR C 2 28  ? 29.631  0.889   58.434  1.00 54.33  ? 110 TYR C OH  1 
ATOM   2108 N  N   . HIS C 2 29  ? 31.710  -2.374  66.005  1.00 53.03  ? 111 HIS C N   1 
ATOM   2109 C  CA  . HIS C 2 29  ? 31.255  -2.809  67.323  1.00 55.53  ? 111 HIS C CA  1 
ATOM   2110 C  C   . HIS C 2 29  ? 29.733  -2.857  67.377  1.00 55.62  ? 111 HIS C C   1 
ATOM   2111 O  O   . HIS C 2 29  ? 29.051  -1.950  66.890  1.00 56.79  ? 111 HIS C O   1 
ATOM   2112 C  CB  . HIS C 2 29  ? 31.739  -1.853  68.400  1.00 56.17  ? 111 HIS C CB  1 
ATOM   2113 C  CG  . HIS C 2 29  ? 33.218  -1.802  68.540  1.00 61.51  ? 111 HIS C CG  1 
ATOM   2114 N  ND1 . HIS C 2 29  ? 33.924  -0.622  68.513  1.00 66.76  ? 111 HIS C ND1 1 
ATOM   2115 C  CD2 . HIS C 2 29  ? 34.127  -2.783  68.716  1.00 64.81  ? 111 HIS C CD2 1 
ATOM   2116 C  CE1 . HIS C 2 29  ? 35.207  -0.875  68.667  1.00 63.05  ? 111 HIS C CE1 1 
ATOM   2117 N  NE2 . HIS C 2 29  ? 35.357  -2.180  68.792  1.00 65.64  ? 111 HIS C NE2 1 
ATOM   2118 N  N   . ALA C 2 30  ? 29.193  -3.909  67.996  1.00 56.94  ? 112 ALA C N   1 
ATOM   2119 C  CA  . ALA C 2 30  ? 27.757  -3.939  68.253  1.00 56.10  ? 112 ALA C CA  1 
ATOM   2120 C  C   . ALA C 2 30  ? 27.306  -2.666  68.954  1.00 53.11  ? 112 ALA C C   1 
ATOM   2121 O  O   . ALA C 2 30  ? 26.317  -2.040  68.553  1.00 48.15  ? 112 ALA C O   1 
ATOM   2122 C  CB  . ALA C 2 30  ? 27.394  -5.159  69.092  1.00 58.80  ? 112 ALA C CB  1 
ATOM   2123 N  N   . LYS C 2 31  ? 28.042  -2.266  70.003  1.00 55.60  ? 113 LYS C N   1 
ATOM   2124 C  CA  . LYS C 2 31  ? 27.713  -1.051  70.744  1.00 54.22  ? 113 LYS C CA  1 
ATOM   2125 C  C   . LYS C 2 31  ? 27.635  0.151   69.816  1.00 51.68  ? 113 LYS C C   1 
ATOM   2126 O  O   . LYS C 2 31  ? 26.808  1.049   70.029  1.00 51.88  ? 113 LYS C O   1 
ATOM   2127 C  CB  . LYS C 2 31  ? 28.745  -0.811  71.856  1.00 54.23  ? 113 LYS C CB  1 
ATOM   2128 C  CG  . LYS C 2 31  ? 29.996  -0.058  71.383  1.00 57.32  ? 113 LYS C CG  1 
ATOM   2129 C  CD  . LYS C 2 31  ? 31.021  0.239   72.471  1.00 63.63  ? 113 LYS C CD  1 
ATOM   2130 C  CE  . LYS C 2 31  ? 31.976  -0.939  72.646  1.00 71.25  ? 113 LYS C CE  1 
ATOM   2131 N  NZ  . LYS C 2 31  ? 33.392  -0.498  72.795  1.00 72.95  ? 113 LYS C NZ  1 
ATOM   2132 N  N   . CYS C 2 32  ? 28.458  0.169   68.762  1.00 46.71  ? 114 CYS C N   1 
ATOM   2133 C  CA  . CYS C 2 32  ? 28.541  1.334   67.901  1.00 45.30  ? 114 CYS C CA  1 
ATOM   2134 C  C   . CYS C 2 32  ? 27.454  1.346   66.832  1.00 46.31  ? 114 CYS C C   1 
ATOM   2135 O  O   . CYS C 2 32  ? 27.095  2.425   66.351  1.00 47.32  ? 114 CYS C O   1 
ATOM   2136 C  CB  . CYS C 2 32  ? 29.935  1.419   67.264  1.00 47.03  ? 114 CYS C CB  1 
ATOM   2137 S  SG  . CYS C 2 32  ? 31.292  2.001   68.363  1.00 48.84  ? 114 CYS C SG  1 
ATOM   2138 N  N   . LEU C 2 33  ? 26.926  0.190   66.444  1.00 47.67  ? 115 LEU C N   1 
ATOM   2139 C  CA  . LEU C 2 33  ? 25.702  0.156   65.650  1.00 50.44  ? 115 LEU C CA  1 
ATOM   2140 C  C   . LEU C 2 33  ? 24.441  0.350   66.492  1.00 52.51  ? 115 LEU C C   1 
ATOM   2141 O  O   . LEU C 2 33  ? 23.340  0.353   65.930  1.00 49.19  ? 115 LEU C O   1 
ATOM   2142 C  CB  . LEU C 2 33  ? 25.600  -1.167  64.895  1.00 52.78  ? 115 LEU C CB  1 
ATOM   2143 C  CG  . LEU C 2 33  ? 26.664  -1.417  63.832  1.00 56.73  ? 115 LEU C CG  1 
ATOM   2144 C  CD1 . LEU C 2 33  ? 27.244  -2.812  63.986  1.00 57.03  ? 115 LEU C CD1 1 
ATOM   2145 C  CD2 . LEU C 2 33  ? 26.036  -1.272  62.479  1.00 61.91  ? 115 LEU C CD2 1 
ATOM   2146 N  N   . ARG C 2 34  ? 24.574  0.511   67.813  1.00 50.37  ? 116 ARG C N   1 
ATOM   2147 C  CA  . ARG C 2 34  ? 23.431  0.481   68.714  1.00 50.37  ? 116 ARG C CA  1 
ATOM   2148 C  C   . ARG C 2 34  ? 22.526  -0.717  68.420  1.00 49.18  ? 116 ARG C C   1 
ATOM   2149 O  O   . ARG C 2 34  ? 21.297  -0.605  68.399  1.00 50.51  ? 116 ARG C O   1 
ATOM   2150 C  CB  . ARG C 2 34  ? 22.655  1.794   68.654  1.00 56.17  ? 116 ARG C CB  1 
ATOM   2151 C  CG  . ARG C 2 34  ? 23.546  3.006   68.460  1.00 61.68  ? 116 ARG C CG  1 
ATOM   2152 C  CD  . ARG C 2 34  ? 22.760  4.305   68.380  1.00 65.85  ? 116 ARG C CD  1 
ATOM   2153 N  NE  . ARG C 2 34  ? 22.427  4.827   69.703  1.00 72.72  ? 116 ARG C NE  1 
ATOM   2154 C  CZ  . ARG C 2 34  ? 23.141  5.749   70.353  1.00 75.46  ? 116 ARG C CZ  1 
ATOM   2155 N  NH1 . ARG C 2 34  ? 24.246  6.254   69.810  1.00 75.11  ? 116 ARG C NH1 1 
ATOM   2156 N  NH2 . ARG C 2 34  ? 22.748  6.166   71.554  1.00 76.11  ? 116 ARG C NH2 1 
ATOM   2157 N  N   . LEU C 2 35  ? 23.148  -1.880  68.205  1.00 46.70  ? 117 LEU C N   1 
ATOM   2158 C  CA  . LEU C 2 35  ? 22.403  -3.119  68.014  1.00 48.55  ? 117 LEU C CA  1 
ATOM   2159 C  C   . LEU C 2 35  ? 21.522  -3.417  69.216  1.00 51.25  ? 117 LEU C C   1 
ATOM   2160 O  O   . LEU C 2 35  ? 21.863  -3.092  70.358  1.00 52.50  ? 117 LEU C O   1 
ATOM   2161 C  CB  . LEU C 2 35  ? 23.355  -4.290  67.786  1.00 50.74  ? 117 LEU C CB  1 
ATOM   2162 C  CG  . LEU C 2 35  ? 23.947  -4.337  66.383  1.00 52.00  ? 117 LEU C CG  1 
ATOM   2163 C  CD1 . LEU C 2 35  ? 24.589  -5.689  66.126  1.00 55.36  ? 117 LEU C CD1 1 
ATOM   2164 C  CD2 . LEU C 2 35  ? 22.867  -4.020  65.367  1.00 49.00  ? 117 LEU C CD2 1 
ATOM   2165 N  N   . THR C 2 36  ? 20.373  -4.051  68.958  1.00 52.42  ? 118 THR C N   1 
ATOM   2166 C  CA  . THR C 2 36  ? 19.543  -4.547  70.048  1.00 57.60  ? 118 THR C CA  1 
ATOM   2167 C  C   . THR C 2 36  ? 19.381  -6.058  70.055  1.00 52.00  ? 118 THR C C   1 
ATOM   2168 O  O   . THR C 2 36  ? 18.773  -6.589  70.992  1.00 60.61  ? 118 THR C O   1 
ATOM   2169 C  CB  . THR C 2 36  ? 18.148  -3.903  70.035  1.00 57.45  ? 118 THR C CB  1 
ATOM   2170 O  OG1 . THR C 2 36  ? 17.493  -4.181  68.793  1.00 58.17  ? 118 THR C OG1 1 
ATOM   2171 C  CG2 . THR C 2 36  ? 18.260  -2.410  70.231  1.00 49.40  ? 118 THR C CG2 1 
ATOM   2172 N  N   . SER C 2 37  ? 19.897  -6.759  69.048  1.00 51.75  ? 119 SER C N   1 
ATOM   2173 C  CA  . SER C 2 37  ? 19.946  -8.218  69.043  1.00 61.83  ? 119 SER C CA  1 
ATOM   2174 C  C   . SER C 2 37  ? 21.143  -8.631  68.208  1.00 57.25  ? 119 SER C C   1 
ATOM   2175 O  O   . SER C 2 37  ? 21.793  -7.803  67.573  1.00 57.23  ? 119 SER C O   1 
ATOM   2176 C  CB  . SER C 2 37  ? 18.644  -8.853  68.522  1.00 56.16  ? 119 SER C CB  1 
ATOM   2177 O  OG  . SER C 2 37  ? 18.034  -8.076  67.498  1.00 55.37  ? 119 SER C OG  1 
ATOM   2178 N  N   . GLU C 2 38  ? 21.441  -9.876  68.240  1.00 62.94  ? 120 GLU C N   1 
ATOM   2179 C  CA  . GLU C 2 38  ? 22.603  -10.322 67.482  1.00 64.61  ? 120 GLU C CA  1 
ATOM   2180 C  C   . GLU C 2 38  ? 22.172  -10.700 66.064  1.00 66.17  ? 120 GLU C C   1 
ATOM   2181 O  O   . GLU C 2 38  ? 21.125  -11.337 65.893  1.00 68.92  ? 120 GLU C O   1 
ATOM   2182 C  CB  . GLU C 2 38  ? 23.268  -11.507 68.177  1.00 72.94  ? 120 GLU C CB  1 
ATOM   2183 C  CG  . GLU C 2 38  ? 24.775  -11.609 67.958  1.00 80.57  ? 120 GLU C CG  1 
ATOM   2184 C  CD  . GLU C 2 38  ? 25.550  -11.958 69.249  1.00 87.63  ? 120 GLU C CD  1 
ATOM   2185 O  OE1 . GLU C 2 38  ? 25.002  -12.657 70.143  1.00 90.26  ? 120 GLU C OE1 1 
ATOM   2186 O  OE2 . GLU C 2 38  ? 26.717  -11.516 69.370  1.00 87.58  ? 120 GLU C OE2 1 
ATOM   2187 N  N   . PRO C 2 39  ? 22.904  -10.278 65.030  1.00 63.69  ? 121 PRO C N   1 
ATOM   2188 C  CA  . PRO C 2 39  ? 22.567  -10.697 63.666  1.00 70.05  ? 121 PRO C CA  1 
ATOM   2189 C  C   . PRO C 2 39  ? 22.648  -12.201 63.525  1.00 80.54  ? 121 PRO C C   1 
ATOM   2190 O  O   . PRO C 2 39  ? 23.477  -12.856 64.159  1.00 80.11  ? 121 PRO C O   1 
ATOM   2191 C  CB  . PRO C 2 39  ? 23.624  -10.004 62.811  1.00 64.64  ? 121 PRO C CB  1 
ATOM   2192 C  CG  . PRO C 2 39  ? 23.955  -8.787  63.594  1.00 63.46  ? 121 PRO C CG  1 
ATOM   2193 C  CD  . PRO C 2 39  ? 23.929  -9.221  65.035  1.00 62.45  ? 121 PRO C CD  1 
ATOM   2194 N  N   . GLU C 2 40  ? 21.776  -12.738 62.666  1.00 95.10  ? 122 GLU C N   1 
ATOM   2195 C  CA  . GLU C 2 40  ? 21.507  -14.169 62.607  1.00 99.58  ? 122 GLU C CA  1 
ATOM   2196 C  C   . GLU C 2 40  ? 22.503  -14.917 61.727  1.00 101.56 ? 122 GLU C C   1 
ATOM   2197 O  O   . GLU C 2 40  ? 23.107  -15.898 62.172  1.00 105.66 ? 122 GLU C O   1 
ATOM   2198 C  CB  . GLU C 2 40  ? 20.073  -14.409 62.119  1.00 101.95 ? 122 GLU C CB  1 
ATOM   2199 N  N   . GLY C 2 41  ? 22.675  -14.483 60.482  1.00 95.90  ? 123 GLY C N   1 
ATOM   2200 C  CA  . GLY C 2 41  ? 23.579  -15.167 59.578  1.00 94.84  ? 123 GLY C CA  1 
ATOM   2201 C  C   . GLY C 2 41  ? 24.608  -14.241 58.967  1.00 90.91  ? 123 GLY C C   1 
ATOM   2202 O  O   . GLY C 2 41  ? 25.361  -13.580 59.692  1.00 93.48  ? 123 GLY C O   1 
ATOM   2203 N  N   . ASP C 2 42  ? 24.643  -14.176 57.636  1.00 85.48  ? 124 ASP C N   1 
ATOM   2204 C  CA  . ASP C 2 42  ? 25.542  -13.265 56.941  1.00 81.44  ? 124 ASP C CA  1 
ATOM   2205 C  C   . ASP C 2 42  ? 25.073  -11.831 57.124  1.00 75.54  ? 124 ASP C C   1 
ATOM   2206 O  O   . ASP C 2 42  ? 23.905  -11.519 56.882  1.00 76.86  ? 124 ASP C O   1 
ATOM   2207 C  CB  . ASP C 2 42  ? 25.599  -13.600 55.454  1.00 88.89  ? 124 ASP C CB  1 
ATOM   2208 C  CG  . ASP C 2 42  ? 26.538  -14.746 55.142  1.00 95.13  ? 124 ASP C CG  1 
ATOM   2209 O  OD1 . ASP C 2 42  ? 26.691  -15.054 53.943  1.00 98.40  ? 124 ASP C OD1 1 
ATOM   2210 O  OD2 . ASP C 2 42  ? 27.119  -15.341 56.079  1.00 96.36  ? 124 ASP C OD2 1 
ATOM   2211 N  N   . TRP C 2 43  ? 25.991  -10.955 57.517  1.00 70.22  ? 125 TRP C N   1 
ATOM   2212 C  CA  . TRP C 2 43  ? 25.674  -9.597  57.940  1.00 64.43  ? 125 TRP C CA  1 
ATOM   2213 C  C   . TRP C 2 43  ? 26.194  -8.592  56.922  1.00 62.80  ? 125 TRP C C   1 
ATOM   2214 O  O   . TRP C 2 43  ? 27.372  -8.632  56.548  1.00 59.64  ? 125 TRP C O   1 
ATOM   2215 C  CB  . TRP C 2 43  ? 26.286  -9.321  59.317  1.00 60.81  ? 125 TRP C CB  1 
ATOM   2216 C  CG  . TRP C 2 43  ? 25.981  -7.972  59.868  1.00 58.62  ? 125 TRP C CG  1 
ATOM   2217 C  CD1 . TRP C 2 43  ? 24.778  -7.533  60.335  1.00 57.24  ? 125 TRP C CD1 1 
ATOM   2218 C  CD2 . TRP C 2 43  ? 26.898  -6.877  60.025  1.00 55.83  ? 125 TRP C CD2 1 
ATOM   2219 N  NE1 . TRP C 2 43  ? 24.885  -6.234  60.766  1.00 54.24  ? 125 TRP C NE1 1 
ATOM   2220 C  CE2 . TRP C 2 43  ? 26.175  -5.807  60.587  1.00 52.72  ? 125 TRP C CE2 1 
ATOM   2221 C  CE3 . TRP C 2 43  ? 28.258  -6.699  59.745  1.00 53.97  ? 125 TRP C CE3 1 
ATOM   2222 C  CZ2 . TRP C 2 43  ? 26.764  -4.570  60.868  1.00 50.70  ? 125 TRP C CZ2 1 
ATOM   2223 C  CZ3 . TRP C 2 43  ? 28.840  -5.474  60.028  1.00 51.61  ? 125 TRP C CZ3 1 
ATOM   2224 C  CH2 . TRP C 2 43  ? 28.093  -4.424  60.584  1.00 49.47  ? 125 TRP C CH2 1 
ATOM   2225 N  N   . PHE C 2 44  ? 25.317  -7.698  56.473  1.00 64.88  ? 126 PHE C N   1 
ATOM   2226 C  CA  . PHE C 2 44  ? 25.704  -6.566  55.640  1.00 64.94  ? 126 PHE C CA  1 
ATOM   2227 C  C   . PHE C 2 44  ? 25.660  -5.292  56.470  1.00 62.60  ? 126 PHE C C   1 
ATOM   2228 O  O   . PHE C 2 44  ? 24.708  -5.061  57.221  1.00 63.68  ? 126 PHE C O   1 
ATOM   2229 C  CB  . PHE C 2 44  ? 24.798  -6.435  54.417  1.00 65.34  ? 126 PHE C CB  1 
ATOM   2230 C  CG  . PHE C 2 44  ? 24.626  -7.710  53.678  1.00 69.23  ? 126 PHE C CG  1 
ATOM   2231 C  CD1 . PHE C 2 44  ? 25.703  -8.565  53.499  1.00 73.14  ? 126 PHE C CD1 1 
ATOM   2232 C  CD2 . PHE C 2 44  ? 23.388  -8.076  53.176  1.00 72.30  ? 126 PHE C CD2 1 
ATOM   2233 C  CE1 . PHE C 2 44  ? 25.551  -9.778  52.825  1.00 77.19  ? 126 PHE C CE1 1 
ATOM   2234 C  CE2 . PHE C 2 44  ? 23.228  -9.272  52.501  1.00 77.05  ? 126 PHE C CE2 1 
ATOM   2235 C  CZ  . PHE C 2 44  ? 24.312  -10.130 52.330  1.00 78.89  ? 126 PHE C CZ  1 
ATOM   2236 N  N   . CYS C 2 45  ? 26.697  -4.477  56.340  1.00 59.25  ? 127 CYS C N   1 
ATOM   2237 C  CA  . CYS C 2 45  ? 26.885  -3.335  57.220  1.00 56.47  ? 127 CYS C CA  1 
ATOM   2238 C  C   . CYS C 2 45  ? 26.040  -2.147  56.753  1.00 53.84  ? 127 CYS C C   1 
ATOM   2239 O  O   . CYS C 2 45  ? 25.484  -2.150  55.648  1.00 52.25  ? 127 CYS C O   1 
ATOM   2240 C  CB  . CYS C 2 45  ? 28.372  -2.996  57.277  1.00 58.40  ? 127 CYS C CB  1 
ATOM   2241 S  SG  . CYS C 2 45  ? 28.947  -1.870  55.974  1.00 62.92  ? 127 CYS C SG  1 
ATOM   2242 N  N   . PRO C 2 46  ? 25.900  -1.107  57.585  1.00 51.94  ? 128 PRO C N   1 
ATOM   2243 C  CA  . PRO C 2 46  ? 25.066  0.031   57.173  1.00 49.65  ? 128 PRO C CA  1 
ATOM   2244 C  C   . PRO C 2 46  ? 25.523  0.701   55.889  1.00 49.83  ? 128 PRO C C   1 
ATOM   2245 O  O   . PRO C 2 46  ? 24.668  1.156   55.124  1.00 49.81  ? 128 PRO C O   1 
ATOM   2246 C  CB  . PRO C 2 46  ? 25.153  0.982   58.382  1.00 41.11  ? 128 PRO C CB  1 
ATOM   2247 C  CG  . PRO C 2 46  ? 25.347  0.119   59.505  1.00 41.60  ? 128 PRO C CG  1 
ATOM   2248 C  CD  . PRO C 2 46  ? 26.252  -0.999  59.010  1.00 49.19  ? 128 PRO C CD  1 
ATOM   2249 N  N   . GLU C 2 47  ? 26.831  0.784   55.623  1.00 47.55  ? 129 GLU C N   1 
ATOM   2250 C  CA  . GLU C 2 47  ? 27.268  1.407   54.382  1.00 51.03  ? 129 GLU C CA  1 
ATOM   2251 C  C   . GLU C 2 47  ? 26.842  0.585   53.171  1.00 53.72  ? 129 GLU C C   1 
ATOM   2252 O  O   . GLU C 2 47  ? 26.358  1.136   52.168  1.00 54.60  ? 129 GLU C O   1 
ATOM   2253 C  CB  . GLU C 2 47  ? 28.781  1.603   54.397  1.00 56.86  ? 129 GLU C CB  1 
ATOM   2254 C  CG  . GLU C 2 47  ? 29.297  2.439   55.563  1.00 61.36  ? 129 GLU C CG  1 
ATOM   2255 C  CD  . GLU C 2 47  ? 28.970  3.930   55.435  1.00 65.48  ? 129 GLU C CD  1 
ATOM   2256 O  OE1 . GLU C 2 47  ? 28.140  4.312   54.576  1.00 66.56  ? 129 GLU C OE1 1 
ATOM   2257 O  OE2 . GLU C 2 47  ? 29.557  4.729   56.201  1.00 67.20  ? 129 GLU C OE2 1 
ATOM   2258 N  N   . CYS C 2 48  ? 26.995  -0.734  53.258  1.00 53.40  ? 130 CYS C N   1 
ATOM   2259 C  CA  . CYS C 2 48  ? 26.581  -1.607  52.168  1.00 56.14  ? 130 CYS C CA  1 
ATOM   2260 C  C   . CYS C 2 48  ? 25.075  -1.580  51.972  1.00 58.07  ? 130 CYS C C   1 
ATOM   2261 O  O   . CYS C 2 48  ? 24.585  -1.653  50.839  1.00 60.10  ? 130 CYS C O   1 
ATOM   2262 C  CB  . CYS C 2 48  ? 27.053  -3.023  52.445  1.00 57.43  ? 130 CYS C CB  1 
ATOM   2263 S  SG  . CYS C 2 48  ? 28.799  -3.177  52.213  1.00 58.85  ? 130 CYS C SG  1 
ATOM   2264 N  N   . GLU C 2 49  ? 24.321  -1.482  53.058  1.00 64.72  ? 131 GLU C N   1 
ATOM   2265 C  CA  . GLU C 2 49  ? 22.879  -1.519  52.907  1.00 65.08  ? 131 GLU C CA  1 
ATOM   2266 C  C   . GLU C 2 49  ? 22.360  -0.201  52.351  1.00 61.34  ? 131 GLU C C   1 
ATOM   2267 O  O   . GLU C 2 49  ? 21.528  -0.192  51.434  1.00 65.47  ? 131 GLU C O   1 
ATOM   2268 C  CB  . GLU C 2 49  ? 22.232  -1.861  54.239  1.00 74.61  ? 131 GLU C CB  1 
ATOM   2269 C  CG  . GLU C 2 49  ? 20.830  -2.402  54.086  1.00 86.79  ? 131 GLU C CG  1 
ATOM   2270 C  CD  . GLU C 2 49  ? 19.945  -2.024  55.264  1.00 95.12  ? 131 GLU C CD  1 
ATOM   2271 O  OE1 . GLU C 2 49  ? 20.236  -2.478  56.402  1.00 95.71  ? 131 GLU C OE1 1 
ATOM   2272 O  OE2 . GLU C 2 49  ? 18.975  -1.250  55.047  1.00 98.32  ? 131 GLU C OE2 1 
ATOM   2273 N  N   . LYS C 2 50  ? 22.861  0.923   52.873  1.00 55.54  ? 132 LYS C N   1 
ATOM   2274 C  CA  . LYS C 2 50  ? 22.550  2.228   52.291  1.00 53.90  ? 132 LYS C CA  1 
ATOM   2275 C  C   . LYS C 2 50  ? 22.822  2.231   50.793  1.00 57.56  ? 132 LYS C C   1 
ATOM   2276 O  O   . LYS C 2 50  ? 21.952  2.596   49.994  1.00 60.29  ? 132 LYS C O   1 
ATOM   2277 C  CB  . LYS C 2 50  ? 23.363  3.329   52.966  1.00 49.65  ? 132 LYS C CB  1 
ATOM   2278 C  CG  . LYS C 2 50  ? 22.533  4.267   53.832  1.00 53.13  ? 132 LYS C CG  1 
ATOM   2279 C  CD  . LYS C 2 50  ? 23.239  5.620   54.079  1.00 53.42  ? 132 LYS C CD  1 
ATOM   2280 N  N   . ILE C 2 51  ? 24.025  1.804   50.390  1.00 53.92  ? 133 ILE C N   1 
ATOM   2281 C  CA  . ILE C 2 51  ? 24.349  1.782   48.968  1.00 51.09  ? 133 ILE C CA  1 
ATOM   2282 C  C   . ILE C 2 51  ? 23.368  0.891   48.213  1.00 56.87  ? 133 ILE C C   1 
ATOM   2283 O  O   . ILE C 2 51  ? 22.839  1.279   47.163  1.00 58.58  ? 133 ILE C O   1 
ATOM   2284 C  CB  . ILE C 2 51  ? 25.805  1.337   48.752  1.00 48.43  ? 133 ILE C CB  1 
ATOM   2285 C  CG1 . ILE C 2 51  ? 26.760  2.418   49.245  1.00 48.37  ? 133 ILE C CG1 1 
ATOM   2286 C  CG2 . ILE C 2 51  ? 26.066  1.075   47.279  1.00 46.86  ? 133 ILE C CG2 1 
ATOM   2287 C  CD1 . ILE C 2 51  ? 28.213  2.030   49.142  1.00 47.36  ? 133 ILE C CD1 1 
ATOM   2288 N  N   . THR C 2 52  ? 23.101  -0.311  48.740  1.00 57.91  ? 134 THR C N   1 
ATOM   2289 C  CA  . THR C 2 52  ? 22.198  -1.225  48.045  1.00 61.05  ? 134 THR C CA  1 
ATOM   2290 C  C   . THR C 2 52  ? 20.852  -0.561  47.777  1.00 62.77  ? 134 THR C C   1 
ATOM   2291 O  O   . THR C 2 52  ? 20.289  -0.691  46.680  1.00 65.74  ? 134 THR C O   1 
ATOM   2292 C  CB  . THR C 2 52  ? 22.020  -2.520  48.848  1.00 60.25  ? 134 THR C CB  1 
ATOM   2293 O  OG1 . THR C 2 52  ? 23.249  -3.259  48.859  1.00 61.35  ? 134 THR C OG1 1 
ATOM   2294 C  CG2 . THR C 2 52  ? 20.931  -3.389  48.238  1.00 58.70  ? 134 THR C CG2 1 
ATOM   2295 N  N   . VAL C 2 53  ? 20.348  0.201   48.747  1.00 62.51  ? 135 VAL C N   1 
ATOM   2296 C  CA  . VAL C 2 53  ? 19.071  0.878   48.553  1.00 64.35  ? 135 VAL C CA  1 
ATOM   2297 C  C   . VAL C 2 53  ? 19.209  2.006   47.536  1.00 66.98  ? 135 VAL C C   1 
ATOM   2298 O  O   . VAL C 2 53  ? 18.376  2.152   46.634  1.00 71.47  ? 135 VAL C O   1 
ATOM   2299 C  CB  . VAL C 2 53  ? 18.519  1.400   49.892  1.00 59.57  ? 135 VAL C CB  1 
ATOM   2300 C  CG1 . VAL C 2 53  ? 17.254  2.215   49.650  1.00 59.34  ? 135 VAL C CG1 1 
ATOM   2301 C  CG2 . VAL C 2 53  ? 18.240  0.256   50.825  1.00 57.59  ? 135 VAL C CG2 1 
ATOM   2302 N  N   . ALA C 2 54  ? 20.249  2.834   47.677  1.00 65.16  ? 136 ALA C N   1 
ATOM   2303 C  CA  . ALA C 2 54  ? 20.384  4.008   46.818  1.00 62.78  ? 136 ALA C CA  1 
ATOM   2304 C  C   . ALA C 2 54  ? 20.609  3.632   45.364  1.00 68.52  ? 136 ALA C C   1 
ATOM   2305 O  O   . ALA C 2 54  ? 20.326  4.450   44.482  1.00 72.03  ? 136 ALA C O   1 
ATOM   2306 C  CB  . ALA C 2 54  ? 21.533  4.904   47.293  1.00 55.02  ? 136 ALA C CB  1 
ATOM   2307 N  N   . GLU C 2 55  ? 21.103  2.418   45.101  1.00 69.02  ? 137 GLU C N   1 
ATOM   2308 C  CA  . GLU C 2 55  ? 21.364  1.940   43.752  1.00 69.94  ? 137 GLU C CA  1 
ATOM   2309 C  C   . GLU C 2 55  ? 20.268  1.019   43.218  1.00 74.13  ? 137 GLU C C   1 
ATOM   2310 O  O   . GLU C 2 55  ? 20.388  0.533   42.092  1.00 78.04  ? 137 GLU C O   1 
ATOM   2311 C  CB  . GLU C 2 55  ? 22.720  1.221   43.701  1.00 69.14  ? 137 GLU C CB  1 
ATOM   2312 C  CG  . GLU C 2 55  ? 23.950  2.126   43.906  1.00 67.89  ? 137 GLU C CG  1 
ATOM   2313 C  CD  . GLU C 2 55  ? 25.284  1.373   43.750  1.00 69.84  ? 137 GLU C CD  1 
ATOM   2314 O  OE1 . GLU C 2 55  ? 25.247  0.137   43.538  1.00 72.84  ? 137 GLU C OE1 1 
ATOM   2315 O  OE2 . GLU C 2 55  ? 26.364  2.012   43.850  1.00 66.59  ? 137 GLU C OE2 1 
ATOM   2316 N  N   . CYS C 2 56  ? 19.209  0.759   43.983  1.00 76.49  ? 138 CYS C N   1 
ATOM   2317 C  CA  . CYS C 2 56  ? 18.088  -0.017  43.463  1.00 81.12  ? 138 CYS C CA  1 
ATOM   2318 C  C   . CYS C 2 56  ? 17.153  0.878   42.663  1.00 79.82  ? 138 CYS C C   1 
ATOM   2319 O  O   . CYS C 2 56  ? 16.702  1.914   43.165  1.00 75.94  ? 138 CYS C O   1 
ATOM   2320 C  CB  . CYS C 2 56  ? 17.308  -0.688  44.591  1.00 84.15  ? 138 CYS C CB  1 
ATOM   2321 S  SG  . CYS C 2 56  ? 15.755  -1.428  43.979  1.00 91.21  ? 138 CYS C SG  1 
ATOM   2322 N  N   . ILE C 2 57  ? 16.832  0.459   41.431  1.00 81.69  ? 139 ILE C N   1 
ATOM   2323 C  CA  . ILE C 2 57  ? 16.069  1.317   40.522  1.00 84.15  ? 139 ILE C CA  1 
ATOM   2324 C  C   . ILE C 2 57  ? 14.728  1.700   41.132  1.00 84.84  ? 139 ILE C C   1 
ATOM   2325 O  O   . ILE C 2 57  ? 14.235  2.819   40.938  1.00 84.93  ? 139 ILE C O   1 
ATOM   2326 C  CB  . ILE C 2 57  ? 15.876  0.630   39.160  1.00 88.79  ? 139 ILE C CB  1 
ATOM   2327 C  CG1 . ILE C 2 57  ? 17.211  0.453   38.451  1.00 89.48  ? 139 ILE C CG1 1 
ATOM   2328 C  CG2 . ILE C 2 57  ? 14.938  1.446   38.287  1.00 90.45  ? 139 ILE C CG2 1 
ATOM   2329 C  CD1 . ILE C 2 57  ? 17.115  -0.484  37.260  1.00 95.02  ? 139 ILE C CD1 1 
ATOM   2330 N  N   . GLU C 2 58  ? 14.113  0.774   41.868  1.00 85.57  ? 140 GLU C N   1 
ATOM   2331 C  CA  . GLU C 2 58  ? 12.832  1.042   42.504  1.00 84.77  ? 140 GLU C CA  1 
ATOM   2332 C  C   . GLU C 2 58  ? 12.943  1.972   43.706  1.00 81.10  ? 140 GLU C C   1 
ATOM   2333 O  O   . GLU C 2 58  ? 11.905  2.453   44.167  1.00 82.59  ? 140 GLU C O   1 
ATOM   2334 C  CB  . GLU C 2 58  ? 12.168  -0.275  42.922  1.00 86.26  ? 140 GLU C CB  1 
ATOM   2335 N  N   . THR C 2 59  ? 14.157  2.246   44.227  1.00 77.60  ? 141 THR C N   1 
ATOM   2336 C  CA  . THR C 2 59  ? 14.315  3.146   45.373  1.00 76.38  ? 141 THR C CA  1 
ATOM   2337 C  C   . THR C 2 59  ? 15.464  4.149   45.217  1.00 71.84  ? 141 THR C C   1 
ATOM   2338 O  O   . THR C 2 59  ? 15.931  4.697   46.219  1.00 67.11  ? 141 THR C O   1 
ATOM   2339 C  CB  . THR C 2 59  ? 14.513  2.369   46.687  1.00 75.72  ? 141 THR C CB  1 
ATOM   2340 O  OG1 . THR C 2 59  ? 15.544  1.381   46.531  1.00 76.23  ? 141 THR C OG1 1 
ATOM   2341 C  CG2 . THR C 2 59  ? 13.219  1.705   47.135  1.00 77.23  ? 141 THR C CG2 1 
ATOM   2342 N  N   . GLN C 2 60  ? 15.927  4.424   44.000  1.00 70.75  ? 142 GLN C N   1 
ATOM   2343 C  CA  . GLN C 2 60  ? 17.007  5.385   43.845  1.00 67.13  ? 142 GLN C CA  1 
ATOM   2344 C  C   . GLN C 2 60  ? 16.485  6.815   44.028  1.00 65.72  ? 142 GLN C C   1 
ATOM   2345 O  O   . GLN C 2 60  ? 15.277  7.067   44.037  1.00 64.26  ? 142 GLN C O   1 
ATOM   2346 C  CB  . GLN C 2 60  ? 17.678  5.214   42.485  1.00 68.69  ? 142 GLN C CB  1 
ATOM   2347 C  CG  . GLN C 2 60  ? 16.728  5.360   41.331  1.00 74.23  ? 142 GLN C CG  1 
ATOM   2348 C  CD  . GLN C 2 60  ? 17.382  5.099   39.986  1.00 77.27  ? 142 GLN C CD  1 
ATOM   2349 O  OE1 . GLN C 2 60  ? 18.607  5.025   39.878  1.00 76.37  ? 142 GLN C OE1 1 
ATOM   2350 N  NE2 . GLN C 2 60  ? 16.561  4.956   38.951  1.00 80.13  ? 142 GLN C NE2 1 
ATOM   2351 N  N   . SER C 2 61  ? 17.415  7.762   44.189  1.00 63.66  ? 143 SER C N   1 
ATOM   2352 C  CA  . SER C 2 61  ? 17.025  9.149   44.416  1.00 61.07  ? 143 SER C CA  1 
ATOM   2353 C  C   . SER C 2 61  ? 16.614  9.815   43.110  1.00 62.46  ? 143 SER C C   1 
ATOM   2354 O  O   . SER C 2 61  ? 16.931  9.342   42.019  1.00 63.57  ? 143 SER C O   1 
ATOM   2355 C  CB  . SER C 2 61  ? 18.164  9.945   45.032  1.00 56.68  ? 143 SER C CB  1 
ATOM   2356 O  OG  . SER C 2 61  ? 19.153  10.191  44.065  1.00 56.60  ? 143 SER C OG  1 
ATOM   2357 N  N   . LYS C 2 62  ? 15.920  10.951  43.235  1.00 63.02  ? 144 LYS C N   1 
ATOM   2358 C  CA  . LYS C 2 62  ? 15.474  11.674  42.048  1.00 64.60  ? 144 LYS C CA  1 
ATOM   2359 C  C   . LYS C 2 62  ? 16.652  12.135  41.198  1.00 62.31  ? 144 LYS C C   1 
ATOM   2360 O  O   . LYS C 2 62  ? 16.555  12.181  39.965  1.00 63.57  ? 144 LYS C O   1 
ATOM   2361 C  CB  . LYS C 2 62  ? 14.594  12.854  42.457  1.00 68.71  ? 144 LYS C CB  1 
ATOM   2362 C  CG  . LYS C 2 62  ? 13.114  12.484  42.596  1.00 76.63  ? 144 LYS C CG  1 
ATOM   2363 C  CD  . LYS C 2 62  ? 12.291  13.585  43.282  1.00 80.68  ? 144 LYS C CD  1 
ATOM   2364 C  CE  . LYS C 2 62  ? 12.168  14.838  42.413  1.00 82.64  ? 144 LYS C CE  1 
ATOM   2365 N  NZ  . LYS C 2 62  ? 10.752  15.215  42.146  1.00 85.54  ? 144 LYS C NZ  1 
ATOM   2366 N  N   . ALA C 2 63  ? 17.777  12.449  41.831  1.00 58.17  ? 145 ALA C N   1 
ATOM   2367 C  CA  . ALA C 2 63  ? 18.984  12.752  41.076  1.00 57.95  ? 145 ALA C CA  1 
ATOM   2368 C  C   . ALA C 2 63  ? 19.530  11.528  40.351  1.00 60.44  ? 145 ALA C C   1 
ATOM   2369 O  O   . ALA C 2 63  ? 20.090  11.662  39.259  1.00 63.08  ? 145 ALA C O   1 
ATOM   2370 C  CB  . ALA C 2 63  ? 20.048  13.338  42.004  1.00 53.04  ? 145 ALA C CB  1 
ATOM   2371 N  N   . MET C 2 64  ? 19.396  10.336  40.933  1.00 63.76  ? 146 MET C N   1 
ATOM   2372 C  CA  . MET C 2 64  ? 19.952  9.152   40.287  1.00 70.39  ? 146 MET C CA  1 
ATOM   2373 C  C   . MET C 2 64  ? 19.101  8.670   39.127  1.00 73.87  ? 146 MET C C   1 
ATOM   2374 O  O   . MET C 2 64  ? 19.652  8.168   38.145  1.00 75.11  ? 146 MET C O   1 
ATOM   2375 C  CB  . MET C 2 64  ? 20.129  8.017   41.291  1.00 75.81  ? 146 MET C CB  1 
ATOM   2376 C  CG  . MET C 2 64  ? 21.285  8.230   42.241  1.00 78.44  ? 146 MET C CG  1 
ATOM   2377 S  SD  . MET C 2 64  ? 22.703  8.994   41.434  1.00 80.80  ? 146 MET C SD  1 
ATOM   2378 C  CE  . MET C 2 64  ? 23.078  7.767   40.172  1.00 82.41  ? 146 MET C CE  1 
ATOM   2379 N  N   . THR C 2 65  ? 17.774  8.795   39.229  1.00 77.54  ? 147 THR C N   1 
ATOM   2380 C  CA  . THR C 2 65  ? 16.912  8.467   38.100  1.00 86.83  ? 147 THR C CA  1 
ATOM   2381 C  C   . THR C 2 65  ? 17.385  9.156   36.828  1.00 87.18  ? 147 THR C C   1 
ATOM   2382 O  O   . THR C 2 65  ? 17.432  8.541   35.758  1.00 89.90  ? 147 THR C O   1 
ATOM   2383 C  CB  . THR C 2 65  ? 15.459  8.865   38.385  1.00 93.23  ? 147 THR C CB  1 
ATOM   2384 O  OG1 . THR C 2 65  ? 15.271  10.250  38.050  1.00 97.45  ? 147 THR C OG1 1 
ATOM   2385 C  CG2 . THR C 2 65  ? 15.068  8.610   39.834  1.00 90.06  ? 147 THR C CG2 1 
ATOM   2386 N  N   . MET C 2 66  ? 17.757  10.427  36.931  1.00 83.02  ? 148 MET C N   1 
ATOM   2387 C  CA  . MET C 2 66  ? 18.061  11.237  35.764  1.00 82.85  ? 148 MET C CA  1 
ATOM   2388 C  C   . MET C 2 66  ? 19.536  11.226  35.377  1.00 76.90  ? 148 MET C C   1 
ATOM   2389 O  O   . MET C 2 66  ? 19.906  11.876  34.396  1.00 75.85  ? 148 MET C O   1 
ATOM   2390 C  CB  . MET C 2 66  ? 17.598  12.673  36.000  1.00 85.78  ? 148 MET C CB  1 
ATOM   2391 C  CG  . MET C 2 66  ? 18.399  13.418  37.031  1.00 85.57  ? 148 MET C CG  1 
ATOM   2392 S  SD  . MET C 2 66  ? 17.830  15.122  37.154  1.00 89.69  ? 148 MET C SD  1 
ATOM   2393 C  CE  . MET C 2 66  ? 16.205  14.897  37.884  1.00 90.93  ? 148 MET C CE  1 
ATOM   2394 N  N   . LEU C 2 67  ? 20.383  10.495  36.090  1.00 72.60  ? 149 LEU C N   1 
ATOM   2395 C  CA  . LEU C 2 67  ? 21.793  10.402  35.747  1.00 70.26  ? 149 LEU C CA  1 
ATOM   2396 C  C   . LEU C 2 67  ? 22.149  8.971   35.362  1.00 72.15  ? 149 LEU C C   1 
ATOM   2397 O  O   . LEU C 2 67  ? 21.685  8.017   35.996  1.00 74.91  ? 149 LEU C O   1 
ATOM   2398 C  CB  . LEU C 2 67  ? 22.675  10.846  36.916  1.00 66.12  ? 149 LEU C CB  1 
ATOM   2399 C  CG  . LEU C 2 67  ? 22.785  12.319  37.285  1.00 62.55  ? 149 LEU C CG  1 
ATOM   2400 C  CD1 . LEU C 2 67  ? 23.963  12.495  38.212  1.00 60.86  ? 149 LEU C CD1 1 
ATOM   2401 C  CD2 . LEU C 2 67  ? 22.964  13.133  36.043  1.00 64.17  ? 149 LEU C CD2 1 
ATOM   2402 N  N   . THR C 2 68  ? 22.968  8.821   34.319  1.00 70.87  ? 150 THR C N   1 
ATOM   2403 C  CA  . THR C 2 68  ? 23.652  7.557   34.091  1.00 71.55  ? 150 THR C CA  1 
ATOM   2404 C  C   . THR C 2 68  ? 24.917  7.494   34.944  1.00 72.78  ? 150 THR C C   1 
ATOM   2405 O  O   . THR C 2 68  ? 25.369  8.487   35.520  1.00 74.53  ? 150 THR C O   1 
ATOM   2406 C  CB  . THR C 2 68  ? 24.019  7.380   32.622  1.00 71.45  ? 150 THR C CB  1 
ATOM   2407 O  OG1 . THR C 2 68  ? 25.191  8.150   32.327  1.00 71.64  ? 150 THR C OG1 1 
ATOM   2408 C  CG2 . THR C 2 68  ? 22.888  7.829   31.719  1.00 71.04  ? 150 THR C CG2 1 
ATOM   2409 N  N   . ILE C 2 69  ? 25.505  6.306   35.023  1.00 73.18  ? 151 ILE C N   1 
ATOM   2410 C  CA  . ILE C 2 69  ? 26.696  6.150   35.850  1.00 70.60  ? 151 ILE C CA  1 
ATOM   2411 C  C   . ILE C 2 69  ? 27.836  7.020   35.324  1.00 71.15  ? 151 ILE C C   1 
ATOM   2412 O  O   . ILE C 2 69  ? 28.654  7.534   36.104  1.00 71.05  ? 151 ILE C O   1 
ATOM   2413 C  CB  . ILE C 2 69  ? 27.063  4.652   35.930  1.00 71.08  ? 151 ILE C CB  1 
ATOM   2414 C  CG1 . ILE C 2 69  ? 28.007  4.372   37.082  1.00 67.84  ? 151 ILE C CG1 1 
ATOM   2415 C  CG2 . ILE C 2 69  ? 27.633  4.136   34.614  1.00 77.20  ? 151 ILE C CG2 1 
ATOM   2416 C  CD1 . ILE C 2 69  ? 28.078  2.910   37.394  1.00 71.74  ? 151 ILE C CD1 1 
ATOM   2417 N  N   . GLU C 2 70  ? 27.863  7.257   34.011  1.00 73.78  ? 152 GLU C N   1 
ATOM   2418 C  CA  A GLU C 2 70  ? 28.943  8.031   33.413  0.63 75.15  ? 152 GLU C CA  1 
ATOM   2419 C  CA  B GLU C 2 70  ? 28.939  8.033   33.400  0.37 75.14  ? 152 GLU C CA  1 
ATOM   2420 C  C   . GLU C 2 70  ? 28.805  9.513   33.735  1.00 72.84  ? 152 GLU C C   1 
ATOM   2421 O  O   . GLU C 2 70  ? 29.782  10.170  34.136  1.00 73.33  ? 152 GLU C O   1 
ATOM   2422 C  CB  A GLU C 2 70  ? 28.958  7.802   31.904  0.63 79.35  ? 152 GLU C CB  1 
ATOM   2423 C  CB  B GLU C 2 70  ? 28.931  7.828   31.882  0.37 79.26  ? 152 GLU C CB  1 
ATOM   2424 C  CG  A GLU C 2 70  ? 30.143  8.396   31.192  0.63 80.05  ? 152 GLU C CG  1 
ATOM   2425 C  CG  B GLU C 2 70  ? 29.268  6.411   31.419  0.37 82.12  ? 152 GLU C CG  1 
ATOM   2426 C  CD  A GLU C 2 70  ? 29.856  8.606   29.739  0.63 82.90  ? 152 GLU C CD  1 
ATOM   2427 C  CD  B GLU C 2 70  ? 28.100  5.449   31.535  0.37 81.54  ? 152 GLU C CD  1 
ATOM   2428 O  OE1 A GLU C 2 70  ? 30.372  7.833   28.910  0.63 86.20  ? 152 GLU C OE1 1 
ATOM   2429 O  OE1 B GLU C 2 70  ? 26.994  5.892   31.905  0.37 79.55  ? 152 GLU C OE1 1 
ATOM   2430 O  OE2 A GLU C 2 70  ? 29.096  9.541   29.428  0.63 83.85  ? 152 GLU C OE2 1 
ATOM   2431 O  OE2 B GLU C 2 70  ? 28.290  4.247   31.261  0.37 83.17  ? 152 GLU C OE2 1 
ATOM   2432 N  N   . GLN C 2 71  ? 27.603  10.061  33.557  1.00 70.59  ? 153 GLN C N   1 
ATOM   2433 C  CA  . GLN C 2 71  ? 27.353  11.447  33.928  1.00 66.86  ? 153 GLN C CA  1 
ATOM   2434 C  C   . GLN C 2 71  ? 27.720  11.680  35.383  1.00 65.19  ? 153 GLN C C   1 
ATOM   2435 O  O   . GLN C 2 71  ? 28.466  12.617  35.717  1.00 66.45  ? 153 GLN C O   1 
ATOM   2436 C  CB  . GLN C 2 71  ? 25.884  11.791  33.674  1.00 63.22  ? 153 GLN C CB  1 
ATOM   2437 C  CG  . GLN C 2 71  ? 25.471  11.626  32.223  1.00 65.07  ? 153 GLN C CG  1 
ATOM   2438 C  CD  . GLN C 2 71  ? 23.969  11.526  32.033  1.00 67.90  ? 153 GLN C CD  1 
ATOM   2439 O  OE1 . GLN C 2 71  ? 23.258  10.983  32.876  1.00 67.55  ? 153 GLN C OE1 1 
ATOM   2440 N  NE2 . GLN C 2 71  ? 23.481  12.032  30.906  1.00 71.65  ? 153 GLN C NE2 1 
ATOM   2441 N  N   . LEU C 2 72  ? 27.221  10.806  36.264  1.00 61.68  ? 154 LEU C N   1 
ATOM   2442 C  CA  . LEU C 2 72  ? 27.519  10.940  37.681  1.00 57.75  ? 154 LEU C CA  1 
ATOM   2443 C  C   . LEU C 2 72  ? 29.020  10.905  37.920  1.00 59.61  ? 154 LEU C C   1 
ATOM   2444 O  O   . LEU C 2 72  ? 29.534  11.636  38.776  1.00 58.41  ? 154 LEU C O   1 
ATOM   2445 C  CB  . LEU C 2 72  ? 26.815  9.845   38.480  1.00 55.63  ? 154 LEU C CB  1 
ATOM   2446 C  CG  . LEU C 2 72  ? 27.262  9.677   39.940  1.00 53.01  ? 154 LEU C CG  1 
ATOM   2447 C  CD1 . LEU C 2 72  ? 27.036  10.931  40.744  1.00 43.55  ? 154 LEU C CD1 1 
ATOM   2448 C  CD2 . LEU C 2 72  ? 26.543  8.497   40.571  1.00 51.52  ? 154 LEU C CD2 1 
ATOM   2449 N  N   . SER C 2 73  ? 29.747  10.081  37.154  1.00 59.99  ? 155 SER C N   1 
ATOM   2450 C  CA  . SER C 2 73  ? 31.199  10.066  37.296  1.00 59.59  ? 155 SER C CA  1 
ATOM   2451 C  C   . SER C 2 73  ? 31.797  11.435  36.974  1.00 57.29  ? 155 SER C C   1 
ATOM   2452 O  O   . SER C 2 73  ? 32.696  11.906  37.684  1.00 56.58  ? 155 SER C O   1 
ATOM   2453 C  CB  . SER C 2 73  ? 31.798  8.982   36.411  1.00 65.25  ? 155 SER C CB  1 
ATOM   2454 O  OG  . SER C 2 73  ? 31.579  9.298   35.053  1.00 72.01  ? 155 SER C OG  1 
ATOM   2455 N  N   . TYR C 2 74  ? 31.298  12.093  35.918  1.00 56.20  ? 156 TYR C N   1 
ATOM   2456 C  CA  A TYR C 2 74  ? 31.768  13.440  35.593  0.53 56.90  ? 156 TYR C CA  1 
ATOM   2457 C  CA  B TYR C 2 74  ? 31.744  13.449  35.584  0.47 56.90  ? 156 TYR C CA  1 
ATOM   2458 C  C   . TYR C 2 74  ? 31.531  14.408  36.758  1.00 55.02  ? 156 TYR C C   1 
ATOM   2459 O  O   . TYR C 2 74  ? 32.447  15.159  37.166  1.00 54.65  ? 156 TYR C O   1 
ATOM   2460 C  CB  A TYR C 2 74  ? 31.083  13.938  34.312  0.53 59.04  ? 156 TYR C CB  1 
ATOM   2461 C  CB  B TYR C 2 74  ? 30.985  13.922  34.338  0.47 58.95  ? 156 TYR C CB  1 
ATOM   2462 C  CG  A TYR C 2 74  ? 31.383  13.126  33.051  0.53 61.68  ? 156 TYR C CG  1 
ATOM   2463 C  CG  B TYR C 2 74  ? 31.506  15.154  33.625  0.47 58.44  ? 156 TYR C CG  1 
ATOM   2464 C  CD1 A TYR C 2 74  ? 32.414  12.188  33.022  0.53 62.15  ? 156 TYR C CD1 1 
ATOM   2465 C  CD1 B TYR C 2 74  ? 32.823  15.241  33.195  0.47 58.65  ? 156 TYR C CD1 1 
ATOM   2466 C  CD2 A TYR C 2 74  ? 30.630  13.303  31.895  0.53 59.05  ? 156 TYR C CD2 1 
ATOM   2467 C  CD2 B TYR C 2 74  ? 30.653  16.216  33.338  0.47 57.14  ? 156 TYR C CD2 1 
ATOM   2468 C  CE1 A TYR C 2 74  ? 32.677  11.459  31.891  0.53 61.08  ? 156 TYR C CE1 1 
ATOM   2469 C  CE1 B TYR C 2 74  ? 33.278  16.370  32.525  0.47 59.69  ? 156 TYR C CE1 1 
ATOM   2470 C  CE2 A TYR C 2 74  ? 30.885  12.578  30.761  0.53 62.33  ? 156 TYR C CE2 1 
ATOM   2471 C  CE2 B TYR C 2 74  ? 31.096  17.336  32.668  0.47 55.36  ? 156 TYR C CE2 1 
ATOM   2472 C  CZ  A TYR C 2 74  ? 31.913  11.660  30.761  0.53 64.95  ? 156 TYR C CZ  1 
ATOM   2473 C  CZ  B TYR C 2 74  ? 32.402  17.411  32.268  0.47 58.40  ? 156 TYR C CZ  1 
ATOM   2474 O  OH  A TYR C 2 74  ? 32.181  10.939  29.619  0.53 68.93  ? 156 TYR C OH  1 
ATOM   2475 O  OH  B TYR C 2 74  ? 32.828  18.535  31.616  0.47 57.84  ? 156 TYR C OH  1 
ATOM   2476 N  N   . LEU C 2 75  ? 30.316  14.394  37.329  1.00 53.94  ? 157 LEU C N   1 
ATOM   2477 C  CA  . LEU C 2 75  ? 30.057  15.230  38.501  1.00 49.92  ? 157 LEU C CA  1 
ATOM   2478 C  C   . LEU C 2 75  ? 31.010  14.890  39.640  1.00 48.97  ? 157 LEU C C   1 
ATOM   2479 O  O   . LEU C 2 75  ? 31.508  15.787  40.336  1.00 51.42  ? 157 LEU C O   1 
ATOM   2480 C  CB  . LEU C 2 75  ? 28.607  15.077  38.950  1.00 48.51  ? 157 LEU C CB  1 
ATOM   2481 C  CG  . LEU C 2 75  ? 27.550  15.355  37.876  1.00 51.70  ? 157 LEU C CG  1 
ATOM   2482 C  CD1 . LEU C 2 75  ? 26.126  15.477  38.465  1.00 51.81  ? 157 LEU C CD1 1 
ATOM   2483 C  CD2 . LEU C 2 75  ? 27.910  16.582  37.055  1.00 50.25  ? 157 LEU C CD2 1 
ATOM   2484 N  N   . LEU C 2 76  ? 31.303  13.602  39.829  1.00 47.86  ? 158 LEU C N   1 
ATOM   2485 C  CA  . LEU C 2 76  ? 32.222  13.209  40.895  1.00 49.63  ? 158 LEU C CA  1 
ATOM   2486 C  C   . LEU C 2 76  ? 33.617  13.786  40.676  1.00 52.32  ? 158 LEU C C   1 
ATOM   2487 O  O   . LEU C 2 76  ? 34.252  14.250  41.632  1.00 49.94  ? 158 LEU C O   1 
ATOM   2488 C  CB  . LEU C 2 76  ? 32.282  11.687  41.021  1.00 49.37  ? 158 LEU C CB  1 
ATOM   2489 C  CG  . LEU C 2 76  ? 30.971  11.077  41.505  1.00 49.01  ? 158 LEU C CG  1 
ATOM   2490 C  CD1 . LEU C 2 76  ? 31.078  9.552   41.644  1.00 48.47  ? 158 LEU C CD1 1 
ATOM   2491 C  CD2 . LEU C 2 76  ? 30.486  11.771  42.806  1.00 44.96  ? 158 LEU C CD2 1 
ATOM   2492 N  N   . LYS C 2 77  ? 34.109  13.777  39.427  1.00 53.10  ? 159 LYS C N   1 
ATOM   2493 C  CA  . LYS C 2 77  ? 35.385  14.435  39.136  1.00 54.09  ? 159 LYS C CA  1 
ATOM   2494 C  C   . LYS C 2 77  ? 35.371  15.879  39.626  1.00 55.17  ? 159 LYS C C   1 
ATOM   2495 O  O   . LYS C 2 77  ? 36.304  16.326  40.316  1.00 58.72  ? 159 LYS C O   1 
ATOM   2496 C  CB  . LYS C 2 77  ? 35.706  14.372  37.639  1.00 54.61  ? 159 LYS C CB  1 
ATOM   2497 N  N   . PHE C 2 78  ? 34.294  16.616  39.322  1.00 53.08  ? 160 PHE C N   1 
ATOM   2498 C  CA  . PHE C 2 78  ? 34.204  17.984  39.853  1.00 54.63  ? 160 PHE C CA  1 
ATOM   2499 C  C   . PHE C 2 78  ? 34.299  18.017  41.379  1.00 53.89  ? 160 PHE C C   1 
ATOM   2500 O  O   . PHE C 2 78  ? 34.942  18.914  41.959  1.00 53.55  ? 160 PHE C O   1 
ATOM   2501 C  CB  . PHE C 2 78  ? 32.905  18.637  39.412  1.00 54.97  ? 160 PHE C CB  1 
ATOM   2502 C  CG  . PHE C 2 78  ? 32.920  19.094  38.001  1.00 58.36  ? 160 PHE C CG  1 
ATOM   2503 C  CD1 . PHE C 2 78  ? 33.854  20.025  37.580  1.00 59.88  ? 160 PHE C CD1 1 
ATOM   2504 C  CD2 . PHE C 2 78  ? 31.993  18.612  37.095  1.00 59.62  ? 160 PHE C CD2 1 
ATOM   2505 C  CE1 . PHE C 2 78  ? 33.873  20.471  36.281  1.00 60.73  ? 160 PHE C CE1 1 
ATOM   2506 C  CE2 . PHE C 2 78  ? 31.999  19.051  35.798  1.00 62.00  ? 160 PHE C CE2 1 
ATOM   2507 C  CZ  . PHE C 2 78  ? 32.946  19.986  35.391  1.00 63.38  ? 160 PHE C CZ  1 
ATOM   2508 N  N   . ALA C 2 79  ? 33.650  17.053  42.046  1.00 51.62  ? 161 ALA C N   1 
ATOM   2509 C  CA  . ALA C 2 79  ? 33.675  17.021  43.506  1.00 51.04  ? 161 ALA C CA  1 
ATOM   2510 C  C   . ALA C 2 79  ? 35.081  16.719  44.043  1.00 51.36  ? 161 ALA C C   1 
ATOM   2511 O  O   . ALA C 2 79  ? 35.507  17.292  45.058  1.00 46.15  ? 161 ALA C O   1 
ATOM   2512 C  CB  . ALA C 2 79  ? 32.655  15.996  44.008  1.00 48.09  ? 161 ALA C CB  1 
ATOM   2513 N  N   . ILE C 2 80  ? 35.810  15.814  43.388  1.00 51.77  ? 162 ILE C N   1 
ATOM   2514 C  CA  . ILE C 2 80  ? 37.188  15.561  43.782  1.00 54.55  ? 162 ILE C CA  1 
ATOM   2515 C  C   . ILE C 2 80  ? 37.983  16.849  43.708  1.00 55.78  ? 162 ILE C C   1 
ATOM   2516 O  O   . ILE C 2 80  ? 38.751  17.184  44.619  1.00 53.46  ? 162 ILE C O   1 
ATOM   2517 C  CB  . ILE C 2 80  ? 37.814  14.475  42.894  1.00 59.26  ? 162 ILE C CB  1 
ATOM   2518 C  CG1 . ILE C 2 80  ? 37.452  13.101  43.410  1.00 61.66  ? 162 ILE C CG1 1 
ATOM   2519 C  CG2 . ILE C 2 80  ? 39.315  14.599  42.921  1.00 62.55  ? 162 ILE C CG2 1 
ATOM   2520 C  CD1 . ILE C 2 80  ? 38.070  12.840  44.764  1.00 65.43  ? 162 ILE C CD1 1 
ATOM   2521 N  N   . GLN C 2 81  ? 37.804  17.598  42.618  1.00 59.70  ? 163 GLN C N   1 
ATOM   2522 C  CA  . GLN C 2 81  ? 38.509  18.871  42.504  1.00 62.58  ? 163 GLN C CA  1 
ATOM   2523 C  C   . GLN C 2 81  ? 38.187  19.797  43.674  1.00 56.80  ? 163 GLN C C   1 
ATOM   2524 O  O   . GLN C 2 81  ? 39.093  20.430  44.228  1.00 56.64  ? 163 GLN C O   1 
ATOM   2525 C  CB  . GLN C 2 81  ? 38.184  19.541  41.173  1.00 70.40  ? 163 GLN C CB  1 
ATOM   2526 C  CG  . GLN C 2 81  ? 38.566  18.709  39.960  1.00 78.76  ? 163 GLN C CG  1 
ATOM   2527 C  CD  . GLN C 2 81  ? 40.054  18.750  39.665  1.00 85.51  ? 163 GLN C CD  1 
ATOM   2528 O  OE1 . GLN C 2 81  ? 40.887  18.684  40.569  1.00 86.72  ? 163 GLN C OE1 1 
ATOM   2529 N  NE2 . GLN C 2 81  ? 40.394  18.891  38.386  1.00 89.69  ? 163 GLN C NE2 1 
ATOM   2530 N  N   . LYS C 2 82  ? 36.912  19.863  44.094  1.00 53.75  ? 164 LYS C N   1 
ATOM   2531 C  CA  . LYS C 2 82  ? 36.602  20.712  45.247  1.00 56.06  ? 164 LYS C CA  1 
ATOM   2532 C  C   . LYS C 2 82  ? 37.192  20.164  46.544  1.00 57.64  ? 164 LYS C C   1 
ATOM   2533 O  O   . LYS C 2 82  ? 37.443  20.933  47.483  1.00 60.56  ? 164 LYS C O   1 
ATOM   2534 C  CB  . LYS C 2 82  ? 35.099  20.910  45.388  1.00 60.51  ? 164 LYS C CB  1 
ATOM   2535 C  CG  . LYS C 2 82  ? 34.589  22.131  44.602  1.00 66.40  ? 164 LYS C CG  1 
ATOM   2536 C  CD  . LYS C 2 82  ? 33.409  21.823  43.672  1.00 67.30  ? 164 LYS C CD  1 
ATOM   2537 C  CE  . LYS C 2 82  ? 32.560  23.050  43.420  1.00 67.92  ? 164 LYS C CE  1 
ATOM   2538 N  NZ  . LYS C 2 82  ? 33.386  24.262  43.145  1.00 76.28  ? 164 LYS C NZ  1 
ATOM   2539 N  N   . MET C 2 83  ? 37.452  18.856  46.616  1.00 56.61  ? 165 MET C N   1 
ATOM   2540 C  CA  . MET C 2 83  ? 38.048  18.319  47.836  1.00 55.08  ? 165 MET C CA  1 
ATOM   2541 C  C   . MET C 2 83  ? 39.536  18.655  47.954  1.00 58.70  ? 165 MET C C   1 
ATOM   2542 O  O   . MET C 2 83  ? 40.039  18.789  49.076  1.00 59.39  ? 165 MET C O   1 
ATOM   2543 C  CB  . MET C 2 83  ? 37.829  16.809  47.917  1.00 53.62  ? 165 MET C CB  1 
ATOM   2544 C  CG  . MET C 2 83  ? 36.381  16.403  48.128  1.00 52.45  ? 165 MET C CG  1 
ATOM   2545 S  SD  . MET C 2 83  ? 36.023  14.694  47.651  1.00 55.63  ? 165 MET C SD  1 
ATOM   2546 C  CE  . MET C 2 83  ? 36.671  13.799  49.074  1.00 51.85  ? 165 MET C CE  1 
ATOM   2547 N  N   . LYS C 2 84  ? 40.264  18.800  46.838  1.00 59.58  ? 166 LYS C N   1 
ATOM   2548 C  CA  . LYS C 2 84  ? 41.699  19.098  46.907  1.00 59.30  ? 166 LYS C CA  1 
ATOM   2549 C  C   . LYS C 2 84  ? 41.958  20.581  47.185  1.00 58.02  ? 166 LYS C C   1 
ATOM   2550 O  O   . LYS C 2 84  ? 42.588  21.289  46.413  1.00 57.21  ? 166 LYS C O   1 
ATOM   2551 C  CB  . LYS C 2 84  ? 42.422  18.655  45.645  1.00 62.26  ? 166 LYS C CB  1 
ATOM   2552 C  CG  . LYS C 2 84  ? 42.380  17.184  45.419  1.00 65.79  ? 166 LYS C CG  1 
ATOM   2553 C  CD  . LYS C 2 84  ? 43.007  16.780  44.097  1.00 68.89  ? 166 LYS C CD  1 
ATOM   2554 C  CE  . LYS C 2 84  ? 42.641  17.702  42.955  1.00 70.93  ? 166 LYS C CE  1 
ATOM   2555 N  NZ  . LYS C 2 84  ? 43.206  17.185  41.663  1.00 75.94  ? 166 LYS C NZ  1 
ATOM   2556 N  N   . GLN C 2 85  ? 41.453  21.044  48.319  1.00 59.47  ? 167 GLN C N   1 
ATOM   2557 C  CA  . GLN C 2 85  ? 41.729  22.399  48.753  1.00 57.41  ? 167 GLN C CA  1 
ATOM   2558 C  C   . GLN C 2 85  ? 43.209  22.557  49.085  1.00 63.11  ? 167 GLN C C   1 
ATOM   2559 O  O   . GLN C 2 85  ? 43.891  21.576  49.395  1.00 65.53  ? 167 GLN C O   1 
ATOM   2560 C  CB  . GLN C 2 85  ? 40.880  22.732  49.971  1.00 52.52  ? 167 GLN C CB  1 
ATOM   2561 C  CG  . GLN C 2 85  ? 39.457  22.980  49.614  1.00 52.50  ? 167 GLN C CG  1 
ATOM   2562 C  CD  . GLN C 2 85  ? 39.321  24.067  48.574  1.00 56.57  ? 167 GLN C CD  1 
ATOM   2563 O  OE1 . GLN C 2 85  ? 40.048  25.065  48.599  1.00 59.09  ? 167 GLN C OE1 1 
ATOM   2564 N  NE2 . GLN C 2 85  ? 38.378  23.889  47.652  1.00 57.14  ? 167 GLN C NE2 1 
ATOM   2565 N  N   . PRO C 2 86  ? 43.735  23.781  49.021  1.00 68.24  ? 168 PRO C N   1 
ATOM   2566 C  CA  . PRO C 2 86  ? 45.119  24.007  49.468  1.00 69.16  ? 168 PRO C CA  1 
ATOM   2567 C  C   . PRO C 2 86  ? 45.268  23.700  50.951  1.00 65.73  ? 168 PRO C C   1 
ATOM   2568 O  O   . PRO C 2 86  ? 44.581  24.281  51.796  1.00 59.57  ? 168 PRO C O   1 
ATOM   2569 C  CB  . PRO C 2 86  ? 45.356  25.489  49.157  1.00 70.93  ? 168 PRO C CB  1 
ATOM   2570 C  CG  . PRO C 2 86  ? 43.999  26.068  48.892  1.00 69.80  ? 168 PRO C CG  1 
ATOM   2571 C  CD  . PRO C 2 86  ? 43.182  24.959  48.328  1.00 69.04  ? 168 PRO C CD  1 
ATOM   2572 N  N   . GLY C 2 87  ? 46.182  22.775  51.252  1.00 67.35  ? 169 GLY C N   1 
ATOM   2573 C  CA  . GLY C 2 87  ? 46.399  22.237  52.587  1.00 65.06  ? 169 GLY C CA  1 
ATOM   2574 C  C   . GLY C 2 87  ? 46.207  20.735  52.686  1.00 62.94  ? 169 GLY C C   1 
ATOM   2575 O  O   . GLY C 2 87  ? 46.449  20.154  53.758  1.00 59.02  ? 169 GLY C O   1 
ATOM   2576 N  N   . THR C 2 88  ? 45.794  20.084  51.599  1.00 64.10  ? 170 THR C N   1 
ATOM   2577 C  CA  . THR C 2 88  ? 45.361  18.694  51.623  1.00 63.03  ? 170 THR C CA  1 
ATOM   2578 C  C   . THR C 2 88  ? 46.395  17.759  51.008  1.00 67.63  ? 170 THR C C   1 
ATOM   2579 O  O   . THR C 2 88  ? 46.045  16.647  50.598  1.00 70.86  ? 170 THR C O   1 
ATOM   2580 C  CB  . THR C 2 88  ? 44.007  18.547  50.911  1.00 57.51  ? 170 THR C CB  1 
ATOM   2581 O  OG1 . THR C 2 88  ? 44.118  18.960  49.547  1.00 52.52  ? 170 THR C OG1 1 
ATOM   2582 C  CG2 . THR C 2 88  ? 42.953  19.412  51.582  1.00 55.70  ? 170 THR C CG2 1 
ATOM   2583 N  N   . ASP C 2 89  ? 47.666  18.182  50.967  1.00 68.24  ? 171 ASP C N   1 
ATOM   2584 C  CA  . ASP C 2 89  ? 48.707  17.435  50.260  1.00 68.74  ? 171 ASP C CA  1 
ATOM   2585 C  C   . ASP C 2 89  ? 48.875  16.023  50.816  1.00 66.08  ? 171 ASP C C   1 
ATOM   2586 O  O   . ASP C 2 89  ? 49.108  15.074  50.059  1.00 67.18  ? 171 ASP C O   1 
ATOM   2587 C  CB  . ASP C 2 89  ? 50.033  18.193  50.339  1.00 76.35  ? 171 ASP C CB  1 
ATOM   2588 C  CG  . ASP C 2 89  ? 49.885  19.686  50.032  1.00 81.95  ? 171 ASP C CG  1 
ATOM   2589 O  OD1 . ASP C 2 89  ? 49.206  20.412  50.806  1.00 82.29  ? 171 ASP C OD1 1 
ATOM   2590 O  OD2 . ASP C 2 89  ? 50.464  20.138  49.018  1.00 84.06  ? 171 ASP C OD2 1 
ATOM   2591 N  N   . ALA C 2 90  ? 48.748  15.858  52.133  1.00 62.29  ? 172 ALA C N   1 
ATOM   2592 C  CA  . ALA C 2 90  ? 48.947  14.548  52.744  1.00 64.09  ? 172 ALA C CA  1 
ATOM   2593 C  C   . ALA C 2 90  ? 47.962  13.483  52.259  1.00 63.69  ? 172 ALA C C   1 
ATOM   2594 O  O   . ALA C 2 90  ? 48.178  12.293  52.532  1.00 65.03  ? 172 ALA C O   1 
ATOM   2595 C  CB  . ALA C 2 90  ? 48.859  14.663  54.271  1.00 63.78  ? 172 ALA C CB  1 
ATOM   2596 N  N   . PHE C 2 91  ? 46.895  13.860  51.557  1.00 61.05  ? 173 PHE C N   1 
ATOM   2597 C  CA  . PHE C 2 91  ? 45.896  12.895  51.127  1.00 60.64  ? 173 PHE C CA  1 
ATOM   2598 C  C   . PHE C 2 91  ? 45.752  12.797  49.615  1.00 65.55  ? 173 PHE C C   1 
ATOM   2599 O  O   . PHE C 2 91  ? 44.873  12.068  49.137  1.00 66.08  ? 173 PHE C O   1 
ATOM   2600 C  CB  . PHE C 2 91  ? 44.535  13.229  51.751  1.00 54.17  ? 173 PHE C CB  1 
ATOM   2601 C  CG  . PHE C 2 91  ? 44.605  13.494  53.203  1.00 52.42  ? 173 PHE C CG  1 
ATOM   2602 C  CD1 . PHE C 2 91  ? 44.851  12.468  54.090  1.00 52.01  ? 173 PHE C CD1 1 
ATOM   2603 C  CD2 . PHE C 2 91  ? 44.454  14.779  53.691  1.00 54.30  ? 173 PHE C CD2 1 
ATOM   2604 C  CE1 . PHE C 2 91  ? 44.924  12.704  55.458  1.00 52.07  ? 173 PHE C CE1 1 
ATOM   2605 C  CE2 . PHE C 2 91  ? 44.526  15.032  55.054  1.00 54.32  ? 173 PHE C CE2 1 
ATOM   2606 C  CZ  . PHE C 2 91  ? 44.769  13.985  55.940  1.00 53.67  ? 173 PHE C CZ  1 
ATOM   2607 N  N   . GLN C 2 92  ? 46.591  13.483  48.846  1.00 68.74  ? 174 GLN C N   1 
ATOM   2608 C  CA  . GLN C 2 92  ? 46.385  13.497  47.409  1.00 70.59  ? 174 GLN C CA  1 
ATOM   2609 C  C   . GLN C 2 92  ? 46.971  12.277  46.713  1.00 74.21  ? 174 GLN C C   1 
ATOM   2610 O  O   . GLN C 2 92  ? 46.484  11.914  45.641  1.00 77.10  ? 174 GLN C O   1 
ATOM   2611 C  CB  . GLN C 2 92  ? 46.953  14.789  46.824  1.00 72.77  ? 174 GLN C CB  1 
ATOM   2612 C  CG  . GLN C 2 92  ? 46.369  16.026  47.510  1.00 72.59  ? 174 GLN C CG  1 
ATOM   2613 C  CD  . GLN C 2 92  ? 46.502  17.296  46.696  1.00 74.08  ? 174 GLN C CD  1 
ATOM   2614 O  OE1 . GLN C 2 92  ? 46.969  17.271  45.557  1.00 79.43  ? 174 GLN C OE1 1 
ATOM   2615 N  NE2 . GLN C 2 92  ? 46.078  18.414  47.274  1.00 69.64  ? 174 GLN C NE2 1 
ATOM   2616 N  N   . LYS C 2 93  ? 47.972  11.623  47.298  1.00 75.17  ? 175 LYS C N   1 
ATOM   2617 C  CA  . LYS C 2 93  ? 48.623  10.459  46.709  1.00 73.68  ? 175 LYS C CA  1 
ATOM   2618 C  C   . LYS C 2 93  ? 48.810  9.392   47.777  1.00 72.37  ? 175 LYS C C   1 
ATOM   2619 O  O   . LYS C 2 93  ? 48.947  9.720   48.958  1.00 75.34  ? 175 LYS C O   1 
ATOM   2620 C  CB  . LYS C 2 93  ? 49.985  10.831  46.097  1.00 75.20  ? 175 LYS C CB  1 
ATOM   2621 N  N   . PRO C 2 94  ? 48.795  8.111   47.399  1.00 70.48  ? 176 PRO C N   1 
ATOM   2622 C  CA  . PRO C 2 94  ? 48.899  7.036   48.404  1.00 69.79  ? 176 PRO C CA  1 
ATOM   2623 C  C   . PRO C 2 94  ? 50.132  7.185   49.285  1.00 74.44  ? 176 PRO C C   1 
ATOM   2624 O  O   . PRO C 2 94  ? 51.182  7.655   48.839  1.00 79.77  ? 176 PRO C O   1 
ATOM   2625 C  CB  . PRO C 2 94  ? 48.971  5.762   47.556  1.00 67.81  ? 176 PRO C CB  1 
ATOM   2626 C  CG  . PRO C 2 94  ? 48.280  6.111   46.288  1.00 67.19  ? 176 PRO C CG  1 
ATOM   2627 C  CD  . PRO C 2 94  ? 48.559  7.582   46.044  1.00 69.67  ? 176 PRO C CD  1 
ATOM   2628 N  N   . VAL C 2 95  ? 49.992  6.791   50.547  1.00 73.25  ? 177 VAL C N   1 
ATOM   2629 C  CA  . VAL C 2 95  ? 51.097  6.955   51.502  1.00 73.52  ? 177 VAL C CA  1 
ATOM   2630 C  C   . VAL C 2 95  ? 52.232  6.025   51.115  1.00 76.28  ? 177 VAL C C   1 
ATOM   2631 O  O   . VAL C 2 95  ? 52.001  4.818   50.950  1.00 75.67  ? 177 VAL C O   1 
ATOM   2632 C  CB  . VAL C 2 95  ? 50.636  6.662   52.925  1.00 71.32  ? 177 VAL C CB  1 
ATOM   2633 C  CG1 . VAL C 2 95  ? 51.716  7.107   53.894  1.00 73.62  ? 177 VAL C CG1 1 
ATOM   2634 C  CG2 . VAL C 2 95  ? 49.312  7.351   53.229  1.00 65.09  ? 177 VAL C CG2 1 
ATOM   2635 N  N   . PRO C 2 96  ? 53.460  6.521   50.975  1.00 83.16  ? 178 PRO C N   1 
ATOM   2636 C  CA  . PRO C 2 96  ? 54.565  5.644   50.569  1.00 89.59  ? 178 PRO C CA  1 
ATOM   2637 C  C   . PRO C 2 96  ? 55.065  4.799   51.731  1.00 93.25  ? 178 PRO C C   1 
ATOM   2638 O  O   . PRO C 2 96  ? 55.137  5.257   52.875  1.00 93.62  ? 178 PRO C O   1 
ATOM   2639 C  CB  . PRO C 2 96  ? 55.645  6.630   50.095  1.00 91.34  ? 178 PRO C CB  1 
ATOM   2640 C  CG  . PRO C 2 96  ? 54.979  8.009   50.091  1.00 86.73  ? 178 PRO C CG  1 
ATOM   2641 C  CD  . PRO C 2 96  ? 53.896  7.919   51.108  1.00 82.25  ? 178 PRO C CD  1 
ATOM   2642 N  N   . LEU C 2 97  ? 55.414  3.546   51.432  1.00 96.02  ? 179 LEU C N   1 
ATOM   2643 C  CA  . LEU C 2 97  ? 56.051  2.723   52.455  1.00 99.41  ? 179 LEU C CA  1 
ATOM   2644 C  C   . LEU C 2 97  ? 57.438  3.233   52.815  1.00 102.56 ? 179 LEU C C   1 
ATOM   2645 O  O   . LEU C 2 97  ? 57.922  2.942   53.915  1.00 101.62 ? 179 LEU C O   1 
ATOM   2646 C  CB  . LEU C 2 97  ? 56.145  1.268   52.005  1.00 104.42 ? 179 LEU C CB  1 
ATOM   2647 C  CG  . LEU C 2 97  ? 54.821  0.599   51.645  1.00 103.51 ? 179 LEU C CG  1 
ATOM   2648 C  CD1 . LEU C 2 97  ? 54.981  -0.194  50.339  1.00 107.27 ? 179 LEU C CD1 1 
ATOM   2649 C  CD2 . LEU C 2 97  ? 54.296  -0.272  52.794  1.00 101.00 ? 179 LEU C CD2 1 
ATOM   2650 N  N   . GLU C 2 98  ? 58.086  3.980   51.913  1.00 106.26 ? 180 GLU C N   1 
ATOM   2651 C  CA  . GLU C 2 98  ? 59.375  4.580   52.239  1.00 110.06 ? 180 GLU C CA  1 
ATOM   2652 C  C   . GLU C 2 98  ? 59.233  5.628   53.336  1.00 107.36 ? 180 GLU C C   1 
ATOM   2653 O  O   . GLU C 2 98  ? 60.122  5.765   54.182  1.00 109.35 ? 180 GLU C O   1 
ATOM   2654 C  CB  . GLU C 2 98  ? 60.012  5.190   50.985  1.00 111.16 ? 180 GLU C CB  1 
ATOM   2655 N  N   . GLN C 2 99  ? 58.123  6.360   53.352  1.00 104.44 ? 181 GLN C N   1 
ATOM   2656 C  CA  . GLN C 2 99  ? 57.909  7.330   54.419  1.00 105.86 ? 181 GLN C CA  1 
ATOM   2657 C  C   . GLN C 2 99  ? 57.390  6.677   55.701  1.00 106.98 ? 181 GLN C C   1 
ATOM   2658 O  O   . GLN C 2 99  ? 57.744  7.122   56.797  1.00 107.97 ? 181 GLN C O   1 
ATOM   2659 C  CB  . GLN C 2 99  ? 56.948  8.426   53.948  1.00 99.36  ? 181 GLN C CB  1 
ATOM   2660 N  N   . HIS C 2 100 ? 56.559  5.638   55.597  1.00 106.23 ? 182 HIS C N   1 
ATOM   2661 C  CA  . HIS C 2 100 ? 55.984  4.979   56.770  1.00 105.35 ? 182 HIS C CA  1 
ATOM   2662 C  C   . HIS C 2 100 ? 55.992  3.473   56.547  1.00 106.41 ? 182 HIS C C   1 
ATOM   2663 O  O   . HIS C 2 100 ? 55.017  2.901   56.044  1.00 106.06 ? 182 HIS C O   1 
ATOM   2664 C  CB  . HIS C 2 100 ? 54.563  5.472   57.050  1.00 105.47 ? 182 HIS C CB  1 
ATOM   2665 C  CG  . HIS C 2 100 ? 54.432  6.965   57.111  1.00 108.90 ? 182 HIS C CG  1 
ATOM   2666 N  ND1 . HIS C 2 100 ? 54.214  7.646   58.291  1.00 108.23 ? 182 HIS C ND1 1 
ATOM   2667 C  CD2 . HIS C 2 100 ? 54.464  7.906   56.134  1.00 109.98 ? 182 HIS C CD2 1 
ATOM   2668 C  CE1 . HIS C 2 100 ? 54.128  8.941   58.039  1.00 107.89 ? 182 HIS C CE1 1 
ATOM   2669 N  NE2 . HIS C 2 100 ? 54.282  9.126   56.738  1.00 108.54 ? 182 HIS C NE2 1 
ATOM   2670 N  N   . PRO C 2 101 ? 57.082  2.791   56.916  1.00 106.52 ? 183 PRO C N   1 
ATOM   2671 C  CA  . PRO C 2 101 ? 57.176  1.354   56.604  1.00 104.93 ? 183 PRO C CA  1 
ATOM   2672 C  C   . PRO C 2 101 ? 56.164  0.504   57.342  1.00 98.13  ? 183 PRO C C   1 
ATOM   2673 O  O   . PRO C 2 101 ? 55.792  -0.565  56.847  1.00 97.28  ? 183 PRO C O   1 
ATOM   2674 C  CB  . PRO C 2 101 ? 58.612  0.998   57.009  1.00 108.57 ? 183 PRO C CB  1 
ATOM   2675 C  CG  . PRO C 2 101 ? 58.988  2.024   58.010  1.00 109.85 ? 183 PRO C CG  1 
ATOM   2676 C  CD  . PRO C 2 101 ? 58.293  3.289   57.588  1.00 108.96 ? 183 PRO C CD  1 
ATOM   2677 N  N   . ASP C 2 102 ? 55.697  0.939   58.501  1.00 94.67  ? 184 ASP C N   1 
ATOM   2678 C  CA  . ASP C 2 102 ? 54.746  0.138   59.255  1.00 93.57  ? 184 ASP C CA  1 
ATOM   2679 C  C   . ASP C 2 102 ? 53.298  0.363   58.819  1.00 88.91  ? 184 ASP C C   1 
ATOM   2680 O  O   . ASP C 2 102 ? 52.388  -0.193  59.451  1.00 88.07  ? 184 ASP C O   1 
ATOM   2681 C  CB  . ASP C 2 102 ? 54.899  0.428   60.750  1.00 96.04  ? 184 ASP C CB  1 
ATOM   2682 C  CG  . ASP C 2 102 ? 54.514  1.855   61.110  1.00 97.29  ? 184 ASP C CG  1 
ATOM   2683 O  OD1 . ASP C 2 102 ? 54.614  2.742   60.228  1.00 98.01  ? 184 ASP C OD1 1 
ATOM   2684 O  OD2 . ASP C 2 102 ? 54.108  2.089   62.273  1.00 96.18  ? 184 ASP C OD2 1 
ATOM   2685 N  N   . TYR C 2 103 ? 53.067  1.136   57.752  1.00 84.54  ? 185 TYR C N   1 
ATOM   2686 C  CA  . TYR C 2 103 ? 51.713  1.594   57.439  1.00 81.02  ? 185 TYR C CA  1 
ATOM   2687 C  C   . TYR C 2 103 ? 50.759  0.423   57.230  1.00 81.04  ? 185 TYR C C   1 
ATOM   2688 O  O   . TYR C 2 103 ? 49.666  0.380   57.815  1.00 78.94  ? 185 TYR C O   1 
ATOM   2689 C  CB  . TYR C 2 103 ? 51.733  2.494   56.204  1.00 80.73  ? 185 TYR C CB  1 
ATOM   2690 C  CG  . TYR C 2 103 ? 50.481  3.339   56.028  1.00 76.94  ? 185 TYR C CG  1 
ATOM   2691 C  CD1 . TYR C 2 103 ? 50.293  4.505   56.758  1.00 74.18  ? 185 TYR C CD1 1 
ATOM   2692 C  CD2 . TYR C 2 103 ? 49.502  2.983   55.108  1.00 76.44  ? 185 TYR C CD2 1 
ATOM   2693 C  CE1 . TYR C 2 103 ? 49.146  5.282   56.591  1.00 72.34  ? 185 TYR C CE1 1 
ATOM   2694 C  CE2 . TYR C 2 103 ? 48.349  3.757   54.932  1.00 72.38  ? 185 TYR C CE2 1 
ATOM   2695 C  CZ  . TYR C 2 103 ? 48.173  4.904   55.674  1.00 70.22  ? 185 TYR C CZ  1 
ATOM   2696 O  OH  . TYR C 2 103 ? 47.026  5.668   55.502  1.00 65.33  ? 185 TYR C OH  1 
ATOM   2697 N  N   . ALA C 2 104 ? 51.168  -0.549  56.412  1.00 82.03  ? 186 ALA C N   1 
ATOM   2698 C  CA  . ALA C 2 104 ? 50.307  -1.682  56.107  1.00 77.48  ? 186 ALA C CA  1 
ATOM   2699 C  C   . ALA C 2 104 ? 49.941  -2.478  57.352  1.00 76.21  ? 186 ALA C C   1 
ATOM   2700 O  O   . ALA C 2 104 ? 48.942  -3.207  57.334  1.00 74.84  ? 186 ALA C O   1 
ATOM   2701 C  CB  . ALA C 2 104 ? 50.987  -2.579  55.070  1.00 81.20  ? 186 ALA C CB  1 
ATOM   2702 N  N   . GLU C 2 105 ? 50.712  -2.340  58.438  1.00 76.07  ? 187 GLU C N   1 
ATOM   2703 C  CA  . GLU C 2 105 ? 50.400  -3.057  59.668  1.00 76.87  ? 187 GLU C CA  1 
ATOM   2704 C  C   . GLU C 2 105 ? 49.161  -2.509  60.366  1.00 71.78  ? 187 GLU C C   1 
ATOM   2705 O  O   . GLU C 2 105 ? 48.603  -3.197  61.228  1.00 69.66  ? 187 GLU C O   1 
ATOM   2706 C  CB  . GLU C 2 105 ? 51.598  -3.019  60.620  1.00 81.65  ? 187 GLU C CB  1 
ATOM   2707 N  N   . TYR C 2 106 ? 48.709  -1.298  60.007  1.00 69.72  ? 188 TYR C N   1 
ATOM   2708 C  CA  . TYR C 2 106 ? 47.521  -0.693  60.603  1.00 64.13  ? 188 TYR C CA  1 
ATOM   2709 C  C   . TYR C 2 106 ? 46.385  -0.436  59.619  1.00 59.22  ? 188 TYR C C   1 
ATOM   2710 O  O   . TYR C 2 106 ? 45.219  -0.468  60.027  1.00 55.98  ? 188 TYR C O   1 
ATOM   2711 C  CB  . TYR C 2 106 ? 47.865  0.646   61.278  1.00 65.83  ? 188 TYR C CB  1 
ATOM   2712 C  CG  . TYR C 2 106 ? 48.844  0.550   62.414  1.00 68.24  ? 188 TYR C CG  1 
ATOM   2713 C  CD1 . TYR C 2 106 ? 48.431  0.188   63.684  1.00 67.66  ? 188 TYR C CD1 1 
ATOM   2714 C  CD2 . TYR C 2 106 ? 50.185  0.833   62.214  1.00 73.31  ? 188 TYR C CD2 1 
ATOM   2715 C  CE1 . TYR C 2 106 ? 49.336  0.093   64.727  1.00 71.88  ? 188 TYR C CE1 1 
ATOM   2716 C  CE2 . TYR C 2 106 ? 51.096  0.745   63.246  1.00 77.29  ? 188 TYR C CE2 1 
ATOM   2717 C  CZ  . TYR C 2 106 ? 50.670  0.372   64.502  1.00 75.24  ? 188 TYR C CZ  1 
ATOM   2718 O  OH  . TYR C 2 106 ? 51.584  0.293   65.525  1.00 76.14  ? 188 TYR C OH  1 
ATOM   2719 N  N   . ILE C 2 107 ? 46.674  -0.175  58.349  1.00 57.45  ? 189 ILE C N   1 
ATOM   2720 C  CA  . ILE C 2 107 ? 45.650  0.250   57.404  1.00 56.82  ? 189 ILE C CA  1 
ATOM   2721 C  C   . ILE C 2 107 ? 45.358  -0.902  56.459  1.00 59.81  ? 189 ILE C C   1 
ATOM   2722 O  O   . ILE C 2 107 ? 46.135  -1.182  55.540  1.00 64.48  ? 189 ILE C O   1 
ATOM   2723 C  CB  . ILE C 2 107 ? 46.070  1.508   56.635  1.00 56.75  ? 189 ILE C CB  1 
ATOM   2724 C  CG1 . ILE C 2 107 ? 46.389  2.634   57.620  1.00 55.62  ? 189 ILE C CG1 1 
ATOM   2725 C  CG2 . ILE C 2 107 ? 44.981  1.906   55.657  1.00 53.76  ? 189 ILE C CG2 1 
ATOM   2726 C  CD1 . ILE C 2 107 ? 45.300  2.857   58.673  1.00 53.93  ? 189 ILE C CD1 1 
ATOM   2727 N  N   . PHE C 2 108 ? 44.216  -1.549  56.664  1.00 60.86  ? 190 PHE C N   1 
ATOM   2728 C  CA  . PHE C 2 108 ? 43.825  -2.676  55.826  1.00 63.60  ? 190 PHE C CA  1 
ATOM   2729 C  C   . PHE C 2 108 ? 43.380  -2.232  54.443  1.00 63.10  ? 190 PHE C C   1 
ATOM   2730 O  O   . PHE C 2 108 ? 43.437  -3.013  53.496  1.00 69.71  ? 190 PHE C O   1 
ATOM   2731 C  CB  . PHE C 2 108 ? 42.701  -3.464  56.515  1.00 66.34  ? 190 PHE C CB  1 
ATOM   2732 C  CG  . PHE C 2 108 ? 42.279  -4.705  55.773  1.00 69.44  ? 190 PHE C CG  1 
ATOM   2733 C  CD1 . PHE C 2 108 ? 43.121  -5.791  55.685  1.00 71.10  ? 190 PHE C CD1 1 
ATOM   2734 C  CD2 . PHE C 2 108 ? 41.036  -4.782  55.166  1.00 69.86  ? 190 PHE C CD2 1 
ATOM   2735 C  CE1 . PHE C 2 108 ? 42.734  -6.933  54.999  1.00 75.29  ? 190 PHE C CE1 1 
ATOM   2736 C  CE2 . PHE C 2 108 ? 40.648  -5.918  54.482  1.00 71.17  ? 190 PHE C CE2 1 
ATOM   2737 C  CZ  . PHE C 2 108 ? 41.499  -6.994  54.398  1.00 74.18  ? 190 PHE C CZ  1 
ATOM   2738 N  N   . HIS C 2 109 ? 42.916  -1.002  54.297  1.00 61.75  ? 191 HIS C N   1 
ATOM   2739 C  CA  . HIS C 2 109 ? 42.311  -0.564  53.046  1.00 62.13  ? 191 HIS C CA  1 
ATOM   2740 C  C   . HIS C 2 109 ? 42.702  0.879   52.806  1.00 61.24  ? 191 HIS C C   1 
ATOM   2741 O  O   . HIS C 2 109 ? 41.989  1.808   53.210  1.00 57.93  ? 191 HIS C O   1 
ATOM   2742 C  CB  . HIS C 2 109 ? 40.793  -0.720  53.078  1.00 62.11  ? 191 HIS C CB  1 
ATOM   2743 C  CG  . HIS C 2 109 ? 40.149  -0.577  51.738  1.00 63.65  ? 191 HIS C CG  1 
ATOM   2744 N  ND1 . HIS C 2 109 ? 39.473  0.564   51.355  1.00 62.02  ? 191 HIS C ND1 1 
ATOM   2745 C  CD2 . HIS C 2 109 ? 40.090  -1.425  50.686  1.00 64.95  ? 191 HIS C CD2 1 
ATOM   2746 C  CE1 . HIS C 2 109 ? 39.017  0.409   50.125  1.00 63.02  ? 191 HIS C CE1 1 
ATOM   2747 N  NE2 . HIS C 2 109 ? 39.377  -0.791  49.698  1.00 66.18  ? 191 HIS C NE2 1 
ATOM   2748 N  N   . PRO C 2 110 ? 43.831  1.108   52.139  1.00 62.78  ? 192 PRO C N   1 
ATOM   2749 C  CA  . PRO C 2 110 ? 44.305  2.481   51.946  1.00 60.91  ? 192 PRO C CA  1 
ATOM   2750 C  C   . PRO C 2 110 ? 43.396  3.235   50.991  1.00 59.97  ? 192 PRO C C   1 
ATOM   2751 O  O   . PRO C 2 110 ? 42.631  2.646   50.224  1.00 61.72  ? 192 PRO C O   1 
ATOM   2752 C  CB  . PRO C 2 110 ? 45.710  2.298   51.365  1.00 61.79  ? 192 PRO C CB  1 
ATOM   2753 C  CG  . PRO C 2 110 ? 46.008  0.805   51.488  1.00 64.72  ? 192 PRO C CG  1 
ATOM   2754 C  CD  . PRO C 2 110 ? 44.698  0.123   51.478  1.00 63.61  ? 192 PRO C CD  1 
ATOM   2755 N  N   . MET C 2 111 ? 43.463  4.563   51.068  1.00 58.04  ? 193 MET C N   1 
ATOM   2756 C  CA  . MET C 2 111 ? 42.632  5.386   50.200  1.00 57.43  ? 193 MET C CA  1 
ATOM   2757 C  C   . MET C 2 111 ? 43.188  6.802   50.138  1.00 57.69  ? 193 MET C C   1 
ATOM   2758 O  O   . MET C 2 111 ? 43.634  7.358   51.145  1.00 57.91  ? 193 MET C O   1 
ATOM   2759 C  CB  . MET C 2 111 ? 41.173  5.408   50.675  1.00 56.35  ? 193 MET C CB  1 
ATOM   2760 C  CG  . MET C 2 111 ? 40.205  6.070   49.694  1.00 59.35  ? 193 MET C CG  1 
ATOM   2761 S  SD  . MET C 2 111 ? 40.163  5.328   48.035  1.00 64.83  ? 193 MET C SD  1 
ATOM   2762 C  CE  . MET C 2 111 ? 39.744  3.634   48.450  1.00 64.58  ? 193 MET C CE  1 
ATOM   2763 N  N   . ASP C 2 112 ? 43.154  7.379   48.945  1.00 62.03  ? 194 ASP C N   1 
ATOM   2764 C  CA  . ASP C 2 112 ? 43.605  8.745   48.747  1.00 65.60  ? 194 ASP C CA  1 
ATOM   2765 C  C   . ASP C 2 112 ? 42.743  9.374   47.663  1.00 64.31  ? 194 ASP C C   1 
ATOM   2766 O  O   . ASP C 2 112 ? 41.994  8.688   46.960  1.00 61.20  ? 194 ASP C O   1 
ATOM   2767 C  CB  . ASP C 2 112 ? 45.081  8.788   48.370  1.00 75.00  ? 194 ASP C CB  1 
ATOM   2768 C  CG  . ASP C 2 112 ? 45.392  7.872   47.223  1.00 84.08  ? 194 ASP C CG  1 
ATOM   2769 O  OD1 . ASP C 2 112 ? 45.472  6.638   47.441  1.00 84.70  ? 194 ASP C OD1 1 
ATOM   2770 O  OD2 . ASP C 2 112 ? 45.515  8.391   46.092  1.00 89.53  ? 194 ASP C OD2 1 
ATOM   2771 N  N   . LEU C 2 113 ? 42.856  10.702  47.538  1.00 64.79  ? 195 LEU C N   1 
ATOM   2772 C  CA  . LEU C 2 113 ? 42.047  11.421  46.560  1.00 63.20  ? 195 LEU C CA  1 
ATOM   2773 C  C   . LEU C 2 113 ? 42.377  11.005  45.134  1.00 67.97  ? 195 LEU C C   1 
ATOM   2774 O  O   . LEU C 2 113 ? 41.482  10.973  44.283  1.00 71.84  ? 195 LEU C O   1 
ATOM   2775 C  CB  . LEU C 2 113 ? 42.233  12.926  46.724  1.00 58.43  ? 195 LEU C CB  1 
ATOM   2776 C  CG  . LEU C 2 113 ? 41.966  13.465  48.126  1.00 50.66  ? 195 LEU C CG  1 
ATOM   2777 C  CD1 . LEU C 2 113 ? 42.605  14.827  48.248  1.00 51.23  ? 195 LEU C CD1 1 
ATOM   2778 C  CD2 . LEU C 2 113 ? 40.485  13.508  48.410  1.00 42.61  ? 195 LEU C CD2 1 
ATOM   2779 N  N   . CYS C 2 114 ? 43.643  10.687  44.846  1.00 67.04  ? 196 CYS C N   1 
ATOM   2780 C  CA  . CYS C 2 114 ? 43.984  10.237  43.501  1.00 66.54  ? 196 CYS C CA  1 
ATOM   2781 C  C   . CYS C 2 114 ? 43.276  8.933   43.167  1.00 64.80  ? 196 CYS C C   1 
ATOM   2782 O  O   . CYS C 2 114 ? 42.759  8.766   42.054  1.00 67.62  ? 196 CYS C O   1 
ATOM   2783 C  CB  . CYS C 2 114 ? 45.495  10.068  43.359  1.00 72.64  ? 196 CYS C CB  1 
ATOM   2784 S  SG  . CYS C 2 114 ? 46.044  9.924   41.645  1.00 79.58  ? 196 CYS C SG  1 
ATOM   2785 N  N   . THR C 2 115 ? 43.236  7.999   44.121  1.00 59.55  ? 197 THR C N   1 
ATOM   2786 C  CA  . THR C 2 115 ? 42.537  6.736   43.895  1.00 59.41  ? 197 THR C CA  1 
ATOM   2787 C  C   . THR C 2 115 ? 41.037  6.965   43.710  1.00 58.14  ? 197 THR C C   1 
ATOM   2788 O  O   . THR C 2 115 ? 40.426  6.405   42.793  1.00 55.03  ? 197 THR C O   1 
ATOM   2789 C  CB  . THR C 2 115 ? 42.807  5.776   45.060  1.00 59.90  ? 197 THR C CB  1 
ATOM   2790 O  OG1 . THR C 2 115 ? 44.218  5.551   45.189  1.00 59.08  ? 197 THR C OG1 1 
ATOM   2791 C  CG2 . THR C 2 115 ? 42.094  4.437   44.846  1.00 52.45  ? 197 THR C CG2 1 
ATOM   2792 N  N   . LEU C 2 116 ? 40.425  7.774   44.588  1.00 57.94  ? 198 LEU C N   1 
ATOM   2793 C  CA  . LEU C 2 116 ? 39.051  8.210   44.373  1.00 58.61  ? 198 LEU C CA  1 
ATOM   2794 C  C   . LEU C 2 116 ? 38.850  8.677   42.937  1.00 66.24  ? 198 LEU C C   1 
ATOM   2795 O  O   . LEU C 2 116 ? 37.918  8.247   42.249  1.00 70.67  ? 198 LEU C O   1 
ATOM   2796 C  CB  . LEU C 2 116 ? 38.712  9.341   45.337  1.00 55.53  ? 198 LEU C CB  1 
ATOM   2797 C  CG  . LEU C 2 116 ? 38.178  8.993   46.710  1.00 55.92  ? 198 LEU C CG  1 
ATOM   2798 C  CD1 . LEU C 2 116 ? 38.079  10.259  47.526  1.00 56.86  ? 198 LEU C CD1 1 
ATOM   2799 C  CD2 . LEU C 2 116 ? 36.830  8.329   46.593  1.00 54.62  ? 198 LEU C CD2 1 
ATOM   2800 N  N   . GLU C 2 117 ? 39.736  9.558   42.468  1.00 66.08  ? 199 GLU C N   1 
ATOM   2801 C  CA  . GLU C 2 117 ? 39.628  10.102  41.121  1.00 66.46  ? 199 GLU C CA  1 
ATOM   2802 C  C   . GLU C 2 117 ? 39.646  8.990   40.076  1.00 68.20  ? 199 GLU C C   1 
ATOM   2803 O  O   . GLU C 2 117 ? 38.720  8.879   39.266  1.00 70.49  ? 199 GLU C O   1 
ATOM   2804 C  CB  . GLU C 2 117 ? 40.759  11.102  40.894  1.00 71.23  ? 199 GLU C CB  1 
ATOM   2805 C  CG  . GLU C 2 117 ? 40.506  12.111  39.798  1.00 77.63  ? 199 GLU C CG  1 
ATOM   2806 C  CD  . GLU C 2 117 ? 41.386  13.359  39.927  1.00 84.45  ? 199 GLU C CD  1 
ATOM   2807 O  OE1 . GLU C 2 117 ? 41.963  13.590  41.021  1.00 85.32  ? 199 GLU C OE1 1 
ATOM   2808 O  OE2 . GLU C 2 117 ? 41.501  14.113  38.933  1.00 88.32  ? 199 GLU C OE2 1 
ATOM   2809 N  N   . LYS C 2 118 ? 40.691  8.143   40.089  1.00 66.14  ? 200 LYS C N   1 
ATOM   2810 C  CA  . LYS C 2 118 ? 40.787  7.069   39.099  1.00 68.04  ? 200 LYS C CA  1 
ATOM   2811 C  C   . LYS C 2 118 ? 39.574  6.145   39.163  1.00 67.11  ? 200 LYS C C   1 
ATOM   2812 O  O   . LYS C 2 118 ? 39.061  5.718   38.122  1.00 70.94  ? 200 LYS C O   1 
ATOM   2813 C  CB  . LYS C 2 118 ? 42.081  6.258   39.277  1.00 71.55  ? 200 LYS C CB  1 
ATOM   2814 C  CG  . LYS C 2 118 ? 43.336  7.057   39.603  1.00 75.92  ? 200 LYS C CG  1 
ATOM   2815 C  CD  . LYS C 2 118 ? 44.011  7.616   38.361  1.00 85.93  ? 200 LYS C CD  1 
ATOM   2816 C  CE  . LYS C 2 118 ? 44.672  8.996   38.624  1.00 88.33  ? 200 LYS C CE  1 
ATOM   2817 N  NZ  . LYS C 2 118 ? 45.516  9.522   37.482  1.00 91.45  ? 200 LYS C NZ  1 
ATOM   2818 N  N   . ASN C 2 119 ? 39.092  5.831   40.369  1.00 64.02  ? 201 ASN C N   1 
ATOM   2819 C  CA  . ASN C 2 119 ? 37.931  4.953   40.496  1.00 64.69  ? 201 ASN C CA  1 
ATOM   2820 C  C   . ASN C 2 119 ? 36.681  5.598   39.914  1.00 62.57  ? 201 ASN C C   1 
ATOM   2821 O  O   . ASN C 2 119 ? 35.929  4.963   39.172  1.00 66.34  ? 201 ASN C O   1 
ATOM   2822 C  CB  . ASN C 2 119 ? 37.676  4.568   41.955  1.00 65.25  ? 201 ASN C CB  1 
ATOM   2823 C  CG  . ASN C 2 119 ? 38.839  3.871   42.589  1.00 70.46  ? 201 ASN C CG  1 
ATOM   2824 O  OD1 . ASN C 2 119 ? 39.841  3.593   41.928  1.00 79.41  ? 201 ASN C OD1 1 
ATOM   2825 N  ND2 . ASN C 2 119 ? 38.704  3.538   43.860  1.00 67.73  ? 201 ASN C ND2 1 
ATOM   2826 N  N   . ALA C 2 120 ? 36.405  6.843   40.289  1.00 55.37  ? 202 ALA C N   1 
ATOM   2827 C  CA  . ALA C 2 120 ? 35.346  7.590   39.621  1.00 54.79  ? 202 ALA C CA  1 
ATOM   2828 C  C   . ALA C 2 120 ? 35.499  7.506   38.102  1.00 60.69  ? 202 ALA C C   1 
ATOM   2829 O  O   . ALA C 2 120 ? 34.525  7.242   37.392  1.00 62.93  ? 202 ALA C O   1 
ATOM   2830 C  CB  . ALA C 2 120 ? 35.352  9.051   40.087  1.00 51.27  ? 202 ALA C CB  1 
ATOM   2831 N  N   . LYS C 2 121 ? 36.729  7.685   37.589  1.00 60.64  ? 203 LYS C N   1 
ATOM   2832 C  CA  . LYS C 2 121 ? 36.928  7.666   36.141  1.00 65.59  ? 203 LYS C CA  1 
ATOM   2833 C  C   . LYS C 2 121 ? 36.541  6.314   35.561  1.00 70.16  ? 203 LYS C C   1 
ATOM   2834 O  O   . LYS C 2 121 ? 35.905  6.242   34.501  1.00 71.65  ? 203 LYS C O   1 
ATOM   2835 C  CB  . LYS C 2 121 ? 38.379  8.020   35.775  1.00 65.19  ? 203 LYS C CB  1 
ATOM   2836 N  N   . LYS C 2 122 ? 36.902  5.218   36.267  1.00 69.48  ? 204 LYS C N   1 
ATOM   2837 C  CA  . LYS C 2 122 ? 36.598  3.832   35.911  1.00 69.18  ? 204 LYS C CA  1 
ATOM   2838 C  C   . LYS C 2 122 ? 35.152  3.479   36.205  1.00 67.64  ? 204 LYS C C   1 
ATOM   2839 O  O   . LYS C 2 122 ? 34.772  2.304   36.214  1.00 69.08  ? 204 LYS C O   1 
ATOM   2840 C  CB  . LYS C 2 122 ? 37.547  2.875   36.637  1.00 63.76  ? 204 LYS C CB  1 
ATOM   2841 N  N   . LYS C 2 123 ? 34.383  4.540   36.452  1.00 66.35  ? 205 LYS C N   1 
ATOM   2842 C  CA  . LYS C 2 123 ? 32.933  4.480   36.580  1.00 66.52  ? 205 LYS C CA  1 
ATOM   2843 C  C   . LYS C 2 123 ? 32.495  3.401   37.565  1.00 67.66  ? 205 LYS C C   1 
ATOM   2844 O  O   . LYS C 2 123 ? 31.576  2.631   37.300  1.00 74.42  ? 205 LYS C O   1 
ATOM   2845 C  CB  . LYS C 2 123 ? 32.278  4.274   35.210  1.00 68.71  ? 205 LYS C CB  1 
ATOM   2846 N  N   . MET C 2 124 ? 33.147  3.349   38.725  1.00 66.34  ? 206 MET C N   1 
ATOM   2847 C  CA  . MET C 2 124 ? 32.796  2.342   39.719  1.00 71.97  ? 206 MET C CA  1 
ATOM   2848 C  C   . MET C 2 124 ? 32.095  2.922   40.941  1.00 67.38  ? 206 MET C C   1 
ATOM   2849 O  O   . MET C 2 124 ? 32.199  2.354   42.025  1.00 68.67  ? 206 MET C O   1 
ATOM   2850 C  CB  . MET C 2 124 ? 34.019  1.530   40.152  1.00 84.19  ? 206 MET C CB  1 
ATOM   2851 C  CG  . MET C 2 124 ? 35.218  2.303   40.685  1.00 89.85  ? 206 MET C CG  1 
ATOM   2852 S  SD  . MET C 2 124 ? 36.625  1.227   41.134  1.00 96.51  ? 206 MET C SD  1 
ATOM   2853 C  CE  . MET C 2 124 ? 36.642  0.075   39.751  1.00 101.21 ? 206 MET C CE  1 
ATOM   2854 N  N   . TYR C 2 125 ? 31.359  4.025   40.786  1.00 61.93  ? 207 TYR C N   1 
ATOM   2855 C  CA  . TYR C 2 125 ? 30.430  4.507   41.808  1.00 59.98  ? 207 TYR C CA  1 
ATOM   2856 C  C   . TYR C 2 125 ? 29.042  4.626   41.202  1.00 60.19  ? 207 TYR C C   1 
ATOM   2857 O  O   . TYR C 2 125 ? 28.830  5.423   40.286  1.00 62.68  ? 207 TYR C O   1 
ATOM   2858 C  CB  . TYR C 2 125 ? 30.862  5.854   42.390  1.00 56.62  ? 207 TYR C CB  1 
ATOM   2859 C  CG  . TYR C 2 125 ? 32.206  5.774   43.040  1.00 56.85  ? 207 TYR C CG  1 
ATOM   2860 C  CD1 . TYR C 2 125 ? 33.302  6.414   42.484  1.00 59.05  ? 207 TYR C CD1 1 
ATOM   2861 C  CD2 . TYR C 2 125 ? 32.391  5.023   44.190  1.00 55.20  ? 207 TYR C CD2 1 
ATOM   2862 C  CE1 . TYR C 2 125 ? 34.551  6.324   43.066  1.00 60.73  ? 207 TYR C CE1 1 
ATOM   2863 C  CE2 . TYR C 2 125 ? 33.632  4.927   44.782  1.00 56.43  ? 207 TYR C CE2 1 
ATOM   2864 C  CZ  . TYR C 2 125 ? 34.714  5.578   44.217  1.00 60.38  ? 207 TYR C CZ  1 
ATOM   2865 O  OH  . TYR C 2 125 ? 35.963  5.481   44.807  1.00 62.89  ? 207 TYR C OH  1 
ATOM   2866 N  N   . GLY C 2 126 ? 28.103  3.846   41.715  1.00 59.04  ? 208 GLY C N   1 
ATOM   2867 C  CA  . GLY C 2 126 ? 26.754  3.885   41.207  1.00 61.51  ? 208 GLY C CA  1 
ATOM   2868 C  C   . GLY C 2 126 ? 25.858  4.914   41.842  1.00 62.38  ? 208 GLY C C   1 
ATOM   2869 O  O   . GLY C 2 126 ? 24.704  5.057   41.433  1.00 67.53  ? 208 GLY C O   1 
ATOM   2870 N  N   . CYS C 2 127 ? 26.348  5.653   42.827  1.00 57.77  ? 209 CYS C N   1 
ATOM   2871 C  CA  . CYS C 2 127 ? 25.499  6.597   43.528  1.00 60.11  ? 209 CYS C CA  1 
ATOM   2872 C  C   . CYS C 2 127 ? 26.407  7.478   44.367  1.00 58.16  ? 209 CYS C C   1 
ATOM   2873 O  O   . CYS C 2 127 ? 27.567  7.135   44.606  1.00 60.58  ? 209 CYS C O   1 
ATOM   2874 C  CB  . CYS C 2 127 ? 24.462  5.874   44.400  1.00 65.26  ? 209 CYS C CB  1 
ATOM   2875 S  SG  . CYS C 2 127 ? 25.207  4.917   45.741  1.00 67.67  ? 209 CYS C SG  1 
ATOM   2876 N  N   . THR C 2 128 ? 25.876  8.616   44.818  1.00 51.66  ? 210 THR C N   1 
ATOM   2877 C  CA  . THR C 2 128 ? 26.723  9.516   45.590  1.00 49.19  ? 210 THR C CA  1 
ATOM   2878 C  C   . THR C 2 128 ? 27.130  8.906   46.929  1.00 48.66  ? 210 THR C C   1 
ATOM   2879 O  O   . THR C 2 128 ? 28.217  9.207   47.443  1.00 50.27  ? 210 THR C O   1 
ATOM   2880 C  CB  . THR C 2 128 ? 26.018  10.852  45.771  1.00 48.26  ? 210 THR C CB  1 
ATOM   2881 O  OG1 . THR C 2 128 ? 24.852  10.685  46.594  1.00 50.70  ? 210 THR C OG1 1 
ATOM   2882 C  CG2 . THR C 2 128 ? 25.598  11.355  44.428  1.00 50.02  ? 210 THR C CG2 1 
ATOM   2883 N  N   . GLU C 2 129 ? 26.292  8.033   47.491  1.00 48.13  ? 211 GLU C N   1 
ATOM   2884 C  CA  . GLU C 2 129 ? 26.615  7.406   48.771  1.00 45.75  ? 211 GLU C CA  1 
ATOM   2885 C  C   . GLU C 2 129 ? 27.815  6.490   48.642  1.00 50.28  ? 211 GLU C C   1 
ATOM   2886 O  O   . GLU C 2 129 ? 28.700  6.491   49.505  1.00 51.43  ? 211 GLU C O   1 
ATOM   2887 C  CB  . GLU C 2 129 ? 25.424  6.618   49.299  1.00 42.23  ? 211 GLU C CB  1 
ATOM   2888 C  CG  . GLU C 2 129 ? 24.301  7.483   49.742  1.00 44.79  ? 211 GLU C CG  1 
ATOM   2889 C  CD  . GLU C 2 129 ? 23.290  7.760   48.645  1.00 54.55  ? 211 GLU C CD  1 
ATOM   2890 O  OE1 . GLU C 2 129 ? 23.590  7.520   47.443  1.00 59.00  ? 211 GLU C OE1 1 
ATOM   2891 O  OE2 . GLU C 2 129 ? 22.177  8.209   49.007  1.00 56.83  ? 211 GLU C OE2 1 
ATOM   2892 N  N   . ALA C 2 130 ? 27.847  5.686   47.578  1.00 53.56  ? 212 ALA C N   1 
ATOM   2893 C  CA  . ALA C 2 130 ? 29.041  4.912   47.271  1.00 51.36  ? 212 ALA C CA  1 
ATOM   2894 C  C   . ALA C 2 130 ? 30.276  5.792   47.370  1.00 51.25  ? 212 ALA C C   1 
ATOM   2895 O  O   . ALA C 2 130 ? 31.248  5.449   48.063  1.00 50.85  ? 212 ALA C O   1 
ATOM   2896 C  CB  . ALA C 2 130 ? 28.907  4.291   45.884  1.00 49.20  ? 212 ALA C CB  1 
ATOM   2897 N  N   . PHE C 2 131 ? 30.204  6.989   46.767  1.00 49.49  ? 213 PHE C N   1 
ATOM   2898 C  CA  . PHE C 2 131 ? 31.379  7.847   46.690  1.00 50.47  ? 213 PHE C CA  1 
ATOM   2899 C  C   . PHE C 2 131 ? 31.800  8.368   48.060  1.00 47.92  ? 213 PHE C C   1 
ATOM   2900 O  O   . PHE C 2 131 ? 32.987  8.302   48.412  1.00 47.67  ? 213 PHE C O   1 
ATOM   2901 C  CB  . PHE C 2 131 ? 31.146  9.010   45.738  1.00 52.76  ? 213 PHE C CB  1 
ATOM   2902 C  CG  . PHE C 2 131 ? 32.379  9.824   45.512  1.00 52.89  ? 213 PHE C CG  1 
ATOM   2903 C  CD1 . PHE C 2 131 ? 33.423  9.312   44.758  1.00 54.15  ? 213 PHE C CD1 1 
ATOM   2904 C  CD2 . PHE C 2 131 ? 32.515  11.080  46.080  1.00 50.53  ? 213 PHE C CD2 1 
ATOM   2905 C  CE1 . PHE C 2 131 ? 34.570  10.048  44.560  1.00 54.39  ? 213 PHE C CE1 1 
ATOM   2906 C  CE2 . PHE C 2 131 ? 33.658  11.825  45.876  1.00 51.82  ? 213 PHE C CE2 1 
ATOM   2907 C  CZ  . PHE C 2 131 ? 34.687  11.310  45.118  1.00 52.78  ? 213 PHE C CZ  1 
ATOM   2908 N  N   . LEU C 2 132 ? 30.854  8.901   48.846  1.00 43.29  ? 214 LEU C N   1 
ATOM   2909 C  CA  . LEU C 2 132 ? 31.236  9.441   50.153  1.00 40.40  ? 214 LEU C CA  1 
ATOM   2910 C  C   . LEU C 2 132 ? 31.726  8.332   51.080  1.00 41.05  ? 214 LEU C C   1 
ATOM   2911 O  O   . LEU C 2 132 ? 32.632  8.545   51.905  1.00 39.89  ? 214 LEU C O   1 
ATOM   2912 C  CB  . LEU C 2 132 ? 30.064  10.190  50.786  1.00 37.76  ? 214 LEU C CB  1 
ATOM   2913 C  CG  . LEU C 2 132 ? 30.127  10.503  52.282  1.00 36.61  ? 214 LEU C CG  1 
ATOM   2914 C  CD1 . LEU C 2 132 ? 31.159  11.596  52.555  1.00 34.40  ? 214 LEU C CD1 1 
ATOM   2915 C  CD2 . LEU C 2 132 ? 28.786  10.937  52.756  1.00 30.54  ? 214 LEU C CD2 1 
ATOM   2916 N  N   . ALA C 2 133 ? 31.149  7.128   50.941  1.00 40.58  ? 215 ALA C N   1 
ATOM   2917 C  CA  . ALA C 2 133 ? 31.561  5.999   51.767  1.00 36.40  ? 215 ALA C CA  1 
ATOM   2918 C  C   . ALA C 2 133 ? 32.990  5.607   51.456  1.00 40.45  ? 215 ALA C C   1 
ATOM   2919 O  O   . ALA C 2 133 ? 33.780  5.332   52.366  1.00 44.54  ? 215 ALA C O   1 
ATOM   2920 C  CB  . ALA C 2 133 ? 30.620  4.818   51.555  1.00 35.18  ? 215 ALA C CB  1 
ATOM   2921 N  N   . ASP C 2 134 ? 33.346  5.591   50.176  1.00 40.56  ? 216 ASP C N   1 
ATOM   2922 C  CA  . ASP C 2 134 ? 34.731  5.320   49.834  1.00 45.91  ? 216 ASP C CA  1 
ATOM   2923 C  C   . ASP C 2 134 ? 35.636  6.435   50.343  1.00 47.22  ? 216 ASP C C   1 
ATOM   2924 O  O   . ASP C 2 134 ? 36.728  6.169   50.864  1.00 47.97  ? 216 ASP C O   1 
ATOM   2925 C  CB  . ASP C 2 134 ? 34.854  5.141   48.324  1.00 50.88  ? 216 ASP C CB  1 
ATOM   2926 C  CG  . ASP C 2 134 ? 35.787  4.019   47.938  1.00 56.46  ? 216 ASP C CG  1 
ATOM   2927 O  OD1 . ASP C 2 134 ? 36.197  3.247   48.832  1.00 54.96  ? 216 ASP C OD1 1 
ATOM   2928 O  OD2 . ASP C 2 134 ? 36.115  3.915   46.729  1.00 63.17  ? 216 ASP C OD2 1 
ATOM   2929 N  N   . ALA C 2 135 ? 35.179  7.688   50.233  1.00 45.83  ? 217 ALA C N   1 
ATOM   2930 C  CA  . ALA C 2 135 ? 36.002  8.817   50.658  1.00 45.78  ? 217 ALA C CA  1 
ATOM   2931 C  C   . ALA C 2 135 ? 36.362  8.711   52.128  1.00 46.13  ? 217 ALA C C   1 
ATOM   2932 O  O   . ALA C 2 135 ? 37.509  8.982   52.511  1.00 45.67  ? 217 ALA C O   1 
ATOM   2933 C  CB  . ALA C 2 135 ? 35.282  10.138  50.383  1.00 43.93  ? 217 ALA C CB  1 
ATOM   2934 N  N   . LYS C 2 136 ? 35.396  8.289   52.960  1.00 46.87  ? 218 LYS C N   1 
ATOM   2935 C  CA  . LYS C 2 136 ? 35.584  8.252   54.412  1.00 45.31  ? 218 LYS C CA  1 
ATOM   2936 C  C   . LYS C 2 136 ? 36.730  7.344   54.844  1.00 45.45  ? 218 LYS C C   1 
ATOM   2937 O  O   . LYS C 2 136 ? 37.245  7.507   55.957  1.00 42.64  ? 218 LYS C O   1 
ATOM   2938 C  CB  . LYS C 2 136 ? 34.284  7.819   55.086  1.00 42.67  ? 218 LYS C CB  1 
ATOM   2939 C  CG  . LYS C 2 136 ? 33.239  8.918   55.091  1.00 40.57  ? 218 LYS C CG  1 
ATOM   2940 C  CD  . LYS C 2 136 ? 31.905  8.449   55.654  1.00 41.73  ? 218 LYS C CD  1 
ATOM   2941 C  CE  . LYS C 2 136 ? 30.923  9.617   55.793  1.00 42.44  ? 218 LYS C CE  1 
ATOM   2942 N  NZ  . LYS C 2 136 ? 29.637  9.267   56.482  1.00 42.25  ? 218 LYS C NZ  1 
ATOM   2943 N  N   . TRP C 2 137 ? 37.144  6.401   53.991  1.00 45.32  ? 219 TRP C N   1 
ATOM   2944 C  CA  . TRP C 2 137 ? 38.343  5.622   54.275  1.00 45.74  ? 219 TRP C CA  1 
ATOM   2945 C  C   . TRP C 2 137 ? 39.535  6.523   54.593  1.00 44.60  ? 219 TRP C C   1 
ATOM   2946 O  O   . TRP C 2 137 ? 40.314  6.237   55.506  1.00 42.89  ? 219 TRP C O   1 
ATOM   2947 C  CB  . TRP C 2 137 ? 38.659  4.711   53.089  1.00 50.41  ? 219 TRP C CB  1 
ATOM   2948 C  CG  . TRP C 2 137 ? 37.882  3.402   53.055  1.00 53.29  ? 219 TRP C CG  1 
ATOM   2949 C  CD1 . TRP C 2 137 ? 36.987  3.012   52.105  1.00 53.60  ? 219 TRP C CD1 1 
ATOM   2950 C  CD2 . TRP C 2 137 ? 37.960  2.316   53.991  1.00 53.65  ? 219 TRP C CD2 1 
ATOM   2951 N  NE1 . TRP C 2 137 ? 36.499  1.763   52.386  1.00 52.53  ? 219 TRP C NE1 1 
ATOM   2952 C  CE2 . TRP C 2 137 ? 37.074  1.313   53.542  1.00 53.48  ? 219 TRP C CE2 1 
ATOM   2953 C  CE3 . TRP C 2 137 ? 38.687  2.096   55.164  1.00 52.21  ? 219 TRP C CE3 1 
ATOM   2954 C  CZ2 . TRP C 2 137 ? 36.890  0.113   54.227  1.00 52.72  ? 219 TRP C CZ2 1 
ATOM   2955 C  CZ3 . TRP C 2 137 ? 38.501  0.909   55.845  1.00 52.02  ? 219 TRP C CZ3 1 
ATOM   2956 C  CH2 . TRP C 2 137 ? 37.609  -0.068  55.374  1.00 52.97  ? 219 TRP C CH2 1 
ATOM   2957 N  N   . ILE C 2 138 ? 39.685  7.621   53.847  1.00 49.11  ? 220 ILE C N   1 
ATOM   2958 C  CA  . ILE C 2 138 ? 40.787  8.561   54.078  1.00 51.76  ? 220 ILE C CA  1 
ATOM   2959 C  C   . ILE C 2 138 ? 40.808  9.011   55.533  1.00 51.43  ? 220 ILE C C   1 
ATOM   2960 O  O   . ILE C 2 138 ? 41.842  8.956   56.210  1.00 55.80  ? 220 ILE C O   1 
ATOM   2961 C  CB  . ILE C 2 138 ? 40.668  9.760   53.119  1.00 46.66  ? 220 ILE C CB  1 
ATOM   2962 C  CG1 . ILE C 2 138 ? 40.788  9.274   51.684  1.00 46.91  ? 220 ILE C CG1 1 
ATOM   2963 C  CG2 . ILE C 2 138 ? 41.705  10.818  53.428  1.00 42.55  ? 220 ILE C CG2 1 
ATOM   2964 C  CD1 . ILE C 2 138 ? 40.776  10.375  50.674  1.00 47.29  ? 220 ILE C CD1 1 
ATOM   2965 N  N   . LEU C 2 139 ? 39.654  9.432   56.041  1.00 49.10  ? 221 LEU C N   1 
ATOM   2966 C  CA  . LEU C 2 139 ? 39.585  9.921   57.413  1.00 49.43  ? 221 LEU C CA  1 
ATOM   2967 C  C   . LEU C 2 139 ? 39.778  8.788   58.416  1.00 47.23  ? 221 LEU C C   1 
ATOM   2968 O  O   . LEU C 2 139 ? 40.565  8.915   59.362  1.00 45.88  ? 221 LEU C O   1 
ATOM   2969 C  CB  . LEU C 2 139 ? 38.254  10.637  57.643  1.00 46.11  ? 221 LEU C CB  1 
ATOM   2970 C  CG  . LEU C 2 139 ? 37.892  11.051  59.072  1.00 43.72  ? 221 LEU C CG  1 
ATOM   2971 C  CD1 . LEU C 2 139 ? 39.081  11.650  59.772  1.00 46.91  ? 221 LEU C CD1 1 
ATOM   2972 C  CD2 . LEU C 2 139 ? 36.752  12.056  59.049  1.00 39.56  ? 221 LEU C CD2 1 
ATOM   2973 N  N   . HIS C 2 140 ? 39.044  7.688   58.238  1.00 43.93  ? 222 HIS C N   1 
ATOM   2974 C  CA  . HIS C 2 140 ? 39.187  6.521   59.105  1.00 44.13  ? 222 HIS C CA  1 
ATOM   2975 C  C   . HIS C 2 140 ? 40.660  6.147   59.263  1.00 45.66  ? 222 HIS C C   1 
ATOM   2976 O  O   . HIS C 2 140 ? 41.173  6.001   60.387  1.00 44.84  ? 222 HIS C O   1 
ATOM   2977 C  CB  . HIS C 2 140 ? 38.364  5.378   58.496  1.00 45.52  ? 222 HIS C CB  1 
ATOM   2978 C  CG  . HIS C 2 140 ? 38.493  4.057   59.189  1.00 48.72  ? 222 HIS C CG  1 
ATOM   2979 N  ND1 . HIS C 2 140 ? 38.013  3.828   60.459  1.00 49.07  ? 222 HIS C ND1 1 
ATOM   2980 C  CD2 . HIS C 2 140 ? 38.997  2.874   58.760  1.00 50.26  ? 222 HIS C CD2 1 
ATOM   2981 C  CE1 . HIS C 2 140 ? 38.236  2.568   60.793  1.00 50.50  ? 222 HIS C CE1 1 
ATOM   2982 N  NE2 . HIS C 2 140 ? 38.833  1.968   59.779  1.00 50.85  ? 222 HIS C NE2 1 
ATOM   2983 N  N   . ASN C 2 141 ? 41.374  6.058   58.137  1.00 43.55  ? 223 ASN C N   1 
ATOM   2984 C  CA  . ASN C 2 141 ? 42.759  5.613   58.186  1.00 49.43  ? 223 ASN C CA  1 
ATOM   2985 C  C   . ASN C 2 141 ? 43.638  6.661   58.830  1.00 52.70  ? 223 ASN C C   1 
ATOM   2986 O  O   . ASN C 2 141 ? 44.591  6.330   59.550  1.00 54.65  ? 223 ASN C O   1 
ATOM   2987 C  CB  . ASN C 2 141 ? 43.254  5.286   56.785  1.00 49.27  ? 223 ASN C CB  1 
ATOM   2988 C  CG  . ASN C 2 141 ? 42.491  4.163   56.167  1.00 48.84  ? 223 ASN C CG  1 
ATOM   2989 O  OD1 . ASN C 2 141 ? 41.931  3.323   56.873  1.00 50.97  ? 223 ASN C OD1 1 
ATOM   2990 N  ND2 . ASN C 2 141 ? 42.482  4.108   54.842  1.00 47.57  ? 223 ASN C ND2 1 
ATOM   2991 N  N   . CYS C 2 142 ? 43.329  7.931   58.580  1.00 52.35  ? 224 CYS C N   1 
ATOM   2992 C  CA  . CYS C 2 142 ? 44.055  8.997   59.249  1.00 54.62  ? 224 CYS C CA  1 
ATOM   2993 C  C   . CYS C 2 142 ? 43.924  8.878   60.762  1.00 55.65  ? 224 CYS C C   1 
ATOM   2994 O  O   . CYS C 2 142 ? 44.908  9.018   61.495  1.00 57.57  ? 224 CYS C O   1 
ATOM   2995 C  CB  . CYS C 2 142 ? 43.546  10.354  58.770  1.00 52.87  ? 224 CYS C CB  1 
ATOM   2996 S  SG  . CYS C 2 142 ? 44.605  11.677  59.291  1.00 54.44  ? 224 CYS C SG  1 
ATOM   2997 N  N   . ILE C 2 143 ? 42.715  8.618   61.251  1.00 53.91  ? 225 ILE C N   1 
ATOM   2998 C  CA  . ILE C 2 143 ? 42.526  8.526   62.690  1.00 52.61  ? 225 ILE C CA  1 
ATOM   2999 C  C   . ILE C 2 143 ? 43.279  7.324   63.231  1.00 54.79  ? 225 ILE C C   1 
ATOM   3000 O  O   . ILE C 2 143 ? 43.925  7.391   64.285  1.00 56.35  ? 225 ILE C O   1 
ATOM   3001 C  CB  . ILE C 2 143 ? 41.025  8.465   63.026  1.00 47.26  ? 225 ILE C CB  1 
ATOM   3002 C  CG1 . ILE C 2 143 ? 40.350  9.799   62.675  1.00 43.33  ? 225 ILE C CG1 1 
ATOM   3003 C  CG2 . ILE C 2 143 ? 40.827  8.113   64.498  1.00 45.74  ? 225 ILE C CG2 1 
ATOM   3004 C  CD1 . ILE C 2 143 ? 38.875  9.778   62.752  1.00 34.17  ? 225 ILE C CD1 1 
ATOM   3005 N  N   . ILE C 2 144 ? 43.243  6.216   62.498  1.00 54.85  ? 226 ILE C N   1 
ATOM   3006 C  CA  . ILE C 2 144 ? 43.918  5.019   62.983  1.00 56.31  ? 226 ILE C CA  1 
ATOM   3007 C  C   . ILE C 2 144 ? 45.415  5.265   63.097  1.00 55.86  ? 226 ILE C C   1 
ATOM   3008 O  O   . ILE C 2 144 ? 46.028  4.963   64.124  1.00 55.11  ? 226 ILE C O   1 
ATOM   3009 C  CB  . ILE C 2 144 ? 43.598  3.814   62.081  1.00 58.22  ? 226 ILE C CB  1 
ATOM   3010 C  CG1 . ILE C 2 144 ? 42.144  3.381   62.303  1.00 56.73  ? 226 ILE C CG1 1 
ATOM   3011 C  CG2 . ILE C 2 144 ? 44.558  2.666   62.369  1.00 58.75  ? 226 ILE C CG2 1 
ATOM   3012 C  CD1 . ILE C 2 144 ? 41.572  2.638   61.153  1.00 57.04  ? 226 ILE C CD1 1 
ATOM   3013 N  N   . TYR C 2 145 ? 46.025  5.849   62.065  1.00 57.90  ? 227 TYR C N   1 
ATOM   3014 C  CA  . TYR C 2 145 ? 47.483  5.881   62.052  1.00 62.78  ? 227 TYR C CA  1 
ATOM   3015 C  C   . TYR C 2 145 ? 48.063  7.123   62.718  1.00 62.88  ? 227 TYR C C   1 
ATOM   3016 O  O   . TYR C 2 145 ? 49.171  7.062   63.256  1.00 61.97  ? 227 TYR C O   1 
ATOM   3017 C  CB  . TYR C 2 145 ? 48.005  5.735   60.615  1.00 65.36  ? 227 TYR C CB  1 
ATOM   3018 C  CG  . TYR C 2 145 ? 49.513  5.667   60.533  1.00 71.93  ? 227 TYR C CG  1 
ATOM   3019 C  CD1 . TYR C 2 145 ? 50.171  4.443   60.522  1.00 75.57  ? 227 TYR C CD1 1 
ATOM   3020 C  CD2 . TYR C 2 145 ? 50.283  6.821   60.418  1.00 74.71  ? 227 TYR C CD2 1 
ATOM   3021 C  CE1 . TYR C 2 145 ? 51.554  4.374   60.448  1.00 78.68  ? 227 TYR C CE1 1 
ATOM   3022 C  CE2 . TYR C 2 145 ? 51.671  6.760   60.343  1.00 77.73  ? 227 TYR C CE2 1 
ATOM   3023 C  CZ  . TYR C 2 145 ? 52.291  5.540   60.355  1.00 80.22  ? 227 TYR C CZ  1 
ATOM   3024 O  OH  . TYR C 2 145 ? 53.657  5.486   60.269  1.00 86.38  ? 227 TYR C OH  1 
ATOM   3025 N  N   . ASN C 2 146 ? 47.344  8.240   62.720  1.00 62.33  ? 228 ASN C N   1 
ATOM   3026 C  CA  . ASN C 2 146 ? 47.831  9.474   63.320  1.00 62.49  ? 228 ASN C CA  1 
ATOM   3027 C  C   . ASN C 2 146 ? 47.082  9.882   64.579  1.00 60.74  ? 228 ASN C C   1 
ATOM   3028 O  O   . ASN C 2 146 ? 47.517  10.819  65.257  1.00 59.44  ? 228 ASN C O   1 
ATOM   3029 C  CB  . ASN C 2 146 ? 47.751  10.627  62.309  1.00 60.34  ? 228 ASN C CB  1 
ATOM   3030 C  CG  . ASN C 2 146 ? 48.718  10.468  61.175  1.00 61.49  ? 228 ASN C CG  1 
ATOM   3031 O  OD1 . ASN C 2 146 ? 48.343  10.565  60.010  1.00 61.00  ? 228 ASN C OD1 1 
ATOM   3032 N  ND2 . ASN C 2 146 ? 49.976  10.217  61.504  1.00 64.99  ? 228 ASN C ND2 1 
ATOM   3033 N  N   . GLY C 2 147 ? 45.969  9.238   64.896  1.00 61.94  ? 229 GLY C N   1 
ATOM   3034 C  CA  . GLY C 2 147 ? 45.240  9.631   66.094  1.00 64.90  ? 229 GLY C CA  1 
ATOM   3035 C  C   . GLY C 2 147 ? 44.219  10.719  65.830  1.00 65.09  ? 229 GLY C C   1 
ATOM   3036 O  O   . GLY C 2 147 ? 44.405  11.605  64.996  1.00 64.33  ? 229 GLY C O   1 
ATOM   3037 N  N   . GLY C 2 148 ? 43.121  10.657  66.589  1.00 64.33  ? 230 GLY C N   1 
ATOM   3038 C  CA  . GLY C 2 148 ? 41.981  11.529  66.356  1.00 64.08  ? 230 GLY C CA  1 
ATOM   3039 C  C   . GLY C 2 148 ? 42.244  13.003  66.587  1.00 65.53  ? 230 GLY C C   1 
ATOM   3040 O  O   . GLY C 2 148 ? 41.551  13.851  66.007  1.00 66.93  ? 230 GLY C O   1 
ATOM   3041 N  N   . ASN C 2 149 ? 43.230  13.339  67.407  1.00 66.96  ? 231 ASN C N   1 
ATOM   3042 C  CA  . ASN C 2 149 ? 43.538  14.736  67.658  1.00 71.20  ? 231 ASN C CA  1 
ATOM   3043 C  C   . ASN C 2 149 ? 44.711  15.246  66.832  1.00 68.14  ? 231 ASN C C   1 
ATOM   3044 O  O   . ASN C 2 149 ? 45.227  16.328  67.111  1.00 66.17  ? 231 ASN C O   1 
ATOM   3045 C  CB  . ASN C 2 149 ? 43.791  14.950  69.147  1.00 79.53  ? 231 ASN C CB  1 
ATOM   3046 C  CG  . ASN C 2 149 ? 42.517  15.299  69.905  1.00 82.42  ? 231 ASN C CG  1 
ATOM   3047 O  OD1 . ASN C 2 149 ? 41.419  15.273  69.340  1.00 79.05  ? 231 ASN C OD1 1 
ATOM   3048 N  ND2 . ASN C 2 149 ? 42.656  15.617  71.189  1.00 87.39  ? 231 ASN C ND2 1 
ATOM   3049 N  N   . HIS C 2 150 ? 45.126  14.508  65.809  1.00 67.31  ? 232 HIS C N   1 
ATOM   3050 C  CA  . HIS C 2 150 ? 46.218  14.957  64.967  1.00 66.01  ? 232 HIS C CA  1 
ATOM   3051 C  C   . HIS C 2 150 ? 45.783  16.109  64.058  1.00 64.82  ? 232 HIS C C   1 
ATOM   3052 O  O   . HIS C 2 150 ? 44.598  16.288  63.752  1.00 64.17  ? 232 HIS C O   1 
ATOM   3053 C  CB  . HIS C 2 150 ? 46.739  13.803  64.123  1.00 66.75  ? 232 HIS C CB  1 
ATOM   3054 C  CG  . HIS C 2 150 ? 48.129  14.021  63.615  1.00 68.91  ? 232 HIS C CG  1 
ATOM   3055 N  ND1 . HIS C 2 150 ? 48.417  14.904  62.596  1.00 68.08  ? 232 HIS C ND1 1 
ATOM   3056 C  CD2 . HIS C 2 150 ? 49.311  13.478  63.991  1.00 69.67  ? 232 HIS C CD2 1 
ATOM   3057 C  CE1 . HIS C 2 150 ? 49.718  14.900  62.372  1.00 70.88  ? 232 HIS C CE1 1 
ATOM   3058 N  NE2 . HIS C 2 150 ? 50.281  14.039  63.200  1.00 71.85  ? 232 HIS C NE2 1 
ATOM   3059 N  N   . LYS C 2 151 ? 46.774  16.899  63.628  1.00 63.46  ? 233 LYS C N   1 
ATOM   3060 C  CA  . LYS C 2 151 ? 46.522  17.974  62.668  1.00 61.49  ? 233 LYS C CA  1 
ATOM   3061 C  C   . LYS C 2 151 ? 46.020  17.423  61.340  1.00 58.01  ? 233 LYS C C   1 
ATOM   3062 O  O   . LYS C 2 151 ? 45.036  17.932  60.771  1.00 56.61  ? 233 LYS C O   1 
ATOM   3063 C  CB  . LYS C 2 151 ? 47.795  18.788  62.445  1.00 62.46  ? 233 LYS C CB  1 
ATOM   3064 C  CG  . LYS C 2 151 ? 47.963  20.007  63.313  1.00 64.53  ? 233 LYS C CG  1 
ATOM   3065 C  CD  . LYS C 2 151 ? 49.192  20.771  62.858  1.00 69.04  ? 233 LYS C CD  1 
ATOM   3066 N  N   . LEU C 2 152 ? 46.695  16.380  60.828  1.00 57.04  ? 234 LEU C N   1 
ATOM   3067 C  CA  . LEU C 2 152 ? 46.252  15.747  59.589  1.00 55.67  ? 234 LEU C CA  1 
ATOM   3068 C  C   . LEU C 2 152 ? 44.820  15.266  59.706  1.00 54.50  ? 234 LEU C C   1 
ATOM   3069 O  O   . LEU C 2 152 ? 44.011  15.459  58.791  1.00 54.49  ? 234 LEU C O   1 
ATOM   3070 C  CB  . LEU C 2 152 ? 47.169  14.592  59.213  1.00 50.77  ? 234 LEU C CB  1 
ATOM   3071 C  CG  . LEU C 2 152 ? 48.622  15.045  59.156  1.00 52.29  ? 234 LEU C CG  1 
ATOM   3072 C  CD1 . LEU C 2 152 ? 49.583  13.875  59.120  1.00 51.08  ? 234 LEU C CD1 1 
ATOM   3073 C  CD2 . LEU C 2 152 ? 48.792  15.961  57.941  1.00 53.52  ? 234 LEU C CD2 1 
ATOM   3074 N  N   . THR C 2 153 ? 44.470  14.687  60.848  1.00 52.56  ? 235 THR C N   1 
ATOM   3075 C  CA  . THR C 2 153 ? 43.085  14.299  61.069  1.00 50.47  ? 235 THR C CA  1 
ATOM   3076 C  C   . THR C 2 153 ? 42.140  15.486  60.943  1.00 47.62  ? 235 THR C C   1 
ATOM   3077 O  O   . THR C 2 153 ? 41.022  15.335  60.442  1.00 47.94  ? 235 THR C O   1 
ATOM   3078 C  CB  . THR C 2 153 ? 42.959  13.637  62.425  1.00 52.27  ? 235 THR C CB  1 
ATOM   3079 O  OG1 . THR C 2 153 ? 43.753  12.443  62.401  1.00 55.32  ? 235 THR C OG1 1 
ATOM   3080 C  CG2 . THR C 2 153 ? 41.507  13.313  62.710  1.00 50.08  ? 235 THR C CG2 1 
ATOM   3081 N  N   . GLN C 2 154 ? 42.569  16.680  61.368  1.00 45.13  ? 236 GLN C N   1 
ATOM   3082 C  CA  A GLN C 2 154 ? 41.736  17.870  61.184  0.52 46.64  ? 236 GLN C CA  1 
ATOM   3083 C  CA  B GLN C 2 154 ? 41.722  17.854  61.182  0.48 46.60  ? 236 GLN C CA  1 
ATOM   3084 C  C   . GLN C 2 154 ? 41.524  18.160  59.701  1.00 47.65  ? 236 GLN C C   1 
ATOM   3085 O  O   . GLN C 2 154 ? 40.405  18.490  59.268  1.00 48.22  ? 236 GLN C O   1 
ATOM   3086 C  CB  A GLN C 2 154 ? 42.367  19.078  61.888  0.52 48.01  ? 236 GLN C CB  1 
ATOM   3087 C  CB  B GLN C 2 154 ? 42.314  19.052  61.920  0.48 47.96  ? 236 GLN C CB  1 
ATOM   3088 C  CG  A GLN C 2 154 ? 42.292  19.045  63.422  0.52 48.30  ? 236 GLN C CG  1 
ATOM   3089 C  CG  B GLN C 2 154 ? 42.550  18.791  63.402  0.48 48.12  ? 236 GLN C CG  1 
ATOM   3090 C  CD  A GLN C 2 154 ? 43.093  20.169  64.100  0.52 52.59  ? 236 GLN C CD  1 
ATOM   3091 C  CD  B GLN C 2 154 ? 41.412  18.022  64.057  0.48 46.92  ? 236 GLN C CD  1 
ATOM   3092 O  OE1 A GLN C 2 154 ? 44.110  19.903  64.752  0.52 53.93  ? 236 GLN C OE1 1 
ATOM   3093 O  OE1 B GLN C 2 154 ? 40.233  18.332  63.855  0.48 47.24  ? 236 GLN C OE1 1 
ATOM   3094 N  NE2 A GLN C 2 154 ? 42.628  21.419  63.967  0.52 48.80  ? 236 GLN C NE2 1 
ATOM   3095 N  NE2 B GLN C 2 154 ? 41.763  17.012  64.855  0.48 46.41  ? 236 GLN C NE2 1 
ATOM   3096 N  N   . ILE C 2 155 ? 42.584  18.011  58.899  1.00 47.19  ? 237 ILE C N   1 
ATOM   3097 C  CA  . ILE C 2 155 ? 42.437  18.228  57.460  1.00 48.23  ? 237 ILE C CA  1 
ATOM   3098 C  C   . ILE C 2 155 ? 41.499  17.184  56.851  1.00 46.31  ? 237 ILE C C   1 
ATOM   3099 O  O   . ILE C 2 155 ? 40.615  17.510  56.037  1.00 41.98  ? 237 ILE C O   1 
ATOM   3100 C  CB  . ILE C 2 155 ? 43.817  18.228  56.774  1.00 48.73  ? 237 ILE C CB  1 
ATOM   3101 C  CG1 . ILE C 2 155 ? 44.704  19.290  57.404  1.00 47.98  ? 237 ILE C CG1 1 
ATOM   3102 C  CG2 . ILE C 2 155 ? 43.673  18.551  55.288  1.00 49.18  ? 237 ILE C CG2 1 
ATOM   3103 C  CD1 . ILE C 2 155 ? 44.120  20.673  57.238  1.00 49.60  ? 237 ILE C CD1 1 
ATOM   3104 N  N   . ALA C 2 156 ? 41.679  15.915  57.237  1.00 46.36  ? 238 ALA C N   1 
ATOM   3105 C  CA  . ALA C 2 156 ? 40.844  14.848  56.697  1.00 47.28  ? 238 ALA C CA  1 
ATOM   3106 C  C   . ALA C 2 156 ? 39.385  15.069  57.038  1.00 46.69  ? 238 ALA C C   1 
ATOM   3107 O  O   . ALA C 2 156 ? 38.500  14.719  56.243  1.00 46.81  ? 238 ALA C O   1 
ATOM   3108 C  CB  . ALA C 2 156 ? 41.298  13.496  57.230  1.00 50.20  ? 238 ALA C CB  1 
ATOM   3109 N  N   . LYS C 2 157 ? 39.118  15.648  58.214  1.00 45.27  ? 239 LYS C N   1 
ATOM   3110 C  CA  . LYS C 2 157 ? 37.758  16.058  58.536  1.00 44.44  ? 239 LYS C CA  1 
ATOM   3111 C  C   . LYS C 2 157 ? 37.268  17.124  57.559  1.00 43.71  ? 239 LYS C C   1 
ATOM   3112 O  O   . LYS C 2 157 ? 36.117  17.080  57.105  1.00 43.78  ? 239 LYS C O   1 
ATOM   3113 C  CB  . LYS C 2 157 ? 37.688  16.542  59.988  1.00 41.89  ? 239 LYS C CB  1 
ATOM   3114 C  CG  . LYS C 2 157 ? 37.901  15.426  60.981  1.00 41.96  ? 239 LYS C CG  1 
ATOM   3115 C  CD  . LYS C 2 157 ? 38.146  15.938  62.389  1.00 49.44  ? 239 LYS C CD  1 
ATOM   3116 C  CE  . LYS C 2 157 ? 37.480  15.031  63.433  1.00 58.49  ? 239 LYS C CE  1 
ATOM   3117 N  NZ  . LYS C 2 157 ? 38.280  14.869  64.706  1.00 63.84  ? 239 LYS C NZ  1 
ATOM   3118 N  N   . VAL C 2 158 ? 38.130  18.074  57.186  1.00 41.22  ? 240 VAL C N   1 
ATOM   3119 C  CA  . VAL C 2 158 ? 37.657  19.068  56.232  1.00 39.46  ? 240 VAL C CA  1 
ATOM   3120 C  C   . VAL C 2 158 ? 37.301  18.403  54.906  1.00 42.36  ? 240 VAL C C   1 
ATOM   3121 O  O   . VAL C 2 158 ? 36.222  18.655  54.352  1.00 43.26  ? 240 VAL C O   1 
ATOM   3122 C  CB  . VAL C 2 158 ? 38.666  20.212  56.046  1.00 42.93  ? 240 VAL C CB  1 
ATOM   3123 C  CG1 . VAL C 2 158 ? 38.099  21.205  55.045  1.00 40.43  ? 240 VAL C CG1 1 
ATOM   3124 C  CG2 . VAL C 2 158 ? 38.967  20.903  57.349  1.00 41.23  ? 240 VAL C CG2 1 
ATOM   3125 N  N   . VAL C 2 159 ? 38.151  17.495  54.397  1.00 42.52  ? 241 VAL C N   1 
ATOM   3126 C  CA  . VAL C 2 159 ? 37.868  16.977  53.052  1.00 42.22  ? 241 VAL C CA  1 
ATOM   3127 C  C   . VAL C 2 159 ? 36.647  16.046  53.075  1.00 40.40  ? 241 VAL C C   1 
ATOM   3128 O  O   . VAL C 2 159 ? 35.864  15.989  52.130  1.00 40.72  ? 241 VAL C O   1 
ATOM   3129 C  CB  . VAL C 2 159 ? 39.100  16.289  52.416  1.00 45.14  ? 241 VAL C CB  1 
ATOM   3130 C  CG1 . VAL C 2 159 ? 40.407  17.054  52.640  1.00 46.27  ? 241 VAL C CG1 1 
ATOM   3131 C  CG2 . VAL C 2 159 ? 39.182  14.821  52.719  1.00 43.95  ? 241 VAL C CG2 1 
ATOM   3132 N  N   . ILE C 2 160 ? 36.424  15.343  54.170  1.00 39.34  ? 242 ILE C N   1 
ATOM   3133 C  CA  . ILE C 2 160 ? 35.209  14.529  54.183  1.00 39.04  ? 242 ILE C CA  1 
ATOM   3134 C  C   . ILE C 2 160 ? 33.983  15.433  54.303  1.00 40.41  ? 242 ILE C C   1 
ATOM   3135 O  O   . ILE C 2 160 ? 32.922  15.143  53.728  1.00 40.79  ? 242 ILE C O   1 
ATOM   3136 C  CB  . ILE C 2 160 ? 35.262  13.455  55.293  1.00 39.98  ? 242 ILE C CB  1 
ATOM   3137 C  CG1 . ILE C 2 160 ? 35.781  12.137  54.720  1.00 42.18  ? 242 ILE C CG1 1 
ATOM   3138 C  CG2 . ILE C 2 160 ? 33.888  13.174  55.806  1.00 39.91  ? 242 ILE C CG2 1 
ATOM   3139 C  CD1 . ILE C 2 160 ? 37.051  12.194  53.923  1.00 40.33  ? 242 ILE C CD1 1 
ATOM   3140 N  N   . LYS C 2 161 ? 34.131  16.598  54.941  1.00 42.61  ? 243 LYS C N   1 
ATOM   3141 C  CA  . LYS C 2 161 ? 32.988  17.500  55.027  1.00 42.67  ? 243 LYS C CA  1 
ATOM   3142 C  C   . LYS C 2 161 ? 32.693  18.173  53.684  1.00 42.87  ? 243 LYS C C   1 
ATOM   3143 O  O   . LYS C 2 161 ? 31.522  18.321  53.306  1.00 40.04  ? 243 LYS C O   1 
ATOM   3144 C  CB  . LYS C 2 161 ? 33.210  18.523  56.130  1.00 44.67  ? 243 LYS C CB  1 
ATOM   3145 C  CG  . LYS C 2 161 ? 31.932  18.805  56.854  1.00 51.45  ? 243 LYS C CG  1 
ATOM   3146 C  CD  . LYS C 2 161 ? 32.170  19.188  58.284  1.00 60.28  ? 243 LYS C CD  1 
ATOM   3147 C  CE  . LYS C 2 161 ? 32.916  18.102  59.020  1.00 68.58  ? 243 LYS C CE  1 
ATOM   3148 N  NZ  . LYS C 2 161 ? 33.181  18.482  60.455  1.00 74.29  ? 243 LYS C NZ  1 
ATOM   3149 N  N   . ILE C 2 162 ? 33.730  18.575  52.944  1.00 42.84  ? 244 ILE C N   1 
ATOM   3150 C  CA  . ILE C 2 162 ? 33.503  19.071  51.591  1.00 43.04  ? 244 ILE C CA  1 
ATOM   3151 C  C   . ILE C 2 162 ? 32.842  17.993  50.741  1.00 44.67  ? 244 ILE C C   1 
ATOM   3152 O  O   . ILE C 2 162 ? 31.911  18.272  49.967  1.00 44.16  ? 244 ILE C O   1 
ATOM   3153 C  CB  . ILE C 2 162 ? 34.819  19.554  50.956  1.00 41.34  ? 244 ILE C CB  1 
ATOM   3154 C  CG1 . ILE C 2 162 ? 35.262  20.866  51.576  1.00 37.93  ? 244 ILE C CG1 1 
ATOM   3155 C  CG2 . ILE C 2 162 ? 34.681  19.660  49.422  1.00 37.46  ? 244 ILE C CG2 1 
ATOM   3156 C  CD1 . ILE C 2 162 ? 36.717  21.110  51.428  1.00 39.51  ? 244 ILE C CD1 1 
ATOM   3157 N  N   . CYS C 2 163 ? 33.299  16.742  50.884  1.00 41.84  ? 245 CYS C N   1 
ATOM   3158 C  CA  . CYS C 2 163 ? 32.696  15.643  50.133  1.00 43.06  ? 245 CYS C CA  1 
ATOM   3159 C  C   . CYS C 2 163 ? 31.203  15.516  50.425  1.00 44.15  ? 245 CYS C C   1 
ATOM   3160 O  O   . CYS C 2 163 ? 30.383  15.515  49.499  1.00 44.48  ? 245 CYS C O   1 
ATOM   3161 C  CB  . CYS C 2 163 ? 33.412  14.336  50.444  1.00 44.46  ? 245 CYS C CB  1 
ATOM   3162 S  SG  . CYS C 2 163 ? 32.906  13.023  49.343  1.00 50.33  ? 245 CYS C SG  1 
ATOM   3163 N  N   . GLU C 2 164 ? 30.832  15.395  51.707  1.00 43.95  ? 246 GLU C N   1 
ATOM   3164 C  CA  . GLU C 2 164 ? 29.416  15.411  52.081  1.00 47.77  ? 246 GLU C CA  1 
ATOM   3165 C  C   . GLU C 2 164 ? 28.671  16.545  51.377  1.00 47.21  ? 246 GLU C C   1 
ATOM   3166 O  O   . GLU C 2 164 ? 27.631  16.331  50.740  1.00 42.68  ? 246 GLU C O   1 
ATOM   3167 C  CB  . GLU C 2 164 ? 29.272  15.546  53.602  1.00 52.32  ? 246 GLU C CB  1 
ATOM   3168 C  CG  . GLU C 2 164 ? 29.371  14.242  54.383  1.00 62.79  ? 246 GLU C CG  1 
ATOM   3169 C  CD  . GLU C 2 164 ? 29.787  14.424  55.867  1.00 72.00  ? 246 GLU C CD  1 
ATOM   3170 O  OE1 . GLU C 2 164 ? 30.099  13.403  56.535  1.00 73.84  ? 246 GLU C OE1 1 
ATOM   3171 O  OE2 . GLU C 2 164 ? 29.800  15.578  56.375  1.00 75.36  ? 246 GLU C OE2 1 
ATOM   3172 N  N   . HIS C 2 165 ? 29.216  17.762  51.466  1.00 50.82  ? 247 HIS C N   1 
ATOM   3173 C  CA  . HIS C 2 165 ? 28.552  18.944  50.917  1.00 48.31  ? 247 HIS C CA  1 
ATOM   3174 C  C   . HIS C 2 165 ? 28.309  18.807  49.414  1.00 49.92  ? 247 HIS C C   1 
ATOM   3175 O  O   . HIS C 2 165 ? 27.193  19.037  48.924  1.00 51.47  ? 247 HIS C O   1 
ATOM   3176 C  CB  . HIS C 2 165 ? 29.407  20.165  51.243  1.00 47.44  ? 247 HIS C CB  1 
ATOM   3177 C  CG  . HIS C 2 165 ? 28.927  21.440  50.632  1.00 48.42  ? 247 HIS C CG  1 
ATOM   3178 N  ND1 . HIS C 2 165 ? 29.423  21.924  49.439  1.00 48.64  ? 247 HIS C ND1 1 
ATOM   3179 C  CD2 . HIS C 2 165 ? 28.035  22.356  51.067  1.00 47.70  ? 247 HIS C CD2 1 
ATOM   3180 C  CE1 . HIS C 2 165 ? 28.836  23.070  49.151  1.00 48.61  ? 247 HIS C CE1 1 
ATOM   3181 N  NE2 . HIS C 2 165 ? 27.998  23.359  50.129  1.00 49.62  ? 247 HIS C NE2 1 
ATOM   3182 N  N   . GLU C 2 166 ? 29.335  18.397  48.667  1.00 48.46  ? 248 GLU C N   1 
ATOM   3183 C  CA  . GLU C 2 166 ? 29.160  18.261  47.229  1.00 48.11  ? 248 GLU C CA  1 
ATOM   3184 C  C   . GLU C 2 166 ? 28.184  17.135  46.874  1.00 49.53  ? 248 GLU C C   1 
ATOM   3185 O  O   . GLU C 2 166 ? 27.362  17.286  45.961  1.00 52.09  ? 248 GLU C O   1 
ATOM   3186 C  CB  . GLU C 2 166 ? 30.517  18.062  46.560  1.00 48.50  ? 248 GLU C CB  1 
ATOM   3187 C  CG  . GLU C 2 166 ? 31.492  19.227  46.791  1.00 53.97  ? 248 GLU C CG  1 
ATOM   3188 C  CD  . GLU C 2 166 ? 31.049  20.546  46.108  1.00 62.84  ? 248 GLU C CD  1 
ATOM   3189 O  OE1 . GLU C 2 166 ? 30.973  20.601  44.858  1.00 67.75  ? 248 GLU C OE1 1 
ATOM   3190 O  OE2 . GLU C 2 166 ? 30.801  21.550  46.816  1.00 64.92  ? 248 GLU C OE2 1 
ATOM   3191 N  N   . MET C 2 167 ? 28.245  16.001  47.578  1.00 49.16  ? 249 MET C N   1 
ATOM   3192 C  CA  . MET C 2 167 ? 27.255  14.949  47.343  1.00 48.46  ? 249 MET C CA  1 
ATOM   3193 C  C   . MET C 2 167 ? 25.839  15.481  47.513  1.00 45.60  ? 249 MET C C   1 
ATOM   3194 O  O   . MET C 2 167 ? 24.941  15.177  46.709  1.00 43.48  ? 249 MET C O   1 
ATOM   3195 C  CB  . MET C 2 167 ? 27.493  13.773  48.290  1.00 47.73  ? 249 MET C CB  1 
ATOM   3196 C  CG  . MET C 2 167 ? 28.822  13.076  48.119  1.00 52.59  ? 249 MET C CG  1 
ATOM   3197 S  SD  . MET C 2 167 ? 29.137  12.674  46.396  1.00 58.01  ? 249 MET C SD  1 
ATOM   3198 C  CE  . MET C 2 167 ? 30.304  13.965  45.959  1.00 52.48  ? 249 MET C CE  1 
ATOM   3199 N  N   . ASN C 2 168 ? 25.628  16.291  48.553  1.00 45.10  ? 250 ASN C N   1 
ATOM   3200 C  CA  . ASN C 2 168 ? 24.312  16.851  48.781  1.00 48.18  ? 250 ASN C CA  1 
ATOM   3201 C  C   . ASN C 2 168 ? 23.913  17.769  47.637  1.00 48.55  ? 250 ASN C C   1 
ATOM   3202 O  O   . ASN C 2 168 ? 22.777  17.695  47.155  1.00 49.78  ? 250 ASN C O   1 
ATOM   3203 C  CB  . ASN C 2 168 ? 24.272  17.579  50.119  1.00 55.11  ? 250 ASN C CB  1 
ATOM   3204 C  CG  . ASN C 2 168 ? 22.892  18.115  50.442  1.00 65.39  ? 250 ASN C CG  1 
ATOM   3205 O  OD1 . ASN C 2 168 ? 22.628  19.312  50.302  1.00 69.22  ? 250 ASN C OD1 1 
ATOM   3206 N  ND2 . ASN C 2 168 ? 21.997  17.233  50.876  1.00 69.52  ? 250 ASN C ND2 1 
ATOM   3207 N  N   . GLU C 2 169 ? 24.840  18.606  47.152  1.00 48.41  ? 251 GLU C N   1 
ATOM   3208 C  CA  . GLU C 2 169 ? 24.510  19.476  46.020  1.00 48.84  ? 251 GLU C CA  1 
ATOM   3209 C  C   . GLU C 2 169 ? 24.077  18.662  44.813  1.00 52.05  ? 251 GLU C C   1 
ATOM   3210 O  O   . GLU C 2 169 ? 23.055  18.960  44.182  1.00 57.89  ? 251 GLU C O   1 
ATOM   3211 C  CB  . GLU C 2 169 ? 25.691  20.370  45.646  1.00 51.06  ? 251 GLU C CB  1 
ATOM   3212 C  CG  . GLU C 2 169 ? 26.041  21.397  46.693  1.00 62.09  ? 251 GLU C CG  1 
ATOM   3213 C  CD  . GLU C 2 169 ? 25.123  22.628  46.707  1.00 73.05  ? 251 GLU C CD  1 
ATOM   3214 O  OE1 . GLU C 2 169 ? 23.879  22.487  46.586  1.00 73.65  ? 251 GLU C OE1 1 
ATOM   3215 O  OE2 . GLU C 2 169 ? 25.656  23.753  46.877  1.00 78.06  ? 251 GLU C OE2 1 
ATOM   3216 N  N   . ILE C 2 170 ? 24.853  17.630  44.471  1.00 49.63  ? 252 ILE C N   1 
ATOM   3217 C  CA  . ILE C 2 170 ? 24.501  16.775  43.343  1.00 49.10  ? 252 ILE C CA  1 
ATOM   3218 C  C   . ILE C 2 170 ? 23.110  16.198  43.529  1.00 52.60  ? 252 ILE C C   1 
ATOM   3219 O  O   . ILE C 2 170 ? 22.305  16.152  42.589  1.00 55.22  ? 252 ILE C O   1 
ATOM   3220 C  CB  . ILE C 2 170 ? 25.553  15.669  43.181  1.00 48.23  ? 252 ILE C CB  1 
ATOM   3221 C  CG1 . ILE C 2 170 ? 26.848  16.281  42.638  1.00 45.09  ? 252 ILE C CG1 1 
ATOM   3222 C  CG2 . ILE C 2 170 ? 25.030  14.568  42.297  1.00 40.13  ? 252 ILE C CG2 1 
ATOM   3223 C  CD1 . ILE C 2 170 ? 28.037  15.389  42.712  1.00 42.15  ? 252 ILE C CD1 1 
ATOM   3224 N  N   . GLU C 2 171 ? 22.790  15.781  44.758  1.00 53.37  ? 253 GLU C N   1 
ATOM   3225 C  CA  . GLU C 2 171 ? 21.488  15.175  45.012  1.00 52.40  ? 253 GLU C CA  1 
ATOM   3226 C  C   . GLU C 2 171 ? 20.350  16.197  44.977  1.00 49.93  ? 253 GLU C C   1 
ATOM   3227 O  O   . GLU C 2 171 ? 19.240  15.860  44.571  1.00 53.69  ? 253 GLU C O   1 
ATOM   3228 C  CB  . GLU C 2 171 ? 21.524  14.435  46.346  1.00 54.21  ? 253 GLU C CB  1 
ATOM   3229 C  CG  . GLU C 2 171 ? 22.367  13.168  46.319  1.00 57.46  ? 253 GLU C CG  1 
ATOM   3230 C  CD  . GLU C 2 171 ? 21.698  12.020  45.568  1.00 63.09  ? 253 GLU C CD  1 
ATOM   3231 O  OE1 . GLU C 2 171 ? 20.520  12.182  45.188  1.00 68.35  ? 253 GLU C OE1 1 
ATOM   3232 O  OE2 . GLU C 2 171 ? 22.336  10.954  45.381  1.00 62.39  ? 253 GLU C OE2 1 
ATOM   3233 N  N   . VAL C 2 172 ? 20.593  17.446  45.364  1.00 48.40  ? 254 VAL C N   1 
ATOM   3234 C  CA  . VAL C 2 172 ? 19.547  18.465  45.274  1.00 49.60  ? 254 VAL C CA  1 
ATOM   3235 C  C   . VAL C 2 172 ? 19.151  18.691  43.822  1.00 52.86  ? 254 VAL C C   1 
ATOM   3236 O  O   . VAL C 2 172 ? 17.963  18.674  43.476  1.00 55.28  ? 254 VAL C O   1 
ATOM   3237 C  CB  . VAL C 2 172 ? 20.009  19.771  45.949  1.00 48.43  ? 254 VAL C CB  1 
ATOM   3238 C  CG1 . VAL C 2 172 ? 19.210  20.935  45.440  1.00 50.11  ? 254 VAL C CG1 1 
ATOM   3239 C  CG2 . VAL C 2 172 ? 19.859  19.663  47.459  1.00 50.48  ? 254 VAL C CG2 1 
ATOM   3240 N  N   . CYS C 2 173 ? 20.148  18.923  42.949  1.00 51.95  ? 255 CYS C N   1 
ATOM   3241 C  CA  . CYS C 2 173 ? 19.932  18.985  41.507  1.00 50.08  ? 255 CYS C CA  1 
ATOM   3242 C  C   . CYS C 2 173 ? 21.224  18.753  40.730  1.00 47.29  ? 255 CYS C C   1 
ATOM   3243 O  O   . CYS C 2 173 ? 22.122  19.602  40.735  1.00 43.51  ? 255 CYS C O   1 
ATOM   3244 C  CB  . CYS C 2 173 ? 19.320  20.321  41.076  1.00 49.37  ? 255 CYS C CB  1 
ATOM   3245 S  SG  . CYS C 2 173 ? 18.923  20.360  39.268  1.00 51.52  ? 255 CYS C SG  1 
ATOM   3246 N  N   . PRO C 2 174 ? 21.332  17.622  40.034  1.00 46.15  ? 256 PRO C N   1 
ATOM   3247 C  CA  . PRO C 2 174 ? 22.513  17.387  39.181  1.00 46.10  ? 256 PRO C CA  1 
ATOM   3248 C  C   . PRO C 2 174 ? 22.731  18.467  38.139  1.00 49.24  ? 256 PRO C C   1 
ATOM   3249 O  O   . PRO C 2 174 ? 23.877  18.849  37.873  1.00 48.05  ? 256 PRO C O   1 
ATOM   3250 C  CB  . PRO C 2 174 ? 22.197  16.045  38.510  1.00 43.95  ? 256 PRO C CB  1 
ATOM   3251 C  CG  . PRO C 2 174 ? 21.105  15.436  39.330  1.00 45.24  ? 256 PRO C CG  1 
ATOM   3252 C  CD  . PRO C 2 174 ? 20.335  16.543  39.946  1.00 44.62  ? 256 PRO C CD  1 
ATOM   3253 N  N   . GLU C 2 175 ? 21.655  18.955  37.516  1.00 54.88  ? 257 GLU C N   1 
ATOM   3254 C  CA  . GLU C 2 175 ? 21.800  19.902  36.409  1.00 56.10  ? 257 GLU C CA  1 
ATOM   3255 C  C   . GLU C 2 175 ? 22.277  21.257  36.912  1.00 51.34  ? 257 GLU C C   1 
ATOM   3256 O  O   . GLU C 2 175 ? 23.205  21.855  36.349  1.00 51.38  ? 257 GLU C O   1 
ATOM   3257 C  CB  . GLU C 2 175 ? 20.477  20.023  35.648  1.00 59.09  ? 257 GLU C CB  1 
ATOM   3258 C  CG  . GLU C 2 175 ? 19.977  18.685  35.146  1.00 65.70  ? 257 GLU C CG  1 
ATOM   3259 C  CD  . GLU C 2 175 ? 18.605  18.750  34.517  1.00 71.85  ? 257 GLU C CD  1 
ATOM   3260 O  OE1 . GLU C 2 175 ? 18.541  18.938  33.289  1.00 74.80  ? 257 GLU C OE1 1 
ATOM   3261 O  OE2 . GLU C 2 175 ? 17.592  18.605  35.240  1.00 74.13  ? 257 GLU C OE2 1 
ATOM   3262 N  N   . CYS C 2 176 ? 21.656  21.751  37.979  1.00 48.75  ? 258 CYS C N   1 
ATOM   3263 C  CA  . CYS C 2 176 ? 22.197  22.898  38.690  1.00 48.33  ? 258 CYS C CA  1 
ATOM   3264 C  C   . CYS C 2 176 ? 23.680  22.716  38.962  1.00 47.17  ? 258 CYS C C   1 
ATOM   3265 O  O   . CYS C 2 176 ? 24.499  23.585  38.632  1.00 47.26  ? 258 CYS C O   1 
ATOM   3266 C  CB  . CYS C 2 176 ? 21.448  23.078  39.998  1.00 50.61  ? 258 CYS C CB  1 
ATOM   3267 S  SG  . CYS C 2 176 ? 19.999  24.086  39.841  1.00 58.25  ? 258 CYS C SG  1 
ATOM   3268 N  N   . TYR C 2 177 ? 24.039  21.564  39.541  1.00 42.80  ? 259 TYR C N   1 
ATOM   3269 C  CA  . TYR C 2 177 ? 25.416  21.318  39.949  1.00 41.52  ? 259 TYR C CA  1 
ATOM   3270 C  C   . TYR C 2 177 ? 26.366  21.445  38.768  1.00 43.84  ? 259 TYR C C   1 
ATOM   3271 O  O   . TYR C 2 177 ? 27.338  22.207  38.813  1.00 42.61  ? 259 TYR C O   1 
ATOM   3272 C  CB  . TYR C 2 177 ? 25.534  19.936  40.587  1.00 42.86  ? 259 TYR C CB  1 
ATOM   3273 C  CG  . TYR C 2 177 ? 26.892  19.661  41.175  1.00 43.54  ? 259 TYR C CG  1 
ATOM   3274 C  CD1 . TYR C 2 177 ? 27.266  20.214  42.399  1.00 42.69  ? 259 TYR C CD1 1 
ATOM   3275 C  CD2 . TYR C 2 177 ? 27.808  18.864  40.504  1.00 44.60  ? 259 TYR C CD2 1 
ATOM   3276 C  CE1 . TYR C 2 177 ? 28.522  19.980  42.939  1.00 43.81  ? 259 TYR C CE1 1 
ATOM   3277 C  CE2 . TYR C 2 177 ? 29.070  18.618  41.037  1.00 46.74  ? 259 TYR C CE2 1 
ATOM   3278 C  CZ  . TYR C 2 177 ? 29.416  19.177  42.250  1.00 46.90  ? 259 TYR C CZ  1 
ATOM   3279 O  OH  . TYR C 2 177 ? 30.653  18.926  42.776  1.00 48.40  ? 259 TYR C OH  1 
ATOM   3280 N  N   . LEU C 2 178 ? 26.089  20.715  37.692  1.00 44.98  ? 260 LEU C N   1 
ATOM   3281 C  CA  . LEU C 2 178 ? 26.959  20.778  36.527  1.00 48.67  ? 260 LEU C CA  1 
ATOM   3282 C  C   . LEU C 2 178 ? 27.054  22.200  35.974  1.00 51.94  ? 260 LEU C C   1 
ATOM   3283 O  O   . LEU C 2 178 ? 28.153  22.673  35.646  1.00 53.24  ? 260 LEU C O   1 
ATOM   3284 C  CB  . LEU C 2 178 ? 26.460  19.807  35.463  1.00 47.15  ? 260 LEU C CB  1 
ATOM   3285 C  CG  . LEU C 2 178 ? 27.096  19.993  34.088  1.00 49.90  ? 260 LEU C CG  1 
ATOM   3286 C  CD1 . LEU C 2 178 ? 28.571  19.585  34.088  1.00 51.30  ? 260 LEU C CD1 1 
ATOM   3287 C  CD2 . LEU C 2 178 ? 26.323  19.211  33.074  1.00 50.08  ? 260 LEU C CD2 1 
ATOM   3288 N  N   . ALA C 2 179 ? 25.919  22.909  35.877  1.00 53.66  ? 261 ALA C N   1 
ATOM   3289 C  CA  . ALA C 2 179 ? 25.979  24.268  35.335  1.00 59.40  ? 261 ALA C CA  1 
ATOM   3290 C  C   . ALA C 2 179 ? 26.800  25.190  36.232  1.00 58.33  ? 261 ALA C C   1 
ATOM   3291 O  O   . ALA C 2 179 ? 27.444  26.127  35.739  1.00 58.97  ? 261 ALA C O   1 
ATOM   3292 C  CB  . ALA C 2 179 ? 24.576  24.839  35.127  1.00 43.77  ? 261 ALA C CB  1 
ATOM   3293 N  N   . ALA C 2 180 ? 26.806  24.929  37.543  1.00 54.15  ? 262 ALA C N   1 
ATOM   3294 C  CA  . ALA C 2 180 ? 27.590  25.746  38.460  1.00 51.76  ? 262 ALA C CA  1 
ATOM   3295 C  C   . ALA C 2 180 ? 29.058  25.367  38.432  1.00 56.74  ? 262 ALA C C   1 
ATOM   3296 O  O   . ALA C 2 180 ? 29.921  26.198  38.726  1.00 57.75  ? 262 ALA C O   1 
ATOM   3297 C  CB  . ALA C 2 180 ? 27.053  25.611  39.877  1.00 42.44  ? 262 ALA C CB  1 
ATOM   3298 N  N   . CYS C 2 181 ? 29.354  24.119  38.090  1.00 59.32  ? 263 CYS C N   1 
ATOM   3299 C  CA  . CYS C 2 181 ? 30.741  23.706  37.972  1.00 62.74  ? 263 CYS C CA  1 
ATOM   3300 C  C   . CYS C 2 181 ? 31.369  24.308  36.726  1.00 66.86  ? 263 CYS C C   1 
ATOM   3301 O  O   . CYS C 2 181 ? 32.462  24.878  36.782  1.00 68.55  ? 263 CYS C O   1 
ATOM   3302 C  CB  . CYS C 2 181 ? 30.825  22.182  37.971  1.00 63.97  ? 263 CYS C CB  1 
ATOM   3303 S  SG  . CYS C 2 181 ? 30.428  21.470  39.608  1.00 63.83  ? 263 CYS C SG  1 
ATOM   3304 N  N   . GLN C 2 182 ? 30.669  24.245  35.599  1.00 70.00  ? 264 GLN C N   1 
ATOM   3305 C  CA  . GLN C 2 182 ? 31.262  24.778  34.381  1.00 75.59  ? 264 GLN C CA  1 
ATOM   3306 C  C   . GLN C 2 182 ? 31.276  26.304  34.375  1.00 77.66  ? 264 GLN C C   1 
ATOM   3307 O  O   . GLN C 2 182 ? 32.249  26.912  33.920  1.00 81.52  ? 264 GLN C O   1 
ATOM   3308 C  CB  . GLN C 2 182 ? 30.528  24.224  33.174  1.00 78.66  ? 264 GLN C CB  1 
ATOM   3309 C  CG  . GLN C 2 182 ? 30.937  22.810  32.887  1.00 80.52  ? 264 GLN C CG  1 
ATOM   3310 C  CD  . GLN C 2 182 ? 29.910  22.094  32.083  1.00 84.98  ? 264 GLN C CD  1 
ATOM   3311 O  OE1 . GLN C 2 182 ? 28.752  22.515  32.020  1.00 86.10  ? 264 GLN C OE1 1 
ATOM   3312 N  NE2 . GLN C 2 182 ? 30.314  21.002  31.450  1.00 88.99  ? 264 GLN C NE2 1 
ATOM   3313 N  N   . LYS C 2 183 ? 30.219  26.939  34.884  1.00 74.64  ? 265 LYS C N   1 
ATOM   3314 C  CA  . LYS C 2 183 ? 30.101  28.399  34.942  1.00 69.08  ? 265 LYS C CA  1 
ATOM   3315 C  C   . LYS C 2 183 ? 30.228  29.017  33.548  1.00 74.39  ? 265 LYS C C   1 
ATOM   3316 O  O   . LYS C 2 183 ? 31.056  29.890  33.300  1.00 79.14  ? 265 LYS C O   1 
ATOM   3317 C  CB  . LYS C 2 183 ? 31.123  29.006  35.911  1.00 60.07  ? 265 LYS C CB  1 
ATOM   3318 N  N   . ARG C 2 184 ? 29.381  28.557  32.634  1.00 73.20  ? 266 ARG C N   1 
ATOM   3319 C  CA  . ARG C 2 184 ? 29.371  29.131  31.295  1.00 77.26  ? 266 ARG C CA  1 
ATOM   3320 C  C   . ARG C 2 184 ? 28.616  30.459  31.311  1.00 81.47  ? 266 ARG C C   1 
ATOM   3321 O  O   . ARG C 2 184 ? 28.291  31.007  32.368  1.00 81.54  ? 266 ARG C O   1 
ATOM   3322 C  CB  . ARG C 2 184 ? 28.780  28.143  30.298  1.00 74.27  ? 266 ARG C CB  1 
ATOM   3323 C  CG  . ARG C 2 184 ? 29.627  26.906  30.127  1.00 75.95  ? 266 ARG C CG  1 
ATOM   3324 C  CD  . ARG C 2 184 ? 28.969  25.889  29.201  1.00 78.11  ? 266 ARG C CD  1 
ATOM   3325 N  NE  . ARG C 2 184 ? 29.632  24.584  29.274  1.00 80.83  ? 266 ARG C NE  1 
ATOM   3326 C  CZ  . ARG C 2 184 ? 30.715  24.243  28.579  1.00 87.70  ? 266 ARG C CZ  1 
ATOM   3327 N  NH1 . ARG C 2 184 ? 31.271  25.105  27.726  1.00 94.78  ? 266 ARG C NH1 1 
ATOM   3328 N  NH2 . ARG C 2 184 ? 31.241  23.032  28.728  1.00 87.30  ? 266 ARG C NH2 1 
ATOM   3329 N  N   . ASP C 2 185 ? 28.328  30.990  30.123  1.00 89.15  ? 267 ASP C N   1 
ATOM   3330 C  CA  . ASP C 2 185 ? 27.661  32.280  29.995  1.00 90.86  ? 267 ASP C CA  1 
ATOM   3331 C  C   . ASP C 2 185 ? 26.292  32.242  30.654  1.00 85.00  ? 267 ASP C C   1 
ATOM   3332 O  O   . ASP C 2 185 ? 25.405  31.504  30.216  1.00 83.93  ? 267 ASP C O   1 
ATOM   3333 C  CB  . ASP C 2 185 ? 27.523  32.661  28.519  1.00 103.54 ? 267 ASP C CB  1 
ATOM   3334 C  CG  . ASP C 2 185 ? 28.796  33.262  27.944  1.00 115.92 ? 267 ASP C CG  1 
ATOM   3335 O  OD1 . ASP C 2 185 ? 28.999  33.203  26.706  1.00 120.85 ? 267 ASP C OD1 1 
ATOM   3336 O  OD2 . ASP C 2 185 ? 29.602  33.793  28.736  1.00 118.60 ? 267 ASP C OD2 1 
ATOM   3337 N  N   . ASN C 2 186 ? 26.121  33.048  31.701  1.00 74.59  ? 268 ASN C N   1 
ATOM   3338 C  CA  . ASN C 2 186 ? 24.846  33.148  32.412  1.00 69.33  ? 268 ASN C CA  1 
ATOM   3339 C  C   . ASN C 2 186 ? 24.373  31.788  32.906  1.00 63.73  ? 268 ASN C C   1 
ATOM   3340 O  O   . ASN C 2 186 ? 23.195  31.447  32.777  1.00 63.33  ? 268 ASN C O   1 
ATOM   3341 C  CB  . ASN C 2 186 ? 23.755  33.774  31.547  1.00 67.56  ? 268 ASN C CB  1 
ATOM   3342 C  CG  . ASN C 2 186 ? 23.965  35.230  31.302  1.00 71.29  ? 268 ASN C CG  1 
ATOM   3343 O  OD1 . ASN C 2 186 ? 24.278  35.991  32.215  1.00 73.26  ? 268 ASN C OD1 1 
ATOM   3344 N  ND2 . ASN C 2 186 ? 23.751  35.646  30.064  1.00 73.88  ? 268 ASN C ND2 1 
ATOM   3345 N  N   . TRP C 2 187 ? 25.295  31.006  33.472  1.00 58.32  ? 269 TRP C N   1 
ATOM   3346 C  CA  . TRP C 2 187 ? 24.972  29.628  33.822  1.00 53.16  ? 269 TRP C CA  1 
ATOM   3347 C  C   . TRP C 2 187 ? 23.758  29.542  34.745  1.00 49.71  ? 269 TRP C C   1 
ATOM   3348 O  O   . TRP C 2 187 ? 22.961  28.607  34.642  1.00 50.38  ? 269 TRP C O   1 
ATOM   3349 C  CB  . TRP C 2 187 ? 26.195  28.977  34.455  1.00 54.18  ? 269 TRP C CB  1 
ATOM   3350 C  CG  . TRP C 2 187 ? 26.592  29.668  35.665  1.00 55.25  ? 269 TRP C CG  1 
ATOM   3351 C  CD1 . TRP C 2 187 ? 27.433  30.730  35.761  1.00 58.60  ? 269 TRP C CD1 1 
ATOM   3352 C  CD2 . TRP C 2 187 ? 26.153  29.376  36.989  1.00 53.10  ? 269 TRP C CD2 1 
ATOM   3353 N  NE1 . TRP C 2 187 ? 27.557  31.119  37.075  1.00 58.16  ? 269 TRP C NE1 1 
ATOM   3354 C  CE2 . TRP C 2 187 ? 26.779  30.302  37.849  1.00 54.21  ? 269 TRP C CE2 1 
ATOM   3355 C  CE3 . TRP C 2 187 ? 25.291  28.418  37.534  1.00 48.32  ? 269 TRP C CE3 1 
ATOM   3356 C  CZ2 . TRP C 2 187 ? 26.564  30.305  39.218  1.00 50.73  ? 269 TRP C CZ2 1 
ATOM   3357 C  CZ3 . TRP C 2 187 ? 25.080  28.418  38.891  1.00 44.74  ? 269 TRP C CZ3 1 
ATOM   3358 C  CH2 . TRP C 2 187 ? 25.707  29.355  39.718  1.00 47.30  ? 269 TRP C CH2 1 
ATOM   3359 N  N   . PHE C 2 188 ? 23.576  30.521  35.624  1.00 49.45  ? 270 PHE C N   1 
ATOM   3360 C  CA  . PHE C 2 188 ? 22.425  30.516  36.510  1.00 45.67  ? 270 PHE C CA  1 
ATOM   3361 C  C   . PHE C 2 188 ? 21.110  30.640  35.757  1.00 45.71  ? 270 PHE C C   1 
ATOM   3362 O  O   . PHE C 2 188 ? 20.071  30.224  36.281  1.00 46.72  ? 270 PHE C O   1 
ATOM   3363 C  CB  . PHE C 2 188 ? 22.540  31.648  37.536  1.00 47.41  ? 270 PHE C CB  1 
ATOM   3364 C  CG  . PHE C 2 188 ? 21.652  31.465  38.723  1.00 45.17  ? 270 PHE C CG  1 
ATOM   3365 C  CD1 . PHE C 2 188 ? 22.010  30.585  39.743  1.00 43.31  ? 270 PHE C CD1 1 
ATOM   3366 C  CD2 . PHE C 2 188 ? 20.448  32.147  38.816  1.00 44.67  ? 270 PHE C CD2 1 
ATOM   3367 C  CE1 . PHE C 2 188 ? 21.180  30.398  40.845  1.00 42.51  ? 270 PHE C CE1 1 
ATOM   3368 C  CE2 . PHE C 2 188 ? 19.608  31.960  39.906  1.00 43.48  ? 270 PHE C CE2 1 
ATOM   3369 C  CZ  . PHE C 2 188 ? 19.974  31.087  40.922  1.00 42.35  ? 270 PHE C CZ  1 
ATOM   3370 N  N   . CYS C 2 189 ? 21.121  31.165  34.542  1.00 46.37  ? 271 CYS C N   1 
ATOM   3371 C  CA  . CYS C 2 189 ? 19.871  31.387  33.828  1.00 50.20  ? 271 CYS C CA  1 
ATOM   3372 C  C   . CYS C 2 189 ? 19.393  30.184  33.017  1.00 52.46  ? 271 CYS C C   1 
ATOM   3373 O  O   . CYS C 2 189 ? 18.355  30.292  32.363  1.00 55.57  ? 271 CYS C O   1 
ATOM   3374 C  CB  . CYS C 2 189 ? 20.004  32.592  32.901  1.00 51.34  ? 271 CYS C CB  1 
ATOM   3375 S  SG  . CYS C 2 189 ? 20.503  34.088  33.749  1.00 53.99  ? 271 CYS C SG  1 
ATOM   3376 N  N   . GLU C 2 190 ? 20.103  29.055  33.032  1.00 52.45  ? 272 GLU C N   1 
ATOM   3377 C  CA  . GLU C 2 190 ? 19.681  27.891  32.250  1.00 57.03  ? 272 GLU C CA  1 
ATOM   3378 C  C   . GLU C 2 190 ? 18.578  27.122  32.968  1.00 55.08  ? 272 GLU C C   1 
ATOM   3379 O  O   . GLU C 2 190 ? 18.796  26.652  34.089  1.00 55.89  ? 272 GLU C O   1 
ATOM   3380 C  CB  . GLU C 2 190 ? 20.854  26.953  31.985  1.00 64.20  ? 272 GLU C CB  1 
ATOM   3381 C  CG  . GLU C 2 190 ? 21.962  27.564  31.165  1.00 72.85  ? 272 GLU C CG  1 
ATOM   3382 C  CD  . GLU C 2 190 ? 21.461  28.175  29.857  1.00 78.20  ? 272 GLU C CD  1 
ATOM   3383 O  OE1 . GLU C 2 190 ? 20.559  27.580  29.208  1.00 76.90  ? 272 GLU C OE1 1 
ATOM   3384 O  OE2 . GLU C 2 190 ? 21.979  29.259  29.490  1.00 82.12  ? 272 GLU C OE2 1 
ATOM   3385 N  N   . PRO C 2 191 ? 17.406  26.946  32.363  1.00 52.19  ? 273 PRO C N   1 
ATOM   3386 C  CA  . PRO C 2 191 ? 16.392  26.097  32.977  1.00 52.70  ? 273 PRO C CA  1 
ATOM   3387 C  C   . PRO C 2 191 ? 16.877  24.659  33.079  1.00 53.08  ? 273 PRO C C   1 
ATOM   3388 O  O   . PRO C 2 191 ? 17.599  24.164  32.209  1.00 50.12  ? 273 PRO C O   1 
ATOM   3389 C  CB  . PRO C 2 191 ? 15.206  26.211  32.013  1.00 53.05  ? 273 PRO C CB  1 
ATOM   3390 C  CG  . PRO C 2 191 ? 15.445  27.409  31.243  1.00 53.35  ? 273 PRO C CG  1 
ATOM   3391 C  CD  . PRO C 2 191 ? 16.926  27.515  31.101  1.00 54.43  ? 273 PRO C CD  1 
ATOM   3392 N  N   . CYS C 2 192 ? 16.469  23.992  34.159  1.00 53.62  ? 274 CYS C N   1 
ATOM   3393 C  CA  . CYS C 2 192 ? 16.669  22.559  34.304  1.00 54.71  ? 274 CYS C CA  1 
ATOM   3394 C  C   . CYS C 2 192 ? 15.530  21.796  33.652  1.00 54.75  ? 274 CYS C C   1 
ATOM   3395 O  O   . CYS C 2 192 ? 14.441  22.330  33.437  1.00 51.71  ? 274 CYS C O   1 
ATOM   3396 C  CB  . CYS C 2 192 ? 16.767  22.173  35.772  1.00 58.84  ? 274 CYS C CB  1 
ATOM   3397 S  SG  . CYS C 2 192 ? 18.069  23.079  36.580  1.00 66.50  ? 274 CYS C SG  1 
ATOM   3398 N  N   . SER C 2 193 ? 15.798  20.516  33.365  1.00 57.19  ? 275 SER C N   1 
ATOM   3399 C  CA  . SER C 2 193 ? 14.841  19.660  32.667  1.00 58.44  ? 275 SER C CA  1 
ATOM   3400 C  C   . SER C 2 193 ? 13.501  19.590  33.377  1.00 59.80  ? 275 SER C C   1 
ATOM   3401 O  O   . SER C 2 193 ? 12.452  19.586  32.727  1.00 60.40  ? 275 SER C O   1 
ATOM   3402 C  CB  . SER C 2 193 ? 15.416  18.261  32.515  1.00 60.59  ? 275 SER C CB  1 
ATOM   3403 O  OG  . SER C 2 193 ? 16.499  18.286  31.614  1.00 63.42  ? 275 SER C OG  1 
ATOM   3404 N  N   . ASN C 2 194 ? 13.508  19.489  34.703  1.00 68.54  ? 276 ASN C N   1 
ATOM   3405 C  CA  . ASN C 2 194 ? 12.292  19.759  35.462  1.00 70.60  ? 276 ASN C CA  1 
ATOM   3406 C  C   . ASN C 2 194 ? 12.455  21.113  36.147  1.00 68.22  ? 276 ASN C C   1 
ATOM   3407 O  O   . ASN C 2 194 ? 13.082  21.202  37.219  1.00 68.16  ? 276 ASN C O   1 
ATOM   3408 C  CB  . ASN C 2 194 ? 12.005  18.658  36.486  1.00 78.05  ? 276 ASN C CB  1 
ATOM   3409 C  CG  . ASN C 2 194 ? 10.589  18.738  37.044  1.00 85.21  ? 276 ASN C CG  1 
ATOM   3410 O  OD1 . ASN C 2 194 ? 9.684   19.290  36.410  1.00 86.31  ? 276 ASN C OD1 1 
ATOM   3411 N  ND2 . ASN C 2 194 ? 10.400  18.209  38.250  1.00 88.47  ? 276 ASN C ND2 1 
ATOM   3412 N  N   . PRO C 2 195 ? 11.924  22.191  35.574  1.00 58.38  ? 277 PRO C N   1 
ATOM   3413 C  CA  . PRO C 2 195 ? 12.321  23.528  36.018  1.00 55.01  ? 277 PRO C CA  1 
ATOM   3414 C  C   . PRO C 2 195 ? 11.749  23.856  37.385  1.00 53.88  ? 277 PRO C C   1 
ATOM   3415 O  O   . PRO C 2 195 ? 10.554  23.678  37.637  1.00 55.65  ? 277 PRO C O   1 
ATOM   3416 C  CB  . PRO C 2 195 ? 11.745  24.441  34.938  1.00 53.48  ? 277 PRO C CB  1 
ATOM   3417 C  CG  . PRO C 2 195 ? 10.593  23.694  34.417  1.00 54.93  ? 277 PRO C CG  1 
ATOM   3418 C  CD  . PRO C 2 195 ? 10.941  22.244  34.485  1.00 57.44  ? 277 PRO C CD  1 
ATOM   3419 N  N   . HIS C 2 196 ? 12.616  24.346  38.255  1.00 50.85  ? 278 HIS C N   1 
ATOM   3420 C  CA  . HIS C 2 196 ? 12.198  24.789  39.570  1.00 52.63  ? 278 HIS C CA  1 
ATOM   3421 C  C   . HIS C 2 196 ? 11.316  26.026  39.463  1.00 50.65  ? 278 HIS C C   1 
ATOM   3422 O  O   . HIS C 2 196 ? 11.678  26.983  38.772  1.00 50.91  ? 278 HIS C O   1 
ATOM   3423 C  CB  . HIS C 2 196 ? 13.415  25.095  40.402  1.00 52.64  ? 278 HIS C CB  1 
ATOM   3424 C  CG  . HIS C 2 196 ? 14.523  24.119  40.199  1.00 53.79  ? 278 HIS C CG  1 
ATOM   3425 N  ND1 . HIS C 2 196 ? 14.490  22.845  40.720  1.00 54.31  ? 278 HIS C ND1 1 
ATOM   3426 C  CD2 . HIS C 2 196 ? 15.696  24.227  39.534  1.00 53.04  ? 278 HIS C CD2 1 
ATOM   3427 C  CE1 . HIS C 2 196 ? 15.598  22.211  40.386  1.00 53.85  ? 278 HIS C CE1 1 
ATOM   3428 N  NE2 . HIS C 2 196 ? 16.346  23.027  39.666  1.00 53.18  ? 278 HIS C NE2 1 
ATOM   3429 N  N   . PRO C 2 197 ? 10.168  26.049  40.126  1.00 49.74  ? 279 PRO C N   1 
ATOM   3430 C  CA  . PRO C 2 197 ? 9.308   27.235  40.057  1.00 48.86  ? 279 PRO C CA  1 
ATOM   3431 C  C   . PRO C 2 197 ? 10.027  28.444  40.627  1.00 46.64  ? 279 PRO C C   1 
ATOM   3432 O  O   . PRO C 2 197 ? 10.807  28.327  41.572  1.00 47.75  ? 279 PRO C O   1 
ATOM   3433 C  CB  . PRO C 2 197 ? 8.091   26.846  40.912  1.00 51.75  ? 279 PRO C CB  1 
ATOM   3434 C  CG  . PRO C 2 197 ? 8.154   25.342  41.043  1.00 49.03  ? 279 PRO C CG  1 
ATOM   3435 C  CD  . PRO C 2 197 ? 9.618   25.005  41.006  1.00 46.53  ? 279 PRO C CD  1 
ATOM   3436 N  N   . LEU C 2 198 ? 9.763   29.609  40.033  1.00 37.47  ? 280 LEU C N   1 
ATOM   3437 C  CA  . LEU C 2 198 ? 10.326  30.876  40.492  1.00 37.24  ? 280 LEU C CA  1 
ATOM   3438 C  C   . LEU C 2 198 ? 9.422   31.499  41.538  1.00 38.57  ? 280 LEU C C   1 
ATOM   3439 O  O   . LEU C 2 198 ? 8.201   31.545  41.375  1.00 39.85  ? 280 LEU C O   1 
ATOM   3440 C  CB  . LEU C 2 198 ? 10.506  31.865  39.344  1.00 42.14  ? 280 LEU C CB  1 
ATOM   3441 C  CG  . LEU C 2 198 ? 11.413  31.466  38.180  1.00 45.83  ? 280 LEU C CG  1 
ATOM   3442 C  CD1 . LEU C 2 198 ? 11.824  32.737  37.409  1.00 47.80  ? 280 LEU C CD1 1 
ATOM   3443 C  CD2 . LEU C 2 198 ? 12.629  30.666  38.641  1.00 41.39  ? 280 LEU C CD2 1 
ATOM   3444 N  N   . VAL C 2 199 ? 10.031  32.000  42.609  1.00 39.00  ? 281 VAL C N   1 
ATOM   3445 C  CA  . VAL C 2 199 ? 9.282   32.459  43.766  1.00 41.49  ? 281 VAL C CA  1 
ATOM   3446 C  C   . VAL C 2 199 ? 9.881   33.752  44.285  1.00 45.42  ? 281 VAL C C   1 
ATOM   3447 O  O   . VAL C 2 199 ? 11.037  34.085  44.014  1.00 35.80  ? 281 VAL C O   1 
ATOM   3448 C  CB  . VAL C 2 199 ? 9.267   31.396  44.888  1.00 39.80  ? 281 VAL C CB  1 
ATOM   3449 C  CG1 . VAL C 2 199 ? 8.485   30.194  44.447  1.00 36.60  ? 281 VAL C CG1 1 
ATOM   3450 C  CG2 . VAL C 2 199 ? 10.679  30.976  45.240  1.00 35.38  ? 281 VAL C CG2 1 
ATOM   3451 N  N   . TRP C 2 200 ? 9.057   34.492  45.027  1.00 45.59  ? 282 TRP C N   1 
ATOM   3452 C  CA  . TRP C 2 200 ? 9.549   35.501  45.962  1.00 45.13  ? 282 TRP C CA  1 
ATOM   3453 C  C   . TRP C 2 200 ? 9.906   34.787  47.260  1.00 46.25  ? 282 TRP C C   1 
ATOM   3454 O  O   . TRP C 2 200 ? 9.027   34.273  47.964  1.00 46.07  ? 282 TRP C O   1 
ATOM   3455 C  CB  . TRP C 2 200 ? 8.514   36.593  46.215  1.00 43.90  ? 282 TRP C CB  1 
ATOM   3456 C  CG  . TRP C 2 200 ? 8.082   37.311  44.997  1.00 44.26  ? 282 TRP C CG  1 
ATOM   3457 C  CD1 . TRP C 2 200 ? 6.908   37.162  44.344  1.00 46.75  ? 282 TRP C CD1 1 
ATOM   3458 C  CD2 . TRP C 2 200 ? 8.818   38.308  44.282  1.00 45.56  ? 282 TRP C CD2 1 
ATOM   3459 N  NE1 . TRP C 2 200 ? 6.858   37.994  43.251  1.00 49.12  ? 282 TRP C NE1 1 
ATOM   3460 C  CE2 . TRP C 2 200 ? 8.018   38.716  43.193  1.00 47.30  ? 282 TRP C CE2 1 
ATOM   3461 C  CE3 . TRP C 2 200 ? 10.082  38.886  44.448  1.00 42.96  ? 282 TRP C CE3 1 
ATOM   3462 C  CZ2 . TRP C 2 200 ? 8.437   39.676  42.273  1.00 45.18  ? 282 TRP C CZ2 1 
ATOM   3463 C  CZ3 . TRP C 2 200 ? 10.493  39.847  43.545  1.00 41.88  ? 282 TRP C CZ3 1 
ATOM   3464 C  CH2 . TRP C 2 200 ? 9.678   40.226  42.461  1.00 41.93  ? 282 TRP C CH2 1 
ATOM   3465 N  N   . ALA C 2 201 ? 11.193  34.727  47.563  1.00 47.64  ? 283 ALA C N   1 
ATOM   3466 C  CA  . ALA C 2 201 ? 11.683  34.148  48.803  1.00 47.74  ? 283 ALA C CA  1 
ATOM   3467 C  C   . ALA C 2 201 ? 11.889  35.266  49.808  1.00 50.26  ? 283 ALA C C   1 
ATOM   3468 O  O   . ALA C 2 201 ? 12.162  36.408  49.429  1.00 54.70  ? 283 ALA C O   1 
ATOM   3469 C  CB  . ALA C 2 201 ? 12.992  33.388  48.573  1.00 46.28  ? 283 ALA C CB  1 
ATOM   3470 N  N   . LYS C 2 202 ? 11.744  34.951  51.094  1.00 50.06  ? 284 LYS C N   1 
ATOM   3471 C  CA  . LYS C 2 202 ? 11.938  35.985  52.103  1.00 53.04  ? 284 LYS C CA  1 
ATOM   3472 C  C   . LYS C 2 202 ? 12.714  35.468  53.302  1.00 54.38  ? 284 LYS C C   1 
ATOM   3473 O  O   . LYS C 2 202 ? 12.270  34.535  53.982  1.00 55.84  ? 284 LYS C O   1 
ATOM   3474 C  CB  . LYS C 2 202 ? 10.608  36.588  52.549  1.00 51.14  ? 284 LYS C CB  1 
ATOM   3475 C  CG  . LYS C 2 202 ? 10.845  37.724  53.510  1.00 49.96  ? 284 LYS C CG  1 
ATOM   3476 C  CD  . LYS C 2 202 ? 9.970   38.889  53.221  1.00 49.92  ? 284 LYS C CD  1 
ATOM   3477 C  CE  . LYS C 2 202 ? 10.522  40.104  53.928  1.00 52.55  ? 284 LYS C CE  1 
ATOM   3478 N  NZ  . LYS C 2 202 ? 11.445  39.775  55.076  1.00 51.69  ? 284 LYS C NZ  1 
ATOM   3479 N  N   . LEU C 2 203 ? 13.859  36.097  53.567  1.00 52.33  ? 285 LEU C N   1 
ATOM   3480 C  CA  . LEU C 2 203 ? 14.613  35.920  54.802  1.00 53.97  ? 285 LEU C CA  1 
ATOM   3481 C  C   . LEU C 2 203 ? 14.301  37.048  55.786  1.00 59.24  ? 285 LEU C C   1 
ATOM   3482 O  O   . LEU C 2 203 ? 13.900  38.154  55.398  1.00 60.34  ? 285 LEU C O   1 
ATOM   3483 C  CB  . LEU C 2 203 ? 16.117  35.893  54.520  1.00 52.08  ? 285 LEU C CB  1 
ATOM   3484 C  CG  . LEU C 2 203 ? 16.641  34.845  53.547  1.00 48.92  ? 285 LEU C CG  1 
ATOM   3485 C  CD1 . LEU C 2 203 ? 18.049  35.217  53.078  1.00 43.05  ? 285 LEU C CD1 1 
ATOM   3486 C  CD2 . LEU C 2 203 ? 16.631  33.500  54.252  1.00 50.25  ? 285 LEU C CD2 1 
ATOM   3487 N  N   . LYS C 2 204 ? 14.488  36.763  57.075  1.00 58.75  ? 286 LYS C N   1 
ATOM   3488 C  CA  . LYS C 2 204 ? 14.312  37.821  58.060  1.00 59.11  ? 286 LYS C CA  1 
ATOM   3489 C  C   . LYS C 2 204 ? 15.222  38.988  57.707  1.00 60.31  ? 286 LYS C C   1 
ATOM   3490 O  O   . LYS C 2 204 ? 16.371  38.799  57.297  1.00 60.24  ? 286 LYS C O   1 
ATOM   3491 C  CB  . LYS C 2 204 ? 14.607  37.328  59.482  1.00 59.68  ? 286 LYS C CB  1 
ATOM   3492 N  N   . GLY C 2 205 ? 14.669  40.195  57.800  1.00 63.65  ? 287 GLY C N   1 
ATOM   3493 C  CA  . GLY C 2 205 ? 15.415  41.426  57.629  1.00 64.02  ? 287 GLY C CA  1 
ATOM   3494 C  C   . GLY C 2 205 ? 15.934  41.700  56.241  1.00 63.63  ? 287 GLY C C   1 
ATOM   3495 O  O   . GLY C 2 205 ? 16.793  42.570  56.086  1.00 67.42  ? 287 GLY C O   1 
ATOM   3496 N  N   . PHE C 2 206 ? 15.447  40.990  55.231  1.00 60.20  ? 288 PHE C N   1 
ATOM   3497 C  CA  . PHE C 2 206 ? 15.854  41.167  53.851  1.00 58.12  ? 288 PHE C CA  1 
ATOM   3498 C  C   . PHE C 2 206 ? 14.599  41.207  52.987  1.00 57.27  ? 288 PHE C C   1 
ATOM   3499 O  O   . PHE C 2 206 ? 13.654  40.459  53.251  1.00 54.70  ? 288 PHE C O   1 
ATOM   3500 C  CB  . PHE C 2 206 ? 16.778  40.008  53.427  1.00 53.06  ? 288 PHE C CB  1 
ATOM   3501 C  CG  . PHE C 2 206 ? 17.564  40.265  52.174  1.00 49.91  ? 288 PHE C CG  1 
ATOM   3502 C  CD1 . PHE C 2 206 ? 18.606  41.181  52.156  1.00 52.61  ? 288 PHE C CD1 1 
ATOM   3503 C  CD2 . PHE C 2 206 ? 17.269  39.576  51.017  1.00 46.37  ? 288 PHE C CD2 1 
ATOM   3504 C  CE1 . PHE C 2 206 ? 19.335  41.414  50.989  1.00 52.56  ? 288 PHE C CE1 1 
ATOM   3505 C  CE2 . PHE C 2 206 ? 17.993  39.790  49.856  1.00 47.64  ? 288 PHE C CE2 1 
ATOM   3506 C  CZ  . PHE C 2 206 ? 19.019  40.711  49.834  1.00 49.94  ? 288 PHE C CZ  1 
ATOM   3507 N  N   . PRO C 2 207 ? 14.546  42.061  51.963  1.00 56.38  ? 289 PRO C N   1 
ATOM   3508 C  CA  . PRO C 2 207 ? 13.331  42.147  51.151  1.00 54.55  ? 289 PRO C CA  1 
ATOM   3509 C  C   . PRO C 2 207 ? 13.075  40.857  50.384  1.00 54.19  ? 289 PRO C C   1 
ATOM   3510 O  O   . PRO C 2 207 ? 13.966  40.028  50.172  1.00 54.35  ? 289 PRO C O   1 
ATOM   3511 C  CB  . PRO C 2 207 ? 13.621  43.309  50.191  1.00 56.23  ? 289 PRO C CB  1 
ATOM   3512 C  CG  . PRO C 2 207 ? 14.861  43.982  50.726  1.00 58.38  ? 289 PRO C CG  1 
ATOM   3513 C  CD  . PRO C 2 207 ? 15.618  42.916  51.424  1.00 57.24  ? 289 PRO C CD  1 
ATOM   3514 N  N   . PHE C 2 208 ? 11.820  40.693  49.974  1.00 50.47  ? 290 PHE C N   1 
ATOM   3515 C  CA  . PHE C 2 208 ? 11.472  39.656  49.017  1.00 46.31  ? 290 PHE C CA  1 
ATOM   3516 C  C   . PHE C 2 208 ? 12.459  39.632  47.856  1.00 45.85  ? 290 PHE C C   1 
ATOM   3517 O  O   . PHE C 2 208 ? 12.899  40.676  47.369  1.00 49.04  ? 290 PHE C O   1 
ATOM   3518 C  CB  . PHE C 2 208 ? 10.051  39.890  48.511  1.00 45.01  ? 290 PHE C CB  1 
ATOM   3519 C  CG  . PHE C 2 208 ? 8.995   39.482  49.495  1.00 54.82  ? 290 PHE C CG  1 
ATOM   3520 C  CD1 . PHE C 2 208 ? 8.720   38.138  49.713  1.00 44.58  ? 290 PHE C CD1 1 
ATOM   3521 C  CD2 . PHE C 2 208 ? 8.290   40.440  50.218  1.00 54.69  ? 290 PHE C CD2 1 
ATOM   3522 C  CE1 . PHE C 2 208 ? 7.766   37.760  50.605  1.00 50.08  ? 290 PHE C CE1 1 
ATOM   3523 C  CE2 . PHE C 2 208 ? 7.327   40.071  51.130  1.00 55.02  ? 290 PHE C CE2 1 
ATOM   3524 C  CZ  . PHE C 2 208 ? 7.061   38.727  51.324  1.00 54.76  ? 290 PHE C CZ  1 
ATOM   3525 N  N   . TRP C 2 209 ? 12.809  38.429  47.412  1.00 41.14  ? 291 TRP C N   1 
ATOM   3526 C  CA  . TRP C 2 209 ? 13.886  38.275  46.440  1.00 44.58  ? 291 TRP C CA  1 
ATOM   3527 C  C   . TRP C 2 209 ? 13.572  37.157  45.452  1.00 42.32  ? 291 TRP C C   1 
ATOM   3528 O  O   . TRP C 2 209 ? 13.073  36.091  45.847  1.00 44.24  ? 291 TRP C O   1 
ATOM   3529 C  CB  . TRP C 2 209 ? 15.231  37.983  47.139  1.00 42.71  ? 291 TRP C CB  1 
ATOM   3530 C  CG  . TRP C 2 209 ? 16.397  38.478  46.352  1.00 40.60  ? 291 TRP C CG  1 
ATOM   3531 C  CD1 . TRP C 2 209 ? 17.109  37.780  45.413  1.00 42.02  ? 291 TRP C CD1 1 
ATOM   3532 C  CD2 . TRP C 2 209 ? 16.978  39.787  46.400  1.00 42.70  ? 291 TRP C CD2 1 
ATOM   3533 N  NE1 . TRP C 2 209 ? 18.093  38.579  44.873  1.00 40.55  ? 291 TRP C NE1 1 
ATOM   3534 C  CE2 . TRP C 2 209 ? 18.039  39.811  45.467  1.00 42.63  ? 291 TRP C CE2 1 
ATOM   3535 C  CE3 . TRP C 2 209 ? 16.706  40.942  47.140  1.00 47.65  ? 291 TRP C CE3 1 
ATOM   3536 C  CZ2 . TRP C 2 209 ? 18.831  40.935  45.263  1.00 45.35  ? 291 TRP C CZ2 1 
ATOM   3537 C  CZ3 . TRP C 2 209 ? 17.507  42.073  46.938  1.00 48.70  ? 291 TRP C CZ3 1 
ATOM   3538 C  CH2 . TRP C 2 209 ? 18.550  42.057  46.004  1.00 48.37  ? 291 TRP C CH2 1 
ATOM   3539 N  N   . PRO C 2 210 ? 13.853  37.360  44.173  1.00 42.99  ? 292 PRO C N   1 
ATOM   3540 C  CA  . PRO C 2 210 ? 13.550  36.317  43.188  1.00 38.91  ? 292 PRO C CA  1 
ATOM   3541 C  C   . PRO C 2 210 ? 14.431  35.098  43.421  1.00 38.46  ? 292 PRO C C   1 
ATOM   3542 O  O   . PRO C 2 210 ? 15.623  35.219  43.718  1.00 40.19  ? 292 PRO C O   1 
ATOM   3543 C  CB  . PRO C 2 210 ? 13.873  37.001  41.858  1.00 40.52  ? 292 PRO C CB  1 
ATOM   3544 C  CG  . PRO C 2 210 ? 15.026  37.908  42.235  1.00 44.37  ? 292 PRO C CG  1 
ATOM   3545 C  CD  . PRO C 2 210 ? 14.611  38.470  43.579  1.00 38.91  ? 292 PRO C CD  1 
ATOM   3546 N  N   . ALA C 2 211 ? 13.847  33.915  43.298  1.00 36.38  ? 293 ALA C N   1 
ATOM   3547 C  CA  . ALA C 2 211 ? 14.623  32.737  43.650  1.00 39.81  ? 293 ALA C CA  1 
ATOM   3548 C  C   . ALA C 2 211 ? 14.061  31.495  42.970  1.00 38.30  ? 293 ALA C C   1 
ATOM   3549 O  O   . ALA C 2 211 ? 12.894  31.445  42.564  1.00 36.71  ? 293 ALA C O   1 
ATOM   3550 C  CB  . ALA C 2 211 ? 14.672  32.541  45.165  1.00 34.52  ? 293 ALA C CB  1 
ATOM   3551 N  N   . LYS C 2 212 ? 14.928  30.496  42.844  1.00 36.56  ? 294 LYS C N   1 
ATOM   3552 C  CA  . LYS C 2 212 ? 14.513  29.158  42.466  1.00 36.99  ? 294 LYS C CA  1 
ATOM   3553 C  C   . LYS C 2 212 ? 14.085  28.361  43.701  1.00 38.68  ? 294 LYS C C   1 
ATOM   3554 O  O   . LYS C 2 212 ? 14.851  28.208  44.663  1.00 36.43  ? 294 LYS C O   1 
ATOM   3555 C  CB  . LYS C 2 212 ? 15.661  28.454  41.747  1.00 36.81  ? 294 LYS C CB  1 
ATOM   3556 C  CG  . LYS C 2 212 ? 16.171  29.200  40.544  1.00 37.19  ? 294 LYS C CG  1 
ATOM   3557 C  CD  . LYS C 2 212 ? 17.317  28.461  39.869  1.00 38.91  ? 294 LYS C CD  1 
ATOM   3558 C  CE  . LYS C 2 212 ? 17.779  29.177  38.598  1.00 41.48  ? 294 LYS C CE  1 
ATOM   3559 N  NZ  . LYS C 2 212 ? 19.132  28.713  38.184  1.00 43.66  ? 294 LYS C NZ  1 
ATOM   3560 N  N   . ALA C 2 213 ? 12.864  27.836  43.664  1.00 39.64  ? 295 ALA C N   1 
ATOM   3561 C  CA  . ALA C 2 213 ? 12.412  26.878  44.670  1.00 41.10  ? 295 ALA C CA  1 
ATOM   3562 C  C   . ALA C 2 213 ? 12.952  25.478  44.342  1.00 43.37  ? 295 ALA C C   1 
ATOM   3563 O  O   . ALA C 2 213 ? 12.390  24.753  43.516  1.00 44.83  ? 295 ALA C O   1 
ATOM   3564 C  CB  . ALA C 2 213 ? 10.890  26.898  44.740  1.00 42.41  ? 295 ALA C CB  1 
ATOM   3565 N  N   . LEU C 2 214 ? 14.028  25.065  45.019  1.00 46.45  ? 296 LEU C N   1 
ATOM   3566 C  CA  . LEU C 2 214 ? 14.663  23.788  44.682  1.00 46.57  ? 296 LEU C CA  1 
ATOM   3567 C  C   . LEU C 2 214 ? 13.990  22.586  45.330  1.00 46.87  ? 296 LEU C C   1 
ATOM   3568 O  O   . LEU C 2 214 ? 14.117  21.475  44.797  1.00 45.82  ? 296 LEU C O   1 
ATOM   3569 C  CB  . LEU C 2 214 ? 16.141  23.784  45.087  1.00 49.24  ? 296 LEU C CB  1 
ATOM   3570 C  CG  . LEU C 2 214 ? 17.026  24.898  44.533  1.00 53.73  ? 296 LEU C CG  1 
ATOM   3571 C  CD1 . LEU C 2 214 ? 18.228  25.145  45.449  1.00 55.59  ? 296 LEU C CD1 1 
ATOM   3572 C  CD2 . LEU C 2 214 ? 17.461  24.610  43.098  1.00 54.70  ? 296 LEU C CD2 1 
ATOM   3573 N  N   . ARG C 2 215 ? 13.324  22.766  46.480  1.00 48.69  ? 297 ARG C N   1 
ATOM   3574 C  CA  . ARG C 2 215 ? 12.723  21.668  47.244  1.00 52.02  ? 297 ARG C CA  1 
ATOM   3575 C  C   . ARG C 2 215 ? 12.006  22.219  48.465  1.00 53.72  ? 297 ARG C C   1 
ATOM   3576 O  O   . ARG C 2 215 ? 12.257  23.348  48.882  1.00 55.09  ? 297 ARG C O   1 
ATOM   3577 C  CB  . ARG C 2 215 ? 13.754  20.650  47.705  1.00 50.36  ? 297 ARG C CB  1 
ATOM   3578 C  CG  . ARG C 2 215 ? 14.922  21.264  48.363  1.00 50.08  ? 297 ARG C CG  1 
ATOM   3579 C  CD  . ARG C 2 215 ? 15.798  20.207  48.968  1.00 55.73  ? 297 ARG C CD  1 
ATOM   3580 N  NE  . ARG C 2 215 ? 17.063  20.778  49.410  1.00 57.89  ? 297 ARG C NE  1 
ATOM   3581 C  CZ  . ARG C 2 215 ? 17.851  20.226  50.318  1.00 61.14  ? 297 ARG C CZ  1 
ATOM   3582 N  NH1 . ARG C 2 215 ? 17.505  19.083  50.894  1.00 65.76  ? 297 ARG C NH1 1 
ATOM   3583 N  NH2 . ARG C 2 215 ? 18.985  20.815  50.643  1.00 61.72  ? 297 ARG C NH2 1 
ATOM   3584 N  N   . ASP C 2 216 ? 11.118  21.394  49.041  1.00 57.79  ? 298 ASP C N   1 
ATOM   3585 C  CA  . ASP C 2 216 ? 10.347  21.714  50.240  1.00 61.19  ? 298 ASP C CA  1 
ATOM   3586 C  C   . ASP C 2 216 ? 10.548  20.639  51.295  1.00 63.99  ? 298 ASP C C   1 
ATOM   3587 O  O   . ASP C 2 216 ? 10.504  19.445  50.983  1.00 66.48  ? 298 ASP C O   1 
ATOM   3588 C  CB  . ASP C 2 216 ? 8.852   21.802  49.966  1.00 70.78  ? 298 ASP C CB  1 
ATOM   3589 C  CG  . ASP C 2 216 ? 8.546   22.358  48.615  1.00 77.04  ? 298 ASP C CG  1 
ATOM   3590 O  OD1 . ASP C 2 216 ? 8.804   23.558  48.411  1.00 78.00  ? 298 ASP C OD1 1 
ATOM   3591 O  OD2 . ASP C 2 216 ? 8.031   21.612  47.759  1.00 80.05  ? 298 ASP C OD2 1 
ATOM   3592 N  N   . LYS C 2 217 ? 10.741  21.061  52.546  1.00 62.10  ? 299 LYS C N   1 
ATOM   3593 C  CA  . LYS C 2 217 ? 10.775  20.130  53.670  1.00 63.82  ? 299 LYS C CA  1 
ATOM   3594 C  C   . LYS C 2 217 ? 10.199  20.827  54.890  1.00 68.20  ? 299 LYS C C   1 
ATOM   3595 O  O   . LYS C 2 217 ? 10.720  21.864  55.305  1.00 67.50  ? 299 LYS C O   1 
ATOM   3596 C  CB  . LYS C 2 217 ? 12.199  19.638  53.953  1.00 57.45  ? 299 LYS C CB  1 
ATOM   3597 N  N   . ASP C 2 218 ? 9.124   20.264  55.443  1.00 74.83  ? 300 ASP C N   1 
ATOM   3598 C  CA  . ASP C 2 218 ? 8.568   20.654  56.747  1.00 79.65  ? 300 ASP C CA  1 
ATOM   3599 C  C   . ASP C 2 218 ? 8.356   22.170  56.856  1.00 79.81  ? 300 ASP C C   1 
ATOM   3600 O  O   . ASP C 2 218 ? 8.843   22.837  57.770  1.00 78.15  ? 300 ASP C O   1 
ATOM   3601 C  CB  . ASP C 2 218 ? 9.451   20.133  57.889  1.00 80.47  ? 300 ASP C CB  1 
ATOM   3602 N  N   . GLY C 2 219 ? 7.608   22.709  55.897  1.00 82.12  ? 301 GLY C N   1 
ATOM   3603 C  CA  . GLY C 2 219 ? 7.266   24.118  55.913  1.00 81.27  ? 301 GLY C CA  1 
ATOM   3604 C  C   . GLY C 2 219 ? 8.334   25.075  55.424  1.00 77.90  ? 301 GLY C C   1 
ATOM   3605 O  O   . GLY C 2 219 ? 8.175   26.291  55.583  1.00 78.21  ? 301 GLY C O   1 
ATOM   3606 N  N   . GLN C 2 220 ? 9.415   24.586  54.841  1.00 68.79  ? 302 GLN C N   1 
ATOM   3607 C  CA  . GLN C 2 220 ? 10.439  25.464  54.308  1.00 63.23  ? 302 GLN C CA  1 
ATOM   3608 C  C   . GLN C 2 220 ? 10.619  25.172  52.828  1.00 58.64  ? 302 GLN C C   1 
ATOM   3609 O  O   . GLN C 2 220 ? 10.230  24.118  52.332  1.00 62.51  ? 302 GLN C O   1 
ATOM   3610 C  CB  . GLN C 2 220 ? 11.761  25.282  55.049  1.00 62.69  ? 302 GLN C CB  1 
ATOM   3611 C  CG  . GLN C 2 220 ? 11.666  25.478  56.551  1.00 64.57  ? 302 GLN C CG  1 
ATOM   3612 C  CD  . GLN C 2 220 ? 12.171  26.843  56.970  1.00 70.21  ? 302 GLN C CD  1 
ATOM   3613 O  OE1 . GLN C 2 220 ? 11.432  27.834  56.923  1.00 72.38  ? 302 GLN C OE1 1 
ATOM   3614 N  NE2 . GLN C 2 220 ? 13.444  26.910  57.377  1.00 71.61  ? 302 GLN C NE2 1 
ATOM   3615 N  N   . VAL C 2 221 ? 11.172  26.124  52.100  1.00 51.54  ? 303 VAL C N   1 
ATOM   3616 C  CA  . VAL C 2 221 ? 11.583  25.872  50.730  1.00 48.91  ? 303 VAL C CA  1 
ATOM   3617 C  C   . VAL C 2 221 ? 13.025  26.319  50.605  1.00 45.86  ? 303 VAL C C   1 
ATOM   3618 O  O   . VAL C 2 221 ? 13.446  27.284  51.251  1.00 46.52  ? 303 VAL C O   1 
ATOM   3619 C  CB  . VAL C 2 221 ? 10.677  26.555  49.672  1.00 50.47  ? 303 VAL C CB  1 
ATOM   3620 C  CG1 . VAL C 2 221 ? 9.224   26.369  50.022  1.00 52.60  ? 303 VAL C CG1 1 
ATOM   3621 C  CG2 . VAL C 2 221 ? 10.989  28.007  49.487  1.00 49.91  ? 303 VAL C CG2 1 
ATOM   3622 N  N   . ASP C 2 222 ? 13.789  25.576  49.817  1.00 48.81  ? 304 ASP C N   1 
ATOM   3623 C  CA  . ASP C 2 222 ? 15.220  25.793  49.645  1.00 50.53  ? 304 ASP C CA  1 
ATOM   3624 C  C   . ASP C 2 222 ? 15.400  26.681  48.422  1.00 50.65  ? 304 ASP C C   1 
ATOM   3625 O  O   . ASP C 2 222 ? 15.356  26.206  47.282  1.00 52.43  ? 304 ASP C O   1 
ATOM   3626 C  CB  . ASP C 2 222 ? 15.928  24.454  49.491  1.00 57.09  ? 304 ASP C CB  1 
ATOM   3627 C  CG  . ASP C 2 222 ? 17.430  24.577  49.452  1.00 64.35  ? 304 ASP C CG  1 
ATOM   3628 O  OD1 . ASP C 2 222 ? 17.960  25.638  49.834  1.00 68.74  ? 304 ASP C OD1 1 
ATOM   3629 O  OD2 . ASP C 2 222 ? 18.092  23.604  49.030  1.00 67.68  ? 304 ASP C OD2 1 
ATOM   3630 N  N   . ALA C 2 223 ? 15.600  27.976  48.650  1.00 47.20  ? 305 ALA C N   1 
ATOM   3631 C  CA  . ALA C 2 223 ? 15.617  28.953  47.572  1.00 46.19  ? 305 ALA C CA  1 
ATOM   3632 C  C   . ALA C 2 223 ? 17.055  29.230  47.142  1.00 46.60  ? 305 ALA C C   1 
ATOM   3633 O  O   . ALA C 2 223 ? 17.927  29.453  47.990  1.00 45.64  ? 305 ALA C O   1 
ATOM   3634 C  CB  . ALA C 2 223 ? 14.929  30.246  48.008  1.00 44.06  ? 305 ALA C CB  1 
ATOM   3635 N  N   . ARG C 2 224 ? 17.302  29.204  45.822  1.00 44.70  ? 306 ARG C N   1 
ATOM   3636 C  CA  . ARG C 2 224 ? 18.559  29.686  45.252  1.00 42.07  ? 306 ARG C CA  1 
ATOM   3637 C  C   . ARG C 2 224 ? 18.290  31.052  44.633  1.00 37.41  ? 306 ARG C C   1 
ATOM   3638 O  O   . ARG C 2 224 ? 17.537  31.171  43.662  1.00 34.82  ? 306 ARG C O   1 
ATOM   3639 C  CB  . ARG C 2 224 ? 19.192  28.702  44.260  1.00 46.51  ? 306 ARG C CB  1 
ATOM   3640 C  CG  . ARG C 2 224 ? 20.710  28.582  44.567  1.00 56.59  ? 306 ARG C CG  1 
ATOM   3641 C  CD  . ARG C 2 224 ? 21.612  27.981  43.507  1.00 63.75  ? 306 ARG C CD  1 
ATOM   3642 N  NE  . ARG C 2 224 ? 21.206  26.607  43.199  1.00 73.07  ? 306 ARG C NE  1 
ATOM   3643 C  CZ  . ARG C 2 224 ? 21.453  25.535  43.958  1.00 77.92  ? 306 ARG C CZ  1 
ATOM   3644 N  NH1 . ARG C 2 224 ? 22.123  25.649  45.105  1.00 77.13  ? 306 ARG C NH1 1 
ATOM   3645 N  NH2 . ARG C 2 224 ? 21.013  24.338  43.565  1.00 79.82  ? 306 ARG C NH2 1 
ATOM   3646 N  N   . PHE C 2 225 ? 18.907  32.077  45.221  1.00 38.33  ? 307 PHE C N   1 
ATOM   3647 C  CA  . PHE C 2 225 ? 18.574  33.462  44.946  1.00 37.24  ? 307 PHE C CA  1 
ATOM   3648 C  C   . PHE C 2 225 ? 19.203  33.930  43.649  1.00 36.22  ? 307 PHE C C   1 
ATOM   3649 O  O   . PHE C 2 225 ? 20.401  33.733  43.413  1.00 38.22  ? 307 PHE C O   1 
ATOM   3650 C  CB  . PHE C 2 225 ? 19.052  34.348  46.092  1.00 41.42  ? 307 PHE C CB  1 
ATOM   3651 C  CG  . PHE C 2 225 ? 18.319  34.118  47.356  1.00 45.21  ? 307 PHE C CG  1 
ATOM   3652 C  CD1 . PHE C 2 225 ? 17.137  34.772  47.606  1.00 46.68  ? 307 PHE C CD1 1 
ATOM   3653 C  CD2 . PHE C 2 225 ? 18.787  33.219  48.279  1.00 49.78  ? 307 PHE C CD2 1 
ATOM   3654 C  CE1 . PHE C 2 225 ? 16.432  34.549  48.770  1.00 48.26  ? 307 PHE C CE1 1 
ATOM   3655 C  CE2 . PHE C 2 225 ? 18.091  32.990  49.439  1.00 52.22  ? 307 PHE C CE2 1 
ATOM   3656 C  CZ  . PHE C 2 225 ? 16.901  33.661  49.679  1.00 50.77  ? 307 PHE C CZ  1 
ATOM   3657 N  N   . PHE C 2 226 ? 18.398  34.578  42.819  1.00 35.77  ? 308 PHE C N   1 
ATOM   3658 C  CA  . PHE C 2 226 ? 18.955  35.335  41.717  1.00 39.16  ? 308 PHE C CA  1 
ATOM   3659 C  C   . PHE C 2 226 ? 19.903  36.424  42.232  1.00 45.54  ? 308 PHE C C   1 
ATOM   3660 O  O   . PHE C 2 226 ? 19.899  36.804  43.413  1.00 44.22  ? 308 PHE C O   1 
ATOM   3661 C  CB  . PHE C 2 226 ? 17.831  35.923  40.877  1.00 38.78  ? 308 PHE C CB  1 
ATOM   3662 C  CG  . PHE C 2 226 ? 17.176  34.902  40.013  1.00 38.50  ? 308 PHE C CG  1 
ATOM   3663 C  CD1 . PHE C 2 226 ? 17.682  34.615  38.769  1.00 35.08  ? 308 PHE C CD1 1 
ATOM   3664 C  CD2 . PHE C 2 226 ? 16.102  34.177  40.479  1.00 36.17  ? 308 PHE C CD2 1 
ATOM   3665 C  CE1 . PHE C 2 226 ? 17.113  33.644  37.991  1.00 34.52  ? 308 PHE C CE1 1 
ATOM   3666 C  CE2 . PHE C 2 226 ? 15.537  33.208  39.712  1.00 35.16  ? 308 PHE C CE2 1 
ATOM   3667 C  CZ  . PHE C 2 226 ? 16.037  32.949  38.453  1.00 35.44  ? 308 PHE C CZ  1 
ATOM   3668 N  N   . GLY C 2 227 ? 20.767  36.885  41.336  1.00 49.61  ? 309 GLY C N   1 
ATOM   3669 C  CA  . GLY C 2 227 ? 21.788  37.832  41.712  1.00 41.14  ? 309 GLY C CA  1 
ATOM   3670 C  C   . GLY C 2 227 ? 22.901  37.189  42.498  1.00 46.24  ? 309 GLY C C   1 
ATOM   3671 O  O   . GLY C 2 227 ? 24.009  37.027  41.983  1.00 46.91  ? 309 GLY C O   1 
ATOM   3672 N  N   . GLN C 2 228 ? 22.627  36.806  43.743  1.00 43.75  ? 310 GLN C N   1 
ATOM   3673 C  CA  . GLN C 2 228 ? 23.701  36.394  44.642  1.00 45.40  ? 310 GLN C CA  1 
ATOM   3674 C  C   . GLN C 2 228 ? 24.061  34.920  44.502  1.00 45.68  ? 310 GLN C C   1 
ATOM   3675 O  O   . GLN C 2 228 ? 25.215  34.545  44.763  1.00 47.03  ? 310 GLN C O   1 
ATOM   3676 C  CB  . GLN C 2 228 ? 23.323  36.714  46.091  1.00 45.06  ? 310 GLN C CB  1 
ATOM   3677 C  CG  . GLN C 2 228 ? 23.476  38.191  46.444  1.00 46.94  ? 310 GLN C CG  1 
ATOM   3678 C  CD  . GLN C 2 228 ? 22.630  39.068  45.554  1.00 49.06  ? 310 GLN C CD  1 
ATOM   3679 O  OE1 . GLN C 2 228 ? 21.403  39.000  45.587  1.00 47.11  ? 310 GLN C OE1 1 
ATOM   3680 N  NE2 . GLN C 2 228 ? 23.279  39.872  44.724  1.00 46.63  ? 310 GLN C NE2 1 
ATOM   3681 N  N   . HIS C 2 229 ? 23.099  34.088  44.105  1.00 41.10  ? 311 HIS C N   1 
ATOM   3682 C  CA  . HIS C 2 229 ? 23.291  32.713  43.684  1.00 41.94  ? 311 HIS C CA  1 
ATOM   3683 C  C   . HIS C 2 229 ? 23.570  31.747  44.827  1.00 42.14  ? 311 HIS C C   1 
ATOM   3684 O  O   . HIS C 2 229 ? 23.860  30.587  44.568  1.00 45.28  ? 311 HIS C O   1 
ATOM   3685 C  CB  . HIS C 2 229 ? 24.392  32.621  42.622  1.00 39.17  ? 311 HIS C CB  1 
ATOM   3686 C  CG  . HIS C 2 229 ? 24.072  33.386  41.377  1.00 43.11  ? 311 HIS C CG  1 
ATOM   3687 N  ND1 . HIS C 2 229 ? 25.035  33.816  40.492  1.00 45.80  ? 311 HIS C ND1 1 
ATOM   3688 C  CD2 . HIS C 2 229 ? 22.887  33.802  40.870  1.00 43.21  ? 311 HIS C CD2 1 
ATOM   3689 C  CE1 . HIS C 2 229 ? 24.457  34.458  39.490  1.00 45.70  ? 311 HIS C CE1 1 
ATOM   3690 N  NE2 . HIS C 2 229 ? 23.153  34.454  39.690  1.00 43.04  ? 311 HIS C NE2 1 
ATOM   3691 N  N   . ASP C 2 230 ? 23.465  32.164  46.075  1.00 43.95  ? 312 ASP C N   1 
ATOM   3692 C  CA  . ASP C 2 230 ? 23.504  31.192  47.151  1.00 48.96  ? 312 ASP C CA  1 
ATOM   3693 C  C   . ASP C 2 230 ? 22.102  30.645  47.406  1.00 50.33  ? 312 ASP C C   1 
ATOM   3694 O  O   . ASP C 2 230 ? 21.119  31.073  46.795  1.00 49.01  ? 312 ASP C O   1 
ATOM   3695 C  CB  . ASP C 2 230 ? 24.088  31.811  48.407  1.00 54.83  ? 312 ASP C CB  1 
ATOM   3696 C  CG  . ASP C 2 230 ? 23.247  32.953  48.932  1.00 61.60  ? 312 ASP C CG  1 
ATOM   3697 O  OD1 . ASP C 2 230 ? 22.801  33.792  48.103  1.00 63.31  ? 312 ASP C OD1 1 
ATOM   3698 O  OD2 . ASP C 2 230 ? 23.042  33.023  50.173  1.00 63.31  ? 312 ASP C OD2 1 
ATOM   3699 N  N   . ARG C 2 231 ? 22.011  29.685  48.327  1.00 51.89  ? 313 ARG C N   1 
ATOM   3700 C  CA  . ARG C 2 231 ? 20.778  28.970  48.627  1.00 49.46  ? 313 ARG C CA  1 
ATOM   3701 C  C   . ARG C 2 231 ? 20.535  29.033  50.123  1.00 51.69  ? 313 ARG C C   1 
ATOM   3702 O  O   . ARG C 2 231 ? 21.483  28.974  50.907  1.00 55.95  ? 313 ARG C O   1 
ATOM   3703 C  CB  . ARG C 2 231 ? 20.850  27.499  48.171  1.00 50.81  ? 313 ARG C CB  1 
ATOM   3704 N  N   . ALA C 2 232 ? 19.268  29.153  50.515  1.00 49.43  ? 314 ALA C N   1 
ATOM   3705 C  CA  . ALA C 2 232 ? 18.889  29.217  51.919  1.00 51.40  ? 314 ALA C CA  1 
ATOM   3706 C  C   . ALA C 2 232 ? 17.413  28.859  52.080  1.00 49.43  ? 314 ALA C C   1 
ATOM   3707 O  O   . ALA C 2 232 ? 16.599  29.094  51.179  1.00 46.28  ? 314 ALA C O   1 
ATOM   3708 C  CB  . ALA C 2 232 ? 19.156  30.605  52.503  1.00 39.53  ? 314 ALA C CB  1 
ATOM   3709 N  N   . TRP C 2 233 ? 17.076  28.304  53.248  1.00 50.49  ? 315 TRP C N   1 
ATOM   3710 C  CA  . TRP C 2 233 ? 15.694  27.957  53.548  1.00 47.43  ? 315 TRP C CA  1 
ATOM   3711 C  C   . TRP C 2 233 ? 14.896  29.207  53.863  1.00 49.61  ? 315 TRP C C   1 
ATOM   3712 O  O   . TRP C 2 233 ? 15.363  30.103  54.573  1.00 52.91  ? 315 TRP C O   1 
ATOM   3713 C  CB  . TRP C 2 233 ? 15.603  26.987  54.730  1.00 44.18  ? 315 TRP C CB  1 
ATOM   3714 C  CG  . TRP C 2 233 ? 16.171  25.664  54.435  1.00 46.63  ? 315 TRP C CG  1 
ATOM   3715 C  CD1 . TRP C 2 233 ? 17.424  25.233  54.758  1.00 50.59  ? 315 TRP C CD1 1 
ATOM   3716 C  CD2 . TRP C 2 233 ? 15.546  24.586  53.721  1.00 48.58  ? 315 TRP C CD2 1 
ATOM   3717 N  NE1 . TRP C 2 233 ? 17.619  23.953  54.303  1.00 53.21  ? 315 TRP C NE1 1 
ATOM   3718 C  CE2 . TRP C 2 233 ? 16.483  23.528  53.661  1.00 51.23  ? 315 TRP C CE2 1 
ATOM   3719 C  CE3 . TRP C 2 233 ? 14.295  24.411  53.124  1.00 49.03  ? 315 TRP C CE3 1 
ATOM   3720 C  CZ2 . TRP C 2 233 ? 16.202  22.305  53.040  1.00 49.28  ? 315 TRP C CZ2 1 
ATOM   3721 C  CZ3 . TRP C 2 233 ? 14.012  23.195  52.517  1.00 50.44  ? 315 TRP C CZ3 1 
ATOM   3722 C  CH2 . TRP C 2 233 ? 14.965  22.157  52.481  1.00 51.11  ? 315 TRP C CH2 1 
ATOM   3723 N  N   . VAL C 2 234 ? 13.682  29.262  53.335  1.00 48.34  ? 316 VAL C N   1 
ATOM   3724 C  CA  . VAL C 2 234 ? 12.764  30.345  53.659  1.00 48.06  ? 316 VAL C CA  1 
ATOM   3725 C  C   . VAL C 2 234 ? 11.418  29.723  54.011  1.00 47.62  ? 316 VAL C C   1 
ATOM   3726 O  O   . VAL C 2 234 ? 11.071  28.645  53.507  1.00 46.66  ? 316 VAL C O   1 
ATOM   3727 C  CB  . VAL C 2 234 ? 12.661  31.345  52.500  1.00 46.13  ? 316 VAL C CB  1 
ATOM   3728 C  CG1 . VAL C 2 234 ? 13.989  32.054  52.314  1.00 42.32  ? 316 VAL C CG1 1 
ATOM   3729 C  CG2 . VAL C 2 234 ? 12.284  30.622  51.227  1.00 45.35  ? 316 VAL C CG2 1 
ATOM   3730 N  N   . PRO C 2 235 ? 10.651  30.344  54.893  1.00 48.29  ? 317 PRO C N   1 
ATOM   3731 C  CA  . PRO C 2 235 ? 9.351   29.777  55.266  1.00 49.75  ? 317 PRO C CA  1 
ATOM   3732 C  C   . PRO C 2 235 ? 8.408   29.686  54.074  1.00 49.57  ? 317 PRO C C   1 
ATOM   3733 O  O   . PRO C 2 235 ? 8.203   30.655  53.341  1.00 49.63  ? 317 PRO C O   1 
ATOM   3734 C  CB  . PRO C 2 235 ? 8.834   30.762  56.319  1.00 49.29  ? 317 PRO C CB  1 
ATOM   3735 C  CG  . PRO C 2 235 ? 9.588   32.023  56.057  1.00 48.39  ? 317 PRO C CG  1 
ATOM   3736 C  CD  . PRO C 2 235 ? 10.933  31.601  55.601  1.00 47.42  ? 317 PRO C CD  1 
ATOM   3737 N  N   . ILE C 2 236 ? 7.836   28.498  53.891  1.00 53.31  ? 318 ILE C N   1 
ATOM   3738 C  CA  . ILE C 2 236 ? 6.806   28.289  52.874  1.00 57.21  ? 318 ILE C CA  1 
ATOM   3739 C  C   . ILE C 2 236 ? 5.719   29.352  52.988  1.00 60.57  ? 318 ILE C C   1 
ATOM   3740 O  O   . ILE C 2 236 ? 5.200   29.838  51.979  1.00 61.05  ? 318 ILE C O   1 
ATOM   3741 C  CB  . ILE C 2 236 ? 6.227   26.861  53.004  1.00 59.90  ? 318 ILE C CB  1 
ATOM   3742 C  CG1 . ILE C 2 236 ? 5.284   26.513  51.873  1.00 55.31  ? 318 ILE C CG1 1 
ATOM   3743 C  CG2 . ILE C 2 236 ? 5.434   26.700  54.281  1.00 66.58  ? 318 ILE C CG2 1 
ATOM   3744 C  CD1 . ILE C 2 236 ? 5.807   26.838  50.594  1.00 52.75  ? 318 ILE C CD1 1 
ATOM   3745 N  N   . ASN C 2 237 ? 5.386   29.756  54.218  1.00 63.31  ? 319 ASN C N   1 
ATOM   3746 C  CA  . ASN C 2 237 ? 4.173   30.529  54.471  1.00 67.88  ? 319 ASN C CA  1 
ATOM   3747 C  C   . ASN C 2 237 ? 4.296   32.002  54.099  1.00 66.72  ? 319 ASN C C   1 
ATOM   3748 O  O   . ASN C 2 237 ? 3.287   32.713  54.128  1.00 68.33  ? 319 ASN C O   1 
ATOM   3749 C  CB  . ASN C 2 237 ? 3.772   30.408  55.941  1.00 72.76  ? 319 ASN C CB  1 
ATOM   3750 C  CG  . ASN C 2 237 ? 4.935   30.626  56.870  1.00 76.94  ? 319 ASN C CG  1 
ATOM   3751 O  OD1 . ASN C 2 237 ? 5.257   31.762  57.220  1.00 78.10  ? 319 ASN C OD1 1 
ATOM   3752 N  ND2 . ASN C 2 237 ? 5.606   29.538  57.250  1.00 78.95  ? 319 ASN C ND2 1 
ATOM   3753 N  N   . ASN C 2 238 ? 5.489   32.486  53.777  1.00 64.33  ? 320 ASN C N   1 
ATOM   3754 C  CA  . ASN C 2 238 ? 5.654   33.806  53.184  1.00 65.50  ? 320 ASN C CA  1 
ATOM   3755 C  C   . ASN C 2 238 ? 6.418   33.694  51.874  1.00 63.52  ? 320 ASN C C   1 
ATOM   3756 O  O   . ASN C 2 238 ? 7.308   34.487  51.574  1.00 63.88  ? 320 ASN C O   1 
ATOM   3757 C  CB  . ASN C 2 238 ? 6.339   34.773  54.145  1.00 69.45  ? 320 ASN C CB  1 
ATOM   3758 C  CG  . ASN C 2 238 ? 5.839   36.204  53.981  1.00 75.97  ? 320 ASN C CG  1 
ATOM   3759 O  OD1 . ASN C 2 238 ? 4.771   36.447  53.402  1.00 78.26  ? 320 ASN C OD1 1 
ATOM   3760 N  ND2 . ASN C 2 238 ? 6.604   37.159  54.496  1.00 78.41  ? 320 ASN C ND2 1 
ATOM   3761 N  N   . CYS C 2 239 ? 6.068   32.695  51.074  1.00 62.25  ? 321 CYS C N   1 
ATOM   3762 C  CA  . CYS C 2 239 ? 6.672   32.438  49.777  1.00 59.18  ? 321 CYS C CA  1 
ATOM   3763 C  C   . CYS C 2 239 ? 5.571   32.477  48.720  1.00 59.10  ? 321 CYS C C   1 
ATOM   3764 O  O   . CYS C 2 239 ? 4.492   31.908  48.924  1.00 60.74  ? 321 CYS C O   1 
ATOM   3765 C  CB  . CYS C 2 239 ? 7.376   31.081  49.799  1.00 59.13  ? 321 CYS C CB  1 
ATOM   3766 S  SG  . CYS C 2 239 ? 8.435   30.747  48.401  1.00 59.18  ? 321 CYS C SG  1 
ATOM   3767 N  N   . TYR C 2 240 ? 5.830   33.162  47.604  1.00 54.86  ? 322 TYR C N   1 
ATOM   3768 C  CA  . TYR C 2 240 ? 4.809   33.405  46.592  1.00 51.61  ? 322 TYR C CA  1 
ATOM   3769 C  C   . TYR C 2 240 ? 5.374   33.137  45.210  1.00 55.00  ? 322 TYR C C   1 
ATOM   3770 O  O   . TYR C 2 240 ? 6.560   33.368  44.949  1.00 58.27  ? 322 TYR C O   1 
ATOM   3771 C  CB  . TYR C 2 240 ? 4.270   34.845  46.639  1.00 48.75  ? 322 TYR C CB  1 
ATOM   3772 C  CG  . TYR C 2 240 ? 3.828   35.281  48.016  1.00 52.02  ? 322 TYR C CG  1 
ATOM   3773 C  CD1 . TYR C 2 240 ? 4.754   35.728  48.946  1.00 51.41  ? 322 TYR C CD1 1 
ATOM   3774 C  CD2 . TYR C 2 240 ? 2.486   35.244  48.389  1.00 56.19  ? 322 TYR C CD2 1 
ATOM   3775 C  CE1 . TYR C 2 240 ? 4.370   36.112  50.200  1.00 55.88  ? 322 TYR C CE1 1 
ATOM   3776 C  CE2 . TYR C 2 240 ? 2.089   35.641  49.647  1.00 59.29  ? 322 TYR C CE2 1 
ATOM   3777 C  CZ  . TYR C 2 240 ? 3.043   36.071  50.547  1.00 60.46  ? 322 TYR C CZ  1 
ATOM   3778 O  OH  . TYR C 2 240 ? 2.693   36.467  51.811  1.00 66.13  ? 322 TYR C OH  1 
ATOM   3779 N  N   . LEU C 2 241 ? 4.512   32.646  44.325  1.00 52.57  ? 323 LEU C N   1 
ATOM   3780 C  CA  . LEU C 2 241 ? 4.917   32.430  42.951  1.00 51.80  ? 323 LEU C CA  1 
ATOM   3781 C  C   . LEU C 2 241 ? 5.293   33.755  42.303  1.00 54.57  ? 323 LEU C C   1 
ATOM   3782 O  O   . LEU C 2 241 ? 4.693   34.794  42.586  1.00 59.67  ? 323 LEU C O   1 
ATOM   3783 C  CB  . LEU C 2 241 ? 3.795   31.755  42.178  1.00 52.91  ? 323 LEU C CB  1 
ATOM   3784 C  CG  . LEU C 2 241 ? 3.539   30.301  42.584  1.00 52.68  ? 323 LEU C CG  1 
ATOM   3785 C  CD1 . LEU C 2 241 ? 2.321   29.755  41.850  1.00 52.00  ? 323 LEU C CD1 1 
ATOM   3786 C  CD2 . LEU C 2 241 ? 4.772   29.434  42.336  1.00 47.79  ? 323 LEU C CD2 1 
ATOM   3787 N  N   . MET C 2 242 ? 6.312   33.709  41.439  1.00 52.70  ? 324 MET C N   1 
ATOM   3788 C  CA  . MET C 2 242 ? 6.791   34.906  40.755  1.00 50.43  ? 324 MET C CA  1 
ATOM   3789 C  C   . MET C 2 242 ? 5.646   35.637  40.061  1.00 49.68  ? 324 MET C C   1 
ATOM   3790 O  O   . MET C 2 242 ? 4.759   35.019  39.465  1.00 45.68  ? 324 MET C O   1 
ATOM   3791 C  CB  . MET C 2 242 ? 7.874   34.539  39.736  1.00 48.78  ? 324 MET C CB  1 
ATOM   3792 C  CG  . MET C 2 242 ? 8.500   35.740  39.059  1.00 49.64  ? 324 MET C CG  1 
ATOM   3793 S  SD  . MET C 2 242 ? 8.962   37.080  40.197  1.00 52.81  ? 324 MET C SD  1 
ATOM   3794 C  CE  . MET C 2 242 ? 10.044  36.257  41.376  1.00 47.62  ? 324 MET C CE  1 
ATOM   3795 N  N   . SER C 2 243 ? 5.670   36.967  40.164  1.00 49.32  ? 325 SER C N   1 
ATOM   3796 C  CA  . SER C 2 243 ? 4.622   37.838  39.658  1.00 47.62  ? 325 SER C CA  1 
ATOM   3797 C  C   . SER C 2 243 ? 5.253   39.102  39.096  1.00 49.63  ? 325 SER C C   1 
ATOM   3798 O  O   . SER C 2 243 ? 6.452   39.363  39.262  1.00 52.07  ? 325 SER C O   1 
ATOM   3799 C  CB  . SER C 2 243 ? 3.634   38.217  40.763  1.00 49.37  ? 325 SER C CB  1 
ATOM   3800 O  OG  . SER C 2 243 ? 4.240   39.133  41.670  1.00 50.48  ? 325 SER C OG  1 
ATOM   3801 N  N   . LYS C 2 244 ? 4.419   39.923  38.463  1.00 52.67  ? 326 LYS C N   1 
ATOM   3802 C  CA  . LYS C 2 244 ? 4.885   41.226  38.007  1.00 55.98  ? 326 LYS C CA  1 
ATOM   3803 C  C   . LYS C 2 244 ? 4.950   42.247  39.145  1.00 61.80  ? 326 LYS C C   1 
ATOM   3804 O  O   . LYS C 2 244 ? 5.831   43.119  39.146  1.00 63.70  ? 326 LYS C O   1 
ATOM   3805 C  CB  . LYS C 2 244 ? 3.999   41.712  36.867  1.00 54.46  ? 326 LYS C CB  1 
ATOM   3806 C  CG  . LYS C 2 244 ? 4.120   40.842  35.628  1.00 55.35  ? 326 LYS C CG  1 
ATOM   3807 C  CD  . LYS C 2 244 ? 2.938   41.009  34.681  1.00 57.61  ? 326 LYS C CD  1 
ATOM   3808 N  N   . GLU C 2 245 ? 4.069   42.154  40.133  1.00 65.69  ? 327 GLU C N   1 
ATOM   3809 C  CA  . GLU C 2 245 ? 4.128   43.054  41.278  1.00 72.55  ? 327 GLU C CA  1 
ATOM   3810 C  C   . GLU C 2 245 ? 4.765   42.333  42.461  1.00 74.65  ? 327 GLU C C   1 
ATOM   3811 O  O   . GLU C 2 245 ? 4.457   41.170  42.741  1.00 73.49  ? 327 GLU C O   1 
ATOM   3812 C  CB  . GLU C 2 245 ? 2.738   43.588  41.651  1.00 76.05  ? 327 GLU C CB  1 
ATOM   3813 N  N   . ILE C 2 246 ? 5.671   43.028  43.137  1.00 76.72  ? 328 ILE C N   1 
ATOM   3814 C  CA  . ILE C 2 246 ? 6.422   42.476  44.263  1.00 79.18  ? 328 ILE C CA  1 
ATOM   3815 C  C   . ILE C 2 246 ? 5.514   42.390  45.490  1.00 80.89  ? 328 ILE C C   1 
ATOM   3816 O  O   . ILE C 2 246 ? 4.670   43.276  45.692  1.00 83.77  ? 328 ILE C O   1 
ATOM   3817 C  CB  . ILE C 2 246 ? 7.672   43.334  44.535  1.00 81.48  ? 328 ILE C CB  1 
ATOM   3818 C  CG1 . ILE C 2 246 ? 8.351   43.687  43.202  1.00 83.20  ? 328 ILE C CG1 1 
ATOM   3819 C  CG2 . ILE C 2 246 ? 8.645   42.630  45.491  1.00 75.06  ? 328 ILE C CG2 1 
ATOM   3820 C  CD1 . ILE C 2 246 ? 8.842   45.113  43.110  1.00 82.55  ? 328 ILE C CD1 1 
ATOM   3821 N  N   . PRO C 2 247 ? 5.642   41.345  46.322  1.00 77.59  ? 329 PRO C N   1 
ATOM   3822 C  CA  . PRO C 2 247 ? 4.815   41.253  47.541  1.00 79.36  ? 329 PRO C CA  1 
ATOM   3823 C  C   . PRO C 2 247 ? 4.900   42.447  48.484  1.00 84.47  ? 329 PRO C C   1 
ATOM   3824 O  O   . PRO C 2 247 ? 3.879   42.796  49.087  1.00 87.48  ? 329 PRO C O   1 
ATOM   3825 C  CB  . PRO C 2 247 ? 5.344   39.973  48.200  1.00 74.85  ? 329 PRO C CB  1 
ATOM   3826 C  CG  . PRO C 2 247 ? 5.738   39.120  47.058  1.00 71.85  ? 329 PRO C CG  1 
ATOM   3827 C  CD  . PRO C 2 247 ? 6.302   40.063  46.016  1.00 73.71  ? 329 PRO C CD  1 
ATOM   3828 N  N   . PHE C 2 248 ? 6.079   43.057  48.665  1.00 85.60  ? 330 PHE C N   1 
ATOM   3829 C  CA  . PHE C 2 248 ? 6.215   44.323  49.391  1.00 85.75  ? 330 PHE C CA  1 
ATOM   3830 C  C   . PHE C 2 248 ? 7.273   45.196  48.707  1.00 91.18  ? 330 PHE C C   1 
ATOM   3831 O  O   . PHE C 2 248 ? 7.387   45.171  47.476  1.00 93.62  ? 330 PHE C O   1 
ATOM   3832 C  CB  . PHE C 2 248 ? 6.549   44.074  50.866  1.00 79.07  ? 330 PHE C CB  1 
ATOM   3833 N  N   . SER C 2 249 ? 8.055   45.964  49.468  1.00 93.27  ? 331 SER C N   1 
ATOM   3834 C  CA  . SER C 2 249 ? 9.052   46.871  48.867  1.00 91.10  ? 331 SER C CA  1 
ATOM   3835 C  C   . SER C 2 249 ? 10.462  46.757  49.483  1.00 87.14  ? 331 SER C C   1 
ATOM   3836 O  O   . SER C 2 249 ? 11.442  47.302  48.957  1.00 84.00  ? 331 SER C O   1 
ATOM   3837 C  CB  . SER C 2 249 ? 8.556   48.319  48.970  1.00 93.42  ? 331 SER C CB  1 
ATOM   3838 O  OG  . SER C 2 249 ? 7.257   48.433  48.412  1.00 90.74  ? 331 SER C OG  1 
ATOM   3839 N  N   . LYS C 2 252 ? 14.697  50.261  49.702  1.00 78.72  ? 334 LYS C N   1 
ATOM   3840 C  CA  . LYS C 2 252 ? 15.388  49.061  50.172  1.00 82.45  ? 334 LYS C CA  1 
ATOM   3841 C  C   . LYS C 2 252 ? 16.880  49.026  49.749  1.00 91.04  ? 334 LYS C C   1 
ATOM   3842 O  O   . LYS C 2 252 ? 17.692  49.837  50.223  1.00 97.00  ? 334 LYS C O   1 
ATOM   3843 C  CB  . LYS C 2 252 ? 14.659  47.813  49.670  1.00 75.63  ? 334 LYS C CB  1 
ATOM   3844 N  N   . THR C 2 253 ? 17.252  48.060  48.882  1.00 91.92  ? 335 THR C N   1 
ATOM   3845 C  CA  . THR C 2 253 ? 18.600  47.986  48.282  1.00 93.88  ? 335 THR C CA  1 
ATOM   3846 C  C   . THR C 2 253 ? 18.432  47.863  46.762  1.00 94.40  ? 335 THR C C   1 
ATOM   3847 O  O   . THR C 2 253 ? 18.717  46.821  46.162  1.00 91.37  ? 335 THR C O   1 
ATOM   3848 C  CB  . THR C 2 253 ? 19.421  46.830  48.864  1.00 89.80  ? 335 THR C CB  1 
ATOM   3849 O  OG1 . THR C 2 253 ? 19.176  45.630  48.133  1.00 81.76  ? 335 THR C OG1 1 
ATOM   3850 C  CG2 . THR C 2 253 ? 19.005  46.585  50.257  1.00 92.96  ? 335 THR C CG2 1 
ATOM   3851 N  N   . LYS C 2 254 ? 18.009  48.971  46.146  1.00 78.71  ? 336 LYS C N   1 
ATOM   3852 C  CA  . LYS C 2 254 ? 17.382  48.922  44.829  1.00 73.57  ? 336 LYS C CA  1 
ATOM   3853 C  C   . LYS C 2 254 ? 18.313  48.326  43.766  1.00 70.39  ? 336 LYS C C   1 
ATOM   3854 O  O   . LYS C 2 254 ? 17.907  47.445  42.998  1.00 68.39  ? 336 LYS C O   1 
ATOM   3855 C  CB  . LYS C 2 254 ? 16.909  50.328  44.444  1.00 73.25  ? 336 LYS C CB  1 
ATOM   3856 N  N   . SER C 2 255 ? 19.574  48.762  43.730  1.00 67.87  ? 337 SER C N   1 
ATOM   3857 C  CA  . SER C 2 255 ? 20.418  48.513  42.562  1.00 64.88  ? 337 SER C CA  1 
ATOM   3858 C  C   . SER C 2 255 ? 20.657  47.015  42.325  1.00 60.02  ? 337 SER C C   1 
ATOM   3859 O  O   . SER C 2 255 ? 20.427  46.501  41.217  1.00 60.28  ? 337 SER C O   1 
ATOM   3860 C  CB  . SER C 2 255 ? 21.730  49.280  42.736  1.00 68.40  ? 337 SER C CB  1 
ATOM   3861 O  OG  . SER C 2 255 ? 22.766  48.815  41.893  1.00 70.64  ? 337 SER C OG  1 
ATOM   3862 N  N   . ILE C 2 256 ? 21.123  46.295  43.354  1.00 57.78  ? 338 ILE C N   1 
ATOM   3863 C  CA  . ILE C 2 256 ? 21.392  44.864  43.207  1.00 55.44  ? 338 ILE C CA  1 
ATOM   3864 C  C   . ILE C 2 256 ? 20.097  44.110  42.947  1.00 52.23  ? 338 ILE C C   1 
ATOM   3865 O  O   . ILE C 2 256 ? 20.081  43.102  42.227  1.00 45.54  ? 338 ILE C O   1 
ATOM   3866 C  CB  . ILE C 2 256 ? 22.101  44.310  44.453  1.00 58.16  ? 338 ILE C CB  1 
ATOM   3867 C  CG1 . ILE C 2 256 ? 21.318  44.709  45.698  1.00 63.71  ? 338 ILE C CG1 1 
ATOM   3868 C  CG2 . ILE C 2 256 ? 23.522  44.857  44.553  1.00 58.07  ? 338 ILE C CG2 1 
ATOM   3869 C  CD1 . ILE C 2 256 ? 21.707  43.934  46.917  1.00 66.27  ? 338 ILE C CD1 1 
ATOM   3870 N  N   . PHE C 2 257 ? 18.992  44.589  43.517  1.00 53.58  ? 339 PHE C N   1 
ATOM   3871 C  CA  . PHE C 2 257 ? 17.697  44.002  43.221  1.00 50.63  ? 339 PHE C CA  1 
ATOM   3872 C  C   . PHE C 2 257 ? 17.384  44.085  41.732  1.00 52.36  ? 339 PHE C C   1 
ATOM   3873 O  O   . PHE C 2 257 ? 16.980  43.089  41.124  1.00 51.78  ? 339 PHE C O   1 
ATOM   3874 C  CB  . PHE C 2 257 ? 16.625  44.698  44.048  1.00 49.68  ? 339 PHE C CB  1 
ATOM   3875 C  CG  . PHE C 2 257 ? 15.248  44.185  43.799  1.00 44.67  ? 339 PHE C CG  1 
ATOM   3876 C  CD1 . PHE C 2 257 ? 14.794  43.062  44.450  1.00 40.24  ? 339 PHE C CD1 1 
ATOM   3877 C  CD2 . PHE C 2 257 ? 14.405  44.832  42.917  1.00 47.01  ? 339 PHE C CD2 1 
ATOM   3878 C  CE1 . PHE C 2 257 ? 13.522  42.587  44.230  1.00 43.14  ? 339 PHE C CE1 1 
ATOM   3879 C  CE2 . PHE C 2 257 ? 13.130  44.354  42.681  1.00 46.99  ? 339 PHE C CE2 1 
ATOM   3880 C  CZ  . PHE C 2 257 ? 12.689  43.233  43.336  1.00 45.17  ? 339 PHE C CZ  1 
ATOM   3881 N  N   . ASN C 2 258 ? 17.567  45.264  41.121  1.00 53.16  ? 340 ASN C N   1 
ATOM   3882 C  CA  . ASN C 2 258 ? 17.324  45.391  39.682  1.00 56.80  ? 340 ASN C CA  1 
ATOM   3883 C  C   . ASN C 2 258 ? 18.234  44.481  38.870  1.00 56.65  ? 340 ASN C C   1 
ATOM   3884 O  O   . ASN C 2 258 ? 17.814  43.926  37.842  1.00 56.30  ? 340 ASN C O   1 
ATOM   3885 C  CB  . ASN C 2 258 ? 17.507  46.832  39.232  1.00 61.52  ? 340 ASN C CB  1 
ATOM   3886 C  CG  . ASN C 2 258 ? 16.411  47.717  39.732  1.00 65.53  ? 340 ASN C CG  1 
ATOM   3887 O  OD1 . ASN C 2 258 ? 15.338  47.233  40.105  1.00 66.42  ? 340 ASN C OD1 1 
ATOM   3888 N  ND2 . ASN C 2 258 ? 16.669  49.016  39.777  1.00 67.05  ? 340 ASN C ND2 1 
ATOM   3889 N  N   . SER C 2 259 ? 19.491  44.325  39.297  1.00 53.48  ? 341 SER C N   1 
ATOM   3890 C  CA  . SER C 2 259 ? 20.338  43.335  38.644  1.00 50.39  ? 341 SER C CA  1 
ATOM   3891 C  C   . SER C 2 259 ? 19.719  41.940  38.723  1.00 49.95  ? 341 SER C C   1 
ATOM   3892 O  O   . SER C 2 259 ? 19.543  41.269  37.696  1.00 51.84  ? 341 SER C O   1 
ATOM   3893 C  CB  . SER C 2 259 ? 21.714  43.352  39.271  1.00 50.39  ? 341 SER C CB  1 
ATOM   3894 O  OG  . SER C 2 259 ? 22.254  44.625  39.060  1.00 56.06  ? 341 SER C OG  1 
ATOM   3895 N  N   . ALA C 2 260 ? 19.364  41.496  39.933  1.00 43.96  ? 342 ALA C N   1 
ATOM   3896 C  CA  . ALA C 2 260 ? 18.769  40.173  40.091  1.00 44.05  ? 342 ALA C CA  1 
ATOM   3897 C  C   . ALA C 2 260 ? 17.512  40.011  39.240  1.00 46.72  ? 342 ALA C C   1 
ATOM   3898 O  O   . ALA C 2 260 ? 17.315  38.966  38.614  1.00 45.64  ? 342 ALA C O   1 
ATOM   3899 C  CB  . ALA C 2 260 ? 18.449  39.903  41.560  1.00 40.46  ? 342 ALA C CB  1 
ATOM   3900 N  N   . MET C 2 261 ? 16.654  41.034  39.207  1.00 48.99  ? 343 MET C N   1 
ATOM   3901 C  CA  . MET C 2 261 ? 15.459  40.998  38.370  1.00 46.79  ? 343 MET C CA  1 
ATOM   3902 C  C   . MET C 2 261 ? 15.819  40.779  36.912  1.00 49.08  ? 343 MET C C   1 
ATOM   3903 O  O   . MET C 2 261 ? 15.233  39.923  36.244  1.00 50.33  ? 343 MET C O   1 
ATOM   3904 C  CB  . MET C 2 261 ? 14.661  42.290  38.525  1.00 48.32  ? 343 MET C CB  1 
ATOM   3905 C  CG  . MET C 2 261 ? 13.737  42.285  39.729  1.00 54.01  ? 343 MET C CG  1 
ATOM   3906 S  SD  . MET C 2 261 ? 12.692  40.821  39.838  1.00 57.30  ? 343 MET C SD  1 
ATOM   3907 C  CE  . MET C 2 261 ? 12.999  40.444  41.502  1.00 53.20  ? 343 MET C CE  1 
ATOM   3908 N  N   . GLN C 2 262 ? 16.776  41.550  36.396  1.00 51.68  ? 344 GLN C N   1 
ATOM   3909 C  CA  . GLN C 2 262 ? 17.210  41.345  35.018  1.00 52.45  ? 344 GLN C CA  1 
ATOM   3910 C  C   . GLN C 2 262 ? 17.644  39.906  34.788  1.00 45.83  ? 344 GLN C C   1 
ATOM   3911 O  O   . GLN C 2 262 ? 17.309  39.297  33.766  1.00 45.44  ? 344 GLN C O   1 
ATOM   3912 C  CB  . GLN C 2 262 ? 18.360  42.287  34.693  1.00 61.86  ? 344 GLN C CB  1 
ATOM   3913 C  CG  . GLN C 2 262 ? 17.956  43.697  34.409  1.00 72.00  ? 344 GLN C CG  1 
ATOM   3914 C  CD  . GLN C 2 262 ? 19.142  44.521  33.954  1.00 80.43  ? 344 GLN C CD  1 
ATOM   3915 O  OE1 . GLN C 2 262 ? 19.934  44.086  33.097  1.00 81.54  ? 344 GLN C OE1 1 
ATOM   3916 N  NE2 . GLN C 2 262 ? 19.290  45.714  34.539  1.00 83.45  ? 344 GLN C NE2 1 
ATOM   3917 N  N   . GLU C 2 263 ? 18.395  39.348  35.732  1.00 41.29  ? 345 GLU C N   1 
ATOM   3918 C  CA  . GLU C 2 263 ? 18.874  37.982  35.571  1.00 43.01  ? 345 GLU C CA  1 
ATOM   3919 C  C   . GLU C 2 263 ? 17.713  36.998  35.558  1.00 43.02  ? 345 GLU C C   1 
ATOM   3920 O  O   . GLU C 2 263 ? 17.672  36.064  34.739  1.00 44.06  ? 345 GLU C O   1 
ATOM   3921 C  CB  . GLU C 2 263 ? 19.855  37.659  36.688  1.00 43.87  ? 345 GLU C CB  1 
ATOM   3922 C  CG  . GLU C 2 263 ? 20.577  36.373  36.513  1.00 46.51  ? 345 GLU C CG  1 
ATOM   3923 C  CD  . GLU C 2 263 ? 21.442  36.055  37.706  1.00 52.15  ? 345 GLU C CD  1 
ATOM   3924 O  OE1 . GLU C 2 263 ? 22.675  36.077  37.552  1.00 56.37  ? 345 GLU C OE1 1 
ATOM   3925 O  OE2 . GLU C 2 263 ? 20.895  35.799  38.804  1.00 52.79  ? 345 GLU C OE2 1 
ATOM   3926 N  N   . MET C 2 264 ? 16.741  37.218  36.440  1.00 41.69  ? 346 MET C N   1 
ATOM   3927 C  CA  . MET C 2 264 ? 15.542  36.399  36.440  1.00 41.58  ? 346 MET C CA  1 
ATOM   3928 C  C   . MET C 2 264 ? 14.799  36.503  35.111  1.00 43.90  ? 346 MET C C   1 
ATOM   3929 O  O   . MET C 2 264 ? 14.317  35.497  34.590  1.00 42.66  ? 346 MET C O   1 
ATOM   3930 C  CB  . MET C 2 264 ? 14.647  36.806  37.599  1.00 38.64  ? 346 MET C CB  1 
ATOM   3931 C  CG  . MET C 2 264 ? 13.570  35.806  37.885  1.00 39.73  ? 346 MET C CG  1 
ATOM   3932 S  SD  . MET C 2 264 ? 12.098  36.614  38.542  1.00 44.50  ? 346 MET C SD  1 
ATOM   3933 C  CE  . MET C 2 264 ? 11.457  37.479  37.116  1.00 37.59  ? 346 MET C CE  1 
ATOM   3934 N  N   . GLU C 2 265 ? 14.722  37.706  34.536  1.00 43.14  ? 347 GLU C N   1 
ATOM   3935 C  CA  . GLU C 2 265 ? 14.000  37.895  33.286  1.00 43.56  ? 347 GLU C CA  1 
ATOM   3936 C  C   . GLU C 2 265 ? 14.692  37.190  32.119  1.00 47.82  ? 347 GLU C C   1 
ATOM   3937 O  O   . GLU C 2 265 ? 14.022  36.686  31.196  1.00 50.87  ? 347 GLU C O   1 
ATOM   3938 C  CB  . GLU C 2 265 ? 13.836  39.388  33.015  1.00 45.26  ? 347 GLU C CB  1 
ATOM   3939 C  CG  . GLU C 2 265 ? 12.629  39.970  33.703  1.00 51.88  ? 347 GLU C CG  1 
ATOM   3940 C  CD  . GLU C 2 265 ? 12.777  41.445  34.012  1.00 64.44  ? 347 GLU C CD  1 
ATOM   3941 O  OE1 . GLU C 2 265 ? 13.767  42.057  33.530  1.00 70.26  ? 347 GLU C OE1 1 
ATOM   3942 O  OE2 . GLU C 2 265 ? 11.914  41.987  34.754  1.00 66.39  ? 347 GLU C OE2 1 
ATOM   3943 N  N   . VAL C 2 266 ? 16.028  37.162  32.127  1.00 44.44  ? 348 VAL C N   1 
ATOM   3944 C  CA  . VAL C 2 266 ? 16.753  36.332  31.170  1.00 42.03  ? 348 VAL C CA  1 
ATOM   3945 C  C   . VAL C 2 266 ? 16.355  34.876  31.348  1.00 43.50  ? 348 VAL C C   1 
ATOM   3946 O  O   . VAL C 2 266 ? 16.095  34.150  30.379  1.00 46.99  ? 348 VAL C O   1 
ATOM   3947 C  CB  . VAL C 2 266 ? 18.272  36.506  31.343  1.00 40.58  ? 348 VAL C CB  1 
ATOM   3948 C  CG1 . VAL C 2 266 ? 19.005  35.548  30.421  1.00 35.76  ? 348 VAL C CG1 1 
ATOM   3949 C  CG2 . VAL C 2 266 ? 18.694  37.929  31.089  1.00 35.27  ? 348 VAL C CG2 1 
ATOM   3950 N  N   . TYR C 2 267 ? 16.324  34.421  32.600  1.00 44.30  ? 349 TYR C N   1 
ATOM   3951 C  CA  . TYR C 2 267 ? 15.891  33.057  32.857  1.00 45.07  ? 349 TYR C CA  1 
ATOM   3952 C  C   . TYR C 2 267 ? 14.488  32.812  32.294  1.00 47.79  ? 349 TYR C C   1 
ATOM   3953 O  O   . TYR C 2 267 ? 14.240  31.777  31.663  1.00 48.77  ? 349 TYR C O   1 
ATOM   3954 C  CB  . TYR C 2 267 ? 15.963  32.769  34.359  1.00 44.26  ? 349 TYR C CB  1 
ATOM   3955 C  CG  . TYR C 2 267 ? 15.430  31.403  34.765  1.00 45.95  ? 349 TYR C CG  1 
ATOM   3956 C  CD1 . TYR C 2 267 ? 14.079  31.206  34.998  1.00 45.79  ? 349 TYR C CD1 1 
ATOM   3957 C  CD2 . TYR C 2 267 ? 16.284  30.318  34.930  1.00 47.08  ? 349 TYR C CD2 1 
ATOM   3958 C  CE1 . TYR C 2 267 ? 13.592  29.968  35.364  1.00 49.44  ? 349 TYR C CE1 1 
ATOM   3959 C  CE2 . TYR C 2 267 ? 15.802  29.084  35.311  1.00 48.64  ? 349 TYR C CE2 1 
ATOM   3960 C  CZ  . TYR C 2 267 ? 14.452  28.912  35.514  1.00 49.64  ? 349 TYR C CZ  1 
ATOM   3961 O  OH  . TYR C 2 267 ? 13.948  27.686  35.873  1.00 51.89  ? 349 TYR C OH  1 
ATOM   3962 N  N   . VAL C 2 268 ? 13.564  33.761  32.482  1.00 44.39  ? 350 VAL C N   1 
ATOM   3963 C  CA  . VAL C 2 268 ? 12.206  33.586  31.969  1.00 42.19  ? 350 VAL C CA  1 
ATOM   3964 C  C   . VAL C 2 268 ? 12.234  33.424  30.461  1.00 44.22  ? 350 VAL C C   1 
ATOM   3965 O  O   . VAL C 2 268 ? 11.527  32.582  29.897  1.00 43.77  ? 350 VAL C O   1 
ATOM   3966 C  CB  . VAL C 2 268 ? 11.305  34.767  32.385  1.00 41.65  ? 350 VAL C CB  1 
ATOM   3967 C  CG1 . VAL C 2 268 ? 9.989   34.731  31.616  1.00 39.60  ? 350 VAL C CG1 1 
ATOM   3968 C  CG2 . VAL C 2 268 ? 11.030  34.737  33.879  1.00 40.77  ? 350 VAL C CG2 1 
ATOM   3969 N  N   . GLU C 2 269 ? 13.033  34.250  29.776  1.00 45.79  ? 351 GLU C N   1 
ATOM   3970 C  CA  . GLU C 2 269 ? 13.113  34.117  28.331  1.00 44.81  ? 351 GLU C CA  1 
ATOM   3971 C  C   . GLU C 2 269 ? 13.622  32.736  27.949  1.00 47.03  ? 351 GLU C C   1 
ATOM   3972 O  O   . GLU C 2 269 ? 13.060  32.082  27.054  1.00 50.74  ? 351 GLU C O   1 
ATOM   3973 C  CB  . GLU C 2 269 ? 14.002  35.212  27.754  1.00 41.00  ? 351 GLU C CB  1 
ATOM   3974 C  CG  . GLU C 2 269 ? 14.086  35.236  26.241  1.00 43.40  ? 351 GLU C CG  1 
ATOM   3975 C  CD  . GLU C 2 269 ? 12.708  35.326  25.579  1.00 60.20  ? 351 GLU C CD  1 
ATOM   3976 O  OE1 . GLU C 2 269 ? 12.546  34.839  24.435  1.00 48.00  ? 351 GLU C OE1 1 
ATOM   3977 O  OE2 . GLU C 2 269 ? 11.778  35.877  26.218  1.00 57.56  ? 351 GLU C OE2 1 
ATOM   3978 N  N   . ASN C 2 270 ? 14.660  32.255  28.643  1.00 44.42  ? 352 ASN C N   1 
ATOM   3979 C  CA  . ASN C 2 270 ? 15.179  30.922  28.350  1.00 45.68  ? 352 ASN C CA  1 
ATOM   3980 C  C   . ASN C 2 270 ? 14.130  29.845  28.598  1.00 43.12  ? 352 ASN C C   1 
ATOM   3981 O  O   . ASN C 2 270 ? 14.028  28.893  27.818  1.00 45.70  ? 352 ASN C O   1 
ATOM   3982 C  CB  . ASN C 2 270 ? 16.427  30.641  29.176  1.00 48.03  ? 352 ASN C CB  1 
ATOM   3983 C  CG  . ASN C 2 270 ? 17.628  31.403  28.670  1.00 50.37  ? 352 ASN C CG  1 
ATOM   3984 O  OD1 . ASN C 2 270 ? 17.673  31.802  27.511  1.00 50.37  ? 352 ASN C OD1 1 
ATOM   3985 N  ND2 . ASN C 2 270 ? 18.601  31.625  29.543  1.00 51.51  ? 352 ASN C ND2 1 
ATOM   3986 N  N   . ILE C 2 271 ? 13.339  29.971  29.670  1.00 42.13  ? 353 ILE C N   1 
ATOM   3987 C  CA  . ILE C 2 271 ? 12.302  28.972  29.929  1.00 47.71  ? 353 ILE C CA  1 
ATOM   3988 C  C   . ILE C 2 271 ? 11.253  29.017  28.819  1.00 53.76  ? 353 ILE C C   1 
ATOM   3989 O  O   . ILE C 2 271 ? 10.805  27.969  28.332  1.00 57.21  ? 353 ILE C O   1 
ATOM   3990 C  CB  . ILE C 2 271 ? 11.686  29.145  31.340  1.00 51.86  ? 353 ILE C CB  1 
ATOM   3991 C  CG1 . ILE C 2 271 ? 11.010  27.864  31.828  1.00 55.80  ? 353 ILE C CG1 1 
ATOM   3992 C  CG2 . ILE C 2 271 ? 10.633  30.189  31.383  1.00 57.41  ? 353 ILE C CG2 1 
ATOM   3993 C  CD1 . ILE C 2 271 ? 11.915  26.956  32.596  1.00 58.81  ? 353 ILE C CD1 1 
ATOM   3994 N  N   . ARG C 2 272 ? 10.908  30.219  28.346  1.00 50.76  ? 354 ARG C N   1 
ATOM   3995 C  CA  . ARG C 2 272 ? 9.972   30.321  27.243  1.00 52.02  ? 354 ARG C CA  1 
ATOM   3996 C  C   . ARG C 2 272 ? 10.514  29.675  25.979  1.00 51.83  ? 354 ARG C C   1 
ATOM   3997 O  O   . ARG C 2 272 ? 9.745   29.093  25.205  1.00 53.33  ? 354 ARG C O   1 
ATOM   3998 C  CB  . ARG C 2 272 ? 9.615   31.778  26.997  1.00 53.29  ? 354 ARG C CB  1 
ATOM   3999 C  CG  . ARG C 2 272 ? 8.409   32.173  27.775  1.00 54.32  ? 354 ARG C CG  1 
ATOM   4000 C  CD  . ARG C 2 272 ? 8.367   33.631  28.083  1.00 52.03  ? 354 ARG C CD  1 
ATOM   4001 N  NE  . ARG C 2 272 ? 7.280   33.883  29.012  1.00 49.98  ? 354 ARG C NE  1 
ATOM   4002 C  CZ  . ARG C 2 272 ? 7.011   35.061  29.553  1.00 48.57  ? 354 ARG C CZ  1 
ATOM   4003 N  NH1 . ARG C 2 272 ? 7.757   36.126  29.259  1.00 45.98  ? 354 ARG C NH1 1 
ATOM   4004 N  NH2 . ARG C 2 272 ? 5.989   35.164  30.395  1.00 46.85  ? 354 ARG C NH2 1 
ATOM   4005 N  N   . ARG C 2 273 ? 11.822  29.763  25.735  1.00 50.54  ? 355 ARG C N   1 
ATOM   4006 C  CA  . ARG C 2 273 ? 12.336  29.105  24.538  1.00 52.17  ? 355 ARG C CA  1 
ATOM   4007 C  C   . ARG C 2 273 ? 12.482  27.599  24.725  1.00 51.72  ? 355 ARG C C   1 
ATOM   4008 O  O   . ARG C 2 273 ? 12.305  26.854  23.757  1.00 53.72  ? 355 ARG C O   1 
ATOM   4009 C  CB  . ARG C 2 273 ? 13.671  29.713  24.107  1.00 54.69  ? 355 ARG C CB  1 
ATOM   4010 C  CG  . ARG C 2 273 ? 13.746  31.223  24.233  1.00 55.52  ? 355 ARG C CG  1 
ATOM   4011 C  CD  . ARG C 2 273 ? 15.088  31.774  23.790  1.00 54.62  ? 355 ARG C CD  1 
ATOM   4012 N  NE  . ARG C 2 273 ? 14.970  33.193  23.495  1.00 54.12  ? 355 ARG C NE  1 
ATOM   4013 C  CZ  . ARG C 2 273 ? 15.976  33.972  23.106  1.00 52.63  ? 355 ARG C CZ  1 
ATOM   4014 N  NH1 . ARG C 2 273 ? 17.202  33.470  22.980  1.00 48.72  ? 355 ARG C NH1 1 
ATOM   4015 N  NH2 . ARG C 2 273 ? 15.748  35.262  22.842  1.00 53.00  ? 355 ARG C NH2 1 
ATOM   4016 N  N   . LYS C 2 274 ? 12.793  27.130  25.945  1.00 48.86  ? 356 LYS C N   1 
ATOM   4017 C  CA  . LYS C 2 274 ? 12.941  25.693  26.158  1.00 50.77  ? 356 LYS C CA  1 
ATOM   4018 C  C   . LYS C 2 274 ? 11.591  24.988  26.168  1.00 54.07  ? 356 LYS C C   1 
ATOM   4019 O  O   . LYS C 2 274 ? 11.432  23.948  25.527  1.00 57.34  ? 356 LYS C O   1 
ATOM   4020 C  CB  . LYS C 2 274 ? 13.693  25.402  27.462  1.00 48.16  ? 356 LYS C CB  1 
ATOM   4021 N  N   . PHE C 2 275 ? 10.602  25.544  26.869  1.00 55.58  ? 357 PHE C N   1 
ATOM   4022 C  CA  . PHE C 2 275 ? 9.356   24.843  27.136  1.00 56.77  ? 357 PHE C CA  1 
ATOM   4023 C  C   . PHE C 2 275 ? 8.131   25.471  26.489  1.00 57.35  ? 357 PHE C C   1 
ATOM   4024 O  O   . PHE C 2 275 ? 7.126   24.775  26.307  1.00 58.23  ? 357 PHE C O   1 
ATOM   4025 C  CB  . PHE C 2 275 ? 9.120   24.745  28.650  1.00 58.32  ? 357 PHE C CB  1 
ATOM   4026 C  CG  . PHE C 2 275 ? 10.107  23.873  29.360  1.00 60.42  ? 357 PHE C CG  1 
ATOM   4027 C  CD1 . PHE C 2 275 ? 10.106  22.506  29.161  1.00 63.28  ? 357 PHE C CD1 1 
ATOM   4028 C  CD2 . PHE C 2 275 ? 11.030  24.419  30.244  1.00 60.96  ? 357 PHE C CD2 1 
ATOM   4029 C  CE1 . PHE C 2 275 ? 11.016  21.700  29.824  1.00 63.33  ? 357 PHE C CE1 1 
ATOM   4030 C  CE2 . PHE C 2 275 ? 11.935  23.612  30.917  1.00 59.14  ? 357 PHE C CE2 1 
ATOM   4031 C  CZ  . PHE C 2 275 ? 11.931  22.257  30.699  1.00 58.79  ? 357 PHE C CZ  1 
ATOM   4032 N  N   . GLY C 2 276 ? 8.181   26.749  26.142  1.00 56.43  ? 358 GLY C N   1 
ATOM   4033 C  CA  . GLY C 2 276 ? 7.121   27.393  25.418  1.00 56.74  ? 358 GLY C CA  1 
ATOM   4034 C  C   . GLY C 2 276 ? 6.273   28.309  26.262  1.00 57.37  ? 358 GLY C C   1 
ATOM   4035 O  O   . GLY C 2 276 ? 5.524   29.116  25.711  1.00 58.73  ? 358 GLY C O   1 
ATOM   4036 N  N   . VAL C 2 277 ? 6.371   28.212  27.582  1.00 55.24  ? 359 VAL C N   1 
ATOM   4037 C  CA  . VAL C 2 277 ? 5.548   29.033  28.455  1.00 57.84  ? 359 VAL C CA  1 
ATOM   4038 C  C   . VAL C 2 277 ? 6.341   29.464  29.675  1.00 55.09  ? 359 VAL C C   1 
ATOM   4039 O  O   . VAL C 2 277 ? 7.294   28.804  30.093  1.00 57.34  ? 359 VAL C O   1 
ATOM   4040 C  CB  . VAL C 2 277 ? 4.266   28.300  28.911  1.00 60.90  ? 359 VAL C CB  1 
ATOM   4041 C  CG1 . VAL C 2 277 ? 3.249   28.241  27.779  1.00 63.70  ? 359 VAL C CG1 1 
ATOM   4042 C  CG2 . VAL C 2 277 ? 4.599   26.919  29.473  1.00 60.96  ? 359 VAL C CG2 1 
ATOM   4043 N  N   . PHE C 2 278 ? 5.943   30.595  30.237  1.00 53.32  ? 360 PHE C N   1 
ATOM   4044 C  CA  . PHE C 2 278 ? 6.184   30.868  31.646  1.00 52.41  ? 360 PHE C CA  1 
ATOM   4045 C  C   . PHE C 2 278 ? 5.035   31.736  32.103  1.00 56.78  ? 360 PHE C C   1 
ATOM   4046 O  O   . PHE C 2 278 ? 4.849   32.833  31.562  1.00 60.97  ? 360 PHE C O   1 
ATOM   4047 C  CB  . PHE C 2 278 ? 7.504   31.585  31.917  1.00 52.28  ? 360 PHE C CB  1 
ATOM   4048 C  CG  . PHE C 2 278 ? 7.682   31.954  33.379  1.00 51.46  ? 360 PHE C CG  1 
ATOM   4049 C  CD1 . PHE C 2 278 ? 7.221   33.168  33.862  1.00 50.01  ? 360 PHE C CD1 1 
ATOM   4050 C  CD2 . PHE C 2 278 ? 8.259   31.057  34.279  1.00 51.05  ? 360 PHE C CD2 1 
ATOM   4051 C  CE1 . PHE C 2 278 ? 7.349   33.488  35.195  1.00 50.13  ? 360 PHE C CE1 1 
ATOM   4052 C  CE2 . PHE C 2 278 ? 8.402   31.378  35.621  1.00 49.37  ? 360 PHE C CE2 1 
ATOM   4053 C  CZ  . PHE C 2 278 ? 7.946   32.589  36.080  1.00 49.68  ? 360 PHE C CZ  1 
ATOM   4054 N  N   . ASN C 2 279 ? 4.288   31.279  33.094  1.00 53.00  ? 361 ASN C N   1 
ATOM   4055 C  CA  . ASN C 2 279 ? 3.106   32.000  33.521  1.00 53.57  ? 361 ASN C CA  1 
ATOM   4056 C  C   . ASN C 2 279 ? 3.394   32.756  34.813  1.00 51.91  ? 361 ASN C C   1 
ATOM   4057 O  O   . ASN C 2 279 ? 3.709   32.148  35.845  1.00 52.09  ? 361 ASN C O   1 
ATOM   4058 C  CB  . ASN C 2 279 ? 1.933   31.044  33.655  1.00 51.50  ? 361 ASN C CB  1 
ATOM   4059 C  CG  . ASN C 2 279 ? 1.648   30.349  32.398  1.00 60.39  ? 361 ASN C CG  1 
ATOM   4060 O  OD1 . ASN C 2 279 ? 1.273   30.978  31.412  1.00 68.16  ? 361 ASN C OD1 1 
ATOM   4061 N  ND2 . ASN C 2 279 ? 1.754   29.048  32.413  1.00 54.57  ? 361 ASN C ND2 1 
ATOM   4062 N  N   . TYR C 2 280 ? 3.318   34.086  34.740  1.00 52.61  ? 362 TYR C N   1 
ATOM   4063 C  CA  . TYR C 2 280 ? 3.373   34.904  35.940  1.00 51.29  ? 362 TYR C CA  1 
ATOM   4064 C  C   . TYR C 2 280 ? 2.107   34.710  36.772  1.00 58.63  ? 362 TYR C C   1 
ATOM   4065 O  O   . TYR C 2 280 ? 1.035   34.369  36.257  1.00 62.76  ? 362 TYR C O   1 
ATOM   4066 C  CB  . TYR C 2 280 ? 3.545   36.372  35.577  1.00 46.93  ? 362 TYR C CB  1 
ATOM   4067 C  CG  . TYR C 2 280 ? 4.973   36.761  35.244  1.00 48.01  ? 362 TYR C CG  1 
ATOM   4068 C  CD1 . TYR C 2 280 ? 5.887   37.102  36.251  1.00 44.14  ? 362 TYR C CD1 1 
ATOM   4069 C  CD2 . TYR C 2 280 ? 5.423   36.768  33.928  1.00 49.60  ? 362 TYR C CD2 1 
ATOM   4070 C  CE1 . TYR C 2 280 ? 7.187   37.446  35.948  1.00 40.70  ? 362 TYR C CE1 1 
ATOM   4071 C  CE2 . TYR C 2 280 ? 6.736   37.121  33.620  1.00 48.05  ? 362 TYR C CE2 1 
ATOM   4072 C  CZ  . TYR C 2 280 ? 7.608   37.458  34.641  1.00 44.61  ? 362 TYR C CZ  1 
ATOM   4073 O  OH  . TYR C 2 280 ? 8.903   37.808  34.342  1.00 46.47  ? 362 TYR C OH  1 
ATOM   4074 N  N   . SER C 2 281 ? 2.241   34.916  38.072  1.00 59.18  ? 363 SER C N   1 
ATOM   4075 C  CA  . SER C 2 281 ? 1.118   34.722  38.973  1.00 62.86  ? 363 SER C CA  1 
ATOM   4076 C  C   . SER C 2 281 ? 0.477   36.047  39.339  1.00 64.44  ? 363 SER C C   1 
ATOM   4077 O  O   . SER C 2 281 ? 1.082   37.118  39.187  1.00 58.33  ? 363 SER C O   1 
ATOM   4078 C  CB  . SER C 2 281 ? 1.565   34.020  40.252  1.00 63.57  ? 363 SER C CB  1 
ATOM   4079 O  OG  . SER C 2 281 ? 1.574   32.627  40.060  1.00 66.85  ? 363 SER C OG  1 
ATOM   4080 N  N   . PRO C 2 282 ? -0.775  36.008  39.794  1.00 69.13  ? 364 PRO C N   1 
ATOM   4081 C  CA  . PRO C 2 282 ? -1.350  37.188  40.438  1.00 69.55  ? 364 PRO C CA  1 
ATOM   4082 C  C   . PRO C 2 282 ? -0.569  37.546  41.692  1.00 66.28  ? 364 PRO C C   1 
ATOM   4083 O  O   . PRO C 2 282 ? 0.132   36.727  42.285  1.00 65.03  ? 364 PRO C O   1 
ATOM   4084 C  CB  . PRO C 2 282 ? -2.792  36.762  40.763  1.00 73.00  ? 364 PRO C CB  1 
ATOM   4085 C  CG  . PRO C 2 282 ? -2.835  35.269  40.556  1.00 72.14  ? 364 PRO C CG  1 
ATOM   4086 C  CD  . PRO C 2 282 ? -1.783  34.963  39.543  1.00 69.51  ? 364 PRO C CD  1 
ATOM   4087 N  N   . PHE C 2 283 ? -0.685  38.813  42.059  1.00 68.19  ? 365 PHE C N   1 
ATOM   4088 C  CA  . PHE C 2 283 ? -0.082  39.360  43.264  1.00 66.38  ? 365 PHE C CA  1 
ATOM   4089 C  C   . PHE C 2 283 ? -0.287  38.441  44.461  1.00 65.27  ? 365 PHE C C   1 
ATOM   4090 O  O   . PHE C 2 283 ? -1.391  37.955  44.707  1.00 67.91  ? 365 PHE C O   1 
ATOM   4091 C  CB  . PHE C 2 283 ? -0.715  40.729  43.519  1.00 71.31  ? 365 PHE C CB  1 
ATOM   4092 C  CG  . PHE C 2 283 ? -0.202  41.420  44.717  1.00 73.13  ? 365 PHE C CG  1 
ATOM   4093 C  CD1 . PHE C 2 283 ? 1.131   41.764  44.807  1.00 74.00  ? 365 PHE C CD1 1 
ATOM   4094 C  CD2 . PHE C 2 283 ? -1.054  41.765  45.746  1.00 75.73  ? 365 PHE C CD2 1 
ATOM   4095 C  CE1 . PHE C 2 283 ? 1.614   42.419  45.928  1.00 75.60  ? 365 PHE C CE1 1 
ATOM   4096 C  CE2 . PHE C 2 283 ? -0.582  42.423  46.861  1.00 78.26  ? 365 PHE C CE2 1 
ATOM   4097 C  CZ  . PHE C 2 283 ? 0.755   42.753  46.956  1.00 76.32  ? 365 PHE C CZ  1 
ATOM   4098 N  N   . ARG C 2 284 ? 0.792   38.177  45.187  1.00 62.45  ? 366 ARG C N   1 
ATOM   4099 C  CA  . ARG C 2 284 ? 0.740   37.386  46.415  1.00 60.31  ? 366 ARG C CA  1 
ATOM   4100 C  C   . ARG C 2 284 ? -0.024  36.073  46.231  1.00 59.59  ? 366 ARG C C   1 
ATOM   4101 O  O   . ARG C 2 284 ? -0.965  35.771  46.957  1.00 60.19  ? 366 ARG C O   1 
ATOM   4102 C  CB  . ARG C 2 284 ? 0.140   38.208  47.555  1.00 63.33  ? 366 ARG C CB  1 
ATOM   4103 C  CG  . ARG C 2 284 ? 1.135   39.159  48.213  1.00 64.45  ? 366 ARG C CG  1 
ATOM   4104 C  CD  . ARG C 2 284 ? 0.513   39.917  49.393  1.00 67.05  ? 366 ARG C CD  1 
ATOM   4105 N  NE  . ARG C 2 284 ? 1.430   39.950  50.526  1.00 67.76  ? 366 ARG C NE  1 
ATOM   4106 C  CZ  . ARG C 2 284 ? 1.243   39.281  51.659  1.00 69.80  ? 366 ARG C CZ  1 
ATOM   4107 N  NH1 . ARG C 2 284 ? 0.166   38.535  51.818  1.00 72.40  ? 366 ARG C NH1 1 
ATOM   4108 N  NH2 . ARG C 2 284 ? 2.134   39.354  52.637  1.00 71.16  ? 366 ARG C NH2 1 
ATOM   4109 N  N   . THR C 2 285 ? 0.384   35.283  45.242  1.00 58.92  ? 367 THR C N   1 
ATOM   4110 C  CA  . THR C 2 285 ? -0.108  33.913  45.138  1.00 59.36  ? 367 THR C CA  1 
ATOM   4111 C  C   . THR C 2 285 ? 0.796   33.006  45.953  1.00 58.72  ? 367 THR C C   1 
ATOM   4112 O  O   . THR C 2 285 ? 1.984   32.894  45.634  1.00 59.79  ? 367 THR C O   1 
ATOM   4113 C  CB  . THR C 2 285 ? -0.130  33.420  43.697  1.00 60.83  ? 367 THR C CB  1 
ATOM   4114 O  OG1 . THR C 2 285 ? -0.892  34.305  42.871  1.00 51.92  ? 367 THR C OG1 1 
ATOM   4115 C  CG2 . THR C 2 285 ? -0.715  32.010  43.642  1.00 51.99  ? 367 THR C CG2 1 
ATOM   4116 N  N   . PRO C 2 286 ? 0.291   32.334  46.981  1.00 59.27  ? 368 PRO C N   1 
ATOM   4117 C  CA  . PRO C 2 286 ? 1.174   31.550  47.856  1.00 56.77  ? 368 PRO C CA  1 
ATOM   4118 C  C   . PRO C 2 286 ? 1.770   30.354  47.129  1.00 59.26  ? 368 PRO C C   1 
ATOM   4119 O  O   . PRO C 2 286 ? 1.050   29.557  46.522  1.00 61.32  ? 368 PRO C O   1 
ATOM   4120 C  CB  . PRO C 2 286 ? 0.244   31.108  48.993  1.00 57.26  ? 368 PRO C CB  1 
ATOM   4121 C  CG  . PRO C 2 286 ? -0.935  32.039  48.918  1.00 59.12  ? 368 PRO C CG  1 
ATOM   4122 C  CD  . PRO C 2 286 ? -1.097  32.352  47.466  1.00 61.33  ? 368 PRO C CD  1 
ATOM   4123 N  N   . TYR C 2 287 ? 3.099   30.234  47.199  1.00 60.56  ? 369 TYR C N   1 
ATOM   4124 C  CA  . TYR C 2 287 ? 3.781   29.054  46.676  1.00 58.69  ? 369 TYR C CA  1 
ATOM   4125 C  C   . TYR C 2 287 ? 3.245   27.804  47.350  1.00 59.66  ? 369 TYR C C   1 
ATOM   4126 O  O   . TYR C 2 287 ? 3.093   27.764  48.570  1.00 61.05  ? 369 TYR C O   1 
ATOM   4127 C  CB  . TYR C 2 287 ? 5.289   29.147  46.912  1.00 56.33  ? 369 TYR C CB  1 
ATOM   4128 C  CG  . TYR C 2 287 ? 6.037   27.886  46.534  1.00 56.62  ? 369 TYR C CG  1 
ATOM   4129 C  CD1 . TYR C 2 287 ? 6.249   27.550  45.203  1.00 58.02  ? 369 TYR C CD1 1 
ATOM   4130 C  CD2 . TYR C 2 287 ? 6.538   27.036  47.497  1.00 57.06  ? 369 TYR C CD2 1 
ATOM   4131 C  CE1 . TYR C 2 287 ? 6.936   26.393  44.847  1.00 57.63  ? 369 TYR C CE1 1 
ATOM   4132 C  CE2 . TYR C 2 287 ? 7.220   25.878  47.154  1.00 57.66  ? 369 TYR C CE2 1 
ATOM   4133 C  CZ  . TYR C 2 287 ? 7.416   25.567  45.829  1.00 58.05  ? 369 TYR C CZ  1 
ATOM   4134 O  OH  . TYR C 2 287 ? 8.086   24.421  45.482  1.00 60.04  ? 369 TYR C OH  1 
ATOM   4135 N  N   . THR C 2 288 ? 2.951   26.788  46.559  1.00 59.63  ? 370 THR C N   1 
ATOM   4136 C  CA  . THR C 2 288 ? 2.587   25.492  47.099  1.00 61.62  ? 370 THR C CA  1 
ATOM   4137 C  C   . THR C 2 288 ? 3.660   24.500  46.685  1.00 62.54  ? 370 THR C C   1 
ATOM   4138 O  O   . THR C 2 288 ? 4.350   24.708  45.678  1.00 55.60  ? 370 THR C O   1 
ATOM   4139 C  CB  . THR C 2 288 ? 1.213   25.017  46.596  1.00 61.13  ? 370 THR C CB  1 
ATOM   4140 O  OG1 . THR C 2 288 ? 1.083   25.334  45.210  1.00 66.04  ? 370 THR C OG1 1 
ATOM   4141 C  CG2 . THR C 2 288 ? 0.121   25.703  47.357  1.00 56.21  ? 370 THR C CG2 1 
ATOM   4142 N  N   . PRO C 2 289 ? 3.834   23.417  47.443  1.00 68.46  ? 371 PRO C N   1 
ATOM   4143 C  CA  . PRO C 2 289 ? 4.807   22.399  47.043  1.00 72.02  ? 371 PRO C CA  1 
ATOM   4144 C  C   . PRO C 2 289 ? 4.421   21.778  45.709  1.00 80.72  ? 371 PRO C C   1 
ATOM   4145 O  O   . PRO C 2 289 ? 3.236   21.631  45.387  1.00 78.29  ? 371 PRO C O   1 
ATOM   4146 C  CB  . PRO C 2 289 ? 4.745   21.377  48.184  1.00 66.68  ? 371 PRO C CB  1 
ATOM   4147 C  CG  . PRO C 2 289 ? 4.076   22.085  49.304  1.00 64.41  ? 371 PRO C CG  1 
ATOM   4148 C  CD  . PRO C 2 289 ? 3.128   23.039  48.675  1.00 54.77  ? 371 PRO C CD  1 
ATOM   4149 N  N   . ASN C 2 290 ? 5.444   21.430  44.925  1.00 96.96  ? 372 ASN C N   1 
ATOM   4150 C  CA  . ASN C 2 290 ? 5.260   20.804  43.617  1.00 100.26 ? 372 ASN C CA  1 
ATOM   4151 C  C   . ASN C 2 290 ? 4.329   21.630  42.743  1.00 99.23  ? 372 ASN C C   1 
ATOM   4152 O  O   . ASN C 2 290 ? 3.542   21.085  41.968  1.00 101.04 ? 372 ASN C O   1 
ATOM   4153 C  CB  . ASN C 2 290 ? 4.734   19.370  43.753  1.00 109.46 ? 372 ASN C CB  1 
ATOM   4154 C  CG  . ASN C 2 290 ? 5.725   18.451  44.450  1.00 113.60 ? 372 ASN C CG  1 
ATOM   4155 O  OD1 . ASN C 2 290 ? 6.935   18.563  44.247  1.00 113.31 ? 372 ASN C OD1 1 
ATOM   4156 N  ND2 . ASN C 2 290 ? 5.217   17.543  45.279  1.00 115.24 ? 372 ASN C ND2 1 
ATOM   4157 N  N   . SER C 2 291 ? 4.392   22.949  42.894  1.00 87.71  ? 373 SER C N   1 
ATOM   4158 C  CA  . SER C 2 291 ? 3.526   23.818  42.119  1.00 82.72  ? 373 SER C CA  1 
ATOM   4159 C  C   . SER C 2 291 ? 3.793   23.602  40.641  1.00 78.64  ? 373 SER C C   1 
ATOM   4160 O  O   . SER C 2 291 ? 4.920   23.325  40.229  1.00 79.04  ? 373 SER C O   1 
ATOM   4161 C  CB  . SER C 2 291 ? 3.760   25.282  42.496  1.00 78.15  ? 373 SER C CB  1 
ATOM   4162 O  OG  . SER C 2 291 ? 2.709   26.113  42.034  1.00 79.04  ? 373 SER C OG  1 
ATOM   4163 N  N   . GLN C 2 292 ? 2.733   23.688  39.842  1.00 77.79  ? 374 GLN C N   1 
ATOM   4164 C  CA  . GLN C 2 292 ? 2.864   23.559  38.400  1.00 76.26  ? 374 GLN C CA  1 
ATOM   4165 C  C   . GLN C 2 292 ? 2.311   24.748  37.624  1.00 70.64  ? 374 GLN C C   1 
ATOM   4166 O  O   . GLN C 2 292 ? 2.453   24.772  36.396  1.00 71.51  ? 374 GLN C O   1 
ATOM   4167 C  CB  . GLN C 2 292 ? 2.187   22.264  37.916  1.00 83.97  ? 374 GLN C CB  1 
ATOM   4168 C  CG  . GLN C 2 292 ? 2.852   21.000  38.442  1.00 87.32  ? 374 GLN C CG  1 
ATOM   4169 C  CD  . GLN C 2 292 ? 3.870   20.432  37.466  1.00 90.55  ? 374 GLN C CD  1 
ATOM   4170 O  OE1 . GLN C 2 292 ? 3.763   19.280  37.040  1.00 94.92  ? 374 GLN C OE1 1 
ATOM   4171 N  NE2 . GLN C 2 292 ? 4.859   21.243  37.097  1.00 88.33  ? 374 GLN C NE2 1 
ATOM   4172 N  N   . TYR C 2 293 ? 1.732   25.747  38.307  1.00 65.17  ? 375 TYR C N   1 
ATOM   4173 C  CA  . TYR C 2 293 ? 1.032   26.839  37.629  1.00 62.12  ? 375 TYR C CA  1 
ATOM   4174 C  C   . TYR C 2 293 ? 1.891   27.478  36.546  1.00 57.75  ? 375 TYR C C   1 
ATOM   4175 O  O   . TYR C 2 293 ? 1.398   27.785  35.454  1.00 59.33  ? 375 TYR C O   1 
ATOM   4176 C  CB  . TYR C 2 293 ? 0.574   27.903  38.642  1.00 58.24  ? 375 TYR C CB  1 
ATOM   4177 C  CG  . TYR C 2 293 ? -0.078  29.121  37.991  1.00 57.78  ? 375 TYR C CG  1 
ATOM   4178 C  CD1 . TYR C 2 293 ? -1.426  29.118  37.659  1.00 62.52  ? 375 TYR C CD1 1 
ATOM   4179 C  CD2 . TYR C 2 293 ? 0.661   30.262  37.684  1.00 54.80  ? 375 TYR C CD2 1 
ATOM   4180 C  CE1 . TYR C 2 293 ? -2.027  30.220  37.051  1.00 62.96  ? 375 TYR C CE1 1 
ATOM   4181 C  CE2 . TYR C 2 293 ? 0.073   31.364  37.076  1.00 55.20  ? 375 TYR C CE2 1 
ATOM   4182 C  CZ  . TYR C 2 293 ? -1.271  31.335  36.760  1.00 59.66  ? 375 TYR C CZ  1 
ATOM   4183 O  OH  . TYR C 2 293 ? -1.863  32.414  36.150  1.00 60.25  ? 375 TYR C OH  1 
ATOM   4184 N  N   . GLN C 2 294 ? 3.183   27.668  36.820  1.00 54.20  ? 376 GLN C N   1 
ATOM   4185 C  CA  . GLN C 2 294 ? 4.050   28.362  35.876  1.00 53.15  ? 376 GLN C CA  1 
ATOM   4186 C  C   . GLN C 2 294 ? 4.232   27.605  34.564  1.00 52.68  ? 376 GLN C C   1 
ATOM   4187 O  O   . GLN C 2 294 ? 4.552   28.234  33.549  1.00 53.77  ? 376 GLN C O   1 
ATOM   4188 C  CB  . GLN C 2 294 ? 5.414   28.635  36.513  1.00 49.45  ? 376 GLN C CB  1 
ATOM   4189 C  CG  . GLN C 2 294 ? 5.417   29.795  37.477  1.00 48.22  ? 376 GLN C CG  1 
ATOM   4190 C  CD  . GLN C 2 294 ? 6.732   29.922  38.230  1.00 47.86  ? 376 GLN C CD  1 
ATOM   4191 O  OE1 . GLN C 2 294 ? 7.739   29.287  37.864  1.00 48.34  ? 376 GLN C OE1 1 
ATOM   4192 N  NE2 . GLN C 2 294 ? 6.726   30.721  39.304  1.00 42.96  ? 376 GLN C NE2 1 
ATOM   4193 N  N   . MET C 2 295 ? 4.037   26.287  34.552  1.00 51.80  ? 377 MET C N   1 
ATOM   4194 C  CA  . MET C 2 295 ? 4.224   25.495  33.347  1.00 57.36  ? 377 MET C CA  1 
ATOM   4195 C  C   . MET C 2 295 ? 2.909   25.113  32.680  1.00 62.51  ? 377 MET C C   1 
ATOM   4196 O  O   . MET C 2 295 ? 2.904   24.256  31.796  1.00 65.74  ? 377 MET C O   1 
ATOM   4197 C  CB  . MET C 2 295 ? 5.030   24.240  33.666  1.00 62.62  ? 377 MET C CB  1 
ATOM   4198 C  CG  . MET C 2 295 ? 6.493   24.510  33.971  1.00 65.82  ? 377 MET C CG  1 
ATOM   4199 S  SD  . MET C 2 295 ? 7.346   25.290  32.583  1.00 75.30  ? 377 MET C SD  1 
ATOM   4200 C  CE  . MET C 2 295 ? 7.610   26.974  33.188  1.00 72.25  ? 377 MET C CE  1 
ATOM   4201 N  N   . LEU C 2 296 ? 1.801   25.730  33.070  1.00 63.57  ? 378 LEU C N   1 
ATOM   4202 C  CA  . LEU C 2 296 ? 0.519   25.379  32.485  1.00 68.06  ? 378 LEU C CA  1 
ATOM   4203 C  C   . LEU C 2 296 ? 0.422   25.892  31.052  1.00 73.63  ? 378 LEU C C   1 
ATOM   4204 O  O   . LEU C 2 296 ? 0.771   27.039  30.760  1.00 75.92  ? 378 LEU C O   1 
ATOM   4205 C  CB  . LEU C 2 296 ? -0.612  25.956  33.330  1.00 68.78  ? 378 LEU C CB  1 
ATOM   4206 C  CG  . LEU C 2 296 ? -1.007  25.197  34.591  1.00 66.61  ? 378 LEU C CG  1 
ATOM   4207 C  CD1 . LEU C 2 296 ? -2.063  25.978  35.328  1.00 68.14  ? 378 LEU C CD1 1 
ATOM   4208 C  CD2 . LEU C 2 296 ? -1.532  23.841  34.224  1.00 67.36  ? 378 LEU C CD2 1 
ATOM   4209 N  N   . LEU C 2 297 ? -0.059  25.027  30.151  1.00 75.39  ? 379 LEU C N   1 
ATOM   4210 C  CA  . LEU C 2 297 ? -0.271  25.438  28.766  1.00 76.59  ? 379 LEU C CA  1 
ATOM   4211 C  C   . LEU C 2 297 ? -1.336  26.516  28.667  1.00 77.45  ? 379 LEU C C   1 
ATOM   4212 O  O   . LEU C 2 297 ? -1.239  27.419  27.827  1.00 78.92  ? 379 LEU C O   1 
ATOM   4213 C  CB  . LEU C 2 297 ? -0.660  24.227  27.913  1.00 77.98  ? 379 LEU C CB  1 
ATOM   4214 C  CG  . LEU C 2 297 ? 0.435   23.160  27.948  1.00 76.36  ? 379 LEU C CG  1 
ATOM   4215 C  CD1 . LEU C 2 297 ? 0.071   21.887  27.199  1.00 75.53  ? 379 LEU C CD1 1 
ATOM   4216 C  CD2 . LEU C 2 297 ? 1.748   23.764  27.446  1.00 72.06  ? 379 LEU C CD2 1 
ATOM   4217 N  N   . ASP C 2 298 ? -2.350  26.433  29.492  1.00 78.33  ? 380 ASP C N   1 
ATOM   4218 C  CA  . ASP C 2 298 ? -3.312  27.509  29.582  1.00 85.27  ? 380 ASP C CA  1 
ATOM   4219 C  C   . ASP C 2 298 ? -3.605  27.755  31.048  1.00 88.56  ? 380 ASP C C   1 
ATOM   4220 O  O   . ASP C 2 298 ? -4.283  26.944  31.692  1.00 90.89  ? 380 ASP C O   1 
ATOM   4221 C  CB  . ASP C 2 298 ? -4.598  27.181  28.834  1.00 93.73  ? 380 ASP C CB  1 
ATOM   4222 C  CG  . ASP C 2 298 ? -5.413  28.418  28.540  1.00 98.38  ? 380 ASP C CG  1 
ATOM   4223 O  OD1 . ASP C 2 298 ? -4.993  29.517  28.986  1.00 96.26  ? 380 ASP C OD1 1 
ATOM   4224 O  OD2 . ASP C 2 298 ? -6.454  28.292  27.854  1.00 103.75 ? 380 ASP C OD2 1 
ATOM   4225 N  N   . PRO C 2 299 ? -3.103  28.852  31.611  1.00 88.73  ? 381 PRO C N   1 
ATOM   4226 C  CA  . PRO C 2 299 ? -3.397  29.141  33.023  1.00 89.29  ? 381 PRO C CA  1 
ATOM   4227 C  C   . PRO C 2 299 ? -4.885  29.196  33.307  1.00 95.30  ? 381 PRO C C   1 
ATOM   4228 O  O   . PRO C 2 299 ? -5.318  28.808  34.400  1.00 97.90  ? 381 PRO C O   1 
ATOM   4229 C  CB  . PRO C 2 299 ? -2.722  30.498  33.248  1.00 86.68  ? 381 PRO C CB  1 
ATOM   4230 C  CG  . PRO C 2 299 ? -1.742  30.639  32.112  1.00 83.29  ? 381 PRO C CG  1 
ATOM   4231 C  CD  . PRO C 2 299 ? -2.332  29.924  30.961  1.00 85.29  ? 381 PRO C CD  1 
ATOM   4232 N  N   . THR C 2 300 ? -5.681  29.652  32.335  1.00 97.29  ? 382 THR C N   1 
ATOM   4233 C  CA  . THR C 2 300 ? -7.131  29.627  32.471  1.00 98.85  ? 382 THR C CA  1 
ATOM   4234 C  C   . THR C 2 300 ? -7.641  28.217  32.705  1.00 101.32 ? 382 THR C C   1 
ATOM   4235 O  O   . THR C 2 300 ? -8.599  28.025  33.456  1.00 104.73 ? 382 THR C O   1 
ATOM   4236 C  CB  . THR C 2 300 ? -7.790  30.191  31.212  1.00 101.40 ? 382 THR C CB  1 
ATOM   4237 O  OG1 . THR C 2 300 ? -7.882  29.152  30.233  1.00 106.44 ? 382 THR C OG1 1 
ATOM   4238 C  CG2 . THR C 2 300 ? -6.951  31.321  30.634  1.00 96.38  ? 382 THR C CG2 1 
ATOM   4239 N  N   . ASN C 2 301 ? -7.009  27.220  32.085  1.00 100.31 ? 383 ASN C N   1 
ATOM   4240 C  CA  . ASN C 2 301 ? -7.559  25.867  31.971  1.00 101.35 ? 383 ASN C CA  1 
ATOM   4241 C  C   . ASN C 2 301 ? -6.501  24.833  32.348  1.00 100.29 ? 383 ASN C C   1 
ATOM   4242 O  O   . ASN C 2 301 ? -5.810  24.286  31.476  1.00 101.99 ? 383 ASN C O   1 
ATOM   4243 C  CB  . ASN C 2 301 ? -8.077  25.619  30.554  1.00 100.11 ? 383 ASN C CB  1 
ATOM   4244 C  CG  . ASN C 2 301 ? -8.403  24.179  30.307  1.00 99.98  ? 383 ASN C CG  1 
ATOM   4245 O  OD1 . ASN C 2 301 ? -8.897  23.487  31.195  1.00 100.34 ? 383 ASN C OD1 1 
ATOM   4246 N  ND2 . ASN C 2 301 ? -8.094  23.700  29.105  1.00 100.20 ? 383 ASN C ND2 1 
ATOM   4247 N  N   . PRO C 2 302 ? -6.343  24.545  33.644  1.00 96.93  ? 384 PRO C N   1 
ATOM   4248 C  CA  . PRO C 2 302 ? -5.323  23.568  34.060  1.00 91.82  ? 384 PRO C CA  1 
ATOM   4249 C  C   . PRO C 2 302 ? -5.458  22.199  33.415  1.00 88.93  ? 384 PRO C C   1 
ATOM   4250 O  O   . PRO C 2 302 ? -4.445  21.499  33.285  1.00 84.36  ? 384 PRO C O   1 
ATOM   4251 C  CB  . PRO C 2 302 ? -5.521  23.499  35.579  1.00 93.50  ? 384 PRO C CB  1 
ATOM   4252 C  CG  . PRO C 2 302 ? -5.982  24.885  35.928  1.00 93.02  ? 384 PRO C CG  1 
ATOM   4253 C  CD  . PRO C 2 302 ? -6.877  25.300  34.791  1.00 95.47  ? 384 PRO C CD  1 
ATOM   4254 N  N   . SER C 2 303 ? -6.656  21.800  32.986  1.00 91.42  ? 385 SER C N   1 
ATOM   4255 C  CA  . SER C 2 303 ? -6.828  20.453  32.449  1.00 95.10  ? 385 SER C CA  1 
ATOM   4256 C  C   . SER C 2 303 ? -5.990  20.206  31.195  1.00 94.84  ? 385 SER C C   1 
ATOM   4257 O  O   . SER C 2 303 ? -5.712  19.047  30.869  1.00 96.68  ? 385 SER C O   1 
ATOM   4258 C  CB  . SER C 2 303 ? -8.303  20.185  32.149  1.00 99.22  ? 385 SER C CB  1 
ATOM   4259 O  OG  . SER C 2 303 ? -8.692  20.756  30.909  1.00 101.05 ? 385 SER C OG  1 
ATOM   4260 N  N   . ALA C 2 304 ? -5.572  21.262  30.491  1.00 92.49  ? 386 ALA C N   1 
ATOM   4261 C  CA  . ALA C 2 304 ? -4.708  21.100  29.326  1.00 93.49  ? 386 ALA C CA  1 
ATOM   4262 C  C   . ALA C 2 304 ? -3.331  20.543  29.681  1.00 92.26  ? 386 ALA C C   1 
ATOM   4263 O  O   . ALA C 2 304 ? -2.633  20.030  28.799  1.00 92.09  ? 386 ALA C O   1 
ATOM   4264 C  CB  . ALA C 2 304 ? -4.553  22.440  28.602  1.00 91.73  ? 386 ALA C CB  1 
ATOM   4265 N  N   . GLY C 2 305 ? -2.916  20.634  30.934  1.00 92.19  ? 387 GLY C N   1 
ATOM   4266 C  CA  . GLY C 2 305 ? -1.631  20.102  31.315  1.00 91.34  ? 387 GLY C CA  1 
ATOM   4267 C  C   . GLY C 2 305 ? -0.512  21.114  31.177  1.00 88.93  ? 387 GLY C C   1 
ATOM   4268 O  O   . GLY C 2 305 ? -0.710  22.313  30.954  1.00 85.91  ? 387 GLY C O   1 
ATOM   4269 N  N   . THR C 2 306 ? 0.704   20.597  31.310  1.00 88.64  ? 388 THR C N   1 
ATOM   4270 C  CA  . THR C 2 306 ? 1.916   21.397  31.341  1.00 82.13  ? 388 THR C CA  1 
ATOM   4271 C  C   . THR C 2 306 ? 2.806   21.067  30.145  1.00 79.94  ? 388 THR C C   1 
ATOM   4272 O  O   . THR C 2 306 ? 2.560   20.122  29.388  1.00 80.99  ? 388 THR C O   1 
ATOM   4273 C  CB  . THR C 2 306 ? 2.671   21.168  32.660  1.00 80.37  ? 388 THR C CB  1 
ATOM   4274 O  OG1 . THR C 2 306 ? 2.958   19.770  32.812  1.00 83.43  ? 388 THR C OG1 1 
ATOM   4275 C  CG2 . THR C 2 306 ? 1.835   21.648  33.846  1.00 78.93  ? 388 THR C CG2 1 
ATOM   4276 N  N   . ALA C 2 307 ? 3.849   21.872  29.973  1.00 77.32  ? 389 ALA C N   1 
ATOM   4277 C  CA  . ALA C 2 307 ? 4.831   21.603  28.934  1.00 79.15  ? 389 ALA C CA  1 
ATOM   4278 C  C   . ALA C 2 307 ? 5.648   20.353  29.269  1.00 84.19  ? 389 ALA C C   1 
ATOM   4279 O  O   . ALA C 2 307 ? 6.082   20.154  30.409  1.00 82.89  ? 389 ALA C O   1 
ATOM   4280 C  CB  . ALA C 2 307 ? 5.744   22.813  28.751  1.00 69.54  ? 389 ALA C CB  1 
ATOM   4281 N  N   . LYS C 2 308 ? 5.850   19.501  28.265  1.00 91.04  ? 390 LYS C N   1 
ATOM   4282 C  CA  . LYS C 2 308 ? 6.542   18.229  28.461  1.00 93.61  ? 390 LYS C CA  1 
ATOM   4283 C  C   . LYS C 2 308 ? 8.040   18.432  28.685  1.00 91.70  ? 390 LYS C C   1 
ATOM   4284 O  O   . LYS C 2 308 ? 8.623   17.835  29.591  1.00 90.98  ? 390 LYS C O   1 
ATOM   4285 C  CB  . LYS C 2 308 ? 6.308   17.303  27.263  1.00 97.72  ? 390 LYS C CB  1 
ATOM   4286 N  N   . GLY D 2 3   ? 15.413  42.649  4.102   1.00 74.04  ? 85  GLY D N   1 
ATOM   4287 C  CA  . GLY D 2 3   ? 14.206  41.862  4.270   1.00 71.44  ? 85  GLY D CA  1 
ATOM   4288 C  C   . GLY D 2 3   ? 14.240  40.490  3.622   1.00 69.57  ? 85  GLY D C   1 
ATOM   4289 O  O   . GLY D 2 3   ? 13.346  40.149  2.844   1.00 68.85  ? 85  GLY D O   1 
ATOM   4290 N  N   . ARG D 2 4   ? 15.263  39.695  3.960   1.00 67.39  ? 86  ARG D N   1 
ATOM   4291 C  CA  . ARG D 2 4   ? 15.508  38.407  3.318   1.00 62.03  ? 86  ARG D CA  1 
ATOM   4292 C  C   . ARG D 2 4   ? 15.376  37.211  4.251   1.00 55.53  ? 86  ARG D C   1 
ATOM   4293 O  O   . ARG D 2 4   ? 15.627  36.085  3.818   1.00 54.99  ? 86  ARG D O   1 
ATOM   4294 C  CB  . ARG D 2 4   ? 16.909  38.385  2.683   1.00 60.61  ? 86  ARG D CB  1 
ATOM   4295 N  N   . ASN D 2 5   ? 15.001  37.406  5.511   1.00 56.49  ? 87  ASN D N   1 
ATOM   4296 C  CA  . ASN D 2 5   ? 14.931  36.294  6.455   1.00 54.04  ? 87  ASN D CA  1 
ATOM   4297 C  C   . ASN D 2 5   ? 13.711  36.394  7.363   1.00 52.62  ? 87  ASN D C   1 
ATOM   4298 O  O   . ASN D 2 5   ? 13.075  37.447  7.496   1.00 53.95  ? 87  ASN D O   1 
ATOM   4299 C  CB  . ASN D 2 5   ? 16.177  36.211  7.336   1.00 54.32  ? 87  ASN D CB  1 
ATOM   4300 C  CG  . ASN D 2 5   ? 17.381  35.714  6.592   1.00 57.14  ? 87  ASN D CG  1 
ATOM   4301 O  OD1 . ASN D 2 5   ? 17.813  34.575  6.805   1.00 58.54  ? 87  ASN D OD1 1 
ATOM   4302 N  ND2 . ASN D 2 5   ? 17.971  36.572  5.755   1.00 57.97  ? 87  ASN D ND2 1 
ATOM   4303 N  N   . ASP D 2 6   ? 13.406  35.257  7.986   1.00 49.87  ? 88  ASP D N   1 
ATOM   4304 C  CA  . ASP D 2 6   ? 12.448  35.171  9.079   1.00 50.43  ? 88  ASP D CA  1 
ATOM   4305 C  C   . ASP D 2 6   ? 12.879  36.061  10.256  1.00 47.95  ? 88  ASP D C   1 
ATOM   4306 O  O   . ASP D 2 6   ? 14.014  36.534  10.336  1.00 46.67  ? 88  ASP D O   1 
ATOM   4307 C  CB  . ASP D 2 6   ? 12.333  33.706  9.517   1.00 50.29  ? 88  ASP D CB  1 
ATOM   4308 C  CG  . ASP D 2 6   ? 11.039  33.390  10.238  1.00 50.59  ? 88  ASP D CG  1 
ATOM   4309 O  OD1 . ASP D 2 6   ? 10.206  34.289  10.443  1.00 53.30  ? 88  ASP D OD1 1 
ATOM   4310 O  OD2 . ASP D 2 6   ? 10.857  32.214  10.592  1.00 50.40  ? 88  ASP D OD2 1 
ATOM   4311 N  N   . PHE D 2 7   ? 11.954  36.294  11.184  1.00 49.04  ? 89  PHE D N   1 
ATOM   4312 C  CA  . PHE D 2 7   ? 12.294  36.973  12.428  1.00 52.83  ? 89  PHE D CA  1 
ATOM   4313 C  C   . PHE D 2 7   ? 12.145  36.077  13.656  1.00 50.72  ? 89  PHE D C   1 
ATOM   4314 O  O   . PHE D 2 7   ? 12.534  36.488  14.756  1.00 53.59  ? 89  PHE D O   1 
ATOM   4315 C  CB  . PHE D 2 7   ? 11.445  38.252  12.597  1.00 45.42  ? 89  PHE D CB  1 
ATOM   4316 N  N   . TYR D 2 8   ? 11.622  34.862  13.499  1.00 47.20  ? 90  TYR D N   1 
ATOM   4317 C  CA  . TYR D 2 8   ? 11.361  33.965  14.615  1.00 43.92  ? 90  TYR D CA  1 
ATOM   4318 C  C   . TYR D 2 8   ? 12.277  32.757  14.541  1.00 44.42  ? 90  TYR D C   1 
ATOM   4319 O  O   . TYR D 2 8   ? 12.393  32.125  13.486  1.00 48.83  ? 90  TYR D O   1 
ATOM   4320 C  CB  . TYR D 2 8   ? 9.911   33.506  14.607  1.00 42.06  ? 90  TYR D CB  1 
ATOM   4321 C  CG  . TYR D 2 8   ? 8.928   34.625  14.802  1.00 42.01  ? 90  TYR D CG  1 
ATOM   4322 C  CD1 . TYR D 2 8   ? 8.527   35.419  13.743  1.00 42.88  ? 90  TYR D CD1 1 
ATOM   4323 C  CD2 . TYR D 2 8   ? 8.407   34.890  16.050  1.00 41.32  ? 90  TYR D CD2 1 
ATOM   4324 C  CE1 . TYR D 2 8   ? 7.631   36.440  13.931  1.00 47.00  ? 90  TYR D CE1 1 
ATOM   4325 C  CE2 . TYR D 2 8   ? 7.516   35.911  16.244  1.00 42.01  ? 90  TYR D CE2 1 
ATOM   4326 C  CZ  . TYR D 2 8   ? 7.129   36.679  15.194  1.00 46.30  ? 90  TYR D CZ  1 
ATOM   4327 O  OH  . TYR D 2 8   ? 6.227   37.685  15.420  1.00 51.86  ? 90  TYR D OH  1 
ATOM   4328 N  N   . CYS D 2 9   ? 12.903  32.429  15.667  1.00 42.52  ? 91  CYS D N   1 
ATOM   4329 C  CA  . CYS D 2 9   ? 13.884  31.353  15.706  1.00 40.85  ? 91  CYS D CA  1 
ATOM   4330 C  C   . CYS D 2 9   ? 13.259  30.053  15.222  1.00 40.23  ? 91  CYS D C   1 
ATOM   4331 O  O   . CYS D 2 9   ? 12.168  29.673  15.653  1.00 42.60  ? 91  CYS D O   1 
ATOM   4332 C  CB  . CYS D 2 9   ? 14.433  31.196  17.127  1.00 44.72  ? 91  CYS D CB  1 
ATOM   4333 S  SG  . CYS D 2 9   ? 15.453  29.700  17.448  1.00 52.30  ? 91  CYS D SG  1 
ATOM   4334 N  N   . TRP D 2 10  ? 13.962  29.366  14.323  1.00 36.76  ? 92  TRP D N   1 
ATOM   4335 C  CA  . TRP D 2 10  ? 13.441  28.124  13.767  1.00 36.38  ? 92  TRP D CA  1 
ATOM   4336 C  C   . TRP D 2 10  ? 13.195  27.067  14.840  1.00 39.12  ? 92  TRP D C   1 
ATOM   4337 O  O   . TRP D 2 10  ? 12.245  26.289  14.727  1.00 32.20  ? 92  TRP D O   1 
ATOM   4338 C  CB  . TRP D 2 10  ? 14.413  27.611  12.715  1.00 40.13  ? 92  TRP D CB  1 
ATOM   4339 C  CG  . TRP D 2 10  ? 14.035  26.322  12.048  1.00 40.54  ? 92  TRP D CG  1 
ATOM   4340 C  CD1 . TRP D 2 10  ? 14.649  25.112  12.202  1.00 36.55  ? 92  TRP D CD1 1 
ATOM   4341 C  CD2 . TRP D 2 10  ? 12.985  26.121  11.093  1.00 39.86  ? 92  TRP D CD2 1 
ATOM   4342 N  NE1 . TRP D 2 10  ? 14.043  24.178  11.409  1.00 37.99  ? 92  TRP D NE1 1 
ATOM   4343 C  CE2 . TRP D 2 10  ? 13.024  24.772  10.712  1.00 37.52  ? 92  TRP D CE2 1 
ATOM   4344 C  CE3 . TRP D 2 10  ? 12.021  26.952  10.526  1.00 40.12  ? 92  TRP D CE3 1 
ATOM   4345 C  CZ2 . TRP D 2 10  ? 12.145  24.235  9.792   1.00 37.36  ? 92  TRP D CZ2 1 
ATOM   4346 C  CZ3 . TRP D 2 10  ? 11.141  26.409  9.610   1.00 39.75  ? 92  TRP D CZ3 1 
ATOM   4347 C  CH2 . TRP D 2 10  ? 11.207  25.064  9.258   1.00 38.47  ? 92  TRP D CH2 1 
ATOM   4348 N  N   . VAL D 2 11  ? 14.020  27.037  15.893  1.00 36.50  ? 93  VAL D N   1 
ATOM   4349 C  CA  . VAL D 2 11  ? 13.898  26.012  16.922  1.00 36.16  ? 93  VAL D CA  1 
ATOM   4350 C  C   . VAL D 2 11  ? 12.799  26.353  17.931  1.00 41.18  ? 93  VAL D C   1 
ATOM   4351 O  O   . VAL D 2 11  ? 11.934  25.512  18.229  1.00 40.90  ? 93  VAL D O   1 
ATOM   4352 C  CB  . VAL D 2 11  ? 15.249  25.799  17.622  1.00 40.54  ? 93  VAL D CB  1 
ATOM   4353 C  CG1 . VAL D 2 11  ? 15.099  24.828  18.809  1.00 35.36  ? 93  VAL D CG1 1 
ATOM   4354 C  CG2 . VAL D 2 11  ? 16.285  25.308  16.624  1.00 37.45  ? 93  VAL D CG2 1 
ATOM   4355 N  N   . CYS D 2 12  ? 12.827  27.567  18.507  1.00 41.44  ? 94  CYS D N   1 
ATOM   4356 C  CA  . CYS D 2 12  ? 11.915  27.894  19.605  1.00 37.68  ? 94  CYS D CA  1 
ATOM   4357 C  C   . CYS D 2 12  ? 10.753  28.791  19.195  1.00 41.65  ? 94  CYS D C   1 
ATOM   4358 O  O   . CYS D 2 12  ? 9.812   28.945  19.978  1.00 44.15  ? 94  CYS D O   1 
ATOM   4359 C  CB  . CYS D 2 12  ? 12.674  28.564  20.751  1.00 37.40  ? 94  CYS D CB  1 
ATOM   4360 S  SG  . CYS D 2 12  ? 13.258  30.248  20.388  1.00 44.09  ? 94  CYS D SG  1 
ATOM   4361 N  N   . HIS D 2 13  ? 10.814  29.403  18.012  1.00 43.33  ? 95  HIS D N   1 
ATOM   4362 C  CA  . HIS D 2 13  ? 9.745   30.199  17.393  1.00 43.41  ? 95  HIS D CA  1 
ATOM   4363 C  C   . HIS D 2 13  ? 9.568   31.567  18.031  1.00 44.47  ? 95  HIS D C   1 
ATOM   4364 O  O   . HIS D 2 13  ? 8.520   32.192  17.868  1.00 44.34  ? 95  HIS D O   1 
ATOM   4365 C  CB  . HIS D 2 13  ? 8.403   29.455  17.366  1.00 43.88  ? 95  HIS D CB  1 
ATOM   4366 C  CG  . HIS D 2 13  ? 8.547   27.983  17.131  1.00 44.89  ? 95  HIS D CG  1 
ATOM   4367 N  ND1 . HIS D 2 13  ? 8.992   27.457  15.933  1.00 45.27  ? 95  HIS D ND1 1 
ATOM   4368 C  CD2 . HIS D 2 13  ? 8.337   26.928  17.950  1.00 44.18  ? 95  HIS D CD2 1 
ATOM   4369 C  CE1 . HIS D 2 13  ? 9.041   26.139  16.026  1.00 44.41  ? 95  HIS D CE1 1 
ATOM   4370 N  NE2 . HIS D 2 13  ? 8.638   25.793  17.237  1.00 44.66  ? 95  HIS D NE2 1 
ATOM   4371 N  N   . ARG D 2 14  ? 10.585  32.094  18.697  1.00 47.04  ? 96  ARG D N   1 
ATOM   4372 C  CA  . ARG D 2 14  ? 10.483  33.421  19.284  1.00 47.83  ? 96  ARG D CA  1 
ATOM   4373 C  C   . ARG D 2 14  ? 11.430  34.417  18.615  1.00 46.33  ? 96  ARG D C   1 
ATOM   4374 O  O   . ARG D 2 14  ? 12.459  34.044  18.046  1.00 45.37  ? 96  ARG D O   1 
ATOM   4375 C  CB  . ARG D 2 14  ? 10.740  33.344  20.787  1.00 45.76  ? 96  ARG D CB  1 
ATOM   4376 C  CG  . ARG D 2 14  ? 9.765   32.422  21.447  1.00 43.28  ? 96  ARG D CG  1 
ATOM   4377 C  CD  . ARG D 2 14  ? 10.134  32.121  22.884  1.00 48.53  ? 96  ARG D CD  1 
ATOM   4378 N  NE  . ARG D 2 14  ? 10.106  33.326  23.694  1.00 53.50  ? 96  ARG D NE  1 
ATOM   4379 C  CZ  . ARG D 2 14  ? 8.997   33.923  24.112  1.00 55.72  ? 96  ARG D CZ  1 
ATOM   4380 N  NH1 . ARG D 2 14  ? 7.819   33.420  23.797  1.00 53.95  ? 96  ARG D NH1 1 
ATOM   4381 N  NH2 . ARG D 2 14  ? 9.071   35.029  24.845  1.00 60.84  ? 96  ARG D NH2 1 
ATOM   4382 N  N   . GLU D 2 15  ? 11.060  35.690  18.693  1.00 45.13  ? 97  GLU D N   1 
ATOM   4383 C  CA  . GLU D 2 15  ? 11.888  36.787  18.212  1.00 49.21  ? 97  GLU D CA  1 
ATOM   4384 C  C   . GLU D 2 15  ? 13.174  36.904  19.036  1.00 49.78  ? 97  GLU D C   1 
ATOM   4385 O  O   . GLU D 2 15  ? 13.502  36.049  19.860  1.00 50.58  ? 97  GLU D O   1 
ATOM   4386 C  CB  . GLU D 2 15  ? 11.078  38.074  18.240  1.00 58.90  ? 97  GLU D CB  1 
ATOM   4387 C  CG  . GLU D 2 15  ? 10.004  38.123  17.165  1.00 65.97  ? 97  GLU D CG  1 
ATOM   4388 C  CD  . GLU D 2 15  ? 9.107   39.331  17.304  1.00 76.01  ? 97  GLU D CD  1 
ATOM   4389 O  OE1 . GLU D 2 15  ? 8.884   40.044  16.289  1.00 78.83  ? 97  GLU D OE1 1 
ATOM   4390 O  OE2 . GLU D 2 15  ? 8.646   39.574  18.446  1.00 80.45  ? 97  GLU D OE2 1 
ATOM   4391 N  N   . GLY D 2 16  ? 13.926  37.979  18.814  1.00 52.53  ? 98  GLY D N   1 
ATOM   4392 C  CA  . GLY D 2 16  ? 15.203  38.210  19.467  1.00 51.56  ? 98  GLY D CA  1 
ATOM   4393 C  C   . GLY D 2 16  ? 16.352  38.172  18.471  1.00 51.91  ? 98  GLY D C   1 
ATOM   4394 O  O   . GLY D 2 16  ? 16.163  38.005  17.266  1.00 52.22  ? 98  GLY D O   1 
ATOM   4395 N  N   . GLN D 2 17  ? 17.569  38.313  19.003  1.00 55.62  ? 99  GLN D N   1 
ATOM   4396 C  CA  . GLN D 2 17  ? 18.758  38.337  18.158  1.00 60.16  ? 99  GLN D CA  1 
ATOM   4397 C  C   . GLN D 2 17  ? 19.093  36.934  17.672  1.00 57.84  ? 99  GLN D C   1 
ATOM   4398 O  O   . GLN D 2 17  ? 19.235  35.998  18.466  1.00 55.32  ? 99  GLN D O   1 
ATOM   4399 C  CB  . GLN D 2 17  ? 19.958  38.952  18.882  1.00 70.72  ? 99  GLN D CB  1 
ATOM   4400 C  CG  . GLN D 2 17  ? 21.306  38.719  18.164  1.00 79.54  ? 99  GLN D CG  1 
ATOM   4401 C  CD  . GLN D 2 17  ? 22.128  40.001  18.015  1.00 91.20  ? 99  GLN D CD  1 
ATOM   4402 O  OE1 . GLN D 2 17  ? 22.161  40.834  18.926  1.00 96.41  ? 99  GLN D OE1 1 
ATOM   4403 N  NE2 . GLN D 2 17  ? 22.783  40.172  16.853  1.00 93.53  ? 99  GLN D NE2 1 
ATOM   4404 N  N   . VAL D 2 18  ? 19.251  36.807  16.359  1.00 56.58  ? 100 VAL D N   1 
ATOM   4405 C  CA  . VAL D 2 18  ? 19.300  35.527  15.677  1.00 51.33  ? 100 VAL D CA  1 
ATOM   4406 C  C   . VAL D 2 18  ? 20.443  35.520  14.671  1.00 54.20  ? 100 VAL D C   1 
ATOM   4407 O  O   . VAL D 2 18  ? 20.783  36.542  14.066  1.00 58.85  ? 100 VAL D O   1 
ATOM   4408 C  CB  . VAL D 2 18  ? 17.961  35.248  14.966  1.00 49.61  ? 100 VAL D CB  1 
ATOM   4409 C  CG1 . VAL D 2 18  ? 16.853  35.010  15.970  1.00 49.05  ? 100 VAL D CG1 1 
ATOM   4410 C  CG2 . VAL D 2 18  ? 17.594  36.418  14.028  1.00 49.87  ? 100 VAL D CG2 1 
ATOM   4411 N  N   . LEU D 2 19  ? 21.050  34.353  14.511  1.00 54.31  ? 101 LEU D N   1 
ATOM   4412 C  CA  . LEU D 2 19  ? 21.854  34.074  13.336  1.00 61.52  ? 101 LEU D CA  1 
ATOM   4413 C  C   . LEU D 2 19  ? 20.949  33.883  12.123  1.00 62.78  ? 101 LEU D C   1 
ATOM   4414 O  O   . LEU D 2 19  ? 19.864  33.289  12.221  1.00 60.23  ? 101 LEU D O   1 
ATOM   4415 C  CB  . LEU D 2 19  ? 22.700  32.823  13.564  1.00 62.69  ? 101 LEU D CB  1 
ATOM   4416 C  CG  . LEU D 2 19  ? 23.663  32.859  14.750  1.00 64.13  ? 101 LEU D CG  1 
ATOM   4417 C  CD1 . LEU D 2 19  ? 24.088  31.449  15.056  1.00 63.86  ? 101 LEU D CD1 1 
ATOM   4418 C  CD2 . LEU D 2 19  ? 24.873  33.738  14.465  1.00 66.42  ? 101 LEU D CD2 1 
ATOM   4419 N  N   . CYS D 2 20  ? 21.403  34.394  10.977  1.00 64.03  ? 102 CYS D N   1 
ATOM   4420 C  CA  . CYS D 2 20  ? 20.664  34.321  9.721   1.00 63.22  ? 102 CYS D CA  1 
ATOM   4421 C  C   . CYS D 2 20  ? 21.349  33.382  8.736   1.00 61.66  ? 102 CYS D C   1 
ATOM   4422 O  O   . CYS D 2 20  ? 22.575  33.426  8.557   1.00 63.19  ? 102 CYS D O   1 
ATOM   4423 C  CB  . CYS D 2 20  ? 20.536  35.698  9.071   1.00 66.89  ? 102 CYS D CB  1 
ATOM   4424 S  SG  . CYS D 2 20  ? 19.667  36.881  10.062  1.00 70.66  ? 102 CYS D SG  1 
ATOM   4425 N  N   . CYS D 2 21  ? 20.553  32.566  8.064   1.00 55.22  ? 103 CYS D N   1 
ATOM   4426 C  CA  . CYS D 2 21  ? 21.120  31.673  7.070   1.00 54.55  ? 103 CYS D CA  1 
ATOM   4427 C  C   . CYS D 2 21  ? 21.328  32.417  5.757   1.00 55.13  ? 103 CYS D C   1 
ATOM   4428 O  O   . CYS D 2 21  ? 20.432  33.117  5.294   1.00 51.28  ? 103 CYS D O   1 
ATOM   4429 C  CB  . CYS D 2 21  ? 20.219  30.460  6.855   1.00 50.53  ? 103 CYS D CB  1 
ATOM   4430 S  SG  . CYS D 2 21  ? 21.063  29.224  5.893   1.00 55.04  ? 103 CYS D SG  1 
ATOM   4431 N  N   . GLU D 2 22  ? 22.503  32.251  5.146   1.00 56.38  ? 104 GLU D N   1 
ATOM   4432 C  CA  . GLU D 2 22  ? 22.705  32.816  3.818   1.00 64.94  ? 104 GLU D CA  1 
ATOM   4433 C  C   . GLU D 2 22  ? 21.993  32.033  2.734   1.00 67.14  ? 104 GLU D C   1 
ATOM   4434 O  O   . GLU D 2 22  ? 21.897  32.532  1.609   1.00 71.82  ? 104 GLU D O   1 
ATOM   4435 C  CB  . GLU D 2 22  ? 24.196  32.896  3.469   1.00 76.36  ? 104 GLU D CB  1 
ATOM   4436 C  CG  . GLU D 2 22  ? 24.780  34.292  3.513   1.00 86.67  ? 104 GLU D CG  1 
ATOM   4437 C  CD  . GLU D 2 22  ? 24.917  34.826  4.934   1.00 95.51  ? 104 GLU D CD  1 
ATOM   4438 O  OE1 . GLU D 2 22  ? 25.012  34.017  5.902   1.00 96.84  ? 104 GLU D OE1 1 
ATOM   4439 O  OE2 . GLU D 2 22  ? 24.938  36.070  5.079   1.00 99.97  ? 104 GLU D OE2 1 
ATOM   4440 N  N   . LEU D 2 23  ? 21.493  30.833  3.033   1.00 66.85  ? 105 LEU D N   1 
ATOM   4441 C  CA  . LEU D 2 23  ? 20.985  29.941  2.002   1.00 68.38  ? 105 LEU D CA  1 
ATOM   4442 C  C   . LEU D 2 23  ? 19.475  29.794  1.998   1.00 67.35  ? 105 LEU D C   1 
ATOM   4443 O  O   . LEU D 2 23  ? 18.932  29.302  1.009   1.00 72.84  ? 105 LEU D O   1 
ATOM   4444 C  CB  . LEU D 2 23  ? 21.620  28.546  2.133   1.00 69.91  ? 105 LEU D CB  1 
ATOM   4445 C  CG  . LEU D 2 23  ? 22.926  28.443  1.342   1.00 74.24  ? 105 LEU D CG  1 
ATOM   4446 C  CD1 . LEU D 2 23  ? 23.706  27.171  1.670   1.00 72.59  ? 105 LEU D CD1 1 
ATOM   4447 C  CD2 . LEU D 2 23  ? 22.639  28.561  -0.151  1.00 78.30  ? 105 LEU D CD2 1 
ATOM   4448 N  N   . CYS D 2 24  ? 18.790  30.223  3.049   1.00 59.99  ? 106 CYS D N   1 
ATOM   4449 C  CA  . CYS D 2 24  ? 17.356  29.992  3.199   1.00 52.37  ? 106 CYS D CA  1 
ATOM   4450 C  C   . CYS D 2 24  ? 16.817  31.032  4.171   1.00 52.35  ? 106 CYS D C   1 
ATOM   4451 O  O   . CYS D 2 24  ? 17.586  31.695  4.874   1.00 55.33  ? 106 CYS D O   1 
ATOM   4452 C  CB  . CYS D 2 24  ? 17.085  28.563  3.695   1.00 45.69  ? 106 CYS D CB  1 
ATOM   4453 S  SG  . CYS D 2 24  ? 17.386  28.376  5.516   1.00 47.26  ? 106 CYS D SG  1 
ATOM   4454 N  N   . PRO D 2 25  ? 15.486  31.177  4.256   1.00 50.14  ? 107 PRO D N   1 
ATOM   4455 C  CA  . PRO D 2 25  ? 14.916  32.209  5.147   1.00 52.37  ? 107 PRO D CA  1 
ATOM   4456 C  C   . PRO D 2 25  ? 15.116  31.970  6.661   1.00 53.81  ? 107 PRO D C   1 
ATOM   4457 O  O   . PRO D 2 25  ? 14.902  32.912  7.442   1.00 57.27  ? 107 PRO D O   1 
ATOM   4458 C  CB  . PRO D 2 25  ? 13.418  32.186  4.791   1.00 50.14  ? 107 PRO D CB  1 
ATOM   4459 C  CG  . PRO D 2 25  ? 13.321  31.440  3.485   1.00 49.48  ? 107 PRO D CG  1 
ATOM   4460 C  CD  . PRO D 2 25  ? 14.446  30.476  3.487   1.00 48.77  ? 107 PRO D CD  1 
ATOM   4461 N  N   . ARG D 2 26  ? 15.529  30.780  7.098   1.00 49.37  ? 108 ARG D N   1 
ATOM   4462 C  CA  . ARG D 2 26  ? 15.491  30.431  8.512   1.00 44.58  ? 108 ARG D CA  1 
ATOM   4463 C  C   . ARG D 2 26  ? 16.475  31.280  9.323   1.00 47.15  ? 108 ARG D C   1 
ATOM   4464 O  O   . ARG D 2 26  ? 17.507  31.728  8.815   1.00 52.41  ? 108 ARG D O   1 
ATOM   4465 C  CB  . ARG D 2 26  ? 15.791  28.940  8.677   1.00 43.06  ? 108 ARG D CB  1 
ATOM   4466 C  CG  . ARG D 2 26  ? 14.564  28.031  8.469   1.00 44.61  ? 108 ARG D CG  1 
ATOM   4467 C  CD  . ARG D 2 26  ? 14.902  26.535  8.469   1.00 43.87  ? 108 ARG D CD  1 
ATOM   4468 N  NE  . ARG D 2 26  ? 15.288  26.118  7.130   1.00 48.59  ? 108 ARG D NE  1 
ATOM   4469 C  CZ  . ARG D 2 26  ? 14.490  25.463  6.301   1.00 50.96  ? 108 ARG D CZ  1 
ATOM   4470 N  NH1 . ARG D 2 26  ? 13.275  25.128  6.685   1.00 48.61  ? 108 ARG D NH1 1 
ATOM   4471 N  NH2 . ARG D 2 26  ? 14.912  25.129  5.092   1.00 57.50  ? 108 ARG D NH2 1 
ATOM   4472 N  N   . VAL D 2 27  ? 16.125  31.532  10.590  1.00 44.16  ? 109 VAL D N   1 
ATOM   4473 C  CA  . VAL D 2 27  ? 16.985  32.210  11.560  1.00 45.94  ? 109 VAL D CA  1 
ATOM   4474 C  C   . VAL D 2 27  ? 16.963  31.418  12.860  1.00 43.26  ? 109 VAL D C   1 
ATOM   4475 O  O   . VAL D 2 27  ? 15.992  30.724  13.165  1.00 38.18  ? 109 VAL D O   1 
ATOM   4476 C  CB  . VAL D 2 27  ? 16.571  33.682  11.827  1.00 46.09  ? 109 VAL D CB  1 
ATOM   4477 C  CG1 . VAL D 2 27  ? 16.356  34.446  10.522  1.00 47.10  ? 109 VAL D CG1 1 
ATOM   4478 C  CG2 . VAL D 2 27  ? 15.325  33.757  12.738  1.00 41.88  ? 109 VAL D CG2 1 
ATOM   4479 N  N   . TYR D 2 28  ? 18.041  31.521  13.633  1.00 46.11  ? 110 TYR D N   1 
ATOM   4480 C  CA  . TYR D 2 28  ? 18.186  30.720  14.842  1.00 46.00  ? 110 TYR D CA  1 
ATOM   4481 C  C   . TYR D 2 28  ? 18.754  31.561  15.976  1.00 51.11  ? 110 TYR D C   1 
ATOM   4482 O  O   . TYR D 2 28  ? 19.714  32.301  15.763  1.00 52.68  ? 110 TYR D O   1 
ATOM   4483 C  CB  . TYR D 2 28  ? 19.133  29.549  14.602  1.00 48.09  ? 110 TYR D CB  1 
ATOM   4484 C  CG  . TYR D 2 28  ? 18.674  28.453  13.674  1.00 51.26  ? 110 TYR D CG  1 
ATOM   4485 C  CD1 . TYR D 2 28  ? 18.437  28.683  12.321  1.00 53.03  ? 110 TYR D CD1 1 
ATOM   4486 C  CD2 . TYR D 2 28  ? 18.560  27.151  14.144  1.00 50.19  ? 110 TYR D CD2 1 
ATOM   4487 C  CE1 . TYR D 2 28  ? 18.046  27.638  11.480  1.00 52.03  ? 110 TYR D CE1 1 
ATOM   4488 C  CE2 . TYR D 2 28  ? 18.182  26.125  13.323  1.00 48.26  ? 110 TYR D CE2 1 
ATOM   4489 C  CZ  . TYR D 2 28  ? 17.935  26.358  12.003  1.00 50.15  ? 110 TYR D CZ  1 
ATOM   4490 O  OH  . TYR D 2 28  ? 17.567  25.278  11.237  1.00 53.50  ? 110 TYR D OH  1 
ATOM   4491 N  N   . HIS D 2 29  ? 18.209  31.424  17.185  1.00 51.16  ? 111 HIS D N   1 
ATOM   4492 C  CA  . HIS D 2 29  ? 18.947  31.879  18.361  1.00 53.38  ? 111 HIS D CA  1 
ATOM   4493 C  C   . HIS D 2 29  ? 20.246  31.097  18.470  1.00 53.08  ? 111 HIS D C   1 
ATOM   4494 O  O   . HIS D 2 29  ? 20.235  29.866  18.434  1.00 53.10  ? 111 HIS D O   1 
ATOM   4495 C  CB  . HIS D 2 29  ? 18.140  31.662  19.631  1.00 55.76  ? 111 HIS D CB  1 
ATOM   4496 C  CG  . HIS D 2 29  ? 16.982  32.583  19.779  1.00 62.87  ? 111 HIS D CG  1 
ATOM   4497 N  ND1 . HIS D 2 29  ? 15.726  32.140  20.130  1.00 66.12  ? 111 HIS D ND1 1 
ATOM   4498 C  CD2 . HIS D 2 29  ? 16.885  33.922  19.636  1.00 67.42  ? 111 HIS D CD2 1 
ATOM   4499 C  CE1 . HIS D 2 29  ? 14.900  33.167  20.186  1.00 65.36  ? 111 HIS D CE1 1 
ATOM   4500 N  NE2 . HIS D 2 29  ? 15.580  34.261  19.894  1.00 67.08  ? 111 HIS D NE2 1 
ATOM   4501 N  N   . ALA D 2 30  ? 21.368  31.804  18.613  1.00 54.80  ? 112 ALA D N   1 
ATOM   4502 C  CA  . ALA D 2 30  ? 22.651  31.117  18.738  1.00 54.64  ? 112 ALA D CA  1 
ATOM   4503 C  C   . ALA D 2 30  ? 22.628  30.129  19.900  1.00 57.24  ? 112 ALA D C   1 
ATOM   4504 O  O   . ALA D 2 30  ? 23.004  28.957  19.746  1.00 57.26  ? 112 ALA D O   1 
ATOM   4505 C  CB  . ALA D 2 30  ? 23.774  32.138  18.911  1.00 56.94  ? 112 ALA D CB  1 
ATOM   4506 N  N   . LYS D 2 31  ? 22.147  30.575  21.067  1.00 58.60  ? 113 LYS D N   1 
ATOM   4507 C  CA  . LYS D 2 31  ? 22.076  29.690  22.222  1.00 58.38  ? 113 LYS D CA  1 
ATOM   4508 C  C   . LYS D 2 31  ? 21.068  28.563  22.024  1.00 55.77  ? 113 LYS D C   1 
ATOM   4509 O  O   . LYS D 2 31  ? 21.070  27.610  22.800  1.00 57.31  ? 113 LYS D O   1 
ATOM   4510 C  CB  . LYS D 2 31  ? 21.759  30.498  23.495  1.00 57.18  ? 113 LYS D CB  1 
ATOM   4511 N  N   . CYS D 2 32  ? 20.220  28.625  21.000  1.00 55.50  ? 114 CYS D N   1 
ATOM   4512 C  CA  . CYS D 2 32  ? 19.334  27.503  20.721  1.00 54.16  ? 114 CYS D CA  1 
ATOM   4513 C  C   . CYS D 2 32  ? 20.034  26.379  19.971  1.00 60.03  ? 114 CYS D C   1 
ATOM   4514 O  O   . CYS D 2 32  ? 19.525  25.252  19.959  1.00 61.89  ? 114 CYS D O   1 
ATOM   4515 C  CB  . CYS D 2 32  ? 18.111  27.967  19.929  1.00 50.03  ? 114 CYS D CB  1 
ATOM   4516 S  SG  . CYS D 2 32  ? 16.767  28.601  20.942  1.00 50.24  ? 114 CYS D SG  1 
ATOM   4517 N  N   . LEU D 2 33  ? 21.178  26.651  19.344  1.00 62.81  ? 115 LEU D N   1 
ATOM   4518 C  CA  . LEU D 2 33  ? 21.985  25.606  18.735  1.00 64.23  ? 115 LEU D CA  1 
ATOM   4519 C  C   . LEU D 2 33  ? 23.111  25.141  19.651  1.00 71.54  ? 115 LEU D C   1 
ATOM   4520 O  O   . LEU D 2 33  ? 23.982  24.378  19.215  1.00 73.73  ? 115 LEU D O   1 
ATOM   4521 C  CB  . LEU D 2 33  ? 22.557  26.096  17.412  1.00 61.76  ? 115 LEU D CB  1 
ATOM   4522 C  CG  . LEU D 2 33  ? 21.470  26.338  16.373  1.00 58.67  ? 115 LEU D CG  1 
ATOM   4523 C  CD1 . LEU D 2 33  ? 22.022  27.164  15.214  1.00 57.44  ? 115 LEU D CD1 1 
ATOM   4524 C  CD2 . LEU D 2 33  ? 20.864  25.001  15.904  1.00 55.98  ? 115 LEU D CD2 1 
ATOM   4525 N  N   . ARG D 2 34  ? 23.108  25.586  20.908  1.00 78.67  ? 116 ARG D N   1 
ATOM   4526 C  CA  . ARG D 2 34  ? 24.188  25.297  21.846  1.00 83.08  ? 116 ARG D CA  1 
ATOM   4527 C  C   . ARG D 2 34  ? 25.532  25.712  21.253  1.00 91.68  ? 116 ARG D C   1 
ATOM   4528 O  O   . ARG D 2 34  ? 26.517  24.972  21.306  1.00 95.95  ? 116 ARG D O   1 
ATOM   4529 C  CB  . ARG D 2 34  ? 24.184  23.821  22.254  1.00 81.45  ? 116 ARG D CB  1 
ATOM   4530 N  N   . LEU D 2 35  ? 25.562  26.901  20.652  1.00 94.56  ? 117 LEU D N   1 
ATOM   4531 C  CA  . LEU D 2 35  ? 26.790  27.497  20.137  1.00 100.10 ? 117 LEU D CA  1 
ATOM   4532 C  C   . LEU D 2 35  ? 27.347  28.451  21.180  1.00 109.77 ? 117 LEU D C   1 
ATOM   4533 O  O   . LEU D 2 35  ? 26.609  29.277  21.725  1.00 109.43 ? 117 LEU D O   1 
ATOM   4534 C  CB  . LEU D 2 35  ? 26.551  28.252  18.828  1.00 90.70  ? 117 LEU D CB  1 
ATOM   4535 C  CG  . LEU D 2 35  ? 26.195  27.420  17.602  1.00 82.79  ? 117 LEU D CG  1 
ATOM   4536 C  CD1 . LEU D 2 35  ? 26.370  28.260  16.363  1.00 81.39  ? 117 LEU D CD1 1 
ATOM   4537 C  CD2 . LEU D 2 35  ? 27.033  26.151  17.541  1.00 81.32  ? 117 LEU D CD2 1 
ATOM   4538 N  N   . THR D 2 36  ? 28.644  28.342  21.445  1.00 123.59 ? 118 THR D N   1 
ATOM   4539 C  CA  . THR D 2 36  ? 29.299  29.152  22.462  1.00 130.27 ? 118 THR D CA  1 
ATOM   4540 C  C   . THR D 2 36  ? 29.766  30.513  21.942  1.00 133.74 ? 118 THR D C   1 
ATOM   4541 O  O   . THR D 2 36  ? 30.321  31.298  22.719  1.00 136.62 ? 118 THR D O   1 
ATOM   4542 C  CB  . THR D 2 36  ? 30.484  28.375  23.055  1.00 140.77 ? 118 THR D CB  1 
ATOM   4543 O  OG1 . THR D 2 36  ? 31.120  27.604  22.024  1.00 143.51 ? 118 THR D OG1 1 
ATOM   4544 C  CG2 . THR D 2 36  ? 30.011  27.440  24.173  1.00 141.88 ? 118 THR D CG2 1 
ATOM   4545 N  N   . SER D 2 37  ? 29.544  30.816  20.664  1.00 131.58 ? 119 SER D N   1 
ATOM   4546 C  CA  . SER D 2 37  ? 29.981  32.077  20.080  1.00 130.82 ? 119 SER D CA  1 
ATOM   4547 C  C   . SER D 2 37  ? 29.228  32.300  18.777  1.00 127.22 ? 119 SER D C   1 
ATOM   4548 O  O   . SER D 2 37  ? 28.734  31.356  18.154  1.00 125.32 ? 119 SER D O   1 
ATOM   4549 C  CB  . SER D 2 37  ? 31.490  32.088  19.821  1.00 128.66 ? 119 SER D CB  1 
ATOM   4550 O  OG  . SER D 2 37  ? 31.829  31.201  18.767  1.00 125.48 ? 119 SER D OG  1 
ATOM   4551 N  N   . GLU D 2 38  ? 29.149  33.563  18.375  1.00 130.02 ? 120 GLU D N   1 
ATOM   4552 C  CA  . GLU D 2 38  ? 28.619  33.892  17.056  1.00 126.28 ? 120 GLU D CA  1 
ATOM   4553 C  C   . GLU D 2 38  ? 29.717  33.685  16.018  1.00 126.64 ? 120 GLU D C   1 
ATOM   4554 O  O   . GLU D 2 38  ? 30.795  34.273  16.153  1.00 130.68 ? 120 GLU D O   1 
ATOM   4555 C  CB  . GLU D 2 38  ? 28.113  35.330  17.020  1.00 127.45 ? 120 GLU D CB  1 
ATOM   4556 N  N   . PRO D 2 39  ? 29.502  32.853  14.995  1.00 110.82 ? 121 PRO D N   1 
ATOM   4557 C  CA  . PRO D 2 39  ? 30.559  32.607  14.000  1.00 109.27 ? 121 PRO D CA  1 
ATOM   4558 C  C   . PRO D 2 39  ? 30.612  33.724  12.964  1.00 106.88 ? 121 PRO D C   1 
ATOM   4559 O  O   . PRO D 2 39  ? 29.585  34.132  12.416  1.00 105.16 ? 121 PRO D O   1 
ATOM   4560 C  CB  . PRO D 2 39  ? 30.144  31.275  13.365  1.00 102.08 ? 121 PRO D CB  1 
ATOM   4561 C  CG  . PRO D 2 39  ? 28.648  31.282  13.469  1.00 97.58  ? 121 PRO D CG  1 
ATOM   4562 C  CD  . PRO D 2 39  ? 28.298  32.040  14.735  1.00 102.13 ? 121 PRO D CD  1 
ATOM   4563 N  N   . GLU D 2 40  ? 31.822  34.214  12.698  1.00 109.55 ? 122 GLU D N   1 
ATOM   4564 C  CA  . GLU D 2 40  ? 32.013  35.317  11.768  1.00 109.49 ? 122 GLU D CA  1 
ATOM   4565 C  C   . GLU D 2 40  ? 31.720  34.877  10.333  1.00 110.45 ? 122 GLU D C   1 
ATOM   4566 O  O   . GLU D 2 40  ? 31.774  33.692  9.986   1.00 109.98 ? 122 GLU D O   1 
ATOM   4567 C  CB  . GLU D 2 40  ? 33.439  35.861  11.870  1.00 113.52 ? 122 GLU D CB  1 
ATOM   4568 N  N   . GLY D 2 41  ? 31.400  35.855  9.494   1.00 109.90 ? 123 GLY D N   1 
ATOM   4569 C  CA  . GLY D 2 41  ? 31.184  35.589  8.089   1.00 107.23 ? 123 GLY D CA  1 
ATOM   4570 C  C   . GLY D 2 41  ? 29.859  34.907  7.815   1.00 98.31  ? 123 GLY D C   1 
ATOM   4571 O  O   . GLY D 2 41  ? 28.975  34.813  8.668   1.00 95.92  ? 123 GLY D O   1 
ATOM   4572 N  N   . ASP D 2 42  ? 29.731  34.427  6.580   1.00 95.03  ? 124 ASP D N   1 
ATOM   4573 C  CA  . ASP D 2 42  ? 28.500  33.781  6.146   1.00 88.66  ? 124 ASP D CA  1 
ATOM   4574 C  C   . ASP D 2 42  ? 28.208  32.551  6.998   1.00 83.19  ? 124 ASP D C   1 
ATOM   4575 O  O   . ASP D 2 42  ? 29.114  31.918  7.548   1.00 85.36  ? 124 ASP D O   1 
ATOM   4576 C  CB  . ASP D 2 42  ? 28.591  33.383  4.672   1.00 93.19  ? 124 ASP D CB  1 
ATOM   4577 C  CG  . ASP D 2 42  ? 28.616  34.580  3.739   1.00 97.99  ? 124 ASP D CG  1 
ATOM   4578 O  OD1 . ASP D 2 42  ? 28.913  35.711  4.188   1.00 100.15 ? 124 ASP D OD1 1 
ATOM   4579 O  OD2 . ASP D 2 42  ? 28.319  34.376  2.545   1.00 99.00  ? 124 ASP D OD2 1 
ATOM   4580 N  N   . TRP D 2 43  ? 26.925  32.213  7.104   1.00 74.59  ? 125 TRP D N   1 
ATOM   4581 C  CA  . TRP D 2 43  ? 26.512  31.120  7.968   1.00 69.46  ? 125 TRP D CA  1 
ATOM   4582 C  C   . TRP D 2 43  ? 25.448  30.264  7.294   1.00 64.88  ? 125 TRP D C   1 
ATOM   4583 O  O   . TRP D 2 43  ? 24.411  30.773  6.857   1.00 62.47  ? 125 TRP D O   1 
ATOM   4584 C  CB  . TRP D 2 43  ? 25.989  31.665  9.289   1.00 63.32  ? 125 TRP D CB  1 
ATOM   4585 C  CG  . TRP D 2 43  ? 25.658  30.633  10.296  1.00 60.34  ? 125 TRP D CG  1 
ATOM   4586 C  CD1 . TRP D 2 43  ? 26.533  29.879  11.024  1.00 58.21  ? 125 TRP D CD1 1 
ATOM   4587 C  CD2 . TRP D 2 43  ? 24.350  30.253  10.716  1.00 53.60  ? 125 TRP D CD2 1 
ATOM   4588 N  NE1 . TRP D 2 43  ? 25.848  29.061  11.885  1.00 63.42  ? 125 TRP D NE1 1 
ATOM   4589 C  CE2 . TRP D 2 43  ? 24.502  29.268  11.709  1.00 53.02  ? 125 TRP D CE2 1 
ATOM   4590 C  CE3 . TRP D 2 43  ? 23.063  30.654  10.352  1.00 51.36  ? 125 TRP D CE3 1 
ATOM   4591 C  CZ2 . TRP D 2 43  ? 23.412  28.674  12.335  1.00 50.26  ? 125 TRP D CZ2 1 
ATOM   4592 C  CZ3 . TRP D 2 43  ? 21.987  30.068  10.972  1.00 48.83  ? 125 TRP D CZ3 1 
ATOM   4593 C  CH2 . TRP D 2 43  ? 22.165  29.084  11.950  1.00 49.64  ? 125 TRP D CH2 1 
ATOM   4594 N  N   . PHE D 2 44  ? 25.704  28.965  7.222   1.00 64.86  ? 126 PHE D N   1 
ATOM   4595 C  CA  . PHE D 2 44  ? 24.752  28.011  6.675   1.00 64.02  ? 126 PHE D CA  1 
ATOM   4596 C  C   . PHE D 2 44  ? 24.085  27.269  7.822   1.00 59.16  ? 126 PHE D C   1 
ATOM   4597 O  O   . PHE D 2 44  ? 24.766  26.750  8.712   1.00 59.31  ? 126 PHE D O   1 
ATOM   4598 C  CB  . PHE D 2 44  ? 25.447  27.036  5.729   1.00 73.13  ? 126 PHE D CB  1 
ATOM   4599 C  CG  . PHE D 2 44  ? 26.009  27.683  4.495   1.00 82.07  ? 126 PHE D CG  1 
ATOM   4600 C  CD1 . PHE D 2 44  ? 25.580  28.934  4.092   1.00 85.86  ? 126 PHE D CD1 1 
ATOM   4601 C  CD2 . PHE D 2 44  ? 26.966  27.030  3.731   1.00 87.79  ? 126 PHE D CD2 1 
ATOM   4602 C  CE1 . PHE D 2 44  ? 26.110  29.534  2.951   1.00 91.04  ? 126 PHE D CE1 1 
ATOM   4603 C  CE2 . PHE D 2 44  ? 27.493  27.617  2.587   1.00 92.39  ? 126 PHE D CE2 1 
ATOM   4604 C  CZ  . PHE D 2 44  ? 27.063  28.870  2.196   1.00 93.14  ? 126 PHE D CZ  1 
ATOM   4605 N  N   . CYS D 2 45  ? 22.759  27.232  7.803   1.00 59.36  ? 127 CYS D N   1 
ATOM   4606 C  CA  . CYS D 2 45  ? 21.995  26.747  8.940   1.00 59.05  ? 127 CYS D CA  1 
ATOM   4607 C  C   . CYS D 2 45  ? 21.933  25.215  8.955   1.00 59.24  ? 127 CYS D C   1 
ATOM   4608 O  O   . CYS D 2 45  ? 22.164  24.565  7.929   1.00 58.74  ? 127 CYS D O   1 
ATOM   4609 C  CB  . CYS D 2 45  ? 20.600  27.362  8.907   1.00 54.20  ? 127 CYS D CB  1 
ATOM   4610 S  SG  . CYS D 2 45  ? 19.383  26.394  8.046   1.00 50.27  ? 127 CYS D SG  1 
ATOM   4611 N  N   . PRO D 2 46  ? 21.628  24.614  10.121  1.00 57.13  ? 128 PRO D N   1 
ATOM   4612 C  CA  . PRO D 2 46  ? 21.662  23.138  10.229  1.00 48.78  ? 128 PRO D CA  1 
ATOM   4613 C  C   . PRO D 2 46  ? 20.757  22.415  9.257   1.00 45.72  ? 128 PRO D C   1 
ATOM   4614 O  O   . PRO D 2 46  ? 21.131  21.345  8.762   1.00 51.30  ? 128 PRO D O   1 
ATOM   4615 C  CB  . PRO D 2 46  ? 21.227  22.883  11.673  1.00 44.27  ? 128 PRO D CB  1 
ATOM   4616 C  CG  . PRO D 2 46  ? 21.578  24.115  12.388  1.00 52.35  ? 128 PRO D CG  1 
ATOM   4617 C  CD  . PRO D 2 46  ? 21.374  25.249  11.427  1.00 56.73  ? 128 PRO D CD  1 
ATOM   4618 N  N   . GLU D 2 47  ? 19.568  22.944  8.977   1.00 38.84  ? 129 GLU D N   1 
ATOM   4619 C  CA  . GLU D 2 47  ? 18.742  22.333  7.946   1.00 40.66  ? 129 GLU D CA  1 
ATOM   4620 C  C   . GLU D 2 47  ? 19.474  22.314  6.609   1.00 46.30  ? 129 GLU D C   1 
ATOM   4621 O  O   . GLU D 2 47  ? 19.507  21.286  5.917   1.00 49.17  ? 129 GLU D O   1 
ATOM   4622 C  CB  . GLU D 2 47  ? 17.413  23.078  7.821   1.00 44.79  ? 129 GLU D CB  1 
ATOM   4623 C  CG  . GLU D 2 47  ? 16.490  22.950  9.021   1.00 48.81  ? 129 GLU D CG  1 
ATOM   4624 C  CD  . GLU D 2 47  ? 15.979  21.535  9.229   1.00 52.27  ? 129 GLU D CD  1 
ATOM   4625 O  OE1 . GLU D 2 47  ? 15.395  21.267  10.294  1.00 53.07  ? 129 GLU D OE1 1 
ATOM   4626 O  OE2 . GLU D 2 47  ? 16.166  20.687  8.333   1.00 55.57  ? 129 GLU D OE2 1 
ATOM   4627 N  N   . CYS D 2 48  ? 20.086  23.447  6.240   1.00 44.28  ? 130 CYS D N   1 
ATOM   4628 C  CA  . CYS D 2 48  ? 20.762  23.550  4.954   1.00 47.48  ? 130 CYS D CA  1 
ATOM   4629 C  C   . CYS D 2 48  ? 21.993  22.655  4.894   1.00 50.65  ? 130 CYS D C   1 
ATOM   4630 O  O   . CYS D 2 48  ? 22.213  21.967  3.889   1.00 50.51  ? 130 CYS D O   1 
ATOM   4631 C  CB  . CYS D 2 48  ? 21.140  25.004  4.671   1.00 50.81  ? 130 CYS D CB  1 
ATOM   4632 S  SG  . CYS D 2 48  ? 19.772  26.005  4.037   1.00 52.59  ? 130 CYS D SG  1 
ATOM   4633 N  N   . GLU D 2 49  ? 22.811  22.650  5.952   1.00 52.66  ? 131 GLU D N   1 
ATOM   4634 C  CA  . GLU D 2 49  ? 23.961  21.753  5.968   1.00 55.96  ? 131 GLU D CA  1 
ATOM   4635 C  C   . GLU D 2 49  ? 23.516  20.308  5.818   1.00 56.47  ? 131 GLU D C   1 
ATOM   4636 O  O   . GLU D 2 49  ? 24.064  19.547  4.999   1.00 59.79  ? 131 GLU D O   1 
ATOM   4637 C  CB  . GLU D 2 49  ? 24.760  21.941  7.255   1.00 59.15  ? 131 GLU D CB  1 
ATOM   4638 C  CG  . GLU D 2 49  ? 25.344  23.314  7.430   1.00 66.77  ? 131 GLU D CG  1 
ATOM   4639 C  CD  . GLU D 2 49  ? 26.582  23.523  6.581   1.00 78.90  ? 131 GLU D CD  1 
ATOM   4640 O  OE1 . GLU D 2 49  ? 27.634  23.941  7.140   1.00 83.27  ? 131 GLU D OE1 1 
ATOM   4641 O  OE2 . GLU D 2 49  ? 26.504  23.267  5.351   1.00 81.66  ? 131 GLU D OE2 1 
ATOM   4642 N  N   . LYS D 2 50  ? 22.486  19.925  6.566   1.00 53.74  ? 132 LYS D N   1 
ATOM   4643 C  CA  . LYS D 2 50  ? 22.055  18.539  6.527   1.00 53.49  ? 132 LYS D CA  1 
ATOM   4644 C  C   . LYS D 2 50  ? 21.523  18.173  5.148   1.00 49.25  ? 132 LYS D C   1 
ATOM   4645 O  O   . LYS D 2 50  ? 21.919  17.150  4.585   1.00 49.92  ? 132 LYS D O   1 
ATOM   4646 C  CB  . LYS D 2 50  ? 21.027  18.283  7.626   1.00 55.20  ? 132 LYS D CB  1 
ATOM   4647 C  CG  . LYS D 2 50  ? 20.226  17.055  7.403   1.00 59.82  ? 132 LYS D CG  1 
ATOM   4648 C  CD  . LYS D 2 50  ? 19.764  16.494  8.719   1.00 66.78  ? 132 LYS D CD  1 
ATOM   4649 C  CE  . LYS D 2 50  ? 18.835  17.449  9.427   1.00 71.05  ? 132 LYS D CE  1 
ATOM   4650 N  NZ  . LYS D 2 50  ? 17.663  16.716  10.004  1.00 71.03  ? 132 LYS D NZ  1 
ATOM   4651 N  N   . ILE D 2 51  ? 20.679  19.026  4.559   1.00 50.37  ? 133 ILE D N   1 
ATOM   4652 C  CA  . ILE D 2 51  ? 20.203  18.792  3.190   1.00 51.31  ? 133 ILE D CA  1 
ATOM   4653 C  C   . ILE D 2 51  ? 21.381  18.650  2.225   1.00 51.51  ? 133 ILE D C   1 
ATOM   4654 O  O   . ILE D 2 51  ? 21.401  17.747  1.379   1.00 48.84  ? 133 ILE D O   1 
ATOM   4655 C  CB  . ILE D 2 51  ? 19.243  19.918  2.740   1.00 51.07  ? 133 ILE D CB  1 
ATOM   4656 C  CG1 . ILE D 2 51  ? 17.895  19.826  3.460   1.00 49.55  ? 133 ILE D CG1 1 
ATOM   4657 C  CG2 . ILE D 2 51  ? 19.040  19.880  1.213   1.00 49.96  ? 133 ILE D CG2 1 
ATOM   4658 C  CD1 . ILE D 2 51  ? 17.117  21.124  3.455   1.00 49.27  ? 133 ILE D CD1 1 
ATOM   4659 N  N   . THR D 2 52  ? 22.376  19.539  2.334   1.00 52.92  ? 134 THR D N   1 
ATOM   4660 C  CA  . THR D 2 52  ? 23.557  19.463  1.473   1.00 57.01  ? 134 THR D CA  1 
ATOM   4661 C  C   . THR D 2 52  ? 24.183  18.069  1.513   1.00 60.43  ? 134 THR D C   1 
ATOM   4662 O  O   . THR D 2 52  ? 24.402  17.446  0.467   1.00 62.21  ? 134 THR D O   1 
ATOM   4663 C  CB  . THR D 2 52  ? 24.592  20.524  1.883   1.00 58.18  ? 134 THR D CB  1 
ATOM   4664 O  OG1 . THR D 2 52  ? 24.198  21.812  1.395   1.00 57.53  ? 134 THR D OG1 1 
ATOM   4665 C  CG2 . THR D 2 52  ? 25.951  20.185  1.326   1.00 53.13  ? 134 THR D CG2 1 
ATOM   4666 N  N   . VAL D 2 53  ? 24.470  17.561  2.719   1.00 60.03  ? 135 VAL D N   1 
ATOM   4667 C  CA  . VAL D 2 53  ? 25.077  16.235  2.824   1.00 61.35  ? 135 VAL D CA  1 
ATOM   4668 C  C   . VAL D 2 53  ? 24.150  15.170  2.251   1.00 59.56  ? 135 VAL D C   1 
ATOM   4669 O  O   . VAL D 2 53  ? 24.595  14.256  1.546   1.00 61.90  ? 135 VAL D O   1 
ATOM   4670 C  CB  . VAL D 2 53  ? 25.450  15.935  4.287   1.00 61.86  ? 135 VAL D CB  1 
ATOM   4671 C  CG1 . VAL D 2 53  ? 25.934  14.479  4.450   1.00 50.80  ? 135 VAL D CG1 1 
ATOM   4672 C  CG2 . VAL D 2 53  ? 26.486  16.938  4.760   1.00 51.87  ? 135 VAL D CG2 1 
ATOM   4673 N  N   . ALA D 2 54  ? 22.846  15.284  2.528   1.00 54.43  ? 136 ALA D N   1 
ATOM   4674 C  CA  . ALA D 2 54  ? 21.871  14.315  2.047   1.00 52.03  ? 136 ALA D CA  1 
ATOM   4675 C  C   . ALA D 2 54  ? 21.738  14.303  0.527   1.00 58.31  ? 136 ALA D C   1 
ATOM   4676 O  O   . ALA D 2 54  ? 21.258  13.306  -0.033  1.00 60.09  ? 136 ALA D O   1 
ATOM   4677 C  CB  . ALA D 2 54  ? 20.498  14.587  2.676   1.00 44.09  ? 136 ALA D CB  1 
ATOM   4678 N  N   . GLU D 2 55  ? 22.138  15.375  -0.156  1.00 59.68  ? 137 GLU D N   1 
ATOM   4679 C  CA  . GLU D 2 55  ? 21.976  15.458  -1.601  1.00 60.96  ? 137 GLU D CA  1 
ATOM   4680 C  C   . GLU D 2 55  ? 23.284  15.264  -2.352  1.00 65.38  ? 137 GLU D C   1 
ATOM   4681 O  O   . GLU D 2 55  ? 23.282  15.270  -3.587  1.00 68.30  ? 137 GLU D O   1 
ATOM   4682 C  CB  . GLU D 2 55  ? 21.337  16.799  -1.993  1.00 61.66  ? 137 GLU D CB  1 
ATOM   4683 C  CG  . GLU D 2 55  ? 19.805  16.856  -1.833  1.00 60.94  ? 137 GLU D CG  1 
ATOM   4684 C  CD  . GLU D 2 55  ? 19.231  18.264  -2.031  1.00 67.18  ? 137 GLU D CD  1 
ATOM   4685 O  OE1 . GLU D 2 55  ? 20.002  19.181  -2.405  1.00 71.71  ? 137 GLU D OE1 1 
ATOM   4686 O  OE2 . GLU D 2 55  ? 18.010  18.461  -1.797  1.00 66.65  ? 137 GLU D OE2 1 
ATOM   4687 N  N   . CYS D 2 56  ? 24.393  15.081  -1.644  1.00 66.38  ? 138 CYS D N   1 
ATOM   4688 C  CA  . CYS D 2 56  ? 25.694  14.873  -2.264  1.00 69.79  ? 138 CYS D CA  1 
ATOM   4689 C  C   . CYS D 2 56  ? 25.866  13.396  -2.602  1.00 72.97  ? 138 CYS D C   1 
ATOM   4690 O  O   . CYS D 2 56  ? 25.527  12.527  -1.791  1.00 73.97  ? 138 CYS D O   1 
ATOM   4691 C  CB  . CYS D 2 56  ? 26.797  15.351  -1.321  1.00 71.11  ? 138 CYS D CB  1 
ATOM   4692 S  SG  . CYS D 2 56  ? 28.453  15.008  -1.898  1.00 77.46  ? 138 CYS D SG  1 
ATOM   4693 N  N   . ILE D 2 57  ? 26.383  13.109  -3.799  1.00 75.25  ? 139 ILE D N   1 
ATOM   4694 C  CA  . ILE D 2 57  ? 26.387  11.726  -4.277  1.00 78.97  ? 139 ILE D CA  1 
ATOM   4695 C  C   . ILE D 2 57  ? 27.232  10.841  -3.373  1.00 80.22  ? 139 ILE D C   1 
ATOM   4696 O  O   . ILE D 2 57  ? 26.908  9.667   -3.152  1.00 80.22  ? 139 ILE D O   1 
ATOM   4697 C  CB  . ILE D 2 57  ? 26.868  11.654  -5.736  1.00 83.27  ? 139 ILE D CB  1 
ATOM   4698 C  CG1 . ILE D 2 57  ? 28.209  12.390  -5.890  1.00 88.36  ? 139 ILE D CG1 1 
ATOM   4699 C  CG2 . ILE D 2 57  ? 25.775  12.175  -6.662  1.00 81.69  ? 139 ILE D CG2 1 
ATOM   4700 C  CD1 . ILE D 2 57  ? 28.775  12.412  -7.297  1.00 91.60  ? 139 ILE D CD1 1 
ATOM   4701 N  N   . GLU D 2 58  ? 28.325  11.383  -2.835  1.00 81.87  ? 140 GLU D N   1 
ATOM   4702 C  CA  . GLU D 2 58  ? 29.195  10.584  -1.985  1.00 81.84  ? 140 GLU D CA  1 
ATOM   4703 C  C   . GLU D 2 58  ? 28.578  10.300  -0.619  1.00 80.66  ? 140 GLU D C   1 
ATOM   4704 O  O   . GLU D 2 58  ? 28.983  9.334   0.030   1.00 84.24  ? 140 GLU D O   1 
ATOM   4705 C  CB  . GLU D 2 58  ? 30.561  11.271  -1.831  1.00 83.23  ? 140 GLU D CB  1 
ATOM   4706 N  N   . THR D 2 59  ? 27.612  11.095  -0.158  1.00 73.91  ? 141 THR D N   1 
ATOM   4707 C  CA  . THR D 2 59  ? 27.113  10.918  1.202   1.00 71.11  ? 141 THR D CA  1 
ATOM   4708 C  C   . THR D 2 59  ? 25.624  10.611  1.282   1.00 66.52  ? 141 THR D C   1 
ATOM   4709 O  O   . THR D 2 59  ? 25.071  10.611  2.390   1.00 66.10  ? 141 THR D O   1 
ATOM   4710 C  CB  . THR D 2 59  ? 27.401  12.155  2.054   1.00 70.59  ? 141 THR D CB  1 
ATOM   4711 O  OG1 . THR D 2 59  ? 26.975  13.326  1.359   1.00 68.15  ? 141 THR D OG1 1 
ATOM   4712 C  CG2 . THR D 2 59  ? 28.891  12.254  2.345   1.00 60.11  ? 141 THR D CG2 1 
ATOM   4713 N  N   . GLN D 2 60  ? 24.967  10.320  0.164   1.00 66.42  ? 142 GLN D N   1 
ATOM   4714 C  CA  . GLN D 2 60  ? 23.521  10.179  0.195   1.00 66.02  ? 142 GLN D CA  1 
ATOM   4715 C  C   . GLN D 2 60  ? 23.111  8.805   0.737   1.00 66.04  ? 142 GLN D C   1 
ATOM   4716 O  O   . GLN D 2 60  ? 23.914  7.875   0.826   1.00 68.16  ? 142 GLN D O   1 
ATOM   4717 C  CB  . GLN D 2 60  ? 22.950  10.397  -1.193  1.00 71.79  ? 142 GLN D CB  1 
ATOM   4718 C  CG  . GLN D 2 60  ? 23.603  9.528   -2.234  1.00 79.13  ? 142 GLN D CG  1 
ATOM   4719 C  CD  . GLN D 2 60  ? 22.972  9.717   -3.585  1.00 83.17  ? 142 GLN D CD  1 
ATOM   4720 O  OE1 . GLN D 2 60  ? 21.966  10.419  -3.716  1.00 81.12  ? 142 GLN D OE1 1 
ATOM   4721 N  NE2 . GLN D 2 60  ? 23.558  9.095   -4.608  1.00 88.19  ? 142 GLN D NE2 1 
ATOM   4722 N  N   . SER D 2 61  ? 21.833  8.678   1.095   1.00 59.93  ? 143 SER D N   1 
ATOM   4723 C  CA  . SER D 2 61  ? 21.363  7.447   1.711   1.00 57.85  ? 143 SER D CA  1 
ATOM   4724 C  C   . SER D 2 61  ? 21.217  6.334   0.675   1.00 57.49  ? 143 SER D C   1 
ATOM   4725 O  O   . SER D 2 61  ? 21.123  6.581   -0.529  1.00 59.95  ? 143 SER D O   1 
ATOM   4726 C  CB  . SER D 2 61  ? 20.036  7.683   2.429   1.00 52.04  ? 143 SER D CB  1 
ATOM   4727 O  OG  . SER D 2 61  ? 18.998  8.006   1.525   1.00 51.80  ? 143 SER D OG  1 
ATOM   4728 N  N   . LYS D 2 62  ? 21.203  5.089   1.158   1.00 57.46  ? 144 LYS D N   1 
ATOM   4729 C  CA  . LYS D 2 62  ? 20.972  3.965   0.248   1.00 62.88  ? 144 LYS D CA  1 
ATOM   4730 C  C   . LYS D 2 62  ? 19.661  4.142   -0.514  1.00 63.89  ? 144 LYS D C   1 
ATOM   4731 O  O   . LYS D 2 62  ? 19.582  3.850   -1.716  1.00 64.67  ? 144 LYS D O   1 
ATOM   4732 C  CB  . LYS D 2 62  ? 20.969  2.641   1.023   1.00 65.78  ? 144 LYS D CB  1 
ATOM   4733 C  CG  . LYS D 2 62  ? 21.163  1.397   0.161   1.00 68.98  ? 144 LYS D CG  1 
ATOM   4734 C  CD  . LYS D 2 62  ? 21.180  0.118   1.007   1.00 70.59  ? 144 LYS D CD  1 
ATOM   4735 N  N   . ALA D 2 63  ? 18.629  4.640   0.173   1.00 58.92  ? 145 ALA D N   1 
ATOM   4736 C  CA  . ALA D 2 63  ? 17.369  4.960   -0.482  1.00 56.79  ? 145 ALA D CA  1 
ATOM   4737 C  C   . ALA D 2 63  ? 17.571  5.947   -1.629  1.00 57.34  ? 145 ALA D C   1 
ATOM   4738 O  O   . ALA D 2 63  ? 17.069  5.735   -2.736  1.00 59.95  ? 145 ALA D O   1 
ATOM   4739 C  CB  . ALA D 2 63  ? 16.387  5.514   0.553   1.00 54.96  ? 145 ALA D CB  1 
ATOM   4740 N  N   . MET D 2 64  ? 18.312  7.031   -1.387  1.00 56.92  ? 146 MET D N   1 
ATOM   4741 C  CA  . MET D 2 64  ? 18.496  8.054   -2.412  1.00 57.87  ? 146 MET D CA  1 
ATOM   4742 C  C   . MET D 2 64  ? 19.263  7.547   -3.620  1.00 62.17  ? 146 MET D C   1 
ATOM   4743 O  O   . MET D 2 64  ? 19.079  8.075   -4.720  1.00 63.36  ? 146 MET D O   1 
ATOM   4744 C  CB  . MET D 2 64  ? 19.238  9.264   -1.845  1.00 58.94  ? 146 MET D CB  1 
ATOM   4745 C  CG  . MET D 2 64  ? 18.367  10.249  -1.134  1.00 57.48  ? 146 MET D CG  1 
ATOM   4746 S  SD  . MET D 2 64  ? 16.758  10.406  -1.915  1.00 57.83  ? 146 MET D SD  1 
ATOM   4747 C  CE  . MET D 2 64  ? 15.757  9.554   -0.721  1.00 55.30  ? 146 MET D CE  1 
ATOM   4748 N  N   . THR D 2 65  ? 20.161  6.571   -3.444  1.00 66.91  ? 147 THR D N   1 
ATOM   4749 C  CA  . THR D 2 65  ? 20.988  6.149   -4.575  1.00 73.18  ? 147 THR D CA  1 
ATOM   4750 C  C   . THR D 2 65  ? 20.177  5.389   -5.611  1.00 73.74  ? 147 THR D C   1 
ATOM   4751 O  O   . THR D 2 65  ? 20.450  5.502   -6.810  1.00 78.43  ? 147 THR D O   1 
ATOM   4752 C  CB  . THR D 2 65  ? 22.160  5.285   -4.112  1.00 75.75  ? 147 THR D CB  1 
ATOM   4753 O  OG1 . THR D 2 65  ? 21.661  4.061   -3.558  1.00 75.82  ? 147 THR D OG1 1 
ATOM   4754 C  CG2 . THR D 2 65  ? 23.003  6.029   -3.075  1.00 74.76  ? 147 THR D CG2 1 
ATOM   4755 N  N   . MET D 2 66  ? 19.181  4.627   -5.175  1.00 73.89  ? 148 MET D N   1 
ATOM   4756 C  CA  . MET D 2 66  ? 18.307  3.891   -6.084  1.00 74.18  ? 148 MET D CA  1 
ATOM   4757 C  C   . MET D 2 66  ? 17.048  4.674   -6.452  1.00 70.86  ? 148 MET D C   1 
ATOM   4758 O  O   . MET D 2 66  ? 15.967  4.099   -6.554  1.00 74.80  ? 148 MET D O   1 
ATOM   4759 C  CB  . MET D 2 66  ? 17.949  2.543   -5.462  1.00 79.49  ? 148 MET D CB  1 
ATOM   4760 C  CG  . MET D 2 66  ? 17.361  2.639   -4.058  1.00 80.77  ? 148 MET D CG  1 
ATOM   4761 S  SD  . MET D 2 66  ? 16.861  1.053   -3.318  1.00 83.94  ? 148 MET D SD  1 
ATOM   4762 C  CE  . MET D 2 66  ? 18.195  0.766   -2.146  1.00 84.19  ? 148 MET D CE  1 
ATOM   4763 N  N   . LEU D 2 67  ? 17.139  5.981   -6.665  1.00 59.79  ? 149 LEU D N   1 
ATOM   4764 C  CA  . LEU D 2 67  ? 15.966  6.779   -6.988  1.00 56.09  ? 149 LEU D CA  1 
ATOM   4765 C  C   . LEU D 2 67  ? 16.378  7.945   -7.869  1.00 59.66  ? 149 LEU D C   1 
ATOM   4766 O  O   . LEU D 2 67  ? 17.345  8.642   -7.554  1.00 61.17  ? 149 LEU D O   1 
ATOM   4767 C  CB  . LEU D 2 67  ? 15.296  7.324   -5.721  1.00 51.38  ? 149 LEU D CB  1 
ATOM   4768 C  CG  . LEU D 2 67  ? 14.556  6.407   -4.738  1.00 49.51  ? 149 LEU D CG  1 
ATOM   4769 C  CD1 . LEU D 2 67  ? 14.056  7.181   -3.513  1.00 44.34  ? 149 LEU D CD1 1 
ATOM   4770 C  CD2 . LEU D 2 67  ? 13.400  5.666   -5.416  1.00 49.82  ? 149 LEU D CD2 1 
ATOM   4771 N  N   . THR D 2 68  ? 15.650  8.170   -8.957  1.00 61.69  ? 150 THR D N   1 
ATOM   4772 C  CA  . THR D 2 68  ? 15.821  9.446   -9.633  1.00 61.39  ? 150 THR D CA  1 
ATOM   4773 C  C   . THR D 2 68  ? 14.968  10.500  -8.939  1.00 56.48  ? 150 THR D C   1 
ATOM   4774 O  O   . THR D 2 68  ? 14.099  10.192  -8.122  1.00 54.85  ? 150 THR D O   1 
ATOM   4775 C  CB  . THR D 2 68  ? 15.449  9.365   -11.118 1.00 61.58  ? 150 THR D CB  1 
ATOM   4776 O  OG1 . THR D 2 68  ? 14.046  9.613   -11.280 1.00 65.59  ? 150 THR D OG1 1 
ATOM   4777 C  CG2 . THR D 2 68  ? 15.801  8.019   -11.701 1.00 54.58  ? 150 THR D CG2 1 
ATOM   4778 N  N   . ILE D 2 69  ? 15.225  11.760  -9.278  1.00 56.83  ? 151 ILE D N   1 
ATOM   4779 C  CA  . ILE D 2 69  ? 14.491  12.862  -8.661  1.00 53.81  ? 151 ILE D CA  1 
ATOM   4780 C  C   . ILE D 2 69  ? 13.001  12.735  -8.960  1.00 56.05  ? 151 ILE D C   1 
ATOM   4781 O  O   . ILE D 2 69  ? 12.153  13.029  -8.106  1.00 55.41  ? 151 ILE D O   1 
ATOM   4782 C  CB  . ILE D 2 69  ? 15.078  14.205  -9.134  1.00 53.12  ? 151 ILE D CB  1 
ATOM   4783 C  CG1 . ILE D 2 69  ? 14.506  15.355  -8.335  1.00 52.96  ? 151 ILE D CG1 1 
ATOM   4784 C  CG2 . ILE D 2 69  ? 14.890  14.414  -10.625 1.00 55.24  ? 151 ILE D CG2 1 
ATOM   4785 C  CD1 . ILE D 2 69  ? 15.072  15.386  -6.985  1.00 53.35  ? 151 ILE D CD1 1 
ATOM   4786 N  N   . GLU D 2 70  ? 12.668  12.232  -10.156 1.00 58.28  ? 152 GLU D N   1 
ATOM   4787 C  CA  . GLU D 2 70  ? 11.279  11.981  -10.532 1.00 59.08  ? 152 GLU D CA  1 
ATOM   4788 C  C   . GLU D 2 70  ? 10.633  10.950  -9.615  1.00 59.55  ? 152 GLU D C   1 
ATOM   4789 O  O   . GLU D 2 70  ? 9.486   11.123  -9.169  1.00 60.39  ? 152 GLU D O   1 
ATOM   4790 C  CB  . GLU D 2 70  ? 11.224  11.491  -11.980 1.00 62.46  ? 152 GLU D CB  1 
ATOM   4791 C  CG  . GLU D 2 70  ? 11.393  12.553  -13.085 1.00 65.10  ? 152 GLU D CG  1 
ATOM   4792 C  CD  . GLU D 2 70  ? 12.827  13.055  -13.211 1.00 66.46  ? 152 GLU D CD  1 
ATOM   4793 O  OE1 . GLU D 2 70  ? 13.752  12.253  -12.943 1.00 68.70  ? 152 GLU D OE1 1 
ATOM   4794 O  OE2 . GLU D 2 70  ? 13.028  14.237  -13.590 1.00 65.56  ? 152 GLU D OE2 1 
ATOM   4795 N  N   . GLN D 2 71  ? 11.354  9.863   -9.331  1.00 61.76  ? 153 GLN D N   1 
ATOM   4796 C  CA  . GLN D 2 71  ? 10.829  8.827   -8.447  1.00 60.67  ? 153 GLN D CA  1 
ATOM   4797 C  C   . GLN D 2 71  ? 10.656  9.354   -7.024  1.00 58.31  ? 153 GLN D C   1 
ATOM   4798 O  O   . GLN D 2 71  ? 9.587   9.190   -6.411  1.00 61.31  ? 153 GLN D O   1 
ATOM   4799 C  CB  . GLN D 2 71  ? 11.751  7.607   -8.484  1.00 61.84  ? 153 GLN D CB  1 
ATOM   4800 C  CG  . GLN D 2 71  ? 12.285  7.329   -9.877  1.00 64.43  ? 153 GLN D CG  1 
ATOM   4801 C  CD  . GLN D 2 71  ? 12.842  5.926   -10.057 1.00 64.73  ? 153 GLN D CD  1 
ATOM   4802 O  OE1 . GLN D 2 71  ? 13.972  5.625   -9.656  1.00 65.68  ? 153 GLN D OE1 1 
ATOM   4803 N  NE2 . GLN D 2 71  ? 12.050  5.060   -10.679 1.00 63.24  ? 153 GLN D NE2 1 
ATOM   4804 N  N   . LEU D 2 72  ? 11.685  10.008  -6.484  1.00 53.41  ? 154 LEU D N   1 
ATOM   4805 C  CA  . LEU D 2 72  ? 11.517  10.651  -5.189  1.00 50.59  ? 154 LEU D CA  1 
ATOM   4806 C  C   . LEU D 2 72  ? 10.255  11.500  -5.170  1.00 48.90  ? 154 LEU D C   1 
ATOM   4807 O  O   . LEU D 2 72  ? 9.478   11.449  -4.209  1.00 50.51  ? 154 LEU D O   1 
ATOM   4808 C  CB  . LEU D 2 72  ? 12.731  11.509  -4.835  1.00 50.51  ? 154 LEU D CB  1 
ATOM   4809 C  CG  . LEU D 2 72  ? 12.505  12.236  -3.497  1.00 48.51  ? 154 LEU D CG  1 
ATOM   4810 C  CD1 . LEU D 2 72  ? 12.409  11.219  -2.378  1.00 48.28  ? 154 LEU D CD1 1 
ATOM   4811 C  CD2 . LEU D 2 72  ? 13.579  13.278  -3.190  1.00 47.63  ? 154 LEU D CD2 1 
ATOM   4812 N  N   . SER D 2 73  ? 10.016  12.262  -6.239  1.00 45.67  ? 155 SER D N   1 
ATOM   4813 C  CA  . SER D 2 73  ? 8.838   13.121  -6.266  1.00 46.94  ? 155 SER D CA  1 
ATOM   4814 C  C   . SER D 2 73  ? 7.557   12.312  -6.156  1.00 49.26  ? 155 SER D C   1 
ATOM   4815 O  O   . SER D 2 73  ? 6.626   12.696  -5.430  1.00 50.72  ? 155 SER D O   1 
ATOM   4816 C  CB  . SER D 2 73  ? 8.840   13.943  -7.535  1.00 48.79  ? 155 SER D CB  1 
ATOM   4817 O  OG  . SER D 2 73  ? 10.089  14.590  -7.628  1.00 55.41  ? 155 SER D OG  1 
ATOM   4818 N  N   . TYR D 2 74  ? 7.495   11.182  -6.859  1.00 46.05  ? 156 TYR D N   1 
ATOM   4819 C  CA  . TYR D 2 74  ? 6.302   10.347  -6.785  1.00 43.97  ? 156 TYR D CA  1 
ATOM   4820 C  C   . TYR D 2 74  ? 6.058   9.893   -5.347  1.00 41.73  ? 156 TYR D C   1 
ATOM   4821 O  O   . TYR D 2 74  ? 4.941   10.034  -4.804  1.00 44.30  ? 156 TYR D O   1 
ATOM   4822 C  CB  . TYR D 2 74  ? 6.467   9.168   -7.754  1.00 49.65  ? 156 TYR D CB  1 
ATOM   4823 C  CG  . TYR D 2 74  ? 5.211   8.439   -8.174  1.00 53.14  ? 156 TYR D CG  1 
ATOM   4824 C  CD1 . TYR D 2 74  ? 4.006   9.100   -8.333  1.00 55.63  ? 156 TYR D CD1 1 
ATOM   4825 C  CD2 . TYR D 2 74  ? 5.243   7.071   -8.414  1.00 54.34  ? 156 TYR D CD2 1 
ATOM   4826 C  CE1 . TYR D 2 74  ? 2.858   8.407   -8.727  1.00 59.62  ? 156 TYR D CE1 1 
ATOM   4827 C  CE2 . TYR D 2 74  ? 4.112   6.373   -8.813  1.00 56.21  ? 156 TYR D CE2 1 
ATOM   4828 C  CZ  . TYR D 2 74  ? 2.922   7.038   -8.971  1.00 59.76  ? 156 TYR D CZ  1 
ATOM   4829 O  OH  . TYR D 2 74  ? 1.803   6.328   -9.371  1.00 62.23  ? 156 TYR D OH  1 
ATOM   4830 N  N   . LEU D 2 75  ? 7.110   9.397   -4.681  1.00 36.97  ? 157 LEU D N   1 
ATOM   4831 C  CA  . LEU D 2 75  ? 6.920   8.967   -3.294  1.00 37.65  ? 157 LEU D CA  1 
ATOM   4832 C  C   . LEU D 2 75  ? 6.456   10.128  -2.419  1.00 37.35  ? 157 LEU D C   1 
ATOM   4833 O  O   . LEU D 2 75  ? 5.597   9.952   -1.546  1.00 37.63  ? 157 LEU D O   1 
ATOM   4834 C  CB  . LEU D 2 75  ? 8.202   8.360   -2.738  1.00 38.02  ? 157 LEU D CB  1 
ATOM   4835 C  CG  . LEU D 2 75  ? 8.819   7.255   -3.598  1.00 42.38  ? 157 LEU D CG  1 
ATOM   4836 C  CD1 . LEU D 2 75  ? 10.018  6.593   -2.903  1.00 34.80  ? 157 LEU D CD1 1 
ATOM   4837 C  CD2 . LEU D 2 75  ? 7.771   6.233   -3.985  1.00 35.20  ? 157 LEU D CD2 1 
ATOM   4838 N  N   . LEU D 2 76  ? 6.988   11.332  -2.663  1.00 38.05  ? 158 LEU D N   1 
ATOM   4839 C  CA  . LEU D 2 76  ? 6.595   12.481  -1.856  1.00 37.28  ? 158 LEU D CA  1 
ATOM   4840 C  C   . LEU D 2 76  ? 5.122   12.810  -2.062  1.00 39.45  ? 158 LEU D C   1 
ATOM   4841 O  O   . LEU D 2 76  ? 4.431   13.231  -1.117  1.00 40.28  ? 158 LEU D O   1 
ATOM   4842 C  CB  . LEU D 2 76  ? 7.488   13.675  -2.178  1.00 35.51  ? 158 LEU D CB  1 
ATOM   4843 C  CG  . LEU D 2 76  ? 8.936   13.433  -1.749  1.00 36.24  ? 158 LEU D CG  1 
ATOM   4844 C  CD1 . LEU D 2 76  ? 9.825   14.651  -1.922  1.00 31.56  ? 158 LEU D CD1 1 
ATOM   4845 C  CD2 . LEU D 2 76  ? 8.925   13.007  -0.321  1.00 34.49  ? 158 LEU D CD2 1 
ATOM   4846 N  N   . LYS D 2 77  ? 4.613   12.583  -3.281  1.00 36.34  ? 159 LYS D N   1 
ATOM   4847 C  CA  . LYS D 2 77  ? 3.184   12.761  -3.526  1.00 38.11  ? 159 LYS D CA  1 
ATOM   4848 C  C   . LYS D 2 77  ? 2.347   11.835  -2.646  1.00 41.79  ? 159 LYS D C   1 
ATOM   4849 O  O   . LYS D 2 77  ? 1.351   12.270  -2.036  1.00 46.01  ? 159 LYS D O   1 
ATOM   4850 C  CB  . LYS D 2 77  ? 2.868   12.529  -5.003  1.00 40.61  ? 159 LYS D CB  1 
ATOM   4851 C  CG  . LYS D 2 77  ? 1.419   12.779  -5.349  1.00 45.22  ? 159 LYS D CG  1 
ATOM   4852 C  CD  . LYS D 2 77  ? 1.112   12.360  -6.756  1.00 52.74  ? 159 LYS D CD  1 
ATOM   4853 C  CE  . LYS D 2 77  ? -0.271  12.868  -7.170  1.00 60.52  ? 159 LYS D CE  1 
ATOM   4854 N  NZ  . LYS D 2 77  ? -0.718  12.397  -8.524  1.00 65.97  ? 159 LYS D NZ  1 
ATOM   4855 N  N   . PHE D 2 78  ? 2.742   10.558  -2.542  1.00 40.97  ? 160 PHE D N   1 
ATOM   4856 C  CA  . PHE D 2 78  ? 2.001   9.673   -1.632  1.00 39.87  ? 160 PHE D CA  1 
ATOM   4857 C  C   . PHE D 2 78  ? 2.122   10.134  -0.181  1.00 38.73  ? 160 PHE D C   1 
ATOM   4858 O  O   . PHE D 2 78  ? 1.173   10.012  0.611   1.00 43.75  ? 160 PHE D O   1 
ATOM   4859 C  CB  . PHE D 2 78  ? 2.489   8.237   -1.768  1.00 31.53  ? 160 PHE D CB  1 
ATOM   4860 C  CG  . PHE D 2 78  ? 2.163   7.614   -3.095  1.00 42.36  ? 160 PHE D CG  1 
ATOM   4861 C  CD1 . PHE D 2 78  ? 0.864   7.244   -3.408  1.00 34.43  ? 160 PHE D CD1 1 
ATOM   4862 C  CD2 . PHE D 2 78  ? 3.158   7.396   -4.037  1.00 40.57  ? 160 PHE D CD2 1 
ATOM   4863 C  CE1 . PHE D 2 78  ? 0.550   6.670   -4.635  1.00 45.76  ? 160 PHE D CE1 1 
ATOM   4864 C  CE2 . PHE D 2 78  ? 2.854   6.827   -5.285  1.00 43.05  ? 160 PHE D CE2 1 
ATOM   4865 C  CZ  . PHE D 2 78  ? 1.550   6.460   -5.581  1.00 44.33  ? 160 PHE D CZ  1 
ATOM   4866 N  N   . ALA D 2 79  ? 3.291   10.639  0.202   1.00 39.28  ? 161 ALA D N   1 
ATOM   4867 C  CA  . ALA D 2 79  ? 3.459   11.103  1.576   1.00 37.24  ? 161 ALA D CA  1 
ATOM   4868 C  C   . ALA D 2 79  ? 2.481   12.223  1.892   1.00 40.50  ? 161 ALA D C   1 
ATOM   4869 O  O   . ALA D 2 79  ? 1.829   12.216  2.945   1.00 42.18  ? 161 ALA D O   1 
ATOM   4870 C  CB  . ALA D 2 79  ? 4.893   11.564  1.792   1.00 37.22  ? 161 ALA D CB  1 
ATOM   4871 N  N   . ILE D 2 80  ? 2.345   13.188  0.972   1.00 43.92  ? 162 ILE D N   1 
ATOM   4872 C  CA  . ILE D 2 80  ? 1.350   14.240  1.154   1.00 43.25  ? 162 ILE D CA  1 
ATOM   4873 C  C   . ILE D 2 80  ? -0.047  13.652  1.271   1.00 45.50  ? 162 ILE D C   1 
ATOM   4874 O  O   . ILE D 2 80  ? -0.896  14.192  1.996   1.00 43.54  ? 162 ILE D O   1 
ATOM   4875 C  CB  . ILE D 2 80  ? 1.447   15.262  0.010   1.00 42.17  ? 162 ILE D CB  1 
ATOM   4876 C  CG1 . ILE D 2 80  ? 2.787   15.965  0.075   1.00 41.25  ? 162 ILE D CG1 1 
ATOM   4877 C  CG2 . ILE D 2 80  ? 0.355   16.310  0.111   1.00 43.23  ? 162 ILE D CG2 1 
ATOM   4878 C  CD1 . ILE D 2 80  ? 3.299   16.353  -1.269  1.00 43.82  ? 162 ILE D CD1 1 
ATOM   4879 N  N   . GLN D 2 81  ? -0.318  12.538  0.576   1.00 48.94  ? 163 GLN D N   1 
ATOM   4880 C  CA  . GLN D 2 81  ? -1.602  11.867  0.792   1.00 51.92  ? 163 GLN D CA  1 
ATOM   4881 C  C   . GLN D 2 81  ? -1.760  11.409  2.241   1.00 46.11  ? 163 GLN D C   1 
ATOM   4882 O  O   . GLN D 2 81  ? -2.821  11.612  2.844   1.00 43.48  ? 163 GLN D O   1 
ATOM   4883 C  CB  . GLN D 2 81  ? -1.770  10.692  -0.167  1.00 61.59  ? 163 GLN D CB  1 
ATOM   4884 C  CG  . GLN D 2 81  ? -2.043  11.129  -1.595  1.00 72.68  ? 163 GLN D CG  1 
ATOM   4885 C  CD  . GLN D 2 81  ? -2.869  12.414  -1.648  1.00 82.82  ? 163 GLN D CD  1 
ATOM   4886 O  OE1 . GLN D 2 81  ? -4.092  12.389  -1.439  1.00 87.19  ? 163 GLN D OE1 1 
ATOM   4887 N  NE2 . GLN D 2 81  ? -2.202  13.548  -1.923  1.00 84.24  ? 163 GLN D NE2 1 
ATOM   4888 N  N   . LYS D 2 82  ? -0.713  10.814  2.833   1.00 45.75  ? 164 LYS D N   1 
ATOM   4889 C  CA  . LYS D 2 82  ? -0.866  10.358  4.221   1.00 47.39  ? 164 LYS D CA  1 
ATOM   4890 C  C   . LYS D 2 82  ? -0.962  11.529  5.194   1.00 46.66  ? 164 LYS D C   1 
ATOM   4891 O  O   . LYS D 2 82  ? -1.543  11.385  6.283   1.00 47.72  ? 164 LYS D O   1 
ATOM   4892 C  CB  . LYS D 2 82  ? 0.279   9.424   4.653   1.00 48.08  ? 164 LYS D CB  1 
ATOM   4893 C  CG  . LYS D 2 82  ? 0.680   8.352   3.645   1.00 53.82  ? 164 LYS D CG  1 
ATOM   4894 C  CD  . LYS D 2 82  ? -0.277  7.157   3.590   1.00 59.05  ? 164 LYS D CD  1 
ATOM   4895 C  CE  . LYS D 2 82  ? 0.210   6.059   2.610   1.00 61.18  ? 164 LYS D CE  1 
ATOM   4896 N  NZ  . LYS D 2 82  ? 1.529   5.410   2.985   1.00 61.03  ? 164 LYS D NZ  1 
ATOM   4897 N  N   . MET D 2 83  ? -0.413  12.691  4.830   1.00 44.26  ? 165 MET D N   1 
ATOM   4898 C  CA  . MET D 2 83  ? -0.492  13.842  5.732   1.00 42.95  ? 165 MET D CA  1 
ATOM   4899 C  C   . MET D 2 83  ? -1.878  14.499  5.730   1.00 43.87  ? 165 MET D C   1 
ATOM   4900 O  O   . MET D 2 83  ? -2.301  15.044  6.753   1.00 44.40  ? 165 MET D O   1 
ATOM   4901 C  CB  . MET D 2 83  ? 0.575   14.860  5.363   1.00 43.66  ? 165 MET D CB  1 
ATOM   4902 C  CG  . MET D 2 83  ? 1.990   14.338  5.416   1.00 45.13  ? 165 MET D CG  1 
ATOM   4903 S  SD  . MET D 2 83  ? 3.191   15.623  4.970   1.00 49.40  ? 165 MET D SD  1 
ATOM   4904 C  CE  . MET D 2 83  ? 4.003   14.728  3.687   1.00 49.52  ? 165 MET D CE  1 
ATOM   4905 N  N   . LYS D 2 84  ? -2.598  14.477  4.609   1.00 43.88  ? 166 LYS D N   1 
ATOM   4906 C  CA  . LYS D 2 84  ? -3.944  15.045  4.589   1.00 46.99  ? 166 LYS D CA  1 
ATOM   4907 C  C   . LYS D 2 84  ? -4.965  14.167  5.300   1.00 47.83  ? 166 LYS D C   1 
ATOM   4908 O  O   . LYS D 2 84  ? -5.981  13.800  4.705   1.00 51.00  ? 166 LYS D O   1 
ATOM   4909 C  CB  . LYS D 2 84  ? -4.432  15.261  3.154   1.00 48.85  ? 166 LYS D CB  1 
ATOM   4910 C  CG  . LYS D 2 84  ? -3.670  16.286  2.379   1.00 48.07  ? 166 LYS D CG  1 
ATOM   4911 C  CD  . LYS D 2 84  ? -4.084  16.254  0.942   1.00 51.90  ? 166 LYS D CD  1 
ATOM   4912 C  CE  . LYS D 2 84  ? -5.303  17.113  0.694   1.00 58.43  ? 166 LYS D CE  1 
ATOM   4913 N  NZ  . LYS D 2 84  ? -5.684  17.042  -0.753  1.00 63.31  ? 166 LYS D NZ  1 
ATOM   4914 N  N   . GLN D 2 85  ? -4.719  13.808  6.553   1.00 48.37  ? 167 GLN D N   1 
ATOM   4915 C  CA  . GLN D 2 85  ? -5.731  13.084  7.309   1.00 48.27  ? 167 GLN D CA  1 
ATOM   4916 C  C   . GLN D 2 85  ? -6.961  13.968  7.520   1.00 52.65  ? 167 GLN D C   1 
ATOM   4917 O  O   . GLN D 2 85  ? -6.845  15.199  7.583   1.00 52.68  ? 167 GLN D O   1 
ATOM   4918 C  CB  . GLN D 2 85  ? -5.177  12.647  8.659   1.00 43.34  ? 167 GLN D CB  1 
ATOM   4919 C  CG  . GLN D 2 85  ? -4.134  11.558  8.567   1.00 44.58  ? 167 GLN D CG  1 
ATOM   4920 C  CD  . GLN D 2 85  ? -4.641  10.351  7.817   1.00 47.50  ? 167 GLN D CD  1 
ATOM   4921 O  OE1 . GLN D 2 85  ? -5.704  9.814   8.129   1.00 50.34  ? 167 GLN D OE1 1 
ATOM   4922 N  NE2 . GLN D 2 85  ? -3.892  9.928   6.805   1.00 45.41  ? 167 GLN D NE2 1 
ATOM   4923 N  N   . PRO D 2 86  ? -8.147  13.371  7.636   1.00 52.67  ? 168 PRO D N   1 
ATOM   4924 C  CA  . PRO D 2 86  ? -9.332  14.151  8.021   1.00 54.17  ? 168 PRO D CA  1 
ATOM   4925 C  C   . PRO D 2 86  ? -9.080  14.965  9.284   1.00 54.24  ? 168 PRO D C   1 
ATOM   4926 O  O   . PRO D 2 86  ? -8.585  14.451  10.291  1.00 52.70  ? 168 PRO D O   1 
ATOM   4927 C  CB  . PRO D 2 86  ? -10.410 13.082  8.242   1.00 53.64  ? 168 PRO D CB  1 
ATOM   4928 C  CG  . PRO D 2 86  ? -9.690  11.773  8.307   1.00 51.65  ? 168 PRO D CG  1 
ATOM   4929 C  CD  . PRO D 2 86  ? -8.458  11.945  7.471   1.00 52.72  ? 168 PRO D CD  1 
ATOM   4930 N  N   . GLY D 2 87  ? -9.433  16.253  9.218   1.00 55.82  ? 169 GLY D N   1 
ATOM   4931 C  CA  . GLY D 2 87  ? -9.184  17.200  10.282  1.00 52.66  ? 169 GLY D CA  1 
ATOM   4932 C  C   . GLY D 2 87  ? -8.067  18.177  9.992   1.00 52.42  ? 169 GLY D C   1 
ATOM   4933 O  O   . GLY D 2 87  ? -7.768  19.019  10.854  1.00 51.54  ? 169 GLY D O   1 
ATOM   4934 N  N   . THR D 2 88  ? -7.438  18.082  8.811   1.00 49.93  ? 170 THR D N   1 
ATOM   4935 C  CA  . THR D 2 88  ? -6.296  18.904  8.428   1.00 50.09  ? 170 THR D CA  1 
ATOM   4936 C  C   . THR D 2 88  ? -6.666  19.989  7.417   1.00 53.44  ? 170 THR D C   1 
ATOM   4937 O  O   . THR D 2 88  ? -5.779  20.525  6.741   1.00 49.09  ? 170 THR D O   1 
ATOM   4938 C  CB  . THR D 2 88  ? -5.178  18.041  7.847   1.00 45.41  ? 170 THR D CB  1 
ATOM   4939 O  OG1 . THR D 2 88  ? -5.672  17.328  6.699   1.00 48.36  ? 170 THR D OG1 1 
ATOM   4940 C  CG2 . THR D 2 88  ? -4.646  17.062  8.880   1.00 39.51  ? 170 THR D CG2 1 
ATOM   4941 N  N   . ASP D 2 89  ? -7.960  20.327  7.311   1.00 58.74  ? 171 ASP D N   1 
ATOM   4942 C  CA  . ASP D 2 89  ? -8.412  21.225  6.252   1.00 61.81  ? 171 ASP D CA  1 
ATOM   4943 C  C   . ASP D 2 89  ? -7.749  22.589  6.359   1.00 58.35  ? 171 ASP D C   1 
ATOM   4944 O  O   . ASP D 2 89  ? -7.419  23.204  5.344   1.00 59.34  ? 171 ASP D O   1 
ATOM   4945 C  CB  . ASP D 2 89  ? -9.930  21.364  6.298   1.00 76.76  ? 171 ASP D CB  1 
ATOM   4946 C  CG  . ASP D 2 89  ? -10.637 20.022  6.413   1.00 88.75  ? 171 ASP D CG  1 
ATOM   4947 O  OD1 . ASP D 2 89  ? -10.072 18.984  5.987   1.00 91.06  ? 171 ASP D OD1 1 
ATOM   4948 O  OD2 . ASP D 2 89  ? -11.766 20.001  6.942   1.00 94.00  ? 171 ASP D OD2 1 
ATOM   4949 N  N   . ALA D 2 90  ? -7.518  23.064  7.583   1.00 54.38  ? 172 ALA D N   1 
ATOM   4950 C  CA  . ALA D 2 90  ? -6.891  24.365  7.791   1.00 50.42  ? 172 ALA D CA  1 
ATOM   4951 C  C   . ALA D 2 90  ? -5.494  24.452  7.194   1.00 51.69  ? 172 ALA D C   1 
ATOM   4952 O  O   . ALA D 2 90  ? -4.956  25.557  7.041   1.00 52.69  ? 172 ALA D O   1 
ATOM   4953 C  CB  . ALA D 2 90  ? -6.815  24.663  9.279   1.00 45.39  ? 172 ALA D CB  1 
ATOM   4954 N  N   . PHE D 2 91  ? -4.878  23.319  6.866   1.00 51.31  ? 173 PHE D N   1 
ATOM   4955 C  CA  . PHE D 2 91  ? -3.519  23.348  6.348   1.00 50.27  ? 173 PHE D CA  1 
ATOM   4956 C  C   . PHE D 2 91  ? -3.433  22.909  4.897   1.00 50.51  ? 173 PHE D C   1 
ATOM   4957 O  O   . PHE D 2 91  ? -2.325  22.755  4.369   1.00 49.80  ? 173 PHE D O   1 
ATOM   4958 C  CB  . PHE D 2 91  ? -2.609  22.504  7.244   1.00 44.08  ? 173 PHE D CB  1 
ATOM   4959 C  CG  . PHE D 2 91  ? -2.623  22.957  8.669   1.00 43.55  ? 173 PHE D CG  1 
ATOM   4960 C  CD1 . PHE D 2 91  ? -2.043  24.166  9.022   1.00 43.26  ? 173 PHE D CD1 1 
ATOM   4961 C  CD2 . PHE D 2 91  ? -3.263  22.209  9.653   1.00 43.84  ? 173 PHE D CD2 1 
ATOM   4962 C  CE1 . PHE D 2 91  ? -2.075  24.614  10.339  1.00 44.32  ? 173 PHE D CE1 1 
ATOM   4963 C  CE2 . PHE D 2 91  ? -3.302  22.650  10.980  1.00 43.17  ? 173 PHE D CE2 1 
ATOM   4964 C  CZ  . PHE D 2 91  ? -2.706  23.848  11.319  1.00 44.74  ? 173 PHE D CZ  1 
ATOM   4965 N  N   . GLN D 2 92  ? -4.567  22.744  4.228   1.00 52.60  ? 174 GLN D N   1 
ATOM   4966 C  CA  . GLN D 2 92  ? -4.556  22.170  2.890   1.00 54.36  ? 174 GLN D CA  1 
ATOM   4967 C  C   . GLN D 2 92  ? -4.413  23.218  1.798   1.00 55.80  ? 174 GLN D C   1 
ATOM   4968 O  O   . GLN D 2 92  ? -3.987  22.887  0.690   1.00 61.13  ? 174 GLN D O   1 
ATOM   4969 C  CB  . GLN D 2 92  ? -5.812  21.307  2.684   1.00 54.82  ? 174 GLN D CB  1 
ATOM   4970 C  CG  . GLN D 2 92  ? -5.618  19.883  3.244   1.00 56.42  ? 174 GLN D CG  1 
ATOM   4971 C  CD  . GLN D 2 92  ? -6.876  19.012  3.269   1.00 56.55  ? 174 GLN D CD  1 
ATOM   4972 O  OE1 . GLN D 2 92  ? -7.880  19.316  2.640   1.00 57.60  ? 174 GLN D OE1 1 
ATOM   4973 N  NE2 . GLN D 2 92  ? -6.814  17.923  4.021   1.00 55.33  ? 174 GLN D NE2 1 
ATOM   4974 N  N   . LYS D 2 93  ? -4.720  24.468  2.090   1.00 49.79  ? 175 LYS D N   1 
ATOM   4975 C  CA  . LYS D 2 93  ? -4.569  25.583  1.182   1.00 49.35  ? 175 LYS D CA  1 
ATOM   4976 C  C   . LYS D 2 93  ? -3.866  26.691  1.968   1.00 52.88  ? 175 LYS D C   1 
ATOM   4977 O  O   . LYS D 2 93  ? -3.804  26.621  3.191   1.00 56.96  ? 175 LYS D O   1 
ATOM   4978 C  CB  . LYS D 2 93  ? -5.936  26.050  0.659   1.00 49.53  ? 175 LYS D CB  1 
ATOM   4979 C  CG  . LYS D 2 93  ? -6.553  25.053  -0.311  1.00 51.47  ? 175 LYS D CG  1 
ATOM   4980 C  CD  . LYS D 2 93  ? -8.051  25.186  -0.392  1.00 58.14  ? 175 LYS D CD  1 
ATOM   4981 N  N   . PRO D 2 94  ? -3.284  27.669  1.281   1.00 53.31  ? 176 PRO D N   1 
ATOM   4982 C  CA  . PRO D 2 94  ? -2.626  28.753  2.023   1.00 51.62  ? 176 PRO D CA  1 
ATOM   4983 C  C   . PRO D 2 94  ? -3.610  29.433  2.954   1.00 52.18  ? 176 PRO D C   1 
ATOM   4984 O  O   . PRO D 2 94  ? -4.826  29.390  2.762   1.00 54.03  ? 176 PRO D O   1 
ATOM   4985 C  CB  . PRO D 2 94  ? -2.156  29.713  0.921   1.00 54.06  ? 176 PRO D CB  1 
ATOM   4986 C  CG  . PRO D 2 94  ? -2.070  28.872  -0.307  1.00 55.30  ? 176 PRO D CG  1 
ATOM   4987 C  CD  . PRO D 2 94  ? -3.145  27.831  -0.175  1.00 54.17  ? 176 PRO D CD  1 
ATOM   4988 N  N   . VAL D 2 95  ? -3.068  30.034  4.002   1.00 50.72  ? 177 VAL D N   1 
ATOM   4989 C  CA  . VAL D 2 95  ? -3.861  30.918  4.842   1.00 51.84  ? 177 VAL D CA  1 
ATOM   4990 C  C   . VAL D 2 95  ? -4.390  32.012  3.929   1.00 58.77  ? 177 VAL D C   1 
ATOM   4991 O  O   . VAL D 2 95  ? -3.590  32.662  3.240   1.00 63.57  ? 177 VAL D O   1 
ATOM   4992 C  CB  . VAL D 2 95  ? -3.031  31.494  5.997   1.00 49.48  ? 177 VAL D CB  1 
ATOM   4993 C  CG1 . VAL D 2 95  ? -3.801  32.624  6.698   1.00 52.68  ? 177 VAL D CG1 1 
ATOM   4994 C  CG2 . VAL D 2 95  ? -2.648  30.379  6.961   1.00 43.31  ? 177 VAL D CG2 1 
ATOM   4995 N  N   . PRO D 2 96  ? -5.708  32.225  3.857   1.00 58.99  ? 178 PRO D N   1 
ATOM   4996 C  CA  . PRO D 2 96  ? -6.258  33.281  2.986   1.00 59.61  ? 178 PRO D CA  1 
ATOM   4997 C  C   . PRO D 2 96  ? -5.945  34.656  3.550   1.00 61.02  ? 178 PRO D C   1 
ATOM   4998 O  O   . PRO D 2 96  ? -6.326  34.972  4.678   1.00 63.93  ? 178 PRO D O   1 
ATOM   4999 C  CB  . PRO D 2 96  ? -7.766  33.006  3.002   1.00 53.78  ? 178 PRO D CB  1 
ATOM   5000 C  CG  . PRO D 2 96  ? -7.935  31.662  3.623   1.00 51.20  ? 178 PRO D CG  1 
ATOM   5001 C  CD  . PRO D 2 96  ? -6.772  31.450  4.518   1.00 58.58  ? 178 PRO D CD  1 
ATOM   5002 N  N   . LEU D 2 97  ? -5.267  35.487  2.758   1.00 64.07  ? 179 LEU D N   1 
ATOM   5003 C  CA  . LEU D 2 97  ? -4.986  36.842  3.222   1.00 66.29  ? 179 LEU D CA  1 
ATOM   5004 C  C   . LEU D 2 97  ? -6.251  37.664  3.409   1.00 69.74  ? 179 LEU D C   1 
ATOM   5005 O  O   . LEU D 2 97  ? -6.235  38.639  4.170   1.00 69.29  ? 179 LEU D O   1 
ATOM   5006 C  CB  . LEU D 2 97  ? -4.042  37.559  2.262   1.00 67.53  ? 179 LEU D CB  1 
ATOM   5007 C  CG  . LEU D 2 97  ? -2.591  37.086  2.335   1.00 66.20  ? 179 LEU D CG  1 
ATOM   5008 C  CD1 . LEU D 2 97  ? -1.690  38.057  1.566   1.00 68.16  ? 179 LEU D CD1 1 
ATOM   5009 C  CD2 . LEU D 2 97  ? -2.115  36.886  3.797   1.00 59.92  ? 179 LEU D CD2 1 
ATOM   5010 N  N   . GLU D 2 98  ? -7.344  37.300  2.735   1.00 75.71  ? 180 GLU D N   1 
ATOM   5011 C  CA  . GLU D 2 98  ? -8.603  38.001  2.963   1.00 83.00  ? 180 GLU D CA  1 
ATOM   5012 C  C   . GLU D 2 98  ? -9.062  37.828  4.412   1.00 85.66  ? 180 GLU D C   1 
ATOM   5013 O  O   . GLU D 2 98  ? -9.257  38.812  5.135   1.00 89.31  ? 180 GLU D O   1 
ATOM   5014 C  CB  . GLU D 2 98  ? -9.663  37.513  1.970   1.00 82.91  ? 180 GLU D CB  1 
ATOM   5015 N  N   . GLN D 2 99  ? -9.191  36.581  4.869   1.00 84.03  ? 181 GLN D N   1 
ATOM   5016 C  CA  . GLN D 2 99  ? -9.654  36.301  6.226   1.00 82.92  ? 181 GLN D CA  1 
ATOM   5017 C  C   . GLN D 2 99  ? -8.606  36.582  7.307   1.00 80.95  ? 181 GLN D C   1 
ATOM   5018 O  O   . GLN D 2 99  ? -8.954  36.555  8.492   1.00 83.32  ? 181 GLN D O   1 
ATOM   5019 C  CB  . GLN D 2 99  ? -10.123 34.844  6.326   1.00 82.36  ? 181 GLN D CB  1 
ATOM   5020 N  N   . HIS D 2 100 ? -7.344  36.828  6.957   1.00 76.30  ? 182 HIS D N   1 
ATOM   5021 C  CA  . HIS D 2 100 ? -6.345  37.265  7.936   1.00 72.16  ? 182 HIS D CA  1 
ATOM   5022 C  C   . HIS D 2 100 ? -5.359  38.195  7.241   1.00 70.69  ? 182 HIS D C   1 
ATOM   5023 O  O   . HIS D 2 100 ? -4.344  37.751  6.687   1.00 66.62  ? 182 HIS D O   1 
ATOM   5024 C  CB  . HIS D 2 100 ? -5.609  36.093  8.588   1.00 69.15  ? 182 HIS D CB  1 
ATOM   5025 C  CG  . HIS D 2 100 ? -6.503  34.970  9.032   1.00 71.45  ? 182 HIS D CG  1 
ATOM   5026 N  ND1 . HIS D 2 100 ? -7.046  34.903  10.298  1.00 71.50  ? 182 HIS D ND1 1 
ATOM   5027 C  CD2 . HIS D 2 100 ? -6.941  33.865  8.375   1.00 70.05  ? 182 HIS D CD2 1 
ATOM   5028 C  CE1 . HIS D 2 100 ? -7.785  33.811  10.398  1.00 71.03  ? 182 HIS D CE1 1 
ATOM   5029 N  NE2 . HIS D 2 100 ? -7.740  33.165  9.246   1.00 68.65  ? 182 HIS D NE2 1 
ATOM   5030 N  N   . PRO D 2 101 ? -5.623  39.507  7.258   1.00 74.01  ? 183 PRO D N   1 
ATOM   5031 C  CA  . PRO D 2 101 ? -4.714  40.440  6.560   1.00 77.49  ? 183 PRO D CA  1 
ATOM   5032 C  C   . PRO D 2 101 ? -3.365  40.625  7.245   1.00 78.92  ? 183 PRO D C   1 
ATOM   5033 O  O   . PRO D 2 101 ? -2.332  40.727  6.566   1.00 79.55  ? 183 PRO D O   1 
ATOM   5034 C  CB  . PRO D 2 101 ? -5.522  41.742  6.524   1.00 80.13  ? 183 PRO D CB  1 
ATOM   5035 C  CG  . PRO D 2 101 ? -6.472  41.624  7.674   1.00 80.17  ? 183 PRO D CG  1 
ATOM   5036 C  CD  . PRO D 2 101 ? -6.828  40.176  7.773   1.00 76.44  ? 183 PRO D CD  1 
ATOM   5037 N  N   . ASP D 2 102 ? -3.335  40.666  8.576   1.00 79.39  ? 184 ASP D N   1 
ATOM   5038 C  CA  . ASP D 2 102 ? -2.072  40.808  9.292   1.00 77.25  ? 184 ASP D CA  1 
ATOM   5039 C  C   . ASP D 2 102 ? -1.159  39.595  9.153   1.00 75.01  ? 184 ASP D C   1 
ATOM   5040 O  O   . ASP D 2 102 ? -0.061  39.616  9.716   1.00 76.79  ? 184 ASP D O   1 
ATOM   5041 C  CB  . ASP D 2 102 ? -2.340  41.065  10.776  1.00 75.70  ? 184 ASP D CB  1 
ATOM   5042 C  CG  . ASP D 2 102 ? -3.033  39.893  11.446  1.00 73.36  ? 184 ASP D CG  1 
ATOM   5043 O  OD1 . ASP D 2 102 ? -3.515  39.002  10.719  1.00 70.68  ? 184 ASP D OD1 1 
ATOM   5044 O  OD2 . ASP D 2 102 ? -3.096  39.851  12.693  1.00 73.66  ? 184 ASP D OD2 1 
ATOM   5045 N  N   . TYR D 2 103 ? -1.576  38.543  8.445   1.00 70.80  ? 185 TYR D N   1 
ATOM   5046 C  CA  . TYR D 2 103 ? -0.780  37.317  8.408   1.00 64.85  ? 185 TYR D CA  1 
ATOM   5047 C  C   . TYR D 2 103 ? 0.625   37.573  7.870   1.00 65.05  ? 185 TYR D C   1 
ATOM   5048 O  O   . TYR D 2 103 ? 1.615   37.068  8.422   1.00 64.61  ? 185 TYR D O   1 
ATOM   5049 C  CB  . TYR D 2 103 ? -1.493  36.269  7.564   1.00 56.14  ? 185 TYR D CB  1 
ATOM   5050 C  CG  . TYR D 2 103 ? -0.965  34.866  7.695   1.00 48.15  ? 185 TYR D CG  1 
ATOM   5051 C  CD1 . TYR D 2 103 ? -1.179  34.124  8.852   1.00 47.16  ? 185 TYR D CD1 1 
ATOM   5052 C  CD2 . TYR D 2 103 ? -0.267  34.268  6.659   1.00 45.82  ? 185 TYR D CD2 1 
ATOM   5053 C  CE1 . TYR D 2 103 ? -0.705  32.820  8.972   1.00 43.41  ? 185 TYR D CE1 1 
ATOM   5054 C  CE2 . TYR D 2 103 ? 0.216   32.961  6.763   1.00 41.14  ? 185 TYR D CE2 1 
ATOM   5055 C  CZ  . TYR D 2 103 ? -0.009  32.235  7.920   1.00 42.60  ? 185 TYR D CZ  1 
ATOM   5056 O  OH  . TYR D 2 103 ? 0.457   30.924  8.035   1.00 37.91  ? 185 TYR D OH  1 
ATOM   5057 N  N   . ALA D 2 104 ? 0.731   38.370  6.803   1.00 63.03  ? 186 ALA D N   1 
ATOM   5058 C  CA  . ALA D 2 104 ? 2.032   38.693  6.226   1.00 60.37  ? 186 ALA D CA  1 
ATOM   5059 C  C   . ALA D 2 104 ? 2.947   39.364  7.246   1.00 58.05  ? 186 ALA D C   1 
ATOM   5060 O  O   . ALA D 2 104 ? 4.173   39.234  7.166   1.00 55.77  ? 186 ALA D O   1 
ATOM   5061 C  CB  . ALA D 2 104 ? 1.837   39.593  4.999   1.00 64.24  ? 186 ALA D CB  1 
ATOM   5062 N  N   . GLU D 2 105 ? 2.369   40.078  8.209   1.00 56.90  ? 187 GLU D N   1 
ATOM   5063 C  CA  . GLU D 2 105 ? 3.132   40.775  9.226   1.00 58.96  ? 187 GLU D CA  1 
ATOM   5064 C  C   . GLU D 2 105 ? 3.794   39.830  10.222  1.00 59.56  ? 187 GLU D C   1 
ATOM   5065 O  O   . GLU D 2 105 ? 4.676   40.261  10.969  1.00 60.12  ? 187 GLU D O   1 
ATOM   5066 C  CB  . GLU D 2 105 ? 2.204   41.741  9.943   1.00 64.87  ? 187 GLU D CB  1 
ATOM   5067 C  CG  . GLU D 2 105 ? 1.552   42.726  8.981   1.00 76.34  ? 187 GLU D CG  1 
ATOM   5068 C  CD  . GLU D 2 105 ? 0.733   43.806  9.681   1.00 87.40  ? 187 GLU D CD  1 
ATOM   5069 O  OE1 . GLU D 2 105 ? -0.141  44.409  9.017   1.00 93.38  ? 187 GLU D OE1 1 
ATOM   5070 O  OE2 . GLU D 2 105 ? 0.958   44.057  10.891  1.00 89.29  ? 187 GLU D OE2 1 
ATOM   5071 N  N   . TYR D 2 106 ? 3.414   38.562  10.240  1.00 58.95  ? 188 TYR D N   1 
ATOM   5072 C  CA  . TYR D 2 106 ? 3.970   37.596  11.180  1.00 58.85  ? 188 TYR D CA  1 
ATOM   5073 C  C   . TYR D 2 106 ? 4.714   36.476  10.494  1.00 55.53  ? 188 TYR D C   1 
ATOM   5074 O  O   . TYR D 2 106 ? 5.726   35.988  11.013  1.00 53.09  ? 188 TYR D O   1 
ATOM   5075 C  CB  . TYR D 2 106 ? 2.852   36.978  12.035  1.00 60.84  ? 188 TYR D CB  1 
ATOM   5076 C  CG  . TYR D 2 106 ? 2.236   37.962  12.973  1.00 64.99  ? 188 TYR D CG  1 
ATOM   5077 C  CD1 . TYR D 2 106 ? 2.702   38.082  14.271  1.00 67.51  ? 188 TYR D CD1 1 
ATOM   5078 C  CD2 . TYR D 2 106 ? 1.199   38.786  12.558  1.00 67.28  ? 188 TYR D CD2 1 
ATOM   5079 C  CE1 . TYR D 2 106 ? 2.148   38.985  15.137  1.00 73.18  ? 188 TYR D CE1 1 
ATOM   5080 C  CE2 . TYR D 2 106 ? 0.640   39.698  13.415  1.00 73.73  ? 188 TYR D CE2 1 
ATOM   5081 C  CZ  . TYR D 2 106 ? 1.118   39.797  14.707  1.00 77.69  ? 188 TYR D CZ  1 
ATOM   5082 O  OH  . TYR D 2 106 ? 0.569   40.707  15.580  1.00 83.75  ? 188 TYR D OH  1 
ATOM   5083 N  N   . ILE D 2 107 ? 4.212   36.051  9.346   1.00 54.68  ? 189 ILE D N   1 
ATOM   5084 C  CA  . ILE D 2 107 ? 4.703   34.884  8.646   1.00 50.76  ? 189 ILE D CA  1 
ATOM   5085 C  C   . ILE D 2 107 ? 5.500   35.374  7.455   1.00 51.32  ? 189 ILE D C   1 
ATOM   5086 O  O   . ILE D 2 107 ? 4.959   36.040  6.563   1.00 52.50  ? 189 ILE D O   1 
ATOM   5087 C  CB  . ILE D 2 107 ? 3.552   33.975  8.216   1.00 50.73  ? 189 ILE D CB  1 
ATOM   5088 C  CG1 . ILE D 2 107 ? 2.664   33.674  9.431   1.00 50.95  ? 189 ILE D CG1 1 
ATOM   5089 C  CG2 . ILE D 2 107 ? 4.108   32.730  7.564   1.00 47.26  ? 189 ILE D CG2 1 
ATOM   5090 C  CD1 . ILE D 2 107 ? 3.433   33.173  10.662  1.00 50.67  ? 189 ILE D CD1 1 
ATOM   5091 N  N   . PHE D 2 108 ? 6.787   35.064  7.464   1.00 49.06  ? 190 PHE D N   1 
ATOM   5092 C  CA  . PHE D 2 108 ? 7.699   35.403  6.389   1.00 49.37  ? 190 PHE D CA  1 
ATOM   5093 C  C   . PHE D 2 108 ? 7.682   34.384  5.258   1.00 48.78  ? 190 PHE D C   1 
ATOM   5094 O  O   . PHE D 2 108 ? 7.902   34.748  4.096   1.00 53.83  ? 190 PHE D O   1 
ATOM   5095 C  CB  . PHE D 2 108 ? 9.118   35.525  6.957   1.00 49.98  ? 190 PHE D CB  1 
ATOM   5096 C  CG  . PHE D 2 108 ? 10.115  36.032  5.972   1.00 51.38  ? 190 PHE D CG  1 
ATOM   5097 C  CD1 . PHE D 2 108 ? 10.788  35.150  5.130   1.00 51.53  ? 190 PHE D CD1 1 
ATOM   5098 C  CD2 . PHE D 2 108 ? 10.373  37.387  5.880   1.00 51.74  ? 190 PHE D CD2 1 
ATOM   5099 C  CE1 . PHE D 2 108 ? 11.699  35.610  4.214   1.00 55.82  ? 190 PHE D CE1 1 
ATOM   5100 C  CE2 . PHE D 2 108 ? 11.282  37.858  4.971   1.00 56.76  ? 190 PHE D CE2 1 
ATOM   5101 C  CZ  . PHE D 2 108 ? 11.948  36.974  4.125   1.00 58.15  ? 190 PHE D CZ  1 
ATOM   5102 N  N   . HIS D 2 109 ? 7.466   33.113  5.568   1.00 44.35  ? 191 HIS D N   1 
ATOM   5103 C  CA  . HIS D 2 109 ? 7.558   32.043  4.578   1.00 46.30  ? 191 HIS D CA  1 
ATOM   5104 C  C   . HIS D 2 109 ? 6.336   31.150  4.755   1.00 45.95  ? 191 HIS D C   1 
ATOM   5105 O  O   . HIS D 2 109 ? 6.371   30.153  5.491   1.00 44.96  ? 191 HIS D O   1 
ATOM   5106 C  CB  . HIS D 2 109 ? 8.869   31.266  4.723   1.00 46.72  ? 191 HIS D CB  1 
ATOM   5107 C  CG  . HIS D 2 109 ? 9.151   30.334  3.587   1.00 47.37  ? 191 HIS D CG  1 
ATOM   5108 N  ND1 . HIS D 2 109 ? 9.862   30.715  2.468   1.00 49.71  ? 191 HIS D ND1 1 
ATOM   5109 C  CD2 . HIS D 2 109 ? 8.810   29.038  3.389   1.00 45.77  ? 191 HIS D CD2 1 
ATOM   5110 C  CE1 . HIS D 2 109 ? 9.947   29.697  1.630   1.00 47.89  ? 191 HIS D CE1 1 
ATOM   5111 N  NE2 . HIS D 2 109 ? 9.313   28.668  2.162   1.00 45.93  ? 191 HIS D NE2 1 
ATOM   5112 N  N   . PRO D 2 110 ? 5.232   31.476  4.092   1.00 45.37  ? 192 PRO D N   1 
ATOM   5113 C  CA  . PRO D 2 110 ? 4.006   30.693  4.282   1.00 42.97  ? 192 PRO D CA  1 
ATOM   5114 C  C   . PRO D 2 110 ? 4.153   29.305  3.684   1.00 40.96  ? 192 PRO D C   1 
ATOM   5115 O  O   . PRO D 2 110 ? 4.942   29.084  2.764   1.00 42.00  ? 192 PRO D O   1 
ATOM   5116 C  CB  . PRO D 2 110 ? 2.938   31.515  3.545   1.00 39.47  ? 192 PRO D CB  1 
ATOM   5117 C  CG  . PRO D 2 110 ? 3.586   32.870  3.285   1.00 44.13  ? 192 PRO D CG  1 
ATOM   5118 C  CD  . PRO D 2 110 ? 5.047   32.589  3.146   1.00 45.12  ? 192 PRO D CD  1 
ATOM   5119 N  N   . MET D 2 111 ? 3.397   28.353  4.222   1.00 39.69  ? 193 MET D N   1 
ATOM   5120 C  CA  . MET D 2 111 ? 3.440   27.029  3.627   1.00 41.18  ? 193 MET D CA  1 
ATOM   5121 C  C   . MET D 2 111 ? 2.163   26.274  3.941   1.00 40.28  ? 193 MET D C   1 
ATOM   5122 O  O   . MET D 2 111 ? 1.595   26.406  5.028   1.00 38.36  ? 193 MET D O   1 
ATOM   5123 C  CB  . MET D 2 111 ? 4.647   26.229  4.122   1.00 45.31  ? 193 MET D CB  1 
ATOM   5124 C  CG  . MET D 2 111 ? 4.814   24.847  3.465   1.00 47.04  ? 193 MET D CG  1 
ATOM   5125 S  SD  . MET D 2 111 ? 5.255   25.018  1.733   1.00 53.44  ? 193 MET D SD  1 
ATOM   5126 C  CE  . MET D 2 111 ? 6.707   26.045  1.830   1.00 55.16  ? 193 MET D CE  1 
ATOM   5127 N  N   . ASP D 2 112 ? 1.740   25.461  2.990   1.00 43.31  ? 194 ASP D N   1 
ATOM   5128 C  CA  . ASP D 2 112 ? 0.570   24.627  3.178   1.00 47.87  ? 194 ASP D CA  1 
ATOM   5129 C  C   . ASP D 2 112 ? 0.763   23.334  2.397   1.00 50.06  ? 194 ASP D C   1 
ATOM   5130 O  O   . ASP D 2 112 ? 1.692   23.190  1.595   1.00 49.47  ? 194 ASP D O   1 
ATOM   5131 C  CB  . ASP D 2 112 ? -0.683  25.354  2.729   1.00 53.36  ? 194 ASP D CB  1 
ATOM   5132 C  CG  . ASP D 2 112 ? -0.641  25.672  1.260   1.00 59.85  ? 194 ASP D CG  1 
ATOM   5133 O  OD1 . ASP D 2 112 ? -0.023  26.694  0.884   1.00 61.63  ? 194 ASP D OD1 1 
ATOM   5134 O  OD2 . ASP D 2 112 ? -1.191  24.867  0.479   1.00 60.71  ? 194 ASP D OD2 1 
ATOM   5135 N  N   . LEU D 2 113 ? -0.134  22.384  2.641   1.00 49.95  ? 195 LEU D N   1 
ATOM   5136 C  CA  . LEU D 2 113 ? 0.004   21.083  2.004   1.00 49.72  ? 195 LEU D CA  1 
ATOM   5137 C  C   . LEU D 2 113 ? -0.098  21.179  0.484   1.00 51.87  ? 195 LEU D C   1 
ATOM   5138 O  O   . LEU D 2 113 ? 0.629   20.488  -0.244  1.00 55.90  ? 195 LEU D O   1 
ATOM   5139 C  CB  . LEU D 2 113 ? -1.048  20.135  2.553   1.00 48.42  ? 195 LEU D CB  1 
ATOM   5140 C  CG  . LEU D 2 113 ? -0.903  19.783  4.015   1.00 43.99  ? 195 LEU D CG  1 
ATOM   5141 C  CD1 . LEU D 2 113 ? -1.872  18.669  4.254   1.00 45.80  ? 195 LEU D CD1 1 
ATOM   5142 C  CD2 . LEU D 2 113 ? 0.514   19.328  4.291   1.00 40.46  ? 195 LEU D CD2 1 
ATOM   5143 N  N   . CYS D 2 114 ? -0.991  22.017  -0.026  1.00 54.66  ? 196 CYS D N   1 
ATOM   5144 C  CA  . CYS D 2 114 ? -1.081  22.146  -1.479  1.00 58.71  ? 196 CYS D CA  1 
ATOM   5145 C  C   . CYS D 2 114 ? 0.254   22.585  -2.071  1.00 56.78  ? 196 CYS D C   1 
ATOM   5146 O  O   . CYS D 2 114 ? 0.756   21.978  -3.024  1.00 60.59  ? 196 CYS D O   1 
ATOM   5147 C  CB  . CYS D 2 114 ? -2.189  23.125  -1.869  1.00 63.72  ? 196 CYS D CB  1 
ATOM   5148 S  SG  . CYS D 2 114 ? -2.436  23.180  -3.650  1.00 71.14  ? 196 CYS D SG  1 
ATOM   5149 N  N   . THR D 2 115 ? 0.858   23.619  -1.491  1.00 50.74  ? 197 THR D N   1 
ATOM   5150 C  CA  . THR D 2 115 ? 2.139   24.101  -1.986  1.00 50.02  ? 197 THR D CA  1 
ATOM   5151 C  C   . THR D 2 115 ? 3.215   23.021  -1.914  1.00 47.71  ? 197 THR D C   1 
ATOM   5152 O  O   . THR D 2 115 ? 3.975   22.833  -2.868  1.00 45.83  ? 197 THR D O   1 
ATOM   5153 C  CB  . THR D 2 115 ? 2.548   25.340  -1.200  1.00 47.80  ? 197 THR D CB  1 
ATOM   5154 O  OG1 . THR D 2 115 ? 1.615   26.388  -1.492  1.00 51.01  ? 197 THR D OG1 1 
ATOM   5155 C  CG2 . THR D 2 115 ? 3.937   25.786  -1.606  1.00 43.76  ? 197 THR D CG2 1 
ATOM   5156 N  N   . LEU D 2 116 ? 3.292   22.296  -0.797  1.00 46.23  ? 198 LEU D N   1 
ATOM   5157 C  CA  . LEU D 2 116 ? 4.180   21.138  -0.724  1.00 47.08  ? 198 LEU D CA  1 
ATOM   5158 C  C   . LEU D 2 116 ? 3.989   20.209  -1.916  1.00 47.82  ? 198 LEU D C   1 
ATOM   5159 O  O   . LEU D 2 116 ? 4.964   19.753  -2.535  1.00 48.63  ? 198 LEU D O   1 
ATOM   5160 C  CB  . LEU D 2 116 ? 3.926   20.366  0.562   1.00 47.43  ? 198 LEU D CB  1 
ATOM   5161 C  CG  . LEU D 2 116 ? 4.551   20.898  1.831   1.00 47.58  ? 198 LEU D CG  1 
ATOM   5162 C  CD1 . LEU D 2 116 ? 4.182   19.931  2.959   1.00 48.25  ? 198 LEU D CD1 1 
ATOM   5163 C  CD2 . LEU D 2 116 ? 6.057   21.009  1.655   1.00 43.48  ? 198 LEU D CD2 1 
ATOM   5164 N  N   . GLU D 2 117 ? 2.729   19.919  -2.253  1.00 47.06  ? 199 GLU D N   1 
ATOM   5165 C  CA  . GLU D 2 117 ? 2.464   19.006  -3.360  1.00 49.85  ? 199 GLU D CA  1 
ATOM   5166 C  C   . GLU D 2 117 ? 2.969   19.573  -4.680  1.00 51.89  ? 199 GLU D C   1 
ATOM   5167 O  O   . GLU D 2 117 ? 3.608   18.862  -5.470  1.00 54.14  ? 199 GLU D O   1 
ATOM   5168 C  CB  . GLU D 2 117 ? 0.975   18.693  -3.433  1.00 56.07  ? 199 GLU D CB  1 
ATOM   5169 C  CG  . GLU D 2 117 ? 0.609   17.872  -4.640  1.00 67.22  ? 199 GLU D CG  1 
ATOM   5170 C  CD  . GLU D 2 117 ? -0.601  16.982  -4.410  1.00 75.88  ? 199 GLU D CD  1 
ATOM   5171 O  OE1 . GLU D 2 117 ? -0.825  16.068  -5.243  1.00 79.99  ? 199 GLU D OE1 1 
ATOM   5172 O  OE2 . GLU D 2 117 ? -1.317  17.190  -3.398  1.00 78.01  ? 199 GLU D OE2 1 
ATOM   5173 N  N   . LYS D 2 118 ? 2.702   20.863  -4.935  1.00 51.17  ? 200 LYS D N   1 
ATOM   5174 C  CA  . LYS D 2 118 ? 3.140   21.456  -6.195  1.00 51.00  ? 200 LYS D CA  1 
ATOM   5175 C  C   . LYS D 2 118 ? 4.657   21.536  -6.258  1.00 49.54  ? 200 LYS D C   1 
ATOM   5176 O  O   . LYS D 2 118 ? 5.253   21.305  -7.313  1.00 52.57  ? 200 LYS D O   1 
ATOM   5177 C  CB  . LYS D 2 118 ? 2.521   22.840  -6.388  1.00 53.78  ? 200 LYS D CB  1 
ATOM   5178 C  CG  . LYS D 2 118 ? 1.001   22.854  -6.461  1.00 57.84  ? 200 LYS D CG  1 
ATOM   5179 C  CD  . LYS D 2 118 ? 0.465   24.234  -6.863  1.00 64.65  ? 200 LYS D CD  1 
ATOM   5180 C  CE  . LYS D 2 118 ? 1.208   25.361  -6.123  1.00 69.78  ? 200 LYS D CE  1 
ATOM   5181 N  NZ  . LYS D 2 118 ? 0.571   26.716  -6.263  1.00 75.08  ? 200 LYS D NZ  1 
ATOM   5182 N  N   . ASN D 2 119 ? 5.305   21.839  -5.139  1.00 46.10  ? 201 ASN D N   1 
ATOM   5183 C  CA  . ASN D 2 119 ? 6.762   21.810  -5.120  1.00 50.23  ? 201 ASN D CA  1 
ATOM   5184 C  C   . ASN D 2 119 ? 7.273   20.430  -5.502  1.00 50.08  ? 201 ASN D C   1 
ATOM   5185 O  O   . ASN D 2 119 ? 8.203   20.301  -6.309  1.00 49.74  ? 201 ASN D O   1 
ATOM   5186 C  CB  . ASN D 2 119 ? 7.290   22.212  -3.740  1.00 46.64  ? 201 ASN D CB  1 
ATOM   5187 C  CG  . ASN D 2 119 ? 7.079   23.677  -3.440  1.00 42.21  ? 201 ASN D CG  1 
ATOM   5188 O  OD1 . ASN D 2 119 ? 6.754   24.465  -4.336  1.00 42.68  ? 201 ASN D OD1 1 
ATOM   5189 N  ND2 . ASN D 2 119 ? 7.247   24.053  -2.175  1.00 38.12  ? 201 ASN D ND2 1 
ATOM   5190 N  N   . ALA D 2 120 ? 6.659   19.383  -4.936  1.00 45.90  ? 202 ALA D N   1 
ATOM   5191 C  CA  . ALA D 2 120 ? 7.053   18.017  -5.261  1.00 43.91  ? 202 ALA D CA  1 
ATOM   5192 C  C   . ALA D 2 120 ? 6.910   17.731  -6.754  1.00 48.60  ? 202 ALA D C   1 
ATOM   5193 O  O   . ALA D 2 120 ? 7.826   17.174  -7.372  1.00 47.76  ? 202 ALA D O   1 
ATOM   5194 C  CB  . ALA D 2 120 ? 6.225   17.026  -4.448  1.00 41.86  ? 202 ALA D CB  1 
ATOM   5195 N  N   . LYS D 2 121 ? 5.760   18.089  -7.355  1.00 48.65  ? 203 LYS D N   1 
ATOM   5196 C  CA  . LYS D 2 121 ? 5.604   17.850  -8.787  1.00 50.37  ? 203 LYS D CA  1 
ATOM   5197 C  C   . LYS D 2 121 ? 6.653   18.615  -9.574  1.00 53.55  ? 203 LYS D C   1 
ATOM   5198 O  O   . LYS D 2 121 ? 7.205   18.096  -10.546 1.00 58.51  ? 203 LYS D O   1 
ATOM   5199 C  CB  . LYS D 2 121 ? 4.193   18.220  -9.267  1.00 43.35  ? 203 LYS D CB  1 
ATOM   5200 N  N   . LYS D 2 122 ? 6.970   19.841  -9.146  1.00 54.30  ? 204 LYS D N   1 
ATOM   5201 C  CA  . LYS D 2 122 ? 7.993   20.659  -9.793  1.00 59.13  ? 204 LYS D CA  1 
ATOM   5202 C  C   . LYS D 2 122 ? 9.409   20.154  -9.540  1.00 55.68  ? 204 LYS D C   1 
ATOM   5203 O  O   . LYS D 2 122 ? 10.363  20.766  -10.036 1.00 55.05  ? 204 LYS D O   1 
ATOM   5204 C  CB  . LYS D 2 122 ? 7.856   22.115  -9.337  1.00 65.80  ? 204 LYS D CB  1 
ATOM   5205 C  CG  . LYS D 2 122 ? 6.498   22.741  -9.701  1.00 70.51  ? 204 LYS D CG  1 
ATOM   5206 C  CD  . LYS D 2 122 ? 6.570   24.256  -9.872  1.00 75.92  ? 204 LYS D CD  1 
ATOM   5207 C  CE  . LYS D 2 122 ? 6.925   24.966  -8.559  1.00 77.62  ? 204 LYS D CE  1 
ATOM   5208 N  NZ  . LYS D 2 122 ? 7.043   26.458  -8.725  1.00 81.19  ? 204 LYS D NZ  1 
ATOM   5209 N  N   . LYS D 2 123 ? 9.547   19.062  -8.786  1.00 52.62  ? 205 LYS D N   1 
ATOM   5210 C  CA  . LYS D 2 123 ? 10.814  18.380  -8.539  1.00 51.97  ? 205 LYS D CA  1 
ATOM   5211 C  C   . LYS D 2 123 ? 11.757  19.230  -7.692  1.00 52.35  ? 205 LYS D C   1 
ATOM   5212 O  O   . LYS D 2 123 ? 12.972  19.170  -7.852  1.00 56.09  ? 205 LYS D O   1 
ATOM   5213 C  CB  . LYS D 2 123 ? 11.486  17.951  -9.847  1.00 53.93  ? 205 LYS D CB  1 
ATOM   5214 C  CG  . LYS D 2 123 ? 10.666  16.943  -10.648 1.00 55.72  ? 205 LYS D CG  1 
ATOM   5215 C  CD  . LYS D 2 123 ? 11.278  16.631  -12.014 1.00 57.47  ? 205 LYS D CD  1 
ATOM   5216 C  CE  . LYS D 2 123 ? 10.709  17.533  -13.096 1.00 63.84  ? 205 LYS D CE  1 
ATOM   5217 N  NZ  . LYS D 2 123 ? 11.201  17.191  -14.483 1.00 69.06  ? 205 LYS D NZ  1 
ATOM   5218 N  N   . MET D 2 124 ? 11.209  19.984  -6.747  1.00 52.55  ? 206 MET D N   1 
ATOM   5219 C  CA  . MET D 2 124 ? 12.046  20.862  -5.935  1.00 57.03  ? 206 MET D CA  1 
ATOM   5220 C  C   . MET D 2 124 ? 12.737  20.160  -4.763  1.00 55.08  ? 206 MET D C   1 
ATOM   5221 O  O   . MET D 2 124 ? 13.655  20.731  -4.178  1.00 56.65  ? 206 MET D O   1 
ATOM   5222 C  CB  . MET D 2 124 ? 11.215  22.033  -5.410  1.00 63.77  ? 206 MET D CB  1 
ATOM   5223 C  CG  . MET D 2 124 ? 11.023  23.148  -6.421  1.00 75.49  ? 206 MET D CG  1 
ATOM   5224 S  SD  . MET D 2 124 ? 9.523   24.138  -6.177  1.00 85.04  ? 206 MET D SD  1 
ATOM   5225 C  CE  . MET D 2 124 ? 10.046  25.332  -4.947  1.00 84.83  ? 206 MET D CE  1 
ATOM   5226 N  N   . TYR D 2 125 ? 12.341  18.953  -4.391  1.00 50.62  ? 207 TYR D N   1 
ATOM   5227 C  CA  . TYR D 2 125 ? 12.955  18.262  -3.269  1.00 46.05  ? 207 TYR D CA  1 
ATOM   5228 C  C   . TYR D 2 125 ? 13.922  17.218  -3.802  1.00 48.14  ? 207 TYR D C   1 
ATOM   5229 O  O   . TYR D 2 125 ? 13.520  16.324  -4.552  1.00 53.22  ? 207 TYR D O   1 
ATOM   5230 C  CB  . TYR D 2 125 ? 11.877  17.641  -2.382  1.00 44.49  ? 207 TYR D CB  1 
ATOM   5231 C  CG  . TYR D 2 125 ? 10.892  18.694  -1.940  1.00 48.75  ? 207 TYR D CG  1 
ATOM   5232 C  CD1 . TYR D 2 125 ? 11.312  19.752  -1.143  1.00 49.06  ? 207 TYR D CD1 1 
ATOM   5233 C  CD2 . TYR D 2 125 ? 9.564   18.678  -2.360  1.00 53.28  ? 207 TYR D CD2 1 
ATOM   5234 C  CE1 . TYR D 2 125 ? 10.444  20.749  -0.738  1.00 49.37  ? 207 TYR D CE1 1 
ATOM   5235 C  CE2 . TYR D 2 125 ? 8.676   19.691  -1.962  1.00 54.34  ? 207 TYR D CE2 1 
ATOM   5236 C  CZ  . TYR D 2 125 ? 9.135   20.722  -1.148  1.00 51.31  ? 207 TYR D CZ  1 
ATOM   5237 O  OH  . TYR D 2 125 ? 8.312   21.739  -0.727  1.00 49.40  ? 207 TYR D OH  1 
ATOM   5238 N  N   . GLY D 2 126 ? 15.190  17.331  -3.416  1.00 45.75  ? 208 GLY D N   1 
ATOM   5239 C  CA  . GLY D 2 126 ? 16.206  16.383  -3.827  1.00 45.54  ? 208 GLY D CA  1 
ATOM   5240 C  C   . GLY D 2 126 ? 16.510  15.273  -2.855  1.00 48.92  ? 208 GLY D C   1 
ATOM   5241 O  O   . GLY D 2 126 ? 17.317  14.398  -3.170  1.00 55.36  ? 208 GLY D O   1 
ATOM   5242 N  N   . CYS D 2 127 ? 15.886  15.266  -1.682  1.00 46.26  ? 209 CYS D N   1 
ATOM   5243 C  CA  . CYS D 2 127 ? 16.073  14.195  -0.710  1.00 48.32  ? 209 CYS D CA  1 
ATOM   5244 C  C   . CYS D 2 127 ? 14.913  14.269  0.279   1.00 48.81  ? 209 CYS D C   1 
ATOM   5245 O  O   . CYS D 2 127 ? 14.101  15.194  0.233   1.00 49.97  ? 209 CYS D O   1 
ATOM   5246 C  CB  . CYS D 2 127 ? 17.420  14.328  -0.009  1.00 52.05  ? 209 CYS D CB  1 
ATOM   5247 S  SG  . CYS D 2 127 ? 17.501  15.846  0.979   1.00 55.86  ? 209 CYS D SG  1 
ATOM   5248 N  N   . THR D 2 128 ? 14.837  13.304  1.195   1.00 45.43  ? 210 THR D N   1 
ATOM   5249 C  CA  . THR D 2 128 ? 13.703  13.361  2.113   1.00 40.18  ? 210 THR D CA  1 
ATOM   5250 C  C   . THR D 2 128 ? 13.891  14.429  3.179   1.00 35.64  ? 210 THR D C   1 
ATOM   5251 O  O   . THR D 2 128 ? 12.905  15.022  3.635   1.00 35.05  ? 210 THR D O   1 
ATOM   5252 C  CB  . THR D 2 128 ? 13.434  11.992  2.761   1.00 40.78  ? 210 THR D CB  1 
ATOM   5253 O  OG1 . THR D 2 128 ? 14.586  11.530  3.479   1.00 44.60  ? 210 THR D OG1 1 
ATOM   5254 C  CG2 . THR D 2 128 ? 13.067  10.975  1.700   1.00 40.70  ? 210 THR D CG2 1 
ATOM   5255 N  N   . GLU D 2 129 ? 15.132  14.693  3.577   1.00 35.71  ? 211 GLU D N   1 
ATOM   5256 C  CA  . GLU D 2 129 ? 15.373  15.714  4.590   1.00 39.77  ? 211 GLU D CA  1 
ATOM   5257 C  C   . GLU D 2 129 ? 14.750  17.031  4.170   1.00 42.66  ? 211 GLU D C   1 
ATOM   5258 O  O   . GLU D 2 129 ? 14.017  17.660  4.944   1.00 40.67  ? 211 GLU D O   1 
ATOM   5259 C  CB  . GLU D 2 129 ? 16.876  15.893  4.831   1.00 41.55  ? 211 GLU D CB  1 
ATOM   5260 C  CG  . GLU D 2 129 ? 17.526  14.759  5.633   1.00 43.99  ? 211 GLU D CG  1 
ATOM   5261 C  CD  . GLU D 2 129 ? 17.943  13.539  4.781   1.00 49.62  ? 211 GLU D CD  1 
ATOM   5262 O  OE1 . GLU D 2 129 ? 17.474  13.373  3.604   1.00 49.71  ? 211 GLU D OE1 1 
ATOM   5263 O  OE2 . GLU D 2 129 ? 18.754  12.743  5.319   1.00 49.81  ? 211 GLU D OE2 1 
ATOM   5264 N  N   . ALA D 2 130 ? 15.010  17.439  2.921   1.00 44.46  ? 212 ALA D N   1 
ATOM   5265 C  CA  . ALA D 2 130 ? 14.555  18.740  2.433   1.00 44.68  ? 212 ALA D CA  1 
ATOM   5266 C  C   . ALA D 2 130 ? 13.036  18.835  2.444   1.00 42.45  ? 212 ALA D C   1 
ATOM   5267 O  O   . ALA D 2 130 ? 12.465  19.898  2.718   1.00 39.51  ? 212 ALA D O   1 
ATOM   5268 C  CB  . ALA D 2 130 ? 15.090  18.974  1.028   1.00 42.00  ? 212 ALA D CB  1 
ATOM   5269 N  N   . PHE D 2 131 ? 12.366  17.724  2.166   1.00 40.55  ? 213 PHE D N   1 
ATOM   5270 C  CA  . PHE D 2 131 ? 10.919  17.740  2.193   1.00 40.76  ? 213 PHE D CA  1 
ATOM   5271 C  C   . PHE D 2 131 ? 10.403  17.948  3.609   1.00 38.85  ? 213 PHE D C   1 
ATOM   5272 O  O   . PHE D 2 131 ? 9.562   18.822  3.851   1.00 40.98  ? 213 PHE D O   1 
ATOM   5273 C  CB  . PHE D 2 131 ? 10.372  16.451  1.593   1.00 44.31  ? 213 PHE D CB  1 
ATOM   5274 C  CG  . PHE D 2 131 ? 8.885   16.446  1.496   1.00 44.04  ? 213 PHE D CG  1 
ATOM   5275 C  CD1 . PHE D 2 131 ? 8.240   17.254  0.561   1.00 42.00  ? 213 PHE D CD1 1 
ATOM   5276 C  CD2 . PHE D 2 131 ? 8.133   15.703  2.383   1.00 42.33  ? 213 PHE D CD2 1 
ATOM   5277 C  CE1 . PHE D 2 131 ? 6.858   17.278  0.477   1.00 42.75  ? 213 PHE D CE1 1 
ATOM   5278 C  CE2 . PHE D 2 131 ? 6.762   15.720  2.318   1.00 44.44  ? 213 PHE D CE2 1 
ATOM   5279 C  CZ  . PHE D 2 131 ? 6.109   16.508  1.350   1.00 44.45  ? 213 PHE D CZ  1 
ATOM   5280 N  N   . LEU D 2 132 ? 10.893  17.154  4.561   1.00 39.26  ? 214 LEU D N   1 
ATOM   5281 C  CA  . LEU D 2 132 ? 10.516  17.382  5.956   1.00 38.68  ? 214 LEU D CA  1 
ATOM   5282 C  C   . LEU D 2 132 ? 10.806  18.822  6.389   1.00 39.25  ? 214 LEU D C   1 
ATOM   5283 O  O   . LEU D 2 132 ? 9.979   19.468  7.053   1.00 37.27  ? 214 LEU D O   1 
ATOM   5284 C  CB  . LEU D 2 132 ? 11.260  16.400  6.858   1.00 33.90  ? 214 LEU D CB  1 
ATOM   5285 C  CG  . LEU D 2 132 ? 10.888  16.493  8.337   1.00 33.10  ? 214 LEU D CG  1 
ATOM   5286 C  CD1 . LEU D 2 132 ? 9.373   16.480  8.513   1.00 34.88  ? 214 LEU D CD1 1 
ATOM   5287 C  CD2 . LEU D 2 132 ? 11.530  15.334  9.089   1.00 26.76  ? 214 LEU D CD2 1 
ATOM   5288 N  N   . ALA D 2 133 ? 11.977  19.341  6.001   1.00 36.08  ? 215 ALA D N   1 
ATOM   5289 C  CA  . ALA D 2 133 ? 12.375  20.680  6.400   1.00 34.52  ? 215 ALA D CA  1 
ATOM   5290 C  C   . ALA D 2 133 ? 11.383  21.713  5.895   1.00 37.71  ? 215 ALA D C   1 
ATOM   5291 O  O   . ALA D 2 133 ? 11.058  22.674  6.607   1.00 42.19  ? 215 ALA D O   1 
ATOM   5292 C  CB  . ALA D 2 133 ? 13.782  20.982  5.890   1.00 34.35  ? 215 ALA D CB  1 
ATOM   5293 N  N   . ASP D 2 134 ? 10.869  21.522  4.679   1.00 34.33  ? 216 ASP D N   1 
ATOM   5294 C  CA  . ASP D 2 134 ? 9.880   22.460  4.167   1.00 39.07  ? 216 ASP D CA  1 
ATOM   5295 C  C   . ASP D 2 134 ? 8.554   22.329  4.893   1.00 40.83  ? 216 ASP D C   1 
ATOM   5296 O  O   . ASP D 2 134 ? 7.948   23.338  5.283   1.00 45.30  ? 216 ASP D O   1 
ATOM   5297 C  CB  . ASP D 2 134 ? 9.672   22.273  2.677   1.00 44.27  ? 216 ASP D CB  1 
ATOM   5298 C  CG  . ASP D 2 134 ? 10.324  23.333  1.901   1.00 55.83  ? 216 ASP D CG  1 
ATOM   5299 O  OD1 . ASP D 2 134 ? 9.810   23.621  0.797   1.00 60.41  ? 216 ASP D OD1 1 
ATOM   5300 O  OD2 . ASP D 2 134 ? 11.334  23.884  2.412   1.00 60.19  ? 216 ASP D OD2 1 
ATOM   5301 N  N   . ALA D 2 135 ? 8.067   21.096  5.050   1.00 36.55  ? 217 ALA D N   1 
ATOM   5302 C  CA  . ALA D 2 135 ? 6.786   20.903  5.710   1.00 34.94  ? 217 ALA D CA  1 
ATOM   5303 C  C   . ALA D 2 135 ? 6.781   21.533  7.096   1.00 39.15  ? 217 ALA D C   1 
ATOM   5304 O  O   . ALA D 2 135 ? 5.749   22.057  7.535   1.00 44.49  ? 217 ALA D O   1 
ATOM   5305 C  CB  . ALA D 2 135 ? 6.474   19.419  5.799   1.00 35.43  ? 217 ALA D CB  1 
ATOM   5306 N  N   . LYS D 2 136 ? 7.931   21.536  7.785   1.00 37.45  ? 218 LYS D N   1 
ATOM   5307 C  CA  . LYS D 2 136 ? 7.966   22.095  9.135   1.00 37.72  ? 218 LYS D CA  1 
ATOM   5308 C  C   . LYS D 2 136 ? 7.630   23.588  9.166   1.00 36.87  ? 218 LYS D C   1 
ATOM   5309 O  O   . LYS D 2 136 ? 7.251   24.100  10.227  1.00 38.43  ? 218 LYS D O   1 
ATOM   5310 C  CB  . LYS D 2 136 ? 9.331   21.850  9.783   1.00 37.09  ? 218 LYS D CB  1 
ATOM   5311 C  CG  . LYS D 2 136 ? 9.554   20.414  10.250  1.00 36.49  ? 218 LYS D CG  1 
ATOM   5312 C  CD  . LYS D 2 136 ? 10.995  20.210  10.710  1.00 41.05  ? 218 LYS D CD  1 
ATOM   5313 C  CE  . LYS D 2 136 ? 11.150  18.881  11.461  1.00 48.23  ? 218 LYS D CE  1 
ATOM   5314 N  NZ  . LYS D 2 136 ? 12.556  18.650  11.914  1.00 52.39  ? 218 LYS D NZ  1 
ATOM   5315 N  N   . TRP D 2 137 ? 7.735   24.295  8.039   1.00 33.92  ? 219 TRP D N   1 
ATOM   5316 C  CA  . TRP D 2 137 ? 7.272   25.675  8.018   1.00 34.24  ? 219 TRP D CA  1 
ATOM   5317 C  C   . TRP D 2 137 ? 5.814   25.753  8.431   1.00 39.48  ? 219 TRP D C   1 
ATOM   5318 O  O   . TRP D 2 137 ? 5.396   26.725  9.067   1.00 40.03  ? 219 TRP D O   1 
ATOM   5319 C  CB  . TRP D 2 137 ? 7.440   26.282  6.636   1.00 37.06  ? 219 TRP D CB  1 
ATOM   5320 C  CG  . TRP D 2 137 ? 8.795   26.810  6.322   1.00 39.60  ? 219 TRP D CG  1 
ATOM   5321 C  CD1 . TRP D 2 137 ? 9.690   26.279  5.438   1.00 38.12  ? 219 TRP D CD1 1 
ATOM   5322 C  CD2 . TRP D 2 137 ? 9.400   27.999  6.843   1.00 41.38  ? 219 TRP D CD2 1 
ATOM   5323 N  NE1 . TRP D 2 137 ? 10.825  27.047  5.397   1.00 40.23  ? 219 TRP D NE1 1 
ATOM   5324 C  CE2 . TRP D 2 137 ? 10.678  28.111  6.246   1.00 42.27  ? 219 TRP D CE2 1 
ATOM   5325 C  CE3 . TRP D 2 137 ? 8.996   28.974  7.758   1.00 39.86  ? 219 TRP D CE3 1 
ATOM   5326 C  CZ2 . TRP D 2 137 ? 11.564  29.152  6.551   1.00 41.84  ? 219 TRP D CZ2 1 
ATOM   5327 C  CZ3 . TRP D 2 137 ? 9.875   30.017  8.051   1.00 40.83  ? 219 TRP D CZ3 1 
ATOM   5328 C  CH2 . TRP D 2 137 ? 11.143  30.093  7.451   1.00 41.26  ? 219 TRP D CH2 1 
ATOM   5329 N  N   . ILE D 2 138 ? 5.018   24.742  8.064   1.00 40.81  ? 220 ILE D N   1 
ATOM   5330 C  CA  . ILE D 2 138 ? 3.608   24.738  8.446   1.00 38.26  ? 220 ILE D CA  1 
ATOM   5331 C  C   . ILE D 2 138 ? 3.468   24.842  9.959   1.00 38.26  ? 220 ILE D C   1 
ATOM   5332 O  O   . ILE D 2 138 ? 2.659   25.618  10.480  1.00 43.80  ? 220 ILE D O   1 
ATOM   5333 C  CB  . ILE D 2 138 ? 2.908   23.482  7.897   1.00 34.97  ? 220 ILE D CB  1 
ATOM   5334 C  CG1 . ILE D 2 138 ? 2.814   23.554  6.372   1.00 35.44  ? 220 ILE D CG1 1 
ATOM   5335 C  CG2 . ILE D 2 138 ? 1.502   23.315  8.479   1.00 28.62  ? 220 ILE D CG2 1 
ATOM   5336 C  CD1 . ILE D 2 138 ? 2.251   22.303  5.802   1.00 33.10  ? 220 ILE D CD1 1 
ATOM   5337 N  N   . LEU D 2 139 ? 4.264   24.071  10.689  1.00 38.38  ? 221 LEU D N   1 
ATOM   5338 C  CA  . LEU D 2 139 ? 4.122   24.050  12.142  1.00 37.02  ? 221 LEU D CA  1 
ATOM   5339 C  C   . LEU D 2 139 ? 4.718   25.307  12.778  1.00 41.92  ? 221 LEU D C   1 
ATOM   5340 O  O   . LEU D 2 139 ? 4.115   25.895  13.689  1.00 44.42  ? 221 LEU D O   1 
ATOM   5341 C  CB  . LEU D 2 139 ? 4.767   22.778  12.695  1.00 28.88  ? 221 LEU D CB  1 
ATOM   5342 C  CG  . LEU D 2 139 ? 4.938   22.661  14.213  1.00 30.67  ? 221 LEU D CG  1 
ATOM   5343 C  CD1 . LEU D 2 139 ? 3.627   22.872  14.986  1.00 31.68  ? 221 LEU D CD1 1 
ATOM   5344 C  CD2 . LEU D 2 139 ? 5.541   21.310  14.542  1.00 27.10  ? 221 LEU D CD2 1 
ATOM   5345 N  N   . HIS D 2 140 ? 5.906   25.712  12.315  1.00 38.43  ? 222 HIS D N   1 
ATOM   5346 C  CA  . HIS D 2 140 ? 6.508   26.991  12.688  1.00 36.89  ? 222 HIS D CA  1 
ATOM   5347 C  C   . HIS D 2 140 ? 5.486   28.118  12.585  1.00 38.37  ? 222 HIS D C   1 
ATOM   5348 O  O   . HIS D 2 140 ? 5.202   28.836  13.561  1.00 39.77  ? 222 HIS D O   1 
ATOM   5349 C  CB  . HIS D 2 140 ? 7.701   27.224  11.756  1.00 35.18  ? 222 HIS D CB  1 
ATOM   5350 C  CG  . HIS D 2 140 ? 8.523   28.432  12.049  1.00 39.60  ? 222 HIS D CG  1 
ATOM   5351 N  ND1 . HIS D 2 140 ? 9.114   28.656  13.272  1.00 41.40  ? 222 HIS D ND1 1 
ATOM   5352 C  CD2 . HIS D 2 140 ? 8.933   29.443  11.239  1.00 41.27  ? 222 HIS D CD2 1 
ATOM   5353 C  CE1 . HIS D 2 140 ? 9.823   29.775  13.212  1.00 43.29  ? 222 HIS D CE1 1 
ATOM   5354 N  NE2 . HIS D 2 140 ? 9.734   30.267  11.989  1.00 40.12  ? 222 HIS D NE2 1 
ATOM   5355 N  N   . ASN D 2 141 ? 4.889   28.251  11.402  1.00 33.06  ? 223 ASN D N   1 
ATOM   5356 C  CA  . ASN D 2 141 ? 3.996   29.364  11.156  1.00 36.74  ? 223 ASN D CA  1 
ATOM   5357 C  C   . ASN D 2 141 ? 2.744   29.253  12.003  1.00 39.02  ? 223 ASN D C   1 
ATOM   5358 O  O   . ASN D 2 141 ? 2.238   30.269  12.500  1.00 44.19  ? 223 ASN D O   1 
ATOM   5359 C  CB  . ASN D 2 141 ? 3.673   29.437  9.669   1.00 39.64  ? 223 ASN D CB  1 
ATOM   5360 C  CG  . ASN D 2 141 ? 4.912   29.692  8.839   1.00 39.91  ? 223 ASN D CG  1 
ATOM   5361 O  OD1 . ASN D 2 141 ? 5.947   30.098  9.379   1.00 43.82  ? 223 ASN D OD1 1 
ATOM   5362 N  ND2 . ASN D 2 141 ? 4.828   29.448  7.534   1.00 34.40  ? 223 ASN D ND2 1 
ATOM   5363 N  N   . CYS D 2 142 ? 2.251   28.027  12.218  1.00 32.69  ? 224 CYS D N   1 
ATOM   5364 C  CA  . CYS D 2 142 ? 1.066   27.885  13.049  1.00 32.75  ? 224 CYS D CA  1 
ATOM   5365 C  C   . CYS D 2 142 ? 1.364   28.304  14.481  1.00 38.75  ? 224 CYS D C   1 
ATOM   5366 O  O   . CYS D 2 142 ? 0.574   29.035  15.097  1.00 39.85  ? 224 CYS D O   1 
ATOM   5367 C  CB  . CYS D 2 142 ? 0.545   26.459  12.995  1.00 37.68  ? 224 CYS D CB  1 
ATOM   5368 S  SG  . CYS D 2 142 ? -1.087  26.277  13.767  1.00 44.68  ? 224 CYS D SG  1 
ATOM   5369 N  N   . ILE D 2 143 ? 2.520   27.891  15.017  1.00 35.19  ? 225 ILE D N   1 
ATOM   5370 C  CA  . ILE D 2 143 ? 2.872   28.301  16.375  1.00 42.53  ? 225 ILE D CA  1 
ATOM   5371 C  C   . ILE D 2 143 ? 2.991   29.819  16.455  1.00 41.77  ? 225 ILE D C   1 
ATOM   5372 O  O   . ILE D 2 143 ? 2.474   30.443  17.392  1.00 39.07  ? 225 ILE D O   1 
ATOM   5373 C  CB  . ILE D 2 143 ? 4.171   27.620  16.855  1.00 46.32  ? 225 ILE D CB  1 
ATOM   5374 C  CG1 . ILE D 2 143 ? 3.948   26.137  17.198  1.00 40.03  ? 225 ILE D CG1 1 
ATOM   5375 C  CG2 . ILE D 2 143 ? 4.750   28.404  18.061  1.00 34.60  ? 225 ILE D CG2 1 
ATOM   5376 C  CD1 . ILE D 2 143 ? 5.206   25.306  17.039  1.00 31.05  ? 225 ILE D CD1 1 
ATOM   5377 N  N   . ILE D 2 144 ? 3.686   30.438  15.485  1.00 39.86  ? 226 ILE D N   1 
ATOM   5378 C  CA  . ILE D 2 144 ? 3.869   31.884  15.556  1.00 40.44  ? 226 ILE D CA  1 
ATOM   5379 C  C   . ILE D 2 144 ? 2.516   32.583  15.534  1.00 44.48  ? 226 ILE D C   1 
ATOM   5380 O  O   . ILE D 2 144 ? 2.209   33.414  16.392  1.00 47.29  ? 226 ILE D O   1 
ATOM   5381 C  CB  . ILE D 2 144 ? 4.761   32.395  14.417  1.00 40.45  ? 226 ILE D CB  1 
ATOM   5382 C  CG1 . ILE D 2 144 ? 6.222   32.033  14.641  1.00 38.99  ? 226 ILE D CG1 1 
ATOM   5383 C  CG2 . ILE D 2 144 ? 4.597   33.898  14.290  1.00 39.68  ? 226 ILE D CG2 1 
ATOM   5384 C  CD1 . ILE D 2 144 ? 7.032   31.918  13.314  1.00 36.87  ? 226 ILE D CD1 1 
ATOM   5385 N  N   . TYR D 2 145 ? 1.673   32.234  14.572  1.00 44.31  ? 227 TYR D N   1 
ATOM   5386 C  CA  . TYR D 2 145 ? 0.479   33.035  14.360  1.00 44.28  ? 227 TYR D CA  1 
ATOM   5387 C  C   . TYR D 2 145 ? -0.652  32.702  15.326  1.00 42.43  ? 227 TYR D C   1 
ATOM   5388 O  O   . TYR D 2 145 ? -1.446  33.580  15.644  1.00 42.92  ? 227 TYR D O   1 
ATOM   5389 C  CB  . TYR D 2 145 ? 0.001   32.866  12.925  1.00 48.73  ? 227 TYR D CB  1 
ATOM   5390 C  CG  . TYR D 2 145 ? -1.087  33.830  12.559  1.00 54.78  ? 227 TYR D CG  1 
ATOM   5391 C  CD1 . TYR D 2 145 ? -0.790  35.146  12.208  1.00 55.03  ? 227 TYR D CD1 1 
ATOM   5392 C  CD2 . TYR D 2 145 ? -2.416  33.433  12.577  1.00 57.19  ? 227 TYR D CD2 1 
ATOM   5393 C  CE1 . TYR D 2 145 ? -1.781  36.031  11.875  1.00 58.75  ? 227 TYR D CE1 1 
ATOM   5394 C  CE2 . TYR D 2 145 ? -3.418  34.315  12.245  1.00 61.49  ? 227 TYR D CE2 1 
ATOM   5395 C  CZ  . TYR D 2 145 ? -3.094  35.610  11.898  1.00 64.25  ? 227 TYR D CZ  1 
ATOM   5396 O  OH  . TYR D 2 145 ? -4.107  36.475  11.566  1.00 73.09  ? 227 TYR D OH  1 
ATOM   5397 N  N   . ASN D 2 146 ? -0.778  31.459  15.774  1.00 44.01  ? 228 ASN D N   1 
ATOM   5398 C  CA  . ASN D 2 146 ? -1.921  31.055  16.585  1.00 48.22  ? 228 ASN D CA  1 
ATOM   5399 C  C   . ASN D 2 146 ? -1.554  30.753  18.029  1.00 53.07  ? 228 ASN D C   1 
ATOM   5400 O  O   . ASN D 2 146 ? -2.452  30.647  18.870  1.00 55.95  ? 228 ASN D O   1 
ATOM   5401 C  CB  . ASN D 2 146 ? -2.623  29.816  15.984  1.00 46.99  ? 228 ASN D CB  1 
ATOM   5402 C  CG  . ASN D 2 146 ? -3.116  30.034  14.542  1.00 46.53  ? 228 ASN D CG  1 
ATOM   5403 O  OD1 . ASN D 2 146 ? -3.976  30.883  14.283  1.00 48.93  ? 228 ASN D OD1 1 
ATOM   5404 N  ND2 . ASN D 2 146 ? -2.577  29.250  13.603  1.00 41.93  ? 228 ASN D ND2 1 
ATOM   5405 N  N   . GLY D 2 147 ? -0.276  30.628  18.347  1.00 54.27  ? 229 GLY D N   1 
ATOM   5406 C  CA  . GLY D 2 147 ? 0.111   30.259  19.688  1.00 53.74  ? 229 GLY D CA  1 
ATOM   5407 C  C   . GLY D 2 147 ? 0.476   28.789  19.789  1.00 54.10  ? 229 GLY D C   1 
ATOM   5408 O  O   . GLY D 2 147 ? 0.074   27.953  18.973  1.00 50.55  ? 229 GLY D O   1 
ATOM   5409 N  N   . GLY D 2 148 ? 1.253   28.472  20.826  1.00 56.70  ? 230 GLY D N   1 
ATOM   5410 C  CA  . GLY D 2 148 ? 1.788   27.130  20.967  1.00 56.17  ? 230 GLY D CA  1 
ATOM   5411 C  C   . GLY D 2 148 ? 0.764   26.075  21.324  1.00 54.68  ? 230 GLY D C   1 
ATOM   5412 O  O   . GLY D 2 148 ? 1.003   24.892  21.072  1.00 52.30  ? 230 GLY D O   1 
ATOM   5413 N  N   . ASN D 2 149 ? -0.373  26.464  21.899  1.00 61.70  ? 231 ASN D N   1 
ATOM   5414 C  CA  . ASN D 2 149 ? -1.362  25.470  22.293  1.00 64.76  ? 231 ASN D CA  1 
ATOM   5415 C  C   . ASN D 2 149 ? -2.691  25.635  21.571  1.00 64.30  ? 231 ASN D C   1 
ATOM   5416 O  O   . ASN D 2 149 ? -3.700  25.096  22.019  1.00 66.27  ? 231 ASN D O   1 
ATOM   5417 C  CB  . ASN D 2 149 ? -1.589  25.489  23.802  1.00 74.66  ? 231 ASN D CB  1 
ATOM   5418 C  CG  . ASN D 2 149 ? -2.154  24.179  24.302  1.00 80.99  ? 231 ASN D CG  1 
ATOM   5419 O  OD1 . ASN D 2 149 ? -1.923  23.127  23.692  1.00 80.11  ? 231 ASN D OD1 1 
ATOM   5420 N  ND2 . ASN D 2 149 ? -2.910  24.228  25.401  1.00 84.58  ? 231 ASN D ND2 1 
ATOM   5421 N  N   . HIS D 2 150 ? -2.718  26.354  20.462  1.00 57.90  ? 232 HIS D N   1 
ATOM   5422 C  CA  . HIS D 2 150 ? -3.934  26.426  19.664  1.00 56.05  ? 232 HIS D CA  1 
ATOM   5423 C  C   . HIS D 2 150 ? -4.318  25.051  19.107  1.00 52.77  ? 232 HIS D C   1 
ATOM   5424 O  O   . HIS D 2 150 ? -3.458  24.225  18.777  1.00 50.99  ? 232 HIS D O   1 
ATOM   5425 C  CB  . HIS D 2 150 ? -3.722  27.409  18.528  1.00 56.04  ? 232 HIS D CB  1 
ATOM   5426 C  CG  . HIS D 2 150 ? -4.980  28.001  17.999  1.00 57.70  ? 232 HIS D CG  1 
ATOM   5427 N  ND1 . HIS D 2 150 ? -5.753  27.372  17.047  1.00 57.61  ? 232 HIS D ND1 1 
ATOM   5428 C  CD2 . HIS D 2 150 ? -5.591  29.175  18.272  1.00 59.03  ? 232 HIS D CD2 1 
ATOM   5429 C  CE1 . HIS D 2 150 ? -6.790  28.134  16.761  1.00 59.32  ? 232 HIS D CE1 1 
ATOM   5430 N  NE2 . HIS D 2 150 ? -6.715  29.234  17.491  1.00 60.93  ? 232 HIS D NE2 1 
ATOM   5431 N  N   . LYS D 2 151 ? -5.631  24.807  19.008  1.00 50.57  ? 233 LYS D N   1 
ATOM   5432 C  CA  . LYS D 2 151 ? -6.128  23.568  18.401  1.00 51.55  ? 233 LYS D CA  1 
ATOM   5433 C  C   . LYS D 2 151 ? -5.495  23.316  17.028  1.00 49.01  ? 233 LYS D C   1 
ATOM   5434 O  O   . LYS D 2 151 ? -5.137  22.172  16.684  1.00 47.44  ? 233 LYS D O   1 
ATOM   5435 C  CB  . LYS D 2 151 ? -7.654  23.630  18.269  1.00 55.26  ? 233 LYS D CB  1 
ATOM   5436 C  CG  . LYS D 2 151 ? -8.421  23.091  19.458  1.00 61.32  ? 233 LYS D CG  1 
ATOM   5437 C  CD  . LYS D 2 151 ? -9.902  22.888  19.124  1.00 66.59  ? 233 LYS D CD  1 
ATOM   5438 C  CE  . LYS D 2 151 ? -10.639 22.073  20.200  1.00 72.32  ? 233 LYS D CE  1 
ATOM   5439 N  NZ  . LYS D 2 151 ? -10.758 20.623  19.843  1.00 76.76  ? 233 LYS D NZ  1 
ATOM   5440 N  N   . LEU D 2 152 ? -5.358  24.381  16.230  1.00 48.17  ? 234 LEU D N   1 
ATOM   5441 C  CA  . LEU D 2 152 ? -4.690  24.279  14.939  1.00 45.84  ? 234 LEU D CA  1 
ATOM   5442 C  C   . LEU D 2 152 ? -3.245  23.825  15.094  1.00 46.96  ? 234 LEU D C   1 
ATOM   5443 O  O   . LEU D 2 152 ? -2.767  22.984  14.322  1.00 48.07  ? 234 LEU D O   1 
ATOM   5444 C  CB  . LEU D 2 152 ? -4.742  25.620  14.223  1.00 43.96  ? 234 LEU D CB  1 
ATOM   5445 C  CG  . LEU D 2 152 ? -6.140  26.082  13.826  1.00 43.74  ? 234 LEU D CG  1 
ATOM   5446 C  CD1 . LEU D 2 152 ? -6.089  27.514  13.338  1.00 40.42  ? 234 LEU D CD1 1 
ATOM   5447 C  CD2 . LEU D 2 152 ? -6.712  25.163  12.763  1.00 39.84  ? 234 LEU D CD2 1 
ATOM   5448 N  N   . THR D 2 153 ? -2.532  24.374  16.079  1.00 46.03  ? 235 THR D N   1 
ATOM   5449 C  CA  . THR D 2 153 ? -1.149  23.969  16.296  1.00 44.17  ? 235 THR D CA  1 
ATOM   5450 C  C   . THR D 2 153 ? -1.056  22.472  16.575  1.00 42.60  ? 235 THR D C   1 
ATOM   5451 O  O   . THR D 2 153 ? -0.149  21.793  16.080  1.00 43.33  ? 235 THR D O   1 
ATOM   5452 C  CB  . THR D 2 153 ? -0.552  24.781  17.444  1.00 47.42  ? 235 THR D CB  1 
ATOM   5453 O  OG1 . THR D 2 153 ? -0.654  26.170  17.134  1.00 50.50  ? 235 THR D OG1 1 
ATOM   5454 C  CG2 . THR D 2 153 ? 0.904   24.433  17.655  1.00 46.53  ? 235 THR D CG2 1 
ATOM   5455 N  N   . GLN D 2 154 ? -2.004  21.939  17.345  1.00 39.98  ? 236 GLN D N   1 
ATOM   5456 C  CA  . GLN D 2 154 ? -2.025  20.512  17.638  1.00 37.83  ? 236 GLN D CA  1 
ATOM   5457 C  C   . GLN D 2 154 ? -2.241  19.682  16.373  1.00 38.01  ? 236 GLN D C   1 
ATOM   5458 O  O   . GLN D 2 154 ? -1.595  18.628  16.187  1.00 38.79  ? 236 GLN D O   1 
ATOM   5459 C  CB  . GLN D 2 154 ? -3.099  20.239  18.682  1.00 40.64  ? 236 GLN D CB  1 
ATOM   5460 C  CG  . GLN D 2 154 ? -2.792  20.903  20.017  1.00 51.55  ? 236 GLN D CG  1 
ATOM   5461 C  CD  . GLN D 2 154 ? -3.972  20.846  20.971  1.00 65.56  ? 236 GLN D CD  1 
ATOM   5462 O  OE1 . GLN D 2 154 ? -4.469  21.878  21.440  1.00 70.19  ? 236 GLN D OE1 1 
ATOM   5463 N  NE2 . GLN D 2 154 ? -4.432  19.630  21.268  1.00 69.62  ? 236 GLN D NE2 1 
ATOM   5464 N  N   . ILE D 2 155 ? -3.121  20.148  15.471  1.00 35.19  ? 237 ILE D N   1 
ATOM   5465 C  CA  . ILE D 2 155 ? -3.223  19.452  14.191  1.00 35.44  ? 237 ILE D CA  1 
ATOM   5466 C  C   . ILE D 2 155 ? -1.893  19.520  13.435  1.00 36.93  ? 237 ILE D C   1 
ATOM   5467 O  O   . ILE D 2 155 ? -1.435  18.520  12.860  1.00 39.35  ? 237 ILE D O   1 
ATOM   5468 C  CB  . ILE D 2 155 ? -4.387  19.999  13.346  1.00 38.57  ? 237 ILE D CB  1 
ATOM   5469 C  CG1 . ILE D 2 155 ? -5.708  19.781  14.069  1.00 38.54  ? 237 ILE D CG1 1 
ATOM   5470 C  CG2 . ILE D 2 155 ? -4.441  19.267  12.017  1.00 30.72  ? 237 ILE D CG2 1 
ATOM   5471 C  CD1 . ILE D 2 155 ? -6.071  18.300  14.245  1.00 39.38  ? 237 ILE D CD1 1 
ATOM   5472 N  N   . ALA D 2 156 ? -1.245  20.690  13.440  1.00 32.85  ? 238 ALA D N   1 
ATOM   5473 C  CA  . ALA D 2 156 ? 0.008   20.845  12.710  1.00 34.65  ? 238 ALA D CA  1 
ATOM   5474 C  C   . ALA D 2 156 ? 1.077   19.907  13.245  1.00 37.33  ? 238 ALA D C   1 
ATOM   5475 O  O   . ALA D 2 156 ? 1.902   19.381  12.471  1.00 37.94  ? 238 ALA D O   1 
ATOM   5476 C  CB  . ALA D 2 156 ? 0.491   22.289  12.787  1.00 36.50  ? 238 ALA D CB  1 
ATOM   5477 N  N   . LYS D 2 157 ? 1.081   19.684  14.566  1.00 35.03  ? 239 LYS D N   1 
ATOM   5478 C  CA  . LYS D 2 157 ? 2.026   18.733  15.145  1.00 35.08  ? 239 LYS D CA  1 
ATOM   5479 C  C   . LYS D 2 157 ? 1.771   17.336  14.609  1.00 38.91  ? 239 LYS D C   1 
ATOM   5480 O  O   . LYS D 2 157 ? 2.717   16.596  14.287  1.00 41.24  ? 239 LYS D O   1 
ATOM   5481 C  CB  . LYS D 2 157 ? 1.945   18.747  16.667  1.00 30.65  ? 239 LYS D CB  1 
ATOM   5482 C  CG  . LYS D 2 157 ? 2.460   20.012  17.285  1.00 35.00  ? 239 LYS D CG  1 
ATOM   5483 C  CD  . LYS D 2 157 ? 2.596   19.875  18.788  1.00 41.91  ? 239 LYS D CD  1 
ATOM   5484 C  CE  . LYS D 2 157 ? 1.895   21.024  19.529  1.00 50.08  ? 239 LYS D CE  1 
ATOM   5485 N  NZ  . LYS D 2 157 ? 1.951   20.877  21.028  1.00 52.55  ? 239 LYS D NZ  1 
ATOM   5486 N  N   . VAL D 2 158 ? 0.494   16.965  14.480  1.00 38.62  ? 240 VAL D N   1 
ATOM   5487 C  CA  . VAL D 2 158 ? 0.195   15.651  13.928  1.00 33.96  ? 240 VAL D CA  1 
ATOM   5488 C  C   . VAL D 2 158 ? 0.710   15.556  12.501  1.00 35.06  ? 240 VAL D C   1 
ATOM   5489 O  O   . VAL D 2 158 ? 1.377   14.585  12.129  1.00 36.34  ? 240 VAL D O   1 
ATOM   5490 C  CB  . VAL D 2 158 ? -1.310  15.366  14.023  1.00 34.98  ? 240 VAL D CB  1 
ATOM   5491 C  CG1 . VAL D 2 158 ? -1.671  14.090  13.259  1.00 35.12  ? 240 VAL D CG1 1 
ATOM   5492 C  CG2 . VAL D 2 158 ? -1.697  15.233  15.487  1.00 37.60  ? 240 VAL D CG2 1 
ATOM   5493 N  N   . VAL D 2 159 ? 0.430   16.577  11.690  1.00 34.32  ? 241 VAL D N   1 
ATOM   5494 C  CA  . VAL D 2 159 ? 0.826   16.543  10.285  1.00 39.03  ? 241 VAL D CA  1 
ATOM   5495 C  C   . VAL D 2 159 ? 2.334   16.351  10.145  1.00 44.24  ? 241 VAL D C   1 
ATOM   5496 O  O   . VAL D 2 159 ? 2.801   15.587  9.283   1.00 46.88  ? 241 VAL D O   1 
ATOM   5497 C  CB  . VAL D 2 159 ? 0.361   17.821  9.559   1.00 34.99  ? 241 VAL D CB  1 
ATOM   5498 C  CG1 . VAL D 2 159 ? 1.012   17.898  8.187   1.00 28.20  ? 241 VAL D CG1 1 
ATOM   5499 C  CG2 . VAL D 2 159 ? -1.140  17.829  9.409   1.00 34.99  ? 241 VAL D CG2 1 
ATOM   5500 N  N   . ILE D 2 160 ? 3.121   17.045  10.976  1.00 42.50  ? 242 ILE D N   1 
ATOM   5501 C  CA  . ILE D 2 160 ? 4.569   16.937  10.821  1.00 38.54  ? 242 ILE D CA  1 
ATOM   5502 C  C   . ILE D 2 160 ? 5.046   15.584  11.312  1.00 37.38  ? 242 ILE D C   1 
ATOM   5503 O  O   . ILE D 2 160 ? 5.935   14.972  10.709  1.00 40.94  ? 242 ILE D O   1 
ATOM   5504 C  CB  . ILE D 2 160 ? 5.311   18.095  11.518  1.00 37.25  ? 242 ILE D CB  1 
ATOM   5505 C  CG1 . ILE D 2 160 ? 5.484   19.276  10.565  1.00 39.62  ? 242 ILE D CG1 1 
ATOM   5506 C  CG2 . ILE D 2 160 ? 6.690   17.658  11.997  1.00 31.16  ? 242 ILE D CG2 1 
ATOM   5507 C  CD1 . ILE D 2 160 ? 4.259   19.622  9.816   1.00 41.19  ? 242 ILE D CD1 1 
ATOM   5508 N  N   . LYS D 2 161 ? 4.441   15.066  12.379  1.00 35.07  ? 243 LYS D N   1 
ATOM   5509 C  CA  . LYS D 2 161 ? 4.812   13.722  12.807  1.00 32.63  ? 243 LYS D CA  1 
ATOM   5510 C  C   . LYS D 2 161 ? 4.514   12.687  11.710  1.00 32.76  ? 243 LYS D C   1 
ATOM   5511 O  O   . LYS D 2 161 ? 5.349   11.810  11.427  1.00 36.66  ? 243 LYS D O   1 
ATOM   5512 C  CB  . LYS D 2 161 ? 4.108   13.384  14.119  1.00 34.79  ? 243 LYS D CB  1 
ATOM   5513 C  CG  . LYS D 2 161 ? 5.047   13.008  15.265  1.00 41.40  ? 243 LYS D CG  1 
ATOM   5514 C  CD  . LYS D 2 161 ? 4.799   13.861  16.533  1.00 44.54  ? 243 LYS D CD  1 
ATOM   5515 N  N   . ILE D 2 162 ? 3.353   12.783  11.048  1.00 28.38  ? 244 ILE D N   1 
ATOM   5516 C  CA  . ILE D 2 162 ? 3.097   11.859  9.945   1.00 32.93  ? 244 ILE D CA  1 
ATOM   5517 C  C   . ILE D 2 162 ? 4.160   12.012  8.867   1.00 36.86  ? 244 ILE D C   1 
ATOM   5518 O  O   . ILE D 2 162 ? 4.647   11.021  8.299   1.00 36.76  ? 244 ILE D O   1 
ATOM   5519 C  CB  . ILE D 2 162 ? 1.697   12.066  9.355   1.00 31.09  ? 244 ILE D CB  1 
ATOM   5520 C  CG1 . ILE D 2 162 ? 0.618   11.694  10.366  1.00 28.80  ? 244 ILE D CG1 1 
ATOM   5521 C  CG2 . ILE D 2 162 ? 1.551   11.266  8.032   1.00 25.98  ? 244 ILE D CG2 1 
ATOM   5522 C  CD1 . ILE D 2 162 ? -0.757  12.136  9.893   1.00 29.31  ? 244 ILE D CD1 1 
ATOM   5523 N  N   . CYS D 2 163 ? 4.538   13.256  8.569   1.00 35.22  ? 245 CYS D N   1 
ATOM   5524 C  CA  . CYS D 2 163 ? 5.559   13.475  7.556   1.00 32.37  ? 245 CYS D CA  1 
ATOM   5525 C  C   . CYS D 2 163 ? 6.880   12.808  7.940   1.00 34.54  ? 245 CYS D C   1 
ATOM   5526 O  O   . CYS D 2 163 ? 7.545   12.192  7.096   1.00 31.30  ? 245 CYS D O   1 
ATOM   5527 C  CB  . CYS D 2 163 ? 5.735   14.967  7.331   1.00 34.17  ? 245 CYS D CB  1 
ATOM   5528 S  SG  . CYS D 2 163 ? 6.983   15.324  6.108   1.00 42.66  ? 245 CYS D SG  1 
ATOM   5529 N  N   . GLU D 2 164 ? 7.278   12.905  9.214   1.00 39.44  ? 246 GLU D N   1 
ATOM   5530 C  CA  . GLU D 2 164 ? 8.491   12.210  9.638   1.00 42.41  ? 246 GLU D CA  1 
ATOM   5531 C  C   . GLU D 2 164 ? 8.357   10.708  9.423   1.00 41.31  ? 246 GLU D C   1 
ATOM   5532 O  O   . GLU D 2 164 ? 9.293   10.046  8.952   1.00 39.86  ? 246 GLU D O   1 
ATOM   5533 C  CB  . GLU D 2 164 ? 8.794   12.508  11.103  1.00 48.63  ? 246 GLU D CB  1 
ATOM   5534 C  CG  . GLU D 2 164 ? 9.290   13.904  11.374  1.00 57.48  ? 246 GLU D CG  1 
ATOM   5535 C  CD  . GLU D 2 164 ? 9.256   14.245  12.851  1.00 65.19  ? 246 GLU D CD  1 
ATOM   5536 O  OE1 . GLU D 2 164 ? 8.977   13.319  13.644  1.00 69.83  ? 246 GLU D OE1 1 
ATOM   5537 O  OE2 . GLU D 2 164 ? 9.495   15.424  13.220  1.00 66.49  ? 246 GLU D OE2 1 
ATOM   5538 N  N   . HIS D 2 165 ? 7.185   10.158  9.749   1.00 42.29  ? 247 HIS D N   1 
ATOM   5539 C  CA  . HIS D 2 165 ? 6.977   8.725   9.592   1.00 39.30  ? 247 HIS D CA  1 
ATOM   5540 C  C   . HIS D 2 165 ? 7.099   8.286   8.128   1.00 42.47  ? 247 HIS D C   1 
ATOM   5541 O  O   . HIS D 2 165 ? 7.722   7.252   7.830   1.00 43.80  ? 247 HIS D O   1 
ATOM   5542 C  CB  . HIS D 2 165 ? 5.619   8.358   10.160  1.00 35.36  ? 247 HIS D CB  1 
ATOM   5543 C  CG  . HIS D 2 165 ? 5.295   6.910   10.026  1.00 42.12  ? 247 HIS D CG  1 
ATOM   5544 N  ND1 . HIS D 2 165 ? 4.838   6.356   8.849   1.00 44.74  ? 247 HIS D ND1 1 
ATOM   5545 C  CD2 . HIS D 2 165 ? 5.360   5.895   10.920  1.00 44.80  ? 247 HIS D CD2 1 
ATOM   5546 C  CE1 . HIS D 2 165 ? 4.632   5.063   9.024   1.00 46.19  ? 247 HIS D CE1 1 
ATOM   5547 N  NE2 . HIS D 2 165 ? 4.937   4.761   10.274  1.00 45.57  ? 247 HIS D NE2 1 
ATOM   5548 N  N   . GLU D 2 166 ? 6.516   9.060   7.197   1.00 39.65  ? 248 GLU D N   1 
ATOM   5549 C  CA  . GLU D 2 166 ? 6.629   8.705   5.789   1.00 40.84  ? 248 GLU D CA  1 
ATOM   5550 C  C   . GLU D 2 166 ? 8.065   8.852   5.291   1.00 41.62  ? 248 GLU D C   1 
ATOM   5551 O  O   . GLU D 2 166 ? 8.572   7.964   4.581   1.00 41.63  ? 248 GLU D O   1 
ATOM   5552 C  CB  . GLU D 2 166 ? 5.673   9.547   4.942   1.00 42.14  ? 248 GLU D CB  1 
ATOM   5553 C  CG  . GLU D 2 166 ? 4.197   9.414   5.330   1.00 43.01  ? 248 GLU D CG  1 
ATOM   5554 C  CD  . GLU D 2 166 ? 3.693   7.993   5.400   1.00 47.69  ? 248 GLU D CD  1 
ATOM   5555 O  OE1 . GLU D 2 166 ? 3.304   7.560   6.497   1.00 50.62  ? 248 GLU D OE1 1 
ATOM   5556 O  OE2 . GLU D 2 166 ? 3.663   7.297   4.369   1.00 52.17  ? 248 GLU D OE2 1 
ATOM   5557 N  N   . MET D 2 167 ? 8.743   9.956   5.650   1.00 39.20  ? 249 MET D N   1 
ATOM   5558 C  CA  . MET D 2 167 ? 10.142  10.097  5.254   1.00 37.29  ? 249 MET D CA  1 
ATOM   5559 C  C   . MET D 2 167 ? 10.946  8.898   5.725   1.00 41.34  ? 249 MET D C   1 
ATOM   5560 O  O   . MET D 2 167 ? 11.766  8.346   4.973   1.00 44.98  ? 249 MET D O   1 
ATOM   5561 C  CB  . MET D 2 167 ? 10.749  11.388  5.802   1.00 36.54  ? 249 MET D CB  1 
ATOM   5562 C  CG  . MET D 2 167 ? 10.188  12.676  5.223   1.00 38.55  ? 249 MET D CG  1 
ATOM   5563 S  SD  . MET D 2 167 ? 9.844   12.605  3.456   1.00 45.65  ? 249 MET D SD  1 
ATOM   5564 C  CE  . MET D 2 167 ? 8.052   12.537  3.422   1.00 38.95  ? 249 MET D CE  1 
ATOM   5565 N  N   . ASN D 2 168 ? 10.680  8.440   6.950   1.00 42.54  ? 250 ASN D N   1 
ATOM   5566 C  CA  . ASN D 2 168 ? 11.404  7.281   7.464   1.00 43.91  ? 250 ASN D CA  1 
ATOM   5567 C  C   . ASN D 2 168 ? 11.110  6.024   6.651   1.00 42.07  ? 250 ASN D C   1 
ATOM   5568 O  O   . ASN D 2 168 ? 12.037  5.267   6.320   1.00 43.62  ? 250 ASN D O   1 
ATOM   5569 C  CB  . ASN D 2 168 ? 11.079  7.048   8.934   1.00 49.16  ? 250 ASN D CB  1 
ATOM   5570 C  CG  . ASN D 2 168 ? 12.131  6.197   9.607   1.00 61.63  ? 250 ASN D CG  1 
ATOM   5571 O  OD1 . ASN D 2 168 ? 13.291  6.221   9.200   1.00 67.54  ? 250 ASN D OD1 1 
ATOM   5572 N  ND2 . ASN D 2 168 ? 11.736  5.411   10.610  1.00 64.95  ? 250 ASN D ND2 1 
ATOM   5573 N  N   . GLU D 2 169 ? 9.833   5.789   6.309   1.00 39.07  ? 251 GLU D N   1 
ATOM   5574 C  CA  . GLU D 2 169 ? 9.492   4.601   5.521   1.00 41.70  ? 251 GLU D CA  1 
ATOM   5575 C  C   . GLU D 2 169 ? 10.188  4.618   4.167   1.00 44.50  ? 251 GLU D C   1 
ATOM   5576 O  O   . GLU D 2 169 ? 10.724  3.594   3.719   1.00 48.29  ? 251 GLU D O   1 
ATOM   5577 C  CB  . GLU D 2 169 ? 7.977   4.475   5.327   1.00 42.85  ? 251 GLU D CB  1 
ATOM   5578 C  CG  . GLU D 2 169 ? 7.200   4.140   6.580   1.00 52.35  ? 251 GLU D CG  1 
ATOM   5579 C  CD  . GLU D 2 169 ? 7.649   2.836   7.212   1.00 65.00  ? 251 GLU D CD  1 
ATOM   5580 O  OE1 . GLU D 2 169 ? 8.258   2.010   6.498   1.00 69.48  ? 251 GLU D OE1 1 
ATOM   5581 O  OE2 . GLU D 2 169 ? 7.400   2.634   8.425   1.00 68.21  ? 251 GLU D OE2 1 
ATOM   5582 N  N   . ILE D 2 170 ? 10.180  5.774   3.492   1.00 42.55  ? 252 ILE D N   1 
ATOM   5583 C  CA  . ILE D 2 170 ? 10.939  5.912   2.248   1.00 43.00  ? 252 ILE D CA  1 
ATOM   5584 C  C   . ILE D 2 170 ? 12.410  5.580   2.474   1.00 44.25  ? 252 ILE D C   1 
ATOM   5585 O  O   . ILE D 2 170 ? 13.072  4.970   1.627   1.00 43.37  ? 252 ILE D O   1 
ATOM   5586 C  CB  . ILE D 2 170 ? 10.780  7.330   1.683   1.00 37.46  ? 252 ILE D CB  1 
ATOM   5587 C  CG1 . ILE D 2 170 ? 9.362   7.575   1.225   1.00 35.87  ? 252 ILE D CG1 1 
ATOM   5588 C  CG2 . ILE D 2 170 ? 11.719  7.532   0.536   1.00 38.66  ? 252 ILE D CG2 1 
ATOM   5589 C  CD1 . ILE D 2 170 ? 9.059   9.032   1.125   1.00 36.64  ? 252 ILE D CD1 1 
ATOM   5590 N  N   . GLU D 2 171 ? 12.949  5.984   3.619   1.00 45.50  ? 253 GLU D N   1 
ATOM   5591 C  CA  . GLU D 2 171 ? 14.369  5.770   3.834   1.00 47.46  ? 253 GLU D CA  1 
ATOM   5592 C  C   . GLU D 2 171 ? 14.698  4.311   4.106   1.00 51.48  ? 253 GLU D C   1 
ATOM   5593 O  O   . GLU D 2 171 ? 15.769  3.854   3.706   1.00 56.58  ? 253 GLU D O   1 
ATOM   5594 C  CB  . GLU D 2 171 ? 14.854  6.664   4.966   1.00 49.16  ? 253 GLU D CB  1 
ATOM   5595 C  CG  . GLU D 2 171 ? 15.050  8.114   4.530   1.00 51.89  ? 253 GLU D CG  1 
ATOM   5596 C  CD  . GLU D 2 171 ? 16.088  8.270   3.421   1.00 58.30  ? 253 GLU D CD  1 
ATOM   5597 O  OE1 . GLU D 2 171 ? 15.992  9.248   2.645   1.00 57.40  ? 253 GLU D OE1 1 
ATOM   5598 O  OE2 . GLU D 2 171 ? 17.004  7.417   3.330   1.00 64.52  ? 253 GLU D OE2 1 
ATOM   5599 N  N   . VAL D 2 172 ? 13.803  3.560   4.764   1.00 49.24  ? 254 VAL D N   1 
ATOM   5600 C  CA  . VAL D 2 172 ? 14.092  2.155   5.064   1.00 48.58  ? 254 VAL D CA  1 
ATOM   5601 C  C   . VAL D 2 172 ? 14.140  1.321   3.787   1.00 50.88  ? 254 VAL D C   1 
ATOM   5602 O  O   . VAL D 2 172 ? 15.054  0.506   3.601   1.00 52.98  ? 254 VAL D O   1 
ATOM   5603 C  CB  . VAL D 2 172 ? 13.073  1.580   6.062   1.00 44.50  ? 254 VAL D CB  1 
ATOM   5604 C  CG1 . VAL D 2 172 ? 13.331  0.098   6.264   1.00 41.01  ? 254 VAL D CG1 1 
ATOM   5605 C  CG2 . VAL D 2 172 ? 13.165  2.310   7.386   1.00 47.02  ? 254 VAL D CG2 1 
ATOM   5606 N  N   . CYS D 2 173 ? 13.141  1.494   2.896   1.00 44.32  ? 255 CYS D N   1 
ATOM   5607 C  CA  . CYS D 2 173 ? 13.137  0.887   1.566   1.00 46.04  ? 255 CYS D CA  1 
ATOM   5608 C  C   . CYS D 2 173 ? 12.151  1.574   0.626   1.00 45.34  ? 255 CYS D C   1 
ATOM   5609 O  O   . CYS D 2 173 ? 10.930  1.465   0.812   1.00 42.92  ? 255 CYS D O   1 
ATOM   5610 C  CB  . CYS D 2 173 ? 12.805  -0.600  1.618   1.00 50.92  ? 255 CYS D CB  1 
ATOM   5611 S  SG  . CYS D 2 173 ? 12.832  -1.292  -0.058  1.00 58.95  ? 255 CYS D SG  1 
ATOM   5612 N  N   . PRO D 2 174 ? 12.643  2.245   -0.426  1.00 45.49  ? 256 PRO D N   1 
ATOM   5613 C  CA  . PRO D 2 174 ? 11.723  2.967   -1.332  1.00 40.74  ? 256 PRO D CA  1 
ATOM   5614 C  C   . PRO D 2 174 ? 10.867  2.055   -2.197  1.00 38.76  ? 256 PRO D C   1 
ATOM   5615 O  O   . PRO D 2 174 ? 9.714   2.388   -2.476  1.00 43.90  ? 256 PRO D O   1 
ATOM   5616 C  CB  . PRO D 2 174 ? 12.665  3.822   -2.190  1.00 41.50  ? 256 PRO D CB  1 
ATOM   5617 C  CG  . PRO D 2 174 ? 14.038  3.663   -1.579  1.00 45.24  ? 256 PRO D CG  1 
ATOM   5618 C  CD  . PRO D 2 174 ? 14.049  2.371   -0.847  1.00 43.76  ? 256 PRO D CD  1 
ATOM   5619 N  N   . GLU D 2 175 ? 11.392  0.927   -2.664  1.00 40.14  ? 257 GLU D N   1 
ATOM   5620 C  CA  . GLU D 2 175 ? 10.539  -0.035  -3.359  1.00 44.64  ? 257 GLU D CA  1 
ATOM   5621 C  C   . GLU D 2 175 ? 9.432   -0.548  -2.436  1.00 45.24  ? 257 GLU D C   1 
ATOM   5622 O  O   . GLU D 2 175 ? 8.258   -0.610  -2.832  1.00 45.54  ? 257 GLU D O   1 
ATOM   5623 C  CB  . GLU D 2 175 ? 11.383  -1.189  -3.910  1.00 47.81  ? 257 GLU D CB  1 
ATOM   5624 C  CG  . GLU D 2 175 ? 12.743  -0.730  -4.398  1.00 52.72  ? 257 GLU D CG  1 
ATOM   5625 C  CD  . GLU D 2 175 ? 13.474  -1.776  -5.191  1.00 57.27  ? 257 GLU D CD  1 
ATOM   5626 O  OE1 . GLU D 2 175 ? 13.591  -1.601  -6.418  1.00 60.35  ? 257 GLU D OE1 1 
ATOM   5627 O  OE2 . GLU D 2 175 ? 13.939  -2.771  -4.594  1.00 59.05  ? 257 GLU D OE2 1 
ATOM   5628 N  N   . CYS D 2 176 ? 9.785   -0.891  -1.191  1.00 40.61  ? 258 CYS D N   1 
ATOM   5629 C  CA  . CYS D 2 176 ? 8.781   -1.332  -0.226  1.00 39.58  ? 258 CYS D CA  1 
ATOM   5630 C  C   . CYS D 2 176 ? 7.682   -0.300  -0.087  1.00 43.81  ? 258 CYS D C   1 
ATOM   5631 O  O   . CYS D 2 176 ? 6.481   -0.621  -0.122  1.00 44.38  ? 258 CYS D O   1 
ATOM   5632 C  CB  . CYS D 2 176 ? 9.427   -1.587  1.136   1.00 37.80  ? 258 CYS D CB  1 
ATOM   5633 S  SG  . CYS D 2 176 ? 9.919   -3.313  1.432   1.00 44.23  ? 258 CYS D SG  1 
ATOM   5634 N  N   . TYR D 2 177 ? 8.090   0.958   0.076   1.00 43.34  ? 259 TYR D N   1 
ATOM   5635 C  CA  . TYR D 2 177 ? 7.137   2.023   0.319   1.00 40.43  ? 259 TYR D CA  1 
ATOM   5636 C  C   . TYR D 2 177 ? 6.260   2.228   -0.896  1.00 43.62  ? 259 TYR D C   1 
ATOM   5637 O  O   . TYR D 2 177 ? 5.035   2.344   -0.782  1.00 45.03  ? 259 TYR D O   1 
ATOM   5638 C  CB  . TYR D 2 177 ? 7.889   3.298   0.675   1.00 42.46  ? 259 TYR D CB  1 
ATOM   5639 C  CG  . TYR D 2 177 ? 7.008   4.498   0.951   1.00 45.61  ? 259 TYR D CG  1 
ATOM   5640 C  CD1 . TYR D 2 177 ? 6.483   4.726   2.220   1.00 45.07  ? 259 TYR D CD1 1 
ATOM   5641 C  CD2 . TYR D 2 177 ? 6.716   5.414   -0.055  1.00 46.63  ? 259 TYR D CD2 1 
ATOM   5642 C  CE1 . TYR D 2 177 ? 5.689   5.833   2.483   1.00 45.36  ? 259 TYR D CE1 1 
ATOM   5643 C  CE2 . TYR D 2 177 ? 5.932   6.523   0.200   1.00 48.24  ? 259 TYR D CE2 1 
ATOM   5644 C  CZ  . TYR D 2 177 ? 5.421   6.727   1.465   1.00 47.42  ? 259 TYR D CZ  1 
ATOM   5645 O  OH  . TYR D 2 177 ? 4.645   7.834   1.705   1.00 48.23  ? 259 TYR D OH  1 
ATOM   5646 N  N   . LEU D 2 178 ? 6.874   2.266   -2.080  1.00 42.78  ? 260 LEU D N   1 
ATOM   5647 C  CA  . LEU D 2 178 ? 6.092   2.449   -3.289  1.00 43.54  ? 260 LEU D CA  1 
ATOM   5648 C  C   . LEU D 2 178 ? 5.055   1.345   -3.429  1.00 44.01  ? 260 LEU D C   1 
ATOM   5649 O  O   . LEU D 2 178 ? 3.866   1.621   -3.604  1.00 43.80  ? 260 LEU D O   1 
ATOM   5650 C  CB  . LEU D 2 178 ? 7.001   2.506   -4.510  1.00 41.49  ? 260 LEU D CB  1 
ATOM   5651 C  CG  . LEU D 2 178 ? 6.195   2.552   -5.813  1.00 42.90  ? 260 LEU D CG  1 
ATOM   5652 C  CD1 . LEU D 2 178 ? 5.312   3.798   -5.888  1.00 35.92  ? 260 LEU D CD1 1 
ATOM   5653 C  CD2 . LEU D 2 178 ? 7.125   2.460   -7.012  1.00 36.77  ? 260 LEU D CD2 1 
ATOM   5654 N  N   . ALA D 2 179 ? 5.480   0.086   -3.310  1.00 44.40  ? 261 ALA D N   1 
ATOM   5655 C  CA  . ALA D 2 179 ? 4.530   -1.018  -3.405  1.00 40.53  ? 261 ALA D CA  1 
ATOM   5656 C  C   . ALA D 2 179 ? 3.397   -0.848  -2.394  1.00 44.57  ? 261 ALA D C   1 
ATOM   5657 O  O   . ALA D 2 179 ? 2.215   -0.941  -2.754  1.00 45.66  ? 261 ALA D O   1 
ATOM   5658 C  CB  . ALA D 2 179 ? 5.249   -2.351  -3.209  1.00 35.03  ? 261 ALA D CB  1 
ATOM   5659 N  N   . ALA D 2 180 ? 3.735   -0.550  -1.130  1.00 42.71  ? 262 ALA D N   1 
ATOM   5660 C  CA  . ALA D 2 180 ? 2.692   -0.403  -0.116  1.00 46.67  ? 262 ALA D CA  1 
ATOM   5661 C  C   . ALA D 2 180 ? 1.769   0.770   -0.417  1.00 45.46  ? 262 ALA D C   1 
ATOM   5662 O  O   . ALA D 2 180 ? 0.620   0.777   0.033   1.00 49.15  ? 262 ALA D O   1 
ATOM   5663 C  CB  . ALA D 2 180 ? 3.306   -0.249  1.279   1.00 31.02  ? 262 ALA D CB  1 
ATOM   5664 N  N   . CYS D 2 181 ? 2.239   1.750   -1.179  1.00 42.95  ? 263 CYS D N   1 
ATOM   5665 C  CA  . CYS D 2 181 ? 1.394   2.873   -1.544  1.00 44.64  ? 263 CYS D CA  1 
ATOM   5666 C  C   . CYS D 2 181 ? 0.494   2.531   -2.714  1.00 48.30  ? 263 CYS D C   1 
ATOM   5667 O  O   . CYS D 2 181 ? -0.667  2.938   -2.734  1.00 51.11  ? 263 CYS D O   1 
ATOM   5668 C  CB  . CYS D 2 181 ? 2.248   4.089   -1.897  1.00 47.05  ? 263 CYS D CB  1 
ATOM   5669 S  SG  . CYS D 2 181 ? 2.973   4.928   -0.490  1.00 50.46  ? 263 CYS D SG  1 
ATOM   5670 N  N   . GLN D 2 182 ? 1.019   1.816   -3.715  1.00 49.33  ? 264 GLN D N   1 
ATOM   5671 C  CA  . GLN D 2 182 ? 0.200   1.456   -4.865  1.00 49.78  ? 264 GLN D CA  1 
ATOM   5672 C  C   . GLN D 2 182 ? -0.887  0.462   -4.467  1.00 49.07  ? 264 GLN D C   1 
ATOM   5673 O  O   . GLN D 2 182 ? -2.013  0.523   -4.980  1.00 50.30  ? 264 GLN D O   1 
ATOM   5674 C  CB  . GLN D 2 182 ? 1.073   0.889   -5.986  1.00 50.89  ? 264 GLN D CB  1 
ATOM   5675 C  CG  . GLN D 2 182 ? 2.192   1.792   -6.478  1.00 49.89  ? 264 GLN D CG  1 
ATOM   5676 C  CD  . GLN D 2 182 ? 1.737   2.780   -7.520  1.00 53.35  ? 264 GLN D CD  1 
ATOM   5677 O  OE1 . GLN D 2 182 ? 0.622   3.300   -7.450  1.00 56.22  ? 264 GLN D OE1 1 
ATOM   5678 N  NE2 . GLN D 2 182 ? 2.598   3.053   -8.500  1.00 52.95  ? 264 GLN D NE2 1 
ATOM   5679 N  N   . LYS D 2 183 ? -0.570  -0.444  -3.540  1.00 47.37  ? 265 LYS D N   1 
ATOM   5680 C  CA  . LYS D 2 183 ? -1.528  -1.416  -3.016  1.00 47.49  ? 265 LYS D CA  1 
ATOM   5681 C  C   . LYS D 2 183 ? -2.074  -2.324  -4.125  1.00 49.84  ? 265 LYS D C   1 
ATOM   5682 O  O   . LYS D 2 183 ? -3.273  -2.602  -4.198  1.00 52.38  ? 265 LYS D O   1 
ATOM   5683 C  CB  . LYS D 2 183 ? -2.656  -0.710  -2.261  1.00 48.71  ? 265 LYS D CB  1 
ATOM   5684 C  CG  . LYS D 2 183 ? -3.165  -1.453  -1.041  1.00 52.40  ? 265 LYS D CG  1 
ATOM   5685 C  CD  . LYS D 2 183 ? -2.363  -1.110  0.204   1.00 54.84  ? 265 LYS D CD  1 
ATOM   5686 N  N   . ARG D 2 184 ? -1.189  -2.783  -5.009  1.00 49.01  ? 266 ARG D N   1 
ATOM   5687 C  CA  . ARG D 2 184 ? -1.530  -3.886  -5.892  1.00 49.81  ? 266 ARG D CA  1 
ATOM   5688 C  C   . ARG D 2 184 ? -1.854  -5.133  -5.068  1.00 51.85  ? 266 ARG D C   1 
ATOM   5689 O  O   . ARG D 2 184 ? -1.446  -5.274  -3.912  1.00 49.75  ? 266 ARG D O   1 
ATOM   5690 C  CB  . ARG D 2 184 ? -0.380  -4.199  -6.844  1.00 48.61  ? 266 ARG D CB  1 
ATOM   5691 C  CG  . ARG D 2 184 ? -0.277  -3.308  -8.048  1.00 51.45  ? 266 ARG D CG  1 
ATOM   5692 C  CD  . ARG D 2 184 ? 0.941   -3.687  -8.871  1.00 50.00  ? 266 ARG D CD  1 
ATOM   5693 N  NE  . ARG D 2 184 ? 2.182   -3.546  -8.108  1.00 48.79  ? 266 ARG D NE  1 
ATOM   5694 C  CZ  . ARG D 2 184 ? 2.865   -2.408  -7.953  1.00 48.04  ? 266 ARG D CZ  1 
ATOM   5695 N  NH1 . ARG D 2 184 ? 2.431   -1.271  -8.494  1.00 52.52  ? 266 ARG D NH1 1 
ATOM   5696 N  NH2 . ARG D 2 184 ? 3.991   -2.405  -7.250  1.00 41.19  ? 266 ARG D NH2 1 
ATOM   5697 N  N   . ASP D 2 185 ? -2.597  -6.053  -5.677  1.00 58.91  ? 267 ASP D N   1 
ATOM   5698 C  CA  . ASP D 2 185 ? -2.944  -7.278  -4.978  1.00 62.90  ? 267 ASP D CA  1 
ATOM   5699 C  C   . ASP D 2 185 ? -1.683  -8.069  -4.681  1.00 62.28  ? 267 ASP D C   1 
ATOM   5700 O  O   . ASP D 2 185 ? -0.796  -8.186  -5.535  1.00 60.18  ? 267 ASP D O   1 
ATOM   5701 C  CB  . ASP D 2 185 ? -3.922  -8.098  -5.802  1.00 74.94  ? 267 ASP D CB  1 
ATOM   5702 C  CG  . ASP D 2 185 ? -5.359  -7.696  -5.548  1.00 84.33  ? 267 ASP D CG  1 
ATOM   5703 O  OD1 . ASP D 2 185 ? -5.847  -7.954  -4.423  1.00 87.20  ? 267 ASP D OD1 1 
ATOM   5704 O  OD2 . ASP D 2 185 ? -5.989  -7.101  -6.455  1.00 86.92  ? 267 ASP D OD2 1 
ATOM   5705 N  N   . ASN D 2 186 ? -1.595  -8.569  -3.440  1.00 60.24  ? 268 ASN D N   1 
ATOM   5706 C  CA  . ASN D 2 186 ? -0.417  -9.283  -2.946  1.00 57.47  ? 268 ASN D CA  1 
ATOM   5707 C  C   . ASN D 2 186 ? 0.822   -8.393  -2.950  1.00 53.17  ? 268 ASN D C   1 
ATOM   5708 O  O   . ASN D 2 186 ? 1.940   -8.857  -3.181  1.00 52.69  ? 268 ASN D O   1 
ATOM   5709 C  CB  . ASN D 2 186 ? -0.161  -10.556 -3.748  1.00 60.53  ? 268 ASN D CB  1 
ATOM   5710 C  CG  . ASN D 2 186 ? -1.050  -11.684 -3.329  1.00 66.11  ? 268 ASN D CG  1 
ATOM   5711 O  OD1 . ASN D 2 186 ? -1.644  -11.652 -2.253  1.00 66.96  ? 268 ASN D OD1 1 
ATOM   5712 N  ND2 . ASN D 2 186 ? -1.157  -12.695 -4.176  1.00 70.55  ? 268 ASN D ND2 1 
ATOM   5713 N  N   . TRP D 2 187 ? 0.629   -7.105  -2.674  1.00 50.16  ? 269 TRP D N   1 
ATOM   5714 C  CA  . TRP D 2 187 ? 1.746   -6.179  -2.777  1.00 50.38  ? 269 TRP D CA  1 
ATOM   5715 C  C   . TRP D 2 187 ? 2.873   -6.545  -1.822  1.00 49.90  ? 269 TRP D C   1 
ATOM   5716 O  O   . TRP D 2 187 ? 4.042   -6.299  -2.120  1.00 53.89  ? 269 TRP D O   1 
ATOM   5717 C  CB  . TRP D 2 187 ? 1.274   -4.753  -2.520  1.00 52.46  ? 269 TRP D CB  1 
ATOM   5718 C  CG  . TRP D 2 187 ? 0.606   -4.572  -1.186  1.00 54.45  ? 269 TRP D CG  1 
ATOM   5719 C  CD1 . TRP D 2 187 ? -0.731  -4.692  -0.901  1.00 55.20  ? 269 TRP D CD1 1 
ATOM   5720 C  CD2 . TRP D 2 187 ? 1.245   -4.220  0.037   1.00 51.27  ? 269 TRP D CD2 1 
ATOM   5721 N  NE1 . TRP D 2 187 ? -0.953  -4.443  0.428   1.00 53.40  ? 269 TRP D NE1 1 
ATOM   5722 C  CE2 . TRP D 2 187 ? 0.243   -4.151  1.029   1.00 52.18  ? 269 TRP D CE2 1 
ATOM   5723 C  CE3 . TRP D 2 187 ? 2.571   -3.962  0.394   1.00 48.74  ? 269 TRP D CE3 1 
ATOM   5724 C  CZ2 . TRP D 2 187 ? 0.527   -3.835  2.358   1.00 52.17  ? 269 TRP D CZ2 1 
ATOM   5725 C  CZ3 . TRP D 2 187 ? 2.854   -3.641  1.710   1.00 49.29  ? 269 TRP D CZ3 1 
ATOM   5726 C  CH2 . TRP D 2 187 ? 1.836   -3.582  2.678   1.00 50.65  ? 269 TRP D CH2 1 
ATOM   5727 N  N   . PHE D 2 188 ? 2.558   -7.143  -0.682  1.00 46.84  ? 270 PHE D N   1 
ATOM   5728 C  CA  . PHE D 2 188 ? 3.629   -7.532  0.226   1.00 43.03  ? 270 PHE D CA  1 
ATOM   5729 C  C   . PHE D 2 188 ? 4.533   -8.624  -0.356  1.00 44.59  ? 270 PHE D C   1 
ATOM   5730 O  O   . PHE D 2 188 ? 5.682   -8.766  0.090   1.00 41.88  ? 270 PHE D O   1 
ATOM   5731 C  CB  . PHE D 2 188 ? 3.034   -7.985  1.549   1.00 39.30  ? 270 PHE D CB  1 
ATOM   5732 C  CG  . PHE D 2 188 ? 4.001   -7.975  2.664   1.00 38.99  ? 270 PHE D CG  1 
ATOM   5733 C  CD1 . PHE D 2 188 ? 4.478   -6.777  3.164   1.00 35.35  ? 270 PHE D CD1 1 
ATOM   5734 C  CD2 . PHE D 2 188 ? 4.451   -9.171  3.218   1.00 43.14  ? 270 PHE D CD2 1 
ATOM   5735 C  CE1 . PHE D 2 188 ? 5.383   -6.755  4.208   1.00 37.20  ? 270 PHE D CE1 1 
ATOM   5736 C  CE2 . PHE D 2 188 ? 5.372   -9.165  4.262   1.00 43.74  ? 270 PHE D CE2 1 
ATOM   5737 C  CZ  . PHE D 2 188 ? 5.845   -7.944  4.760   1.00 40.25  ? 270 PHE D CZ  1 
ATOM   5738 N  N   . CYS D 2 189 ? 4.061   -9.377  -1.350  1.00 45.06  ? 271 CYS D N   1 
ATOM   5739 C  CA  . CYS D 2 189 ? 4.829   -10.469 -1.928  1.00 47.31  ? 271 CYS D CA  1 
ATOM   5740 C  C   . CYS D 2 189 ? 5.712   -10.031 -3.082  1.00 48.53  ? 271 CYS D C   1 
ATOM   5741 O  O   . CYS D 2 189 ? 6.345   -10.884 -3.715  1.00 48.09  ? 271 CYS D O   1 
ATOM   5742 C  CB  . CYS D 2 189 ? 3.895   -11.572 -2.413  1.00 53.22  ? 271 CYS D CB  1 
ATOM   5743 S  SG  . CYS D 2 189 ? 2.743   -12.141 -1.185  1.00 60.03  ? 271 CYS D SG  1 
ATOM   5744 N  N   . GLU D 2 190 ? 5.746   -8.741  -3.392  1.00 50.94  ? 272 GLU D N   1 
ATOM   5745 C  CA  . GLU D 2 190 ? 6.617   -8.243  -4.451  1.00 52.24  ? 272 GLU D CA  1 
ATOM   5746 C  C   . GLU D 2 190 ? 8.054   -8.159  -3.944  1.00 50.57  ? 272 GLU D C   1 
ATOM   5747 O  O   . GLU D 2 190 ? 8.320   -7.429  -2.978  1.00 46.02  ? 272 GLU D O   1 
ATOM   5748 C  CB  . GLU D 2 190 ? 6.134   -6.887  -4.923  1.00 53.69  ? 272 GLU D CB  1 
ATOM   5749 C  CG  . GLU D 2 190 ? 4.678   -6.889  -5.342  1.00 59.15  ? 272 GLU D CG  1 
ATOM   5750 C  CD  . GLU D 2 190 ? 4.191   -5.528  -5.841  1.00 62.95  ? 272 GLU D CD  1 
ATOM   5751 O  OE1 . GLU D 2 190 ? 3.099   -5.476  -6.449  1.00 65.44  ? 272 GLU D OE1 1 
ATOM   5752 O  OE2 . GLU D 2 190 ? 4.892   -4.514  -5.625  1.00 62.87  ? 272 GLU D OE2 1 
ATOM   5753 N  N   . PRO D 2 191 ? 8.991   -8.903  -4.521  1.00 50.51  ? 273 PRO D N   1 
ATOM   5754 C  CA  . PRO D 2 191 ? 10.369  -8.834  -4.034  1.00 49.74  ? 273 PRO D CA  1 
ATOM   5755 C  C   . PRO D 2 191 ? 11.045  -7.592  -4.576  1.00 50.74  ? 273 PRO D C   1 
ATOM   5756 O  O   . PRO D 2 191 ? 10.752  -7.127  -5.679  1.00 52.96  ? 273 PRO D O   1 
ATOM   5757 C  CB  . PRO D 2 191 ? 11.017  -10.113 -4.573  1.00 47.73  ? 273 PRO D CB  1 
ATOM   5758 C  CG  . PRO D 2 191 ? 10.092  -10.612 -5.665  1.00 50.07  ? 273 PRO D CG  1 
ATOM   5759 C  CD  . PRO D 2 191 ? 8.850   -9.771  -5.698  1.00 50.15  ? 273 PRO D CD  1 
ATOM   5760 N  N   . CYS D 2 192 ? 11.939  -7.043  -3.764  1.00 50.47  ? 274 CYS D N   1 
ATOM   5761 C  CA  . CYS D 2 192 ? 12.683  -5.841  -4.107  1.00 51.72  ? 274 CYS D CA  1 
ATOM   5762 C  C   . CYS D 2 192 ? 13.897  -6.188  -4.972  1.00 59.20  ? 274 CYS D C   1 
ATOM   5763 O  O   . CYS D 2 192 ? 14.314  -7.348  -5.069  1.00 62.60  ? 274 CYS D O   1 
ATOM   5764 C  CB  . CYS D 2 192 ? 13.102  -5.111  -2.834  1.00 50.89  ? 274 CYS D CB  1 
ATOM   5765 S  SG  . CYS D 2 192 ? 11.656  -4.438  -1.935  1.00 53.72  ? 274 CYS D SG  1 
ATOM   5766 N  N   . SER D 2 193 ? 14.445  -5.165  -5.632  1.00 59.74  ? 275 SER D N   1 
ATOM   5767 C  CA  . SER D 2 193 ? 15.596  -5.382  -6.500  1.00 61.77  ? 275 SER D CA  1 
ATOM   5768 C  C   . SER D 2 193 ? 16.717  -6.084  -5.752  1.00 63.51  ? 275 SER D C   1 
ATOM   5769 O  O   . SER D 2 193 ? 17.239  -7.100  -6.216  1.00 65.28  ? 275 SER D O   1 
ATOM   5770 C  CB  . SER D 2 193 ? 16.075  -4.055  -7.064  1.00 60.02  ? 275 SER D CB  1 
ATOM   5771 O  OG  . SER D 2 193 ? 15.009  -3.434  -7.738  1.00 60.49  ? 275 SER D OG  1 
ATOM   5772 N  N   . ASN D 2 194 ? 17.114  -5.540  -4.596  1.00 68.34  ? 276 ASN D N   1 
ATOM   5773 C  CA  . ASN D 2 194 ? 17.913  -6.274  -3.621  1.00 68.34  ? 276 ASN D CA  1 
ATOM   5774 C  C   . ASN D 2 194 ? 16.933  -6.925  -2.667  1.00 64.17  ? 276 ASN D C   1 
ATOM   5775 O  O   . ASN D 2 194 ? 16.454  -6.266  -1.736  1.00 65.56  ? 276 ASN D O   1 
ATOM   5776 C  CB  . ASN D 2 194 ? 18.871  -5.373  -2.838  1.00 74.60  ? 276 ASN D CB  1 
ATOM   5777 C  CG  . ASN D 2 194 ? 20.042  -4.891  -3.670  1.00 84.13  ? 276 ASN D CG  1 
ATOM   5778 O  OD1 . ASN D 2 194 ? 19.867  -4.276  -4.731  1.00 87.12  ? 276 ASN D OD1 1 
ATOM   5779 N  ND2 . ASN D 2 194 ? 21.251  -5.165  -3.191  1.00 87.23  ? 276 ASN D ND2 1 
ATOM   5780 N  N   . PRO D 2 195 ? 16.576  -8.183  -2.874  1.00 52.51  ? 277 PRO D N   1 
ATOM   5781 C  CA  . PRO D 2 195 ? 15.557  -8.790  -2.016  1.00 46.77  ? 277 PRO D CA  1 
ATOM   5782 C  C   . PRO D 2 195 ? 16.034  -8.861  -0.580  1.00 41.08  ? 277 PRO D C   1 
ATOM   5783 O  O   . PRO D 2 195 ? 17.157  -9.251  -0.309  1.00 45.60  ? 277 PRO D O   1 
ATOM   5784 C  CB  . PRO D 2 195 ? 15.356  -10.180 -2.623  1.00 48.61  ? 277 PRO D CB  1 
ATOM   5785 C  CG  . PRO D 2 195 ? 16.555  -10.399 -3.493  1.00 53.57  ? 277 PRO D CG  1 
ATOM   5786 C  CD  . PRO D 2 195 ? 16.991  -9.068  -3.966  1.00 53.10  ? 277 PRO D CD  1 
ATOM   5787 N  N   . HIS D 2 196 ? 15.175  -8.454  0.335   1.00 40.83  ? 278 HIS D N   1 
ATOM   5788 C  CA  . HIS D 2 196 ? 15.445  -8.625  1.750   1.00 40.53  ? 278 HIS D CA  1 
ATOM   5789 C  C   . HIS D 2 196 ? 15.445  -10.107 2.136   1.00 42.03  ? 278 HIS D C   1 
ATOM   5790 O  O   . HIS D 2 196 ? 14.576  -10.874 1.694   1.00 42.42  ? 278 HIS D O   1 
ATOM   5791 C  CB  . HIS D 2 196 ? 14.398  -7.862  2.546   1.00 40.30  ? 278 HIS D CB  1 
ATOM   5792 C  CG  . HIS D 2 196 ? 14.162  -6.482  2.021   1.00 41.90  ? 278 HIS D CG  1 
ATOM   5793 N  ND1 . HIS D 2 196 ? 15.107  -5.481  2.118   1.00 42.03  ? 278 HIS D ND1 1 
ATOM   5794 C  CD2 . HIS D 2 196 ? 13.100  -5.936  1.387   1.00 40.81  ? 278 HIS D CD2 1 
ATOM   5795 C  CE1 . HIS D 2 196 ? 14.634  -4.377  1.566   1.00 40.37  ? 278 HIS D CE1 1 
ATOM   5796 N  NE2 . HIS D 2 196 ? 13.423  -4.629  1.106   1.00 40.66  ? 278 HIS D NE2 1 
ATOM   5797 N  N   . PRO D 2 197 ? 16.405  -10.543 2.950   1.00 40.65  ? 279 PRO D N   1 
ATOM   5798 C  CA  . PRO D 2 197 ? 16.433  -11.951 3.376   1.00 40.13  ? 279 PRO D CA  1 
ATOM   5799 C  C   . PRO D 2 197 ? 15.187  -12.328 4.165   1.00 39.27  ? 279 PRO D C   1 
ATOM   5800 O  O   . PRO D 2 197 ? 14.591  -11.507 4.863   1.00 43.47  ? 279 PRO D O   1 
ATOM   5801 C  CB  . PRO D 2 197 ? 17.688  -12.029 4.251   1.00 41.81  ? 279 PRO D CB  1 
ATOM   5802 C  CG  . PRO D 2 197 ? 18.541  -10.876 3.805   1.00 39.44  ? 279 PRO D CG  1 
ATOM   5803 C  CD  . PRO D 2 197 ? 17.591  -9.792  3.393   1.00 36.66  ? 279 PRO D CD  1 
ATOM   5804 N  N   . LEU D 2 198 ? 14.791  -13.590 4.040   1.00 37.74  ? 280 LEU D N   1 
ATOM   5805 C  CA  . LEU D 2 198 ? 13.622  -14.119 4.731   1.00 38.77  ? 280 LEU D CA  1 
ATOM   5806 C  C   . LEU D 2 198 ? 14.048  -14.738 6.048   1.00 38.23  ? 280 LEU D C   1 
ATOM   5807 O  O   . LEU D 2 198 ? 14.929  -15.605 6.065   1.00 39.31  ? 280 LEU D O   1 
ATOM   5808 C  CB  . LEU D 2 198 ? 12.928  -15.194 3.901   1.00 42.81  ? 280 LEU D CB  1 
ATOM   5809 C  CG  . LEU D 2 198 ? 12.099  -14.848 2.684   1.00 48.29  ? 280 LEU D CG  1 
ATOM   5810 C  CD1 . LEU D 2 198 ? 11.014  -15.916 2.514   1.00 47.88  ? 280 LEU D CD1 1 
ATOM   5811 C  CD2 . LEU D 2 198 ? 11.508  -13.449 2.843   1.00 49.89  ? 280 LEU D CD2 1 
ATOM   5812 N  N   . VAL D 2 199 ? 13.398  -14.349 7.141   1.00 34.75  ? 281 VAL D N   1 
ATOM   5813 C  CA  . VAL D 2 199 ? 13.829  -14.863 8.430   1.00 38.47  ? 281 VAL D CA  1 
ATOM   5814 C  C   . VAL D 2 199 ? 12.644  -15.361 9.240   1.00 40.46  ? 281 VAL D C   1 
ATOM   5815 O  O   . VAL D 2 199 ? 11.497  -14.956 9.041   1.00 40.81  ? 281 VAL D O   1 
ATOM   5816 C  CB  . VAL D 2 199 ? 14.616  -13.813 9.254   1.00 35.96  ? 281 VAL D CB  1 
ATOM   5817 C  CG1 . VAL D 2 199 ? 15.917  -13.438 8.545   1.00 34.85  ? 281 VAL D CG1 1 
ATOM   5818 C  CG2 . VAL D 2 199 ? 13.741  -12.592 9.543   1.00 30.99  ? 281 VAL D CG2 1 
ATOM   5819 N  N   . TRP D 2 200 ? 12.956  -16.274 10.153  1.00 37.99  ? 282 TRP D N   1 
ATOM   5820 C  CA  . TRP D 2 200 ? 12.198  -16.445 11.376  1.00 33.83  ? 282 TRP D CA  1 
ATOM   5821 C  C   . TRP D 2 200 ? 12.654  -15.372 12.355  1.00 34.62  ? 282 TRP D C   1 
ATOM   5822 O  O   . TRP D 2 200 ? 13.831  -15.335 12.730  1.00 38.69  ? 282 TRP D O   1 
ATOM   5823 C  CB  . TRP D 2 200 ? 12.448  -17.829 11.964  1.00 35.87  ? 282 TRP D CB  1 
ATOM   5824 C  CG  . TRP D 2 200 ? 12.058  -19.015 11.125  1.00 38.15  ? 282 TRP D CG  1 
ATOM   5825 C  CD1 . TRP D 2 200 ? 12.897  -19.959 10.623  1.00 40.98  ? 282 TRP D CD1 1 
ATOM   5826 C  CD2 . TRP D 2 200 ? 10.734  -19.413 10.739  1.00 40.84  ? 282 TRP D CD2 1 
ATOM   5827 N  NE1 . TRP D 2 200 ? 12.186  -20.916 9.936   1.00 43.29  ? 282 TRP D NE1 1 
ATOM   5828 C  CE2 . TRP D 2 200 ? 10.856  -20.600 9.985   1.00 42.15  ? 282 TRP D CE2 1 
ATOM   5829 C  CE3 . TRP D 2 200 ? 9.458   -18.877 10.946  1.00 43.61  ? 282 TRP D CE3 1 
ATOM   5830 C  CZ2 . TRP D 2 200 ? 9.752   -21.262 9.439   1.00 42.32  ? 282 TRP D CZ2 1 
ATOM   5831 C  CZ3 . TRP D 2 200 ? 8.359   -19.542 10.398  1.00 43.68  ? 282 TRP D CZ3 1 
ATOM   5832 C  CH2 . TRP D 2 200 ? 8.517   -20.718 9.655   1.00 42.18  ? 282 TRP D CH2 1 
ATOM   5833 N  N   . ALA D 2 201 ? 11.747  -14.484 12.750  1.00 35.60  ? 283 ALA D N   1 
ATOM   5834 C  CA  . ALA D 2 201 ? 12.026  -13.466 13.760  1.00 32.36  ? 283 ALA D CA  1 
ATOM   5835 C  C   . ALA D 2 201 ? 11.137  -13.727 14.970  1.00 35.37  ? 283 ALA D C   1 
ATOM   5836 O  O   . ALA D 2 201 ? 9.941   -14.013 14.812  1.00 35.34  ? 283 ALA D O   1 
ATOM   5837 C  CB  . ALA D 2 201 ? 11.785  -12.056 13.214  1.00 25.87  ? 283 ALA D CB  1 
ATOM   5838 N  N   . LYS D 2 202 ? 11.716  -13.645 16.173  1.00 35.13  ? 284 LYS D N   1 
ATOM   5839 C  CA  . LYS D 2 202 ? 10.974  -13.948 17.392  1.00 34.16  ? 284 LYS D CA  1 
ATOM   5840 C  C   . LYS D 2 202 ? 10.893  -12.732 18.313  1.00 33.90  ? 284 LYS D C   1 
ATOM   5841 O  O   . LYS D 2 202 ? 11.908  -12.282 18.851  1.00 38.39  ? 284 LYS D O   1 
ATOM   5842 C  CB  . LYS D 2 202 ? 11.585  -15.135 18.130  1.00 35.86  ? 284 LYS D CB  1 
ATOM   5843 C  CG  . LYS D 2 202 ? 10.752  -15.462 19.364  1.00 41.33  ? 284 LYS D CG  1 
ATOM   5844 C  CD  . LYS D 2 202 ? 11.031  -16.817 19.955  1.00 43.92  ? 284 LYS D CD  1 
ATOM   5845 C  CE  . LYS D 2 202 ? 10.035  -17.121 21.061  1.00 44.48  ? 284 LYS D CE  1 
ATOM   5846 N  NZ  . LYS D 2 202 ? 9.594   -15.870 21.747  1.00 44.53  ? 284 LYS D NZ  1 
ATOM   5847 N  N   . LEU D 2 203 ? 9.685   -12.223 18.513  1.00 34.32  ? 285 LEU D N   1 
ATOM   5848 C  CA  . LEU D 2 203 ? 9.403   -11.161 19.466  1.00 37.17  ? 285 LEU D CA  1 
ATOM   5849 C  C   . LEU D 2 203 ? 9.191   -11.756 20.848  1.00 42.83  ? 285 LEU D C   1 
ATOM   5850 O  O   . LEU D 2 203 ? 8.915   -12.948 20.987  1.00 50.95  ? 285 LEU D O   1 
ATOM   5851 C  CB  . LEU D 2 203 ? 8.167   -10.384 19.040  1.00 38.44  ? 285 LEU D CB  1 
ATOM   5852 C  CG  . LEU D 2 203 ? 8.307   -9.693  17.694  1.00 39.67  ? 285 LEU D CG  1 
ATOM   5853 C  CD1 . LEU D 2 203 ? 6.943   -9.289  17.143  1.00 36.50  ? 285 LEU D CD1 1 
ATOM   5854 C  CD2 . LEU D 2 203 ? 9.176   -8.494  17.926  1.00 43.13  ? 285 LEU D CD2 1 
ATOM   5855 N  N   . LYS D 2 204 ? 9.334   -10.928 21.885  1.00 43.36  ? 286 LYS D N   1 
ATOM   5856 C  CA  . LYS D 2 204 ? 9.120   -11.456 23.230  1.00 43.32  ? 286 LYS D CA  1 
ATOM   5857 C  C   . LYS D 2 204 ? 7.659   -11.861 23.353  1.00 42.07  ? 286 LYS D C   1 
ATOM   5858 O  O   . LYS D 2 204 ? 6.776   -11.192 22.812  1.00 43.38  ? 286 LYS D O   1 
ATOM   5859 C  CB  . LYS D 2 204 ? 9.500   -10.443 24.314  1.00 42.69  ? 286 LYS D CB  1 
ATOM   5860 N  N   . GLY D 2 205 ? 7.420   -13.000 23.996  1.00 38.92  ? 287 GLY D N   1 
ATOM   5861 C  CA  . GLY D 2 205 ? 6.061   -13.508 24.179  1.00 41.31  ? 287 GLY D CA  1 
ATOM   5862 C  C   . GLY D 2 205 ? 5.278   -13.788 22.909  1.00 42.61  ? 287 GLY D C   1 
ATOM   5863 O  O   . GLY D 2 205 ? 4.063   -13.533 22.854  1.00 47.42  ? 287 GLY D O   1 
ATOM   5864 N  N   . PHE D 2 206 ? 5.941   -14.319 21.887  1.00 37.82  ? 288 PHE D N   1 
ATOM   5865 C  CA  . PHE D 2 206 ? 5.321   -14.529 20.592  1.00 37.10  ? 288 PHE D CA  1 
ATOM   5866 C  C   . PHE D 2 206 ? 6.107   -15.609 19.886  1.00 38.63  ? 288 PHE D C   1 
ATOM   5867 O  O   . PHE D 2 206 ? 7.323   -15.696 20.077  1.00 42.34  ? 288 PHE D O   1 
ATOM   5868 C  CB  . PHE D 2 206 ? 5.341   -13.233 19.772  1.00 37.89  ? 288 PHE D CB  1 
ATOM   5869 C  CG  . PHE D 2 206 ? 4.312   -13.185 18.669  1.00 38.66  ? 288 PHE D CG  1 
ATOM   5870 C  CD1 . PHE D 2 206 ? 2.967   -13.138 18.960  1.00 41.58  ? 288 PHE D CD1 1 
ATOM   5871 C  CD2 . PHE D 2 206 ? 4.698   -13.168 17.345  1.00 37.37  ? 288 PHE D CD2 1 
ATOM   5872 C  CE1 . PHE D 2 206 ? 2.029   -13.090 17.949  1.00 44.97  ? 288 PHE D CE1 1 
ATOM   5873 C  CE2 . PHE D 2 206 ? 3.761   -13.112 16.341  1.00 38.49  ? 288 PHE D CE2 1 
ATOM   5874 C  CZ  . PHE D 2 206 ? 2.433   -13.076 16.640  1.00 42.07  ? 288 PHE D CZ  1 
ATOM   5875 N  N   . PRO D 2 207 ? 5.470   -16.427 19.061  1.00 36.19  ? 289 PRO D N   1 
ATOM   5876 C  CA  . PRO D 2 207 ? 6.217   -17.464 18.352  1.00 31.32  ? 289 PRO D CA  1 
ATOM   5877 C  C   . PRO D 2 207 ? 7.088   -16.874 17.255  1.00 32.07  ? 289 PRO D C   1 
ATOM   5878 O  O   . PRO D 2 207 ? 6.900   -15.746 16.801  1.00 33.19  ? 289 PRO D O   1 
ATOM   5879 C  CB  . PRO D 2 207 ? 5.123   -18.361 17.760  1.00 32.74  ? 289 PRO D CB  1 
ATOM   5880 C  CG  . PRO D 2 207 ? 3.844   -17.840 18.300  1.00 39.46  ? 289 PRO D CG  1 
ATOM   5881 C  CD  . PRO D 2 207 ? 4.050   -16.432 18.701  1.00 33.56  ? 289 PRO D CD  1 
ATOM   5882 N  N   . PHE D 2 208 ? 8.073   -17.664 16.841  1.00 32.28  ? 290 PHE D N   1 
ATOM   5883 C  CA  . PHE D 2 208 ? 8.808   -17.354 15.630  1.00 31.68  ? 290 PHE D CA  1 
ATOM   5884 C  C   . PHE D 2 208 ? 7.819   -17.040 14.513  1.00 35.01  ? 290 PHE D C   1 
ATOM   5885 O  O   . PHE D 2 208 ? 6.759   -17.663 14.407  1.00 36.27  ? 290 PHE D O   1 
ATOM   5886 C  CB  . PHE D 2 208 ? 9.707   -18.534 15.230  1.00 29.95  ? 290 PHE D CB  1 
ATOM   5887 C  CG  . PHE D 2 208 ? 10.980  -18.644 16.031  1.00 33.73  ? 290 PHE D CG  1 
ATOM   5888 C  CD1 . PHE D 2 208 ? 12.052  -17.791 15.781  1.00 36.11  ? 290 PHE D CD1 1 
ATOM   5889 C  CD2 . PHE D 2 208 ? 11.114  -19.624 17.023  1.00 33.25  ? 290 PHE D CD2 1 
ATOM   5890 C  CE1 . PHE D 2 208 ? 13.225  -17.905 16.516  1.00 37.82  ? 290 PHE D CE1 1 
ATOM   5891 C  CE2 . PHE D 2 208 ? 12.274  -19.750 17.767  1.00 29.89  ? 290 PHE D CE2 1 
ATOM   5892 C  CZ  . PHE D 2 208 ? 13.329  -18.897 17.523  1.00 35.97  ? 290 PHE D CZ  1 
ATOM   5893 N  N   . TRP D 2 209 ? 8.172   -16.073 13.673  1.00 33.72  ? 291 TRP D N   1 
ATOM   5894 C  CA  . TRP D 2 209 ? 7.232   -15.593 12.710  1.00 32.96  ? 291 TRP D CA  1 
ATOM   5895 C  C   . TRP D 2 209 ? 7.968   -15.148 11.453  1.00 35.53  ? 291 TRP D C   1 
ATOM   5896 O  O   . TRP D 2 209 ? 9.016   -14.478 11.558  1.00 36.75  ? 291 TRP D O   1 
ATOM   5897 C  CB  . TRP D 2 209 ? 6.436   -14.434 13.299  1.00 33.61  ? 291 TRP D CB  1 
ATOM   5898 C  CG  . TRP D 2 209 ? 5.124   -14.196 12.629  1.00 37.60  ? 291 TRP D CG  1 
ATOM   5899 C  CD1 . TRP D 2 209 ? 4.889   -13.440 11.497  1.00 37.39  ? 291 TRP D CD1 1 
ATOM   5900 C  CD2 . TRP D 2 209 ? 3.853   -14.703 13.044  1.00 36.45  ? 291 TRP D CD2 1 
ATOM   5901 N  NE1 . TRP D 2 209 ? 3.548   -13.456 11.199  1.00 38.96  ? 291 TRP D NE1 1 
ATOM   5902 C  CE2 . TRP D 2 209 ? 2.891   -14.223 12.127  1.00 38.43  ? 291 TRP D CE2 1 
ATOM   5903 C  CE3 . TRP D 2 209 ? 3.436   -15.511 14.101  1.00 37.32  ? 291 TRP D CE3 1 
ATOM   5904 C  CZ2 . TRP D 2 209 ? 1.534   -14.528 12.237  1.00 42.30  ? 291 TRP D CZ2 1 
ATOM   5905 C  CZ3 . TRP D 2 209 ? 2.078   -15.814 14.214  1.00 42.12  ? 291 TRP D CZ3 1 
ATOM   5906 C  CH2 . TRP D 2 209 ? 1.143   -15.319 13.284  1.00 43.42  ? 291 TRP D CH2 1 
ATOM   5907 N  N   . PRO D 2 210 ? 7.465   -15.514 10.267  1.00 33.20  ? 292 PRO D N   1 
ATOM   5908 C  CA  . PRO D 2 210 ? 8.152   -15.142 9.020   1.00 34.53  ? 292 PRO D CA  1 
ATOM   5909 C  C   . PRO D 2 210 ? 8.195   -13.626 8.823   1.00 34.39  ? 292 PRO D C   1 
ATOM   5910 O  O   . PRO D 2 210 ? 7.218   -12.910 9.086   1.00 35.81  ? 292 PRO D O   1 
ATOM   5911 C  CB  . PRO D 2 210 ? 7.308   -15.827 7.943   1.00 35.29  ? 292 PRO D CB  1 
ATOM   5912 C  CG  . PRO D 2 210 ? 5.931   -15.969 8.602   1.00 32.92  ? 292 PRO D CG  1 
ATOM   5913 C  CD  . PRO D 2 210 ? 6.228   -16.272 10.020  1.00 31.11  ? 292 PRO D CD  1 
ATOM   5914 N  N   . ALA D 2 211 ? 9.345   -13.138 8.361   1.00 29.12  ? 293 ALA D N   1 
ATOM   5915 C  CA  . ALA D 2 211 ? 9.552   -11.698 8.240   1.00 32.54  ? 293 ALA D CA  1 
ATOM   5916 C  C   . ALA D 2 211 ? 10.581  -11.419 7.175   1.00 36.23  ? 293 ALA D C   1 
ATOM   5917 O  O   . ALA D 2 211 ? 11.420  -12.268 6.854   1.00 41.44  ? 293 ALA D O   1 
ATOM   5918 C  CB  . ALA D 2 211 ? 10.049  -11.047 9.536   1.00 30.37  ? 293 ALA D CB  1 
ATOM   5919 N  N   . LYS D 2 212 ? 10.524  -10.200 6.655   1.00 33.74  ? 294 LYS D N   1 
ATOM   5920 C  CA  . LYS D 2 212 ? 11.592  -9.651  5.831   1.00 31.97  ? 294 LYS D CA  1 
ATOM   5921 C  C   . LYS D 2 212 ? 12.550  -8.930  6.760   1.00 33.23  ? 294 LYS D C   1 
ATOM   5922 O  O   . LYS D 2 212 ? 12.117  -8.175  7.636   1.00 36.61  ? 294 LYS D O   1 
ATOM   5923 C  CB  . LYS D 2 212 ? 11.045  -8.675  4.791   1.00 29.40  ? 294 LYS D CB  1 
ATOM   5924 C  CG  . LYS D 2 212 ? 10.029  -9.237  3.870   1.00 30.12  ? 294 LYS D CG  1 
ATOM   5925 C  CD  . LYS D 2 212 ? 9.281   -8.104  3.198   1.00 35.67  ? 294 LYS D CD  1 
ATOM   5926 C  CE  . LYS D 2 212 ? 8.332   -8.616  2.118   1.00 36.02  ? 294 LYS D CE  1 
ATOM   5927 N  NZ  . LYS D 2 212 ? 7.678   -7.459  1.483   1.00 35.66  ? 294 LYS D NZ  1 
ATOM   5928 N  N   . ALA D 2 213 ? 13.835  -9.202  6.604   1.00 32.36  ? 295 ALA D N   1 
ATOM   5929 C  CA  . ALA D 2 213 ? 14.873  -8.480  7.331   1.00 32.49  ? 295 ALA D CA  1 
ATOM   5930 C  C   . ALA D 2 213 ? 15.238  -7.252  6.502   1.00 37.08  ? 295 ALA D C   1 
ATOM   5931 O  O   . ALA D 2 213 ? 15.890  -7.379  5.463   1.00 42.38  ? 295 ALA D O   1 
ATOM   5932 C  CB  . ALA D 2 213 ? 16.080  -9.380  7.574   1.00 29.12  ? 295 ALA D CB  1 
ATOM   5933 N  N   . LEU D 2 214 ? 14.802  -6.068  6.939   1.00 32.60  ? 296 LEU D N   1 
ATOM   5934 C  CA  . LEU D 2 214 ? 14.925  -4.892  6.084   1.00 35.99  ? 296 LEU D CA  1 
ATOM   5935 C  C   . LEU D 2 214 ? 16.224  -4.141  6.276   1.00 42.38  ? 296 LEU D C   1 
ATOM   5936 O  O   . LEU D 2 214 ? 16.663  -3.449  5.353   1.00 49.68  ? 296 LEU D O   1 
ATOM   5937 C  CB  . LEU D 2 214 ? 13.776  -3.918  6.339   1.00 36.85  ? 296 LEU D CB  1 
ATOM   5938 C  CG  . LEU D 2 214 ? 12.433  -4.465  5.927   1.00 36.80  ? 296 LEU D CG  1 
ATOM   5939 C  CD1 . LEU D 2 214 ? 11.388  -3.574  6.473   1.00 36.44  ? 296 LEU D CD1 1 
ATOM   5940 C  CD2 . LEU D 2 214 ? 12.383  -4.499  4.425   1.00 37.59  ? 296 LEU D CD2 1 
ATOM   5941 N  N   . ARG D 2 215 ? 16.810  -4.205  7.467   1.00 40.49  ? 297 ARG D N   1 
ATOM   5942 C  CA  . ARG D 2 215 ? 18.089  -3.571  7.734   1.00 40.18  ? 297 ARG D CA  1 
ATOM   5943 C  C   . ARG D 2 215 ? 18.594  -4.086  9.069   1.00 41.56  ? 297 ARG D C   1 
ATOM   5944 O  O   . ARG D 2 215 ? 17.873  -4.776  9.795   1.00 40.47  ? 297 ARG D O   1 
ATOM   5945 C  CB  . ARG D 2 215 ? 17.982  -2.047  7.737   1.00 41.78  ? 297 ARG D CB  1 
ATOM   5946 C  CG  . ARG D 2 215 ? 16.752  -1.531  8.362   1.00 40.78  ? 297 ARG D CG  1 
ATOM   5947 C  CD  . ARG D 2 215 ? 16.746  -0.020  8.410   1.00 44.50  ? 297 ARG D CD  1 
ATOM   5948 N  NE  . ARG D 2 215 ? 15.544  0.396   9.112   1.00 49.35  ? 297 ARG D NE  1 
ATOM   5949 C  CZ  . ARG D 2 215 ? 15.442  1.466   9.880   1.00 51.84  ? 297 ARG D CZ  1 
ATOM   5950 N  NH1 . ARG D 2 215 ? 16.481  2.269   10.036  1.00 53.78  ? 297 ARG D NH1 1 
ATOM   5951 N  NH2 . ARG D 2 215 ? 14.290  1.725   10.486  1.00 52.15  ? 297 ARG D NH2 1 
ATOM   5952 N  N   . ASP D 2 216 ? 19.858  -3.745  9.374   1.00 44.14  ? 298 ASP D N   1 
ATOM   5953 C  CA  . ASP D 2 216 ? 20.519  -4.099  10.623  1.00 45.21  ? 298 ASP D CA  1 
ATOM   5954 C  C   . ASP D 2 216 ? 21.051  -2.841  11.282  1.00 43.47  ? 298 ASP D C   1 
ATOM   5955 O  O   . ASP D 2 216 ? 21.590  -1.963  10.606  1.00 41.64  ? 298 ASP D O   1 
ATOM   5956 C  CB  . ASP D 2 216 ? 21.692  -5.070  10.404  1.00 55.18  ? 298 ASP D CB  1 
ATOM   5957 C  CG  . ASP D 2 216 ? 21.402  -6.111  9.351   1.00 61.41  ? 298 ASP D CG  1 
ATOM   5958 O  OD1 . ASP D 2 216 ? 21.736  -5.888  8.164   1.00 65.52  ? 298 ASP D OD1 1 
ATOM   5959 O  OD2 . ASP D 2 216 ? 20.838  -7.159  9.714   1.00 61.77  ? 298 ASP D OD2 1 
ATOM   5960 N  N   . LYS D 2 217 ? 20.925  -2.768  12.603  1.00 47.07  ? 299 LYS D N   1 
ATOM   5961 C  CA  . LYS D 2 217 ? 21.518  -1.672  13.361  1.00 54.19  ? 299 LYS D CA  1 
ATOM   5962 C  C   . LYS D 2 217 ? 21.687  -2.105  14.807  1.00 52.88  ? 299 LYS D C   1 
ATOM   5963 O  O   . LYS D 2 217 ? 20.726  -2.568  15.429  1.00 48.89  ? 299 LYS D O   1 
ATOM   5964 C  CB  . LYS D 2 217 ? 20.653  -0.411  13.290  1.00 58.32  ? 299 LYS D CB  1 
ATOM   5965 C  CG  . LYS D 2 217 ? 21.384  0.841   13.704  1.00 62.47  ? 299 LYS D CG  1 
ATOM   5966 C  CD  . LYS D 2 217 ? 20.397  1.933   14.093  1.00 65.68  ? 299 LYS D CD  1 
ATOM   5967 N  N   . ASP D 2 218 ? 22.902  -1.954  15.326  1.00 58.89  ? 300 ASP D N   1 
ATOM   5968 C  CA  . ASP D 2 218 ? 23.216  -2.180  16.739  1.00 62.12  ? 300 ASP D CA  1 
ATOM   5969 C  C   . ASP D 2 218 ? 22.690  -3.528  17.236  1.00 59.20  ? 300 ASP D C   1 
ATOM   5970 O  O   . ASP D 2 218 ? 22.019  -3.622  18.267  1.00 60.23  ? 300 ASP D O   1 
ATOM   5971 C  CB  . ASP D 2 218 ? 22.692  -1.031  17.609  1.00 73.49  ? 300 ASP D CB  1 
ATOM   5972 C  CG  . ASP D 2 218 ? 23.183  0.350   17.138  1.00 84.90  ? 300 ASP D CG  1 
ATOM   5973 O  OD1 . ASP D 2 218 ? 24.406  0.625   17.240  1.00 89.72  ? 300 ASP D OD1 1 
ATOM   5974 O  OD2 . ASP D 2 218 ? 22.340  1.170   16.671  1.00 85.59  ? 300 ASP D OD2 1 
ATOM   5975 N  N   . GLY D 2 219 ? 23.010  -4.587  16.501  1.00 53.97  ? 301 GLY D N   1 
ATOM   5976 C  CA  . GLY D 2 219 ? 22.634  -5.916  16.939  1.00 52.76  ? 301 GLY D CA  1 
ATOM   5977 C  C   . GLY D 2 219 ? 21.170  -6.240  16.793  1.00 51.40  ? 301 GLY D C   1 
ATOM   5978 O  O   . GLY D 2 219 ? 20.736  -7.297  17.263  1.00 53.20  ? 301 GLY D O   1 
ATOM   5979 N  N   . GLN D 2 220 ? 20.406  -5.372  16.137  1.00 51.61  ? 302 GLN D N   1 
ATOM   5980 C  CA  . GLN D 2 220 ? 18.976  -5.531  15.929  1.00 50.09  ? 302 GLN D CA  1 
ATOM   5981 C  C   . GLN D 2 220 ? 18.686  -5.668  14.442  1.00 47.05  ? 302 GLN D C   1 
ATOM   5982 O  O   . GLN D 2 220 ? 19.393  -5.107  13.599  1.00 48.49  ? 302 GLN D O   1 
ATOM   5983 C  CB  . GLN D 2 220 ? 18.195  -4.320  16.472  1.00 56.31  ? 302 GLN D CB  1 
ATOM   5984 C  CG  . GLN D 2 220 ? 18.518  -3.939  17.896  1.00 59.63  ? 302 GLN D CG  1 
ATOM   5985 C  CD  . GLN D 2 220 ? 17.683  -4.713  18.854  1.00 60.83  ? 302 GLN D CD  1 
ATOM   5986 O  OE1 . GLN D 2 220 ? 18.048  -5.817  19.229  1.00 65.58  ? 302 GLN D OE1 1 
ATOM   5987 N  NE2 . GLN D 2 220 ? 16.531  -4.168  19.231  1.00 58.68  ? 302 GLN D NE2 1 
ATOM   5988 N  N   . VAL D 2 221 ? 17.620  -6.393  14.131  1.00 40.44  ? 303 VAL D N   1 
ATOM   5989 C  CA  . VAL D 2 221 ? 17.120  -6.542  12.775  1.00 40.03  ? 303 VAL D CA  1 
ATOM   5990 C  C   . VAL D 2 221 ? 15.768  -5.862  12.698  1.00 41.16  ? 303 VAL D C   1 
ATOM   5991 O  O   . VAL D 2 221 ? 14.909  -6.099  13.546  1.00 43.12  ? 303 VAL D O   1 
ATOM   5992 C  CB  . VAL D 2 221 ? 16.990  -8.017  12.379  1.00 37.84  ? 303 VAL D CB  1 
ATOM   5993 C  CG1 . VAL D 2 221 ? 16.325  -8.112  11.052  1.00 36.83  ? 303 VAL D CG1 1 
ATOM   5994 C  CG2 . VAL D 2 221 ? 18.340  -8.675  12.351  1.00 38.99  ? 303 VAL D CG2 1 
ATOM   5995 N  N   . ASP D 2 222 ? 15.578  -5.021  11.688  1.00 41.32  ? 304 ASP D N   1 
ATOM   5996 C  CA  . ASP D 2 222 ? 14.292  -4.372  11.444  1.00 40.15  ? 304 ASP D CA  1 
ATOM   5997 C  C   . ASP D 2 222 ? 13.421  -5.325  10.630  1.00 37.89  ? 304 ASP D C   1 
ATOM   5998 O  O   . ASP D 2 222 ? 13.549  -5.421  9.403   1.00 40.10  ? 304 ASP D O   1 
ATOM   5999 C  CB  . ASP D 2 222 ? 14.507  -3.042  10.730  1.00 45.95  ? 304 ASP D CB  1 
ATOM   6000 C  CG  . ASP D 2 222 ? 13.233  -2.226  10.610  1.00 52.99  ? 304 ASP D CG  1 
ATOM   6001 O  OD1 . ASP D 2 222 ? 12.230  -2.534  11.287  1.00 54.70  ? 304 ASP D OD1 1 
ATOM   6002 O  OD2 . ASP D 2 222 ? 13.236  -1.256  9.833   1.00 56.04  ? 304 ASP D OD2 1 
ATOM   6003 N  N   . ALA D 2 223 ? 12.534  -6.042  11.312  1.00 35.66  ? 305 ALA D N   1 
ATOM   6004 C  CA  . ALA D 2 223 ? 11.721  -7.084  10.687  1.00 36.89  ? 305 ALA D CA  1 
ATOM   6005 C  C   . ALA D 2 223 ? 10.346  -6.553  10.257  1.00 39.59  ? 305 ALA D C   1 
ATOM   6006 O  O   . ALA D 2 223 ? 9.649   -5.876  11.031  1.00 38.96  ? 305 ALA D O   1 
ATOM   6007 C  CB  . ALA D 2 223 ? 11.558  -8.271  11.644  1.00 30.85  ? 305 ALA D CB  1 
ATOM   6008 N  N   . ARG D 2 224 ? 9.955   -6.868  9.023   1.00 34.32  ? 306 ARG D N   1 
ATOM   6009 C  CA  . ARG D 2 224 ? 8.607   -6.596  8.545   1.00 35.11  ? 306 ARG D CA  1 
ATOM   6010 C  C   . ARG D 2 224 ? 7.891   -7.941  8.393   1.00 33.90  ? 306 ARG D C   1 
ATOM   6011 O  O   . ARG D 2 224 ? 8.250   -8.754  7.538   1.00 31.91  ? 306 ARG D O   1 
ATOM   6012 C  CB  . ARG D 2 224 ? 8.650   -5.800  7.243   1.00 38.89  ? 306 ARG D CB  1 
ATOM   6013 C  CG  . ARG D 2 224 ? 7.311   -5.297  6.771   1.00 44.59  ? 306 ARG D CG  1 
ATOM   6014 C  CD  . ARG D 2 224 ? 7.359   -3.832  6.506   1.00 51.46  ? 306 ARG D CD  1 
ATOM   6015 N  NE  . ARG D 2 224 ? 6.016   -3.272  6.432   1.00 59.81  ? 306 ARG D NE  1 
ATOM   6016 C  CZ  . ARG D 2 224 ? 5.506   -2.720  5.333   1.00 65.87  ? 306 ARG D CZ  1 
ATOM   6017 N  NH1 . ARG D 2 224 ? 6.249   -2.659  4.220   1.00 69.15  ? 306 ARG D NH1 1 
ATOM   6018 N  NH2 . ARG D 2 224 ? 4.265   -2.221  5.346   1.00 64.25  ? 306 ARG D NH2 1 
ATOM   6019 N  N   . PHE D 2 225 ? 6.880   -8.171  9.227   1.00 34.19  ? 307 PHE D N   1 
ATOM   6020 C  CA  . PHE D 2 225 ? 6.243   -9.476  9.347   1.00 35.30  ? 307 PHE D CA  1 
ATOM   6021 C  C   . PHE D 2 225 ? 5.259   -9.789  8.218   1.00 36.24  ? 307 PHE D C   1 
ATOM   6022 O  O   . PHE D 2 225 ? 4.491   -8.936  7.779   1.00 36.88  ? 307 PHE D O   1 
ATOM   6023 C  CB  . PHE D 2 225 ? 5.526   -9.551  10.689  1.00 37.39  ? 307 PHE D CB  1 
ATOM   6024 C  CG  . PHE D 2 225 ? 6.462   -9.543  11.843  1.00 41.68  ? 307 PHE D CG  1 
ATOM   6025 C  CD1 . PHE D 2 225 ? 7.103   -10.706 12.234  1.00 43.05  ? 307 PHE D CD1 1 
ATOM   6026 C  CD2 . PHE D 2 225 ? 6.744   -8.376  12.513  1.00 42.85  ? 307 PHE D CD2 1 
ATOM   6027 C  CE1 . PHE D 2 225 ? 7.990   -10.710 13.301  1.00 41.49  ? 307 PHE D CE1 1 
ATOM   6028 C  CE2 . PHE D 2 225 ? 7.645   -8.374  13.581  1.00 41.84  ? 307 PHE D CE2 1 
ATOM   6029 C  CZ  . PHE D 2 225 ? 8.266   -9.537  13.967  1.00 39.74  ? 307 PHE D CZ  1 
ATOM   6030 N  N   . PHE D 2 226 ? 5.277   -11.036 7.757   1.00 37.33  ? 308 PHE D N   1 
ATOM   6031 C  CA  . PHE D 2 226 ? 4.236   -11.507 6.862   1.00 36.09  ? 308 PHE D CA  1 
ATOM   6032 C  C   . PHE D 2 226 ? 2.915   -11.615 7.613   1.00 38.69  ? 308 PHE D C   1 
ATOM   6033 O  O   . PHE D 2 226 ? 2.870   -11.731 8.845   1.00 38.80  ? 308 PHE D O   1 
ATOM   6034 C  CB  . PHE D 2 226 ? 4.609   -12.860 6.266   1.00 37.81  ? 308 PHE D CB  1 
ATOM   6035 C  CG  . PHE D 2 226 ? 5.607   -12.769 5.155   1.00 42.90  ? 308 PHE D CG  1 
ATOM   6036 C  CD1 . PHE D 2 226 ? 6.936   -12.477 5.422   1.00 43.08  ? 308 PHE D CD1 1 
ATOM   6037 C  CD2 . PHE D 2 226 ? 5.219   -12.962 3.839   1.00 46.38  ? 308 PHE D CD2 1 
ATOM   6038 C  CE1 . PHE D 2 226 ? 7.860   -12.389 4.405   1.00 45.17  ? 308 PHE D CE1 1 
ATOM   6039 C  CE2 . PHE D 2 226 ? 6.145   -12.874 2.811   1.00 46.65  ? 308 PHE D CE2 1 
ATOM   6040 C  CZ  . PHE D 2 226 ? 7.464   -12.591 3.094   1.00 46.61  ? 308 PHE D CZ  1 
ATOM   6041 N  N   . GLY D 2 227 ? 1.823   -11.581 6.855   1.00 36.53  ? 309 GLY D N   1 
ATOM   6042 C  CA  . GLY D 2 227 ? 0.531   -11.601 7.497   1.00 36.59  ? 309 GLY D CA  1 
ATOM   6043 C  C   . GLY D 2 227 ? 0.157   -10.268 8.112   1.00 36.85  ? 309 GLY D C   1 
ATOM   6044 O  O   . GLY D 2 227 ? -0.806  -9.627  7.681   1.00 38.94  ? 309 GLY D O   1 
ATOM   6045 N  N   . GLN D 2 228 ? 0.926   -9.824  9.102   1.00 35.61  ? 310 GLN D N   1 
ATOM   6046 C  CA  . GLN D 2 228 ? 0.568   -8.619  9.845   1.00 40.10  ? 310 GLN D CA  1 
ATOM   6047 C  C   . GLN D 2 228 ? 1.078   -7.345  9.177   1.00 39.69  ? 310 GLN D C   1 
ATOM   6048 O  O   . GLN D 2 228 ? 0.426   -6.295  9.279   1.00 42.04  ? 310 GLN D O   1 
ATOM   6049 C  CB  . GLN D 2 228 ? 1.096   -8.717  11.277  1.00 42.12  ? 310 GLN D CB  1 
ATOM   6050 C  CG  . GLN D 2 228 ? 0.220   -9.542  12.183  1.00 45.12  ? 310 GLN D CG  1 
ATOM   6051 C  CD  . GLN D 2 228 ? -0.130  -10.869 11.568  1.00 45.17  ? 310 GLN D CD  1 
ATOM   6052 O  OE1 . GLN D 2 228 ? 0.742   -11.700 11.326  1.00 44.82  ? 310 GLN D OE1 1 
ATOM   6053 N  NE2 . GLN D 2 228 ? -1.401  -11.063 11.274  1.00 45.71  ? 310 GLN D NE2 1 
ATOM   6054 N  N   . HIS D 2 229 ? 2.216   -7.420  8.491   1.00 37.64  ? 311 HIS D N   1 
ATOM   6055 C  CA  . HIS D 2 229 ? 2.805   -6.373  7.658   1.00 39.32  ? 311 HIS D CA  1 
ATOM   6056 C  C   . HIS D 2 229 ? 3.370   -5.221  8.463   1.00 41.57  ? 311 HIS D C   1 
ATOM   6057 O  O   . HIS D 2 229 ? 3.888   -4.277  7.865   1.00 45.23  ? 311 HIS D O   1 
ATOM   6058 C  CB  . HIS D 2 229 ? 1.829   -5.825  6.602   1.00 36.91  ? 311 HIS D CB  1 
ATOM   6059 C  CG  . HIS D 2 229 ? 1.396   -6.853  5.603   1.00 45.98  ? 311 HIS D CG  1 
ATOM   6060 N  ND1 . HIS D 2 229 ? 0.184   -6.797  4.947   1.00 50.43  ? 311 HIS D ND1 1 
ATOM   6061 C  CD2 . HIS D 2 229 ? 2.008   -7.981  5.164   1.00 48.17  ? 311 HIS D CD2 1 
ATOM   6062 C  CE1 . HIS D 2 229 ? 0.070   -7.843  4.145   1.00 50.71  ? 311 HIS D CE1 1 
ATOM   6063 N  NE2 . HIS D 2 229 ? 1.163   -8.576  4.256   1.00 49.44  ? 311 HIS D NE2 1 
ATOM   6064 N  N   . ASP D 2 230 ? 3.304   -5.267  9.790   1.00 38.86  ? 312 ASP D N   1 
ATOM   6065 C  CA  . ASP D 2 230 ? 3.912   -4.247  10.629  1.00 35.23  ? 312 ASP D CA  1 
ATOM   6066 C  C   . ASP D 2 230 ? 5.405   -4.542  10.811  1.00 34.66  ? 312 ASP D C   1 
ATOM   6067 O  O   . ASP D 2 230 ? 5.901   -5.612  10.442  1.00 37.12  ? 312 ASP D O   1 
ATOM   6068 C  CB  . ASP D 2 230 ? 3.199   -4.179  11.976  1.00 34.62  ? 312 ASP D CB  1 
ATOM   6069 C  CG  . ASP D 2 230 ? 3.322   -5.472  12.746  1.00 42.30  ? 312 ASP D CG  1 
ATOM   6070 O  OD1 . ASP D 2 230 ? 3.149   -6.526  12.100  1.00 46.17  ? 312 ASP D OD1 1 
ATOM   6071 O  OD2 . ASP D 2 230 ? 3.616   -5.456  13.966  1.00 41.67  ? 312 ASP D OD2 1 
ATOM   6072 N  N   . ARG D 2 231 ? 6.126   -3.581  11.389  1.00 47.09  ? 313 ARG D N   1 
ATOM   6073 C  CA  . ARG D 2 231 ? 7.573   -3.677  11.571  1.00 46.14  ? 313 ARG D CA  1 
ATOM   6074 C  C   . ARG D 2 231 ? 7.958   -3.657  13.044  1.00 43.54  ? 313 ARG D C   1 
ATOM   6075 O  O   . ARG D 2 231 ? 7.288   -3.042  13.879  1.00 44.48  ? 313 ARG D O   1 
ATOM   6076 C  CB  . ARG D 2 231 ? 8.310   -2.526  10.881  1.00 51.82  ? 313 ARG D CB  1 
ATOM   6077 C  CG  . ARG D 2 231 ? 8.943   -2.910  9.577   1.00 55.66  ? 313 ARG D CG  1 
ATOM   6078 C  CD  . ARG D 2 231 ? 9.839   -1.787  9.008   1.00 59.39  ? 313 ARG D CD  1 
ATOM   6079 N  NE  . ARG D 2 231 ? 9.412   -0.428  9.327   1.00 62.38  ? 313 ARG D NE  1 
ATOM   6080 C  CZ  . ARG D 2 231 ? 10.196  0.487   9.890   1.00 65.69  ? 313 ARG D CZ  1 
ATOM   6081 N  NH1 . ARG D 2 231 ? 11.447  0.190   10.202  1.00 66.08  ? 313 ARG D NH1 1 
ATOM   6082 N  NH2 . ARG D 2 231 ? 9.736   1.705   10.140  1.00 67.67  ? 313 ARG D NH2 1 
ATOM   6083 N  N   . ALA D 2 232 ? 9.074   -4.294  13.353  1.00 37.18  ? 314 ALA D N   1 
ATOM   6084 C  CA  . ALA D 2 232 ? 9.554   -4.284  14.725  1.00 37.37  ? 314 ALA D CA  1 
ATOM   6085 C  C   . ALA D 2 232 ? 11.038  -4.616  14.738  1.00 39.81  ? 314 ALA D C   1 
ATOM   6086 O  O   . ALA D 2 232 ? 11.501  -5.432  13.943  1.00 39.21  ? 314 ALA D O   1 
ATOM   6087 C  CB  . ALA D 2 232 ? 8.778   -5.281  15.587  1.00 37.56  ? 314 ALA D CB  1 
ATOM   6088 N  N   . TRP D 2 233 ? 11.771  -3.988  15.653  1.00 36.88  ? 315 TRP D N   1 
ATOM   6089 C  CA  . TRP D 2 233 ? 13.168  -4.339  15.894  1.00 36.16  ? 315 TRP D CA  1 
ATOM   6090 C  C   . TRP D 2 233 ? 13.265  -5.634  16.693  1.00 43.10  ? 315 TRP D C   1 
ATOM   6091 O  O   . TRP D 2 233 ? 12.593  -5.797  17.716  1.00 51.33  ? 315 TRP D O   1 
ATOM   6092 C  CB  . TRP D 2 233 ? 13.863  -3.215  16.655  1.00 39.25  ? 315 TRP D CB  1 
ATOM   6093 C  CG  . TRP D 2 233 ? 14.095  -1.983  15.830  1.00 43.54  ? 315 TRP D CG  1 
ATOM   6094 C  CD1 . TRP D 2 233 ? 13.430  -0.803  15.917  1.00 41.29  ? 315 TRP D CD1 1 
ATOM   6095 C  CD2 . TRP D 2 233 ? 15.075  -1.818  14.794  1.00 44.10  ? 315 TRP D CD2 1 
ATOM   6096 N  NE1 . TRP D 2 233 ? 13.924  0.087   15.003  1.00 42.21  ? 315 TRP D NE1 1 
ATOM   6097 C  CE2 . TRP D 2 233 ? 14.938  -0.512  14.300  1.00 40.91  ? 315 TRP D CE2 1 
ATOM   6098 C  CE3 . TRP D 2 233 ? 16.050  -2.655  14.237  1.00 43.70  ? 315 TRP D CE3 1 
ATOM   6099 C  CZ2 . TRP D 2 233 ? 15.740  -0.016  13.273  1.00 41.71  ? 315 TRP D CZ2 1 
ATOM   6100 C  CZ3 . TRP D 2 233 ? 16.847  -2.161  13.215  1.00 44.03  ? 315 TRP D CZ3 1 
ATOM   6101 C  CH2 . TRP D 2 233 ? 16.685  -0.857  12.745  1.00 46.40  ? 315 TRP D CH2 1 
ATOM   6102 N  N   . VAL D 2 234 ? 14.113  -6.547  16.245  1.00 35.83  ? 316 VAL D N   1 
ATOM   6103 C  CA  . VAL D 2 234 ? 14.253  -7.863  16.867  1.00 39.10  ? 316 VAL D CA  1 
ATOM   6104 C  C   . VAL D 2 234 ? 15.737  -8.141  17.065  1.00 39.71  ? 316 VAL D C   1 
ATOM   6105 O  O   . VAL D 2 234 ? 16.492  -8.076  16.092  1.00 39.27  ? 316 VAL D O   1 
ATOM   6106 C  CB  . VAL D 2 234 ? 13.620  -8.955  15.991  1.00 40.83  ? 316 VAL D CB  1 
ATOM   6107 C  CG1 . VAL D 2 234 ? 13.844  -10.322 16.603  1.00 40.90  ? 316 VAL D CG1 1 
ATOM   6108 C  CG2 . VAL D 2 234 ? 12.161  -8.691  15.764  1.00 32.14  ? 316 VAL D CG2 1 
ATOM   6109 N  N   . PRO D 2 235 ? 16.207  -8.471  18.267  1.00 45.01  ? 317 PRO D N   1 
ATOM   6110 C  CA  . PRO D 2 235 ? 17.643  -8.748  18.434  1.00 41.65  ? 317 PRO D CA  1 
ATOM   6111 C  C   . PRO D 2 235 ? 18.112  -9.862  17.502  1.00 40.75  ? 317 PRO D C   1 
ATOM   6112 O  O   . PRO D 2 235 ? 17.420  -10.858 17.266  1.00 39.14  ? 317 PRO D O   1 
ATOM   6113 C  CB  . PRO D 2 235 ? 17.766  -9.138  19.911  1.00 40.14  ? 317 PRO D CB  1 
ATOM   6114 C  CG  . PRO D 2 235 ? 16.373  -9.453  20.366  1.00 41.63  ? 317 PRO D CG  1 
ATOM   6115 C  CD  . PRO D 2 235 ? 15.474  -8.589  19.539  1.00 46.14  ? 317 PRO D CD  1 
ATOM   6116 N  N   . ILE D 2 236 ? 19.303  -9.663  16.940  1.00 42.81  ? 318 ILE D N   1 
ATOM   6117 C  CA  . ILE D 2 236 ? 19.727  -10.498 15.827  1.00 41.16  ? 318 ILE D CA  1 
ATOM   6118 C  C   . ILE D 2 236 ? 19.849  -11.962 16.236  1.00 44.79  ? 318 ILE D C   1 
ATOM   6119 O  O   . ILE D 2 236 ? 19.731  -12.853 15.387  1.00 45.51  ? 318 ILE D O   1 
ATOM   6120 C  CB  . ILE D 2 236 ? 21.040  -9.949  15.245  1.00 38.82  ? 318 ILE D CB  1 
ATOM   6121 C  CG1 . ILE D 2 236 ? 21.245  -10.476 13.834  1.00 38.12  ? 318 ILE D CG1 1 
ATOM   6122 C  CG2 . ILE D 2 236 ? 22.202  -10.340 16.122  1.00 36.49  ? 318 ILE D CG2 1 
ATOM   6123 C  CD1 . ILE D 2 236 ? 22.491  -9.967  13.192  1.00 41.02  ? 318 ILE D CD1 1 
ATOM   6124 N  N   . ASN D 2 237 ? 20.096  -12.243 17.528  1.00 46.47  ? 319 ASN D N   1 
ATOM   6125 C  CA  . ASN D 2 237 ? 20.149  -13.624 18.000  1.00 48.51  ? 319 ASN D CA  1 
ATOM   6126 C  C   . ASN D 2 237 ? 18.837  -14.354 17.801  1.00 49.03  ? 319 ASN D C   1 
ATOM   6127 O  O   . ASN D 2 237 ? 18.822  -15.589 17.834  1.00 50.42  ? 319 ASN D O   1 
ATOM   6128 C  CB  . ASN D 2 237 ? 20.495  -13.695 19.479  1.00 56.71  ? 319 ASN D CB  1 
ATOM   6129 C  CG  . ASN D 2 237 ? 21.960  -13.963 19.716  1.00 66.37  ? 319 ASN D CG  1 
ATOM   6130 O  OD1 . ASN D 2 237 ? 22.727  -14.159 18.761  1.00 66.08  ? 319 ASN D OD1 1 
ATOM   6131 N  ND2 . ASN D 2 237 ? 22.374  -13.961 20.995  1.00 71.70  ? 319 ASN D ND2 1 
ATOM   6132 N  N   . ASN D 2 238 ? 17.735  -13.621 17.621  1.00 48.45  ? 320 ASN D N   1 
ATOM   6133 C  CA  . ASN D 2 238 ? 16.412  -14.202 17.464  1.00 49.54  ? 320 ASN D CA  1 
ATOM   6134 C  C   . ASN D 2 238 ? 15.978  -14.258 16.008  1.00 49.65  ? 320 ASN D C   1 
ATOM   6135 O  O   . ASN D 2 238 ? 14.772  -14.216 15.722  1.00 50.98  ? 320 ASN D O   1 
ATOM   6136 C  CB  . ASN D 2 238 ? 15.389  -13.411 18.278  1.00 59.71  ? 320 ASN D CB  1 
ATOM   6137 C  CG  . ASN D 2 238 ? 15.361  -13.808 19.750  1.00 68.17  ? 320 ASN D CG  1 
ATOM   6138 O  OD1 . ASN D 2 238 ? 15.651  -14.957 20.114  1.00 69.12  ? 320 ASN D OD1 1 
ATOM   6139 N  ND2 . ASN D 2 238 ? 14.993  -12.856 20.604  1.00 72.81  ? 320 ASN D ND2 1 
ATOM   6140 N  N   . CYS D 2 239 ? 16.929  -14.342 15.076  1.00 45.53  ? 321 CYS D N   1 
ATOM   6141 C  CA  . CYS D 2 239 ? 16.606  -14.351 13.656  1.00 41.91  ? 321 CYS D CA  1 
ATOM   6142 C  C   . CYS D 2 239 ? 17.334  -15.492 12.972  1.00 44.44  ? 321 CYS D C   1 
ATOM   6143 O  O   . CYS D 2 239 ? 18.559  -15.466 12.829  1.00 44.06  ? 321 CYS D O   1 
ATOM   6144 C  CB  . CYS D 2 239 ? 16.961  -13.031 13.000  1.00 43.17  ? 321 CYS D CB  1 
ATOM   6145 S  SG  . CYS D 2 239 ? 15.828  -11.764 13.450  1.00 46.71  ? 321 CYS D SG  1 
ATOM   6146 N  N   . TYR D 2 240 ? 16.575  -16.471 12.518  1.00 42.67  ? 322 TYR D N   1 
ATOM   6147 C  CA  . TYR D 2 240 ? 17.128  -17.545 11.726  1.00 38.08  ? 322 TYR D CA  1 
ATOM   6148 C  C   . TYR D 2 240 ? 16.785  -17.272 10.270  1.00 40.90  ? 322 TYR D C   1 
ATOM   6149 O  O   . TYR D 2 240 ? 15.773  -16.626 9.975   1.00 41.92  ? 322 TYR D O   1 
ATOM   6150 C  CB  . TYR D 2 240 ? 16.561  -18.893 12.190  1.00 37.48  ? 322 TYR D CB  1 
ATOM   6151 C  CG  . TYR D 2 240 ? 16.807  -19.260 13.672  1.00 36.39  ? 322 TYR D CG  1 
ATOM   6152 C  CD1 . TYR D 2 240 ? 18.020  -18.969 14.306  1.00 37.50  ? 322 TYR D CD1 1 
ATOM   6153 C  CD2 . TYR D 2 240 ? 15.829  -19.911 14.422  1.00 34.01  ? 322 TYR D CD2 1 
ATOM   6154 C  CE1 . TYR D 2 240 ? 18.240  -19.304 15.618  1.00 31.39  ? 322 TYR D CE1 1 
ATOM   6155 C  CE2 . TYR D 2 240 ? 16.044  -20.255 15.742  1.00 34.26  ? 322 TYR D CE2 1 
ATOM   6156 C  CZ  . TYR D 2 240 ? 17.253  -19.954 16.339  1.00 37.31  ? 322 TYR D CZ  1 
ATOM   6157 O  OH  . TYR D 2 240 ? 17.459  -20.294 17.667  1.00 36.44  ? 322 TYR D OH  1 
ATOM   6158 N  N   . LEU D 2 241 ? 17.648  -17.723 9.354   1.00 38.24  ? 323 LEU D N   1 
ATOM   6159 C  CA  . LEU D 2 241 ? 17.248  -17.720 7.952   1.00 34.78  ? 323 LEU D CA  1 
ATOM   6160 C  C   . LEU D 2 241 ? 16.069  -18.661 7.763   1.00 36.68  ? 323 LEU D C   1 
ATOM   6161 O  O   . LEU D 2 241 ? 15.928  -19.667 8.473   1.00 34.62  ? 323 LEU D O   1 
ATOM   6162 C  CB  . LEU D 2 241 ? 18.390  -18.146 7.039   1.00 33.71  ? 323 LEU D CB  1 
ATOM   6163 C  CG  . LEU D 2 241 ? 19.673  -17.306 7.058   1.00 38.04  ? 323 LEU D CG  1 
ATOM   6164 C  CD1 . LEU D 2 241 ? 20.681  -17.908 6.101   1.00 35.85  ? 323 LEU D CD1 1 
ATOM   6165 C  CD2 . LEU D 2 241 ? 19.383  -15.843 6.719   1.00 31.09  ? 323 LEU D CD2 1 
ATOM   6166 N  N   . MET D 2 242 ? 15.209  -18.322 6.798   1.00 37.58  ? 324 MET D N   1 
ATOM   6167 C  CA  . MET D 2 242 ? 13.971  -19.071 6.611   1.00 36.69  ? 324 MET D CA  1 
ATOM   6168 C  C   . MET D 2 242 ? 14.257  -20.540 6.337   1.00 37.34  ? 324 MET D C   1 
ATOM   6169 O  O   . MET D 2 242 ? 15.135  -20.880 5.540   1.00 38.73  ? 324 MET D O   1 
ATOM   6170 C  CB  . MET D 2 242 ? 13.147  -18.476 5.463   1.00 35.66  ? 324 MET D CB  1 
ATOM   6171 C  CG  . MET D 2 242 ? 11.807  -19.187 5.218   1.00 36.63  ? 324 MET D CG  1 
ATOM   6172 S  SD  . MET D 2 242 ? 10.925  -19.600 6.737   1.00 40.64  ? 324 MET D SD  1 
ATOM   6173 C  CE  . MET D 2 242 ? 10.751  -17.963 7.453   1.00 41.86  ? 324 MET D CE  1 
ATOM   6174 N  N   . SER D 2 243 ? 13.507  -21.412 7.001   1.00 35.50  ? 325 SER D N   1 
ATOM   6175 C  CA  . SER D 2 243 ? 13.642  -22.845 6.805   1.00 41.50  ? 325 SER D CA  1 
ATOM   6176 C  C   . SER D 2 243 ? 12.345  -23.419 6.244   1.00 46.58  ? 325 SER D C   1 
ATOM   6177 O  O   . SER D 2 243 ? 11.268  -22.843 6.405   1.00 48.51  ? 325 SER D O   1 
ATOM   6178 C  CB  . SER D 2 243 ? 14.013  -23.560 8.121   1.00 37.18  ? 325 SER D CB  1 
ATOM   6179 O  OG  . SER D 2 243 ? 12.895  -23.661 8.981   1.00 36.45  ? 325 SER D OG  1 
ATOM   6180 N  N   . LYS D 2 244 ? 12.463  -24.575 5.577   1.00 48.87  ? 326 LYS D N   1 
ATOM   6181 C  CA  . LYS D 2 244 ? 11.283  -25.257 5.038   1.00 48.76  ? 326 LYS D CA  1 
ATOM   6182 C  C   . LYS D 2 244 ? 10.408  -25.833 6.147   1.00 47.67  ? 326 LYS D C   1 
ATOM   6183 O  O   . LYS D 2 244 ? 9.179   -25.793 6.051   1.00 50.55  ? 326 LYS D O   1 
ATOM   6184 C  CB  . LYS D 2 244 ? 11.703  -26.370 4.088   1.00 52.92  ? 326 LYS D CB  1 
ATOM   6185 C  CG  . LYS D 2 244 ? 10.921  -26.365 2.807   1.00 63.25  ? 326 LYS D CG  1 
ATOM   6186 C  CD  . LYS D 2 244 ? 11.602  -27.227 1.744   1.00 71.10  ? 326 LYS D CD  1 
ATOM   6187 C  CE  . LYS D 2 244 ? 13.070  -26.850 1.567   1.00 73.04  ? 326 LYS D CE  1 
ATOM   6188 N  NZ  . LYS D 2 244 ? 13.760  -27.809 0.652   1.00 78.47  ? 326 LYS D NZ  1 
ATOM   6189 N  N   . GLU D 2 245 ? 11.017  -26.370 7.202   1.00 42.93  ? 327 GLU D N   1 
ATOM   6190 C  CA  . GLU D 2 245 ? 10.284  -26.957 8.309   1.00 44.90  ? 327 GLU D CA  1 
ATOM   6191 C  C   . GLU D 2 245 ? 9.877   -25.908 9.333   1.00 43.33  ? 327 GLU D C   1 
ATOM   6192 O  O   . GLU D 2 245 ? 10.488  -24.847 9.463   1.00 45.45  ? 327 GLU D O   1 
ATOM   6193 C  CB  . GLU D 2 245 ? 11.107  -28.046 8.986   1.00 52.58  ? 327 GLU D CB  1 
ATOM   6194 C  CG  . GLU D 2 245 ? 11.751  -29.049 8.017   1.00 66.16  ? 327 GLU D CG  1 
ATOM   6195 C  CD  . GLU D 2 245 ? 12.991  -28.522 7.263   1.00 72.41  ? 327 GLU D CD  1 
ATOM   6196 O  OE1 . GLU D 2 245 ? 13.418  -29.206 6.308   1.00 76.62  ? 327 GLU D OE1 1 
ATOM   6197 O  OE2 . GLU D 2 245 ? 13.543  -27.452 7.609   1.00 73.51  ? 327 GLU D OE2 1 
ATOM   6198 N  N   . ILE D 2 246 ? 8.820   -26.226 10.068  1.00 41.93  ? 328 ILE D N   1 
ATOM   6199 C  CA  . ILE D 2 246 ? 8.303   -25.350 11.104  1.00 42.31  ? 328 ILE D CA  1 
ATOM   6200 C  C   . ILE D 2 246 ? 8.238   -26.180 12.377  1.00 43.73  ? 328 ILE D C   1 
ATOM   6201 O  O   . ILE D 2 246 ? 7.182   -26.745 12.686  1.00 50.21  ? 328 ILE D O   1 
ATOM   6202 C  CB  . ILE D 2 246 ? 6.931   -24.772 10.713  1.00 42.52  ? 328 ILE D CB  1 
ATOM   6203 C  CG1 . ILE D 2 246 ? 7.073   -23.929 9.460   1.00 38.83  ? 328 ILE D CG1 1 
ATOM   6204 C  CG2 . ILE D 2 246 ? 6.396   -23.820 11.788  1.00 40.83  ? 328 ILE D CG2 1 
ATOM   6205 C  CD1 . ILE D 2 246 ? 6.125   -24.309 8.411   1.00 39.96  ? 328 ILE D CD1 1 
ATOM   6206 N  N   . PRO D 2 247 ? 9.330   -26.267 13.144  1.00 42.16  ? 329 PRO D N   1 
ATOM   6207 C  CA  . PRO D 2 247 ? 9.389   -27.205 14.283  1.00 42.49  ? 329 PRO D CA  1 
ATOM   6208 C  C   . PRO D 2 247 ? 8.692   -26.733 15.554  1.00 44.42  ? 329 PRO D C   1 
ATOM   6209 O  O   . PRO D 2 247 ? 8.598   -27.515 16.518  1.00 45.88  ? 329 PRO D O   1 
ATOM   6210 C  CB  . PRO D 2 247 ? 10.904  -27.343 14.546  1.00 42.80  ? 329 PRO D CB  1 
ATOM   6211 C  CG  . PRO D 2 247 ? 11.591  -26.478 13.507  1.00 37.73  ? 329 PRO D CG  1 
ATOM   6212 C  CD  . PRO D 2 247 ? 10.584  -25.517 12.987  1.00 38.14  ? 329 PRO D CD  1 
ATOM   6213 N  N   . PHE D 2 248 ? 8.251   -25.488 15.625  1.00 41.29  ? 330 PHE D N   1 
ATOM   6214 C  CA  . PHE D 2 248 ? 7.621   -24.994 16.837  1.00 48.45  ? 330 PHE D CA  1 
ATOM   6215 C  C   . PHE D 2 248 ? 6.107   -25.012 16.678  1.00 51.70  ? 330 PHE D C   1 
ATOM   6216 O  O   . PHE D 2 248 ? 5.575   -25.097 15.566  1.00 55.32  ? 330 PHE D O   1 
ATOM   6217 C  CB  . PHE D 2 248 ? 8.109   -23.587 17.158  1.00 40.91  ? 330 PHE D CB  1 
ATOM   6218 C  CG  . PHE D 2 248 ? 8.058   -22.679 15.995  1.00 38.48  ? 330 PHE D CG  1 
ATOM   6219 C  CD1 . PHE D 2 248 ? 6.891   -21.978 15.700  1.00 39.17  ? 330 PHE D CD1 1 
ATOM   6220 C  CD2 . PHE D 2 248 ? 9.146   -22.552 15.160  1.00 36.06  ? 330 PHE D CD2 1 
ATOM   6221 C  CE1 . PHE D 2 248 ? 6.825   -21.126 14.603  1.00 37.41  ? 330 PHE D CE1 1 
ATOM   6222 C  CE2 . PHE D 2 248 ? 9.090   -21.721 14.051  1.00 40.75  ? 330 PHE D CE2 1 
ATOM   6223 C  CZ  . PHE D 2 248 ? 7.932   -21.006 13.768  1.00 40.25  ? 330 PHE D CZ  1 
ATOM   6224 N  N   . SER D 2 249 ? 5.413   -24.960 17.808  1.00 58.79  ? 331 SER D N   1 
ATOM   6225 C  CA  . SER D 2 249 ? 3.962   -24.937 17.747  1.00 66.38  ? 331 SER D CA  1 
ATOM   6226 C  C   . SER D 2 249 ? 3.470   -23.503 17.756  1.00 64.73  ? 331 SER D C   1 
ATOM   6227 O  O   . SER D 2 249 ? 4.182   -22.581 18.160  1.00 65.05  ? 331 SER D O   1 
ATOM   6228 C  CB  . SER D 2 249 ? 3.340   -25.727 18.892  1.00 78.95  ? 331 SER D CB  1 
ATOM   6229 O  OG  . SER D 2 249 ? 3.066   -27.061 18.476  1.00 85.18  ? 331 SER D OG  1 
ATOM   6230 N  N   . VAL D 2 250 ? 2.250   -23.324 17.250  1.00 63.67  ? 332 VAL D N   1 
ATOM   6231 C  CA  . VAL D 2 250 ? 1.627   -22.012 17.107  1.00 63.32  ? 332 VAL D CA  1 
ATOM   6232 C  C   . VAL D 2 250 ? 0.137   -22.133 17.413  1.00 68.80  ? 332 VAL D C   1 
ATOM   6233 O  O   . VAL D 2 250 ? -0.701  -21.629 16.658  1.00 71.16  ? 332 VAL D O   1 
ATOM   6234 C  CB  . VAL D 2 250 ? 1.842   -21.426 15.694  1.00 54.36  ? 332 VAL D CB  1 
ATOM   6235 C  CG1 . VAL D 2 250 ? 3.263   -20.945 15.507  1.00 50.41  ? 332 VAL D CG1 1 
ATOM   6236 C  CG2 . VAL D 2 250 ? 1.498   -22.438 14.610  1.00 52.00  ? 332 VAL D CG2 1 
ATOM   6237 N  N   . LYS D 2 251 ? -0.207  -22.788 18.526  1.00 66.96  ? 333 LYS D N   1 
ATOM   6238 C  CA  . LYS D 2 251 ? -1.596  -23.196 18.740  1.00 73.33  ? 333 LYS D CA  1 
ATOM   6239 C  C   . LYS D 2 251 ? -2.536  -21.991 18.815  1.00 75.35  ? 333 LYS D C   1 
ATOM   6240 O  O   . LYS D 2 251 ? -3.626  -22.009 18.227  1.00 77.47  ? 333 LYS D O   1 
ATOM   6241 C  CB  . LYS D 2 251 ? -1.713  -24.059 20.005  1.00 76.35  ? 333 LYS D CB  1 
ATOM   6242 N  N   . LYS D 2 252 ? -2.122  -20.920 19.500  1.00 70.09  ? 334 LYS D N   1 
ATOM   6243 C  CA  . LYS D 2 252 ? -3.048  -19.827 19.764  1.00 64.99  ? 334 LYS D CA  1 
ATOM   6244 C  C   . LYS D 2 252 ? -3.324  -18.971 18.540  1.00 59.97  ? 334 LYS D C   1 
ATOM   6245 O  O   . LYS D 2 252 ? -4.261  -18.174 18.568  1.00 63.63  ? 334 LYS D O   1 
ATOM   6246 C  CB  . LYS D 2 252 ? -2.507  -18.940 20.874  1.00 64.32  ? 334 LYS D CB  1 
ATOM   6247 C  CG  . LYS D 2 252 ? -2.872  -19.409 22.240  1.00 71.08  ? 334 LYS D CG  1 
ATOM   6248 C  CD  . LYS D 2 252 ? -2.461  -18.394 23.283  1.00 72.26  ? 334 LYS D CD  1 
ATOM   6249 C  CE  . LYS D 2 252 ? -2.878  -18.873 24.658  1.00 77.66  ? 334 LYS D CE  1 
ATOM   6250 N  NZ  . LYS D 2 252 ? -2.540  -20.327 24.828  1.00 81.43  ? 334 LYS D NZ  1 
ATOM   6251 N  N   . THR D 2 253 ? -2.517  -19.081 17.483  1.00 54.17  ? 335 THR D N   1 
ATOM   6252 C  CA  . THR D 2 253 ? -2.652  -18.242 16.293  1.00 51.06  ? 335 THR D CA  1 
ATOM   6253 C  C   . THR D 2 253 ? -2.589  -19.089 15.027  1.00 50.41  ? 335 THR D C   1 
ATOM   6254 O  O   . THR D 2 253 ? -2.199  -18.592 13.957  1.00 50.01  ? 335 THR D O   1 
ATOM   6255 C  CB  . THR D 2 253 ? -1.575  -17.149 16.252  1.00 51.21  ? 335 THR D CB  1 
ATOM   6256 O  OG1 . THR D 2 253 ? -0.278  -17.746 16.106  1.00 52.73  ? 335 THR D OG1 1 
ATOM   6257 C  CG2 . THR D 2 253 ? -1.600  -16.305 17.521  1.00 51.20  ? 335 THR D CG2 1 
ATOM   6258 N  N   . LYS D 2 254 ? -3.022  -20.354 15.136  1.00 50.17  ? 336 LYS D N   1 
ATOM   6259 C  CA  . LYS D 2 254 ? -2.771  -21.364 14.111  1.00 52.73  ? 336 LYS D CA  1 
ATOM   6260 C  C   . LYS D 2 254 ? -3.217  -20.904 12.721  1.00 54.24  ? 336 LYS D C   1 
ATOM   6261 O  O   . LYS D 2 254 ? -2.460  -21.000 11.750  1.00 57.00  ? 336 LYS D O   1 
ATOM   6262 C  CB  . LYS D 2 254 ? -3.463  -22.669 14.497  1.00 54.53  ? 336 LYS D CB  1 
ATOM   6263 C  CG  . LYS D 2 254 ? -3.107  -23.827 13.582  1.00 55.93  ? 336 LYS D CG  1 
ATOM   6264 C  CD  . LYS D 2 254 ? -3.974  -25.048 13.865  1.00 61.52  ? 336 LYS D CD  1 
ATOM   6265 N  N   . SER D 2 255 ? -4.442  -20.391 12.602  1.00 54.00  ? 337 SER D N   1 
ATOM   6266 C  CA  . SER D 2 255 ? -4.921  -19.931 11.301  1.00 53.09  ? 337 SER D CA  1 
ATOM   6267 C  C   . SER D 2 255 ? -4.126  -18.719 10.807  1.00 49.99  ? 337 SER D C   1 
ATOM   6268 O  O   . SER D 2 255 ? -3.632  -18.714 9.670   1.00 49.82  ? 337 SER D O   1 
ATOM   6269 C  CB  . SER D 2 255 ? -6.411  -19.623 11.383  1.00 56.54  ? 337 SER D CB  1 
ATOM   6270 O  OG  . SER D 2 255 ? -6.765  -18.760 10.323  1.00 59.65  ? 337 SER D OG  1 
ATOM   6271 N  N   . ILE D 2 256 ? -3.969  -17.692 11.659  1.00 46.84  ? 338 ILE D N   1 
ATOM   6272 C  CA  . ILE D 2 256 ? -3.187  -16.510 11.291  1.00 43.59  ? 338 ILE D CA  1 
ATOM   6273 C  C   . ILE D 2 256 ? -1.825  -16.932 10.777  1.00 44.02  ? 338 ILE D C   1 
ATOM   6274 O  O   . ILE D 2 256 ? -1.413  -16.588 9.666   1.00 43.12  ? 338 ILE D O   1 
ATOM   6275 C  CB  . ILE D 2 256 ? -3.034  -15.573 12.500  1.00 41.76  ? 338 ILE D CB  1 
ATOM   6276 C  CG1 . ILE D 2 256 ? -4.371  -15.397 13.197  1.00 46.79  ? 338 ILE D CG1 1 
ATOM   6277 C  CG2 . ILE D 2 256 ? -2.413  -14.272 12.103  1.00 39.08  ? 338 ILE D CG2 1 
ATOM   6278 C  CD1 . ILE D 2 256 ? -5.407  -14.831 12.311  1.00 45.51  ? 338 ILE D CD1 1 
ATOM   6279 N  N   . PHE D 2 257 ? -1.125  -17.718 11.584  1.00 46.22  ? 339 PHE D N   1 
ATOM   6280 C  CA  . PHE D 2 257 ? 0.186   -18.198 11.207  1.00 46.03  ? 339 PHE D CA  1 
ATOM   6281 C  C   . PHE D 2 257 ? 0.148   -18.908 9.868   1.00 46.28  ? 339 PHE D C   1 
ATOM   6282 O  O   . PHE D 2 257 ? 0.983   -18.633 8.988   1.00 43.88  ? 339 PHE D O   1 
ATOM   6283 C  CB  . PHE D 2 257 ? 0.714   -19.131 12.281  1.00 49.42  ? 339 PHE D CB  1 
ATOM   6284 C  CG  . PHE D 2 257 ? 2.074   -19.608 12.001  1.00 48.28  ? 339 PHE D CG  1 
ATOM   6285 C  CD1 . PHE D 2 257 ? 3.160   -18.807 12.297  1.00 46.84  ? 339 PHE D CD1 1 
ATOM   6286 C  CD2 . PHE D 2 257 ? 2.276   -20.831 11.390  1.00 48.99  ? 339 PHE D CD2 1 
ATOM   6287 C  CE1 . PHE D 2 257 ? 4.444   -19.235 12.019  1.00 48.12  ? 339 PHE D CE1 1 
ATOM   6288 C  CE2 . PHE D 2 257 ? 3.555   -21.261 11.104  1.00 49.98  ? 339 PHE D CE2 1 
ATOM   6289 C  CZ  . PHE D 2 257 ? 4.640   -20.468 11.419  1.00 48.95  ? 339 PHE D CZ  1 
ATOM   6290 N  N   . ASN D 2 258 ? -0.828  -19.803 9.678   1.00 46.17  ? 340 ASN D N   1 
ATOM   6291 C  CA  . ASN D 2 258 ? -0.880  -20.516 8.410   1.00 51.25  ? 340 ASN D CA  1 
ATOM   6292 C  C   . ASN D 2 258 ? -1.047  -19.538 7.261   1.00 44.27  ? 340 ASN D C   1 
ATOM   6293 O  O   . ASN D 2 258 ? -0.339  -19.639 6.248   1.00 43.10  ? 340 ASN D O   1 
ATOM   6294 C  CB  . ASN D 2 258 ? -1.990  -21.571 8.404   1.00 67.13  ? 340 ASN D CB  1 
ATOM   6295 C  CG  . ASN D 2 258 ? -1.983  -22.415 7.115   1.00 77.81  ? 340 ASN D CG  1 
ATOM   6296 O  OD1 . ASN D 2 258 ? -2.998  -22.511 6.408   1.00 82.69  ? 340 ASN D OD1 1 
ATOM   6297 N  ND2 . ASN D 2 258 ? -0.822  -23.003 6.791   1.00 78.66  ? 340 ASN D ND2 1 
ATOM   6298 N  N   . SER D 2 259 ? -1.898  -18.518 7.446   1.00 40.48  ? 341 SER D N   1 
ATOM   6299 C  CA  . SER D 2 259 ? -2.051  -17.493 6.420   1.00 38.80  ? 341 SER D CA  1 
ATOM   6300 C  C   . SER D 2 259 ? -0.732  -16.777 6.179   1.00 40.84  ? 341 SER D C   1 
ATOM   6301 O  O   . SER D 2 259 ? -0.314  -16.593 5.027   1.00 42.81  ? 341 SER D O   1 
ATOM   6302 C  CB  . SER D 2 259 ? -3.128  -16.494 6.819   1.00 39.97  ? 341 SER D CB  1 
ATOM   6303 O  OG  . SER D 2 259 ? -4.404  -17.091 6.802   1.00 49.71  ? 341 SER D OG  1 
ATOM   6304 N  N   . ALA D 2 260 ? -0.040  -16.390 7.256   1.00 33.85  ? 342 ALA D N   1 
ATOM   6305 C  CA  . ALA D 2 260 ? 1.238   -15.725 7.049   1.00 42.99  ? 342 ALA D CA  1 
ATOM   6306 C  C   . ALA D 2 260 ? 2.169   -16.630 6.239   1.00 43.91  ? 342 ALA D C   1 
ATOM   6307 O  O   . ALA D 2 260 ? 2.779   -16.183 5.248   1.00 40.89  ? 342 ALA D O   1 
ATOM   6308 C  CB  . ALA D 2 260 ? 1.858   -15.314 8.388   1.00 36.41  ? 342 ALA D CB  1 
ATOM   6309 N  N   . MET D 2 261 ? 2.193   -17.933 6.571   1.00 40.79  ? 343 MET D N   1 
ATOM   6310 C  CA  . MET D 2 261 ? 3.080   -18.823 5.842   1.00 40.52  ? 343 MET D CA  1 
ATOM   6311 C  C   . MET D 2 261 ? 2.665   -18.892 4.383   1.00 41.17  ? 343 MET D C   1 
ATOM   6312 O  O   . MET D 2 261 ? 3.520   -18.855 3.484   1.00 39.89  ? 343 MET D O   1 
ATOM   6313 C  CB  . MET D 2 261 ? 3.089   -20.211 6.479   1.00 41.79  ? 343 MET D CB  1 
ATOM   6314 C  CG  . MET D 2 261 ? 3.874   -20.321 7.798   1.00 43.10  ? 343 MET D CG  1 
ATOM   6315 S  SD  . MET D 2 261 ? 5.445   -19.440 7.811   1.00 47.54  ? 343 MET D SD  1 
ATOM   6316 C  CE  . MET D 2 261 ? 6.341   -20.340 6.537   1.00 48.29  ? 343 MET D CE  1 
ATOM   6317 N  N   . GLN D 2 262 ? 1.351   -18.930 4.125   1.00 41.18  ? 344 GLN D N   1 
ATOM   6318 C  CA  . GLN D 2 262 ? 0.900   -18.961 2.738   1.00 44.90  ? 344 GLN D CA  1 
ATOM   6319 C  C   . GLN D 2 262 ? 1.391   -17.738 2.000   1.00 44.74  ? 344 GLN D C   1 
ATOM   6320 O  O   . GLN D 2 262 ? 1.950   -17.846 0.900   1.00 47.62  ? 344 GLN D O   1 
ATOM   6321 C  CB  . GLN D 2 262 ? -0.616  -19.051 2.659   1.00 48.40  ? 344 GLN D CB  1 
ATOM   6322 C  CG  . GLN D 2 262 ? -1.104  -20.454 2.619   1.00 60.62  ? 344 GLN D CG  1 
ATOM   6323 C  CD  . GLN D 2 262 ? -2.620  -20.562 2.715   1.00 72.65  ? 344 GLN D CD  1 
ATOM   6324 O  OE1 . GLN D 2 262 ? -3.361  -19.612 2.393   1.00 74.12  ? 344 GLN D OE1 1 
ATOM   6325 N  NE2 . GLN D 2 262 ? -3.093  -21.730 3.169   1.00 77.68  ? 344 GLN D NE2 1 
ATOM   6326 N  N   . GLU D 2 263 ? 1.269   -16.574 2.632   1.00 42.20  ? 345 GLU D N   1 
ATOM   6327 C  CA  . GLU D 2 263 ? 1.691   -15.372 1.948   1.00 43.36  ? 345 GLU D CA  1 
ATOM   6328 C  C   . GLU D 2 263 ? 3.190   -15.446 1.685   1.00 45.03  ? 345 GLU D C   1 
ATOM   6329 O  O   . GLU D 2 263 ? 3.645   -15.144 0.578   1.00 47.40  ? 345 GLU D O   1 
ATOM   6330 C  CB  . GLU D 2 263 ? 1.287   -14.144 2.770   1.00 41.54  ? 345 GLU D CB  1 
ATOM   6331 C  CG  . GLU D 2 263 ? 1.845   -12.825 2.289   1.00 43.37  ? 345 GLU D CG  1 
ATOM   6332 C  CD  . GLU D 2 263 ? 1.449   -11.659 3.197   1.00 50.16  ? 345 GLU D CD  1 
ATOM   6333 O  OE1 . GLU D 2 263 ? 1.030   -10.609 2.662   1.00 54.63  ? 345 GLU D OE1 1 
ATOM   6334 O  OE2 . GLU D 2 263 ? 1.550   -11.775 4.445   1.00 50.64  ? 345 GLU D OE2 1 
ATOM   6335 N  N   . MET D 2 264 ? 3.956   -15.982 2.646   1.00 43.23  ? 346 MET D N   1 
ATOM   6336 C  CA  . MET D 2 264 ? 5.396   -16.090 2.450   1.00 42.27  ? 346 MET D CA  1 
ATOM   6337 C  C   . MET D 2 264 ? 5.705   -16.973 1.258   1.00 48.25  ? 346 MET D C   1 
ATOM   6338 O  O   . MET D 2 264 ? 6.561   -16.634 0.433   1.00 51.32  ? 346 MET D O   1 
ATOM   6339 C  CB  . MET D 2 264 ? 6.070   -16.602 3.717   1.00 36.65  ? 346 MET D CB  1 
ATOM   6340 C  CG  . MET D 2 264 ? 7.594   -16.441 3.723   1.00 38.88  ? 346 MET D CG  1 
ATOM   6341 S  SD  . MET D 2 264 ? 8.484   -17.687 4.744   1.00 45.40  ? 346 MET D SD  1 
ATOM   6342 C  CE  . MET D 2 264 ? 8.351   -19.164 3.729   1.00 45.91  ? 346 MET D CE  1 
ATOM   6343 N  N   . GLU D 2 265 ? 4.965   -18.068 1.105   1.00 53.04  ? 347 GLU D N   1 
ATOM   6344 C  CA  . GLU D 2 265 ? 5.288   -18.965 0.008   1.00 55.57  ? 347 GLU D CA  1 
ATOM   6345 C  C   . GLU D 2 265 ? 5.021   -18.290 -1.325  1.00 55.73  ? 347 GLU D C   1 
ATOM   6346 O  O   . GLU D 2 265 ? 5.785   -18.473 -2.283  1.00 57.15  ? 347 GLU D O   1 
ATOM   6347 C  CB  . GLU D 2 265 ? 4.522   -20.274 0.152   1.00 60.57  ? 347 GLU D CB  1 
ATOM   6348 C  CG  . GLU D 2 265 ? 5.283   -21.253 1.036   1.00 67.18  ? 347 GLU D CG  1 
ATOM   6349 C  CD  . GLU D 2 265 ? 4.409   -22.118 1.910   1.00 74.55  ? 347 GLU D CD  1 
ATOM   6350 O  OE1 . GLU D 2 265 ? 4.857   -22.458 3.029   1.00 79.00  ? 347 GLU D OE1 1 
ATOM   6351 O  OE2 . GLU D 2 265 ? 3.289   -22.470 1.477   1.00 79.68  ? 347 GLU D OE2 1 
ATOM   6352 N  N   . VAL D 2 266 ? 3.996   -17.434 -1.379  1.00 50.50  ? 348 VAL D N   1 
ATOM   6353 C  CA  . VAL D 2 266 ? 3.757   -16.673 -2.595  1.00 48.46  ? 348 VAL D CA  1 
ATOM   6354 C  C   . VAL D 2 266 ? 4.977   -15.825 -2.908  1.00 48.03  ? 348 VAL D C   1 
ATOM   6355 O  O   . VAL D 2 266 ? 5.534   -15.891 -4.012  1.00 51.03  ? 348 VAL D O   1 
ATOM   6356 C  CB  . VAL D 2 266 ? 2.481   -15.831 -2.463  1.00 46.17  ? 348 VAL D CB  1 
ATOM   6357 C  CG1 . VAL D 2 266 ? 2.468   -14.786 -3.560  1.00 45.85  ? 348 VAL D CG1 1 
ATOM   6358 C  CG2 . VAL D 2 266 ? 1.273   -16.750 -2.560  1.00 46.54  ? 348 VAL D CG2 1 
ATOM   6359 N  N   . TYR D 2 267 ? 5.462   -15.084 -1.905  1.00 46.40  ? 349 TYR D N   1 
ATOM   6360 C  CA  . TYR D 2 267 ? 6.693   -14.324 -2.068  1.00 46.23  ? 349 TYR D CA  1 
ATOM   6361 C  C   . TYR D 2 267 ? 7.816   -15.228 -2.569  1.00 46.98  ? 349 TYR D C   1 
ATOM   6362 O  O   . TYR D 2 267 ? 8.471   -14.915 -3.573  1.00 47.57  ? 349 TYR D O   1 
ATOM   6363 C  CB  . TYR D 2 267 ? 7.053   -13.637 -0.748  1.00 43.96  ? 349 TYR D CB  1 
ATOM   6364 C  CG  . TYR D 2 267 ? 8.374   -12.891 -0.721  1.00 43.88  ? 349 TYR D CG  1 
ATOM   6365 C  CD1 . TYR D 2 267 ? 9.570   -13.554 -0.458  1.00 45.38  ? 349 TYR D CD1 1 
ATOM   6366 C  CD2 . TYR D 2 267 ? 8.425   -11.512 -0.922  1.00 46.46  ? 349 TYR D CD2 1 
ATOM   6367 C  CE1 . TYR D 2 267 ? 10.789  -12.871 -0.434  1.00 47.49  ? 349 TYR D CE1 1 
ATOM   6368 C  CE2 . TYR D 2 267 ? 9.639   -10.810 -0.875  1.00 46.21  ? 349 TYR D CE2 1 
ATOM   6369 C  CZ  . TYR D 2 267 ? 10.817  -11.497 -0.629  1.00 47.64  ? 349 TYR D CZ  1 
ATOM   6370 O  OH  . TYR D 2 267 ? 12.020  -10.825 -0.586  1.00 47.81  ? 349 TYR D OH  1 
ATOM   6371 N  N   . VAL D 2 268 ? 8.005   -16.396 -1.942  1.00 45.64  ? 350 VAL D N   1 
ATOM   6372 C  CA  . VAL D 2 268 ? 9.081   -17.265 -2.413  1.00 48.29  ? 350 VAL D CA  1 
ATOM   6373 C  C   . VAL D 2 268 ? 8.856   -17.619 -3.887  1.00 54.48  ? 350 VAL D C   1 
ATOM   6374 O  O   . VAL D 2 268 ? 9.750   -17.446 -4.726  1.00 58.37  ? 350 VAL D O   1 
ATOM   6375 C  CB  . VAL D 2 268 ? 9.232   -18.516 -1.524  1.00 43.94  ? 350 VAL D CB  1 
ATOM   6376 C  CG1 . VAL D 2 268 ? 10.227  -19.455 -2.125  1.00 38.29  ? 350 VAL D CG1 1 
ATOM   6377 C  CG2 . VAL D 2 268 ? 9.728   -18.148 -0.138  1.00 43.96  ? 350 VAL D CG2 1 
ATOM   6378 N  N   . GLU D 2 269 ? 7.637   -18.033 -4.247  1.00 54.67  ? 351 GLU D N   1 
ATOM   6379 C  CA  . GLU D 2 269 ? 7.406   -18.349 -5.651  1.00 54.34  ? 351 GLU D CA  1 
ATOM   6380 C  C   . GLU D 2 269 ? 7.821   -17.166 -6.516  1.00 53.43  ? 351 GLU D C   1 
ATOM   6381 O  O   . GLU D 2 269 ? 8.642   -17.314 -7.433  1.00 52.65  ? 351 GLU D O   1 
ATOM   6382 C  CB  . GLU D 2 269 ? 5.945   -18.737 -5.884  1.00 55.39  ? 351 GLU D CB  1 
ATOM   6383 N  N   . ASN D 2 270 ? 7.375   -15.958 -6.140  1.00 52.97  ? 352 ASN D N   1 
ATOM   6384 C  CA  . ASN D 2 270 ? 7.663   -14.773 -6.948  1.00 53.28  ? 352 ASN D CA  1 
ATOM   6385 C  C   . ASN D 2 270 ? 9.160   -14.580 -7.105  1.00 56.48  ? 352 ASN D C   1 
ATOM   6386 O  O   . ASN D 2 270 ? 9.664   -14.386 -8.218  1.00 59.36  ? 352 ASN D O   1 
ATOM   6387 C  CB  . ASN D 2 270 ? 7.036   -13.526 -6.331  1.00 48.96  ? 352 ASN D CB  1 
ATOM   6388 C  CG  . ASN D 2 270 ? 5.538   -13.449 -6.567  1.00 54.42  ? 352 ASN D CG  1 
ATOM   6389 O  OD1 . ASN D 2 270 ? 4.983   -14.185 -7.391  1.00 59.32  ? 352 ASN D OD1 1 
ATOM   6390 N  ND2 . ASN D 2 270 ? 4.872   -12.560 -5.837  1.00 52.60  ? 352 ASN D ND2 1 
ATOM   6391 N  N   . ILE D 2 271 ? 9.900   -14.696 -6.008  1.00 56.48  ? 353 ILE D N   1 
ATOM   6392 C  CA  . ILE D 2 271 ? 11.311  -14.382 -6.118  1.00 57.90  ? 353 ILE D CA  1 
ATOM   6393 C  C   . ILE D 2 271 ? 12.002  -15.447 -6.950  1.00 56.39  ? 353 ILE D C   1 
ATOM   6394 O  O   . ILE D 2 271 ? 12.845  -15.140 -7.799  1.00 57.41  ? 353 ILE D O   1 
ATOM   6395 C  CB  . ILE D 2 271 ? 11.930  -14.193 -4.724  1.00 60.51  ? 353 ILE D CB  1 
ATOM   6396 C  CG1 . ILE D 2 271 ? 13.429  -14.029 -4.798  1.00 67.13  ? 353 ILE D CG1 1 
ATOM   6397 C  CG2 . ILE D 2 271 ? 11.714  -15.367 -3.879  1.00 60.19  ? 353 ILE D CG2 1 
ATOM   6398 C  CD1 . ILE D 2 271 ? 13.962  -13.541 -3.492  1.00 68.34  ? 353 ILE D CD1 1 
ATOM   6399 N  N   . ARG D 2 272 ? 11.573  -16.698 -6.815  1.00 55.65  ? 354 ARG D N   1 
ATOM   6400 C  CA  . ARG D 2 272 ? 12.143  -17.729 -7.668  1.00 57.88  ? 354 ARG D CA  1 
ATOM   6401 C  C   . ARG D 2 272 ? 11.858  -17.420 -9.125  1.00 61.67  ? 354 ARG D C   1 
ATOM   6402 O  O   . ARG D 2 272 ? 12.736  -17.571 -9.979  1.00 61.83  ? 354 ARG D O   1 
ATOM   6403 C  CB  . ARG D 2 272 ? 11.591  -19.097 -7.295  1.00 58.07  ? 354 ARG D CB  1 
ATOM   6404 C  CG  . ARG D 2 272 ? 12.528  -19.925 -6.493  1.00 59.89  ? 354 ARG D CG  1 
ATOM   6405 C  CD  . ARG D 2 272 ? 11.798  -21.158 -6.036  1.00 63.92  ? 354 ARG D CD  1 
ATOM   6406 N  NE  . ARG D 2 272 ? 12.463  -21.820 -4.919  1.00 65.27  ? 354 ARG D NE  1 
ATOM   6407 C  CZ  . ARG D 2 272 ? 11.831  -22.572 -4.028  1.00 65.55  ? 354 ARG D CZ  1 
ATOM   6408 N  NH1 . ARG D 2 272 ? 10.518  -22.750 -4.127  1.00 65.68  ? 354 ARG D NH1 1 
ATOM   6409 N  NH2 . ARG D 2 272 ? 12.509  -23.150 -3.047  1.00 66.44  ? 354 ARG D NH2 1 
ATOM   6410 N  N   . ARG D 2 273 ? 10.641  -16.944 -9.420  1.00 63.06  ? 355 ARG D N   1 
ATOM   6411 C  CA  . ARG D 2 273 ? 10.306  -16.585 -10.790 1.00 63.09  ? 355 ARG D CA  1 
ATOM   6412 C  C   . ARG D 2 273 ? 11.162  -15.424 -11.272 1.00 64.06  ? 355 ARG D C   1 
ATOM   6413 O  O   . ARG D 2 273 ? 11.593  -15.420 -12.426 1.00 68.53  ? 355 ARG D O   1 
ATOM   6414 C  CB  . ARG D 2 273 ? 8.819   -16.255 -10.884 1.00 62.78  ? 355 ARG D CB  1 
ATOM   6415 C  CG  . ARG D 2 273 ? 8.320   -15.876 -12.264 1.00 71.46  ? 355 ARG D CG  1 
ATOM   6416 C  CD  . ARG D 2 273 ? 6.819   -15.525 -12.248 1.00 78.23  ? 355 ARG D CD  1 
ATOM   6417 N  NE  . ARG D 2 273 ? 6.425   -14.789 -11.041 1.00 81.72  ? 355 ARG D NE  1 
ATOM   6418 C  CZ  . ARG D 2 273 ? 6.585   -13.474 -10.868 1.00 84.26  ? 355 ARG D CZ  1 
ATOM   6419 N  NH1 . ARG D 2 273 ? 6.201   -12.889 -9.739  1.00 80.78  ? 355 ARG D NH1 1 
ATOM   6420 N  NH2 . ARG D 2 273 ? 7.122   -12.738 -11.833 1.00 88.83  ? 355 ARG D NH2 1 
ATOM   6421 N  N   . LYS D 2 274 ? 11.480  -14.472 -10.390 1.00 62.57  ? 356 LYS D N   1 
ATOM   6422 C  CA  . LYS D 2 274 ? 12.160  -13.248 -10.799 1.00 65.75  ? 356 LYS D CA  1 
ATOM   6423 C  C   . LYS D 2 274 ? 13.680  -13.402 -10.873 1.00 67.90  ? 356 LYS D C   1 
ATOM   6424 O  O   . LYS D 2 274 ? 14.323  -12.826 -11.761 1.00 71.32  ? 356 LYS D O   1 
ATOM   6425 C  CB  . LYS D 2 274 ? 11.796  -12.117 -9.836  1.00 66.05  ? 356 LYS D CB  1 
ATOM   6426 C  CG  . LYS D 2 274 ? 12.527  -10.812 -10.073 1.00 70.35  ? 356 LYS D CG  1 
ATOM   6427 C  CD  . LYS D 2 274 ? 11.977  -9.716  -9.166  1.00 73.93  ? 356 LYS D CD  1 
ATOM   6428 C  CE  . LYS D 2 274 ? 12.650  -8.366  -9.423  1.00 80.44  ? 356 LYS D CE  1 
ATOM   6429 N  NZ  . LYS D 2 274 ? 12.544  -7.429  -8.254  1.00 81.77  ? 356 LYS D NZ  1 
ATOM   6430 N  N   . PHE D 2 275 ? 14.266  -14.172 -9.958  1.00 62.26  ? 357 PHE D N   1 
ATOM   6431 C  CA  . PHE D 2 275 ? 15.707  -14.298 -9.851  1.00 60.64  ? 357 PHE D CA  1 
ATOM   6432 C  C   . PHE D 2 275 ? 16.229  -15.669 -10.215 1.00 63.00  ? 357 PHE D C   1 
ATOM   6433 O  O   . PHE D 2 275 ? 17.387  -15.784 -10.609 1.00 68.63  ? 357 PHE D O   1 
ATOM   6434 C  CB  . PHE D 2 275 ? 16.159  -13.987 -8.427  1.00 63.60  ? 357 PHE D CB  1 
ATOM   6435 C  CG  . PHE D 2 275 ? 16.037  -12.550 -8.061  1.00 66.74  ? 357 PHE D CG  1 
ATOM   6436 C  CD1 . PHE D 2 275 ? 17.031  -11.652 -8.411  1.00 70.38  ? 357 PHE D CD1 1 
ATOM   6437 C  CD2 . PHE D 2 275 ? 14.933  -12.092 -7.368  1.00 65.54  ? 357 PHE D CD2 1 
ATOM   6438 C  CE1 . PHE D 2 275 ? 16.929  -10.326 -8.080  1.00 71.18  ? 357 PHE D CE1 1 
ATOM   6439 C  CE2 . PHE D 2 275 ? 14.829  -10.767 -7.027  1.00 67.45  ? 357 PHE D CE2 1 
ATOM   6440 C  CZ  . PHE D 2 275 ? 15.827  -9.880  -7.387  1.00 69.59  ? 357 PHE D CZ  1 
ATOM   6441 N  N   . GLY D 2 276 ? 15.423  -16.714 -10.076 1.00 62.42  ? 358 GLY D N   1 
ATOM   6442 C  CA  . GLY D 2 276 ? 15.826  -18.051 -10.436 1.00 62.05  ? 358 GLY D CA  1 
ATOM   6443 C  C   . GLY D 2 276 ? 16.127  -18.941 -9.259  1.00 62.72  ? 358 GLY D C   1 
ATOM   6444 O  O   . GLY D 2 276 ? 16.160  -20.166 -9.426  1.00 67.46  ? 358 GLY D O   1 
ATOM   6445 N  N   . VAL D 2 277 ? 16.321  -18.381 -8.066  1.00 60.12  ? 359 VAL D N   1 
ATOM   6446 C  CA  . VAL D 2 277 ? 16.765  -19.199 -6.946  1.00 59.28  ? 359 VAL D CA  1 
ATOM   6447 C  C   . VAL D 2 277 ? 16.148  -18.704 -5.644  1.00 57.82  ? 359 VAL D C   1 
ATOM   6448 O  O   . VAL D 2 277 ? 15.798  -17.530 -5.501  1.00 60.10  ? 359 VAL D O   1 
ATOM   6449 C  CB  . VAL D 2 277 ? 18.306  -19.208 -6.877  1.00 61.62  ? 359 VAL D CB  1 
ATOM   6450 C  CG1 . VAL D 2 277 ? 18.823  -17.942 -6.236  1.00 60.53  ? 359 VAL D CG1 1 
ATOM   6451 C  CG2 . VAL D 2 277 ? 18.761  -20.399 -6.123  1.00 64.55  ? 359 VAL D CG2 1 
ATOM   6452 N  N   . PHE D 2 278 ? 15.987  -19.626 -4.700  1.00 53.61  ? 360 PHE D N   1 
ATOM   6453 C  CA  . PHE D 2 278 ? 15.777  -19.277 -3.296  1.00 48.29  ? 360 PHE D CA  1 
ATOM   6454 C  C   . PHE D 2 278 ? 16.213  -20.472 -2.472  1.00 49.33  ? 360 PHE D C   1 
ATOM   6455 O  O   . PHE D 2 278 ? 15.623  -21.548 -2.595  1.00 50.27  ? 360 PHE D O   1 
ATOM   6456 C  CB  . PHE D 2 278 ? 14.325  -18.933 -2.978  1.00 46.04  ? 360 PHE D CB  1 
ATOM   6457 C  CG  . PHE D 2 278 ? 14.105  -18.587 -1.518  1.00 46.70  ? 360 PHE D CG  1 
ATOM   6458 C  CD1 . PHE D 2 278 ? 14.312  -17.284 -1.056  1.00 43.26  ? 360 PHE D CD1 1 
ATOM   6459 C  CD2 . PHE D 2 278 ? 13.760  -19.566 -0.597  1.00 47.05  ? 360 PHE D CD2 1 
ATOM   6460 C  CE1 . PHE D 2 278 ? 14.157  -16.954 0.277   1.00 38.70  ? 360 PHE D CE1 1 
ATOM   6461 C  CE2 . PHE D 2 278 ? 13.600  -19.238 0.737   1.00 44.16  ? 360 PHE D CE2 1 
ATOM   6462 C  CZ  . PHE D 2 278 ? 13.792  -17.915 1.170   1.00 39.90  ? 360 PHE D CZ  1 
ATOM   6463 N  N   . ASN D 2 279 ? 17.219  -20.292 -1.624  1.00 49.59  ? 361 ASN D N   1 
ATOM   6464 C  CA  . ASN D 2 279 ? 17.783  -21.394 -0.851  1.00 49.58  ? 361 ASN D CA  1 
ATOM   6465 C  C   . ASN D 2 279 ? 17.263  -21.354 0.585   1.00 49.46  ? 361 ASN D C   1 
ATOM   6466 O  O   . ASN D 2 279 ? 17.544  -20.415 1.342   1.00 46.88  ? 361 ASN D O   1 
ATOM   6467 C  CB  . ASN D 2 279 ? 19.300  -21.341 -0.901  1.00 48.48  ? 361 ASN D CB  1 
ATOM   6468 C  CG  . ASN D 2 279 ? 19.801  -21.236 -2.305  1.00 50.52  ? 361 ASN D CG  1 
ATOM   6469 O  OD1 . ASN D 2 279 ? 20.446  -20.257 -2.683  1.00 51.13  ? 361 ASN D OD1 1 
ATOM   6470 N  ND2 . ASN D 2 279 ? 19.476  -22.235 -3.111  1.00 52.14  ? 361 ASN D ND2 1 
ATOM   6471 N  N   . TYR D 2 280 ? 16.486  -22.364 0.944   1.00 47.70  ? 362 TYR D N   1 
ATOM   6472 C  CA  . TYR D 2 280 ? 16.120  -22.552 2.327   1.00 44.99  ? 362 TYR D CA  1 
ATOM   6473 C  C   . TYR D 2 280 ? 17.333  -23.011 3.134   1.00 47.47  ? 362 TYR D C   1 
ATOM   6474 O  O   . TYR D 2 280 ? 18.288  -23.585 2.608   1.00 52.32  ? 362 TYR D O   1 
ATOM   6475 C  CB  . TYR D 2 280 ? 15.009  -23.587 2.441   1.00 43.00  ? 362 TYR D CB  1 
ATOM   6476 C  CG  . TYR D 2 280 ? 13.643  -23.106 2.047   1.00 42.60  ? 362 TYR D CG  1 
ATOM   6477 C  CD1 . TYR D 2 280 ? 12.832  -22.438 2.959   1.00 42.08  ? 362 TYR D CD1 1 
ATOM   6478 C  CD2 . TYR D 2 280 ? 13.145  -23.338 0.776   1.00 44.05  ? 362 TYR D CD2 1 
ATOM   6479 C  CE1 . TYR D 2 280 ? 11.577  -22.002 2.610   1.00 39.36  ? 362 TYR D CE1 1 
ATOM   6480 C  CE2 . TYR D 2 280 ? 11.883  -22.903 0.413   1.00 43.00  ? 362 TYR D CE2 1 
ATOM   6481 C  CZ  . TYR D 2 280 ? 11.103  -22.244 1.342   1.00 44.31  ? 362 TYR D CZ  1 
ATOM   6482 O  OH  . TYR D 2 280 ? 9.837   -21.816 1.002   1.00 49.75  ? 362 TYR D OH  1 
ATOM   6483 N  N   . SER D 2 281 ? 17.274  -22.763 4.430   1.00 45.98  ? 363 SER D N   1 
ATOM   6484 C  CA  . SER D 2 281 ? 18.281  -23.158 5.397   1.00 47.54  ? 363 SER D CA  1 
ATOM   6485 C  C   . SER D 2 281 ? 17.672  -24.160 6.360   1.00 45.78  ? 363 SER D C   1 
ATOM   6486 O  O   . SER D 2 281 ? 16.449  -24.189 6.549   1.00 47.19  ? 363 SER D O   1 
ATOM   6487 C  CB  . SER D 2 281 ? 18.778  -21.949 6.202   1.00 50.60  ? 363 SER D CB  1 
ATOM   6488 O  OG  . SER D 2 281 ? 19.336  -20.958 5.367   1.00 54.52  ? 363 SER D OG  1 
ATOM   6489 N  N   . PRO D 2 282 ? 18.488  -24.991 6.996   1.00 42.25  ? 364 PRO D N   1 
ATOM   6490 C  CA  . PRO D 2 282 ? 17.974  -25.812 8.095   1.00 43.09  ? 364 PRO D CA  1 
ATOM   6491 C  C   . PRO D 2 282 ? 17.548  -24.930 9.261   1.00 44.43  ? 364 PRO D C   1 
ATOM   6492 O  O   . PRO D 2 282 ? 17.805  -23.731 9.286   1.00 46.55  ? 364 PRO D O   1 
ATOM   6493 C  CB  . PRO D 2 282 ? 19.154  -26.726 8.451   1.00 44.83  ? 364 PRO D CB  1 
ATOM   6494 C  CG  . PRO D 2 282 ? 20.352  -26.147 7.731   1.00 46.66  ? 364 PRO D CG  1 
ATOM   6495 C  CD  . PRO D 2 282 ? 19.831  -25.399 6.559   1.00 46.52  ? 364 PRO D CD  1 
ATOM   6496 N  N   . PHE D 2 283 ? 16.767  -25.456 10.174  1.00 41.19  ? 365 PHE D N   1 
ATOM   6497 C  CA  . PHE D 2 283 ? 16.311  -24.636 11.255  1.00 36.73  ? 365 PHE D CA  1 
ATOM   6498 C  C   . PHE D 2 283 ? 17.468  -24.317 12.165  1.00 41.08  ? 365 PHE D C   1 
ATOM   6499 O  O   . PHE D 2 283 ? 18.389  -25.075 12.248  1.00 44.66  ? 365 PHE D O   1 
ATOM   6500 C  CB  . PHE D 2 283 ? 15.123  -25.262 11.970  1.00 35.45  ? 365 PHE D CB  1 
ATOM   6501 C  CG  . PHE D 2 283 ? 14.359  -24.304 12.828  1.00 39.13  ? 365 PHE D CG  1 
ATOM   6502 C  CD1 . PHE D 2 283 ? 13.724  -23.231 12.280  1.00 33.73  ? 365 PHE D CD1 1 
ATOM   6503 C  CD2 . PHE D 2 283 ? 14.331  -24.454 14.181  1.00 36.36  ? 365 PHE D CD2 1 
ATOM   6504 C  CE1 . PHE D 2 283 ? 13.054  -22.344 13.060  1.00 33.90  ? 365 PHE D CE1 1 
ATOM   6505 C  CE2 . PHE D 2 283 ? 13.659  -23.573 14.965  1.00 34.46  ? 365 PHE D CE2 1 
ATOM   6506 C  CZ  . PHE D 2 283 ? 13.024  -22.511 14.403  1.00 33.83  ? 365 PHE D CZ  1 
ATOM   6507 N  N   . ARG D 2 284 ? 17.381  -23.160 12.802  1.00 40.46  ? 366 ARG D N   1 
ATOM   6508 C  CA  . ARG D 2 284 ? 18.319  -22.544 13.695  1.00 38.12  ? 366 ARG D CA  1 
ATOM   6509 C  C   . ARG D 2 284 ? 19.569  -22.057 13.063  1.00 41.00  ? 366 ARG D C   1 
ATOM   6510 O  O   . ARG D 2 284 ? 20.545  -21.970 13.730  1.00 46.01  ? 366 ARG D O   1 
ATOM   6511 C  CB  . ARG D 2 284 ? 18.649  -23.357 14.929  1.00 39.24  ? 366 ARG D CB  1 
ATOM   6512 C  CG  . ARG D 2 284 ? 17.493  -23.697 15.786  1.00 41.37  ? 366 ARG D CG  1 
ATOM   6513 C  CD  . ARG D 2 284 ? 17.972  -24.304 17.056  1.00 41.31  ? 366 ARG D CD  1 
ATOM   6514 N  NE  . ARG D 2 284 ? 18.983  -25.302 16.818  1.00 51.97  ? 366 ARG D NE  1 
ATOM   6515 C  CZ  . ARG D 2 284 ? 18.741  -26.586 16.643  1.00 52.64  ? 366 ARG D CZ  1 
ATOM   6516 N  NH1 . ARG D 2 284 ? 17.518  -27.028 16.667  1.00 51.12  ? 366 ARG D NH1 1 
ATOM   6517 N  NH2 . ARG D 2 284 ? 19.729  -27.418 16.445  1.00 50.74  ? 366 ARG D NH2 1 
ATOM   6518 N  N   . THR D 2 285 ? 19.559  -21.726 11.790  1.00 38.26  ? 367 THR D N   1 
ATOM   6519 C  CA  . THR D 2 285 ? 20.766  -21.213 11.213  1.00 38.70  ? 367 THR D CA  1 
ATOM   6520 C  C   . THR D 2 285 ? 20.565  -19.744 11.296  1.00 38.29  ? 367 THR D C   1 
ATOM   6521 O  O   . THR D 2 285 ? 19.634  -19.216 10.766  1.00 37.67  ? 367 THR D O   1 
ATOM   6522 C  CB  . THR D 2 285 ? 21.058  -21.711 9.793   1.00 40.04  ? 367 THR D CB  1 
ATOM   6523 O  OG1 . THR D 2 285 ? 21.107  -20.631 8.882   1.00 44.94  ? 367 THR D OG1 1 
ATOM   6524 C  CG2 . THR D 2 285 ? 20.071  -22.666 9.362   1.00 39.33  ? 367 THR D CG2 1 
ATOM   6525 N  N   . PRO D 2 286 ? 21.479  -19.080 11.947  1.00 38.77  ? 368 PRO D N   1 
ATOM   6526 C  CA  . PRO D 2 286 ? 21.387  -17.674 12.234  1.00 38.74  ? 368 PRO D CA  1 
ATOM   6527 C  C   . PRO D 2 286 ? 21.436  -16.694 11.119  1.00 38.39  ? 368 PRO D C   1 
ATOM   6528 O  O   . PRO D 2 286 ? 22.139  -16.827 10.169  1.00 40.97  ? 368 PRO D O   1 
ATOM   6529 C  CB  . PRO D 2 286 ? 22.601  -17.437 13.109  1.00 41.04  ? 368 PRO D CB  1 
ATOM   6530 C  CG  . PRO D 2 286 ? 23.064  -18.771 13.512  1.00 37.76  ? 368 PRO D CG  1 
ATOM   6531 C  CD  . PRO D 2 286 ? 22.763  -19.615 12.360  1.00 37.96  ? 368 PRO D CD  1 
ATOM   6532 N  N   . TYR D 2 287 ? 20.609  -15.688 11.246  1.00 39.43  ? 369 TYR D N   1 
ATOM   6533 C  CA  . TYR D 2 287 ? 20.727  -14.585 10.313  1.00 37.94  ? 369 TYR D CA  1 
ATOM   6534 C  C   . TYR D 2 287 ? 21.955  -13.744 10.667  1.00 47.28  ? 369 TYR D C   1 
ATOM   6535 O  O   . TYR D 2 287 ? 22.222  -13.472 11.841  1.00 48.46  ? 369 TYR D O   1 
ATOM   6536 C  CB  . TYR D 2 287 ? 19.456  -13.740 10.339  1.00 32.33  ? 369 TYR D CB  1 
ATOM   6537 C  CG  . TYR D 2 287 ? 19.599  -12.400 9.656   1.00 34.25  ? 369 TYR D CG  1 
ATOM   6538 C  CD1 . TYR D 2 287 ? 19.999  -11.273 10.378  1.00 35.18  ? 369 TYR D CD1 1 
ATOM   6539 C  CD2 . TYR D 2 287 ? 19.330  -12.251 8.283   1.00 34.78  ? 369 TYR D CD2 1 
ATOM   6540 C  CE1 . TYR D 2 287 ? 20.139  -10.048 9.771   1.00 38.39  ? 369 TYR D CE1 1 
ATOM   6541 C  CE2 . TYR D 2 287 ? 19.453  -11.009 7.658   1.00 36.41  ? 369 TYR D CE2 1 
ATOM   6542 C  CZ  . TYR D 2 287 ? 19.858  -9.911  8.416   1.00 40.64  ? 369 TYR D CZ  1 
ATOM   6543 O  OH  . TYR D 2 287 ? 20.013  -8.669  7.839   1.00 45.12  ? 369 TYR D OH  1 
ATOM   6544 N  N   . THR D 2 288 ? 22.713  -13.344 9.656   1.00 36.60  ? 370 THR D N   1 
ATOM   6545 C  CA  . THR D 2 288 ? 23.826  -12.428 9.830   1.00 45.48  ? 370 THR D CA  1 
ATOM   6546 C  C   . THR D 2 288 ? 23.631  -11.210 8.935   1.00 46.35  ? 370 THR D C   1 
ATOM   6547 O  O   . THR D 2 288 ? 22.895  -11.268 7.940   1.00 45.76  ? 370 THR D O   1 
ATOM   6548 C  CB  . THR D 2 288 ? 25.161  -13.101 9.500   1.00 40.69  ? 370 THR D CB  1 
ATOM   6549 O  OG1 . THR D 2 288 ? 25.129  -13.560 8.150   1.00 44.07  ? 370 THR D OG1 1 
ATOM   6550 C  CG2 . THR D 2 288 ? 25.389  -14.262 10.409  1.00 40.70  ? 370 THR D CG2 1 
ATOM   6551 N  N   . PRO D 2 289 ? 24.255  -10.080 9.275   1.00 48.22  ? 371 PRO D N   1 
ATOM   6552 C  CA  . PRO D 2 289 ? 23.965  -8.842  8.551   1.00 48.64  ? 371 PRO D CA  1 
ATOM   6553 C  C   . PRO D 2 289 ? 24.258  -8.994  7.078   1.00 56.64  ? 371 PRO D C   1 
ATOM   6554 O  O   . PRO D 2 289 ? 25.275  -9.569  6.685   1.00 59.85  ? 371 PRO D O   1 
ATOM   6555 C  CB  . PRO D 2 289 ? 24.897  -7.822  9.211   1.00 49.57  ? 371 PRO D CB  1 
ATOM   6556 C  CG  . PRO D 2 289 ? 25.030  -8.306  10.586  1.00 49.74  ? 371 PRO D CG  1 
ATOM   6557 C  CD  . PRO D 2 289 ? 25.053  -9.817  10.488  1.00 49.31  ? 371 PRO D CD  1 
ATOM   6558 N  N   . ASN D 2 290 ? 23.325  -8.507  6.263   1.00 62.91  ? 372 ASN D N   1 
ATOM   6559 C  CA  . ASN D 2 290 ? 23.511  -8.468  4.818   1.00 67.82  ? 372 ASN D CA  1 
ATOM   6560 C  C   . ASN D 2 290 ? 23.741  -9.861  4.250   1.00 64.77  ? 372 ASN D C   1 
ATOM   6561 O  O   . ASN D 2 290 ? 24.587  -10.058 3.385   1.00 66.83  ? 372 ASN D O   1 
ATOM   6562 C  CB  . ASN D 2 290 ? 24.669  -7.545  4.447   1.00 80.10  ? 372 ASN D CB  1 
ATOM   6563 C  CG  . ASN D 2 290 ? 24.298  -6.574  3.364   1.00 87.37  ? 372 ASN D CG  1 
ATOM   6564 O  OD1 . ASN D 2 290 ? 23.113  -6.291  3.154   1.00 88.21  ? 372 ASN D OD1 1 
ATOM   6565 N  ND2 . ASN D 2 290 ? 25.303  -6.069  2.645   1.00 90.56  ? 372 ASN D ND2 1 
ATOM   6566 N  N   . SER D 2 291 ? 22.994  -10.835 4.752   1.00 59.31  ? 373 SER D N   1 
ATOM   6567 C  CA  . SER D 2 291 ? 23.201  -12.216 4.350   1.00 57.62  ? 373 SER D CA  1 
ATOM   6568 C  C   . SER D 2 291 ? 22.785  -12.443 2.908   1.00 55.26  ? 373 SER D C   1 
ATOM   6569 O  O   . SER D 2 291 ? 21.725  -11.990 2.478   1.00 56.27  ? 373 SER D O   1 
ATOM   6570 C  CB  . SER D 2 291 ? 22.403  -13.149 5.247   1.00 55.78  ? 373 SER D CB  1 
ATOM   6571 O  OG  . SER D 2 291 ? 21.998  -14.291 4.517   1.00 56.45  ? 373 SER D OG  1 
ATOM   6572 N  N   . GLN D 2 292 ? 23.601  -13.199 2.173   1.00 58.82  ? 374 GLN D N   1 
ATOM   6573 C  CA  . GLN D 2 292 ? 23.300  -13.521 0.782   1.00 63.16  ? 374 GLN D CA  1 
ATOM   6574 C  C   . GLN D 2 292 ? 23.060  -15.004 0.547   1.00 62.28  ? 374 GLN D C   1 
ATOM   6575 O  O   . GLN D 2 292 ? 23.086  -15.444 -0.609  1.00 65.90  ? 374 GLN D O   1 
ATOM   6576 C  CB  . GLN D 2 292 ? 24.421  -13.060 -0.144  1.00 73.40  ? 374 GLN D CB  1 
ATOM   6577 C  CG  . GLN D 2 292 ? 24.110  -11.779 -0.846  1.00 79.49  ? 374 GLN D CG  1 
ATOM   6578 C  CD  . GLN D 2 292 ? 24.614  -10.612 -0.065  1.00 84.13  ? 374 GLN D CD  1 
ATOM   6579 O  OE1 . GLN D 2 292 ? 25.586  -10.732 0.689   1.00 86.62  ? 374 GLN D OE1 1 
ATOM   6580 N  NE2 . GLN D 2 292 ? 23.952  -9.473  -0.211  1.00 86.10  ? 374 GLN D NE2 1 
ATOM   6581 N  N   . TYR D 2 293 ? 22.850  -15.792 1.603   1.00 55.15  ? 375 TYR D N   1 
ATOM   6582 C  CA  . TYR D 2 293 ? 22.724  -17.231 1.402   1.00 51.03  ? 375 TYR D CA  1 
ATOM   6583 C  C   . TYR D 2 293 ? 21.542  -17.554 0.493   1.00 47.35  ? 375 TYR D C   1 
ATOM   6584 O  O   . TYR D 2 293 ? 21.692  -18.267 -0.502  1.00 47.89  ? 375 TYR D O   1 
ATOM   6585 C  CB  . TYR D 2 293 ? 22.605  -17.953 2.742   1.00 47.35  ? 375 TYR D CB  1 
ATOM   6586 C  CG  . TYR D 2 293 ? 22.332  -19.427 2.579   1.00 47.17  ? 375 TYR D CG  1 
ATOM   6587 C  CD1 . TYR D 2 293 ? 23.354  -20.319 2.307   1.00 48.96  ? 375 TYR D CD1 1 
ATOM   6588 C  CD2 . TYR D 2 293 ? 21.050  -19.917 2.669   1.00 46.55  ? 375 TYR D CD2 1 
ATOM   6589 C  CE1 . TYR D 2 293 ? 23.104  -21.668 2.134   1.00 51.26  ? 375 TYR D CE1 1 
ATOM   6590 C  CE2 . TYR D 2 293 ? 20.787  -21.256 2.506   1.00 50.36  ? 375 TYR D CE2 1 
ATOM   6591 C  CZ  . TYR D 2 293 ? 21.814  -22.138 2.240   1.00 53.44  ? 375 TYR D CZ  1 
ATOM   6592 O  OH  . TYR D 2 293 ? 21.517  -23.484 2.075   1.00 54.16  ? 375 TYR D OH  1 
ATOM   6593 N  N   . GLN D 2 294 ? 20.372  -16.978 0.777   1.00 46.69  ? 376 GLN D N   1 
ATOM   6594 C  CA  . GLN D 2 294 ? 19.175  -17.283 -0.004  1.00 47.62  ? 376 GLN D CA  1 
ATOM   6595 C  C   . GLN D 2 294 ? 19.320  -16.954 -1.489  1.00 51.91  ? 376 GLN D C   1 
ATOM   6596 O  O   . GLN D 2 294 ? 18.550  -17.476 -2.307  1.00 52.90  ? 376 GLN D O   1 
ATOM   6597 C  CB  . GLN D 2 294 ? 17.968  -16.533 0.567   1.00 41.44  ? 376 GLN D CB  1 
ATOM   6598 C  CG  . GLN D 2 294 ? 17.399  -17.153 1.826   1.00 37.93  ? 376 GLN D CG  1 
ATOM   6599 C  CD  . GLN D 2 294 ? 16.647  -16.156 2.665   1.00 38.16  ? 376 GLN D CD  1 
ATOM   6600 O  OE1 . GLN D 2 294 ? 16.465  -15.001 2.266   1.00 44.24  ? 376 GLN D OE1 1 
ATOM   6601 N  NE2 . GLN D 2 294 ? 16.218  -16.579 3.841   1.00 33.74  ? 376 GLN D NE2 1 
ATOM   6602 N  N   . MET D 2 295 ? 20.272  -16.105 -1.859  1.00 54.66  ? 377 MET D N   1 
ATOM   6603 C  CA  . MET D 2 295 ? 20.472  -15.717 -3.247  1.00 57.80  ? 377 MET D CA  1 
ATOM   6604 C  C   . MET D 2 295 ? 21.666  -16.404 -3.896  1.00 58.51  ? 377 MET D C   1 
ATOM   6605 O  O   . MET D 2 295 ? 21.908  -16.185 -5.085  1.00 57.00  ? 377 MET D O   1 
ATOM   6606 C  CB  . MET D 2 295 ? 20.637  -14.194 -3.354  1.00 58.36  ? 377 MET D CB  1 
ATOM   6607 C  CG  . MET D 2 295 ? 19.371  -13.390 -3.108  1.00 59.78  ? 377 MET D CG  1 
ATOM   6608 S  SD  . MET D 2 295 ? 18.052  -13.685 -4.318  1.00 66.47  ? 377 MET D SD  1 
ATOM   6609 C  CE  . MET D 2 295 ? 17.065  -14.915 -3.432  1.00 63.85  ? 377 MET D CE  1 
ATOM   6610 N  N   . LEU D 2 296 ? 22.413  -17.218 -3.156  1.00 60.32  ? 378 LEU D N   1 
ATOM   6611 C  CA  . LEU D 2 296 ? 23.604  -17.837 -3.720  1.00 64.90  ? 378 LEU D CA  1 
ATOM   6612 C  C   . LEU D 2 296 ? 23.239  -18.681 -4.931  1.00 66.02  ? 378 LEU D C   1 
ATOM   6613 O  O   . LEU D 2 296 ? 22.189  -19.332 -4.967  1.00 62.63  ? 378 LEU D O   1 
ATOM   6614 C  CB  . LEU D 2 296 ? 24.318  -18.689 -2.669  1.00 66.52  ? 378 LEU D CB  1 
ATOM   6615 C  CG  . LEU D 2 296 ? 25.056  -17.848 -1.623  1.00 66.93  ? 378 LEU D CG  1 
ATOM   6616 C  CD1 . LEU D 2 296 ? 25.585  -18.682 -0.474  1.00 67.88  ? 378 LEU D CD1 1 
ATOM   6617 C  CD2 . LEU D 2 296 ? 26.180  -17.093 -2.284  1.00 69.55  ? 378 LEU D CD2 1 
ATOM   6618 N  N   . LEU D 2 297 ? 24.099  -18.636 -5.947  1.00 69.61  ? 379 LEU D N   1 
ATOM   6619 C  CA  . LEU D 2 297 ? 23.874  -19.474 -7.115  1.00 72.50  ? 379 LEU D CA  1 
ATOM   6620 C  C   . LEU D 2 297 ? 23.969  -20.945 -6.733  1.00 76.34  ? 379 LEU D C   1 
ATOM   6621 O  O   . LEU D 2 297 ? 23.004  -21.699 -6.876  1.00 79.53  ? 379 LEU D O   1 
ATOM   6622 C  CB  . LEU D 2 297 ? 24.860  -19.109 -8.228  1.00 73.32  ? 379 LEU D CB  1 
ATOM   6623 C  CG  . LEU D 2 297 ? 24.452  -17.807 -8.933  1.00 69.45  ? 379 LEU D CG  1 
ATOM   6624 C  CD1 . LEU D 2 297 ? 25.462  -17.365 -9.984  1.00 69.43  ? 379 LEU D CD1 1 
ATOM   6625 C  CD2 . LEU D 2 297 ? 23.066  -17.954 -9.540  1.00 66.15  ? 379 LEU D CD2 1 
ATOM   6626 N  N   . ASP D 2 298 ? 25.113  -21.369 -6.211  1.00 77.71  ? 380 ASP D N   1 
ATOM   6627 C  CA  . ASP D 2 298 ? 25.190  -22.685 -5.615  1.00 81.94  ? 380 ASP D CA  1 
ATOM   6628 C  C   . ASP D 2 298 ? 25.457  -22.486 -4.136  1.00 85.72  ? 380 ASP D C   1 
ATOM   6629 O  O   . ASP D 2 298 ? 26.414  -21.782 -3.777  1.00 89.15  ? 380 ASP D O   1 
ATOM   6630 C  CB  . ASP D 2 298 ? 26.282  -23.539 -6.261  1.00 87.86  ? 380 ASP D CB  1 
ATOM   6631 C  CG  . ASP D 2 298 ? 26.730  -24.689 -5.373  1.00 90.78  ? 380 ASP D CG  1 
ATOM   6632 O  OD1 . ASP D 2 298 ? 25.879  -25.262 -4.648  1.00 88.47  ? 380 ASP D OD1 1 
ATOM   6633 O  OD2 . ASP D 2 298 ? 27.929  -25.034 -5.405  1.00 94.23  ? 380 ASP D OD2 1 
ATOM   6634 N  N   . PRO D 2 299 ? 24.630  -23.037 -3.246  1.00 84.53  ? 381 PRO D N   1 
ATOM   6635 C  CA  . PRO D 2 299 ? 24.857  -22.798 -1.816  1.00 81.92  ? 381 PRO D CA  1 
ATOM   6636 C  C   . PRO D 2 299 ? 26.073  -23.522 -1.264  1.00 83.05  ? 381 PRO D C   1 
ATOM   6637 O  O   . PRO D 2 299 ? 26.628  -23.083 -0.251  1.00 82.09  ? 381 PRO D O   1 
ATOM   6638 C  CB  . PRO D 2 299 ? 23.557  -23.295 -1.163  1.00 80.07  ? 381 PRO D CB  1 
ATOM   6639 C  CG  . PRO D 2 299 ? 22.559  -23.377 -2.287  1.00 79.72  ? 381 PRO D CG  1 
ATOM   6640 C  CD  . PRO D 2 299 ? 23.357  -23.732 -3.494  1.00 83.33  ? 381 PRO D CD  1 
ATOM   6641 N  N   . THR D 2 300 ? 26.501  -24.624 -1.872  1.00 86.37  ? 382 THR D N   1 
ATOM   6642 C  CA  . THR D 2 300 ? 27.679  -25.304 -1.351  1.00 91.51  ? 382 THR D CA  1 
ATOM   6643 C  C   . THR D 2 300 ? 28.982  -24.653 -1.803  1.00 96.13  ? 382 THR D C   1 
ATOM   6644 O  O   . THR D 2 300 ? 30.055  -25.062 -1.340  1.00 99.97  ? 382 THR D O   1 
ATOM   6645 C  CB  . THR D 2 300 ? 27.677  -26.790 -1.740  1.00 94.82  ? 382 THR D CB  1 
ATOM   6646 O  OG1 . THR D 2 300 ? 27.185  -26.960 -3.079  1.00 97.48  ? 382 THR D OG1 1 
ATOM   6647 C  CG2 . THR D 2 300 ? 26.828  -27.612 -0.752  1.00 91.25  ? 382 THR D CG2 1 
ATOM   6648 N  N   . ASN D 2 301 ? 28.923  -23.645 -2.675  1.00 95.56  ? 383 ASN D N   1 
ATOM   6649 C  CA  . ASN D 2 301 ? 30.120  -22.935 -3.129  1.00 96.89  ? 383 ASN D CA  1 
ATOM   6650 C  C   . ASN D 2 301 ? 29.784  -21.458 -3.259  1.00 91.67  ? 383 ASN D C   1 
ATOM   6651 O  O   . ASN D 2 301 ? 29.319  -20.998 -4.311  1.00 88.39  ? 383 ASN D O   1 
ATOM   6652 C  CB  . ASN D 2 301 ? 30.650  -23.490 -4.452  1.00 101.80 ? 383 ASN D CB  1 
ATOM   6653 C  CG  . ASN D 2 301 ? 31.726  -22.603 -5.053  1.00 105.42 ? 383 ASN D CG  1 
ATOM   6654 O  OD1 . ASN D 2 301 ? 31.801  -22.431 -6.268  1.00 105.01 ? 383 ASN D OD1 1 
ATOM   6655 N  ND2 . ASN D 2 301 ? 32.573  -22.032 -4.188  1.00 108.46 ? 383 ASN D ND2 1 
ATOM   6656 N  N   . PRO D 2 302 ? 30.017  -20.672 -2.207  1.00 90.72  ? 384 PRO D N   1 
ATOM   6657 C  CA  . PRO D 2 302 ? 29.695  -19.237 -2.285  1.00 89.11  ? 384 PRO D CA  1 
ATOM   6658 C  C   . PRO D 2 302 ? 30.461  -18.497 -3.363  1.00 87.49  ? 384 PRO D C   1 
ATOM   6659 O  O   . PRO D 2 302 ? 29.985  -17.452 -3.825  1.00 84.22  ? 384 PRO D O   1 
ATOM   6660 C  CB  . PRO D 2 302 ? 30.056  -18.716 -0.882  1.00 87.79  ? 384 PRO D CB  1 
ATOM   6661 C  CG  . PRO D 2 302 ? 30.027  -19.921 -0.008  1.00 86.08  ? 384 PRO D CG  1 
ATOM   6662 C  CD  . PRO D 2 302 ? 30.461  -21.068 -0.860  1.00 88.84  ? 384 PRO D CD  1 
ATOM   6663 N  N   . SER D 2 303 ? 31.634  -19.000 -3.773  1.00 92.68  ? 385 SER D N   1 
ATOM   6664 C  CA  . SER D 2 303 ? 32.455  -18.266 -4.734  1.00 97.25  ? 385 SER D CA  1 
ATOM   6665 C  C   . SER D 2 303 ? 31.723  -18.051 -6.052  1.00 95.48  ? 385 SER D C   1 
ATOM   6666 O  O   . SER D 2 303 ? 32.049  -17.119 -6.796  1.00 95.29  ? 385 SER D O   1 
ATOM   6667 C  CB  . SER D 2 303 ? 33.787  -18.992 -4.977  1.00 105.56 ? 385 SER D CB  1 
ATOM   6668 O  OG  . SER D 2 303 ? 33.641  -20.136 -5.810  1.00 109.70 ? 385 SER D OG  1 
ATOM   6669 N  N   . ALA D 2 304 ? 30.722  -18.885 -6.348  1.00 92.15  ? 386 ALA D N   1 
ATOM   6670 C  CA  . ALA D 2 304 ? 30.029  -18.843 -7.629  1.00 90.85  ? 386 ALA D CA  1 
ATOM   6671 C  C   . ALA D 2 304 ? 29.134  -17.624 -7.791  1.00 87.76  ? 386 ALA D C   1 
ATOM   6672 O  O   . ALA D 2 304 ? 28.588  -17.429 -8.881  1.00 90.36  ? 386 ALA D O   1 
ATOM   6673 C  CB  . ALA D 2 304 ? 29.189  -20.109 -7.822  1.00 89.18  ? 386 ALA D CB  1 
ATOM   6674 N  N   . GLY D 2 305 ? 28.955  -16.816 -6.747  1.00 83.18  ? 387 GLY D N   1 
ATOM   6675 C  CA  . GLY D 2 305 ? 28.149  -15.617 -6.846  1.00 76.96  ? 387 GLY D CA  1 
ATOM   6676 C  C   . GLY D 2 305 ? 26.690  -15.852 -6.522  1.00 72.02  ? 387 GLY D C   1 
ATOM   6677 O  O   . GLY D 2 305 ? 26.253  -16.942 -6.136  1.00 69.83  ? 387 GLY D O   1 
ATOM   6678 N  N   . THR D 2 306 ? 25.920  -14.782 -6.690  1.00 70.01  ? 388 THR D N   1 
ATOM   6679 C  CA  . THR D 2 306 ? 24.497  -14.771 -6.412  1.00 68.51  ? 388 THR D CA  1 
ATOM   6680 C  C   . THR D 2 306 ? 23.721  -14.418 -7.672  1.00 69.90  ? 388 THR D C   1 
ATOM   6681 O  O   . THR D 2 306 ? 24.232  -13.739 -8.564  1.00 70.24  ? 388 THR D O   1 
ATOM   6682 C  CB  . THR D 2 306 ? 24.158  -13.755 -5.309  1.00 69.69  ? 388 THR D CB  1 
ATOM   6683 O  OG1 . THR D 2 306 ? 24.197  -12.438 -5.861  1.00 72.76  ? 388 THR D OG1 1 
ATOM   6684 C  CG2 . THR D 2 306 ? 25.158  -13.828 -4.178  1.00 70.17  ? 388 THR D CG2 1 
ATOM   6685 N  N   . ALA D 2 307 ? 22.476  -14.881 -7.738  1.00 73.94  ? 389 ALA D N   1 
ATOM   6686 C  CA  . ALA D 2 307 ? 21.575  -14.434 -8.790  1.00 80.94  ? 389 ALA D CA  1 
ATOM   6687 C  C   . ALA D 2 307 ? 21.389  -12.929 -8.697  1.00 90.72  ? 389 ALA D C   1 
ATOM   6688 O  O   . ALA D 2 307 ? 21.191  -12.379 -7.612  1.00 88.73  ? 389 ALA D O   1 
ATOM   6689 C  CB  . ALA D 2 307 ? 20.231  -15.142 -8.676  1.00 72.66  ? 389 ALA D CB  1 
ATOM   6690 N  N   . LYS D 2 308 ? 21.474  -12.256 -9.833  1.00 108.51 ? 390 LYS D N   1 
ATOM   6691 C  CA  . LYS D 2 308 ? 21.406  -10.808 -9.850  1.00 111.38 ? 390 LYS D CA  1 
ATOM   6692 C  C   . LYS D 2 308 ? 20.392  -10.278 -10.849 1.00 116.66 ? 390 LYS D C   1 
ATOM   6693 O  O   . LYS D 2 308 ? 20.217  -9.057  -10.926 1.00 120.24 ? 390 LYS D O   1 
ATOM   6694 C  CB  . LYS D 2 308 ? 22.790  -10.210 -10.159 1.00 116.22 ? 390 LYS D CB  1 
ATOM   6695 N  N   . ILE D 2 309 ? 19.705  -11.157 -11.583 1.00 117.47 ? 391 ILE D N   1 
ATOM   6696 C  CA  . ILE D 2 309 ? 18.864  -10.798 -12.734 1.00 119.49 ? 391 ILE D CA  1 
ATOM   6697 C  C   . ILE D 2 309 ? 18.066  -9.514  -12.534 1.00 117.17 ? 391 ILE D C   1 
ATOM   6698 O  O   . ILE D 2 309 ? 17.264  -9.414  -11.607 1.00 113.71 ? 391 ILE D O   1 
ATOM   6699 C  CB  . ILE D 2 309 ? 17.887  -11.954 -13.093 1.00 119.85 ? 391 ILE D CB  1 
ATOM   6700 C  CG1 . ILE D 2 309 ? 18.625  -13.147 -13.715 1.00 119.39 ? 391 ILE D CG1 1 
ATOM   6701 C  CG2 . ILE D 2 309 ? 16.805  -11.453 -14.045 1.00 122.67 ? 391 ILE D CG2 1 
ATOM   6702 C  CD1 . ILE D 2 309 ? 17.706  -14.149 -14.397 1.00 116.65 ? 391 ILE D CD1 1 
HETATM 6703 S  S   . SO4 E 3 .   ? 48.109  25.017  63.454  1.00 139.21 ? 201 SO4 A S   1 
HETATM 6704 O  O1  . SO4 E 3 .   ? 48.258  23.569  63.474  1.00 138.89 ? 201 SO4 A O1  1 
HETATM 6705 O  O2  . SO4 E 3 .   ? 48.081  25.486  62.072  1.00 139.37 ? 201 SO4 A O2  1 
HETATM 6706 O  O3  . SO4 E 3 .   ? 49.240  25.629  64.144  1.00 140.75 ? 201 SO4 A O3  1 
HETATM 6707 O  O4  . SO4 E 3 .   ? 46.872  25.387  64.133  1.00 138.48 ? 201 SO4 A O4  1 
HETATM 6708 ZN ZN  . ZN  F 4 .   ? 33.333  1.169   67.615  1.00 50.24  ? 501 ZN  C ZN  1 
HETATM 6709 ZN ZN  . ZN  G 4 .   ? 18.416  22.614  39.034  1.00 68.76  ? 502 ZN  C ZN  1 
HETATM 6710 ZN ZN  . ZN  H 4 .   ? 29.758  -3.284  54.199  1.00 62.53  ? 503 ZN  C ZN  1 
HETATM 6711 S  S   . SO4 I 3 .   ? 6.486   39.616  29.875  1.00 163.88 ? 504 SO4 C S   1 
HETATM 6712 O  O1  . SO4 I 3 .   ? 6.744   39.440  28.450  1.00 164.14 ? 504 SO4 C O1  1 
HETATM 6713 O  O2  . SO4 I 3 .   ? 6.477   41.044  30.181  1.00 164.25 ? 504 SO4 C O2  1 
HETATM 6714 O  O3  . SO4 I 3 .   ? 7.547   38.971  30.640  1.00 163.64 ? 504 SO4 C O3  1 
HETATM 6715 O  O4  . SO4 I 3 .   ? 5.197   39.014  30.220  1.00 163.43 ? 504 SO4 C O4  1 
HETATM 6716 S  S   . SO4 J 3 .   ? 5.241   36.175  25.934  1.00 150.14 ? 505 SO4 C S   1 
HETATM 6717 O  O1  . SO4 J 3 .   ? 5.123   34.719  25.886  1.00 149.37 ? 505 SO4 C O1  1 
HETATM 6718 O  O2  . SO4 J 3 .   ? 4.882   36.725  24.631  1.00 150.91 ? 505 SO4 C O2  1 
HETATM 6719 O  O3  . SO4 J 3 .   ? 6.616   36.546  26.254  1.00 149.94 ? 505 SO4 C O3  1 
HETATM 6720 O  O4  . SO4 J 3 .   ? 4.352   36.725  26.957  1.00 150.36 ? 505 SO4 C O4  1 
HETATM 6721 S  S   . SO4 K 3 .   ? 11.354  42.394  57.903  1.00 133.24 ? 506 SO4 C S   1 
HETATM 6722 O  O1  . SO4 K 3 .   ? 12.162  42.288  56.693  1.00 133.14 ? 506 SO4 C O1  1 
HETATM 6723 O  O2  . SO4 K 3 .   ? 9.954   42.580  57.529  1.00 133.50 ? 506 SO4 C O2  1 
HETATM 6724 O  O3  . SO4 K 3 .   ? 11.506  41.176  58.701  1.00 131.73 ? 506 SO4 C O3  1 
HETATM 6725 O  O4  . SO4 K 3 .   ? 11.789  43.555  58.674  1.00 133.63 ? 506 SO4 C O4  1 
HETATM 6726 ZN ZN  . ZN  L 4 .   ? 19.453  27.448  5.867   1.00 53.05  ? 501 ZN  D ZN  1 
HETATM 6727 ZN ZN  . ZN  M 4 .   ? 15.397  30.050  19.769  1.00 44.93  ? 502 ZN  D ZN  1 
HETATM 6728 ZN ZN  . ZN  N 4 .   ? 11.923  -3.277  0.178   1.00 52.61  ? 503 ZN  D ZN  1 
HETATM 6729 S  S   . SO4 O 3 .   ? 12.598  3.236   13.365  1.00 98.45  ? 504 SO4 D S   1 
HETATM 6730 O  O1  . SO4 O 3 .   ? 13.740  4.035   12.898  1.00 98.71  ? 504 SO4 D O1  1 
HETATM 6731 O  O2  . SO4 O 3 .   ? 12.172  2.345   12.288  1.00 98.75  ? 504 SO4 D O2  1 
HETATM 6732 O  O3  . SO4 O 3 .   ? 12.978  2.474   14.555  1.00 96.92  ? 504 SO4 D O3  1 
HETATM 6733 O  O4  . SO4 O 3 .   ? 11.464  4.093   13.690  1.00 97.50  ? 504 SO4 D O4  1 
HETATM 6734 S  S   . SO4 P 3 .   ? 17.599  1.005   17.440  1.00 130.94 ? 505 SO4 D S   1 
HETATM 6735 O  O1  . SO4 P 3 .   ? 18.979  0.854   16.976  1.00 129.68 ? 505 SO4 D O1  1 
HETATM 6736 O  O2  . SO4 P 3 .   ? 17.037  2.236   16.877  1.00 130.52 ? 505 SO4 D O2  1 
HETATM 6737 O  O3  . SO4 P 3 .   ? 16.823  -0.158  17.028  1.00 130.26 ? 505 SO4 D O3  1 
HETATM 6738 O  O4  . SO4 P 3 .   ? 17.546  1.069   18.898  1.00 131.88 ? 505 SO4 D O4  1 
HETATM 6739 C  C1  . GOL Q 5 .   ? 16.994  38.771  22.678  1.00 74.07  ? 506 GOL D C1  1 
HETATM 6740 O  O1  . GOL Q 5 .   ? 17.129  40.169  22.564  1.00 75.09  ? 506 GOL D O1  1 
HETATM 6741 C  C2  . GOL Q 5 .   ? 18.394  38.211  22.497  1.00 73.54  ? 506 GOL D C2  1 
HETATM 6742 O  O2  . GOL Q 5 .   ? 19.063  38.176  23.690  1.00 74.13  ? 506 GOL D O2  1 
HETATM 6743 C  C3  . GOL Q 5 .   ? 18.223  36.816  21.854  1.00 75.28  ? 506 GOL D C3  1 
HETATM 6744 O  O3  . GOL Q 5 .   ? 19.465  36.162  21.921  1.00 77.93  ? 506 GOL D O3  1 
HETATM 6745 O  O   . HOH R 6 .   ? 44.497  54.792  55.830  1.00 39.41  ? 301 HOH A O   1 
HETATM 6746 O  O   . HOH R 6 .   ? 19.742  38.206  47.398  1.00 40.75  ? 302 HOH A O   1 
HETATM 6747 O  O   . HOH R 6 .   ? 48.455  37.440  59.977  1.00 55.22  ? 303 HOH A O   1 
HETATM 6748 O  O   . HOH R 6 .   ? 39.049  44.726  61.993  1.00 31.56  ? 304 HOH A O   1 
HETATM 6749 O  O   . HOH R 6 .   ? 31.655  38.173  41.086  1.00 44.91  ? 305 HOH A O   1 
HETATM 6750 O  O   . HOH R 6 .   ? 42.829  51.333  46.604  1.00 41.86  ? 306 HOH A O   1 
HETATM 6751 O  O   . HOH R 6 .   ? 33.440  38.401  65.246  1.00 54.98  ? 307 HOH A O   1 
HETATM 6752 O  O   . HOH R 6 .   ? 51.553  41.686  58.735  1.00 50.88  ? 308 HOH A O   1 
HETATM 6753 O  O   . HOH S 6 .   ? -16.205 -17.422 15.295  1.00 38.43  ? 201 HOH B O   1 
HETATM 6754 O  O   . HOH S 6 .   ? -9.141  6.090   13.712  1.00 42.60  ? 202 HOH B O   1 
HETATM 6755 O  O   . HOH S 6 .   ? 0.056   -3.509  9.959   1.00 37.41  ? 203 HOH B O   1 
HETATM 6756 O  O   . HOH T 6 .   ? 11.447  27.778  36.643  1.00 52.41  ? 601 HOH C O   1 
HETATM 6757 O  O   . HOH T 6 .   ? 15.121  25.410  36.533  1.00 47.31  ? 602 HOH C O   1 
HETATM 6758 O  O   . HOH T 6 .   ? 9.892   33.149  51.666  1.00 52.45  ? 603 HOH C O   1 
HETATM 6759 O  O   . HOH T 6 .   ? 36.139  -0.838  59.581  1.00 43.36  ? 604 HOH C O   1 
HETATM 6760 O  O   . HOH T 6 .   ? 4.223   32.431  38.493  1.00 48.65  ? 605 HOH C O   1 
HETATM 6761 O  O   . HOH T 6 .   ? 14.460  37.478  51.303  1.00 39.68  ? 606 HOH C O   1 
HETATM 6762 O  O   . HOH T 6 .   ? -2.895  23.938  31.110  1.00 53.11  ? 607 HOH C O   1 
HETATM 6763 O  O   . HOH T 6 .   ? 10.090  38.647  31.654  1.00 46.43  ? 608 HOH C O   1 
HETATM 6764 O  O   . HOH T 6 .   ? 3.411   38.753  44.522  1.00 50.08  ? 609 HOH C O   1 
HETATM 6765 O  O   . HOH T 6 .   ? 17.881  26.286  36.887  1.00 38.20  ? 610 HOH C O   1 
HETATM 6766 O  O   . HOH T 6 .   ? 37.690  25.010  44.925  1.00 46.23  ? 611 HOH C O   1 
HETATM 6767 O  O   . HOH T 6 .   ? 31.931  6.625   39.182  1.00 49.62  ? 612 HOH C O   1 
HETATM 6768 O  O   . HOH T 6 .   ? 17.233  28.506  26.149  1.00 42.51  ? 613 HOH C O   1 
HETATM 6769 O  O   . HOH U 6 .   ? -11.121 19.024  21.237  1.00 37.08  ? 601 HOH D O   1 
HETATM 6770 O  O   . HOH U 6 .   ? 16.048  -21.682 18.861  1.00 49.40  ? 602 HOH D O   1 
HETATM 6771 O  O   . HOH U 6 .   ? 13.362  24.671  3.339   1.00 64.34  ? 603 HOH D O   1 
HETATM 6772 O  O   . HOH U 6 .   ? 8.000   -12.804 16.763  1.00 49.22  ? 604 HOH D O   1 
HETATM 6773 O  O   . HOH U 6 .   ? 17.068  -21.501 10.201  1.00 40.66  ? 605 HOH D O   1 
HETATM 6774 O  O   . HOH U 6 .   ? -1.356  28.692  22.941  1.00 50.24  ? 606 HOH D O   1 
HETATM 6775 O  O   . HOH U 6 .   ? 20.792  -22.462 -5.612  1.00 45.27  ? 607 HOH D O   1 
HETATM 6776 O  O   . HOH U 6 .   ? 7.561   34.000  10.206  1.00 68.14  ? 608 HOH D O   1 
HETATM 6777 O  O   . HOH U 6 .   ? 20.320  -14.443 22.656  1.00 34.78  ? 609 HOH D O   1 
HETATM 6778 O  O   . HOH U 6 .   ? 1.091   28.883  1.999   1.00 46.21  ? 610 HOH D O   1 
HETATM 6779 O  O   . HOH U 6 .   ? 20.831  -10.762 19.684  1.00 43.32  ? 611 HOH D O   1 
HETATM 6780 O  O   . HOH U 6 .   ? 1.540   -2.566  -4.917  1.00 41.16  ? 612 HOH D O   1 
HETATM 6781 O  O   . HOH U 6 .   ? 7.848   -5.146  2.942   1.00 49.84  ? 613 HOH D O   1 
HETATM 6782 O  O   . HOH U 6 .   ? 7.460   32.154  8.143   1.00 40.71  ? 614 HOH D O   1 
HETATM 6783 O  O   . HOH U 6 .   ? 9.969   26.636  0.371   1.00 52.72  ? 615 HOH D O   1 
HETATM 6784 O  O   . HOH U 6 .   ? 2.729   -11.277 13.266  1.00 31.56  ? 616 HOH D O   1 
HETATM 6785 O  O   . HOH U 6 .   ? 10.612  25.057  12.779  1.00 33.78  ? 617 HOH D O   1 
HETATM 6786 O  O   . HOH U 6 .   ? 13.499  30.673  11.184  1.00 49.51  ? 618 HOH D O   1 
HETATM 6787 O  O   . HOH U 6 .   ? 17.135  -19.486 4.099   1.00 49.04  ? 619 HOH D O   1 
HETATM 6788 O  O   . HOH U 6 .   ? 8.803   22.992  17.645  1.00 34.86  ? 620 HOH D O   1 
HETATM 6789 O  O   . HOH U 6 .   ? 21.755  -24.606 17.231  1.00 40.26  ? 621 HOH D O   1 
HETATM 6790 O  O   . HOH U 6 .   ? 10.705  16.719  -5.567  1.00 56.79  ? 622 HOH D O   1 
HETATM 6791 O  O   . HOH U 6 .   ? 20.656  34.802  24.328  1.00 54.99  ? 623 HOH D O   1 
HETATM 6792 O  O   . HOH U 6 .   ? 20.982  33.475  21.624  1.00 49.61  ? 624 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 3   ? 1.0706 0.7910 1.5077 -0.0728 0.2243  0.1322  1   MET A N   
2    C CA  . MET A 3   ? 1.0679 0.8255 1.4210 -0.0697 0.1865  0.1363  1   MET A CA  
3    C C   . MET A 3   ? 1.0180 0.8128 1.3547 -0.0843 0.1704  0.0771  1   MET A C   
4    O O   . MET A 3   ? 1.0242 0.8265 1.3904 -0.0884 0.1685  0.0439  1   MET A O   
5    C CB  . MET A 3   ? 1.0503 0.8194 1.3690 -0.0463 0.1512  0.1780  1   MET A CB  
6    N N   . ALA A 4   ? 0.9798 0.7983 1.2703 -0.0927 0.1600  0.0654  2   ALA A N   
7    C CA  . ALA A 4   ? 0.9152 0.7714 1.1899 -0.1034 0.1399  0.0182  2   ALA A CA  
8    C C   . ALA A 4   ? 0.8766 0.7526 1.1233 -0.0915 0.1058  0.0158  2   ALA A C   
9    O O   . ALA A 4   ? 0.8829 0.7824 1.1306 -0.1004 0.0932  -0.0217 2   ALA A O   
10   C CB  . ALA A 4   ? 0.9404 0.8177 1.1768 -0.1095 0.1339  0.0134  2   ALA A CB  
11   N N   . GLY A 5   ? 0.8471 0.7169 1.0669 -0.0731 0.0897  0.0557  3   GLY A N   
12   C CA  . GLY A 5   ? 0.7714 0.6610 0.9677 -0.0630 0.0589  0.0529  3   GLY A CA  
13   C C   . GLY A 5   ? 0.6802 0.5982 0.8173 -0.0626 0.0320  0.0472  3   GLY A C   
14   O O   . GLY A 5   ? 0.6763 0.5971 0.7865 -0.0663 0.0362  0.0545  3   GLY A O   
15   N N   . VAL A 6   ? 0.6485 0.5858 0.7689 -0.0593 0.0079  0.0320  4   VAL A N   
16   C CA  . VAL A 6   ? 0.6191 0.5802 0.6932 -0.0591 -0.0150 0.0233  4   VAL A CA  
17   C C   . VAL A 6   ? 0.5993 0.5710 0.6755 -0.0712 -0.0066 -0.0004 4   VAL A C   
18   O O   . VAL A 6   ? 0.6494 0.6230 0.7595 -0.0827 0.0056  -0.0247 4   VAL A O   
19   C CB  . VAL A 6   ? 0.6128 0.5890 0.6781 -0.0568 -0.0365 0.0075  4   VAL A CB  
20   C CG1 . VAL A 6   ? 0.5454 0.5291 0.6329 -0.0697 -0.0316 -0.0266 4   VAL A CG1 
21   C CG2 . VAL A 6   ? 0.6373 0.6317 0.6580 -0.0534 -0.0586 0.0071  4   VAL A CG2 
22   N N   . SER A 7   ? 0.5595 0.5398 0.6042 -0.0701 -0.0110 0.0055  5   SER A N   
23   C CA  . SER A 7   ? 0.5608 0.5550 0.6141 -0.0791 -0.0039 -0.0158 5   SER A CA  
24   C C   . SER A 7   ? 0.5712 0.5870 0.6021 -0.0751 -0.0260 -0.0281 5   SER A C   
25   O O   . SER A 7   ? 0.6186 0.6344 0.6145 -0.0677 -0.0386 -0.0158 5   SER A O   
26   C CB  . SER A 7   ? 0.6161 0.5985 0.6619 -0.0835 0.0200  -0.0010 5   SER A CB  
27   O OG  . SER A 7   ? 0.6852 0.6855 0.7286 -0.0884 0.0221  -0.0192 5   SER A OG  
28   N N   . PHE A 8   ? 0.5291 0.5647 0.5844 -0.0803 -0.0310 -0.0518 6   PHE A N   
29   C CA  . PHE A 8   ? 0.5199 0.5732 0.5660 -0.0750 -0.0484 -0.0603 6   PHE A CA  
30   C C   . PHE A 8   ? 0.5669 0.6332 0.6373 -0.0787 -0.0356 -0.0726 6   PHE A C   
31   O O   . PHE A 8   ? 0.6126 0.6971 0.6977 -0.0744 -0.0485 -0.0830 6   PHE A O   
32   C CB  . PHE A 8   ? 0.5080 0.5776 0.5632 -0.0747 -0.0715 -0.0718 6   PHE A CB  
33   C CG  . PHE A 8   ? 0.5435 0.6019 0.5839 -0.0747 -0.0780 -0.0662 6   PHE A CG  
34   C CD1 . PHE A 8   ? 0.5801 0.6309 0.5909 -0.0663 -0.0902 -0.0545 6   PHE A CD1 
35   C CD2 . PHE A 8   ? 0.5162 0.5728 0.5779 -0.0848 -0.0688 -0.0765 6   PHE A CD2 
36   C CE1 . PHE A 8   ? 0.5961 0.6388 0.6023 -0.0668 -0.0934 -0.0516 6   PHE A CE1 
37   C CE2 . PHE A 8   ? 0.4919 0.5378 0.5476 -0.0857 -0.0696 -0.0752 6   PHE A CE2 
38   C CZ  . PHE A 8   ? 0.5085 0.5480 0.5384 -0.0761 -0.0817 -0.0621 6   PHE A CZ  
39   N N   . SER A 9   ? 0.5706 0.6273 0.6503 -0.0865 -0.0086 -0.0704 7   SER A N   
40   C CA  . SER A 9   ? 0.5810 0.6530 0.6952 -0.0923 0.0073  -0.0868 7   SER A CA  
41   C C   . SER A 9   ? 0.6137 0.6839 0.7044 -0.0891 0.0158  -0.0861 7   SER A C   
42   O O   . SER A 9   ? 0.6157 0.7036 0.7299 -0.0839 0.0077  -0.1004 7   SER A O   
43   C CB  . SER A 9   ? 0.6341 0.6951 0.7702 -0.1049 0.0382  -0.0871 7   SER A CB  
44   O OG  . SER A 9   ? 0.6732 0.7357 0.8368 -0.1110 0.0347  -0.0941 7   SER A OG  
45   N N   . GLY A 10  ? 0.6580 0.7078 0.7027 -0.0928 0.0320  -0.0693 8   GLY A N   
46   C CA  . GLY A 10  ? 0.6911 0.7408 0.7034 -0.0940 0.0401  -0.0727 8   GLY A CA  
47   C C   . GLY A 10  ? 0.7528 0.8074 0.7480 -0.0834 0.0117  -0.0739 8   GLY A C   
48   O O   . GLY A 10  ? 0.8365 0.8858 0.8155 -0.0772 -0.0097 -0.0602 8   GLY A O   
49   N N   . HIS A 11  ? 0.7534 0.8172 0.7611 -0.0817 0.0145  -0.0923 9   HIS A N   
50   C CA  . HIS A 11  ? 0.7512 0.8173 0.7530 -0.0727 -0.0071 -0.0965 9   HIS A CA  
51   C C   . HIS A 11  ? 0.6884 0.7645 0.7285 -0.0617 -0.0334 -0.0956 9   HIS A C   
52   O O   . HIS A 11  ? 0.7254 0.7985 0.7535 -0.0548 -0.0530 -0.0916 9   HIS A O   
53   C CB  . HIS A 11  ? 0.8065 0.8625 0.7502 -0.0734 -0.0205 -0.0810 9   HIS A CB  
54   C CG  . HIS A 11  ? 0.8983 0.9493 0.7904 -0.0857 -0.0026 -0.0756 9   HIS A CG  
55   N ND1 . HIS A 11  ? 0.9308 0.9739 0.7972 -0.0909 0.0051  -0.0528 9   HIS A ND1 
56   C CD2 . HIS A 11  ? 0.9396 0.9932 0.7979 -0.0955 0.0087  -0.0890 9   HIS A CD2 
57   C CE1 . HIS A 11  ? 0.9853 1.0285 0.7993 -0.1030 0.0178  -0.0481 9   HIS A CE1 
58   N NE2 . HIS A 11  ? 0.9954 1.0466 0.8009 -0.1076 0.0203  -0.0728 9   HIS A NE2 
59   N N   . ARG A 12  ? 0.5999 0.6894 0.6826 -0.0620 -0.0348 -0.0990 10  ARG A N   
60   C CA  . ARG A 12  ? 0.5399 0.6425 0.6449 -0.0553 -0.0628 -0.0959 10  ARG A CA  
61   C C   . ARG A 12  ? 0.5434 0.6525 0.6691 -0.0443 -0.0774 -0.0980 10  ARG A C   
62   O O   . ARG A 12  ? 0.5757 0.6812 0.6851 -0.0387 -0.0993 -0.0880 10  ARG A O   
63   C CB  . ARG A 12  ? 0.5229 0.6470 0.6738 -0.0607 -0.0627 -0.1041 10  ARG A CB  
64   C CG  . ARG A 12  ? 0.4534 0.5964 0.6170 -0.0582 -0.0936 -0.1013 10  ARG A CG  
65   C CD  . ARG A 12  ? 0.4790 0.6502 0.6873 -0.0669 -0.0957 -0.1135 10  ARG A CD  
66   N NE  . ARG A 12  ? 0.5445 0.7066 0.7329 -0.0794 -0.0896 -0.1159 10  ARG A NE  
67   C CZ  . ARG A 12  ? 0.5579 0.7337 0.7413 -0.0867 -0.1083 -0.1196 10  ARG A CZ  
68   N NH1 . ARG A 12  ? 0.5731 0.7744 0.7624 -0.0829 -0.1379 -0.1167 10  ARG A NH1 
69   N NH2 . ARG A 12  ? 0.5720 0.7352 0.7449 -0.0987 -0.0954 -0.1257 10  ARG A NH2 
70   N N   . LEU A 13  ? 0.5156 0.6317 0.6806 -0.0414 -0.0619 -0.1107 11  LEU A N   
71   C CA  . LEU A 13  ? 0.5178 0.6385 0.7194 -0.0289 -0.0726 -0.1113 11  LEU A CA  
72   C C   . LEU A 13  ? 0.5265 0.6241 0.6869 -0.0267 -0.0758 -0.1071 11  LEU A C   
73   O O   . LEU A 13  ? 0.5386 0.6341 0.7103 -0.0171 -0.0951 -0.0967 11  LEU A O   
74   C CB  . LEU A 13  ? 0.5696 0.6997 0.8293 -0.0270 -0.0480 -0.1296 11  LEU A CB  
75   C CG  . LEU A 13  ? 0.5638 0.6975 0.8806 -0.0117 -0.0548 -0.1295 11  LEU A CG  
76   C CD1 . LEU A 13  ? 0.5316 0.6872 0.8768 -0.0010 -0.0921 -0.1085 11  LEU A CD1 
77   C CD2 . LEU A 13  ? 0.5527 0.6967 0.9386 -0.0101 -0.0252 -0.1513 11  LEU A CD2 
78   N N   . GLU A 14  ? 0.5350 0.6170 0.6465 -0.0367 -0.0579 -0.1138 12  GLU A N   
79   C CA  . GLU A 14  ? 0.5417 0.6076 0.6171 -0.0374 -0.0621 -0.1135 12  GLU A CA  
80   C C   . GLU A 14  ? 0.5777 0.6401 0.6256 -0.0342 -0.0889 -0.0947 12  GLU A C   
81   O O   . GLU A 14  ? 0.6118 0.6657 0.6599 -0.0292 -0.1005 -0.0905 12  GLU A O   
82   C CB  . GLU A 14  ? 0.5484 0.6069 0.5738 -0.0513 -0.0416 -0.1238 12  GLU A CB  
83   N N   . LEU A 15  ? 0.5469 0.6139 0.5760 -0.0381 -0.0954 -0.0847 13  LEU A N   
84   C CA  . LEU A 15  ? 0.5266 0.5905 0.5332 -0.0373 -0.1151 -0.0714 13  LEU A CA  
85   C C   . LEU A 15  ? 0.5188 0.5895 0.5500 -0.0306 -0.1344 -0.0648 13  LEU A C   
86   O O   . LEU A 15  ? 0.5128 0.5748 0.5279 -0.0288 -0.1462 -0.0572 13  LEU A O   
87   C CB  . LEU A 15  ? 0.5571 0.6239 0.5534 -0.0432 -0.1130 -0.0658 13  LEU A CB  
88   C CG  . LEU A 15  ? 0.5581 0.6190 0.5358 -0.0495 -0.0937 -0.0642 13  LEU A CG  
89   C CD1 . LEU A 15  ? 0.5663 0.6276 0.5539 -0.0540 -0.0894 -0.0589 13  LEU A CD1 
90   C CD2 . LEU A 15  ? 0.5162 0.5682 0.4521 -0.0512 -0.0951 -0.0568 13  LEU A CD2 
91   N N   . LEU A 16  ? 0.5156 0.6042 0.5862 -0.0276 -0.1386 -0.0659 14  LEU A N   
92   C CA  . LEU A 16  ? 0.5021 0.6025 0.5914 -0.0219 -0.1616 -0.0539 14  LEU A CA  
93   C C   . LEU A 16  ? 0.5408 0.6312 0.6542 -0.0106 -0.1636 -0.0479 14  LEU A C   
94   O O   . LEU A 16  ? 0.5493 0.6387 0.6611 -0.0063 -0.1820 -0.0311 14  LEU A O   
95   C CB  . LEU A 16  ? 0.4797 0.6098 0.6073 -0.0231 -0.1701 -0.0561 14  LEU A CB  
96   C CG  . LEU A 16  ? 0.5397 0.6756 0.6416 -0.0367 -0.1695 -0.0619 14  LEU A CG  
97   C CD1 . LEU A 16  ? 0.4447 0.6125 0.5863 -0.0427 -0.1738 -0.0711 14  LEU A CD1 
98   C CD2 . LEU A 16  ? 0.4487 0.5791 0.5104 -0.0425 -0.1843 -0.0533 14  LEU A CD2 
99   N N   . ALA A 17  ? 0.5396 0.6202 0.6738 -0.0076 -0.1422 -0.0617 15  ALA A N   
100  C CA  . ALA A 17  ? 0.5348 0.6009 0.6992 0.0019  -0.1380 -0.0601 15  ALA A CA  
101  C C   . ALA A 17  ? 0.5519 0.5947 0.6755 -0.0021 -0.1399 -0.0561 15  ALA A C   
102  O O   . ALA A 17  ? 0.5880 0.6186 0.7281 0.0052  -0.1477 -0.0426 15  ALA A O   
103  C CB  . ALA A 17  ? 0.4968 0.5588 0.6933 0.0015  -0.1085 -0.0837 15  ALA A CB  
104  N N   . ALA A 18  ? 0.5457 0.5828 0.6202 -0.0135 -0.1325 -0.0661 16  ALA A N   
105  C CA  . ALA A 18  ? 0.5342 0.5556 0.5753 -0.0184 -0.1362 -0.0637 16  ALA A CA  
106  C C   . ALA A 18  ? 0.5721 0.5944 0.5997 -0.0171 -0.1570 -0.0428 16  ALA A C   
107  O O   . ALA A 18  ? 0.5728 0.5803 0.5995 -0.0159 -0.1609 -0.0337 16  ALA A O   
108  C CB  . ALA A 18  ? 0.5326 0.5559 0.5304 -0.0294 -0.1293 -0.0743 16  ALA A CB  
109  N N   . TYR A 19  ? 0.5727 0.6118 0.5894 -0.0199 -0.1674 -0.0369 17  TYR A N   
110  C CA  . TYR A 19  ? 0.5435 0.5865 0.5403 -0.0237 -0.1840 -0.0222 17  TYR A CA  
111  C C   . TYR A 19  ? 0.5519 0.5969 0.5715 -0.0159 -0.1988 -0.0024 17  TYR A C   
112  O O   . TYR A 19  ? 0.5448 0.5802 0.5444 -0.0187 -0.2069 0.0126  17  TYR A O   
113  C CB  . TYR A 19  ? 0.5627 0.6245 0.5501 -0.0309 -0.1878 -0.0265 17  TYR A CB  
114  C CG  . TYR A 19  ? 0.5706 0.6466 0.5451 -0.0376 -0.2045 -0.0167 17  TYR A CG  
115  C CD1 . TYR A 19  ? 0.5884 0.6569 0.5278 -0.0478 -0.2049 -0.0155 17  TYR A CD1 
116  C CD2 . TYR A 19  ? 0.5641 0.6650 0.5621 -0.0362 -0.2192 -0.0112 17  TYR A CD2 
117  C CE1 . TYR A 19  ? 0.6634 0.7467 0.5835 -0.0586 -0.2172 -0.0104 17  TYR A CE1 
118  C CE2 . TYR A 19  ? 0.6289 0.7491 0.6079 -0.0465 -0.2364 -0.0043 17  TYR A CE2 
119  C CZ  . TYR A 19  ? 0.6866 0.7968 0.6224 -0.0590 -0.2341 -0.0047 17  TYR A CZ  
120  O OH  . TYR A 19  ? 0.7292 0.8604 0.6390 -0.0736 -0.2486 -0.0012 17  TYR A OH  
121  N N   . GLU A 20  ? 0.5444 0.6022 0.6088 -0.0059 -0.2018 0.0002  18  GLU A N   
122  C CA  . GLU A 20  ? 0.5435 0.6059 0.6404 0.0051  -0.2184 0.0247  18  GLU A CA  
123  C C   . GLU A 20  ? 0.5492 0.5794 0.6564 0.0114  -0.2085 0.0331  18  GLU A C   
124  O O   . GLU A 20  ? 0.5613 0.5841 0.6666 0.0149  -0.2219 0.0603  18  GLU A O   
125  C CB  . GLU A 20  ? 0.5524 0.6377 0.7096 0.0161  -0.2212 0.0230  18  GLU A CB  
126  C CG  . GLU A 20  ? 0.7142 0.8072 0.9208 0.0317  -0.2398 0.0522  18  GLU A CG  
127  C CD  . GLU A 20  ? 0.8733 1.0015 1.1432 0.0410  -0.2489 0.0515  18  GLU A CD  
128  O OE1 . GLU A 20  ? 0.9194 1.0446 1.2319 0.0455  -0.2249 0.0283  18  GLU A OE1 
129  O OE2 . GLU A 20  ? 0.9320 1.0941 1.2098 0.0420  -0.2797 0.0727  18  GLU A OE2 
130  N N   . GLU A 21  ? 0.6135 0.6247 0.7298 0.0105  -0.1839 0.0097  19  GLU A N   
131  C CA  . GLU A 21  ? 0.6678 0.6478 0.7939 0.0119  -0.1704 0.0103  19  GLU A CA  
132  C C   . GLU A 21  ? 0.6670 0.6343 0.7449 0.0015  -0.1764 0.0209  19  GLU A C   
133  O O   . GLU A 21  ? 0.6696 0.6148 0.7567 0.0041  -0.1755 0.0389  19  GLU A O   
134  C CB  . GLU A 21  ? 0.7748 0.7438 0.9064 0.0058  -0.1435 -0.0237 19  GLU A CB  
135  C CG  . GLU A 21  ? 0.9197 0.8808 1.1148 0.0156  -0.1252 -0.0347 19  GLU A CG  
136  C CD  . GLU A 21  ? 1.0914 1.0199 1.3189 0.0187  -0.1109 -0.0327 19  GLU A CD  
137  O OE1 . GLU A 21  ? 1.1248 1.0379 1.3237 0.0049  -0.0974 -0.0520 19  GLU A OE1 
138  O OE2 . GLU A 21  ? 1.1594 1.0787 1.4462 0.0348  -0.1131 -0.0111 19  GLU A OE2 
139  N N   . VAL A 22  ? 0.6811 0.6606 0.7124 -0.0105 -0.1798 0.0107  20  VAL A N   
140  C CA  . VAL A 22  ? 0.7040 0.6735 0.6961 -0.0213 -0.1817 0.0171  20  VAL A CA  
141  C C   . VAL A 22  ? 0.7531 0.7268 0.7304 -0.0218 -0.1995 0.0471  20  VAL A C   
142  O O   . VAL A 22  ? 0.7813 0.7370 0.7413 -0.0275 -0.1974 0.0614  20  VAL A O   
143  C CB  . VAL A 22  ? 0.6529 0.6352 0.6111 -0.0322 -0.1790 -0.0011 20  VAL A CB  
144  C CG1 . VAL A 22  ? 0.6594 0.6367 0.5850 -0.0435 -0.1803 0.0050  20  VAL A CG1 
145  C CG2 . VAL A 22  ? 0.6050 0.5836 0.5676 -0.0345 -0.1644 -0.0247 20  VAL A CG2 
146  N N   . ILE A 23  ? 0.7829 0.7824 0.7658 -0.0178 -0.2171 0.0573  21  ILE A N   
147  C CA  . ILE A 23  ? 0.8024 0.8141 0.7621 -0.0221 -0.2379 0.0854  21  ILE A CA  
148  C C   . ILE A 23  ? 0.8175 0.8140 0.8069 -0.0092 -0.2458 0.1194  21  ILE A C   
149  O O   . ILE A 23  ? 0.8359 0.8266 0.7958 -0.0150 -0.2557 0.1477  21  ILE A O   
150  C CB  . ILE A 23  ? 0.8415 0.8920 0.8012 -0.0245 -0.2563 0.0829  21  ILE A CB  
151  C CG1 . ILE A 23  ? 0.8287 0.8887 0.7650 -0.0371 -0.2450 0.0519  21  ILE A CG1 
152  C CG2 . ILE A 23  ? 0.9249 0.9944 0.8521 -0.0334 -0.2798 0.1093  21  ILE A CG2 
153  C CD1 . ILE A 23  ? 0.8349 0.8829 0.7244 -0.0532 -0.2350 0.0449  21  ILE A CD1 
154  N N   . ARG A 24  ? 0.8167 0.8060 0.8666 0.0079  -0.2397 0.1186  22  ARG A N   
155  C CA  . ARG A 24  ? 0.8722 0.8464 0.9665 0.0237  -0.2463 0.1535  22  ARG A CA  
156  C C   . ARG A 24  ? 0.9159 0.8487 0.9964 0.0190  -0.2301 0.1659  22  ARG A C   
157  O O   . ARG A 24  ? 0.9040 0.8133 0.9831 0.0120  -0.2044 0.1369  22  ARG A O   
158  C CB  . ARG A 24  ? 0.8180 0.7896 0.9901 0.0418  -0.2347 0.1418  22  ARG A CB  
159  N N   . GLU A 25  ? 1.0199 0.9456 1.0907 0.0215  -0.2456 0.2103  23  GLU A N   
160  C CA  . GLU A 25  ? 1.1136 0.9967 1.1760 0.0167  -0.2277 0.2268  23  GLU A CA  
161  C C   . GLU A 25  ? 1.1533 1.0003 1.2909 0.0315  -0.2031 0.2208  23  GLU A C   
162  O O   . GLU A 25  ? 1.1494 0.9612 1.2874 0.0225  -0.1763 0.2066  23  GLU A O   
163  C CB  . GLU A 25  ? 1.2061 1.0894 1.2383 0.0157  -0.2500 0.2820  23  GLU A CB  
164  N N   . GLU A 26  ? 1.1767 1.0330 1.3837 0.0525  -0.2093 0.2283  24  GLU A N   
165  C CA  . GLU A 26  ? 1.1939 1.0143 1.4813 0.0662  -0.1819 0.2213  24  GLU A CA  
166  C C   . GLU A 26  ? 1.1537 0.9664 1.4498 0.0556  -0.1501 0.1603  24  GLU A C   
167  O O   . GLU A 26  ? 1.1805 0.9572 1.5185 0.0546  -0.1192 0.1428  24  GLU A O   
168  C CB  . GLU A 26  ? 1.2123 1.0475 1.5804 0.0924  -0.1967 0.2477  24  GLU A CB  
169  N N   . SER A 27  ? 1.0786 0.9245 1.3349 0.0458  -0.1561 0.1280  25  SER A N   
170  C CA  . SER A 27  ? 1.0111 0.8553 1.2683 0.0350  -0.1300 0.0754  25  SER A CA  
171  C C   . SER A 27  ? 0.9839 0.8099 1.1959 0.0148  -0.1151 0.0554  25  SER A C   
172  O O   . SER A 27  ? 1.0076 0.8391 1.1652 0.0050  -0.1286 0.0702  25  SER A O   
173  C CB  . SER A 27  ? 0.9534 0.8371 1.1817 0.0313  -0.1417 0.0545  25  SER A CB  
174  O OG  . SER A 27  ? 0.9522 0.8598 1.2177 0.0474  -0.1605 0.0756  25  SER A OG  
175  N N   . ALA A 28  ? 0.9490 0.7565 1.1866 0.0065  -0.0860 0.0184  26  ALA A N   
176  C CA  . ALA A 28  ? 0.9255 0.7204 1.1305 -0.0135 -0.0728 -0.0025 26  ALA A CA  
177  C C   . ALA A 28  ? 0.9089 0.7371 1.0503 -0.0268 -0.0862 -0.0213 26  ALA A C   
178  O O   . ALA A 28  ? 0.9263 0.7546 1.0308 -0.0387 -0.0901 -0.0182 26  ALA A O   
179  C CB  . ALA A 28  ? 0.9057 0.6791 1.1536 -0.0228 -0.0394 -0.0426 26  ALA A CB  
180  N N   . ALA A 29  ? 0.8493 0.7048 0.9823 -0.0247 -0.0915 -0.0392 27  ALA A N   
181  C CA  . ALA A 29  ? 0.7925 0.6769 0.8734 -0.0353 -0.1025 -0.0538 27  ALA A CA  
182  C C   . ALA A 29  ? 0.7669 0.6603 0.8099 -0.0355 -0.1228 -0.0267 27  ALA A C   
183  O O   . ALA A 29  ? 0.8012 0.6965 0.8470 -0.0254 -0.1369 0.0021  27  ALA A O   
184  C CB  . ALA A 29  ? 0.7683 0.6765 0.8482 -0.0309 -0.1046 -0.0671 27  ALA A CB  
185  N N   . ASP A 30  ? 0.7169 0.6193 0.7264 -0.0485 -0.1240 -0.0379 28  ASP A N   
186  C CA  . ASP A 30  ? 0.6847 0.5968 0.6598 -0.0522 -0.1371 -0.0207 28  ASP A CA  
187  C C   . ASP A 30  ? 0.6487 0.5869 0.5989 -0.0580 -0.1428 -0.0368 28  ASP A C   
188  O O   . ASP A 30  ? 0.6382 0.5840 0.5660 -0.0637 -0.1480 -0.0304 28  ASP A O   
189  C CB  . ASP A 30  ? 0.7089 0.6004 0.6777 -0.0621 -0.1289 -0.0114 28  ASP A CB  
190  C CG  . ASP A 30  ? 0.7361 0.6248 0.7143 -0.0749 -0.1143 -0.0393 28  ASP A CG  
191  O OD1 . ASP A 30  ? 0.7120 0.6164 0.6966 -0.0770 -0.1128 -0.0649 28  ASP A OD1 
192  O OD2 . ASP A 30  ? 0.7912 0.6640 0.7694 -0.0850 -0.1042 -0.0356 28  ASP A OD2 
193  N N   . TRP A 31  ? 0.5427 0.4783 0.6298 0.0400  -0.0857 -0.0305 29  TRP A N   
194  C CA  . TRP A 31  ? 0.5425 0.5062 0.6251 0.0290  -0.0771 -0.0370 29  TRP A CA  
195  C C   . TRP A 31  ? 0.5383 0.5306 0.6378 0.0318  -0.0778 -0.0572 29  TRP A C   
196  O O   . TRP A 31  ? 0.5435 0.5340 0.6599 0.0398  -0.0793 -0.0700 29  TRP A O   
197  C CB  . TRP A 31  ? 0.5151 0.4747 0.6012 0.0138  -0.0665 -0.0337 29  TRP A CB  
198  C CG  . TRP A 31  ? 0.4790 0.4314 0.5837 0.0094  -0.0693 -0.0470 29  TRP A CG  
199  C CD1 . TRP A 31  ? 0.5073 0.4306 0.6243 0.0067  -0.0731 -0.0433 29  TRP A CD1 
200  C CD2 . TRP A 31  ? 0.4669 0.4355 0.5738 0.0064  -0.0698 -0.0663 29  TRP A CD2 
201  N NE1 . TRP A 31  ? 0.5170 0.4360 0.6429 0.0031  -0.0789 -0.0625 29  TRP A NE1 
202  C CE2 . TRP A 31  ? 0.4895 0.4357 0.6050 0.0036  -0.0759 -0.0765 29  TRP A CE2 
203  C CE3 . TRP A 31  ? 0.4738 0.4692 0.5724 0.0051  -0.0656 -0.0752 29  TRP A CE3 
204  C CZ2 . TRP A 31  ? 0.4816 0.4302 0.5890 0.0014  -0.0784 -0.0966 29  TRP A CZ2 
205  C CZ3 . TRP A 31  ? 0.4995 0.4989 0.5922 0.0020  -0.0647 -0.0916 29  TRP A CZ3 
206  C CH2 . TRP A 31  ? 0.5074 0.4828 0.6002 0.0012  -0.0714 -0.1029 29  TRP A CH2 
207  N N   . ALA A 32  ? 0.4907 0.5068 0.5842 0.0253  -0.0748 -0.0596 30  ALA A N   
208  C CA  . ALA A 32  ? 0.4581 0.5024 0.5647 0.0227  -0.0698 -0.0742 30  ALA A CA  
209  C C   . ALA A 32  ? 0.4720 0.5233 0.5639 0.0082  -0.0627 -0.0722 30  ALA A C   
210  O O   . ALA A 32  ? 0.4791 0.5215 0.5561 0.0039  -0.0632 -0.0616 30  ALA A O   
211  C CB  . ALA A 32  ? 0.4124 0.4797 0.5380 0.0307  -0.0778 -0.0774 30  ALA A CB  
212  N N   . LEU A 33  ? 0.4718 0.5352 0.5646 0.0022  -0.0550 -0.0823 31  LEU A N   
213  C CA  . LEU A 33  ? 0.4441 0.5087 0.5215 -0.0102 -0.0512 -0.0794 31  LEU A CA  
214  C C   . LEU A 33  ? 0.4398 0.5255 0.5184 -0.0157 -0.0435 -0.0848 31  LEU A C   
215  O O   . LEU A 33  ? 0.4636 0.5583 0.5452 -0.0129 -0.0344 -0.0953 31  LEU A O   
216  C CB  . LEU A 33  ? 0.4514 0.5006 0.5201 -0.0142 -0.0525 -0.0830 31  LEU A CB  
217  C CG  . LEU A 33  ? 0.4114 0.4605 0.4650 -0.0247 -0.0536 -0.0798 31  LEU A CG  
218  C CD1 . LEU A 33  ? 0.3670 0.4147 0.4252 -0.0271 -0.0555 -0.0666 31  LEU A CD1 
219  C CD2 . LEU A 33  ? 0.3959 0.4297 0.4414 -0.0279 -0.0615 -0.0863 31  LEU A CD2 
220  N N   . TYR A 34  ? 0.4304 0.5208 0.5049 -0.0239 -0.0449 -0.0777 32  TYR A N   
221  C CA  . TYR A 34  ? 0.4640 0.5715 0.5428 -0.0335 -0.0374 -0.0784 32  TYR A CA  
222  C C   . TYR A 34  ? 0.5060 0.6006 0.5609 -0.0448 -0.0360 -0.0712 32  TYR A C   
223  O O   . TYR A 34  ? 0.5330 0.6102 0.5761 -0.0439 -0.0435 -0.0657 32  TYR A O   
224  C CB  . TYR A 34  ? 0.4495 0.5695 0.5486 -0.0354 -0.0453 -0.0764 32  TYR A CB  
225  C CG  . TYR A 34  ? 0.4512 0.5793 0.5717 -0.0224 -0.0548 -0.0803 32  TYR A CG  
226  C CD1 . TYR A 34  ? 0.4384 0.5943 0.5939 -0.0172 -0.0498 -0.0877 32  TYR A CD1 
227  C CD2 . TYR A 34  ? 0.4459 0.5536 0.5518 -0.0141 -0.0678 -0.0754 32  TYR A CD2 
228  C CE1 . TYR A 34  ? 0.4257 0.5883 0.6048 -0.0031 -0.0624 -0.0903 32  TYR A CE1 
229  C CE2 . TYR A 34  ? 0.4458 0.5556 0.5653 -0.0015 -0.0798 -0.0762 32  TYR A CE2 
230  C CZ  . TYR A 34  ? 0.4370 0.5743 0.5954 0.0045  -0.0795 -0.0838 32  TYR A CZ  
231  O OH  . TYR A 34  ? 0.4448 0.5847 0.6224 0.0195  -0.0949 -0.0841 32  TYR A OH  
232  N N   . THR A 35  ? 0.4939 0.5974 0.5442 -0.0548 -0.0253 -0.0698 33  THR A N   
233  C CA  . THR A 35  ? 0.5246 0.6113 0.5480 -0.0651 -0.0255 -0.0604 33  THR A CA  
234  C C   . THR A 35  ? 0.5340 0.6322 0.5614 -0.0788 -0.0123 -0.0548 33  THR A C   
235  O O   . THR A 35  ? 0.5150 0.6398 0.5710 -0.0800 -0.0011 -0.0598 33  THR A O   
236  C CB  . THR A 35  ? 0.5390 0.6105 0.5318 -0.0624 -0.0267 -0.0625 33  THR A CB  
237  O OG1 . THR A 35  ? 0.5368 0.5885 0.5044 -0.0699 -0.0339 -0.0510 33  THR A OG1 
238  C CG2 . THR A 35  ? 0.5102 0.5914 0.4899 -0.0616 -0.0095 -0.0715 33  THR A CG2 
239  N N   . TYR A 36  ? 0.5323 0.6109 0.5349 -0.0894 -0.0133 -0.0430 34  TYR A N   
240  C CA  . TYR A 36  ? 0.5694 0.6546 0.5747 -0.1058 0.0016  -0.0337 34  TYR A CA  
241  C C   . TYR A 36  ? 0.6023 0.6924 0.5792 -0.1086 0.0240  -0.0328 34  TYR A C   
242  O O   . TYR A 36  ? 0.5971 0.6695 0.5342 -0.1009 0.0206  -0.0359 34  TYR A O   
243  C CB  . TYR A 36  ? 0.5545 0.6095 0.5433 -0.1167 -0.0089 -0.0189 34  TYR A CB  
244  C CG  . TYR A 36  ? 0.5213 0.5657 0.5300 -0.1125 -0.0279 -0.0222 34  TYR A CG  
245  C CD1 . TYR A 36  ? 0.4400 0.4685 0.4387 -0.0979 -0.0420 -0.0256 34  TYR A CD1 
246  C CD2 . TYR A 36  ? 0.5628 0.6128 0.6007 -0.1233 -0.0311 -0.0228 34  TYR A CD2 
247  C CE1 . TYR A 36  ? 0.4154 0.4321 0.4245 -0.0920 -0.0538 -0.0298 34  TYR A CE1 
248  C CE2 . TYR A 36  ? 0.5121 0.5454 0.5562 -0.1179 -0.0492 -0.0289 34  TYR A CE2 
249  C CZ  . TYR A 36  ? 0.4664 0.4825 0.4921 -0.1011 -0.0579 -0.0326 34  TYR A CZ  
250  O OH  . TYR A 36  ? 0.5248 0.5223 0.5494 -0.0941 -0.0705 -0.0395 34  TYR A OH  
251  N N   . GLU A 37  ? 0.6860 0.8003 0.6843 -0.1201 0.0474  -0.0292 35  GLU A N   
252  C CA  . GLU A 37  ? 0.7843 0.8994 0.7474 -0.1248 0.0756  -0.0250 35  GLU A CA  
253  C C   . GLU A 37  ? 0.8564 0.9345 0.7688 -0.1389 0.0740  -0.0040 35  GLU A C   
254  O O   . GLU A 37  ? 0.9052 0.9682 0.8306 -0.1503 0.0601  0.0089  35  GLU A O   
255  C CB  . GLU A 37  ? 0.8967 1.0544 0.9067 -0.1327 0.1064  -0.0258 35  GLU A CB  
256  C CG  . GLU A 37  ? 1.0628 1.2322 1.0460 -0.1234 0.1387  -0.0352 35  GLU A CG  
257  C CD  . GLU A 37  ? 1.1338 1.3544 1.1844 -0.1152 0.1598  -0.0488 35  GLU A CD  
258  O OE1 . GLU A 37  ? 1.1371 1.3908 1.2528 -0.1287 0.1644  -0.0412 35  GLU A OE1 
259  O OE2 . GLU A 37  ? 1.1773 1.4040 1.2185 -0.0950 0.1703  -0.0676 35  GLU A OE2 
260  N N   . ASP A 38  ? 0.9355 0.9935 0.7847 -0.1367 0.0859  -0.0013 36  ASP A N   
261  C CA  . ASP A 38  ? 1.0133 1.0278 0.8024 -0.1459 0.0770  0.0195  36  ASP A CA  
262  C C   . ASP A 38  ? 1.0025 1.0141 0.8049 -0.1691 0.0932  0.0429  36  ASP A C   
263  O O   . ASP A 38  ? 0.9972 1.0397 0.8281 -0.1805 0.1265  0.0456  36  ASP A O   
264  C CB  . ASP A 38  ? 1.1338 1.1267 0.8450 -0.1403 0.0891  0.0176  36  ASP A CB  
265  C CG  . ASP A 38  ? 1.1960 1.1931 0.9002 -0.1198 0.0768  -0.0089 36  ASP A CG  
266  O OD1 . ASP A 38  ? 1.1652 1.1673 0.9084 -0.1103 0.0488  -0.0191 36  ASP A OD1 
267  O OD2 . ASP A 38  ? 1.2658 1.2590 0.9236 -0.1135 0.0976  -0.0197 36  ASP A OD2 
268  N N   . GLY A 39  ? 1.0105 0.9848 0.7977 -0.1759 0.0694  0.0601  37  GLY A N   
269  C CA  . GLY A 39  ? 1.0309 0.9917 0.8300 -0.1992 0.0794  0.0836  37  GLY A CA  
270  C C   . GLY A 39  ? 0.9835 0.9825 0.8636 -0.2113 0.0883  0.0774  37  GLY A C   
271  O O   . GLY A 39  ? 1.0190 1.0280 0.9203 -0.2341 0.1132  0.0931  37  GLY A O   
272  N N   . SER A 40  ? 0.8741 0.8944 0.8004 -0.1975 0.0678  0.0559  38  SER A N   
273  C CA  . SER A 40  ? 0.7993 0.8564 0.7991 -0.2064 0.0701  0.0472  38  SER A CA  
274  C C   . SER A 40  ? 0.7663 0.8208 0.7903 -0.1907 0.0371  0.0293  38  SER A C   
275  O O   . SER A 40  ? 0.7975 0.8388 0.7935 -0.1706 0.0221  0.0202  38  SER A O   
276  C CB  . SER A 40  ? 0.7682 0.8778 0.8008 -0.2041 0.1005  0.0367  38  SER A CB  
277  O OG  . SER A 40  ? 0.7776 0.9254 0.8866 -0.2080 0.0937  0.0258  38  SER A OG  
278  N N   . ASP A 41  ? 0.7182 0.7857 0.7946 -0.2006 0.0265  0.0244  39  ASP A N   
279  C CA  . ASP A 41  ? 0.6493 0.7142 0.7430 -0.1860 -0.0016 0.0069  39  ASP A CA  
280  C C   . ASP A 41  ? 0.5843 0.6954 0.7213 -0.1763 -0.0004 -0.0097 39  ASP A C   
281  O O   . ASP A 41  ? 0.5691 0.6795 0.7223 -0.1675 -0.0234 -0.0223 39  ASP A O   
282  C CB  . ASP A 41  ? 0.7161 0.7539 0.8280 -0.2005 -0.0223 0.0091  39  ASP A CB  
283  C CG  . ASP A 41  ? 0.7944 0.7773 0.8622 -0.1961 -0.0363 0.0172  39  ASP A CG  
284  O OD1 . ASP A 41  ? 0.8109 0.7619 0.8864 -0.2088 -0.0504 0.0207  39  ASP A OD1 
285  O OD2 . ASP A 41  ? 0.8316 0.8023 0.8606 -0.1796 -0.0351 0.0195  39  ASP A OD2 
286  N N   . ASP A 42  ? 0.5448 0.6925 0.6968 -0.1757 0.0259  -0.0102 40  ASP A N   
287  C CA  . ASP A 42  ? 0.4686 0.6600 0.6674 -0.1638 0.0269  -0.0253 40  ASP A CA  
288  C C   . ASP A 42  ? 0.4525 0.6364 0.6195 -0.1377 0.0208  -0.0375 40  ASP A C   
289  O O   . ASP A 42  ? 0.5036 0.6735 0.6268 -0.1311 0.0341  -0.0358 40  ASP A O   
290  C CB  . ASP A 42  ? 0.4867 0.7230 0.7251 -0.1728 0.0611  -0.0217 40  ASP A CB  
291  N N   . LEU A 43  ? 0.4041 0.5936 0.5907 -0.1242 -0.0012 -0.0491 41  LEU A N   
292  C CA  . LEU A 43  ? 0.3930 0.5737 0.5560 -0.1020 -0.0075 -0.0583 41  LEU A CA  
293  C C   . LEU A 43  ? 0.4285 0.6391 0.6102 -0.0902 0.0118  -0.0671 41  LEU A C   
294  O O   . LEU A 43  ? 0.4602 0.7087 0.6915 -0.0931 0.0233  -0.0698 41  LEU A O   
295  C CB  . LEU A 43  ? 0.4020 0.5749 0.5742 -0.0923 -0.0349 -0.0647 41  LEU A CB  
296  C CG  . LEU A 43  ? 0.4042 0.5457 0.5361 -0.0778 -0.0456 -0.0661 41  LEU A CG  
297  C CD1 . LEU A 43  ? 0.4098 0.5205 0.5046 -0.0843 -0.0435 -0.0578 41  LEU A CD1 
298  C CD2 . LEU A 43  ? 0.4007 0.5327 0.5353 -0.0712 -0.0683 -0.0702 41  LEU A CD2 
299  N N   . LYS A 44  ? 0.4528 0.6462 0.5984 -0.0766 0.0156  -0.0724 42  LYS A N   
300  C CA  . LYS A 44  ? 0.4512 0.6624 0.6067 -0.0619 0.0317  -0.0844 42  LYS A CA  
301  C C   . LYS A 44  ? 0.4374 0.6261 0.5750 -0.0443 0.0154  -0.0923 42  LYS A C   
302  O O   . LYS A 44  ? 0.3818 0.5425 0.4923 -0.0453 -0.0011 -0.0869 42  LYS A O   
303  C CB  . LYS A 44  ? 0.4781 0.6872 0.6001 -0.0671 0.0606  -0.0838 42  LYS A CB  
304  C CG  . LYS A 44  ? 0.5594 0.7274 0.6160 -0.0659 0.0538  -0.0825 42  LYS A CG  
305  C CD  . LYS A 44  ? 0.6361 0.7966 0.6471 -0.0700 0.0801  -0.0825 42  LYS A CD  
306  C CE  . LYS A 44  ? 0.6858 0.8271 0.6590 -0.0539 0.0816  -0.0996 42  LYS A CE  
307  N NZ  . LYS A 44  ? 0.7568 0.8702 0.6596 -0.0613 0.0919  -0.0945 42  LYS A NZ  
308  N N   . LEU A 45  ? 0.4373 0.6392 0.5963 -0.0279 0.0212  -0.1044 43  LEU A N   
309  C CA  . LEU A 45  ? 0.4159 0.5930 0.5607 -0.0130 0.0073  -0.1106 43  LEU A CA  
310  C C   . LEU A 45  ? 0.4684 0.6191 0.5663 -0.0130 0.0154  -0.1167 43  LEU A C   
311  O O   . LEU A 45  ? 0.5050 0.6621 0.5883 -0.0126 0.0369  -0.1246 43  LEU A O   
312  C CB  . LEU A 45  ? 0.4005 0.5951 0.5867 0.0060  0.0068  -0.1209 43  LEU A CB  
313  C CG  . LEU A 45  ? 0.4100 0.5747 0.5802 0.0216  -0.0007 -0.1294 43  LEU A CG  
314  C CD1 . LEU A 45  ? 0.3706 0.5129 0.5325 0.0200  -0.0250 -0.1168 43  LEU A CD1 
315  C CD2 . LEU A 45  ? 0.3984 0.5789 0.6089 0.0427  0.0037  -0.1417 43  LEU A CD2 
316  N N   . ALA A 46  ? 0.4690 0.5900 0.5419 -0.0147 -0.0018 -0.1124 44  ALA A N   
317  C CA  . ALA A 46  ? 0.4472 0.5414 0.4795 -0.0161 -0.0032 -0.1184 44  ALA A CA  
318  C C   . ALA A 46  ? 0.4984 0.5740 0.5332 -0.0028 -0.0097 -0.1319 44  ALA A C   
319  O O   . ALA A 46  ? 0.5285 0.5888 0.5365 0.0021  -0.0034 -0.1468 44  ALA A O   
320  C CB  . ALA A 46  ? 0.4088 0.4848 0.4235 -0.0268 -0.0197 -0.1057 44  ALA A CB  
321  N N   . ALA A 47  ? 0.4663 0.5378 0.5280 0.0032  -0.0225 -0.1266 45  ALA A N   
322  C CA  . ALA A 47  ? 0.5001 0.5483 0.5674 0.0146  -0.0301 -0.1363 45  ALA A CA  
323  C C   . ALA A 47  ? 0.4840 0.5326 0.5805 0.0215  -0.0404 -0.1249 45  ALA A C   
324  O O   . ALA A 47  ? 0.4191 0.4830 0.5239 0.0169  -0.0433 -0.1118 45  ALA A O   
325  C CB  . ALA A 47  ? 0.4475 0.4648 0.4905 0.0062  -0.0433 -0.1381 45  ALA A CB  
326  N N   . SER A 48  ? 0.5287 0.5536 0.6344 0.0323  -0.0477 -0.1299 46  SER A N   
327  C CA  . SER A 48  ? 0.4817 0.4978 0.6057 0.0398  -0.0586 -0.1166 46  SER A CA  
328  C C   . SER A 48  ? 0.5098 0.4875 0.6359 0.0462  -0.0668 -0.1208 46  SER A C   
329  O O   . SER A 48  ? 0.4968 0.4596 0.6156 0.0500  -0.0641 -0.1397 46  SER A O   
330  C CB  . SER A 48  ? 0.4879 0.5305 0.6391 0.0540  -0.0580 -0.1181 46  SER A CB  
331  O OG  . SER A 48  ? 0.5388 0.5859 0.7068 0.0694  -0.0490 -0.1375 46  SER A OG  
332  N N   . GLY A 49  ? 0.5351 0.4920 0.6659 0.0464  -0.0765 -0.1031 47  GLY A N   
333  C CA  . GLY A 49  ? 0.4991 0.4150 0.6349 0.0496  -0.0847 -0.1040 47  GLY A CA  
334  C C   . GLY A 49  ? 0.5102 0.4026 0.6462 0.0462  -0.0912 -0.0780 47  GLY A C   
335  O O   . GLY A 49  ? 0.4974 0.4032 0.6248 0.0468  -0.0905 -0.0613 47  GLY A O   
336  N N   . GLU A 50  ? 0.6374 0.4902 0.7798 0.0421  -0.0974 -0.0753 48  GLU A N   
337  C CA  . GLU A 50  ? 0.6104 0.4326 0.7527 0.0365  -0.1000 -0.0486 48  GLU A CA  
338  C C   . GLU A 50  ? 0.5835 0.4012 0.7337 0.0124  -0.0952 -0.0406 48  GLU A C   
339  O O   . GLU A 50  ? 0.5428 0.3783 0.6966 0.0027  -0.0954 -0.0565 48  GLU A O   
340  C CB  . GLU A 50  ? 0.6319 0.4087 0.7839 0.0503  -0.1118 -0.0479 48  GLU A CB  
341  C CG  . GLU A 50  ? 0.6997 0.4511 0.8642 0.0530  -0.1188 -0.0745 48  GLU A CG  
342  C CD  . GLU A 50  ? 0.8593 0.5652 1.0345 0.0735  -0.1310 -0.0771 48  GLU A CD  
343  O OE1 . GLU A 50  ? 0.8807 0.5997 1.0627 0.0989  -0.1330 -0.0901 48  GLU A OE1 
344  O OE2 . GLU A 50  ? 0.9226 0.5791 1.1047 0.0643  -0.1390 -0.0658 48  GLU A OE2 
345  N N   . GLY A 51  ? 0.6480 0.4437 0.8014 0.0028  -0.0904 -0.0138 49  GLY A N   
346  C CA  . GLY A 51  ? 0.5795 0.3788 0.7527 -0.0202 -0.0826 -0.0020 49  GLY A CA  
347  C C   . GLY A 51  ? 0.6022 0.4344 0.7666 -0.0261 -0.0648 0.0140  49  GLY A C   
348  O O   . GLY A 51  ? 0.6438 0.4881 0.8337 -0.0432 -0.0566 0.0219  49  GLY A O   
349  N N   . GLY A 52  ? 0.5665 0.4144 0.6993 -0.0120 -0.0602 0.0164  50  GLY A N   
350  C CA  . GLY A 52  ? 0.5573 0.4276 0.6749 -0.0153 -0.0430 0.0298  50  GLY A CA  
351  C C   . GLY A 52  ? 0.5542 0.4580 0.6929 -0.0264 -0.0375 0.0204  50  GLY A C   
352  O O   . GLY A 52  ? 0.5157 0.4307 0.6703 -0.0302 -0.0499 0.0006  50  GLY A O   
353  N N   . LEU A 53  ? 0.5608 0.4766 0.6970 -0.0305 -0.0179 0.0364  51  LEU A N   
354  C CA  . LEU A 53  ? 0.5345 0.4822 0.6907 -0.0366 -0.0119 0.0303  51  LEU A CA  
355  C C   . LEU A 53  ? 0.5210 0.4762 0.7253 -0.0514 -0.0238 0.0228  51  LEU A C   
356  O O   . LEU A 53  ? 0.4644 0.4410 0.6797 -0.0536 -0.0337 0.0093  51  LEU A O   
357  C CB  . LEU A 53  ? 0.4689 0.4233 0.6215 -0.0368 0.0153  0.0498  51  LEU A CB  
358  C CG  . LEU A 53  ? 0.5526 0.5010 0.6496 -0.0218 0.0241  0.0518  51  LEU A CG  
359  C CD1 . LEU A 53  ? 0.5497 0.4967 0.6384 -0.0214 0.0561  0.0717  51  LEU A CD1 
360  C CD2 . LEU A 53  ? 0.4925 0.4625 0.5809 -0.0161 0.0131  0.0318  51  LEU A CD2 
361  N N   . GLN A 54  ? 0.5841 0.5180 0.8160 -0.0625 -0.0257 0.0322  52  GLN A N   
362  C CA  . GLN A 54  ? 0.6051 0.5434 0.8857 -0.0789 -0.0415 0.0247  52  GLN A CA  
363  C C   . GLN A 54  ? 0.6082 0.5418 0.8716 -0.0747 -0.0679 -0.0037 52  GLN A C   
364  O O   . GLN A 54  ? 0.5902 0.5405 0.8692 -0.0810 -0.0825 -0.0155 52  GLN A O   
365  C CB  . GLN A 54  ? 0.6784 0.5879 0.9912 -0.0932 -0.0409 0.0394  52  GLN A CB  
366  C CG  . GLN A 54  ? 0.7579 0.6648 1.1226 -0.1124 -0.0643 0.0290  52  GLN A CG  
367  C CD  . GLN A 54  ? 0.8696 0.7302 1.2472 -0.1223 -0.0746 0.0325  52  GLN A CD  
368  O OE1 . GLN A 54  ? 0.9269 0.7548 1.2635 -0.1085 -0.0764 0.0291  52  GLN A OE1 
369  N NE2 . GLN A 54  ? 0.8531 0.7100 1.2924 -0.1462 -0.0828 0.0400  52  GLN A NE2 
370  N N   . GLU A 55  ? 0.6144 0.5251 0.8435 -0.0623 -0.0735 -0.0142 53  GLU A N   
371  C CA  . GLU A 55  ? 0.6276 0.5343 0.8351 -0.0557 -0.0909 -0.0413 53  GLU A CA  
372  C C   . GLU A 55  ? 0.6085 0.5459 0.7910 -0.0483 -0.0866 -0.0487 53  GLU A C   
373  O O   . GLU A 55  ? 0.4410 0.3856 0.6159 -0.0514 -0.0988 -0.0639 53  GLU A O   
374  C CB  . GLU A 55  ? 0.7000 0.5786 0.8869 -0.0416 -0.0938 -0.0499 53  GLU A CB  
375  C CG  . GLU A 55  ? 0.7685 0.6465 0.9299 -0.0303 -0.1026 -0.0780 53  GLU A CG  
376  C CD  . GLU A 55  ? 0.8757 0.7329 1.0399 -0.0395 -0.1216 -0.0986 53  GLU A CD  
377  O OE1 . GLU A 55  ? 0.9140 0.7751 1.0490 -0.0334 -0.1258 -0.1204 53  GLU A OE1 
378  O OE2 . GLU A 55  ? 0.9265 0.7606 1.1197 -0.0535 -0.1327 -0.0930 53  GLU A OE2 
379  N N   . LEU A 56  ? 0.5693 0.5205 0.7352 -0.0392 -0.0710 -0.0373 54  LEU A N   
380  C CA  . LEU A 56  ? 0.4717 0.4463 0.6151 -0.0334 -0.0682 -0.0445 54  LEU A CA  
381  C C   . LEU A 56  ? 0.4621 0.4540 0.6189 -0.0426 -0.0726 -0.0442 54  LEU A C   
382  O O   . LEU A 56  ? 0.4396 0.4384 0.5794 -0.0426 -0.0811 -0.0565 54  LEU A O   
383  C CB  . LEU A 56  ? 0.4326 0.4138 0.5583 -0.0244 -0.0551 -0.0326 54  LEU A CB  
384  C CG  . LEU A 56  ? 0.4270 0.4294 0.5369 -0.0224 -0.0512 -0.0354 54  LEU A CG  
385  C CD1 . LEU A 56  ? 0.3653 0.3768 0.4606 -0.0193 -0.0577 -0.0515 54  LEU A CD1 
386  C CD2 . LEU A 56  ? 0.4096 0.4099 0.5009 -0.0152 -0.0410 -0.0241 54  LEU A CD2 
387  N N   . SER A 57  ? 0.4915 0.4897 0.6818 -0.0505 -0.0675 -0.0298 55  SER A N   
388  C CA  . SER A 57  ? 0.4852 0.5028 0.6980 -0.0565 -0.0744 -0.0289 55  SER A CA  
389  C C   . SER A 57  ? 0.4729 0.4838 0.6833 -0.0632 -0.1008 -0.0450 55  SER A C   
390  O O   . SER A 57  ? 0.4716 0.4946 0.6831 -0.0645 -0.1120 -0.0468 55  SER A O   
391  C CB  . SER A 57  ? 0.4760 0.5053 0.7387 -0.0639 -0.0635 -0.0115 55  SER A CB  
392  O OG  . SER A 57  ? 0.5837 0.5939 0.8639 -0.0719 -0.0632 -0.0063 55  SER A OG  
393  N N   . GLY A 58  ? 0.4133 0.4004 0.6144 -0.0658 -0.1120 -0.0576 56  GLY A N   
394  C CA  . GLY A 58  ? 0.4399 0.4127 0.6248 -0.0705 -0.1372 -0.0762 56  GLY A CA  
395  C C   . GLY A 58  ? 0.6074 0.5785 0.7373 -0.0618 -0.1371 -0.0901 56  GLY A C   
396  O O   . GLY A 58  ? 0.5435 0.5004 0.6473 -0.0648 -0.1566 -0.1045 56  GLY A O   
397  N N   . HIS A 59  ? 0.4250 0.4076 0.5351 -0.0519 -0.1162 -0.0862 57  HIS A N   
398  C CA  . HIS A 59  ? 0.4334 0.4174 0.4996 -0.0460 -0.1113 -0.0969 57  HIS A CA  
399  C C   . HIS A 59  ? 0.4564 0.4578 0.5129 -0.0471 -0.1071 -0.0862 57  HIS A C   
400  O O   . HIS A 59  ? 0.4927 0.4956 0.5151 -0.0450 -0.1003 -0.0911 57  HIS A O   
401  C CB  . HIS A 59  ? 0.4559 0.4415 0.5131 -0.0350 -0.0936 -0.1026 57  HIS A CB  
402  C CG  . HIS A 59  ? 0.5388 0.5012 0.6005 -0.0302 -0.0978 -0.1154 57  HIS A CG  
403  N ND1 . HIS A 59  ? 0.5394 0.4900 0.6323 -0.0314 -0.1003 -0.1065 57  HIS A ND1 
404  C CD2 . HIS A 59  ? 0.4904 0.4346 0.5271 -0.0234 -0.0991 -0.1366 57  HIS A CD2 
405  C CE1 . HIS A 59  ? 0.5564 0.4803 0.6463 -0.0263 -0.1063 -0.1214 57  HIS A CE1 
406  N NE2 . HIS A 59  ? 0.6016 0.5214 0.6575 -0.0201 -0.1054 -0.1415 57  HIS A NE2 
407  N N   . PHE A 60  ? 0.4120 0.4251 0.4988 -0.0501 -0.1094 -0.0717 58  PHE A N   
408  C CA  . PHE A 60  ? 0.4149 0.4387 0.4937 -0.0489 -0.1062 -0.0624 58  PHE A CA  
409  C C   . PHE A 60  ? 0.4262 0.4412 0.4828 -0.0533 -0.1265 -0.0647 58  PHE A C   
410  O O   . PHE A 60  ? 0.4648 0.4729 0.5338 -0.0581 -0.1479 -0.0684 58  PHE A O   
411  C CB  . PHE A 60  ? 0.3914 0.4285 0.5088 -0.0467 -0.0991 -0.0484 58  PHE A CB  
412  C CG  . PHE A 60  ? 0.3919 0.4321 0.5119 -0.0407 -0.0782 -0.0438 58  PHE A CG  
413  C CD1 . PHE A 60  ? 0.3656 0.4062 0.4594 -0.0362 -0.0687 -0.0454 58  PHE A CD1 
414  C CD2 . PHE A 60  ? 0.4051 0.4456 0.5529 -0.0408 -0.0701 -0.0366 58  PHE A CD2 
415  C CE1 . PHE A 60  ? 0.3874 0.4273 0.4781 -0.0302 -0.0562 -0.0420 58  PHE A CE1 
416  C CE2 . PHE A 60  ? 0.3826 0.4197 0.5210 -0.0344 -0.0536 -0.0307 58  PHE A CE2 
417  C CZ  . PHE A 60  ? 0.3937 0.4298 0.5014 -0.0283 -0.0490 -0.0344 58  PHE A CZ  
418  N N   . GLU A 61  ? 0.4394 0.4522 0.4632 -0.0527 -0.1224 -0.0610 59  GLU A N   
419  C CA  . GLU A 61  ? 0.5658 0.5634 0.5538 -0.0562 -0.1411 -0.0604 59  GLU A CA  
420  C C   . GLU A 61  ? 0.5987 0.5989 0.5995 -0.0544 -0.1491 -0.0448 59  GLU A C   
421  O O   . GLU A 61  ? 0.5944 0.6020 0.6058 -0.0513 -0.1326 -0.0375 59  GLU A O   
422  C CB  . GLU A 61  ? 0.6564 0.6426 0.5878 -0.0578 -0.1280 -0.0671 59  GLU A CB  
423  C CG  . GLU A 61  ? 0.6748 0.6600 0.5990 -0.0548 -0.1155 -0.0845 59  GLU A CG  
424  C CD  . GLU A 61  ? 0.7124 0.6916 0.5872 -0.0541 -0.0964 -0.0926 59  GLU A CD  
425  O OE1 . GLU A 61  ? 0.7279 0.6945 0.5570 -0.0586 -0.0972 -0.0861 59  GLU A OE1 
426  O OE2 . GLU A 61  ? 0.6932 0.6804 0.5766 -0.0482 -0.0789 -0.1047 59  GLU A OE2 
427  N N   . ASN A 62  ? 0.5859 0.5771 0.5863 -0.0554 -0.1777 -0.0408 60  ASN A N   
428  C CA  . ASN A 62  ? 0.6181 0.6128 0.6449 -0.0501 -0.1898 -0.0264 60  ASN A CA  
429  C C   . ASN A 62  ? 0.6534 0.6287 0.6348 -0.0499 -0.1868 -0.0159 60  ASN A C   
430  O O   . ASN A 62  ? 0.6265 0.5998 0.6277 -0.0435 -0.1923 -0.0041 60  ASN A O   
431  C CB  . ASN A 62  ? 0.6616 0.6546 0.7095 -0.0506 -0.2271 -0.0252 60  ASN A CB  
432  C CG  . ASN A 62  ? 0.6983 0.7133 0.8096 -0.0530 -0.2302 -0.0311 60  ASN A CG  
433  O OD1 . ASN A 62  ? 0.7266 0.7629 0.8844 -0.0494 -0.2065 -0.0273 60  ASN A OD1 
434  N ND2 . ASN A 62  ? 0.7329 0.7394 0.8434 -0.0602 -0.2597 -0.0402 60  ASN A ND2 
435  N N   . GLN A 63  ? 0.6789 0.6385 0.6016 -0.0566 -0.1771 -0.0196 61  GLN A N   
436  C CA  . GLN A 63  ? 0.7061 0.6454 0.5837 -0.0605 -0.1708 -0.0071 61  GLN A CA  
437  C C   . GLN A 63  ? 0.6670 0.6164 0.5499 -0.0643 -0.1387 -0.0073 61  GLN A C   
438  O O   . GLN A 63  ? 0.7011 0.6356 0.5517 -0.0714 -0.1290 0.0031  61  GLN A O   
439  C CB  . GLN A 63  ? 0.8241 0.7383 0.6298 -0.0664 -0.1785 -0.0084 61  GLN A CB  
440  C CG  . GLN A 63  ? 1.0135 0.9103 0.8037 -0.0634 -0.2197 -0.0084 61  GLN A CG  
441  C CD  . GLN A 63  ? 1.1247 1.0326 0.9382 -0.0629 -0.2327 -0.0286 61  GLN A CD  
442  O OE1 . GLN A 63  ? 1.1322 1.0671 1.0123 -0.0606 -0.2261 -0.0341 61  GLN A OE1 
443  N NE2 . GLN A 63  ? 1.1774 1.0592 0.9311 -0.0655 -0.2517 -0.0392 61  GLN A NE2 
444  N N   . LYS A 64  ? 0.5401 0.5128 0.4623 -0.0611 -0.1239 -0.0177 62  LYS A N   
445  C CA  . LYS A 64  ? 0.5534 0.5370 0.4804 -0.0649 -0.0992 -0.0205 62  LYS A CA  
446  C C   . LYS A 64  ? 0.5236 0.5184 0.4922 -0.0582 -0.0939 -0.0216 62  LYS A C   
447  O O   . LYS A 64  ? 0.4985 0.5011 0.4970 -0.0502 -0.1000 -0.0237 62  LYS A O   
448  C CB  . LYS A 64  ? 0.5879 0.5848 0.5062 -0.0665 -0.0843 -0.0343 62  LYS A CB  
449  C CG  . LYS A 64  ? 0.6768 0.6602 0.5428 -0.0721 -0.0808 -0.0356 62  LYS A CG  
450  C CD  . LYS A 64  ? 0.7565 0.7560 0.6185 -0.0728 -0.0555 -0.0474 62  LYS A CD  
451  C CE  . LYS A 64  ? 0.8750 0.8770 0.7187 -0.0834 -0.0334 -0.0373 62  LYS A CE  
452  N NZ  . LYS A 64  ? 0.8768 0.8908 0.7603 -0.0894 -0.0288 -0.0283 62  LYS A NZ  
453  N N   . VAL A 65  ? 0.5228 0.5169 0.4914 -0.0624 -0.0820 -0.0200 63  VAL A N   
454  C CA  . VAL A 65  ? 0.4535 0.4556 0.4465 -0.0570 -0.0747 -0.0255 63  VAL A CA  
455  C C   . VAL A 65  ? 0.4722 0.4938 0.4716 -0.0578 -0.0644 -0.0356 63  VAL A C   
456  O O   . VAL A 65  ? 0.5046 0.5341 0.4945 -0.0655 -0.0563 -0.0377 63  VAL A O   
457  C CB  . VAL A 65  ? 0.4594 0.4461 0.4478 -0.0624 -0.0734 -0.0212 63  VAL A CB  
458  C CG1 . VAL A 65  ? 0.4647 0.4544 0.4668 -0.0567 -0.0693 -0.0297 63  VAL A CG1 
459  C CG2 . VAL A 65  ? 0.4560 0.4183 0.4397 -0.0585 -0.0851 -0.0109 63  VAL A CG2 
460  N N   . MET A 66  ? 0.5227 0.5520 0.5397 -0.0489 -0.0631 -0.0405 64  MET A N   
461  C CA  . MET A 66  ? 0.5232 0.5662 0.5475 -0.0467 -0.0570 -0.0484 64  MET A CA  
462  C C   . MET A 66  ? 0.5209 0.5630 0.5543 -0.0387 -0.0553 -0.0491 64  MET A C   
463  O O   . MET A 66  ? 0.5752 0.6076 0.6098 -0.0332 -0.0549 -0.0450 64  MET A O   
464  C CB  . MET A 66  ? 0.5149 0.5600 0.5407 -0.0446 -0.0594 -0.0530 64  MET A CB  
465  C CG  . MET A 66  ? 0.5330 0.5711 0.5362 -0.0507 -0.0644 -0.0533 64  MET A CG  
466  S SD  . MET A 66  ? 0.6049 0.6374 0.5998 -0.0487 -0.0711 -0.0649 64  MET A SD  
467  C CE  . MET A 66  ? 0.6159 0.6518 0.6472 -0.0426 -0.0729 -0.0645 64  MET A CE  
468  N N   . TYR A 67  ? 0.4581 0.5092 0.4961 -0.0364 -0.0539 -0.0543 65  TYR A N   
469  C CA  . TYR A 67  ? 0.4596 0.5050 0.4951 -0.0283 -0.0555 -0.0541 65  TYR A CA  
470  C C   . TYR A 67  ? 0.5032 0.5517 0.5466 -0.0215 -0.0548 -0.0546 65  TYR A C   
471  O O   . TYR A 67  ? 0.5622 0.6225 0.6165 -0.0212 -0.0561 -0.0606 65  TYR A O   
472  C CB  . TYR A 67  ? 0.4157 0.4633 0.4489 -0.0316 -0.0626 -0.0584 65  TYR A CB  
473  C CG  . TYR A 67  ? 0.4502 0.4877 0.4764 -0.0400 -0.0644 -0.0574 65  TYR A CG  
474  C CD1 . TYR A 67  ? 0.4866 0.5020 0.4963 -0.0343 -0.0643 -0.0560 65  TYR A CD1 
475  C CD2 . TYR A 67  ? 0.4580 0.5053 0.4940 -0.0528 -0.0637 -0.0571 65  TYR A CD2 
476  C CE1 . TYR A 67  ? 0.5134 0.5131 0.5172 -0.0398 -0.0675 -0.0556 65  TYR A CE1 
477  C CE2 . TYR A 67  ? 0.4859 0.5169 0.5144 -0.0616 -0.0663 -0.0535 65  TYR A CE2 
478  C CZ  . TYR A 67  ? 0.5282 0.5335 0.5409 -0.0544 -0.0702 -0.0534 65  TYR A CZ  
479  O OH  . TYR A 67  ? 0.5663 0.5491 0.5721 -0.0608 -0.0746 -0.0506 65  TYR A OH  
480  N N   . GLY A 68  ? 0.5083 0.5449 0.5482 -0.0156 -0.0509 -0.0478 66  GLY A N   
481  C CA  . GLY A 68  ? 0.5249 0.5566 0.5715 -0.0105 -0.0507 -0.0451 66  GLY A CA  
482  C C   . GLY A 68  ? 0.5706 0.5896 0.5996 -0.0017 -0.0533 -0.0395 66  GLY A C   
483  O O   . GLY A 68  ? 0.6146 0.6207 0.6224 0.0015  -0.0473 -0.0330 66  GLY A O   
484  N N   . PHE A 69  ? 0.5385 0.5590 0.5728 0.0041  -0.0626 -0.0423 67  PHE A N   
485  C CA  . PHE A 69  ? 0.5619 0.5675 0.5751 0.0137  -0.0717 -0.0361 67  PHE A CA  
486  C C   . PHE A 69  ? 0.5741 0.5627 0.5907 0.0196  -0.0704 -0.0266 67  PHE A C   
487  O O   . PHE A 69  ? 0.5571 0.5510 0.5974 0.0235  -0.0767 -0.0326 67  PHE A O   
488  C CB  . PHE A 69  ? 0.5623 0.5833 0.5858 0.0169  -0.0892 -0.0451 67  PHE A CB  
489  C CG  . PHE A 69  ? 0.6250 0.6285 0.6233 0.0274  -0.1066 -0.0393 67  PHE A CG  
490  C CD1 . PHE A 69  ? 0.6626 0.6499 0.6224 0.0274  -0.1131 -0.0387 67  PHE A CD1 
491  C CD2 . PHE A 69  ? 0.6330 0.6312 0.6415 0.0389  -0.1190 -0.0350 67  PHE A CD2 
492  C CE1 . PHE A 69  ? 0.6997 0.6654 0.6254 0.0377  -0.1338 -0.0340 67  PHE A CE1 
493  C CE2 . PHE A 69  ? 0.6444 0.6228 0.6246 0.0498  -0.1402 -0.0277 67  PHE A CE2 
494  C CZ  . PHE A 69  ? 0.6685 0.6303 0.6042 0.0487  -0.1483 -0.0271 67  PHE A CZ  
495  N N   . CYS A 70  ? 0.5803 0.5465 0.5739 0.0204  -0.0599 -0.0117 68  CYS A N   
496  C CA  . CYS A 70  ? 0.6143 0.5593 0.6120 0.0220  -0.0557 0.0014  68  CYS A CA  
497  C C   . CYS A 70  ? 0.6824 0.5972 0.6370 0.0313  -0.0578 0.0184  68  CYS A C   
498  O O   . CYS A 70  ? 0.7310 0.6364 0.6478 0.0327  -0.0484 0.0244  68  CYS A O   
499  C CB  . CYS A 70  ? 0.6547 0.6015 0.6727 0.0105  -0.0375 0.0076  68  CYS A CB  
500  S SG  . CYS A 70  ? 0.7939 0.7135 0.8283 0.0064  -0.0326 0.0240  68  CYS A SG  
501  N N   . SER A 71  ? 0.7073 0.6026 0.6633 0.0390  -0.0701 0.0260  69  SER A N   
502  C CA  . SER A 71  ? 0.7480 0.6066 0.6589 0.0481  -0.0744 0.0465  69  SER A CA  
503  C C   . SER A 71  ? 0.7693 0.6030 0.6768 0.0396  -0.0508 0.0683  69  SER A C   
504  O O   . SER A 71  ? 0.8227 0.6586 0.7735 0.0311  -0.0464 0.0672  69  SER A O   
505  C CB  . SER A 71  ? 0.8339 0.6814 0.7538 0.0621  -0.1019 0.0459  69  SER A CB  
506  O OG  . SER A 71  ? 0.9782 0.7820 0.8539 0.0703  -0.1069 0.0704  69  SER A OG  
507  N N   . VAL A 72  ? 0.7484 0.5570 0.6040 0.0412  -0.0353 0.0878  70  VAL A N   
508  C CA  . VAL A 72  ? 0.7961 0.5860 0.6515 0.0307  -0.0054 0.1116  70  VAL A CA  
509  C C   . VAL A 72  ? 0.8885 0.6295 0.6797 0.0390  -0.0036 0.1395  70  VAL A C   
510  O O   . VAL A 72  ? 0.9523 0.6775 0.6774 0.0501  -0.0068 0.1419  70  VAL A O   
511  C CB  . VAL A 72  ? 0.7791 0.5919 0.6376 0.0229  0.0259  0.1099  70  VAL A CB  
512  C CG1 . VAL A 72  ? 0.8328 0.6280 0.6886 0.0137  0.0603  0.1377  70  VAL A CG1 
513  C CG2 . VAL A 72  ? 0.7216 0.5754 0.6448 0.0131  0.0233  0.0888  70  VAL A CG2 
514  N N   . LYS A 73  ? 0.8895 0.6014 0.6956 0.0330  0.0005  0.1611  71  LYS A N   
515  C CA  . LYS A 73  ? 0.9822 0.6400 0.7263 0.0391  0.0032  0.1936  71  LYS A CA  
516  C C   . LYS A 73  ? 1.0705 0.7128 0.8114 0.0227  0.0472  0.2230  71  LYS A C   
517  O O   . LYS A 73  ? 1.1326 0.7862 0.8447 0.0207  0.0790  0.2270  71  LYS A O   
518  C CB  . LYS A 73  ? 0.9708 0.5976 0.7306 0.0468  -0.0283 0.1999  71  LYS A CB  
519  N N   . ALA A 77  ? 1.5745 1.0535 1.1557 0.0325  0.0512  0.3206  75  ALA A N   
520  C CA  . ALA A 77  ? 1.7231 1.1328 1.2455 0.0414  0.0341  0.3548  75  ALA A CA  
521  C C   . ALA A 77  ? 1.8041 1.1855 1.2300 0.0678  -0.0002 0.3539  75  ALA A C   
522  O O   . ALA A 77  ? 1.8663 1.1921 1.2455 0.0808  -0.0291 0.3774  75  ALA A O   
523  C CB  . ALA A 77  ? 1.7749 1.1447 1.2659 0.0231  0.0827  0.4004  75  ALA A CB  
524  N N   . ALA A 78  ? 1.7840 1.2004 1.1819 0.0757  -0.0005 0.3270  76  ALA A N   
525  C CA  . ALA A 78  ? 1.8067 1.2041 1.1226 0.0981  -0.0378 0.3182  76  ALA A CA  
526  C C   . ALA A 78  ? 1.6947 1.1483 1.0748 0.1058  -0.0758 0.2738  76  ALA A C   
527  O O   . ALA A 78  ? 1.5978 1.0901 1.0746 0.0984  -0.0807 0.2560  76  ALA A O   
528  C CB  . ALA A 78  ? 1.8806 1.2598 1.0974 0.0997  -0.0031 0.3264  76  ALA A CB  
529  N N   . LEU A 79  ? 1.6900 1.1450 1.0139 0.1197  -0.1026 0.2564  77  LEU A N   
530  C CA  . LEU A 79  ? 1.5681 1.0752 0.9520 0.1247  -0.1373 0.2176  77  LEU A CA  
531  C C   . LEU A 79  ? 1.4273 0.9924 0.8818 0.1081  -0.1041 0.1923  77  LEU A C   
532  O O   . LEU A 79  ? 1.4393 1.0048 0.8657 0.0992  -0.0624 0.1964  77  LEU A O   
533  C CB  . LEU A 79  ? 1.5992 1.0921 0.9070 0.1390  -0.1718 0.2050  77  LEU A CB  
534  C CG  . LEU A 79  ? 1.6289 1.0890 0.9031 0.1589  -0.2309 0.2137  77  LEU A CG  
535  C CD1 . LEU A 79  ? 1.6515 1.1044 0.8591 0.1684  -0.2660 0.1947  77  LEU A CD1 
536  C CD2 . LEU A 79  ? 1.5378 1.0377 0.9220 0.1637  -0.2620 0.1999  77  LEU A CD2 
537  N N   . PRO A 80  ? 1.2895 0.9034 0.8334 0.1053  -0.1211 0.1663  78  PRO A N   
538  C CA  . PRO A 80  ? 1.1629 0.8267 0.7712 0.0897  -0.0929 0.1452  78  PRO A CA  
539  C C   . PRO A 80  ? 1.0569 0.7441 0.6431 0.0891  -0.0902 0.1224  78  PRO A C   
540  O O   . PRO A 80  ? 1.0808 0.7641 0.6345 0.0993  -0.1230 0.1099  78  PRO A O   
541  C CB  . PRO A 80  ? 1.1249 0.8236 0.8192 0.0902  -0.1160 0.1261  78  PRO A CB  
542  C CG  . PRO A 80  ? 1.1703 0.8550 0.8476 0.1090  -0.1617 0.1252  78  PRO A CG  
543  C CD  . PRO A 80  ? 1.2608 0.8840 0.8508 0.1177  -0.1652 0.1571  78  PRO A CD  
544  N N   . LYS A 81  ? 0.9823 0.6934 0.5921 0.0770  -0.0534 0.1163  79  LYS A N   
545  C CA  . LYS A 81  ? 1.0116 0.7461 0.6154 0.0758  -0.0492 0.0926  79  LYS A CA  
546  C C   . LYS A 81  ? 0.9346 0.7198 0.6243 0.0653  -0.0517 0.0706  79  LYS A C   
547  O O   . LYS A 81  ? 0.9212 0.7228 0.6697 0.0579  -0.0473 0.0738  79  LYS A O   
548  C CB  . LYS A 81  ? 1.1074 0.8283 0.6675 0.0742  -0.0057 0.1013  79  LYS A CB  
549  C CG  . LYS A 81  ? 1.2395 0.9115 0.7271 0.0796  0.0137  0.1323  79  LYS A CG  
550  C CD  . LYS A 81  ? 1.3424 0.9923 0.7548 0.0862  0.0485  0.1341  79  LYS A CD  
551  C CE  . LYS A 81  ? 1.4256 1.0371 0.7418 0.1018  0.0182  0.1225  79  LYS A CE  
552  N NZ  . LYS A 81  ? 1.4765 1.0811 0.7442 0.1083  0.0465  0.1064  79  LYS A NZ  
553  N N   . TYR A 82  ? 0.8793 0.6845 0.5714 0.0645  -0.0601 0.0481  80  TYR A N   
554  C CA  . TYR A 82  ? 0.7660 0.6141 0.5283 0.0556  -0.0680 0.0287  80  TYR A CA  
555  C C   . TYR A 82  ? 0.7326 0.5984 0.5086 0.0483  -0.0445 0.0185  80  TYR A C   
556  O O   . TYR A 82  ? 0.7673 0.6182 0.4989 0.0530  -0.0395 0.0118  80  TYR A O   
557  C CB  . TYR A 82  ? 0.7170 0.5770 0.4882 0.0594  -0.1055 0.0129  80  TYR A CB  
558  C CG  . TYR A 82  ? 0.7595 0.6102 0.5384 0.0685  -0.1295 0.0224  80  TYR A CG  
559  C CD1 . TYR A 82  ? 0.7262 0.5972 0.5653 0.0668  -0.1290 0.0218  80  TYR A CD1 
560  C CD2 . TYR A 82  ? 0.8035 0.6197 0.5247 0.0810  -0.1539 0.0319  80  TYR A CD2 
561  C CE1 . TYR A 82  ? 0.7397 0.5993 0.5893 0.0784  -0.1508 0.0295  80  TYR A CE1 
562  C CE2 . TYR A 82  ? 0.8201 0.6253 0.5510 0.0920  -0.1790 0.0423  80  TYR A CE2 
563  C CZ  . TYR A 82  ? 0.8183 0.6461 0.6171 0.0913  -0.1764 0.0409  80  TYR A CZ  
564  O OH  . TYR A 82  ? 0.8710 0.6856 0.6839 0.1053  -0.2011 0.0501  80  TYR A OH  
565  N N   . VAL A 83  ? 0.6959 0.5892 0.5307 0.0384  -0.0320 0.0169  81  VAL A N   
566  C CA  . VAL A 83  ? 0.7046 0.6167 0.5637 0.0322  -0.0132 0.0098  81  VAL A CA  
567  C C   . VAL A 83  ? 0.6932 0.6324 0.5906 0.0252  -0.0308 -0.0076 81  VAL A C   
568  O O   . VAL A 83  ? 0.6966 0.6502 0.6264 0.0214  -0.0434 -0.0106 81  VAL A O   
569  C CB  . VAL A 83  ? 0.6975 0.6193 0.5951 0.0250  0.0112  0.0230  81  VAL A CB  
570  C CG1 . VAL A 83  ? 0.6618 0.6055 0.5902 0.0211  0.0257  0.0158  81  VAL A CG1 
571  C CG2 . VAL A 83  ? 0.7616 0.6568 0.6246 0.0293  0.0329  0.0444  81  VAL A CG2 
572  N N   . LEU A 84  ? 0.6591 0.6021 0.5509 0.0242  -0.0298 -0.0187 82  LEU A N   
573  C CA  . LEU A 84  ? 0.6380 0.6040 0.5652 0.0152  -0.0397 -0.0305 82  LEU A CA  
574  C C   . LEU A 84  ? 0.6571 0.6324 0.6078 0.0121  -0.0223 -0.0286 82  LEU A C   
575  O O   . LEU A 84  ? 0.7338 0.6975 0.6668 0.0184  -0.0095 -0.0291 82  LEU A O   
576  C CB  . LEU A 84  ? 0.6464 0.6061 0.5543 0.0144  -0.0574 -0.0433 82  LEU A CB  
577  C CG  . LEU A 84  ? 0.6039 0.5836 0.5449 0.0029  -0.0644 -0.0519 82  LEU A CG  
578  C CD1 . LEU A 84  ? 0.5842 0.5879 0.5581 -0.0022 -0.0725 -0.0524 82  LEU A CD1 
579  C CD2 . LEU A 84  ? 0.6198 0.5871 0.5435 -0.0003 -0.0793 -0.0626 82  LEU A CD2 
580  N N   . ILE A 85  ? 0.6564 0.6511 0.6460 0.0040  -0.0237 -0.0278 83  ILE A N   
581  C CA  . ILE A 85  ? 0.6042 0.6099 0.6219 0.0007  -0.0157 -0.0261 83  ILE A CA  
582  C C   . ILE A 85  ? 0.5925 0.6025 0.6119 -0.0042 -0.0273 -0.0351 83  ILE A C   
583  O O   . ILE A 85  ? 0.5758 0.5944 0.6004 -0.0116 -0.0388 -0.0400 83  ILE A O   
584  C CB  . ILE A 85  ? 0.5643 0.5825 0.6171 -0.0063 -0.0164 -0.0210 83  ILE A CB  
585  C CG1 . ILE A 85  ? 0.5886 0.5990 0.6441 -0.0039 -0.0018 -0.0083 83  ILE A CG1 
586  C CG2 . ILE A 85  ? 0.5551 0.5861 0.6386 -0.0100 -0.0170 -0.0204 83  ILE A CG2 
587  C CD1 . ILE A 85  ? 0.5710 0.5832 0.6524 -0.0115 -0.0082 -0.0052 83  ILE A CD1 
588  N N   . ASN A 86  ? 0.5678 0.5690 0.5811 0.0008  -0.0222 -0.0367 84  ASN A N   
589  C CA  . ASN A 86  ? 0.5605 0.5586 0.5757 -0.0038 -0.0323 -0.0415 84  ASN A CA  
590  C C   . ASN A 86  ? 0.5512 0.5620 0.5980 -0.0063 -0.0339 -0.0356 84  ASN A C   
591  O O   . ASN A 86  ? 0.6262 0.6367 0.6901 0.0018  -0.0269 -0.0321 84  ASN A O   
592  C CB  . ASN A 86  ? 0.6362 0.6113 0.6283 0.0051  -0.0284 -0.0473 84  ASN A CB  
593  C CG  . ASN A 86  ? 0.6942 0.6591 0.6901 0.0007  -0.0387 -0.0499 84  ASN A CG  
594  O OD1 . ASN A 86  ? 0.7208 0.6916 0.7213 -0.0123 -0.0504 -0.0488 84  ASN A OD1 
595  N ND2 . ASN A 86  ? 0.7214 0.6682 0.7142 0.0123  -0.0325 -0.0526 84  ASN A ND2 
596  N N   . TRP A 87  ? 0.4691 0.4906 0.5235 -0.0163 -0.0442 -0.0353 85  TRP A N   
597  C CA  . TRP A 87  ? 0.4498 0.4794 0.5262 -0.0196 -0.0525 -0.0310 85  TRP A CA  
598  C C   . TRP A 87  ? 0.4925 0.5124 0.5586 -0.0233 -0.0641 -0.0292 85  TRP A C   
599  O O   . TRP A 87  ? 0.4841 0.4984 0.5276 -0.0318 -0.0676 -0.0314 85  TRP A O   
600  C CB  . TRP A 87  ? 0.4185 0.4565 0.4980 -0.0270 -0.0585 -0.0337 85  TRP A CB  
601  C CG  . TRP A 87  ? 0.3877 0.4283 0.4793 -0.0317 -0.0735 -0.0321 85  TRP A CG  
602  C CD1 . TRP A 87  ? 0.3868 0.4201 0.4557 -0.0376 -0.0857 -0.0333 85  TRP A CD1 
603  C CD2 . TRP A 87  ? 0.3857 0.4353 0.5139 -0.0316 -0.0798 -0.0281 85  TRP A CD2 
604  N NE1 . TRP A 87  ? 0.4207 0.4542 0.5018 -0.0398 -0.1031 -0.0318 85  TRP A NE1 
605  C CE2 . TRP A 87  ? 0.3972 0.4430 0.5209 -0.0370 -0.1016 -0.0293 85  TRP A CE2 
606  C CE3 . TRP A 87  ? 0.3379 0.3982 0.5030 -0.0290 -0.0689 -0.0226 85  TRP A CE3 
607  C CZ2 . TRP A 87  ? 0.4033 0.4569 0.5631 -0.0398 -0.1186 -0.0272 85  TRP A CZ2 
608  C CZ3 . TRP A 87  ? 0.3399 0.4118 0.5485 -0.0334 -0.0808 -0.0189 85  TRP A CZ3 
609  C CH2 . TRP A 87  ? 0.3524 0.4216 0.5607 -0.0387 -0.1081 -0.0222 85  TRP A CH2 
610  N N   . VAL A 88  ? 0.4740 0.4925 0.5604 -0.0171 -0.0699 -0.0235 86  VAL A N   
611  C CA  . VAL A 88  ? 0.4978 0.5025 0.5739 -0.0196 -0.0850 -0.0182 86  VAL A CA  
612  C C   . VAL A 88  ? 0.5396 0.5538 0.6394 -0.0191 -0.1019 -0.0128 86  VAL A C   
613  O O   . VAL A 88  ? 0.5771 0.6042 0.7187 -0.0097 -0.1019 -0.0098 86  VAL A O   
614  C CB  . VAL A 88  ? 0.5106 0.4965 0.5874 -0.0098 -0.0827 -0.0166 86  VAL A CB  
615  C CG1 . VAL A 88  ? 0.5411 0.5060 0.6026 -0.0138 -0.1000 -0.0079 86  VAL A CG1 
616  C CG2 . VAL A 88  ? 0.4973 0.4715 0.5502 -0.0113 -0.0707 -0.0248 86  VAL A CG2 
617  N N   . GLY A 89  ? 0.5312 0.5396 0.6051 -0.0290 -0.1163 -0.0122 87  GLY A N   
618  C CA  . GLY A 89  ? 0.5011 0.5134 0.5898 -0.0296 -0.1392 -0.0092 87  GLY A CA  
619  C C   . GLY A 89  ? 0.5259 0.5309 0.6341 -0.0203 -0.1566 0.0012  87  GLY A C   
620  O O   . GLY A 89  ? 0.5662 0.5508 0.6538 -0.0172 -0.1555 0.0073  87  GLY A O   
621  N N   . GLU A 90  ? 0.5517 0.5734 0.7067 -0.0156 -0.1742 0.0036  88  GLU A N   
622  C CA  . GLU A 90  ? 0.5666 0.5865 0.7532 -0.0040 -0.1960 0.0137  88  GLU A CA  
623  C C   . GLU A 90  ? 0.6289 0.6150 0.7615 -0.0067 -0.2208 0.0229  88  GLU A C   
624  O O   . GLU A 90  ? 0.7000 0.6744 0.8477 0.0049  -0.2377 0.0334  88  GLU A O   
625  C CB  . GLU A 90  ? 0.5261 0.5743 0.7771 -0.0025 -0.2168 0.0143  88  GLU A CB  
626  N N   . ASP A 91  ? 0.6627 0.6313 0.7323 -0.0206 -0.2225 0.0201  89  ASP A N   
627  C CA  . ASP A 91  ? 0.7499 0.6834 0.7585 -0.0248 -0.2418 0.0315  89  ASP A CA  
628  C C   . ASP A 91  ? 0.7257 0.6377 0.6880 -0.0322 -0.2168 0.0360  89  ASP A C   
629  O O   . ASP A 91  ? 0.7485 0.6294 0.6542 -0.0390 -0.2251 0.0480  89  ASP A O   
630  C CB  . ASP A 91  ? 0.8462 0.7706 0.8090 -0.0346 -0.2617 0.0261  89  ASP A CB  
631  C CG  . ASP A 91  ? 0.9175 0.8562 0.9245 -0.0300 -0.2979 0.0235  89  ASP A CG  
632  O OD1 . ASP A 91  ? 0.9773 0.9148 1.0181 -0.0190 -0.3234 0.0355  89  ASP A OD1 
633  O OD2 . ASP A 91  ? 0.9056 0.8553 0.9171 -0.0373 -0.3035 0.0096  89  ASP A OD2 
634  N N   . VAL A 92  ? 0.6759 0.6012 0.6622 -0.0312 -0.1886 0.0286  90  VAL A N   
635  C CA  . VAL A 92  ? 0.6693 0.5754 0.6260 -0.0391 -0.1697 0.0327  90  VAL A CA  
636  C C   . VAL A 92  ? 0.6711 0.5480 0.6336 -0.0303 -0.1820 0.0461  90  VAL A C   
637  O O   . VAL A 92  ? 0.6893 0.5739 0.6986 -0.0137 -0.1884 0.0441  90  VAL A O   
638  C CB  . VAL A 92  ? 0.6393 0.5660 0.6185 -0.0399 -0.1429 0.0190  90  VAL A CB  
639  C CG1 . VAL A 92  ? 0.6508 0.5582 0.6101 -0.0491 -0.1294 0.0221  90  VAL A CG1 
640  C CG2 . VAL A 92  ? 0.5793 0.5303 0.5543 -0.0465 -0.1325 0.0071  90  VAL A CG2 
641  N N   . PRO A 93  ? 0.7340 0.5766 0.6530 -0.0405 -0.1836 0.0602  91  PRO A N   
642  C CA  . PRO A 93  ? 0.7746 0.5816 0.6991 -0.0320 -0.1958 0.0731  91  PRO A CA  
643  C C   . PRO A 93  ? 0.7755 0.5843 0.7381 -0.0229 -0.1799 0.0605  91  PRO A C   
644  O O   . PRO A 93  ? 0.7576 0.5826 0.7224 -0.0312 -0.1579 0.0472  91  PRO A O   
645  C CB  . PRO A 93  ? 0.7866 0.5571 0.6533 -0.0513 -0.1924 0.0908  91  PRO A CB  
646  C CG  . PRO A 93  ? 0.7984 0.5852 0.6242 -0.0642 -0.1860 0.0897  91  PRO A CG  
647  C CD  . PRO A 93  ? 0.7658 0.5984 0.6283 -0.0596 -0.1738 0.0666  91  PRO A CD  
648  N N   . ASP A 94  ? 0.8226 0.6113 0.8124 -0.0039 -0.1929 0.0641  92  ASP A N   
649  C CA  . ASP A 94  ? 0.8113 0.5961 0.8311 0.0094  -0.1779 0.0493  92  ASP A CA  
650  C C   . ASP A 94  ? 0.8249 0.5820 0.8154 -0.0074 -0.1650 0.0459  92  ASP A C   
651  O O   . ASP A 94  ? 0.8433 0.6094 0.8424 -0.0061 -0.1480 0.0279  92  ASP A O   
652  C CB  . ASP A 94  ? 0.9249 0.6867 0.9764 0.0346  -0.1938 0.0542  92  ASP A CB  
653  C CG  . ASP A 94  ? 0.9983 0.7996 1.1031 0.0542  -0.2020 0.0522  92  ASP A CG  
654  O OD1 . ASP A 94  ? 0.9358 0.7801 1.0543 0.0480  -0.1920 0.0442  92  ASP A OD1 
655  O OD2 . ASP A 94  ? 1.0883 0.8769 1.2261 0.0755  -0.2202 0.0594  92  ASP A OD2 
656  N N   . ALA A 95  ? 0.8190 0.5411 0.7742 -0.0244 -0.1738 0.0639  93  ALA A N   
657  C CA  . ALA A 95  ? 0.8554 0.5536 0.7928 -0.0447 -0.1631 0.0626  93  ALA A CA  
658  C C   . ALA A 95  ? 0.8176 0.5562 0.7539 -0.0610 -0.1431 0.0498  93  ALA A C   
659  O O   . ALA A 95  ? 0.7887 0.5249 0.7323 -0.0681 -0.1346 0.0363  93  ALA A O   
660  C CB  . ALA A 95  ? 0.9115 0.5688 0.8130 -0.0633 -0.1722 0.0890  93  ALA A CB  
661  N N   . ARG A 96  ? 0.7991 0.5734 0.7274 -0.0651 -0.1384 0.0521  94  ARG A N   
662  C CA  . ARG A 96  ? 0.7659 0.5769 0.6971 -0.0776 -0.1202 0.0401  94  ARG A CA  
663  C C   . ARG A 96  ? 0.7723 0.6098 0.7312 -0.0619 -0.1141 0.0194  94  ARG A C   
664  O O   . ARG A 96  ? 0.8128 0.6665 0.7778 -0.0686 -0.1035 0.0072  94  ARG A O   
665  C CB  . ARG A 96  ? 0.7249 0.5591 0.6337 -0.0863 -0.1150 0.0468  94  ARG A CB  
666  C CG  . ARG A 96  ? 0.7168 0.5909 0.6356 -0.0937 -0.0966 0.0325  94  ARG A CG  
667  C CD  . ARG A 96  ? 0.7839 0.6590 0.6980 -0.1164 -0.0813 0.0377  94  ARG A CD  
668  N NE  . ARG A 96  ? 0.7759 0.6917 0.7049 -0.1209 -0.0649 0.0251  94  ARG A NE  
669  C CZ  . ARG A 96  ? 0.7721 0.7038 0.7213 -0.1363 -0.0527 0.0228  94  ARG A CZ  
670  N NH1 . ARG A 96  ? 0.8176 0.7261 0.7730 -0.1521 -0.0546 0.0323  94  ARG A NH1 
671  N NH2 . ARG A 96  ? 0.7203 0.6904 0.6882 -0.1360 -0.0402 0.0113  94  ARG A NH2 
672  N N   . LYS A 97  ? 0.7458 0.5877 0.7235 -0.0410 -0.1206 0.0167  95  LYS A N   
673  C CA  . LYS A 97  ? 0.7584 0.6188 0.7585 -0.0263 -0.1099 0.0000  95  LYS A CA  
674  C C   . LYS A 97  ? 0.7671 0.5996 0.7606 -0.0247 -0.1063 -0.0111 95  LYS A C   
675  O O   . LYS A 97  ? 0.7174 0.5604 0.7079 -0.0247 -0.0969 -0.0250 95  LYS A O   
676  C CB  . LYS A 97  ? 0.7684 0.6387 0.7989 -0.0046 -0.1139 0.0009  95  LYS A CB  
677  C CG  . LYS A 97  ? 0.7804 0.6615 0.8300 0.0121  -0.0970 -0.0139 95  LYS A CG  
678  C CD  . LYS A 97  ? 0.8010 0.7116 0.8922 0.0276  -0.0937 -0.0119 95  LYS A CD  
679  C CE  . LYS A 97  ? 0.8292 0.7540 0.9310 0.0398  -0.0691 -0.0239 95  LYS A CE  
680  N NZ  . LYS A 97  ? 0.8467 0.8020 1.0003 0.0547  -0.0608 -0.0202 95  LYS A NZ  
681  N N   . CYS A 98  ? 0.7783 0.5698 0.7649 -0.0243 -0.1171 -0.0047 96  CYS A N   
682  C CA  . CYS A 98  ? 0.7965 0.5523 0.7749 -0.0216 -0.1177 -0.0179 96  CYS A CA  
683  C C   . CYS A 98  ? 0.7995 0.5568 0.7655 -0.0461 -0.1171 -0.0228 96  CYS A C   
684  O O   . CYS A 98  ? 0.8008 0.5538 0.7604 -0.0437 -0.1153 -0.0408 96  CYS A O   
685  C CB  . CYS A 98  ? 0.8370 0.5432 0.8133 -0.0159 -0.1318 -0.0085 96  CYS A CB  
686  S SG  . CYS A 98  ? 0.8823 0.5352 0.8493 -0.0041 -0.1346 -0.0291 96  CYS A SG  
687  N N   . ALA A 99  ? 0.7674 0.5323 0.7301 -0.0693 -0.1184 -0.0068 97  ALA A N   
688  C CA  . ALA A 99  ? 0.7105 0.4850 0.6758 -0.0936 -0.1163 -0.0095 97  ALA A CA  
689  C C   . ALA A 99  ? 0.7107 0.5293 0.6846 -0.0907 -0.1079 -0.0231 97  ALA A C   
690  O O   . ALA A 99  ? 0.7269 0.5466 0.7053 -0.0970 -0.1125 -0.0364 97  ALA A O   
691  C CB  . ALA A 99  ? 0.6662 0.4448 0.6279 -0.1171 -0.1118 0.0122  97  ALA A CB  
692  N N   . CYS A 100 ? 0.6375 0.4890 0.6136 -0.0809 -0.0990 -0.0199 98  CYS A N   
693  C CA  . CYS A 100 ? 0.5900 0.4783 0.5739 -0.0776 -0.0917 -0.0303 98  CYS A CA  
694  C C   . CYS A 100 ? 0.5713 0.4510 0.5491 -0.0605 -0.0929 -0.0462 98  CYS A C   
695  O O   . CYS A 100 ? 0.5623 0.4587 0.5403 -0.0610 -0.0928 -0.0555 98  CYS A O   
696  C CB  . CYS A 100 ? 0.6022 0.5190 0.5885 -0.0714 -0.0840 -0.0242 98  CYS A CB  
697  S SG  . CYS A 100 ? 0.7077 0.6391 0.6880 -0.0910 -0.0776 -0.0110 98  CYS A SG  
698  N N   . ALA A 101 ? 0.5724 0.4245 0.5428 -0.0440 -0.0935 -0.0492 99  ALA A N   
699  C CA  . ALA A 101 ? 0.5899 0.4310 0.5462 -0.0257 -0.0886 -0.0643 99  ALA A CA  
700  C C   . ALA A 101 ? 0.6520 0.4736 0.5891 -0.0338 -0.0999 -0.0787 99  ALA A C   
701  O O   . ALA A 101 ? 0.6773 0.5016 0.5955 -0.0247 -0.0978 -0.0895 99  ALA A O   
702  C CB  . ALA A 101 ? 0.5997 0.4117 0.5549 -0.0059 -0.0850 -0.0666 99  ALA A CB  
703  N N   . SER A 102 ? 0.6742 0.4748 0.6156 -0.0522 -0.1139 -0.0775 100 SER A N   
704  C CA  . SER A 102 ? 0.7545 0.5374 0.6866 -0.0639 -0.1310 -0.0913 100 SER A CA  
705  C C   . SER A 102 ? 0.7662 0.5909 0.7170 -0.0777 -0.1352 -0.0903 100 SER A C   
706  O O   . SER A 102 ? 0.8484 0.6647 0.7979 -0.0872 -0.1539 -0.1020 100 SER A O   
707  C CB  . SER A 102 ? 0.8327 0.5787 0.7727 -0.0819 -0.1446 -0.0884 100 SER A CB  
708  O OG  . SER A 102 ? 0.8478 0.6184 0.8160 -0.1031 -0.1394 -0.0679 100 SER A OG  
709  N N   . HIS A 103 ? 0.6893 0.5566 0.6595 -0.0786 -0.1211 -0.0779 101 HIS A N   
710  C CA  . HIS A 103 ? 0.6625 0.5698 0.6537 -0.0862 -0.1229 -0.0781 101 HIS A CA  
711  C C   . HIS A 103 ? 0.6444 0.5618 0.6173 -0.0674 -0.1213 -0.0852 101 HIS A C   
712  O O   . HIS A 103 ? 0.6691 0.6070 0.6531 -0.0702 -0.1315 -0.0893 101 HIS A O   
713  C CB  . HIS A 103 ? 0.6174 0.5610 0.6344 -0.0955 -0.1072 -0.0635 101 HIS A CB  
714  C CG  . HIS A 103 ? 0.6374 0.5708 0.6650 -0.1144 -0.1042 -0.0514 101 HIS A CG  
715  N ND1 . HIS A 103 ? 0.6277 0.5765 0.6575 -0.1196 -0.0888 -0.0370 101 HIS A ND1 
716  C CD2 . HIS A 103 ? 0.6648 0.5686 0.6964 -0.1300 -0.1151 -0.0504 101 HIS A CD2 
717  C CE1 . HIS A 103 ? 0.6506 0.5803 0.6822 -0.1373 -0.0882 -0.0251 101 HIS A CE1 
718  N NE2 . HIS A 103 ? 0.6815 0.5841 0.7185 -0.1449 -0.1040 -0.0324 101 HIS A NE2 
719  N N   . VAL A 104 ? 0.5876 0.4912 0.5362 -0.0486 -0.1087 -0.0850 102 VAL A N   
720  C CA  . VAL A 104 ? 0.5838 0.4997 0.5186 -0.0335 -0.1006 -0.0851 102 VAL A CA  
721  C C   . VAL A 104 ? 0.6715 0.5760 0.5821 -0.0308 -0.1182 -0.0959 102 VAL A C   
722  O O   . VAL A 104 ? 0.7179 0.6444 0.6360 -0.0294 -0.1228 -0.0932 102 VAL A O   
723  C CB  . VAL A 104 ? 0.5967 0.4973 0.5135 -0.0153 -0.0824 -0.0834 102 VAL A CB  
724  C CG1 . VAL A 104 ? 0.6139 0.5219 0.5138 -0.0022 -0.0714 -0.0810 102 VAL A CG1 
725  C CG2 . VAL A 104 ? 0.5671 0.4823 0.5129 -0.0178 -0.0723 -0.0721 102 VAL A CG2 
726  N N   . ALA A 105 ? 0.7321 0.5986 0.6124 -0.0297 -0.1321 -0.1090 103 ALA A N   
727  C CA  . ALA A 105 ? 0.7918 0.6398 0.6385 -0.0261 -0.1546 -0.1210 103 ALA A CA  
728  C C   . ALA A 105 ? 0.8070 0.6869 0.6944 -0.0421 -0.1776 -0.1200 103 ALA A C   
729  O O   . ALA A 105 ? 0.8345 0.7200 0.7096 -0.0358 -0.1932 -0.1218 103 ALA A O   
730  C CB  . ALA A 105 ? 0.8267 0.6237 0.6345 -0.0246 -0.1692 -0.1387 103 ALA A CB  
731  N N   . LYS A 106 ? 0.7637 0.6636 0.7003 -0.0623 -0.1799 -0.1161 104 LYS A N   
732  C CA  . LYS A 106 ? 0.7566 0.6954 0.7455 -0.0778 -0.1950 -0.1141 104 LYS A CA  
733  C C   . LYS A 106 ? 0.6777 0.6582 0.6902 -0.0690 -0.1806 -0.1039 104 LYS A C   
734  O O   . LYS A 106 ? 0.6087 0.6140 0.6468 -0.0684 -0.1972 -0.1055 104 LYS A O   
735  C CB  . LYS A 106 ? 0.8055 0.7534 0.8376 -0.1017 -0.1913 -0.1090 104 LYS A CB  
736  C CG  . LYS A 106 ? 0.8601 0.8376 0.9496 -0.1231 -0.2107 -0.1105 104 LYS A CG  
737  C CD  . LYS A 106 ? 0.9396 0.9011 1.0502 -0.1469 -0.2094 -0.1065 104 LYS A CD  
738  C CE  . LYS A 106 ? 0.9891 0.9994 1.1718 -0.1706 -0.2010 -0.0954 104 LYS A CE  
739  N NZ  . LYS A 106 ? 1.0339 1.0236 1.2239 -0.1917 -0.1870 -0.0834 104 LYS A NZ  
740  N N   . VAL A 107 ? 0.6477 0.6341 0.6535 -0.0611 -0.1529 -0.0944 105 VAL A N   
741  C CA  . VAL A 107 ? 0.5896 0.6053 0.6110 -0.0516 -0.1410 -0.0872 105 VAL A CA  
742  C C   . VAL A 107 ? 0.6162 0.6172 0.6041 -0.0342 -0.1518 -0.0887 105 VAL A C   
743  O O   . VAL A 107 ? 0.5928 0.6146 0.6007 -0.0287 -0.1604 -0.0867 105 VAL A O   
744  C CB  . VAL A 107 ? 0.5890 0.6077 0.6076 -0.0486 -0.1147 -0.0785 105 VAL A CB  
745  C CG1 . VAL A 107 ? 0.5939 0.6290 0.6177 -0.0369 -0.1056 -0.0738 105 VAL A CG1 
746  C CG2 . VAL A 107 ? 0.5769 0.6127 0.6249 -0.0651 -0.1049 -0.0739 105 VAL A CG2 
747  N N   . ALA A 108 ? 0.6409 0.6039 0.5755 -0.0239 -0.1499 -0.0912 106 ALA A N   
748  C CA  . ALA A 108 ? 0.6608 0.6033 0.5516 -0.0081 -0.1577 -0.0900 106 ALA A CA  
749  C C   . ALA A 108 ? 0.7027 0.6428 0.5916 -0.0096 -0.1940 -0.0979 106 ALA A C   
750  O O   . ALA A 108 ? 0.7482 0.6863 0.6224 0.0016  -0.2071 -0.0930 106 ALA A O   
751  C CB  . ALA A 108 ? 0.6788 0.5802 0.5093 0.0034  -0.1441 -0.0924 106 ALA A CB  
752  N N   . GLU A 109 ? 0.7340 0.6726 0.6403 -0.0239 -0.2135 -0.1091 107 GLU A N   
753  C CA  . GLU A 109 ? 0.7865 0.7265 0.7017 -0.0277 -0.2535 -0.1176 107 GLU A CA  
754  C C   . GLU A 109 ? 0.7508 0.7437 0.7392 -0.0318 -0.2599 -0.1112 107 GLU A C   
755  O O   . GLU A 109 ? 0.7248 0.7251 0.7224 -0.0254 -0.2908 -0.1127 107 GLU A O   
756  C CB  . GLU A 109 ? 0.8115 0.7347 0.7338 -0.0453 -0.2734 -0.1316 107 GLU A CB  
757  C CG  . GLU A 109 ? 0.8968 0.8107 0.8181 -0.0497 -0.3211 -0.1436 107 GLU A CG  
758  C CD  . GLU A 109 ? 1.0248 0.8892 0.8561 -0.0294 -0.3389 -0.1494 107 GLU A CD  
759  O OE1 . GLU A 109 ? 1.0507 0.8815 0.8183 -0.0153 -0.3100 -0.1473 107 GLU A OE1 
760  O OE2 . GLU A 109 ? 1.1060 0.9650 0.9297 -0.0272 -0.3817 -0.1554 107 GLU A OE2 
761  N N   . PHE A 110 ? 0.7079 0.7359 0.7458 -0.0399 -0.2310 -0.1043 108 PHE A N   
762  C CA  . PHE A 110 ? 0.6170 0.6954 0.7242 -0.0414 -0.2303 -0.1005 108 PHE A CA  
763  C C   . PHE A 110 ? 0.6482 0.7278 0.7433 -0.0201 -0.2288 -0.0934 108 PHE A C   
764  O O   . PHE A 110 ? 0.6769 0.7784 0.8072 -0.0124 -0.2508 -0.0937 108 PHE A O   
765  C CB  . PHE A 110 ? 0.4810 0.5885 0.6291 -0.0549 -0.1976 -0.0961 108 PHE A CB  
766  C CG  . PHE A 110 ? 0.4723 0.6320 0.6904 -0.0557 -0.1899 -0.0945 108 PHE A CG  
767  C CD1 . PHE A 110 ? 0.4421 0.6379 0.7261 -0.0711 -0.2031 -0.0981 108 PHE A CD1 
768  C CD2 . PHE A 110 ? 0.4716 0.6446 0.6942 -0.0418 -0.1677 -0.0904 108 PHE A CD2 
769  C CE1 . PHE A 110 ? 0.3983 0.6468 0.7531 -0.0698 -0.1910 -0.0973 108 PHE A CE1 
770  C CE2 . PHE A 110 ? 0.4587 0.6777 0.7443 -0.0393 -0.1575 -0.0920 108 PHE A CE2 
771  C CZ  . PHE A 110 ? 0.4185 0.6774 0.7711 -0.0524 -0.1670 -0.0952 108 PHE A CZ  
772  N N   . PHE A 111 ? 0.6226 0.6769 0.6714 -0.0103 -0.2052 -0.0862 109 PHE A N   
773  C CA  . PHE A 111 ? 0.6511 0.6992 0.6867 0.0074  -0.2017 -0.0771 109 PHE A CA  
774  C C   . PHE A 111 ? 0.7191 0.7232 0.6865 0.0201  -0.2200 -0.0728 109 PHE A C   
775  O O   . PHE A 111 ? 0.7567 0.7306 0.6741 0.0268  -0.2006 -0.0645 109 PHE A O   
776  C CB  . PHE A 111 ? 0.6249 0.6724 0.6570 0.0081  -0.1669 -0.0705 109 PHE A CB  
777  C CG  . PHE A 111 ? 0.5736 0.6572 0.6571 -0.0022 -0.1489 -0.0745 109 PHE A CG  
778  C CD1 . PHE A 111 ? 0.5522 0.6681 0.6857 0.0030  -0.1497 -0.0772 109 PHE A CD1 
779  C CD2 . PHE A 111 ? 0.5666 0.6485 0.6441 -0.0146 -0.1297 -0.0750 109 PHE A CD2 
780  C CE1 . PHE A 111 ? 0.5169 0.6627 0.6877 -0.0048 -0.1283 -0.0814 109 PHE A CE1 
781  C CE2 . PHE A 111 ? 0.5577 0.6668 0.6697 -0.0237 -0.1127 -0.0769 109 PHE A CE2 
782  C CZ  . PHE A 111 ? 0.5290 0.6699 0.6845 -0.0190 -0.1100 -0.0805 109 PHE A CZ  
783  N N   . GLN A 112 ? 0.7334 0.7351 0.7007 0.0235  -0.2583 -0.0776 110 GLN A N   
784  C CA  . GLN A 112 ? 0.8359 0.7896 0.7255 0.0336  -0.2820 -0.0765 110 GLN A CA  
785  C C   . GLN A 112 ? 0.9227 0.8432 0.7556 0.0491  -0.2630 -0.0599 110 GLN A C   
786  O O   . GLN A 112 ? 0.9150 0.8499 0.7782 0.0559  -0.2520 -0.0488 110 GLN A O   
787  C CB  . GLN A 112 ? 0.8475 0.8079 0.7545 0.0387  -0.3316 -0.0806 110 GLN A CB  
788  C CG  . GLN A 112 ? 0.8461 0.8304 0.8006 0.0212  -0.3567 -0.0967 110 GLN A CG  
789  C CD  . GLN A 112 ? 0.8945 0.8304 0.7771 0.0159  -0.3754 -0.1090 110 GLN A CD  
790  O OE1 . GLN A 112 ? 0.9662 0.8662 0.7916 0.0258  -0.4126 -0.1119 110 GLN A OE1 
791  N NE2 . GLN A 112 ? 0.8645 0.7948 0.7456 0.0017  -0.3512 -0.1170 110 GLN A NE2 
792  N N   . GLY A 113 ? 0.9588 0.8330 0.7096 0.0541  -0.2560 -0.0584 111 GLY A N   
793  C CA  . GLY A 113 ? 0.9677 0.8075 0.6601 0.0670  -0.2367 -0.0399 111 GLY A CA  
794  C C   . GLY A 113 ? 0.9061 0.7457 0.5967 0.0633  -0.1882 -0.0326 111 GLY A C   
795  O O   . GLY A 113 ? 0.9149 0.7383 0.5841 0.0699  -0.1679 -0.0142 111 GLY A O   
796  N N   . VAL A 114 ? 0.8414 0.6983 0.5582 0.0524  -0.1710 -0.0449 112 VAL A N   
797  C CA  . VAL A 114 ? 0.8352 0.6932 0.5543 0.0504  -0.1296 -0.0384 112 VAL A CA  
798  C C   . VAL A 114 ? 0.8837 0.6983 0.5230 0.0617  -0.1110 -0.0318 112 VAL A C   
799  O O   . VAL A 114 ? 0.9153 0.7001 0.4987 0.0666  -0.1223 -0.0444 112 VAL A O   
800  C CB  . VAL A 114 ? 0.8234 0.7035 0.5821 0.0388  -0.1208 -0.0522 112 VAL A CB  
801  C CG1 . VAL A 114 ? 0.7856 0.6616 0.5398 0.0404  -0.0840 -0.0470 112 VAL A CG1 
802  C CG2 . VAL A 114 ? 0.7753 0.6977 0.6074 0.0279  -0.1271 -0.0541 112 VAL A CG2 
803  N N   . ASP A 115 ? 0.9112 0.7202 0.5440 0.0652  -0.0809 -0.0127 113 ASP A N   
804  C CA  . ASP A 115 ? 1.0431 0.8138 0.6016 0.0758  -0.0549 -0.0039 113 ASP A CA  
805  C C   . ASP A 115 ? 1.0429 0.8230 0.6156 0.0751  -0.0162 -0.0086 113 ASP A C   
806  O O   . ASP A 115 ? 1.0902 0.8402 0.6014 0.0856  -0.0001 -0.0150 113 ASP A O   
807  C CB  . ASP A 115 ? 1.1284 0.8824 0.6668 0.0796  -0.0411 0.0234  113 ASP A CB  
808  C CG  . ASP A 115 ? 1.2052 0.9327 0.7016 0.0873  -0.0804 0.0297  113 ASP A CG  
809  O OD1 . ASP A 115 ? 1.2833 0.9808 0.7137 0.0955  -0.1046 0.0188  113 ASP A OD1 
810  O OD2 . ASP A 115 ? 1.2078 0.9417 0.7368 0.0863  -0.0900 0.0447  113 ASP A OD2 
811  N N   . VAL A 116 ? 0.9764 0.7959 0.6271 0.0648  -0.0032 -0.0077 114 VAL A N   
812  C CA  . VAL A 116 ? 0.9760 0.8074 0.6494 0.0659  0.0273  -0.0126 114 VAL A CA  
813  C C   . VAL A 116 ? 0.9312 0.8001 0.6798 0.0538  0.0159  -0.0213 114 VAL A C   
814  O O   . VAL A 116 ? 0.9263 0.8175 0.7180 0.0441  0.0015  -0.0167 114 VAL A O   
815  C CB  . VAL A 116 ? 0.9907 0.8257 0.6723 0.0684  0.0699  0.0080  114 VAL A CB  
816  C CG1 . VAL A 116 ? 0.9475 0.8084 0.6906 0.0557  0.0683  0.0237  114 VAL A CG1 
817  C CG2 . VAL A 116 ? 0.9962 0.8482 0.7106 0.0725  0.0988  0.0015  114 VAL A CG2 
818  N N   . ILE A 117 ? 0.8753 0.7468 0.6347 0.0559  0.0227  -0.0340 115 ILE A N   
819  C CA  . ILE A 117 ? 0.7802 0.6807 0.6012 0.0456  0.0141  -0.0393 115 ILE A CA  
820  C C   . ILE A 117 ? 0.7736 0.6921 0.6349 0.0487  0.0426  -0.0316 115 ILE A C   
821  O O   . ILE A 117 ? 0.8513 0.7564 0.6927 0.0617  0.0663  -0.0339 115 ILE A O   
822  C CB  . ILE A 117 ? 0.7537 0.6415 0.5637 0.0438  -0.0062 -0.0574 115 ILE A CB  
823  C CG1 . ILE A 117 ? 0.7595 0.6374 0.5453 0.0382  -0.0376 -0.0645 115 ILE A CG1 
824  C CG2 . ILE A 117 ? 0.6872 0.6010 0.5543 0.0331  -0.0119 -0.0580 115 ILE A CG2 
825  C CD1 . ILE A 117 ? 0.7675 0.6403 0.5616 0.0294  -0.0600 -0.0794 115 ILE A CD1 
826  N N   . VAL A 118 ? 0.6894 0.6379 0.6083 0.0379  0.0393  -0.0240 116 VAL A N   
827  C CA  . VAL A 118 ? 0.6945 0.6662 0.6654 0.0381  0.0589  -0.0154 116 VAL A CA  
828  C C   . VAL A 118 ? 0.6925 0.6814 0.7046 0.0314  0.0404  -0.0217 116 VAL A C   
829  O O   . VAL A 118 ? 0.6965 0.6952 0.7223 0.0195  0.0198  -0.0227 116 VAL A O   
830  C CB  . VAL A 118 ? 0.6707 0.6564 0.6701 0.0298  0.0675  0.0008  116 VAL A CB  
831  C CG1 . VAL A 118 ? 0.6166 0.6309 0.6822 0.0262  0.0807  0.0090  116 VAL A CG1 
832  C CG2 . VAL A 118 ? 0.7459 0.7085 0.6975 0.0365  0.0872  0.0113  116 VAL A CG2 
833  N N   . ASN A 119 ? 0.6942 0.6846 0.7239 0.0406  0.0485  -0.0254 117 ASN A N   
834  C CA  . ASN A 119 ? 0.6633 0.6649 0.7277 0.0355  0.0295  -0.0278 117 ASN A CA  
835  C C   . ASN A 119 ? 0.6152 0.6472 0.7394 0.0294  0.0287  -0.0171 117 ASN A C   
836  O O   . ASN A 119 ? 0.6233 0.6712 0.7816 0.0353  0.0500  -0.0092 117 ASN A O   
837  C CB  . ASN A 119 ? 0.6991 0.6850 0.7604 0.0496  0.0337  -0.0356 117 ASN A CB  
838  C CG  . ASN A 119 ? 0.7944 0.7443 0.7968 0.0542  0.0299  -0.0490 117 ASN A CG  
839  O OD1 . ASN A 119 ? 0.7917 0.7329 0.7681 0.0421  0.0109  -0.0531 117 ASN A OD1 
840  N ND2 . ASN A 119 ? 0.8735 0.8023 0.8573 0.0723  0.0473  -0.0575 117 ASN A ND2 
841  N N   . ALA A 120 ? 0.5641 0.6037 0.7017 0.0174  0.0039  -0.0174 118 ALA A N   
842  C CA  . ALA A 120 ? 0.5257 0.5883 0.7113 0.0090  -0.0046 -0.0102 118 ALA A CA  
843  C C   . ALA A 120 ? 0.4909 0.5545 0.6854 0.0037  -0.0321 -0.0120 118 ALA A C   
844  O O   . ALA A 120 ? 0.5011 0.5486 0.6575 -0.0009 -0.0443 -0.0173 118 ALA A O   
845  C CB  . ALA A 120 ? 0.5271 0.5906 0.7052 -0.0025 -0.0065 -0.0085 118 ALA A CB  
846  N N   . SER A 121 ? 0.4758 0.5583 0.7216 0.0042  -0.0419 -0.0062 119 SER A N   
847  C CA  . SER A 121 ? 0.4750 0.5558 0.7255 -0.0011 -0.0729 -0.0058 119 SER A CA  
848  C C   . SER A 121 ? 0.4684 0.5669 0.7604 -0.0110 -0.0921 -0.0031 119 SER A C   
849  O O   . SER A 121 ? 0.5135 0.6065 0.8007 -0.0154 -0.1219 -0.0035 119 SER A O   
850  C CB  . SER A 121 ? 0.5464 0.6239 0.8144 0.0127  -0.0793 -0.0023 119 SER A CB  
851  O OG  . SER A 121 ? 0.6317 0.6846 0.8560 0.0193  -0.0667 -0.0072 119 SER A OG  
852  N N   . SER A 122 ? 0.4082 0.5252 0.7415 -0.0148 -0.0775 0.0007  120 SER A N   
853  C CA  . SER A 122 ? 0.4676 0.5953 0.8371 -0.0284 -0.0979 0.0011  120 SER A CA  
854  C C   . SER A 122 ? 0.4996 0.6236 0.8636 -0.0365 -0.0774 0.0018  120 SER A C   
855  O O   . SER A 122 ? 0.4983 0.6175 0.8412 -0.0296 -0.0478 0.0052  120 SER A O   
856  C CB  . SER A 122 ? 0.4747 0.6333 0.9268 -0.0267 -0.1085 0.0091  120 SER A CB  
857  O OG  . SER A 122 ? 0.5161 0.6982 1.0196 -0.0245 -0.0752 0.0183  120 SER A OG  
858  N N   . VAL A 123 ? 0.5131 0.6333 0.8905 -0.0507 -0.0955 -0.0016 121 VAL A N   
859  C CA  . VAL A 123 ? 0.5190 0.6320 0.8988 -0.0580 -0.0772 0.0021  121 VAL A CA  
860  C C   . VAL A 123 ? 0.5474 0.6825 0.9797 -0.0562 -0.0459 0.0184  121 VAL A C   
861  O O   . VAL A 123 ? 0.6063 0.7311 1.0194 -0.0553 -0.0187 0.0260  121 VAL A O   
862  C CB  . VAL A 123 ? 0.4504 0.5510 0.8421 -0.0736 -0.1041 -0.0056 121 VAL A CB  
863  C CG1 . VAL A 123 ? 0.4609 0.5413 0.7978 -0.0726 -0.1314 -0.0221 121 VAL A CG1 
864  C CG2 . VAL A 123 ? 0.3992 0.5234 0.8705 -0.0845 -0.1201 0.0009  121 VAL A CG2 
865  N N   . GLU A 124 ? 0.5710 0.7364 1.0685 -0.0543 -0.0478 0.0248  122 GLU A N   
866  C CA  . GLU A 124 ? 0.6062 0.7980 1.1619 -0.0524 -0.0125 0.0407  122 GLU A CA  
867  C C   . GLU A 124 ? 0.6221 0.8050 1.1304 -0.0348 0.0272  0.0442  122 GLU A C   
868  O O   . GLU A 124 ? 0.6745 0.8690 1.2067 -0.0331 0.0646  0.0577  122 GLU A O   
869  C CB  . GLU A 124 ? 0.7104 0.9415 1.3526 -0.0501 -0.0236 0.0451  122 GLU A CB  
870  C CG  . GLU A 124 ? 0.7976 1.0342 1.4809 -0.0665 -0.0716 0.0393  122 GLU A CG  
871  C CD  . GLU A 124 ? 0.8691 1.1379 1.6190 -0.0587 -0.0955 0.0404  122 GLU A CD  
872  O OE1 . GLU A 124 ? 0.8890 1.1425 1.5939 -0.0467 -0.1192 0.0318  122 GLU A OE1 
873  O OE2 . GLU A 124 ? 0.8919 1.2013 1.7420 -0.0648 -0.0907 0.0512  122 GLU A OE2 
874  N N   . ASP A 125 ? 0.5484 0.7093 0.9893 -0.0226 0.0202  0.0324  123 ASP A N   
875  C CA  . ASP A 125 ? 0.5288 0.6735 0.9163 -0.0075 0.0514  0.0324  123 ASP A CA  
876  C C   . ASP A 125 ? 0.5491 0.6679 0.8835 -0.0129 0.0634  0.0360  123 ASP A C   
877  O O   . ASP A 125 ? 0.5921 0.6943 0.8786 -0.0017 0.0882  0.0378  123 ASP A O   
878  C CB  . ASP A 125 ? 0.5439 0.6708 0.8822 0.0042  0.0364  0.0189  123 ASP A CB  
879  C CG  . ASP A 125 ? 0.6024 0.7471 0.9857 0.0135  0.0241  0.0172  123 ASP A CG  
880  O OD1 . ASP A 125 ? 0.6223 0.7524 0.9780 0.0151  -0.0018 0.0093  123 ASP A OD1 
881  O OD2 . ASP A 125 ? 0.6215 0.7952 1.0712 0.0193  0.0401  0.0253  123 ASP A OD2 
882  N N   . ILE A 126 ? 0.5402 0.6517 0.8802 -0.0283 0.0447  0.0367  124 ILE A N   
883  C CA  . ILE A 126 ? 0.6013 0.6848 0.8920 -0.0313 0.0488  0.0393  124 ILE A CA  
884  C C   . ILE A 126 ? 0.6743 0.7578 1.0010 -0.0436 0.0653  0.0571  124 ILE A C   
885  O O   . ILE A 126 ? 0.6863 0.7617 1.0335 -0.0576 0.0459  0.0566  124 ILE A O   
886  C CB  . ILE A 126 ? 0.5612 0.6297 0.8230 -0.0360 0.0160  0.0241  124 ILE A CB  
887  C CG1 . ILE A 126 ? 0.5045 0.5734 0.7341 -0.0264 0.0050  0.0109  124 ILE A CG1 
888  C CG2 . ILE A 126 ? 0.5639 0.6055 0.7847 -0.0363 0.0167  0.0259  124 ILE A CG2 
889  C CD1 . ILE A 126 ? 0.4770 0.5366 0.6817 -0.0306 -0.0201 -0.0024 124 ILE A CD1 
890  N N   . ASP A 127 ? 0.7423 0.8315 1.0743 -0.0384 0.1030  0.0730  125 ASP A N   
891  C CA  . ASP A 127 ? 0.7735 0.8622 1.1385 -0.0508 0.1280  0.0955  125 ASP A CA  
892  C C   . ASP A 127 ? 0.7511 0.7997 1.0413 -0.0461 0.1426  0.1062  125 ASP A C   
893  O O   . ASP A 127 ? 0.7502 0.7869 0.9847 -0.0307 0.1670  0.1091  125 ASP A O   
894  C CB  . ASP A 127 ? 0.8411 0.9638 1.2614 -0.0476 0.1660  0.1087  125 ASP A CB  
895  C CG  . ASP A 127 ? 0.9185 1.0452 1.3828 -0.0639 0.1958  0.1350  125 ASP A CG  
896  O OD1 . ASP A 127 ? 0.9944 1.0919 1.4011 -0.0604 0.2249  0.1507  125 ASP A OD1 
897  O OD2 . ASP A 127 ? 0.9266 1.0833 1.4821 -0.0813 0.1882  0.1410  125 ASP A OD2 
898  N N   . ALA A 128 ? 0.7500 0.7742 1.0380 -0.0583 0.1257  0.1117  126 ALA A N   
899  C CA  . ALA A 128 ? 0.7707 0.7532 0.9909 -0.0531 0.1319  0.1234  126 ALA A CA  
900  C C   . ALA A 128 ? 0.8044 0.7771 0.9967 -0.0489 0.1773  0.1484  126 ALA A C   
901  O O   . ALA A 128 ? 0.8147 0.7568 0.9261 -0.0346 0.1849  0.1522  126 ALA A O   
902  C CB  . ALA A 128 ? 0.7592 0.7174 1.0000 -0.0679 0.1107  0.1288  126 ALA A CB  
903  N N   . GLY A 129 ? 0.8024 0.8010 1.0603 -0.0611 0.2082  0.1657  127 GLY A N   
904  C CA  . GLY A 129 ? 0.8297 0.8227 1.0612 -0.0561 0.2595  0.1895  127 GLY A CA  
905  C C   . GLY A 129 ? 0.8442 0.8411 1.0185 -0.0316 0.2776  0.1758  127 GLY A C   
906  O O   . GLY A 129 ? 0.9132 0.8740 0.9973 -0.0180 0.2942  0.1823  127 GLY A O   
907  N N   . ALA A 130 ? 0.7789 0.8139 1.0002 -0.0249 0.2702  0.1556  128 ALA A N   
908  C CA  . ALA A 130 ? 0.7957 0.8313 0.9703 -0.0014 0.2877  0.1411  128 ALA A CA  
909  C C   . ALA A 130 ? 0.8698 0.8619 0.9408 0.0123  0.2631  0.1264  128 ALA A C   
910  O O   . ALA A 130 ? 0.9480 0.9132 0.9412 0.0289  0.2854  0.1257  128 ALA A O   
911  C CB  . ALA A 130 ? 0.7045 0.7818 0.9487 0.0030  0.2728  0.1218  128 ALA A CB  
912  N N   . ILE A 131 ? 0.8545 0.8393 0.9241 0.0056  0.2166  0.1135  129 ILE A N   
913  C CA  . ILE A 131 ? 0.8563 0.8060 0.8433 0.0160  0.1902  0.1011  129 ILE A CA  
914  C C   . ILE A 131 ? 0.9366 0.8441 0.8512 0.0194  0.2044  0.1215  129 ILE A C   
915  O O   . ILE A 131 ? 0.9478 0.8240 0.7789 0.0343  0.2032  0.1160  129 ILE A O   
916  C CB  . ILE A 131 ? 0.7621 0.7175 0.7735 0.0075  0.1443  0.0865  129 ILE A CB  
917  C CG1 . ILE A 131 ? 0.7059 0.6912 0.7577 0.0085  0.1284  0.0656  129 ILE A CG1 
918  C CG2 . ILE A 131 ? 0.7517 0.6746 0.6938 0.0154  0.1185  0.0801  129 ILE A CG2 
919  C CD1 . ILE A 131 ? 0.6370 0.6322 0.7195 -0.0016 0.0919  0.0534  129 ILE A CD1 
920  N N   . GLY A 132 ? 0.9703 0.8717 0.9127 0.0051  0.2157  0.1459  130 GLY A N   
921  C CA  . GLY A 132 ? 1.0831 0.9388 0.9533 0.0080  0.2284  0.1697  130 GLY A CA  
922  C C   . GLY A 132 ? 1.2216 1.0602 1.0253 0.0214  0.2732  0.1800  130 GLY A C   
923  O O   . GLY A 132 ? 1.3110 1.1063 1.0159 0.0353  0.2687  0.1818  130 GLY A O   
924  N N   . GLN A 133 ? 1.2421 1.1149 1.0987 0.0192  0.3160  0.1850  131 GLN A N   
925  C CA  . GLN A 133 ? 1.3221 1.1813 1.1174 0.0350  0.3656  0.1916  131 GLN A CA  
926  C C   . GLN A 133 ? 1.3870 1.2256 1.1042 0.0578  0.3478  0.1615  131 GLN A C   
927  O O   . GLN A 133 ? 1.4998 1.2978 1.1163 0.0739  0.3693  0.1638  131 GLN A O   
928  C CB  . GLN A 133 ? 1.2806 1.1902 1.1665 0.0307  0.4133  0.1986  131 GLN A CB  
929  N N   . ARG A 134 ? 1.3386 1.2005 1.0968 0.0587  0.3080  0.1334  132 ARG A N   
930  C CA  . ARG A 134 ? 1.3573 1.1976 1.0494 0.0766  0.2870  0.1048  132 ARG A CA  
931  C C   . ARG A 134 ? 1.4138 1.2011 1.0015 0.0831  0.2585  0.1051  132 ARG A C   
932  O O   . ARG A 134 ? 1.4946 1.2472 0.9963 0.0998  0.2575  0.0902  132 ARG A O   
933  C CB  . ARG A 134 ? 1.2875 1.1588 1.0436 0.0716  0.2466  0.0803  132 ARG A CB  
934  C CG  . ARG A 134 ? 1.2940 1.1855 1.0782 0.0838  0.2620  0.0612  132 ARG A CG  
935  C CD  . ARG A 134 ? 1.2420 1.1594 1.0856 0.0764  0.2217  0.0429  132 ARG A CD  
936  N NE  . ARG A 134 ? 1.2818 1.1935 1.1124 0.0916  0.2201  0.0197  132 ARG A NE  
937  C CZ  . ARG A 134 ? 1.2482 1.1793 1.1277 0.0880  0.1933  0.0055  132 ARG A CZ  
938  N NH1 . ARG A 134 ? 1.2966 1.2149 1.1609 0.1024  0.1926  -0.0139 132 ARG A NH1 
939  N NH2 . ARG A 134 ? 1.1661 1.1243 1.1045 0.0707  0.1674  0.0108  132 ARG A NH2 
940  N N   . LEU A 135 ? 1.3451 1.1233 0.9398 0.0712  0.2319  0.1205  133 LEU A N   
941  C CA  . LEU A 135 ? 1.3446 1.0764 0.8528 0.0783  0.1976  0.1216  133 LEU A CA  
942  C C   . LEU A 135 ? 1.4681 1.1495 0.8767 0.0872  0.2274  0.1468  133 LEU A C   
943  O O   . LEU A 135 ? 1.5163 1.2009 0.9327 0.0836  0.2793  0.1695  133 LEU A O   
944  C CB  . LEU A 135 ? 1.2379 0.9785 0.7954 0.0660  0.1575  0.1273  133 LEU A CB  
945  C CG  . LEU A 135 ? 1.0819 0.8662 0.7222 0.0582  0.1272  0.1026  133 LEU A CG  
946  C CD1 . LEU A 135 ? 0.9700 0.7720 0.6816 0.0438  0.1113  0.1118  133 LEU A CD1 
947  C CD2 . LEU A 135 ? 1.0835 0.8588 0.6882 0.0666  0.0851  0.0781  133 LEU A CD2 
948  N N   . GLY B 1   ? 1.5626 0.9600 1.2013 -0.1432 -0.1922 0.1391  -1  GLY B N   
949  C CA  . GLY B 1   ? 1.6717 1.0706 1.3004 -0.1919 -0.2230 0.1240  -1  GLY B CA  
950  C C   . GLY B 1   ? 1.7586 1.2197 1.4538 -0.2492 -0.2546 0.1699  -1  GLY B C   
951  O O   . GLY B 1   ? 1.8307 1.2478 1.4968 -0.3149 -0.2858 0.1751  -1  GLY B O   
952  N N   . SER B 2   ? 1.8180 1.3868 1.6026 -0.2246 -0.2451 0.2035  0   SER B N   
953  C CA  . SER B 2   ? 1.7763 1.4179 1.6364 -0.2692 -0.2691 0.2548  0   SER B CA  
954  C C   . SER B 2   ? 1.6908 1.4159 1.6306 -0.2279 -0.2445 0.2892  0   SER B C   
955  O O   . SER B 2   ? 1.6698 1.4341 1.6209 -0.1665 -0.2126 0.2674  0   SER B O   
956  C CB  . SER B 2   ? 1.7280 1.4363 1.6192 -0.2896 -0.2875 0.2543  0   SER B CB  
957  O OG  . SER B 2   ? 1.6357 1.4243 1.5743 -0.2337 -0.2583 0.2409  0   SER B OG  
958  N N   . MET B 3   ? 1.5638 1.3182 1.5569 -0.2635 -0.2588 0.3420  1   MET B N   
959  C CA  . MET B 3   ? 1.3548 1.1785 1.4183 -0.2267 -0.2346 0.3770  1   MET B CA  
960  C C   . MET B 3   ? 1.1209 1.0541 1.2516 -0.1856 -0.2132 0.3755  1   MET B C   
961  O O   . MET B 3   ? 1.0283 1.0077 1.1871 -0.1328 -0.1804 0.3732  1   MET B O   
962  C CB  . MET B 3   ? 1.3340 1.1750 1.4479 -0.2775 -0.2556 0.4357  1   MET B CB  
963  C CG  . MET B 3   ? 1.2556 1.1653 1.4430 -0.2425 -0.2310 0.4763  1   MET B CG  
964  S SD  . MET B 3   ? 1.1367 1.1865 1.4413 -0.2457 -0.2307 0.5247  1   MET B SD  
965  C CE  . MET B 3   ? 1.1351 1.1955 1.4937 -0.2915 -0.2473 0.5940  1   MET B CE  
966  N N   . ALA B 4   ? 1.0024 0.9775 1.1567 -0.2091 -0.2281 0.3755  2   ALA B N   
967  C CA  . ALA B 4   ? 0.8516 0.9243 1.0729 -0.1746 -0.2019 0.3767  2   ALA B CA  
968  C C   . ALA B 4   ? 0.7925 0.8649 0.9806 -0.1161 -0.1671 0.3190  2   ALA B C   
969  O O   . ALA B 4   ? 0.7342 0.8820 0.9737 -0.0770 -0.1330 0.3161  2   ALA B O   
970  C CB  . ALA B 4   ? 0.7529 0.8627 1.0011 -0.2104 -0.2223 0.3914  2   ALA B CB  
971  N N   . GLY B 5   ? 0.7896 0.7806 0.8927 -0.1106 -0.1730 0.2726  3   GLY B N   
972  C CA  . GLY B 5   ? 0.7646 0.7585 0.8339 -0.0577 -0.1425 0.2178  3   GLY B CA  
973  C C   . GLY B 5   ? 0.7370 0.7541 0.8059 -0.0555 -0.1366 0.1837  3   GLY B C   
974  O O   . GLY B 5   ? 0.7361 0.7450 0.8087 -0.0957 -0.1610 0.1967  3   GLY B O   
975  N N   . VAL B 6   ? 0.6724 0.7223 0.7350 -0.0072 -0.1022 0.1389  4   VAL B N   
976  C CA  . VAL B 6   ? 0.6299 0.7047 0.6954 0.0009  -0.0872 0.1021  4   VAL B CA  
977  C C   . VAL B 6   ? 0.5761 0.7203 0.7224 -0.0196 -0.0821 0.1394  4   VAL B C   
978  O O   . VAL B 6   ? 0.5330 0.7427 0.7479 -0.0129 -0.0652 0.1744  4   VAL B O   
979  C CB  . VAL B 6   ? 0.5869 0.6989 0.6408 0.0540  -0.0472 0.0493  4   VAL B CB  
980  C CG1 . VAL B 6   ? 0.5602 0.7693 0.6873 0.0786  -0.0124 0.0633  4   VAL B CG1 
981  C CG2 . VAL B 6   ? 0.5669 0.6749 0.6006 0.0586  -0.0351 0.0026  4   VAL B CG2 
982  N N   . SER B 7   ? 0.5827 0.7124 0.7204 -0.0433 -0.0951 0.1350  5   SER B N   
983  C CA  . SER B 7   ? 0.6149 0.8072 0.8248 -0.0602 -0.0885 0.1734  5   SER B CA  
984  C C   . SER B 7   ? 0.5724 0.7898 0.7908 -0.0370 -0.0531 0.1342  5   SER B C   
985  O O   . SER B 7   ? 0.5792 0.7460 0.7342 -0.0313 -0.0568 0.0866  5   SER B O   
986  C CB  . SER B 7   ? 0.5928 0.7571 0.7919 -0.1136 -0.1364 0.2152  5   SER B CB  
987  O OG  . SER B 7   ? 0.5799 0.7915 0.8227 -0.1229 -0.1292 0.2359  5   SER B OG  
988  N N   . PHE B 8   ? 0.5563 0.8480 0.8539 -0.0250 -0.0158 0.1561  6   PHE B N   
989  C CA  . PHE B 8   ? 0.5321 0.8478 0.8469 -0.0055 0.0254  0.1244  6   PHE B CA  
990  C C   . PHE B 8   ? 0.5688 0.9155 0.9351 -0.0269 0.0240  0.1752  6   PHE B C   
991  O O   . PHE B 8   ? 0.5545 0.9381 0.9641 -0.0086 0.0707  0.1685  6   PHE B O   
992  C CB  . PHE B 8   ? 0.4781 0.8525 0.8390 0.0303  0.0842  0.0984  6   PHE B CB  
993  C CG  . PHE B 8   ? 0.4609 0.8307 0.7866 0.0522  0.0856  0.0647  6   PHE B CG  
994  C CD1 . PHE B 8   ? 0.4845 0.8214 0.7434 0.0727  0.0894  0.0007  6   PHE B CD1 
995  C CD2 . PHE B 8   ? 0.4370 0.8423 0.7995 0.0554  0.0865  0.0993  6   PHE B CD2 
996  C CE1 . PHE B 8   ? 0.4996 0.8428 0.7284 0.0969  0.0925  -0.0248 6   PHE B CE1 
997  C CE2 . PHE B 8   ? 0.4782 0.8864 0.8088 0.0793  0.0899  0.0723  6   PHE B CE2 
998  C CZ  . PHE B 8   ? 0.4783 0.8584 0.7424 0.1009  0.0929  0.0114  6   PHE B CZ  
999  N N   . SER B 9   ? 0.6071 0.9423 0.9699 -0.0658 -0.0265 0.2271  7   SER B N   
1000 C CA  . SER B 9   ? 0.5593 0.9452 0.9824 -0.0867 -0.0313 0.2911  7   SER B CA  
1001 C C   . SER B 9   ? 0.5743 0.9407 0.9658 -0.0938 -0.0368 0.2778  7   SER B C   
1002 O O   . SER B 9   ? 0.5390 0.9531 0.9855 -0.0817 -0.0028 0.3032  7   SER B O   
1003 C CB  . SER B 9   ? 0.5890 0.9836 1.0235 -0.1294 -0.0839 0.3525  7   SER B CB  
1004 O OG  . SER B 9   ? 0.6462 0.9864 1.0092 -0.1683 -0.1375 0.3462  7   SER B OG  
1005 N N   . GLY B 10  ? 0.6191 0.9140 0.9222 -0.1130 -0.0771 0.2415  8   GLY B N   
1006 C CA  . GLY B 10  ? 0.6026 0.8742 0.8660 -0.1234 -0.0884 0.2289  8   GLY B CA  
1007 C C   . GLY B 10  ? 0.5322 0.8024 0.7975 -0.0843 -0.0349 0.1819  8   GLY B C   
1008 O O   . GLY B 10  ? 0.4915 0.7699 0.7573 -0.0877 -0.0311 0.1930  8   GLY B O   
1009 N N   . HIS B 11  ? 0.4885 0.7523 0.7543 -0.0488 0.0074  0.1300  9   HIS B N   
1010 C CA  . HIS B 11  ? 0.5096 0.7675 0.7701 -0.0171 0.0580  0.0774  9   HIS B CA  
1011 C C   . HIS B 11  ? 0.4991 0.8094 0.8260 0.0154  0.1241  0.0630  9   HIS B C   
1012 O O   . HIS B 11  ? 0.5021 0.8034 0.8139 0.0412  0.1669  0.0013  9   HIS B O   
1013 C CB  . HIS B 11  ? 0.5675 0.7523 0.7354 -0.0096 0.0438  0.0056  9   HIS B CB  
1014 C CG  . HIS B 11  ? 0.6594 0.7826 0.7539 -0.0430 -0.0154 0.0121  9   HIS B CG  
1015 N ND1 . HIS B 11  ? 0.6986 0.7992 0.7627 -0.0514 -0.0217 0.0068  9   HIS B ND1 
1016 C CD2 . HIS B 11  ? 0.7237 0.8019 0.7679 -0.0725 -0.0680 0.0234  9   HIS B CD2 
1017 C CE1 . HIS B 11  ? 0.7641 0.8106 0.7598 -0.0865 -0.0773 0.0122  9   HIS B CE1 
1018 N NE2 . HIS B 11  ? 0.7708 0.7998 0.7531 -0.1010 -0.1047 0.0213  9   HIS B NE2 
1019 N N   . ARG B 12  ? 0.5785 0.6917 0.4347 0.0442  -0.0579 0.2121  10  ARG B N   
1020 C CA  . ARG B 12  ? 0.5539 0.6683 0.4550 0.0346  -0.0614 0.2058  10  ARG B CA  
1021 C C   . ARG B 12  ? 0.5330 0.6662 0.5186 0.0458  -0.0415 0.2209  10  ARG B C   
1022 O O   . ARG B 12  ? 0.5163 0.6386 0.5385 0.0441  -0.0418 0.2088  10  ARG B O   
1023 C CB  . ARG B 12  ? 0.5143 0.6387 0.4097 0.0137  -0.0680 0.1947  10  ARG B CB  
1024 C CG  . ARG B 12  ? 0.5144 0.6333 0.4435 -0.0034 -0.0667 0.1693  10  ARG B CG  
1025 C CD  . ARG B 12  ? 0.5017 0.6433 0.4311 -0.0252 -0.0642 0.1513  10  ARG B CD  
1026 N NE  . ARG B 12  ? 0.4864 0.6152 0.4041 -0.0529 -0.0665 0.1195  10  ARG B NE  
1027 C CZ  . ARG B 12  ? 0.5188 0.6233 0.3586 -0.0839 -0.0862 0.1069  10  ARG B CZ  
1028 N NH1 . ARG B 12  ? 0.4703 0.5569 0.2461 -0.0875 -0.1056 0.1205  10  ARG B NH1 
1029 N NH2 . ARG B 12  ? 0.4721 0.5658 0.2937 -0.1145 -0.0892 0.0815  10  ARG B NH2 
1030 N N   . LEU B 13  ? 0.5294 0.6876 0.5477 0.0543  -0.0292 0.2506  11  LEU B N   
1031 C CA  . LEU B 13  ? 0.5426 0.7103 0.6432 0.0603  -0.0151 0.2689  11  LEU B CA  
1032 C C   . LEU B 13  ? 0.5748 0.7459 0.6889 0.0675  -0.0022 0.2772  11  LEU B C   
1033 O O   . LEU B 13  ? 0.5557 0.7231 0.7310 0.0649  0.0018  0.2728  11  LEU B O   
1034 C CB  . LEU B 13  ? 0.4827 0.6694 0.6142 0.0659  -0.0124 0.3069  11  LEU B CB  
1035 C CG  . LEU B 13  ? 0.4883 0.6735 0.7082 0.0685  -0.0030 0.3276  11  LEU B CG  
1036 C CD1 . LEU B 13  ? 0.4515 0.6190 0.7272 0.0630  -0.0057 0.2899  11  LEU B CD1 
1037 C CD2 . LEU B 13  ? 0.4247 0.6193 0.6813 0.0724  -0.0079 0.3717  11  LEU B CD2 
1038 N N   . GLU B 14  ? 0.6025 0.7833 0.6629 0.0755  0.0048  0.2841  12  GLU B N   
1039 C CA  . GLU B 14  ? 0.6278 0.8250 0.7111 0.0838  0.0228  0.2865  12  GLU B CA  
1040 C C   . GLU B 14  ? 0.6245 0.8023 0.7274 0.0855  0.0085  0.2523  12  GLU B C   
1041 O O   . GLU B 14  ? 0.6461 0.8370 0.8153 0.0861  0.0161  0.2539  12  GLU B O   
1042 C CB  . GLU B 14  ? 0.7391 0.9540 0.7571 0.0926  0.0372  0.2915  12  GLU B CB  
1043 C CG  . GLU B 14  ? 0.8653 1.1147 0.9130 0.1007  0.0665  0.2944  12  GLU B CG  
1044 C CD  . GLU B 14  ? 0.9946 1.2622 0.9692 0.1089  0.0848  0.2871  12  GLU B CD  
1045 O OE1 . GLU B 14  ? 1.0375 1.2785 0.9371 0.1101  0.0662  0.2726  12  GLU B OE1 
1046 O OE2 . GLU B 14  ? 1.0402 1.3510 1.0318 0.1113  0.1192  0.2935  12  GLU B OE2 
1047 N N   . LEU B 15  ? 0.5497 0.6953 0.5974 0.0822  -0.0169 0.2250  13  LEU B N   
1048 C CA  . LEU B 15  ? 0.5595 0.6801 0.6188 0.0801  -0.0400 0.1991  13  LEU B CA  
1049 C C   . LEU B 15  ? 0.5372 0.6541 0.6567 0.0644  -0.0459 0.1964  13  LEU B C   
1050 O O   . LEU B 15  ? 0.5239 0.6449 0.6972 0.0658  -0.0514 0.1915  13  LEU B O   
1051 C CB  . LEU B 15  ? 0.5907 0.6700 0.5726 0.0700  -0.0713 0.1783  13  LEU B CB  
1052 C CG  . LEU B 15  ? 0.5885 0.6575 0.4977 0.0787  -0.0737 0.1754  13  LEU B CG  
1053 C CD1 . LEU B 15  ? 0.5967 0.6238 0.4374 0.0562  -0.1067 0.1616  13  LEU B CD1 
1054 C CD2 . LEU B 15  ? 0.5877 0.6567 0.5053 0.1045  -0.0707 0.1621  13  LEU B CD2 
1055 N N   . LEU B 16  ? 0.5195 0.6317 0.6374 0.0496  -0.0445 0.1968  14  LEU B N   
1056 C CA  . LEU B 16  ? 0.4927 0.5972 0.6628 0.0340  -0.0486 0.1853  14  LEU B CA  
1057 C C   . LEU B 16  ? 0.5079 0.6335 0.7630 0.0405  -0.0291 0.2075  14  LEU B C   
1058 O O   . LEU B 16  ? 0.5189 0.6358 0.8246 0.0289  -0.0362 0.1967  14  LEU B O   
1059 C CB  . LEU B 16  ? 0.4883 0.5859 0.6390 0.0184  -0.0489 0.1695  14  LEU B CB  
1060 C CG  . LEU B 16  ? 0.4960 0.5695 0.5683 -0.0034 -0.0723 0.1434  14  LEU B CG  
1061 C CD1 . LEU B 16  ? 0.5006 0.5829 0.5511 -0.0211 -0.0654 0.1255  14  LEU B CD1 
1062 C CD2 . LEU B 16  ? 0.4692 0.5183 0.5449 -0.0218 -0.0949 0.1247  14  LEU B CD2 
1063 N N   . ALA B 17  ? 0.5141 0.6656 0.7814 0.0539  -0.0072 0.2402  15  ALA B N   
1064 C CA  . ALA B 17  ? 0.4648 0.6357 0.8086 0.0532  0.0101  0.2685  15  ALA B CA  
1065 C C   . ALA B 17  ? 0.4376 0.6280 0.8191 0.0549  0.0130  0.2655  15  ALA B C   
1066 O O   . ALA B 17  ? 0.4738 0.6665 0.9272 0.0438  0.0114  0.2686  15  ALA B O   
1067 C CB  . ALA B 17  ? 0.3855 0.5793 0.7190 0.0597  0.0300  0.3098  15  ALA B CB  
1068 N N   . ALA B 18  ? 0.3881 0.5926 0.7296 0.0692  0.0145  0.2556  16  ALA B N   
1069 C CA  . ALA B 18  ? 0.3762 0.6045 0.7692 0.0752  0.0143  0.2466  16  ALA B CA  
1070 C C   . ALA B 18  ? 0.4876 0.6859 0.9070 0.0628  -0.0221 0.2213  16  ALA B C   
1071 O O   . ALA B 18  ? 0.5330 0.7497 1.0292 0.0560  -0.0259 0.2233  16  ALA B O   
1072 C CB  . ALA B 18  ? 0.3929 0.6370 0.7445 0.0978  0.0206  0.2324  16  ALA B CB  
1073 N N   . TYR B 19  ? 0.4291 0.5832 0.7837 0.0538  -0.0499 0.1993  17  TYR B N   
1074 C CA  . TYR B 19  ? 0.4387 0.5641 0.8051 0.0341  -0.0856 0.1778  17  TYR B CA  
1075 C C   . TYR B 19  ? 0.4735 0.5968 0.8989 0.0140  -0.0808 0.1795  17  TYR B C   
1076 O O   . TYR B 19  ? 0.5140 0.6353 0.9894 0.0002  -0.1013 0.1717  17  TYR B O   
1077 C CB  . TYR B 19  ? 0.4901 0.5715 0.7666 0.0191  -0.1142 0.1559  17  TYR B CB  
1078 C CG  . TYR B 19  ? 0.5804 0.6349 0.8551 0.0014  -0.1590 0.1398  17  TYR B CG  
1079 C CD1 . TYR B 19  ? 0.6629 0.7259 0.9752 0.0191  -0.1809 0.1426  17  TYR B CD1 
1080 C CD2 . TYR B 19  ? 0.6238 0.6481 0.8656 -0.0334 -0.1805 0.1209  17  TYR B CD2 
1081 C CE1 . TYR B 19  ? 0.6849 0.7222 1.0043 0.0031  -0.2322 0.1338  17  TYR B CE1 
1082 C CE2 . TYR B 19  ? 0.7197 0.7177 0.9519 -0.0554 -0.2285 0.1112  17  TYR B CE2 
1083 C CZ  . TYR B 19  ? 0.7127 0.7155 0.9860 -0.0365 -0.2580 0.1214  17  TYR B CZ  
1084 O OH  . TYR B 19  ? 0.7044 0.6802 0.9747 -0.0574 -0.3136 0.1174  17  TYR B OH  
1085 N N   . GLU B 20  ? 0.4623 0.5829 0.8874 0.0120  -0.0583 0.1885  18  GLU B N   
1086 C CA  . GLU B 20  ? 0.4712 0.5829 0.9618 -0.0032 -0.0541 0.1887  18  GLU B CA  
1087 C C   . GLU B 20  ? 0.4766 0.6166 1.0539 -0.0048 -0.0470 0.2125  18  GLU B C   
1088 O O   . GLU B 20  ? 0.4753 0.6036 1.1063 -0.0241 -0.0624 0.2021  18  GLU B O   
1089 C CB  . GLU B 20  ? 0.4767 0.5844 0.9712 0.0033  -0.0326 0.2023  18  GLU B CB  
1090 C CG  . GLU B 20  ? 0.5222 0.6155 1.0987 -0.0070 -0.0282 0.2088  18  GLU B CG  
1091 C CD  . GLU B 20  ? 0.5687 0.6259 1.1463 -0.0222 -0.0399 0.1638  18  GLU B CD  
1092 O OE1 . GLU B 20  ? 0.5955 0.6317 1.2423 -0.0293 -0.0392 0.1607  18  GLU B OE1 
1093 O OE2 . GLU B 20  ? 0.5836 0.6328 1.0918 -0.0292 -0.0489 0.1302  18  GLU B OE2 
1094 N N   . GLU B 21  ? 0.4953 0.6764 1.0855 0.0116  -0.0226 0.2424  19  GLU B N   
1095 C CA  . GLU B 21  ? 0.4746 0.6964 1.1496 0.0063  -0.0098 0.2654  19  GLU B CA  
1096 C C   . GLU B 21  ? 0.4409 0.6715 1.1548 0.0009  -0.0381 0.2432  19  GLU B C   
1097 O O   . GLU B 21  ? 0.4438 0.6904 1.2401 -0.0164 -0.0436 0.2506  19  GLU B O   
1098 C CB  . GLU B 21  ? 0.5484 0.8206 1.2149 0.0224  0.0257  0.2934  19  GLU B CB  
1099 C CG  . GLU B 21  ? 0.6542 0.9356 1.3379 0.0125  0.0521  0.3359  19  GLU B CG  
1100 C CD  . GLU B 21  ? 0.7751 1.1149 1.4471 0.0193  0.0896  0.3630  19  GLU B CD  
1101 O OE1 . GLU B 21  ? 0.7996 1.1919 1.5245 0.0191  0.1049  0.3603  19  GLU B OE1 
1102 O OE2 . GLU B 21  ? 0.8351 1.1720 1.4447 0.0239  0.1038  0.3841  19  GLU B OE2 
1103 N N   . VAL B 22  ? 0.4382 0.6562 1.0974 0.0134  -0.0617 0.2186  20  VAL B N   
1104 C CA  . VAL B 22  ? 0.4250 0.6472 1.1243 0.0088  -0.0988 0.2018  20  VAL B CA  
1105 C C   . VAL B 22  ? 0.4476 0.6288 1.1543 -0.0237 -0.1333 0.1849  20  VAL B C   
1106 O O   . VAL B 22  ? 0.4063 0.6007 1.1822 -0.0381 -0.1582 0.1829  20  VAL B O   
1107 C CB  . VAL B 22  ? 0.4036 0.6096 1.0407 0.0283  -0.1237 0.1837  20  VAL B CB  
1108 C CG1 . VAL B 22  ? 0.4082 0.5977 1.0717 0.0176  -0.1793 0.1680  20  VAL B CG1 
1109 C CG2 . VAL B 22  ? 0.3839 0.6396 1.0422 0.0607  -0.0912 0.1920  20  VAL B CG2 
1110 N N   . ILE B 23  ? 0.4685 0.6037 1.1077 -0.0371 -0.1342 0.1694  21  ILE B N   
1111 C CA  . ILE B 23  ? 0.4779 0.5738 1.1128 -0.0699 -0.1617 0.1437  21  ILE B CA  
1112 C C   . ILE B 23  ? 0.5005 0.6001 1.2219 -0.0849 -0.1486 0.1527  21  ILE B C   
1113 O O   . ILE B 23  ? 0.5668 0.6484 1.3190 -0.1123 -0.1770 0.1356  21  ILE B O   
1114 C CB  . ILE B 23  ? 0.5305 0.5855 1.0705 -0.0797 -0.1605 0.1168  21  ILE B CB  
1115 C CG1 . ILE B 23  ? 0.5457 0.5909 0.9984 -0.0732 -0.1798 0.1116  21  ILE B CG1 
1116 C CG2 . ILE B 23  ? 0.5802 0.5990 1.1115 -0.1156 -0.1817 0.0822  21  ILE B CG2 
1117 C CD1 . ILE B 23  ? 0.5486 0.5671 0.9110 -0.0849 -0.1721 0.0896  21  ILE B CD1 
1118 N N   . ARG B 24  ? 0.6680 0.6437 1.3158 -0.0837 0.0148  0.0663  22  ARG B N   
1119 C CA  . ARG B 24  ? 0.7758 0.6803 1.4421 -0.0937 0.0201  0.0687  22  ARG B CA  
1120 C C   . ARG B 24  ? 0.7661 0.6763 1.3900 -0.1329 0.0564  0.0666  22  ARG B C   
1121 O O   . ARG B 24  ? 0.6535 0.5745 1.2067 -0.1483 0.0622  0.0910  22  ARG B O   
1122 C CB  . ARG B 24  ? 0.7399 0.5518 1.3777 -0.0773 -0.0169 0.1161  22  ARG B CB  
1123 N N   . GLU B 25  ? 0.7508 0.6600 1.4221 -0.1502 0.0823  0.0325  23  GLU B N   
1124 C CA  . GLU B 25  ? 0.7503 0.6738 1.3882 -0.1903 0.1189  0.0239  23  GLU B CA  
1125 C C   . GLU B 25  ? 0.8448 0.6803 1.4183 -0.2096 0.1147  0.0660  23  GLU B C   
1126 O O   . GLU B 25  ? 0.8216 0.6780 1.3341 -0.2387 0.1345  0.0762  23  GLU B O   
1127 C CB  . GLU B 25  ? 0.7251 0.6705 1.4317 -0.2069 0.1482  -0.0265 23  GLU B CB  
1128 N N   . GLU B 26  ? 0.9591 0.6975 1.5435 -0.1940 0.0875  0.0917  24  GLU B N   
1129 C CA  . GLU B 26  ? 1.0746 0.7222 1.5926 -0.2175 0.0832  0.1348  24  GLU B CA  
1130 C C   . GLU B 26  ? 1.1039 0.7532 1.5386 -0.2172 0.0631  0.1801  24  GLU B C   
1131 O O   . GLU B 26  ? 1.1785 0.7901 1.5406 -0.2503 0.0717  0.2087  24  GLU B O   
1132 C CB  . GLU B 26  ? 1.1750 0.7117 1.7291 -0.1996 0.0570  0.1524  24  GLU B CB  
1133 N N   . SER B 27  ? 1.0410 0.7360 1.4835 -0.1844 0.0387  0.1841  25  SER B N   
1134 C CA  . SER B 27  ? 1.0260 0.7257 1.3943 -0.1839 0.0201  0.2221  25  SER B CA  
1135 C C   . SER B 27  ? 0.9589 0.7357 1.2823 -0.2106 0.0525  0.2076  25  SER B C   
1136 O O   . SER B 27  ? 0.9008 0.7561 1.2613 -0.2078 0.0743  0.1693  25  SER B O   
1137 C CB  . SER B 27  ? 1.0003 0.7269 1.3953 -0.1425 -0.0139 0.2256  25  SER B CB  
1138 O OG  . SER B 27  ? 1.0249 0.7511 1.3488 -0.1436 -0.0328 0.2614  25  SER B OG  
1139 N N   . ALA B 28  ? 0.9906 0.7479 1.2340 -0.2362 0.0541  0.2383  26  ALA B N   
1140 C CA  . ALA B 28  ? 0.9682 0.7986 1.1724 -0.2611 0.0852  0.2218  26  ALA B CA  
1141 C C   . ALA B 28  ? 0.9071 0.8146 1.1189 -0.2343 0.0787  0.2088  26  ALA B C   
1142 O O   . ALA B 28  ? 0.8577 0.8419 1.0781 -0.2391 0.1037  0.1796  26  ALA B O   
1143 C CB  . ALA B 28  ? 0.9245 0.7182 1.0426 -0.2977 0.0891  0.2539  26  ALA B CB  
1144 N N   . ALA B 29  ? 0.8767 0.7645 1.0847 -0.2064 0.0446  0.2306  27  ALA B N   
1145 C CA  . ALA B 29  ? 0.8018 0.7515 1.0096 -0.1849 0.0383  0.2207  27  ALA B CA  
1146 C C   . ALA B 29  ? 0.6962 0.7127 0.9647 -0.1710 0.0554  0.1808  27  ALA B C   
1147 O O   . ALA B 29  ? 0.7181 0.7281 1.0451 -0.1631 0.0563  0.1628  27  ALA B O   
1148 C CB  . ALA B 29  ? 0.7164 0.6340 0.9249 -0.1575 -0.0012 0.2446  27  ALA B CB  
1149 N N   . ASP B 30  ? 0.5966 0.6781 0.8501 -0.1704 0.0701  0.1661  28  ASP B N   
1150 C CA  . ASP B 30  ? 0.5340 0.6795 0.8346 -0.1577 0.0822  0.1348  28  ASP B CA  
1151 C C   . ASP B 30  ? 0.4942 0.6783 0.7826 -0.1380 0.0734  0.1337  28  ASP B C   
1152 O O   . ASP B 30  ? 0.4531 0.6913 0.7663 -0.1309 0.0844  0.1125  28  ASP B O   
1153 C CB  . ASP B 30  ? 0.5791 0.7732 0.8853 -0.1800 0.1155  0.1111  28  ASP B CB  
1154 C CG  . ASP B 30  ? 0.6411 0.8603 0.8925 -0.1964 0.1306  0.1162  28  ASP B CG  
1155 O OD1 . ASP B 30  ? 0.6207 0.8161 0.8266 -0.1941 0.1173  0.1377  28  ASP B OD1 
1156 O OD2 . ASP B 30  ? 0.6714 0.9415 0.9279 -0.2128 0.1565  0.0949  28  ASP B OD2 
1157 N N   . TRP B 31  ? 0.5120 0.6694 0.7603 -0.1311 0.0543  0.1561  29  TRP B N   
1158 C CA  . TRP B 31  ? 0.4872 0.6730 0.7323 -0.1119 0.0451  0.1517  29  TRP B CA  
1159 C C   . TRP B 31  ? 0.5085 0.6560 0.7333 -0.1015 0.0162  0.1731  29  TRP B C   
1160 O O   . TRP B 31  ? 0.5579 0.6647 0.7457 -0.1124 0.0055  0.1969  29  TRP B O   
1161 C CB  . TRP B 31  ? 0.4599 0.6864 0.6711 -0.1162 0.0630  0.1445  29  TRP B CB  
1162 C CG  . TRP B 31  ? 0.4883 0.6961 0.6433 -0.1330 0.0650  0.1600  29  TRP B CG  
1163 C CD1 . TRP B 31  ? 0.4875 0.6982 0.6180 -0.1583 0.0840  0.1600  29  TRP B CD1 
1164 C CD2 . TRP B 31  ? 0.5269 0.7169 0.6410 -0.1306 0.0496  0.1746  29  TRP B CD2 
1165 N NE1 . TRP B 31  ? 0.5958 0.7908 0.6707 -0.1734 0.0813  0.1746  29  TRP B NE1 
1166 C CE2 . TRP B 31  ? 0.5624 0.7455 0.6261 -0.1566 0.0601  0.1836  29  TRP B CE2 
1167 C CE3 . TRP B 31  ? 0.4783 0.6609 0.5920 -0.1129 0.0293  0.1786  29  TRP B CE3 
1168 C CZ2 . TRP B 31  ? 0.5736 0.7453 0.5866 -0.1655 0.0508  0.1964  29  TRP B CZ2 
1169 C CZ3 . TRP B 31  ? 0.5561 0.7265 0.6212 -0.1203 0.0198  0.1907  29  TRP B CZ3 
1170 C CH2 . TRP B 31  ? 0.6085 0.7744 0.6234 -0.1465 0.0303  0.1997  29  TRP B CH2 
1171 N N   . ALA B 32  ? 0.4813 0.6458 0.7258 -0.0832 0.0039  0.1647  30  ALA B N   
1172 C CA  . ALA B 32  ? 0.5073 0.6502 0.7346 -0.0734 -0.0225 0.1793  30  ALA B CA  
1173 C C   . ALA B 32  ? 0.5056 0.6799 0.7221 -0.0654 -0.0191 0.1669  30  ALA B C   
1174 O O   . ALA B 32  ? 0.4639 0.6688 0.7090 -0.0595 -0.0076 0.1477  30  ALA B O   
1175 C CB  . ALA B 32  ? 0.5171 0.6428 0.7934 -0.0587 -0.0453 0.1784  30  ALA B CB  
1176 N N   . LEU B 33  ? 0.5012 0.6656 0.6763 -0.0669 -0.0303 0.1779  31  LEU B N   
1177 C CA  . LEU B 33  ? 0.4566 0.6423 0.6162 -0.0621 -0.0244 0.1652  31  LEU B CA  
1178 C C   . LEU B 33  ? 0.4789 0.6561 0.6335 -0.0565 -0.0483 0.1689  31  LEU B C   
1179 O O   . LEU B 33  ? 0.5327 0.6910 0.6575 -0.0625 -0.0656 0.1872  31  LEU B O   
1180 C CB  . LEU B 33  ? 0.4788 0.6717 0.5919 -0.0729 -0.0079 0.1654  31  LEU B CB  
1181 C CG  . LEU B 33  ? 0.4593 0.6645 0.5535 -0.0676 -0.0029 0.1520  31  LEU B CG  
1182 C CD1 . LEU B 33  ? 0.3911 0.6164 0.5178 -0.0544 0.0101  0.1352  31  LEU B CD1 
1183 C CD2 . LEU B 33  ? 0.4714 0.6842 0.5214 -0.0799 0.0111  0.1495  31  LEU B CD2 
1184 N N   . TYR B 34  ? 0.4065 0.6007 0.5876 -0.0478 -0.0490 0.1517  32  TYR B N   
1185 C CA  . TYR B 34  ? 0.4135 0.6101 0.5976 -0.0443 -0.0681 0.1474  32  TYR B CA  
1186 C C   . TYR B 34  ? 0.5016 0.7055 0.6593 -0.0479 -0.0573 0.1343  32  TYR B C   
1187 O O   . TYR B 34  ? 0.4980 0.7059 0.6491 -0.0475 -0.0366 0.1262  32  TYR B O   
1188 C CB  . TYR B 34  ? 0.3852 0.5967 0.6255 -0.0360 -0.0769 0.1336  32  TYR B CB  
1189 C CG  . TYR B 34  ? 0.3865 0.5901 0.6649 -0.0304 -0.0832 0.1392  32  TYR B CG  
1190 C CD1 . TYR B 34  ? 0.4966 0.7071 0.7964 -0.0332 -0.0631 0.1322  32  TYR B CD1 
1191 C CD2 . TYR B 34  ? 0.4518 0.6393 0.7442 -0.0221 -0.1106 0.1518  32  TYR B CD2 
1192 C CE1 . TYR B 34  ? 0.4887 0.6878 0.8247 -0.0302 -0.0670 0.1340  32  TYR B CE1 
1193 C CE2 . TYR B 34  ? 0.4694 0.6401 0.7992 -0.0152 -0.1174 0.1566  32  TYR B CE2 
1194 C CZ  . TYR B 34  ? 0.5080 0.6830 0.8598 -0.0205 -0.0937 0.1460  32  TYR B CZ  
1195 O OH  . TYR B 34  ? 0.4208 0.5762 0.8112 -0.0162 -0.0969 0.1467  32  TYR B OH  
1196 N N   . THR B 35  ? 0.4309 0.6356 0.5734 -0.0512 -0.0727 0.1321  33  THR B N   
1197 C CA  . THR B 35  ? 0.4445 0.6506 0.5611 -0.0575 -0.0634 0.1175  33  THR B CA  
1198 C C   . THR B 35  ? 0.4721 0.6897 0.5945 -0.0613 -0.0836 0.1098  33  THR B C   
1199 O O   . THR B 35  ? 0.4776 0.7035 0.6199 -0.0564 -0.1071 0.1188  33  THR B O   
1200 C CB  . THR B 35  ? 0.5115 0.7099 0.5805 -0.0657 -0.0525 0.1208  33  THR B CB  
1201 O OG1 . THR B 35  ? 0.5478 0.7431 0.6015 -0.0690 -0.0393 0.1014  33  THR B OG1 
1202 C CG2 . THR B 35  ? 0.5452 0.7443 0.5833 -0.0759 -0.0724 0.1359  33  THR B CG2 
1203 N N   . TYR B 36  ? 0.4896 0.7078 0.5950 -0.0699 -0.0751 0.0923  34  TYR B N   
1204 C CA  . TYR B 36  ? 0.5551 0.7913 0.6646 -0.0774 -0.0922 0.0809  34  TYR B CA  
1205 C C   . TYR B 36  ? 0.6541 0.8964 0.7247 -0.0861 -0.1062 0.0890  34  TYR B C   
1206 O O   . TYR B 36  ? 0.7184 0.9489 0.7509 -0.0922 -0.0952 0.0953  34  TYR B O   
1207 C CB  . TYR B 36  ? 0.5336 0.7665 0.6400 -0.0885 -0.0766 0.0567  34  TYR B CB  
1208 C CG  . TYR B 36  ? 0.5066 0.7339 0.6418 -0.0852 -0.0628 0.0508  34  TYR B CG  
1209 C CD1 . TYR B 36  ? 0.4972 0.7481 0.6691 -0.0897 -0.0702 0.0379  34  TYR B CD1 
1210 C CD2 . TYR B 36  ? 0.4919 0.6964 0.6176 -0.0789 -0.0428 0.0568  34  TYR B CD2 
1211 C CE1 . TYR B 36  ? 0.4951 0.7454 0.6877 -0.0923 -0.0568 0.0323  34  TYR B CE1 
1212 C CE2 . TYR B 36  ? 0.4977 0.7006 0.6444 -0.0780 -0.0324 0.0545  34  TYR B CE2 
1213 C CZ  . TYR B 36  ? 0.4992 0.7243 0.6767 -0.0868 -0.0388 0.0429  34  TYR B CZ  
1214 O OH  . TYR B 36  ? 0.4837 0.7120 0.6777 -0.0912 -0.0279 0.0405  34  TYR B OH  
1215 N N   . GLU B 37  ? 0.6996 0.9668 0.7814 -0.0876 -0.1317 0.0877  35  GLU B N   
1216 C CA  . GLU B 37  ? 0.7720 1.0545 0.8151 -0.0999 -0.1473 0.0922  35  GLU B CA  
1217 C C   . GLU B 37  ? 0.7798 1.0671 0.7967 -0.1191 -0.1288 0.0637  35  GLU B C   
1218 O O   . GLU B 37  ? 0.7415 1.0259 0.7785 -0.1224 -0.1149 0.0414  35  GLU B O   
1219 C CB  . GLU B 37  ? 0.8027 1.1154 0.8721 -0.0917 -0.1838 0.0999  35  GLU B CB  
1220 C CG  . GLU B 37  ? 0.9089 1.2265 0.9407 -0.0953 -0.2094 0.1278  35  GLU B CG  
1221 C CD  . GLU B 37  ? 0.9617 1.2822 1.0291 -0.0737 -0.2450 0.1522  35  GLU B CD  
1222 O OE1 . GLU B 37  ? 0.9984 1.2927 1.0434 -0.0704 -0.2567 0.1855  35  GLU B OE1 
1223 O OE2 . GLU B 37  ? 0.9693 1.3165 1.0891 -0.0605 -0.2602 0.1365  35  GLU B OE2 
1224 N N   . ASP B 38  ? 0.8332 1.1259 0.8028 -0.1350 -0.1272 0.0636  36  ASP B N   
1225 C CA  . ASP B 38  ? 0.8564 1.1473 0.7996 -0.1543 -0.1048 0.0336  36  ASP B CA  
1226 C C   . ASP B 38  ? 0.8421 1.1559 0.8023 -0.1652 -0.1108 0.0088  36  ASP B C   
1227 O O   . ASP B 38  ? 0.8537 1.2053 0.8268 -0.1652 -0.1393 0.0133  36  ASP B O   
1228 C CB  . ASP B 38  ? 0.9668 1.2725 0.8587 -0.1732 -0.1051 0.0346  36  ASP B CB  
1229 C CG  . ASP B 38  ? 1.0545 1.3464 0.9265 -0.1681 -0.1021 0.0597  36  ASP B CG  
1230 O OD1 . ASP B 38  ? 1.0687 1.3335 0.9627 -0.1517 -0.0870 0.0653  36  ASP B OD1 
1231 O OD2 . ASP B 38  ? 1.0897 1.4007 0.9216 -0.1836 -0.1146 0.0735  36  ASP B OD2 
1232 N N   . GLY B 39  ? 0.7927 1.0831 0.7534 -0.1745 -0.0844 -0.0176 37  GLY B N   
1233 C CA  . GLY B 39  ? 0.8185 1.1260 0.7914 -0.1913 -0.0840 -0.0448 37  GLY B CA  
1234 C C   . GLY B 39  ? 0.7868 1.1228 0.8060 -0.1814 -0.1047 -0.0409 37  GLY B C   
1235 O O   . GLY B 39  ? 0.8360 1.2149 0.8672 -0.1936 -0.1196 -0.0583 37  GLY B O   
1236 N N   . SER B 40  ? 0.7205 1.0394 0.7690 -0.1602 -0.1051 -0.0221 38  SER B N   
1237 C CA  . SER B 40  ? 0.6881 1.0381 0.7862 -0.1477 -0.1257 -0.0190 38  SER B CA  
1238 C C   . SER B 40  ? 0.6205 0.9431 0.7444 -0.1349 -0.1110 -0.0107 38  SER B C   
1239 O O   . SER B 40  ? 0.5912 0.8750 0.6948 -0.1296 -0.0922 0.0011  38  SER B O   
1240 C CB  . SER B 40  ? 0.7644 1.1406 0.8719 -0.1305 -0.1594 0.0052  38  SER B CB  
1241 O OG  . SER B 40  ? 0.7903 1.1872 0.9536 -0.1122 -0.1770 0.0080  38  SER B OG  
1242 N N   . ASP B 41  ? 0.5961 0.9461 0.7672 -0.1314 -0.1192 -0.0206 39  ASP B N   
1243 C CA  . ASP B 41  ? 0.5354 0.8723 0.7358 -0.1211 -0.1085 -0.0143 39  ASP B CA  
1244 C C   . ASP B 41  ? 0.4470 0.8003 0.6871 -0.0974 -0.1297 0.0019  39  ASP B C   
1245 O O   . ASP B 41  ? 0.4090 0.7642 0.6838 -0.0906 -0.1231 0.0007  39  ASP B O   
1246 C CB  . ASP B 41  ? 0.5783 0.9329 0.8025 -0.1396 -0.0966 -0.0408 39  ASP B CB  
1247 C CG  . ASP B 41  ? 0.6616 0.9740 0.8463 -0.1595 -0.0688 -0.0464 39  ASP B CG  
1248 O OD1 . ASP B 41  ? 0.6625 0.9330 0.8111 -0.1528 -0.0580 -0.0308 39  ASP B OD1 
1249 O OD2 . ASP B 41  ? 0.7010 1.0216 0.8915 -0.1824 -0.0580 -0.0671 39  ASP B OD2 
1250 N N   . ASP B 42  ? 0.4702 0.8333 0.7047 -0.0860 -0.1550 0.0174  40  ASP B N   
1251 C CA  . ASP B 42  ? 0.5357 0.9034 0.8076 -0.0628 -0.1764 0.0348  40  ASP B CA  
1252 C C   . ASP B 42  ? 0.5398 0.8645 0.7856 -0.0553 -0.1653 0.0629  40  ASP B C   
1253 O O   . ASP B 42  ? 0.5702 0.8736 0.7646 -0.0625 -0.1593 0.0769  40  ASP B O   
1254 C CB  . ASP B 42  ? 0.6838 1.0784 0.9646 -0.0518 -0.2136 0.0435  40  ASP B CB  
1255 C CG  . ASP B 42  ? 0.7844 1.1907 1.1279 -0.0256 -0.2379 0.0490  40  ASP B CG  
1256 O OD1 . ASP B 42  ? 0.8178 1.1883 1.1640 -0.0124 -0.2380 0.0732  40  ASP B OD1 
1257 O OD2 . ASP B 42  ? 0.8025 1.2548 1.1965 -0.0188 -0.2555 0.0256  40  ASP B OD2 
1258 N N   . LEU B 43  ? 0.3940 0.7976 0.5889 -0.1076 -0.0852 0.0946  41  LEU B N   
1259 C CA  . LEU B 43  ? 0.3714 0.7659 0.5787 -0.0936 -0.0804 0.1104  41  LEU B CA  
1260 C C   . LEU B 43  ? 0.4464 0.8736 0.6561 -0.1015 -0.0973 0.1397  41  LEU B C   
1261 O O   . LEU B 43  ? 0.4486 0.8997 0.6744 -0.1060 -0.1220 0.1554  41  LEU B O   
1262 C CB  . LEU B 43  ? 0.3139 0.6896 0.5636 -0.0725 -0.0861 0.1142  41  LEU B CB  
1263 C CG  . LEU B 43  ? 0.3540 0.7031 0.6121 -0.0560 -0.0720 0.1126  41  LEU B CG  
1264 C CD1 . LEU B 43  ? 0.3868 0.7072 0.6121 -0.0567 -0.0486 0.0895  41  LEU B CD1 
1265 C CD2 . LEU B 43  ? 0.2712 0.6083 0.5674 -0.0406 -0.0817 0.1136  41  LEU B CD2 
1266 N N   . LYS B 44  ? 0.4176 0.8469 0.6122 -0.1038 -0.0842 0.1476  42  LYS B N   
1267 C CA  . LYS B 44  ? 0.3750 0.8313 0.5665 -0.1146 -0.0970 0.1787  42  LYS B CA  
1268 C C   . LYS B 44  ? 0.4310 0.8774 0.6455 -0.1029 -0.0878 0.1903  42  LYS B C   
1269 O O   . LYS B 44  ? 0.4193 0.8456 0.6391 -0.0900 -0.0667 0.1700  42  LYS B O   
1270 C CB  . LYS B 44  ? 0.3948 0.8774 0.5319 -0.1411 -0.0873 0.1746  42  LYS B CB  
1271 C CG  . LYS B 44  ? 0.4860 0.9655 0.5953 -0.1456 -0.0534 0.1532  42  LYS B CG  
1272 C CD  . LYS B 44  ? 0.6115 1.1256 0.6653 -0.1767 -0.0457 0.1500  42  LYS B CD  
1273 C CE  . LYS B 44  ? 0.6929 1.2154 0.7243 -0.1834 -0.0114 0.1306  42  LYS B CE  
1274 N NZ  . LYS B 44  ? 0.7446 1.2508 0.7527 -0.1840 0.0168  0.0837  42  LYS B NZ  
1275 N N   . LEU B 45  ? 0.4173 0.8773 0.6479 -0.1077 -0.1056 0.2244  43  LEU B N   
1276 C CA  . LEU B 45  ? 0.3933 0.8482 0.6471 -0.1014 -0.0975 0.2366  43  LEU B CA  
1277 C C   . LEU B 45  ? 0.3939 0.8715 0.6085 -0.1202 -0.0731 0.2332  43  LEU B C   
1278 O O   . LEU B 45  ? 0.4107 0.9140 0.5879 -0.1445 -0.0776 0.2485  43  LEU B O   
1279 C CB  . LEU B 45  ? 0.3726 0.8275 0.6612 -0.1013 -0.1253 0.2740  43  LEU B CB  
1280 C CG  . LEU B 45  ? 0.3637 0.8230 0.6643 -0.1085 -0.1196 0.2962  43  LEU B CG  
1281 C CD1 . LEU B 45  ? 0.2776 0.7169 0.6188 -0.0868 -0.1091 0.2788  43  LEU B CD1 
1282 C CD2 . LEU B 45  ? 0.3390 0.7960 0.6571 -0.1178 -0.1489 0.3386  43  LEU B CD2 
1283 N N   . ALA B 46  ? 0.4080 0.8795 0.6324 -0.1095 -0.0479 0.2127  44  ALA B N   
1284 C CA  . ALA B 46  ? 0.4337 0.9308 0.6286 -0.1248 -0.0198 0.2010  44  ALA B CA  
1285 C C   . ALA B 46  ? 0.4493 0.9672 0.6601 -0.1355 -0.0177 0.2271  44  ALA B C   
1286 O O   . ALA B 46  ? 0.5431 1.0931 0.7195 -0.1627 -0.0079 0.2381  44  ALA B O   
1287 C CB  . ALA B 46  ? 0.3493 0.8311 0.5513 -0.1059 0.0069  0.1613  44  ALA B CB  
1288 N N   . ALA B 47  ? 0.4011 0.9032 0.6612 -0.1181 -0.0262 0.2368  45  ALA B N   
1289 C CA  . ALA B 47  ? 0.4273 0.9478 0.7058 -0.1310 -0.0245 0.2617  45  ALA B CA  
1290 C C   . ALA B 47  ? 0.4138 0.9082 0.7477 -0.1111 -0.0431 0.2721  45  ALA B C   
1291 O O   . ALA B 47  ? 0.3652 0.8321 0.7181 -0.0889 -0.0551 0.2589  45  ALA B O   
1292 C CB  . ALA B 47  ? 0.4296 0.9814 0.7039 -0.1373 0.0106  0.2400  45  ALA B CB  
1293 N N   . SER B 48  ? 0.4153 0.9197 0.7729 -0.1228 -0.0454 0.2956  46  SER B N   
1294 C CA  . SER B 48  ? 0.4150 0.8967 0.8252 -0.1078 -0.0611 0.3027  46  SER B CA  
1295 C C   . SER B 48  ? 0.4461 0.9437 0.8671 -0.1265 -0.0526 0.3201  46  SER B C   
1296 O O   . SER B 48  ? 0.5334 1.0622 0.9271 -0.1567 -0.0436 0.3410  46  SER B O   
1297 C CB  . SER B 48  ? 0.4967 0.9365 0.9129 -0.1000 -0.0927 0.3194  46  SER B CB  
1298 O OG  . SER B 48  ? 0.5544 1.0106 0.9621 -0.1261 -0.1101 0.3605  46  SER B OG  
1299 N N   . GLY B 49  ? 0.4257 0.8982 0.8778 -0.1110 -0.0550 0.3095  47  GLY B N   
1300 C CA  . GLY B 49  ? 0.4235 0.9140 0.8887 -0.1282 -0.0445 0.3193  47  GLY B CA  
1301 C C   . GLY B 49  ? 0.4175 0.8783 0.9175 -0.1104 -0.0510 0.3047  47  GLY B C   
1302 O O   . GLY B 49  ? 0.2806 0.7001 0.7873 -0.0876 -0.0648 0.2900  47  GLY B O   
1303 N N   . GLU B 50  ? 0.4448 0.9281 0.9603 -0.1247 -0.0384 0.3058  48  GLU B N   
1304 C CA  . GLU B 50  ? 0.4613 0.9237 1.0092 -0.1180 -0.0458 0.2984  48  GLU B CA  
1305 C C   . GLU B 50  ? 0.4995 0.9857 1.0654 -0.1058 -0.0276 0.2639  48  GLU B C   
1306 O O   . GLU B 50  ? 0.5724 1.0470 1.1632 -0.1027 -0.0338 0.2558  48  GLU B O   
1307 C CB  . GLU B 50  ? 0.5217 0.9853 1.0796 -0.1481 -0.0528 0.3327  48  GLU B CB  
1308 C CG  . GLU B 50  ? 0.6432 1.1025 1.1749 -0.1688 -0.0659 0.3720  48  GLU B CG  
1309 C CD  . GLU B 50  ? 0.7612 1.2160 1.2948 -0.2002 -0.0740 0.4078  48  GLU B CD  
1310 O OE1 . GLU B 50  ? 0.8094 1.2510 1.3224 -0.2163 -0.0924 0.4442  48  GLU B OE1 
1311 O OE2 . GLU B 50  ? 0.7913 1.2549 1.3454 -0.2094 -0.0632 0.3993  48  GLU B OE2 
1312 N N   . GLY B 51  ? 0.4186 0.9391 0.9767 -0.0991 -0.0067 0.2428  49  GLY B N   
1313 C CA  . GLY B 51  ? 0.3761 0.9231 0.9615 -0.0891 0.0073  0.2138  49  GLY B CA  
1314 C C   . GLY B 51  ? 0.2950 0.8170 0.8873 -0.0568 -0.0025 0.1851  49  GLY B C   
1315 O O   . GLY B 51  ? 0.2547 0.8026 0.8692 -0.0457 0.0067  0.1608  49  GLY B O   
1316 N N   . GLY B 52  ? 0.2874 0.7613 0.8590 -0.0428 -0.0207 0.1863  50  GLY B N   
1317 C CA  . GLY B 52  ? 0.2681 0.7166 0.8316 -0.0170 -0.0284 0.1610  50  GLY B CA  
1318 C C   . GLY B 52  ? 0.2760 0.7408 0.8341 -0.0002 -0.0162 0.1431  50  GLY B C   
1319 O O   . GLY B 52  ? 0.2850 0.7716 0.8374 -0.0069 -0.0025 0.1492  50  GLY B O   
1320 N N   . LEU B 53  ? 0.2646 0.7183 0.8236 0.0211  -0.0221 0.1218  51  LEU B N   
1321 C CA  . LEU B 53  ? 0.2795 0.7372 0.8358 0.0410  -0.0153 0.1062  51  LEU B CA  
1322 C C   . LEU B 53  ? 0.2782 0.7890 0.8640 0.0393  0.0086  0.0981  51  LEU B C   
1323 O O   . LEU B 53  ? 0.2777 0.7964 0.8603 0.0464  0.0216  0.0923  51  LEU B O   
1324 C CB  . LEU B 53  ? 0.2170 0.6596 0.7726 0.0620  -0.0279 0.0902  51  LEU B CB  
1325 C CG  . LEU B 53  ? 0.2369 0.6306 0.7567 0.0652  -0.0452 0.0924  51  LEU B CG  
1326 C CD1 . LEU B 53  ? 0.2365 0.6260 0.7562 0.0818  -0.0571 0.0810  51  LEU B CD1 
1327 C CD2 . LEU B 53  ? 0.2076 0.5756 0.7015 0.0679  -0.0433 0.0960  51  LEU B CD2 
1328 N N   . GLN B 54  ? 0.2848 0.8354 0.9010 0.0290  0.0173  0.0944  52  GLN B N   
1329 C CA  . GLN B 54  ? 0.2997 0.9064 0.9467 0.0276  0.0438  0.0786  52  GLN B CA  
1330 C C   . GLN B 54  ? 0.3151 0.9433 0.9462 0.0036  0.0653  0.0921  52  GLN B C   
1331 O O   . GLN B 54  ? 0.3081 0.9669 0.9458 0.0074  0.0896  0.0760  52  GLN B O   
1332 C CB  . GLN B 54  ? 0.3264 0.9738 1.0097 0.0186  0.0484  0.0698  52  GLN B CB  
1333 C CG  . GLN B 54  ? 0.3911 1.0935 1.1160 0.0327  0.0680  0.0390  52  GLN B CG  
1334 C CD  . GLN B 54  ? 0.5048 1.1907 1.2301 0.0717  0.0564  0.0225  52  GLN B CD  
1335 O OE1 . GLN B 54  ? 0.4840 1.1882 1.2182 0.0865  0.0743  0.0072  52  GLN B OE1 
1336 N NE2 . GLN B 54  ? 0.6479 1.2970 1.3595 0.0875  0.0278  0.0280  52  GLN B NE2 
1337 N N   . GLU B 55  ? 0.3122 0.9248 0.9187 -0.0214 0.0564  0.1215  53  GLU B N   
1338 C CA  . GLU B 55  ? 0.2687 0.8997 0.8463 -0.0464 0.0709  0.1392  53  GLU B CA  
1339 C C   . GLU B 55  ? 0.2923 0.9024 0.8444 -0.0333 0.0683  0.1370  53  GLU B C   
1340 O O   . GLU B 55  ? 0.3438 0.9848 0.8795 -0.0422 0.0910  0.1299  53  GLU B O   
1341 C CB  . GLU B 55  ? 0.2804 0.8942 0.8393 -0.0735 0.0554  0.1746  53  GLU B CB  
1342 C CG  . GLU B 55  ? 0.4356 1.0593 0.9530 -0.1015 0.0603  0.2003  53  GLU B CG  
1343 C CD  . GLU B 55  ? 0.5260 1.2030 1.0284 -0.1297 0.0919  0.1961  53  GLU B CD  
1344 O OE1 . GLU B 55  ? 0.5556 1.2621 1.0865 -0.1354 0.1080  0.1826  53  GLU B OE1 
1345 O OE2 . GLU B 55  ? 0.5636 1.2529 1.0215 -0.1480 0.1008  0.2042  53  GLU B OE2 
1346 N N   . LEU B 56  ? 0.2473 0.8055 0.7912 -0.0146 0.0426  0.1399  54  LEU B N   
1347 C CA  . LEU B 56  ? 0.2616 0.7969 0.7820 -0.0046 0.0380  0.1389  54  LEU B CA  
1348 C C   . LEU B 56  ? 0.2933 0.8496 0.8271 0.0144  0.0598  0.1127  54  LEU B C   
1349 O O   . LEU B 56  ? 0.3351 0.8790 0.8298 0.0098  0.0691  0.1040  54  LEU B O   
1350 C CB  . LEU B 56  ? 0.2394 0.7159 0.7478 0.0111  0.0104  0.1398  54  LEU B CB  
1351 C CG  . LEU B 56  ? 0.2218 0.6709 0.7120 0.0261  0.0059  0.1314  54  LEU B CG  
1352 C CD1 . LEU B 56  ? 0.2041 0.6642 0.6717 0.0078  0.0072  0.1474  54  LEU B CD1 
1353 C CD2 . LEU B 56  ? 0.1964 0.5918 0.6699 0.0380  -0.0163 0.1268  54  LEU B CD2 
1354 N N   . SER B 57  ? 0.2754 0.8382 0.8425 0.0354  0.0645  0.0906  55  SER B N   
1355 C CA  . SER B 57  ? 0.3351 0.9104 0.9231 0.0593  0.0840  0.0638  55  SER B CA  
1356 C C   . SER B 57  ? 0.3695 0.9765 0.9338 0.0415  0.1168  0.0448  55  SER B C   
1357 O O   . SER B 57  ? 0.3975 0.9882 0.9500 0.0554  0.1311  0.0171  55  SER B O   
1358 C CB  . SER B 57  ? 0.4306 1.0123 1.0558 0.0818  0.0801  0.0427  55  SER B CB  
1359 O OG  . SER B 57  ? 0.4870 1.0221 1.0995 0.0939  0.0477  0.0509  55  SER B OG  
1360 N N   . GLY B 58  ? 0.3633 1.0132 0.9180 0.0092  0.1291  0.0581  56  GLY B N   
1361 C CA  . GLY B 58  ? 0.3237 1.0095 0.8498 -0.0124 0.1616  0.0388  56  GLY B CA  
1362 C C   . GLY B 58  ? 0.3574 1.0157 0.8159 -0.0302 0.1616  0.0409  56  GLY B C   
1363 O O   . GLY B 58  ? 0.4311 1.1113 0.8623 -0.0427 0.1889  0.0152  56  GLY B O   
1364 N N   . HIS B 59  ? 0.3276 0.9404 0.7614 -0.0303 0.1324  0.0661  57  HIS B N   
1365 C CA  . HIS B 59  ? 0.3609 0.9544 0.7343 -0.0498 0.1283  0.0718  57  HIS B CA  
1366 C C   . HIS B 59  ? 0.3804 0.9255 0.7373 -0.0289 0.1243  0.0494  57  HIS B C   
1367 O O   . HIS B 59  ? 0.3932 0.9220 0.7029 -0.0444 0.1194  0.0513  57  HIS B O   
1368 C CB  . HIS B 59  ? 0.3620 0.9422 0.7215 -0.0667 0.0985  0.1143  57  HIS B CB  
1369 C CG  . HIS B 59  ? 0.4070 1.0257 0.7771 -0.0919 0.1002  0.1412  57  HIS B CG  
1370 N ND1 . HIS B 59  ? 0.4723 1.1160 0.7984 -0.1284 0.1041  0.1617  57  HIS B ND1 
1371 C CD2 . HIS B 59  ? 0.4097 1.0463 0.8279 -0.0888 0.0981  0.1519  57  HIS B CD2 
1372 C CE1 . HIS B 59  ? 0.4741 1.1453 0.8194 -0.1474 0.1049  0.1859  57  HIS B CE1 
1373 N NE2 . HIS B 59  ? 0.4453 1.1135 0.8482 -0.1242 0.1021  0.1788  57  HIS B NE2 
1374 N N   . PHE B 60  ? 0.3675 0.8899 0.7617 0.0040  0.1253  0.0293  58  PHE B N   
1375 C CA  . PHE B 60  ? 0.3919 0.8636 0.7693 0.0213  0.1226  0.0095  58  PHE B CA  
1376 C C   . PHE B 60  ? 0.4724 0.9531 0.8282 0.0155  0.1533  -0.0283 58  PHE B C   
1377 O O   . PHE B 60  ? 0.5037 1.0292 0.8776 0.0120  0.1791  -0.0479 58  PHE B O   
1378 C CB  . PHE B 60  ? 0.3694 0.8095 0.7904 0.0570  0.1100  0.0055  58  PHE B CB  
1379 C CG  . PHE B 60  ? 0.3482 0.7701 0.7802 0.0614  0.0794  0.0363  58  PHE B CG  
1380 C CD1 . PHE B 60  ? 0.3174 0.7071 0.7138 0.0504  0.0616  0.0511  58  PHE B CD1 
1381 C CD2 . PHE B 60  ? 0.3323 0.7727 0.8130 0.0759  0.0689  0.0470  58  PHE B CD2 
1382 C CE1 . PHE B 60  ? 0.2752 0.6515 0.6841 0.0539  0.0363  0.0739  58  PHE B CE1 
1383 C CE2 . PHE B 60  ? 0.2813 0.7058 0.7706 0.0779  0.0419  0.0708  58  PHE B CE2 
1384 C CZ  . PHE B 60  ? 0.2674 0.6594 0.7209 0.0673  0.0268  0.0830  58  PHE B CZ  
1385 N N   . GLU B 61  ? 0.5378 0.9800 0.8532 0.0104  0.1519  -0.0403 59  GLU B N   
1386 C CA  . GLU B 61  ? 0.5929 1.0365 0.8815 0.0015  0.1795  -0.0791 59  GLU B CA  
1387 C C   . GLU B 61  ? 0.6022 0.9836 0.8989 0.0272  0.1788  -0.1031 59  GLU B C   
1388 O O   . GLU B 61  ? 0.6429 0.9776 0.9319 0.0348  0.1548  -0.0849 59  GLU B O   
1389 C CB  . GLU B 61  ? 0.6425 1.1005 0.8689 -0.0363 0.1782  -0.0716 59  GLU B CB  
1390 C CG  . GLU B 61  ? 0.6765 1.1842 0.8933 -0.0615 0.1703  -0.0367 59  GLU B CG  
1391 C CD  . GLU B 61  ? 0.7814 1.3028 0.9388 -0.0970 0.1617  -0.0224 59  GLU B CD  
1392 O OE1 . GLU B 61  ? 0.8452 1.3539 0.9653 -0.1078 0.1713  -0.0490 59  GLU B OE1 
1393 O OE2 . GLU B 61  ? 0.8050 1.3494 0.9544 -0.1145 0.1434  0.0160  59  GLU B OE2 
1394 N N   . ASN B 62  ? 0.6496 1.0300 0.9627 0.0395  0.2056  -0.1444 60  ASN B N   
1395 C CA  . ASN B 62  ? 0.6869 1.0038 1.0154 0.0666  0.2058  -0.1678 60  ASN B CA  
1396 C C   . ASN B 62  ? 0.7312 1.0034 1.0055 0.0468  0.2065  -0.1814 60  ASN B C   
1397 O O   . ASN B 62  ? 0.7752 0.9832 1.0539 0.0640  0.2013  -0.1924 60  ASN B O   
1398 C CB  . ASN B 62  ? 0.7220 1.0553 1.0965 0.0889  0.2347  -0.2105 60  ASN B CB  
1399 C CG  . ASN B 62  ? 0.7005 1.0624 1.1426 0.1186  0.2278  -0.1984 60  ASN B CG  
1400 O OD1 . ASN B 62  ? 0.6892 1.0193 1.1539 0.1401  0.1987  -0.1693 60  ASN B OD1 
1401 N ND2 . ASN B 62  ? 0.6954 1.1226 1.1686 0.1167  0.2545  -0.2211 60  ASN B ND2 
1402 N N   . GLN B 63  ? 0.7296 1.0333 0.9532 0.0099  0.2112  -0.1793 61  GLN B N   
1403 C CA  . GLN B 63  ? 0.7483 1.0179 0.9217 -0.0121 0.2107  -0.1929 61  GLN B CA  
1404 C C   . GLN B 63  ? 0.7178 0.9702 0.8666 -0.0245 0.1790  -0.1541 61  GLN B C   
1405 O O   . GLN B 63  ? 0.7745 1.0003 0.8858 -0.0434 0.1753  -0.1624 61  GLN B O   
1406 C CB  . GLN B 63  ? 0.7855 1.1045 0.9159 -0.0473 0.2346  -0.2189 61  GLN B CB  
1407 N N   . LYS B 64  ? 0.6168 0.8824 0.7906 -0.0134 0.1570  -0.1156 62  LYS B N   
1408 C CA  . LYS B 64  ? 0.5653 0.8287 0.7213 -0.0266 0.1295  -0.0817 62  LYS B CA  
1409 C C   . LYS B 64  ? 0.5684 0.7949 0.7557 -0.0013 0.1084  -0.0597 62  LYS B C   
1410 O O   . LYS B 64  ? 0.5651 0.7873 0.7922 0.0248  0.1094  -0.0581 62  LYS B O   
1411 C CB  . LYS B 64  ? 0.5303 0.8528 0.6814 -0.0448 0.1207  -0.0537 62  LYS B CB  
1412 C CG  . LYS B 64  ? 0.5974 0.9642 0.7087 -0.0760 0.1367  -0.0667 62  LYS B CG  
1413 C CD  . LYS B 64  ? 0.6612 1.0422 0.7353 -0.1032 0.1158  -0.0461 62  LYS B CD  
1414 C CE  . LYS B 64  ? 0.7216 1.1600 0.7614 -0.1343 0.1212  -0.0388 62  LYS B CE  
1415 N NZ  . LYS B 64  ? 0.7191 1.1912 0.7831 -0.1324 0.1142  -0.0056 62  LYS B NZ  
1416 N N   . VAL B 65  ? 0.3359 0.6486 0.5166 -0.0417 0.1290  0.0388  63  VAL B N   
1417 C CA  . VAL B 65  ? 0.3600 0.6708 0.5201 -0.0547 0.1148  0.0219  63  VAL B CA  
1418 C C   . VAL B 65  ? 0.3700 0.6988 0.5728 -0.0476 0.1046  0.0067  63  VAL B C   
1419 O O   . VAL B 65  ? 0.3600 0.6992 0.5799 -0.0394 0.1121  -0.0069 63  VAL B O   
1420 C CB  . VAL B 65  ? 0.3777 0.6872 0.4785 -0.0776 0.1298  -0.0020 63  VAL B CB  
1421 C CG1 . VAL B 65  ? 0.3858 0.7019 0.4667 -0.0955 0.1183  -0.0259 63  VAL B CG1 
1422 C CG2 . VAL B 65  ? 0.3180 0.5904 0.3613 -0.0887 0.1330  0.0171  63  VAL B CG2 
1423 N N   . MET B 66  ? 0.3686 0.6949 0.5874 -0.0486 0.0834  0.0094  64  MET B N   
1424 C CA  . MET B 66  ? 0.3727 0.7048 0.6266 -0.0428 0.0688  -0.0022 64  MET B CA  
1425 C C   . MET B 66  ? 0.4090 0.7445 0.6563 -0.0515 0.0506  -0.0183 64  MET B C   
1426 O O   . MET B 66  ? 0.4696 0.7981 0.6921 -0.0609 0.0451  -0.0107 64  MET B O   
1427 C CB  . MET B 66  ? 0.3663 0.6917 0.6585 -0.0373 0.0622  0.0226  64  MET B CB  
1428 C CG  . MET B 66  ? 0.3820 0.7075 0.6813 -0.0325 0.0811  0.0409  64  MET B CG  
1429 S SD  . MET B 66  ? 0.4547 0.7792 0.7925 -0.0383 0.0785  0.0610  64  MET B SD  
1430 C CE  . MET B 66  ? 0.4448 0.7407 0.7712 -0.0361 0.0775  0.0535  64  MET B CE  
1431 N N   . TYR B 67  ? 0.3873 0.7280 0.6546 -0.0469 0.0368  -0.0412 65  TYR B N   
1432 C CA  . TYR B 67  ? 0.3460 0.6935 0.6134 -0.0536 0.0184  -0.0604 65  TYR B CA  
1433 C C   . TYR B 67  ? 0.3418 0.6740 0.6450 -0.0460 -0.0043 -0.0531 65  TYR B C   
1434 O O   . TYR B 67  ? 0.3671 0.6853 0.6833 -0.0355 -0.0126 -0.0623 65  TYR B O   
1435 C CB  . TYR B 67  ? 0.2969 0.6701 0.5515 -0.0572 0.0215  -0.1074 65  TYR B CB  
1436 C CG  . TYR B 67  ? 0.3123 0.7001 0.5246 -0.0733 0.0481  -0.1174 65  TYR B CG  
1437 C CD1 . TYR B 67  ? 0.3535 0.7330 0.5175 -0.0974 0.0538  -0.1090 65  TYR B CD1 
1438 C CD2 . TYR B 67  ? 0.3144 0.7149 0.5274 -0.0662 0.0658  -0.1316 65  TYR B CD2 
1439 C CE1 . TYR B 67  ? 0.4309 0.8110 0.5410 -0.1197 0.0774  -0.1161 65  TYR B CE1 
1440 C CE2 . TYR B 67  ? 0.3561 0.7686 0.5258 -0.0860 0.0926  -0.1410 65  TYR B CE2 
1441 C CZ  . TYR B 67  ? 0.4281 0.8277 0.5426 -0.1153 0.0988  -0.1325 65  TYR B CZ  
1442 O OH  . TYR B 67  ? 0.4317 0.8310 0.4883 -0.1425 0.1238  -0.1405 65  TYR B OH  
1443 N N   . GLY B 68  ? 0.3242 0.6533 0.6379 -0.0527 -0.0169 -0.0378 66  GLY B N   
1444 C CA  . GLY B 68  ? 0.3256 0.6396 0.6672 -0.0532 -0.0366 -0.0312 66  GLY B CA  
1445 C C   . GLY B 68  ? 0.3701 0.6889 0.7143 -0.0557 -0.0581 -0.0546 66  GLY B C   
1446 O O   . GLY B 68  ? 0.4710 0.8040 0.8043 -0.0630 -0.0596 -0.0564 66  GLY B O   
1447 N N   . PHE B 69  ? 0.3543 0.6551 0.7086 -0.0492 -0.0781 -0.0731 67  PHE B N   
1448 C CA  . PHE B 69  ? 0.4278 0.7312 0.7901 -0.0500 -0.1019 -0.0964 67  PHE B CA  
1449 C C   . PHE B 69  ? 0.4679 0.7447 0.8466 -0.0589 -0.1199 -0.0763 67  PHE B C   
1450 O O   . PHE B 69  ? 0.5086 0.7492 0.8866 -0.0619 -0.1259 -0.0617 67  PHE B O   
1451 C CB  . PHE B 69  ? 0.5144 0.8159 0.8782 -0.0345 -0.1196 -0.1396 67  PHE B CB  
1452 C CG  . PHE B 69  ? 0.6043 0.9497 0.9562 -0.0346 -0.1030 -0.1732 67  PHE B CG  
1453 C CD1 . PHE B 69  ? 0.6855 1.0424 1.0239 -0.0318 -0.0788 -0.1741 67  PHE B CD1 
1454 C CD2 . PHE B 69  ? 0.6304 1.0079 0.9796 -0.0435 -0.1076 -0.2039 67  PHE B CD2 
1455 C CE1 . PHE B 69  ? 0.7149 1.1151 1.0358 -0.0403 -0.0592 -0.2083 67  PHE B CE1 
1456 C CE2 . PHE B 69  ? 0.7084 1.1293 1.0380 -0.0542 -0.0876 -0.2383 67  PHE B CE2 
1457 C CZ  . PHE B 69  ? 0.7462 1.1789 1.0601 -0.0544 -0.0624 -0.2412 67  PHE B CZ  
1458 N N   . CYS B 70  ? 0.4377 0.7300 0.8256 -0.0672 -0.1284 -0.0768 68  CYS B N   
1459 C CA  . CYS B 70  ? 0.4380 0.7130 0.8431 -0.0799 -0.1427 -0.0614 68  CYS B CA  
1460 C C   . CYS B 70  ? 0.4569 0.7355 0.8691 -0.0804 -0.1664 -0.0831 68  CYS B C   
1461 O O   . CYS B 70  ? 0.4788 0.7877 0.8869 -0.0790 -0.1642 -0.0964 68  CYS B O   
1462 C CB  . CYS B 70  ? 0.4454 0.7440 0.8654 -0.0906 -0.1270 -0.0356 68  CYS B CB  
1463 S SG  . CYS B 70  ? 0.5347 0.8235 0.9784 -0.1131 -0.1400 -0.0256 68  CYS B SG  
1464 N N   . SER B 71  ? 0.4677 0.7094 0.8836 -0.0855 -0.1904 -0.0865 69  SER B N   
1465 C CA  . SER B 71  ? 0.4815 0.7234 0.9070 -0.0868 -0.2152 -0.1060 69  SER B CA  
1466 C C   . SER B 71  ? 0.4982 0.7516 0.9413 -0.1070 -0.2129 -0.0847 69  SER B C   
1467 O O   . SER B 71  ? 0.4850 0.7225 0.9308 -0.1248 -0.2055 -0.0624 69  SER B O   
1468 C CB  . SER B 71  ? 0.5180 0.7057 0.9332 -0.0796 -0.2488 -0.1248 69  SER B CB  
1469 O OG  . SER B 71  ? 0.5529 0.7376 0.9784 -0.0816 -0.2744 -0.1428 69  SER B OG  
1470 N N   . VAL B 72  ? 0.5131 0.7985 0.9676 -0.1066 -0.2185 -0.0953 70  VAL B N   
1471 C CA  . VAL B 72  ? 0.5610 0.8695 1.0374 -0.1201 -0.2180 -0.0823 70  VAL B CA  
1472 C C   . VAL B 72  ? 0.5699 0.8804 1.0547 -0.1223 -0.2421 -0.1015 70  VAL B C   
1473 O O   . VAL B 72  ? 0.5405 0.8614 1.0142 -0.1113 -0.2496 -0.1241 70  VAL B O   
1474 C CB  . VAL B 72  ? 0.4099 0.7548 0.8861 -0.1133 -0.2021 -0.0730 70  VAL B CB  
1475 C CG1 . VAL B 72  ? 0.4123 0.7823 0.9129 -0.1194 -0.2117 -0.0711 70  VAL B CG1 
1476 C CG2 . VAL B 72  ? 0.3926 0.7386 0.8678 -0.1121 -0.1796 -0.0540 70  VAL B CG2 
1477 N N   . LYS B 73  ? 0.5927 0.8969 1.0960 -0.1398 -0.2526 -0.0960 71  LYS B N   
1478 C CA  . LYS B 73  ? 0.7001 1.0043 1.2124 -0.1427 -0.2763 -0.1137 71  LYS B CA  
1479 C C   . LYS B 73  ? 0.7870 1.1351 1.3227 -0.1467 -0.2752 -0.1113 71  LYS B C   
1480 O O   . LYS B 73  ? 0.7567 1.1271 1.3124 -0.1556 -0.2628 -0.0977 71  LYS B O   
1481 C CB  . LYS B 73  ? 0.6965 0.9530 1.2052 -0.1616 -0.2949 -0.1132 71  LYS B CB  
1482 N N   . ASP B 74  ? 1.0888 1.1647 1.4818 -0.2133 -0.0112 -0.1420 72  ASP B N   
1483 C CA  . ASP B 74  ? 1.1470 1.2887 1.5736 -0.2174 -0.0418 -0.1663 72  ASP B CA  
1484 C C   . ASP B 74  ? 1.2644 1.4257 1.7305 -0.2590 -0.0408 -0.1980 72  ASP B C   
1485 O O   . ASP B 74  ? 1.2708 1.5022 1.7846 -0.2663 -0.0655 -0.2181 72  ASP B O   
1486 C CB  . ASP B 74  ? 1.1695 1.2994 1.5518 -0.1966 -0.0676 -0.1702 72  ASP B CB  
1487 N N   . SER B 75  ? 1.3560 1.4564 1.8053 -0.2862 -0.0145 -0.2031 73  SER B N   
1488 C CA  . SER B 75  ? 1.4083 1.5186 1.8942 -0.3321 -0.0071 -0.2338 73  SER B CA  
1489 C C   . SER B 75  ? 1.4451 1.4895 1.9194 -0.3565 0.0355  -0.2206 73  SER B C   
1490 O O   . SER B 75  ? 1.4319 1.4462 1.8832 -0.3382 0.0544  -0.1885 73  SER B O   
1491 C CB  . SER B 75  ? 1.4423 1.5340 1.9036 -0.3448 -0.0279 -0.2631 73  SER B CB  
1492 O OG  . SER B 75  ? 1.4039 1.5435 1.8568 -0.3191 -0.0676 -0.2680 73  SER B OG  
1493 N N   . GLN B 76  ? 1.4926 1.5106 1.9790 -0.4002 0.0502  -0.2452 74  GLN B N   
1494 C CA  . GLN B 76  ? 1.5206 1.4628 1.9875 -0.4265 0.0910  -0.2314 74  GLN B CA  
1495 C C   . GLN B 76  ? 1.5455 1.3869 1.9436 -0.4022 0.0999  -0.2084 74  GLN B C   
1496 O O   . GLN B 76  ? 1.5367 1.3343 1.9036 -0.3825 0.1162  -0.1726 74  GLN B O   
1497 C CB  . GLN B 76  ? 1.5908 1.5314 2.0837 -0.4761 0.1028  -0.2613 74  GLN B CB  
1498 N N   . ALA B 77  ? 1.5352 1.3407 1.9102 -0.4023 0.0885  -0.2301 75  ALA B N   
1499 C CA  . ALA B 77  ? 1.4934 1.2123 1.8136 -0.3738 0.0957  -0.2134 75  ALA B CA  
1500 C C   . ALA B 77  ? 1.3802 1.1241 1.6805 -0.3376 0.0680  -0.2211 75  ALA B C   
1501 O O   . ALA B 77  ? 1.4204 1.1234 1.6953 -0.3395 0.0661  -0.2439 75  ALA B O   
1502 C CB  . ALA B 77  ? 1.5222 1.1530 1.8242 -0.4063 0.1180  -0.2318 75  ALA B CB  
1503 N N   . ALA B 78  ? 1.2746 1.0814 1.5830 -0.3066 0.0491  -0.2035 76  ALA B N   
1504 C CA  . ALA B 78  ? 1.2057 1.0235 1.4858 -0.2694 0.0296  -0.2006 76  ALA B CA  
1505 C C   . ALA B 78  ? 1.1373 0.9230 1.3954 -0.2318 0.0404  -0.1629 76  ALA B C   
1506 O O   . ALA B 78  ? 1.1279 0.9059 1.3944 -0.2318 0.0541  -0.1369 76  ALA B O   
1507 C CB  . ALA B 78  ? 1.1676 1.0747 1.4690 -0.2612 -0.0023 -0.2083 76  ALA B CB  
1508 N N   . LEU B 79  ? 1.0630 0.8317 1.2921 -0.2019 0.0348  -0.1615 77  LEU B N   
1509 C CA  . LEU B 79  ? 0.9432 0.6952 1.1593 -0.1653 0.0404  -0.1288 77  LEU B CA  
1510 C C   . LEU B 79  ? 0.8399 0.6550 1.0731 -0.1536 0.0286  -0.1069 77  LEU B C   
1511 O O   . LEU B 79  ? 0.7712 0.6470 1.0195 -0.1587 0.0100  -0.1188 77  LEU B O   
1512 C CB  . LEU B 79  ? 0.8413 0.5797 1.0320 -0.1383 0.0375  -0.1366 77  LEU B CB  
1513 N N   . PRO B 80  ? 0.8251 0.6257 1.0559 -0.1391 0.0377  -0.0758 78  PRO B N   
1514 C CA  . PRO B 80  ? 0.7676 0.6232 1.0122 -0.1306 0.0298  -0.0586 78  PRO B CA  
1515 C C   . PRO B 80  ? 0.7426 0.6307 0.9778 -0.1001 0.0141  -0.0529 78  PRO B C   
1516 O O   . PRO B 80  ? 0.7853 0.6471 1.0014 -0.0802 0.0150  -0.0515 78  PRO B O   
1517 C CB  . PRO B 80  ? 0.7936 0.6114 1.0267 -0.1283 0.0455  -0.0286 78  PRO B CB  
1518 C CG  . PRO B 80  ? 0.8460 0.5937 1.0575 -0.1163 0.0533  -0.0227 78  PRO B CG  
1519 C CD  . PRO B 80  ? 0.8564 0.5864 1.0712 -0.1336 0.0552  -0.0557 78  PRO B CD  
1520 N N   . LYS B 81  ? 0.6623 0.6073 0.9140 -0.0975 0.0018  -0.0513 79  LYS B N   
1521 C CA  . LYS B 81  ? 0.6267 0.6013 0.8693 -0.0721 -0.0113 -0.0420 79  LYS B CA  
1522 C C   . LYS B 81  ? 0.5852 0.5689 0.8306 -0.0608 -0.0051 -0.0167 79  LYS B C   
1523 O O   . LYS B 81  ? 0.5762 0.5561 0.8317 -0.0753 0.0067  -0.0091 79  LYS B O   
1524 C CB  . LYS B 81  ? 0.5799 0.6047 0.8356 -0.0752 -0.0324 -0.0580 79  LYS B CB  
1525 N N   . TYR B 82  ? 0.5503 0.5435 0.7827 -0.0379 -0.0113 -0.0048 80  TYR B N   
1526 C CA  . TYR B 82  ? 0.5209 0.5157 0.7491 -0.0274 -0.0063 0.0176  80  TYR B CA  
1527 C C   . TYR B 82  ? 0.4958 0.5309 0.7294 -0.0173 -0.0156 0.0202  80  TYR B C   
1528 O O   . TYR B 82  ? 0.4988 0.5446 0.7235 -0.0050 -0.0257 0.0160  80  TYR B O   
1529 C CB  . TYR B 82  ? 0.5165 0.4795 0.7285 -0.0102 -0.0030 0.0311  80  TYR B CB  
1530 C CG  . TYR B 82  ? 0.5515 0.4660 0.7590 -0.0171 0.0070  0.0343  80  TYR B CG  
1531 C CD1 . TYR B 82  ? 0.5215 0.4136 0.7218 -0.0268 0.0143  0.0519  80  TYR B CD1 
1532 C CD2 . TYR B 82  ? 0.5296 0.4149 0.7351 -0.0158 0.0105  0.0189  80  TYR B CD2 
1533 C CE1 . TYR B 82  ? 0.6026 0.4403 0.7935 -0.0334 0.0232  0.0578  80  TYR B CE1 
1534 C CE2 . TYR B 82  ? 0.6059 0.4384 0.8076 -0.0211 0.0205  0.0214  80  TYR B CE2 
1535 C CZ  . TYR B 82  ? 0.6336 0.4403 0.8279 -0.0294 0.0260  0.0424  80  TYR B CZ  
1536 O OH  . TYR B 82  ? 0.7300 0.4739 0.9153 -0.0347 0.0358  0.0478  80  TYR B OH  
1537 N N   . VAL B 83  ? 0.4867 0.5386 0.7312 -0.0237 -0.0097 0.0267  81  VAL B N   
1538 C CA  . VAL B 83  ? 0.4361 0.5206 0.6891 -0.0147 -0.0150 0.0279  81  VAL B CA  
1539 C C   . VAL B 83  ? 0.4330 0.5073 0.6670 -0.0074 -0.0089 0.0455  81  VAL B C   
1540 O O   . VAL B 83  ? 0.4174 0.4715 0.6394 -0.0161 0.0012  0.0563  81  VAL B O   
1541 C CB  . VAL B 83  ? 0.4149 0.5314 0.7009 -0.0275 -0.0106 0.0162  81  VAL B CB  
1542 C CG1 . VAL B 83  ? 0.4121 0.5557 0.7088 -0.0144 -0.0143 0.0170  81  VAL B CG1 
1543 C CG2 . VAL B 83  ? 0.4046 0.5389 0.7142 -0.0354 -0.0222 -0.0028 81  VAL B CG2 
1544 N N   . LEU B 84  ? 0.4549 0.5400 0.6820 0.0071  -0.0162 0.0488  82  LEU B N   
1545 C CA  . LEU B 84  ? 0.4644 0.5494 0.6783 0.0112  -0.0125 0.0604  82  LEU B CA  
1546 C C   . LEU B 84  ? 0.4728 0.5806 0.6990 0.0126  -0.0111 0.0537  82  LEU B C   
1547 O O   . LEU B 84  ? 0.5106 0.6294 0.7450 0.0225  -0.0206 0.0475  82  LEU B O   
1548 C CB  . LEU B 84  ? 0.5181 0.5958 0.7183 0.0239  -0.0185 0.0674  82  LEU B CB  
1549 C CG  . LEU B 84  ? 0.5521 0.6366 0.7425 0.0253  -0.0173 0.0751  82  LEU B CG  
1550 C CD1 . LEU B 84  ? 0.5539 0.6285 0.7316 0.0166  -0.0134 0.0858  82  LEU B CD1 
1551 C CD2 . LEU B 84  ? 0.5240 0.6099 0.7095 0.0346  -0.0216 0.0782  82  LEU B CD2 
1552 N N   . ILE B 85  ? 0.4165 0.5279 0.6419 0.0027  0.0013  0.0545  83  ILE B N   
1553 C CA  . ILE B 85  ? 0.4007 0.5296 0.6382 0.0052  0.0072  0.0464  83  ILE B CA  
1554 C C   . ILE B 85  ? 0.4368 0.5551 0.6481 0.0089  0.0073  0.0544  83  ILE B C   
1555 O O   . ILE B 85  ? 0.4535 0.5605 0.6402 -0.0009 0.0130  0.0626  83  ILE B O   
1556 C CB  . ILE B 85  ? 0.4057 0.5460 0.6575 -0.0107 0.0260  0.0376  83  ILE B CB  
1557 C CG1 . ILE B 85  ? 0.3894 0.5505 0.6799 -0.0148 0.0241  0.0247  83  ILE B CG1 
1558 C CG2 . ILE B 85  ? 0.4197 0.5723 0.6792 -0.0075 0.0369  0.0282  83  ILE B CG2 
1559 C CD1 . ILE B 85  ? 0.4096 0.5766 0.7112 -0.0367 0.0453  0.0179  83  ILE B CD1 
1560 N N   . ASN B 86  ? 0.4341 0.5541 0.6482 0.0216  -0.0003 0.0522  84  ASN B N   
1561 C CA  . ASN B 86  ? 0.4335 0.5449 0.6288 0.0228  0.0014  0.0550  84  ASN B CA  
1562 C C   . ASN B 86  ? 0.4901 0.6066 0.6947 0.0207  0.0145  0.0432  84  ASN B C   
1563 O O   . ASN B 86  ? 0.5084 0.6277 0.7328 0.0329  0.0130  0.0355  84  ASN B O   
1564 C CB  . ASN B 86  ? 0.4437 0.5473 0.6346 0.0342  -0.0087 0.0582  84  ASN B CB  
1565 C CG  . ASN B 86  ? 0.4274 0.5202 0.6032 0.0324  -0.0045 0.0581  84  ASN B CG  
1566 O OD1 . ASN B 86  ? 0.4496 0.5426 0.6118 0.0215  0.0002  0.0589  84  ASN B OD1 
1567 N ND2 . ASN B 86  ? 0.3539 0.4343 0.5293 0.0418  -0.0073 0.0570  84  ASN B ND2 
1568 N N   . TRP B 87  ? 0.4861 0.6014 0.6749 0.0057  0.0276  0.0415  85  TRP B N   
1569 C CA  . TRP B 87  ? 0.4929 0.6115 0.6858 -0.0001 0.0464  0.0267  85  TRP B CA  
1570 C C   . TRP B 87  ? 0.5219 0.6249 0.6891 -0.0024 0.0482  0.0242  85  TRP B C   
1571 O O   . TRP B 87  ? 0.5180 0.6129 0.6521 -0.0135 0.0424  0.0330  85  TRP B O   
1572 C CB  . TRP B 87  ? 0.4689 0.5891 0.6464 -0.0200 0.0631  0.0254  85  TRP B CB  
1573 C CG  . TRP B 87  ? 0.4797 0.6007 0.6511 -0.0306 0.0876  0.0081  85  TRP B CG  
1574 C CD1 . TRP B 87  ? 0.5063 0.6111 0.6347 -0.0435 0.0950  0.0057  85  TRP B CD1 
1575 C CD2 . TRP B 87  ? 0.4884 0.6293 0.6989 -0.0307 0.1097  -0.0121 85  TRP B CD2 
1576 N NE1 . TRP B 87  ? 0.5180 0.6261 0.6506 -0.0520 0.1230  -0.0158 85  TRP B NE1 
1577 C CE2 . TRP B 87  ? 0.5216 0.6538 0.7084 -0.0434 0.1339  -0.0273 85  TRP B CE2 
1578 C CE3 . TRP B 87  ? 0.4507 0.6198 0.7176 -0.0220 0.1112  -0.0213 85  TRP B CE3 
1579 C CZ2 . TRP B 87  ? 0.4983 0.6483 0.7192 -0.0458 0.1634  -0.0522 85  TRP B CZ2 
1580 C CZ3 . TRP B 87  ? 0.4354 0.6279 0.7423 -0.0239 0.1369  -0.0450 85  TRP B CZ3 
1581 C CH2 . TRP B 87  ? 0.4596 0.6422 0.7451 -0.0347 0.1646  -0.0605 85  TRP B CH2 
1582 N N   . VAL B 88  ? 0.4924 0.5909 0.6770 0.0076  0.0555  0.0112  86  VAL B N   
1583 C CA  . VAL B 88  ? 0.5033 0.5820 0.6662 0.0028  0.0624  0.0034  86  VAL B CA  
1584 C C   . VAL B 88  ? 0.5513 0.6303 0.7264 0.0006  0.0870  -0.0185 86  VAL B C   
1585 O O   . VAL B 88  ? 0.5740 0.6584 0.7902 0.0190  0.0912  -0.0281 86  VAL B O   
1586 C CB  . VAL B 88  ? 0.4840 0.5453 0.6541 0.0180  0.0508  0.0081  86  VAL B CB  
1587 C CG1 . VAL B 88  ? 0.4988 0.5356 0.6451 0.0084  0.0593  -0.0008 86  VAL B CG1 
1588 C CG2 . VAL B 88  ? 0.4338 0.4991 0.5968 0.0200  0.0318  0.0262  86  VAL B CG2 
1589 N N   . GLY B 89  ? 0.5686 0.6416 0.7079 -0.0211 0.1026  -0.0272 87  GLY B N   
1590 C CA  . GLY B 89  ? 0.6462 0.7196 0.7930 -0.0268 0.1323  -0.0516 87  GLY B CA  
1591 C C   . GLY B 89  ? 0.6996 0.7529 0.8653 -0.0124 0.1416  -0.0690 87  GLY B C   
1592 O O   . GLY B 89  ? 0.7192 0.7477 0.8635 -0.0129 0.1314  -0.0652 87  GLY B O   
1593 N N   . GLU B 90  ? 0.7571 0.8202 0.9659 -0.0002 0.1631  -0.0898 88  GLU B N   
1594 C CA  . GLU B 90  ? 0.8385 0.8771 1.0708 0.0185  0.1720  -0.1063 88  GLU B CA  
1595 C C   . GLU B 90  ? 0.9206 0.9227 1.1013 -0.0017 0.1863  -0.1203 88  GLU B C   
1596 O O   . GLU B 90  ? 0.9608 0.9286 1.1445 0.0096  0.1859  -0.1262 88  GLU B O   
1597 C CB  . GLU B 90  ? 0.8642 0.9248 1.1576 0.0349  0.1961  -0.1306 88  GLU B CB  
1598 N N   . ASP B 91  ? 0.9481 0.9533 1.0767 -0.0328 0.1965  -0.1244 89  ASP B N   
1599 C CA  . ASP B 91  ? 0.9968 0.9717 1.0721 -0.0565 0.2094  -0.1417 89  ASP B CA  
1600 C C   . ASP B 91  ? 0.9539 0.9231 0.9798 -0.0759 0.1815  -0.1221 89  ASP B C   
1601 O O   . ASP B 91  ? 1.0069 0.9616 0.9803 -0.1027 0.1864  -0.1340 89  ASP B O   
1602 C CB  . ASP B 91  ? 1.1038 1.0833 1.1500 -0.0796 0.2433  -0.1658 89  ASP B CB  
1603 C CG  . ASP B 91  ? 1.2059 1.1909 1.3091 -0.0611 0.2778  -0.1946 89  ASP B CG  
1604 O OD1 . ASP B 91  ? 1.2443 1.2041 1.3783 -0.0408 0.2844  -0.2098 89  ASP B OD1 
1605 O OD2 . ASP B 91  ? 1.2381 1.2519 1.3589 -0.0662 0.2991  -0.2026 89  ASP B OD2 
1606 N N   . VAL B 92  ? 0.8458 0.8288 0.8893 -0.0633 0.1525  -0.0944 90  VAL B N   
1607 C CA  . VAL B 92  ? 0.7670 0.7484 0.7825 -0.0759 0.1271  -0.0785 90  VAL B CA  
1608 C C   . VAL B 92  ? 0.7707 0.7190 0.7912 -0.0731 0.1297  -0.0885 90  VAL B C   
1609 O O   . VAL B 92  ? 0.7968 0.7274 0.8530 -0.0492 0.1362  -0.0904 90  VAL B O   
1610 C CB  . VAL B 92  ? 0.6946 0.7005 0.7314 -0.0625 0.1014  -0.0495 90  VAL B CB  
1611 C CG1 . VAL B 92  ? 0.6805 0.6901 0.7022 -0.0722 0.0783  -0.0360 90  VAL B CG1 
1612 C CG2 . VAL B 92  ? 0.6726 0.7018 0.7021 -0.0671 0.1012  -0.0400 90  VAL B CG2 
1613 N N   . PRO B 93  ? 0.7661 0.7025 0.7516 -0.0974 0.1244  -0.0954 91  PRO B N   
1614 C CA  . PRO B 93  ? 0.7500 0.6500 0.7395 -0.0986 0.1282  -0.1036 91  PRO B CA  
1615 C C   . PRO B 93  ? 0.7117 0.6109 0.7315 -0.0786 0.1122  -0.0794 91  PRO B C   
1616 O O   . PRO B 93  ? 0.6766 0.6086 0.7055 -0.0739 0.0930  -0.0580 91  PRO B O   
1617 C CB  . PRO B 93  ? 0.7448 0.6483 0.6942 -0.1334 0.1192  -0.1127 91  PRO B CB  
1618 C CG  . PRO B 93  ? 0.7514 0.6794 0.6665 -0.1490 0.1179  -0.1172 91  PRO B CG  
1619 C CD  . PRO B 93  ? 0.7704 0.7238 0.7093 -0.1266 0.1144  -0.0974 91  PRO B CD  
1620 N N   . ASP B 94  ? 0.7589 0.6147 0.7898 -0.0673 0.1215  -0.0831 92  ASP B N   
1621 C CA  . ASP B 94  ? 0.7417 0.5872 0.7917 -0.0478 0.1090  -0.0598 92  ASP B CA  
1622 C C   . ASP B 94  ? 0.7082 0.5727 0.7476 -0.0660 0.0936  -0.0451 92  ASP B C   
1623 O O   . ASP B 94  ? 0.6769 0.5623 0.7297 -0.0534 0.0796  -0.0243 92  ASP B O   
1624 C CB  . ASP B 94  ? 0.8534 0.6379 0.9060 -0.0354 0.1215  -0.0652 92  ASP B CB  
1625 C CG  . ASP B 94  ? 0.9546 0.7277 1.0374 -0.0042 0.1309  -0.0729 92  ASP B CG  
1626 O OD1 . ASP B 94  ? 0.9591 0.7761 1.0646 0.0078  0.1265  -0.0710 92  ASP B OD1 
1627 O OD2 . ASP B 94  ? 1.0226 0.7427 1.1098 0.0084  0.1431  -0.0818 92  ASP B OD2 
1628 N N   . ALA B 95  ? 0.7184 0.5793 0.7370 -0.0965 0.0965  -0.0582 93  ALA B N   
1629 C CA  . ALA B 95  ? 0.6567 0.5441 0.6768 -0.1143 0.0834  -0.0480 93  ALA B CA  
1630 C C   . ALA B 95  ? 0.5891 0.5338 0.6207 -0.1094 0.0639  -0.0345 93  ALA B C   
1631 O O   . ALA B 95  ? 0.6282 0.5973 0.6756 -0.1078 0.0531  -0.0198 93  ALA B O   
1632 C CB  . ALA B 95  ? 0.6569 0.5388 0.6588 -0.1503 0.0877  -0.0686 93  ALA B CB  
1633 N N   . ARG B 96  ? 0.5676 0.5301 0.5899 -0.1075 0.0615  -0.0397 94  ARG B N   
1634 C CA  . ARG B 96  ? 0.6051 0.6117 0.6338 -0.1025 0.0431  -0.0246 94  ARG B CA  
1635 C C   . ARG B 96  ? 0.6005 0.6116 0.6525 -0.0743 0.0410  -0.0073 94  ARG B C   
1636 O O   . ARG B 96  ? 0.5779 0.6167 0.6437 -0.0678 0.0267  0.0081  94  ARG B O   
1637 C CB  . ARG B 96  ? 0.6638 0.6813 0.6634 -0.1152 0.0419  -0.0342 94  ARG B CB  
1638 C CG  . ARG B 96  ? 0.6393 0.6901 0.6392 -0.1086 0.0240  -0.0159 94  ARG B CG  
1639 C CD  . ARG B 96  ? 0.6439 0.7268 0.6485 -0.1201 -0.0003 -0.0083 94  ARG B CD  
1640 N NE  . ARG B 96  ? 0.6421 0.7511 0.6453 -0.1121 -0.0203 0.0106  94  ARG B NE  
1641 C CZ  . ARG B 96  ? 0.6035 0.7450 0.6295 -0.1087 -0.0431 0.0231  94  ARG B CZ  
1642 N NH1 . ARG B 96  ? 0.5380 0.6960 0.5924 -0.1155 -0.0462 0.0170  94  ARG B NH1 
1643 N NH2 . ARG B 96  ? 0.6153 0.7714 0.6384 -0.0984 -0.0611 0.0414  94  ARG B NH2 
1644 N N   . LYS B 97  ? 0.6277 0.6127 0.6875 -0.0570 0.0540  -0.0110 95  LYS B N   
1645 C CA  . LYS B 97  ? 0.6038 0.5923 0.6867 -0.0323 0.0486  0.0039  95  LYS B CA  
1646 C C   . LYS B 97  ? 0.5892 0.5756 0.6758 -0.0310 0.0403  0.0175  95  LYS B C   
1647 O O   . LYS B 97  ? 0.5512 0.5610 0.6484 -0.0237 0.0295  0.0304  95  LYS B O   
1648 C CB  . LYS B 97  ? 0.6823 0.6422 0.7782 -0.0131 0.0597  -0.0030 95  LYS B CB  
1649 C CG  . LYS B 97  ? 0.7775 0.7416 0.8791 -0.0117 0.0745  -0.0204 95  LYS B CG  
1650 C CD  . LYS B 97  ? 0.8081 0.7494 0.9382 0.0139  0.0825  -0.0266 95  LYS B CD  
1651 C CE  . LYS B 97  ? 0.8308 0.7658 0.9688 0.0132  0.1059  -0.0517 95  LYS B CE  
1652 N NZ  . LYS B 97  ? 0.8098 0.7772 0.9853 0.0286  0.1100  -0.0556 95  LYS B NZ  
1653 N N   . CYS B 98  ? 0.6234 0.5785 0.6989 -0.0410 0.0486  0.0129  96  CYS B N   
1654 C CA  . CYS B 98  ? 0.6410 0.5875 0.7145 -0.0445 0.0475  0.0240  96  CYS B CA  
1655 C C   . CYS B 98  ? 0.6527 0.6441 0.7378 -0.0568 0.0385  0.0278  96  CYS B C   
1656 O O   . CYS B 98  ? 0.6389 0.6414 0.7320 -0.0497 0.0352  0.0390  96  CYS B O   
1657 C CB  . CYS B 98  ? 0.6850 0.5868 0.7413 -0.0598 0.0615  0.0161  96  CYS B CB  
1658 S SG  . CYS B 98  ? 0.7618 0.6366 0.8057 -0.0642 0.0670  0.0310  96  CYS B SG  
1659 N N   . ALA B 99  ? 0.6642 0.6818 0.7506 -0.0744 0.0337  0.0177  97  ALA B N   
1660 C CA  . ALA B 99  ? 0.5891 0.6530 0.6945 -0.0817 0.0208  0.0216  97  ALA B CA  
1661 C C   . ALA B 99  ? 0.5698 0.6571 0.6878 -0.0609 0.0090  0.0348  97  ALA B C   
1662 O O   . ALA B 99  ? 0.5682 0.6773 0.7064 -0.0546 0.0047  0.0423  97  ALA B O   
1663 C CB  . ALA B 99  ? 0.5846 0.6707 0.6846 -0.1033 0.0118  0.0092  97  ALA B CB  
1664 N N   . CYS B 100 ? 0.5139 0.5951 0.6211 -0.0516 0.0068  0.0357  98  CYS B N   
1665 C CA  . CYS B 100 ? 0.4912 0.5899 0.6078 -0.0367 -0.0030 0.0472  98  CYS B CA  
1666 C C   . CYS B 100 ? 0.5130 0.6029 0.6412 -0.0195 0.0001  0.0550  98  CYS B C   
1667 O O   . CYS B 100 ? 0.5297 0.6346 0.6703 -0.0097 -0.0071 0.0630  98  CYS B O   
1668 C CB  . CYS B 100 ? 0.5359 0.6278 0.6360 -0.0362 -0.0009 0.0445  98  CYS B CB  
1669 S SG  . CYS B 100 ? 0.6319 0.7372 0.7048 -0.0578 -0.0103 0.0393  98  CYS B SG  
1670 N N   . ALA B 101 ? 0.5100 0.5714 0.6307 -0.0157 0.0096  0.0529  99  ALA B N   
1671 C CA  . ALA B 101 ? 0.4467 0.4973 0.5689 -0.0012 0.0090  0.0607  99  ALA B CA  
1672 C C   . ALA B 101 ? 0.4844 0.5496 0.6135 -0.0044 0.0094  0.0649  99  ALA B C   
1673 O O   . ALA B 101 ? 0.5041 0.5731 0.6365 0.0065  0.0063  0.0696  99  ALA B O   
1674 C CB  . ALA B 101 ? 0.4581 0.4704 0.5650 0.0033  0.0155  0.0606  99  ALA B CB  
1675 N N   . SER B 102 ? 0.4716 0.5478 0.6061 -0.0204 0.0147  0.0602  100 SER B N   
1676 C CA  . SER B 102 ? 0.4491 0.5465 0.6000 -0.0231 0.0189  0.0607  100 SER B CA  
1677 C C   . SER B 102 ? 0.4291 0.5613 0.6067 -0.0135 0.0070  0.0627  100 SER B C   
1678 O O   . SER B 102 ? 0.4815 0.6311 0.6785 -0.0098 0.0114  0.0616  100 SER B O   
1679 C CB  . SER B 102 ? 0.4733 0.5810 0.6332 -0.0447 0.0289  0.0527  100 SER B CB  
1680 O OG  . SER B 102 ? 0.4657 0.6034 0.6434 -0.0541 0.0174  0.0466  100 SER B OG  
1681 N N   . HIS B 103 ? 0.4038 0.5414 0.5802 -0.0089 -0.0057 0.0657  101 HIS B N   
1682 C CA  . HIS B 103 ? 0.3843 0.5428 0.5784 0.0015  -0.0183 0.0717  101 HIS B CA  
1683 C C   . HIS B 103 ? 0.4011 0.5444 0.5914 0.0162  -0.0178 0.0766  101 HIS B C   
1684 O O   . HIS B 103 ? 0.4208 0.5740 0.6275 0.0260  -0.0243 0.0809  101 HIS B O   
1685 C CB  . HIS B 103 ? 0.3618 0.5269 0.5458 -0.0040 -0.0318 0.0750  101 HIS B CB  
1686 C CG  . HIS B 103 ? 0.3830 0.5633 0.5660 -0.0215 -0.0360 0.0677  101 HIS B CG  
1687 N ND1 . HIS B 103 ? 0.4135 0.5914 0.5723 -0.0325 -0.0444 0.0664  101 HIS B ND1 
1688 C CD2 . HIS B 103 ? 0.3959 0.5941 0.5973 -0.0333 -0.0318 0.0592  101 HIS B CD2 
1689 C CE1 . HIS B 103 ? 0.4300 0.6237 0.5918 -0.0499 -0.0479 0.0568  101 HIS B CE1 
1690 N NE2 . HIS B 103 ? 0.4236 0.6314 0.6147 -0.0511 -0.0404 0.0523  101 HIS B NE2 
1691 N N   . VAL B 104 ? 0.4000 0.5199 0.5720 0.0185  -0.0122 0.0754  102 VAL B N   
1692 C CA  . VAL B 104 ? 0.4101 0.5207 0.5808 0.0285  -0.0150 0.0776  102 VAL B CA  
1693 C C   . VAL B 104 ? 0.4139 0.5279 0.5959 0.0363  -0.0135 0.0769  102 VAL B C   
1694 O O   . VAL B 104 ? 0.4314 0.5450 0.6223 0.0425  -0.0180 0.0794  102 VAL B O   
1695 C CB  . VAL B 104 ? 0.3989 0.4914 0.5563 0.0314  -0.0129 0.0749  102 VAL B CB  
1696 C CG1 . VAL B 104 ? 0.4071 0.4974 0.5690 0.0389  -0.0175 0.0742  102 VAL B CG1 
1697 C CG2 . VAL B 104 ? 0.3630 0.4519 0.5164 0.0268  -0.0113 0.0722  102 VAL B CG2 
1698 N N   . ALA B 105 ? 0.4375 0.5506 0.6168 0.0345  -0.0043 0.0726  103 ALA B N   
1699 C CA  . ALA B 105 ? 0.4067 0.5209 0.5938 0.0408  0.0020  0.0677  103 ALA B CA  
1700 C C   . ALA B 105 ? 0.3969 0.5316 0.6174 0.0481  -0.0016 0.0684  103 ALA B C   
1701 O O   . ALA B 105 ? 0.4470 0.5748 0.6765 0.0578  -0.0024 0.0670  103 ALA B O   
1702 C CB  . ALA B 105 ? 0.4095 0.5188 0.5831 0.0336  0.0174  0.0620  103 ALA B CB  
1703 N N   . LYS B 106 ? 0.3752 0.5334 0.6147 0.0439  -0.0062 0.0707  104 LYS B N   
1704 C CA  . LYS B 106 ? 0.3610 0.5413 0.6354 0.0543  -0.0160 0.0739  104 LYS B CA  
1705 C C   . LYS B 106 ? 0.3665 0.5292 0.6317 0.0623  -0.0303 0.0854  104 LYS B C   
1706 O O   . LYS B 106 ? 0.3416 0.5006 0.6261 0.0764  -0.0348 0.0887  104 LYS B O   
1707 C CB  . LYS B 106 ? 0.3753 0.5876 0.6690 0.0458  -0.0244 0.0742  104 LYS B CB  
1708 C CG  . LYS B 106 ? 0.4858 0.7331 0.8293 0.0585  -0.0342 0.0738  104 LYS B CG  
1709 C CD  . LYS B 106 ? 0.5634 0.8530 0.9358 0.0466  -0.0401 0.0679  104 LYS B CD  
1710 C CE  . LYS B 106 ? 0.6345 0.9573 1.0448 0.0599  -0.0682 0.0759  104 LYS B CE  
1711 N NZ  . LYS B 106 ? 0.6748 1.0435 1.1555 0.0735  -0.0654 0.0651  104 LYS B NZ  
1712 N N   . VAL B 107 ? 0.3757 0.5234 0.6112 0.0530  -0.0344 0.0907  105 VAL B N   
1713 C CA  . VAL B 107 ? 0.3583 0.4865 0.5799 0.0550  -0.0423 0.1008  105 VAL B CA  
1714 C C   . VAL B 107 ? 0.3701 0.4760 0.5918 0.0612  -0.0349 0.0968  105 VAL B C   
1715 O O   . VAL B 107 ? 0.4015 0.4913 0.6285 0.0688  -0.0393 0.1035  105 VAL B O   
1716 C CB  . VAL B 107 ? 0.3523 0.4739 0.5462 0.0412  -0.0420 0.1023  105 VAL B CB  
1717 C CG1 . VAL B 107 ? 0.3389 0.4387 0.5167 0.0385  -0.0422 0.1093  105 VAL B CG1 
1718 C CG2 . VAL B 107 ? 0.3373 0.4757 0.5253 0.0330  -0.0517 0.1057  105 VAL B CG2 
1719 N N   . ALA B 108 ? 0.3149 0.4165 0.5286 0.0578  -0.0250 0.0859  106 ALA B N   
1720 C CA  . ALA B 108 ? 0.3809 0.4637 0.5919 0.0605  -0.0202 0.0788  106 ALA B CA  
1721 C C   . ALA B 108 ? 0.4174 0.4955 0.6478 0.0723  -0.0155 0.0741  106 ALA B C   
1722 O O   . ALA B 108 ? 0.4861 0.5419 0.7181 0.0758  -0.0140 0.0718  106 ALA B O   
1723 C CB  . ALA B 108 ? 0.3208 0.4020 0.5153 0.0554  -0.0157 0.0689  106 ALA B CB  
1724 N N   . GLU B 109 ? 0.3827 0.4816 0.6319 0.0779  -0.0110 0.0708  107 GLU B N   
1725 C CA  . GLU B 109 ? 0.3938 0.4928 0.6712 0.0918  -0.0037 0.0634  107 GLU B CA  
1726 C C   . GLU B 109 ? 0.4283 0.5239 0.7295 0.1058  -0.0176 0.0767  107 GLU B C   
1727 O O   . GLU B 109 ? 0.4422 0.5193 0.7609 0.1196  -0.0140 0.0731  107 GLU B O   
1728 C CB  . GLU B 109 ? 0.4010 0.5294 0.6995 0.0922  0.0088  0.0531  107 GLU B CB  
1729 C CG  . GLU B 109 ? 0.5092 0.6286 0.7786 0.0809  0.0259  0.0400  107 GLU B CG  
1730 C CD  . GLU B 109 ? 0.6556 0.7607 0.9286 0.0873  0.0430  0.0231  107 GLU B CD  
1731 O OE1 . GLU B 109 ? 0.6949 0.8095 1.0094 0.1026  0.0473  0.0183  107 GLU B OE1 
1732 O OE2 . GLU B 109 ? 0.7342 0.8172 0.9682 0.0780  0.0504  0.0140  107 GLU B OE2 
1733 N N   . PHE B 110 ? 0.4468 0.5539 0.7434 0.1024  -0.0342 0.0924  108 PHE B N   
1734 C CA  . PHE B 110 ? 0.4486 0.5484 0.7585 0.1159  -0.0520 0.1091  108 PHE B CA  
1735 C C   . PHE B 110 ? 0.5039 0.5567 0.7916 0.1163  -0.0520 0.1172  108 PHE B C   
1736 O O   . PHE B 110 ? 0.5191 0.5491 0.8231 0.1333  -0.0575 0.1244  108 PHE B O   
1737 C CB  . PHE B 110 ? 0.4352 0.5547 0.7322 0.1075  -0.0704 0.1230  108 PHE B CB  
1738 C CG  . PHE B 110 ? 0.4133 0.5262 0.7167 0.1214  -0.0947 0.1434  108 PHE B CG  
1739 C CD1 . PHE B 110 ? 0.4194 0.5645 0.7705 0.1404  -0.1088 0.1443  108 PHE B CD1 
1740 C CD2 . PHE B 110 ? 0.4461 0.5212 0.7084 0.1154  -0.1037 0.1620  108 PHE B CD2 
1741 C CE1 . PHE B 110 ? 0.4597 0.5986 0.8170 0.1567  -0.1369 0.1654  108 PHE B CE1 
1742 C CE2 . PHE B 110 ? 0.5382 0.5996 0.7961 0.1283  -0.1288 0.1847  108 PHE B CE2 
1743 C CZ  . PHE B 110 ? 0.5056 0.5983 0.8108 0.1509  -0.1482 0.1876  108 PHE B CZ  
1744 N N   . PHE B 111 ? 0.4583 0.9265 0.6676 0.0257  0.0959  0.1264  109 PHE B N   
1745 C CA  . PHE B 111 ? 0.4390 0.8642 0.6621 0.0601  0.0926  0.1269  109 PHE B CA  
1746 C C   . PHE B 111 ? 0.5254 0.9012 0.7202 0.0608  0.1025  0.1141  109 PHE B C   
1747 O O   . PHE B 111 ? 0.5691 0.8787 0.7347 0.0587  0.0916  0.1100  109 PHE B O   
1748 C CB  . PHE B 111 ? 0.4120 0.7921 0.6246 0.0583  0.0709  0.1313  109 PHE B CB  
1749 C CG  . PHE B 111 ? 0.4382 0.8658 0.6741 0.0526  0.0621  0.1421  109 PHE B CG  
1750 C CD1 . PHE B 111 ? 0.4894 0.9141 0.7008 0.0196  0.0517  0.1415  109 PHE B CD1 
1751 C CD2 . PHE B 111 ? 0.4158 0.8898 0.6951 0.0790  0.0643  0.1532  109 PHE B CD2 
1752 C CE1 . PHE B 111 ? 0.4635 0.9346 0.6944 0.0105  0.0451  0.1496  109 PHE B CE1 
1753 C CE2 . PHE B 111 ? 0.3924 0.9150 0.6912 0.0708  0.0554  0.1640  109 PHE B CE2 
1754 C CZ  . PHE B 111 ? 0.4070 0.9304 0.6820 0.0351  0.0466  0.1611  109 PHE B CZ  
1755 N N   . GLN B 112 ? 0.5772 0.9937 0.7865 0.0672  0.1243  0.1070  110 GLN B N   
1756 C CA  . GLN B 112 ? 0.6577 1.0444 0.8359 0.0561  0.1377  0.0926  110 GLN B CA  
1757 C C   . GLN B 112 ? 0.7309 1.0415 0.8872 0.0679  0.1311  0.0879  110 GLN B C   
1758 O O   . GLN B 112 ? 0.7493 1.0451 0.9298 0.0977  0.1293  0.0911  110 GLN B O   
1759 C CB  . GLN B 112 ? 0.6317 1.0763 0.8437 0.0752  0.1645  0.0831  110 GLN B CB  
1760 C CG  . GLN B 112 ? 0.6585 1.0899 0.8394 0.0569  0.1830  0.0651  110 GLN B CG  
1761 C CD  . GLN B 112 ? 0.6329 1.0696 0.7686 0.0072  0.1798  0.0630  110 GLN B CD  
1762 O OE1 . GLN B 112 ? 0.7152 1.1139 0.8062 -0.0171 0.1845  0.0532  110 GLN B OE1 
1763 N NE2 . GLN B 112 ? 0.5426 1.0250 0.6856 -0.0108 0.1720  0.0724  110 GLN B NE2 
1764 N N   . GLY B 113 ? 0.8213 1.0853 0.9289 0.0421  0.1272  0.0807  111 GLY B N   
1765 C CA  . GLY B 113 ? 0.8612 1.0619 0.9443 0.0484  0.1222  0.0741  111 GLY B CA  
1766 C C   . GLY B 113 ? 0.8765 1.0213 0.9295 0.0390  0.0944  0.0794  111 GLY B C   
1767 O O   . GLY B 113 ? 0.9016 1.0065 0.9471 0.0510  0.0892  0.0744  111 GLY B O   
1768 N N   . VAL B 114 ? 0.7874 0.9284 0.8223 0.0181  0.0772  0.0876  112 VAL B N   
1769 C CA  . VAL B 114 ? 0.7695 0.8562 0.7769 0.0133  0.0507  0.0904  112 VAL B CA  
1770 C C   . VAL B 114 ? 0.7921 0.8286 0.7515 -0.0006 0.0449  0.0850  112 VAL B C   
1771 O O   . VAL B 114 ? 0.8377 0.8718 0.7636 -0.0259 0.0527  0.0840  112 VAL B O   
1772 C CB  . VAL B 114 ? 0.7271 0.8129 0.7209 -0.0066 0.0354  0.0987  112 VAL B CB  
1773 C CG1 . VAL B 114 ? 0.6668 0.6900 0.6279 -0.0094 0.0081  0.0994  112 VAL B CG1 
1774 C CG2 . VAL B 114 ? 0.6921 0.8264 0.7314 0.0060  0.0378  0.1039  112 VAL B CG2 
1775 N N   . ASP B 115 ? 0.7557 0.7557 0.7099 0.0134  0.0307  0.0814  113 ASP B N   
1776 C CA  . ASP B 115 ? 0.7898 0.7455 0.7000 0.0024  0.0210  0.0774  113 ASP B CA  
1777 C C   . ASP B 115 ? 0.8088 0.7207 0.6816 -0.0093 -0.0088 0.0852  113 ASP B C   
1778 O O   . ASP B 115 ? 0.8782 0.7549 0.7044 -0.0263 -0.0181 0.0871  113 ASP B O   
1779 C CB  . ASP B 115 ? 0.8161 0.7603 0.7386 0.0220  0.0214  0.0677  113 ASP B CB  
1780 C CG  . ASP B 115 ? 0.8281 0.7937 0.7683 0.0295  0.0518  0.0578  113 ASP B CG  
1781 O OD1 . ASP B 115 ? 0.8733 0.8439 0.7920 0.0124  0.0683  0.0535  113 ASP B OD1 
1782 O OD2 . ASP B 115 ? 0.7697 0.7447 0.7429 0.0514  0.0593  0.0538  113 ASP B OD2 
1783 N N   . VAL B 116 ? 0.7912 0.7004 0.6815 0.0008  -0.0253 0.0893  114 VAL B N   
1784 C CA  . VAL B 116 ? 0.7619 0.6238 0.6154 -0.0081 -0.0525 0.0959  114 VAL B CA  
1785 C C   . VAL B 116 ? 0.7424 0.6142 0.6150 -0.0076 -0.0583 0.0994  114 VAL B C   
1786 O O   . VAL B 116 ? 0.6847 0.5945 0.6037 0.0087  -0.0515 0.0954  114 VAL B O   
1787 C CB  . VAL B 116 ? 0.7558 0.5855 0.6010 0.0098  -0.0761 0.0912  114 VAL B CB  
1788 C CG1 . VAL B 116 ? 0.6860 0.5428 0.5807 0.0360  -0.0778 0.0818  114 VAL B CG1 
1789 C CG2 . VAL B 116 ? 0.8367 0.6110 0.6395 0.0043  -0.1057 0.0992  114 VAL B CG2 
1790 N N   . ILE B 117 ? 0.7563 0.5894 0.5879 -0.0278 -0.0713 0.1070  115 ILE B N   
1791 C CA  . ILE B 117 ? 0.7226 0.5546 0.5618 -0.0326 -0.0775 0.1088  115 ILE B CA  
1792 C C   . ILE B 117 ? 0.7420 0.5162 0.5618 -0.0193 -0.1070 0.1073  115 ILE B C   
1793 O O   . ILE B 117 ? 0.7912 0.5084 0.5621 -0.0257 -0.1242 0.1135  115 ILE B O   
1794 C CB  . ILE B 117 ? 0.7476 0.5788 0.5529 -0.0692 -0.0672 0.1165  115 ILE B CB  
1795 C CG1 . ILE B 117 ? 0.7245 0.6272 0.5592 -0.0784 -0.0375 0.1154  115 ILE B CG1 
1796 C CG2 . ILE B 117 ? 0.7650 0.5835 0.5689 -0.0773 -0.0756 0.1168  115 ILE B CG2 
1797 C CD1 . ILE B 117 ? 0.6735 0.5960 0.4865 -0.1152 -0.0257 0.1200  115 ILE B CD1 
1798 N N   . VAL B 118 ? 0.7351 0.5246 0.5920 -0.0012 -0.1130 0.0990  116 VAL B N   
1799 C CA  . VAL B 118 ? 0.7530 0.4992 0.6042 0.0177  -0.1389 0.0925  116 VAL B CA  
1800 C C   . VAL B 118 ? 0.8138 0.5489 0.6626 0.0058  -0.1398 0.0905  116 VAL B C   
1801 O O   . VAL B 118 ? 0.8193 0.6066 0.7083 0.0042  -0.1256 0.0852  116 VAL B O   
1802 C CB  . VAL B 118 ? 0.6974 0.4774 0.5971 0.0487  -0.1435 0.0786  116 VAL B CB  
1803 C CG1 . VAL B 118 ? 0.6674 0.4141 0.5682 0.0690  -0.1683 0.0681  116 VAL B CG1 
1804 C CG2 . VAL B 118 ? 0.7226 0.5126 0.6218 0.0576  -0.1415 0.0784  116 VAL B CG2 
1805 N N   . ASN B 119 ? 0.8445 0.5096 0.6443 -0.0032 -0.1568 0.0949  117 ASN B N   
1806 C CA  . ASN B 119 ? 0.8685 0.5127 0.6604 -0.0155 -0.1579 0.0903  117 ASN B CA  
1807 C C   . ASN B 119 ? 0.8491 0.4856 0.6721 0.0169  -0.1741 0.0734  117 ASN B C   
1808 O O   . ASN B 119 ? 0.8814 0.4915 0.7037 0.0452  -0.1943 0.0694  117 ASN B O   
1809 C CB  . ASN B 119 ? 0.9666 0.5296 0.6860 -0.0419 -0.1677 0.1016  117 ASN B CB  
1810 C CG  . ASN B 119 ? 1.0172 0.5880 0.7005 -0.0766 -0.1526 0.1163  117 ASN B CG  
1811 O OD1 . ASN B 119 ? 0.9961 0.6393 0.7099 -0.0902 -0.1285 0.1164  117 ASN B OD1 
1812 N ND2 . ASN B 119 ? 1.1288 0.6260 0.7462 -0.0908 -0.1670 0.1286  117 ASN B ND2 
1813 N N   . ALA B 120 ? 0.8016 0.4713 0.6556 0.0122  -0.1643 0.0621  118 ALA B N   
1814 C CA  . ALA B 120 ? 0.7357 0.4143 0.6270 0.0410  -0.1753 0.0421  118 ALA B CA  
1815 C C   . ALA B 120 ? 0.7760 0.4515 0.6696 0.0251  -0.1688 0.0310  118 ALA B C   
1816 O O   . ALA B 120 ? 0.7937 0.5110 0.6940 -0.0037 -0.1493 0.0359  118 ALA B O   
1817 C CB  . ALA B 120 ? 0.6556 0.4114 0.6050 0.0582  -0.1664 0.0343  118 ALA B CB  
1818 N N   . SER B 121 ? 0.4538 0.5793 1.2859 0.1258  0.0678  0.1442  119 SER B N   
1819 C CA  . SER B 121 ? 0.4509 0.5980 1.2793 0.1314  0.0817  0.1186  119 SER B CA  
1820 C C   . SER B 121 ? 0.4772 0.6979 1.3334 0.1359  0.0763  0.1047  119 SER B C   
1821 O O   . SER B 121 ? 0.5085 0.7593 1.3667 0.1385  0.0906  0.0806  119 SER B O   
1822 C CB  . SER B 121 ? 0.4851 0.5891 1.3082 0.1509  0.0788  0.1110  119 SER B CB  
1823 O OG  . SER B 121 ? 0.5833 0.6230 1.3784 0.1419  0.0902  0.1214  119 SER B OG  
1824 N N   . SER B 122 ? 0.4512 0.7062 1.3323 0.1348  0.0576  0.1170  120 SER B N   
1825 C CA  . SER B 122 ? 0.4604 0.7959 1.3733 0.1329  0.0563  0.1018  120 SER B CA  
1826 C C   . SER B 122 ? 0.4793 0.8421 1.3927 0.1075  0.0477  0.1232  120 SER B C   
1827 O O   . SER B 122 ? 0.4769 0.7958 1.3763 0.0993  0.0360  0.1487  120 SER B O   
1828 C CB  . SER B 122 ? 0.4671 0.8233 1.4245 0.1598  0.0341  0.0905  120 SER B CB  
1829 O OG  . SER B 122 ? 0.4950 0.8339 1.4633 0.1594  0.0033  0.1183  120 SER B OG  
1830 N N   . VAL B 123 ? 0.5072 0.9475 1.4396 0.0921  0.0542  0.1108  121 VAL B N   
1831 C CA  . VAL B 123 ? 0.5236 0.9944 1.4606 0.0662  0.0404  0.1309  121 VAL B CA  
1832 C C   . VAL B 123 ? 0.5442 1.0031 1.5069 0.0810  0.0098  0.1461  121 VAL B C   
1833 O O   . VAL B 123 ? 0.5350 0.9708 1.4874 0.0655  -0.0086 0.1733  121 VAL B O   
1834 C CB  . VAL B 123 ? 0.5993 1.1649 1.5551 0.0417  0.0552  0.1116  121 VAL B CB  
1835 C CG1 . VAL B 123 ? 0.6229 1.2042 1.5635 0.0020  0.0435  0.1368  121 VAL B CG1 
1836 C CG2 . VAL B 123 ? 0.6176 1.2024 1.5578 0.0334  0.0842  0.0900  121 VAL B CG2 
1837 N N   . GLU B 124 ? 0.5572 1.0250 1.5550 0.1111  -0.0012 0.1294  122 GLU B N   
1838 C CA  . GLU B 124 ? 0.6018 1.0604 1.6293 0.1243  -0.0400 0.1447  122 GLU B CA  
1839 C C   . GLU B 124 ? 0.6158 0.9900 1.6116 0.1244  -0.0630 0.1807  122 GLU B C   
1840 O O   . GLU B 124 ? 0.6581 1.0212 1.6643 0.1233  -0.1007 0.2030  122 GLU B O   
1841 C CB  . GLU B 124 ? 0.6360 1.1097 1.7109 0.1586  -0.0542 0.1187  122 GLU B CB  
1842 N N   . ASP B 125 ? 0.6146 0.9314 1.5723 0.1236  -0.0423 0.1855  123 ASP B N   
1843 C CA  . ASP B 125 ? 0.6014 0.8452 1.5316 0.1208  -0.0570 0.2155  123 ASP B CA  
1844 C C   . ASP B 125 ? 0.5649 0.8064 1.4643 0.0881  -0.0575 0.2292  123 ASP B C   
1845 O O   . ASP B 125 ? 0.5968 0.7645 1.4262 0.0714  -0.0639 0.2389  123 ASP B O   
1846 C CB  . ASP B 125 ? 0.6218 0.8059 1.5199 0.1271  -0.0285 0.2084  123 ASP B CB  
1847 C CG  . ASP B 125 ? 0.7224 0.8853 1.6229 0.1518  -0.0324 0.1929  123 ASP B CG  
1848 O OD1 . ASP B 125 ? 0.7979 0.9635 1.7218 0.1680  -0.0690 0.1966  123 ASP B OD1 
1849 O OD2 . ASP B 125 ? 0.7496 0.8897 1.6303 0.1541  -0.0039 0.1762  123 ASP B OD2 
1850 N N   . ILE B 126 ? 0.5066 0.8174 1.4386 0.0716  -0.0500 0.2252  124 ILE B N   
1851 C CA  . ILE B 126 ? 0.5019 0.8042 1.4078 0.0392  -0.0540 0.2361  124 ILE B CA  
1852 C C   . ILE B 126 ? 0.5203 0.8704 1.4501 0.0249  -0.0853 0.2497  124 ILE B C   
1853 O O   . ILE B 126 ? 0.5267 0.9305 1.4666 0.0060  -0.0801 0.2448  124 ILE B O   
1854 C CB  . ILE B 126 ? 0.4476 0.7686 1.3511 0.0221  -0.0290 0.2258  124 ILE B CB  
1855 C CG1 . ILE B 126 ? 0.4431 0.7223 1.3314 0.0374  -0.0015 0.2104  124 ILE B CG1 
1856 C CG2 . ILE B 126 ? 0.4438 0.7465 1.3374 -0.0086 -0.0417 0.2376  124 ILE B CG2 
1857 C CD1 . ILE B 126 ? 0.4244 0.7086 1.2943 0.0216  0.0136  0.1999  124 ILE B CD1 
1858 N N   . ASP B 127 ? 0.5448 0.8540 1.4451 0.0267  -0.1168 0.2620  125 ASP B N   
1859 C CA  . ASP B 127 ? 0.5782 0.9267 1.5006 0.0123  -0.1519 0.2752  125 ASP B CA  
1860 C C   . ASP B 127 ? 0.5703 0.8734 1.4356 -0.0217 -0.1595 0.2835  125 ASP B C   
1861 O O   . ASP B 127 ? 0.6014 0.8245 1.3968 -0.0293 -0.1659 0.2848  125 ASP B O   
1862 C CB  . ASP B 127 ? 0.6677 0.9965 1.5947 0.0317  -0.1931 0.2852  125 ASP B CB  
1863 C CG  . ASP B 127 ? 0.7571 1.1347 1.7203 0.0178  -0.2333 0.2970  125 ASP B CG  
1864 O OD1 . ASP B 127 ? 0.7428 1.1887 1.7409 -0.0031 -0.2210 0.2921  125 ASP B OD1 
1865 O OD2 . ASP B 127 ? 0.8409 1.1801 1.7860 0.0229  -0.2790 0.3114  125 ASP B OD2 
1866 N N   . ALA B 128 ? 0.5357 0.8890 1.4298 -0.0464 -0.1591 0.2867  126 ALA B N   
1867 C CA  . ALA B 128 ? 0.5737 0.8857 1.4289 -0.0776 -0.1719 0.2917  126 ALA B CA  
1868 C C   . ALA B 128 ? 0.6568 0.9273 1.4695 -0.0859 -0.2055 0.2999  126 ALA B C   
1869 O O   . ALA B 128 ? 0.7154 0.9141 1.4676 -0.1014 -0.2057 0.2919  126 ALA B O   
1870 C CB  . ALA B 128 ? 0.5178 0.8928 1.4136 -0.1069 -0.1791 0.3015  126 ALA B CB  
1871 N N   . GLY B 129 ? 0.6536 0.9685 1.4998 -0.0769 -0.2351 0.3117  127 GLY B N   
1872 C CA  . GLY B 129 ? 0.6899 0.9589 1.4892 -0.0865 -0.2752 0.3229  127 GLY B CA  
1873 C C   . GLY B 129 ? 0.7496 0.9243 1.4646 -0.0802 -0.2704 0.3197  127 GLY B C   
1874 O O   . GLY B 129 ? 0.7994 0.9039 1.4339 -0.1059 -0.2756 0.3162  127 GLY B O   
1875 N N   . ALA B 130 ? 0.7192 0.8908 1.4490 -0.0504 -0.2582 0.3179  128 ALA B N   
1876 C CA  . ALA B 130 ? 0.7822 0.8624 1.4274 -0.0504 -0.2546 0.3186  128 ALA B CA  
1877 C C   . ALA B 130 ? 0.7792 0.8016 1.3572 -0.0743 -0.2117 0.2972  128 ALA B C   
1878 O O   . ALA B 130 ? 0.8547 0.8017 1.3395 -0.1019 -0.2134 0.2935  128 ALA B O   
1879 C CB  . ALA B 130 ? 0.6770 0.7686 1.3638 -0.0140 -0.2445 0.3172  128 ALA B CB  
1880 N N   . ILE B 131 ? 0.6803 0.7392 1.3077 -0.0677 -0.1747 0.2797  129 ILE B N   
1881 C CA  . ILE B 131 ? 0.6970 0.7109 1.2906 -0.0850 -0.1379 0.2528  129 ILE B CA  
1882 C C   . ILE B 131 ? 0.7961 0.7788 1.3482 -0.1185 -0.1519 0.2433  129 ILE B C   
1883 O O   . ILE B 131 ? 0.8276 0.7476 1.3133 -0.1410 -0.1317 0.2191  129 ILE B O   
1884 C CB  . ILE B 131 ? 0.6348 0.6959 1.3007 -0.0720 -0.1128 0.2420  129 ILE B CB  
1885 C CG1 . ILE B 131 ? 0.6007 0.6732 1.2883 -0.0434 -0.0892 0.2406  129 ILE B CG1 
1886 C CG2 . ILE B 131 ? 0.6407 0.6668 1.3027 -0.0904 -0.0927 0.2135  129 ILE B CG2 
1887 C CD1 . ILE B 131 ? 0.5150 0.6428 1.2693 -0.0326 -0.0729 0.2364  129 ILE B CD1 
1888 N N   . GLY B 132 ? 0.8252 0.8524 1.4150 -0.1261 -0.1849 0.2586  130 GLY B N   
1889 C CA  . GLY B 132 ? 0.9153 0.9112 1.4680 -0.1578 -0.2027 0.2491  130 GLY B CA  
1890 C C   . GLY B 132 ? 1.0617 0.9945 1.5166 -0.1793 -0.2182 0.2505  130 GLY B C   
1891 O O   . GLY B 132 ? 1.1097 0.9878 1.5026 -0.2088 -0.2048 0.2228  130 GLY B O   
1892 N N   . GLN B 133 ? 1.2156 1.1529 1.6560 -0.1675 -0.2492 0.2805  131 GLN B N   
1893 C CA  . GLN B 133 ? 1.3382 1.2041 1.6729 -0.1931 -0.2750 0.2906  131 GLN B CA  
1894 C C   . GLN B 133 ? 1.3943 1.1864 1.6400 -0.2128 -0.2300 0.2656  131 GLN B C   
1895 O O   . GLN B 133 ? 1.5109 1.2368 1.6507 -0.2550 -0.2297 0.2535  131 GLN B O   
1896 C CB  . GLN B 133 ? 1.3656 1.2463 1.7199 -0.1708 -0.3248 0.3283  131 GLN B CB  
1897 N N   . ARG B 134 ? 1.3001 1.1047 1.5850 -0.1878 -0.1893 0.2544  132 ARG B N   
1898 C CA  . ARG B 134 ? 1.3219 1.0652 1.5333 -0.2093 -0.1414 0.2268  132 ARG B CA  
1899 C C   . ARG B 134 ? 1.3189 1.0404 1.5034 -0.2429 -0.1040 0.1779  132 ARG B C   
1900 O O   . ARG B 134 ? 1.4517 1.1146 1.5436 -0.2815 -0.0719 0.1507  132 ARG B O   
1901 C CB  . ARG B 134 ? 1.2544 1.0235 1.5294 -0.1750 -0.1055 0.2203  132 ARG B CB  
1902 C CG  . ARG B 134 ? 1.2533 1.0246 1.5392 -0.1467 -0.1348 0.2574  132 ARG B CG  
1903 C CD  . ARG B 134 ? 1.1689 0.9713 1.5240 -0.1122 -0.0999 0.2478  132 ARG B CD  
1904 N NE  . ARG B 134 ? 1.2031 0.9490 1.4983 -0.1320 -0.0538 0.2247  132 ARG B NE  
1905 C CZ  . ARG B 134 ? 1.1374 0.8944 1.4749 -0.1096 -0.0219 0.2141  132 ARG B CZ  
1906 N NH1 . ARG B 134 ? 1.1612 0.8690 1.4448 -0.1336 0.0208  0.1911  132 ARG B NH1 
1907 N NH2 . ARG B 134 ? 1.0404 0.8604 1.4726 -0.0677 -0.0303 0.2236  132 ARG B NH2 
1908 N N   . LEU B 135 ? 1.1640 0.9307 1.4297 -0.2321 -0.1073 0.1630  133 LEU B N   
1909 C CA  . LEU B 135 ? 1.1184 0.8667 1.3846 -0.2569 -0.0777 0.1105  133 LEU B CA  
1910 C C   . LEU B 135 ? 1.1821 0.8880 1.3586 -0.3009 -0.0982 0.1008  133 LEU B C   
1911 O O   . LEU B 135 ? 1.1693 0.8920 1.3518 -0.3019 -0.1486 0.1310  133 LEU B O   
1912 C CB  . LEU B 135 ? 1.0239 0.8242 1.4092 -0.2312 -0.0863 0.1039  133 LEU B CB  
1913 C CG  . LEU B 135 ? 0.9603 0.7979 1.4252 -0.1945 -0.0664 0.1101  133 LEU B CG  
1914 C CD1 . LEU B 135 ? 0.7197 0.6161 1.2774 -0.1722 -0.0976 0.1373  133 LEU B CD1 
1915 C CD2 . LEU B 135 ? 0.9194 0.7335 1.4066 -0.1981 -0.0155 0.0550  133 LEU B CD2 
1916 N N   . ASN C 5   ? 1.3591 0.7036 1.0149 0.2503  0.1367  -0.0007 87  ASN C N   
1917 C CA  . ASN C 5   ? 1.2979 0.6968 0.9798 0.2159  0.1161  0.0015  87  ASN C CA  
1918 C C   . ASN C 5   ? 1.2118 0.6855 0.9627 0.2206  0.1122  0.0201  87  ASN C C   
1919 O O   . ASN C 5   ? 1.2247 0.7071 1.0068 0.2430  0.1147  0.0364  87  ASN C O   
1920 C CB  . ASN C 5   ? 1.3455 0.7109 0.9977 0.1868  0.0932  0.0003  87  ASN C CB  
1921 C CG  . ASN C 5   ? 1.4149 0.7380 1.0121 0.1619  0.0874  -0.0181 87  ASN C CG  
1922 O OD1 . ASN C 5   ? 1.3795 0.7271 0.9780 0.1295  0.0717  -0.0208 87  ASN C OD1 
1923 N ND2 . ASN C 5   ? 1.4943 0.7538 1.0422 0.1775  0.1003  -0.0304 87  ASN C ND2 
1924 N N   . ASP C 6   ? 1.1197 0.6449 0.8925 0.1985  0.1044  0.0178  88  ASP C N   
1925 C CA  . ASP C 6   ? 1.0238 0.6152 0.8535 0.1955  0.0966  0.0326  88  ASP C CA  
1926 C C   . ASP C 6   ? 0.9948 0.5882 0.8347 0.1844  0.0759  0.0456  88  ASP C C   
1927 O O   . ASP C 6   ? 1.0140 0.5696 0.8180 0.1675  0.0645  0.0410  88  ASP C O   
1928 C CB  . ASP C 6   ? 0.9749 0.6049 0.8111 0.1717  0.0919  0.0238  88  ASP C CB  
1929 C CG  . ASP C 6   ? 0.9283 0.6206 0.8169 0.1678  0.0849  0.0365  88  ASP C CG  
1930 O OD1 . ASP C 6   ? 0.9410 0.6524 0.8643 0.1809  0.0813  0.0535  88  ASP C OD1 
1931 O OD2 . ASP C 6   ? 0.8838 0.6043 0.7779 0.1509  0.0817  0.0299  88  ASP C OD2 
1932 N N   . PHE C 7   ? 0.9255 0.5634 0.8140 0.1925  0.0698  0.0636  89  PHE C N   
1933 C CA  . PHE C 7   ? 0.8926 0.5344 0.7889 0.1812  0.0483  0.0774  89  PHE C CA  
1934 C C   . PHE C 7   ? 0.8393 0.5213 0.7459 0.1521  0.0321  0.0768  89  PHE C C   
1935 O O   . PHE C 7   ? 0.8253 0.5031 0.7222 0.1358  0.0145  0.0836  89  PHE C O   
1936 C CB  . PHE C 7   ? 0.8385 0.4987 0.7784 0.2076  0.0471  0.1003  89  PHE C CB  
1937 N N   . TYR C 8   ? 0.8297 0.5459 0.7508 0.1454  0.0383  0.0685  90  TYR C N   
1938 C CA  . TYR C 8   ? 0.7953 0.5448 0.7238 0.1209  0.0251  0.0668  90  TYR C CA  
1939 C C   . TYR C 8   ? 0.7752 0.5131 0.6704 0.1007  0.0280  0.0482  90  TYR C C   
1940 O O   . TYR C 8   ? 0.7829 0.5079 0.6646 0.1060  0.0415  0.0364  90  TYR C O   
1941 C CB  . TYR C 8   ? 0.7967 0.5939 0.7684 0.1263  0.0274  0.0732  90  TYR C CB  
1942 C CG  . TYR C 8   ? 0.8085 0.6288 0.8222 0.1419  0.0204  0.0952  90  TYR C CG  
1943 C CD1 . TYR C 8   ? 0.8231 0.6416 0.8595 0.1713  0.0361  0.1043  90  TYR C CD1 
1944 C CD2 . TYR C 8   ? 0.7743 0.6184 0.8047 0.1277  -0.0018 0.1079  90  TYR C CD2 
1945 C CE1 . TYR C 8   ? 0.8180 0.6646 0.9008 0.1868  0.0296  0.1275  90  TYR C CE1 
1946 C CE2 . TYR C 8   ? 0.7790 0.6478 0.8510 0.1400  -0.0117 0.1303  90  TYR C CE2 
1947 C CZ  . TYR C 8   ? 0.8028 0.6762 0.9050 0.1697  0.0038  0.1411  90  TYR C CZ  
1948 O OH  . TYR C 8   ? 0.8185 0.7236 0.9698 0.1823  -0.0070 0.1665  90  TYR C OH  
1949 N N   . CYS C 9   ? 0.7520 0.4964 0.6347 0.0781  0.0155  0.0468  91  CYS C N   
1950 C CA  . CYS C 9   ? 0.7469 0.4865 0.6042 0.0589  0.0177  0.0326  91  CYS C CA  
1951 C C   . CYS C 9   ? 0.7427 0.5084 0.6135 0.0595  0.0268  0.0225  91  CYS C C   
1952 O O   . CYS C 9   ? 0.7677 0.5635 0.6662 0.0641  0.0262  0.0267  91  CYS C O   
1953 C CB  . CYS C 9   ? 0.7697 0.5170 0.6156 0.0380  0.0058  0.0354  91  CYS C CB  
1954 S SG  . CYS C 9   ? 0.8656 0.6219 0.6932 0.0166  0.0104  0.0216  91  CYS C SG  
1955 N N   . TRP C 10  ? 0.7245 0.4779 0.5751 0.0530  0.0334  0.0103  92  TRP C N   
1956 C CA  . TRP C 10  ? 0.6701 0.4443 0.5300 0.0540  0.0411  0.0017  92  TRP C CA  
1957 C C   . TRP C 10  ? 0.6296 0.4356 0.5018 0.0411  0.0364  -0.0003 92  TRP C C   
1958 O O   . TRP C 10  ? 0.6374 0.4641 0.5250 0.0447  0.0410  -0.0035 92  TRP C O   
1959 C CB  . TRP C 10  ? 0.6766 0.4272 0.5089 0.0485  0.0454  -0.0091 92  TRP C CB  
1960 C CG  . TRP C 10  ? 0.6847 0.4514 0.5213 0.0498  0.0520  -0.0168 92  TRP C CG  
1961 C CD1 . TRP C 10  ? 0.6446 0.4266 0.4785 0.0356  0.0490  -0.0231 92  TRP C CD1 
1962 C CD2 . TRP C 10  ? 0.7191 0.4883 0.5635 0.0670  0.0633  -0.0173 92  TRP C CD2 
1963 N NE1 . TRP C 10  ? 0.6310 0.4222 0.4688 0.0425  0.0554  -0.0275 92  TRP C NE1 
1964 C CE2 . TRP C 10  ? 0.6852 0.4682 0.5276 0.0608  0.0648  -0.0242 92  TRP C CE2 
1965 C CE3 . TRP C 10  ? 0.7209 0.4839 0.5755 0.0878  0.0735  -0.0109 92  TRP C CE3 
1966 C CZ2 . TRP C 10  ? 0.6989 0.4864 0.5443 0.0729  0.0754  -0.0252 92  TRP C CZ2 
1967 C CZ3 . TRP C 10  ? 0.6849 0.4555 0.5450 0.1004  0.0864  -0.0119 92  TRP C CZ3 
1968 C CH2 . TRP C 10  ? 0.7054 0.4865 0.5585 0.0920  0.0870  -0.0192 92  TRP C CH2 
1969 N N   . VAL C 11  ? 0.6507 0.4581 0.5135 0.0268  0.0285  0.0015  93  VAL C N   
1970 C CA  . VAL C 11  ? 0.6455 0.4759 0.5118 0.0159  0.0270  -0.0025 93  VAL C CA  
1971 C C   . VAL C 11  ? 0.6479 0.4909 0.5263 0.0164  0.0190  0.0043  93  VAL C C   
1972 O O   . VAL C 11  ? 0.5935 0.4538 0.4843 0.0169  0.0194  0.0013  93  VAL C O   
1973 C CB  . VAL C 11  ? 0.6045 0.4302 0.4504 -0.0005 0.0263  -0.0050 93  VAL C CB  
1974 C CG1 . VAL C 11  ? 0.5144 0.3604 0.3615 -0.0076 0.0276  -0.0084 93  VAL C CG1 
1975 C CG2 . VAL C 11  ? 0.5497 0.3692 0.3880 -0.0049 0.0310  -0.0112 93  VAL C CG2 
1976 N N   . CYS C 12  ? 0.6825 0.5142 0.5552 0.0151  0.0096  0.0143  94  CYS C N   
1977 C CA  . CYS C 12  ? 0.6845 0.5254 0.5648 0.0125  -0.0026 0.0227  94  CYS C CA  
1978 C C   . CYS C 12  ? 0.7588 0.6078 0.6687 0.0264  -0.0078 0.0351  94  CYS C C   
1979 O O   . CYS C 12  ? 0.7680 0.6293 0.6904 0.0230  -0.0207 0.0438  94  CYS C O   
1980 C CB  . CYS C 12  ? 0.6982 0.5235 0.5521 0.0006  -0.0121 0.0287  94  CYS C CB  
1981 S SG  . CYS C 12  ? 0.7615 0.5611 0.6108 0.0078  -0.0189 0.0430  94  CYS C SG  
1982 N N   . HIS C 13  ? 0.7725 0.6143 0.6931 0.0419  0.0016  0.0369  95  HIS C N   
1983 C CA  . HIS C 13  ? 0.7004 0.5533 0.6534 0.0593  0.0023  0.0495  95  HIS C CA  
1984 C C   . HIS C 13  ? 0.7194 0.5701 0.6812 0.0617  -0.0129 0.0665  95  HIS C C   
1985 O O   . HIS C 13  ? 0.6983 0.5679 0.6953 0.0744  -0.0160 0.0809  95  HIS C O   
1986 C CB  . HIS C 13  ? 0.6583 0.5418 0.6406 0.0602  0.0039  0.0506  95  HIS C CB  
1987 C CG  . HIS C 13  ? 0.6694 0.5547 0.6393 0.0541  0.0141  0.0350  95  HIS C CG  
1988 N ND1 . HIS C 13  ? 0.6633 0.5380 0.6242 0.0629  0.0295  0.0263  95  HIS C ND1 
1989 C CD2 . HIS C 13  ? 0.6529 0.5462 0.6155 0.0408  0.0105  0.0270  95  HIS C CD2 
1990 C CE1 . HIS C 13  ? 0.6419 0.5225 0.5947 0.0550  0.0334  0.0154  95  HIS C CE1 
1991 N NE2 . HIS C 13  ? 0.6279 0.5195 0.5827 0.0429  0.0232  0.0155  95  HIS C NE2 
1992 N N   . ARG C 14  ? 0.7706 0.6004 0.7027 0.0498  -0.0226 0.0672  96  ARG C N   
1993 C CA  . ARG C 14  ? 0.7726 0.5951 0.7070 0.0515  -0.0386 0.0844  96  ARG C CA  
1994 C C   . ARG C 14  ? 0.7592 0.5477 0.6782 0.0629  -0.0329 0.0875  96  ARG C C   
1995 O O   . ARG C 14  ? 0.7399 0.5074 0.6390 0.0641  -0.0189 0.0747  96  ARG C O   
1996 C CB  . ARG C 14  ? 0.7573 0.5758 0.6635 0.0293  -0.0545 0.0849  96  ARG C CB  
1997 C CG  . ARG C 14  ? 0.7360 0.5794 0.6531 0.0183  -0.0649 0.0844  96  ARG C CG  
1998 C CD  . ARG C 14  ? 0.7578 0.5883 0.6355 -0.0028 -0.0789 0.0832  96  ARG C CD  
1999 N N   . GLU C 15  ? 0.8391 0.6197 0.7664 0.0710  -0.0455 0.1055  97  GLU C N   
2000 C CA  . GLU C 15  ? 0.8896 0.6319 0.8012 0.0837  -0.0416 0.1103  97  GLU C CA  
2001 C C   . GLU C 15  ? 0.9056 0.6169 0.7725 0.0629  -0.0503 0.1091  97  GLU C C   
2002 O O   . GLU C 15  ? 0.9051 0.6242 0.7513 0.0412  -0.0517 0.0995  97  GLU C O   
2003 C CB  . GLU C 15  ? 0.9767 0.7257 0.9225 0.1059  -0.0497 0.1324  97  GLU C CB  
2004 C CG  . GLU C 15  ? 1.0542 0.8245 1.0409 0.1318  -0.0334 0.1346  97  GLU C CG  
2005 C CD  . GLU C 15  ? 1.1318 0.9262 1.1652 0.1514  -0.0436 0.1602  97  GLU C CD  
2006 O OE1 . GLU C 15  ? 1.1805 0.9492 1.2167 0.1746  -0.0387 0.1703  97  GLU C OE1 
2007 O OE2 . GLU C 15  ? 1.1174 0.9552 1.1845 0.1430  -0.0575 0.1709  97  GLU C OE2 
2008 N N   . GLY C 16  ? 0.8841 0.5599 0.7360 0.0700  -0.0553 0.1200  98  GLY C N   
2009 C CA  . GLY C 16  ? 0.9290 0.5716 0.7379 0.0503  -0.0618 0.1209  98  GLY C CA  
2010 C C   . GLY C 16  ? 0.9341 0.5347 0.7167 0.0515  -0.0489 0.1106  98  GLY C C   
2011 O O   . GLY C 16  ? 0.9845 0.5779 0.7772 0.0685  -0.0351 0.1016  98  GLY C O   
2012 N N   . GLN C 17  ? 0.9786 0.5493 0.7241 0.0315  -0.0539 0.1125  99  GLN C N   
2013 C CA  . GLN C 17  ? 1.0280 0.5561 0.7459 0.0272  -0.0452 0.1035  99  GLN C CA  
2014 C C   . GLN C 17  ? 1.0209 0.5686 0.7381 0.0153  -0.0325 0.0838  99  GLN C C   
2015 O O   . GLN C 17  ? 1.0159 0.6000 0.7381 -0.0007 -0.0317 0.0788  99  GLN C O   
2016 C CB  . GLN C 17  ? 1.1672 0.6583 0.8477 0.0065  -0.0547 0.1136  99  GLN C CB  
2017 C CG  . GLN C 17  ? 1.2848 0.8011 0.9519 -0.0209 -0.0595 0.1164  99  GLN C CG  
2018 C CD  . GLN C 17  ? 1.4209 0.9027 1.0498 -0.0461 -0.0614 0.1216  99  GLN C CD  
2019 O OE1 . GLN C 17  ? 1.4967 0.9321 1.1080 -0.0451 -0.0614 0.1223  99  GLN C OE1 
2020 N NE2 . GLN C 17  ? 1.4271 0.9286 1.0409 -0.0692 -0.0626 0.1262  99  GLN C NE2 
2021 N N   . VAL C 18  ? 1.0170 0.5382 0.7265 0.0249  -0.0227 0.0729  100 VAL C N   
2022 C CA  . VAL C 18  ? 0.9409 0.4797 0.6529 0.0189  -0.0120 0.0555  100 VAL C CA  
2023 C C   . VAL C 18  ? 0.9734 0.4627 0.6511 0.0110  -0.0097 0.0471  100 VAL C C   
2024 O O   . VAL C 18  ? 1.0066 0.4439 0.6613 0.0186  -0.0128 0.0524  100 VAL C O   
2025 C CB  . VAL C 18  ? 0.8720 0.4374 0.6149 0.0436  -0.0016 0.0497  100 VAL C CB  
2026 C CG1 . VAL C 18  ? 0.7545 0.3721 0.5311 0.0450  -0.0057 0.0558  100 VAL C CG1 
2027 C CG2 . VAL C 18  ? 0.8305 0.3613 0.5742 0.0731  0.0042  0.0544  100 VAL C CG2 
2028 N N   . LEU C 19  ? 0.9677 0.4717 0.6412 -0.0049 -0.0057 0.0345  101 LEU C N   
2029 C CA  . LEU C 19  ? 1.0088 0.4706 0.6515 -0.0127 -0.0049 0.0242  101 LEU C CA  
2030 C C   . LEU C 19  ? 1.0325 0.4906 0.6791 0.0110  0.0066  0.0123  101 LEU C C   
2031 O O   . LEU C 19  ? 0.9945 0.4993 0.6712 0.0205  0.0136  0.0090  101 LEU C O   
2032 C CB  . LEU C 19  ? 0.9661 0.4498 0.6050 -0.0440 -0.0089 0.0197  101 LEU C CB  
2033 C CG  . LEU C 19  ? 0.9477 0.4236 0.5725 -0.0728 -0.0181 0.0305  101 LEU C CG  
2034 C CD1 . LEU C 19  ? 0.8531 0.3781 0.5007 -0.0792 -0.0168 0.0397  101 LEU C CD1 
2035 C CD2 . LEU C 19  ? 0.9806 0.4570 0.5951 -0.0990 -0.0220 0.0245  101 LEU C CD2 
2036 N N   . CYS C 20  ? 1.0896 0.4880 0.7015 0.0201  0.0090  0.0061  102 CYS C N   
2037 C CA  . CYS C 20  ? 1.0925 0.4752 0.6976 0.0451  0.0226  -0.0048 102 CYS C CA  
2038 C C   . CYS C 20  ? 1.1029 0.4637 0.6751 0.0274  0.0203  -0.0195 102 CYS C C   
2039 O O   . CYS C 20  ? 1.1442 0.4523 0.6757 0.0097  0.0106  -0.0227 102 CYS C O   
2040 C CB  . CYS C 20  ? 1.1996 0.5241 0.7834 0.0728  0.0296  -0.0020 102 CYS C CB  
2041 S SG  . CYS C 20  ? 1.2719 0.6224 0.8978 0.0972  0.0305  0.0179  102 CYS C SG  
2042 N N   . CYS C 21  ? 1.0721 0.4706 0.6604 0.0316  0.0277  -0.0274 103 CYS C N   
2043 C CA  . CYS C 21  ? 1.0813 0.4577 0.6370 0.0194  0.0254  -0.0407 103 CYS C CA  
2044 C C   . CYS C 21  ? 1.1856 0.4836 0.6882 0.0344  0.0312  -0.0499 103 CYS C C   
2045 O O   . CYS C 21  ? 1.1795 0.4568 0.6825 0.0659  0.0458  -0.0479 103 CYS C O   
2046 C CB  . CYS C 21  ? 1.0382 0.4634 0.6188 0.0281  0.0346  -0.0459 103 CYS C CB  
2047 S SG  . CYS C 21  ? 1.0977 0.5120 0.6460 0.0042  0.0244  -0.0581 103 CYS C SG  
2048 N N   . GLU C 22  ? 1.3423 0.5960 0.7986 0.0115  0.0193  -0.0594 104 GLU C N   
2049 C CA  . GLU C 22  ? 1.4557 0.6237 0.8486 0.0209  0.0224  -0.0710 104 GLU C CA  
2050 C C   . GLU C 22  ? 1.4870 0.6430 0.8549 0.0379  0.0359  -0.0844 104 GLU C C   
2051 O O   . GLU C 22  ? 1.5690 0.6679 0.8949 0.0593  0.0478  -0.0922 104 GLU C O   
2052 C CB  . GLU C 22  ? 1.5917 0.7101 0.9404 -0.0164 -0.0007 -0.0740 104 GLU C CB  
2053 C CG  . GLU C 22  ? 1.7019 0.7874 1.0454 -0.0243 -0.0090 -0.0633 104 GLU C CG  
2054 C CD  . GLU C 22  ? 1.8389 0.8474 1.1319 -0.0083 -0.0051 -0.0689 104 GLU C CD  
2055 O OE1 . GLU C 22  ? 1.8891 0.8789 1.1545 0.0088  0.0055  -0.0805 104 GLU C OE1 
2056 O OE2 . GLU C 22  ? 1.8899 0.8710 1.1775 -0.0119 -0.0116 -0.0595 104 GLU C OE2 
2057 N N   . LEU C 23  ? 1.4330 0.6480 0.8283 0.0292  0.0346  -0.0854 105 LEU C N   
2058 C CA  . LEU C 23  ? 1.4159 0.6240 0.7878 0.0433  0.0469  -0.0962 105 LEU C CA  
2059 C C   . LEU C 23  ? 1.3163 0.5698 0.7307 0.0780  0.0719  -0.0910 105 LEU C C   
2060 O O   . LEU C 23  ? 1.3604 0.5803 0.7483 0.1065  0.0928  -0.0970 105 LEU C O   
2061 C CB  . LEU C 23  ? 1.4675 0.7106 0.8428 0.0137  0.0296  -0.0985 105 LEU C CB  
2062 C CG  . LEU C 23  ? 1.6040 0.8207 0.9343 0.0187  0.0343  -0.1107 105 LEU C CG  
2063 C CD1 . LEU C 23  ? 1.5689 0.8406 0.9362 0.0435  0.0552  -0.1078 105 LEU C CD1 
2064 C CD2 . LEU C 23  ? 1.7153 0.8507 0.9791 0.0318  0.0419  -0.1203 105 LEU C CD2 
2065 N N   . CYS C 24  ? 1.1769 0.5042 0.6550 0.0757  0.0706  -0.0793 106 CYS C N   
2066 C CA  . CYS C 24  ? 1.0835 0.4614 0.6080 0.1017  0.0895  -0.0720 106 CYS C CA  
2067 C C   . CYS C 24  ? 1.0511 0.4405 0.6115 0.1199  0.0955  -0.0594 106 CYS C C   
2068 O O   . CYS C 24  ? 1.0401 0.3971 0.5871 0.1127  0.0853  -0.0565 106 CYS C O   
2069 C CB  . CYS C 24  ? 0.9615 0.4092 0.5285 0.0856  0.0818  -0.0679 106 CYS C CB  
2070 S SG  . CYS C 24  ? 0.9946 0.4940 0.6125 0.0671  0.0666  -0.0558 106 CYS C SG  
2071 N N   . PRO C 25  ? 1.0376 0.4711 0.6431 0.1436  0.1111  -0.0501 107 PRO C N   
2072 C CA  . PRO C 25  ? 1.0607 0.5101 0.7042 0.1597  0.1132  -0.0354 107 PRO C CA  
2073 C C   . PRO C 25  ? 1.0640 0.5595 0.7464 0.1385  0.0944  -0.0252 107 PRO C C   
2074 O O   . PRO C 25  ? 1.0747 0.5711 0.7762 0.1460  0.0903  -0.0133 107 PRO C O   
2075 C CB  . PRO C 25  ? 1.0222 0.5084 0.7032 0.1889  0.1351  -0.0276 107 PRO C CB  
2076 C CG  . PRO C 25  ? 1.0437 0.5075 0.6878 0.1949  0.1497  -0.0403 107 PRO C CG  
2077 C CD  . PRO C 25  ? 1.0277 0.4822 0.6408 0.1616  0.1305  -0.0519 107 PRO C CD  
2078 N N   . ARG C 26  ? 1.0096 0.5409 0.7021 0.1138  0.0836  -0.0288 108 ARG C N   
2079 C CA  . ARG C 26  ? 0.9419 0.5218 0.6725 0.0986  0.0712  -0.0196 108 ARG C CA  
2080 C C   . ARG C 26  ? 0.9344 0.4935 0.6549 0.0850  0.0573  -0.0134 108 ARG C C   
2081 O O   . ARG C 26  ? 0.9610 0.4694 0.6427 0.0777  0.0526  -0.0178 108 ARG C O   
2082 C CB  . ARG C 26  ? 0.9331 0.5460 0.6691 0.0768  0.0644  -0.0260 108 ARG C CB  
2083 C CG  . ARG C 26  ? 0.9230 0.5723 0.6824 0.0867  0.0746  -0.0271 108 ARG C CG  
2084 C CD  . ARG C 26  ? 0.9147 0.5686 0.6577 0.0691  0.0691  -0.0366 108 ARG C CD  
2085 N NE  . ARG C 26  ? 0.8853 0.5679 0.6440 0.0762  0.0774  -0.0378 108 ARG C NE  
2086 C CZ  . ARG C 26  ? 0.9401 0.6033 0.6703 0.0779  0.0822  -0.0457 108 ARG C CZ  
2087 N NH1 . ARG C 26  ? 0.9649 0.5783 0.6494 0.0731  0.0788  -0.0536 108 ARG C NH1 
2088 N NH2 . ARG C 26  ? 0.9334 0.6217 0.6763 0.0836  0.0894  -0.0452 108 ARG C NH2 
2089 N N   . VAL C 27  ? 0.8789 0.4753 0.6314 0.0797  0.0495  -0.0026 109 VAL C N   
2090 C CA  . VAL C 27  ? 0.9007 0.4841 0.6443 0.0644  0.0363  0.0052  109 VAL C CA  
2091 C C   . VAL C 27  ? 0.8837 0.5136 0.6481 0.0448  0.0282  0.0080  109 VAL C C   
2092 O O   . VAL C 27  ? 0.8479 0.5186 0.6408 0.0496  0.0314  0.0081  109 VAL C O   
2093 C CB  . VAL C 27  ? 0.8830 0.4504 0.6364 0.0841  0.0354  0.0188  109 VAL C CB  
2094 C CG1 . VAL C 27  ? 0.8352 0.3447 0.5584 0.1022  0.0438  0.0152  109 VAL C CG1 
2095 C CG2 . VAL C 27  ? 0.8125 0.4248 0.6103 0.1025  0.0405  0.0274  109 VAL C CG2 
2096 N N   . TYR C 28  ? 0.8894 0.5102 0.6370 0.0225  0.0186  0.0106  110 TYR C N   
2097 C CA  . TYR C 28  ? 0.7959 0.4550 0.5557 0.0041  0.0141  0.0125  110 TYR C CA  
2098 C C   . TYR C 28  ? 0.8315 0.4794 0.5797 -0.0078 0.0049  0.0242  110 TYR C C   
2099 O O   . TYR C 28  ? 0.8743 0.4822 0.5981 -0.0133 0.0003  0.0285  110 TYR C O   
2100 C CB  . TYR C 28  ? 0.8152 0.4850 0.5669 -0.0154 0.0150  0.0038  110 TYR C CB  
2101 C CG  . TYR C 28  ? 0.8460 0.5315 0.6069 -0.0085 0.0218  -0.0069 110 TYR C CG  
2102 C CD1 . TYR C 28  ? 0.8822 0.5352 0.6251 0.0015  0.0253  -0.0135 110 TYR C CD1 
2103 C CD2 . TYR C 28  ? 0.7947 0.5230 0.5773 -0.0121 0.0248  -0.0104 110 TYR C CD2 
2104 C CE1 . TYR C 28  ? 0.8693 0.5346 0.6155 0.0064  0.0308  -0.0222 110 TYR C CE1 
2105 C CE2 . TYR C 28  ? 0.7621 0.5028 0.5515 -0.0065 0.0297  -0.0183 110 TYR C CE2 
2106 C CZ  . TYR C 28  ? 0.8163 0.5265 0.5871 0.0019  0.0321  -0.0237 110 TYR C CZ  
2107 O OH  . TYR C 28  ? 0.8570 0.5775 0.6299 0.0066  0.0363  -0.0306 110 TYR C OH  
2108 N N   . HIS C 29  ? 0.8582 0.5376 0.6192 -0.0131 0.0018  0.0291  111 HIS C N   
2109 C CA  . HIS C 29  ? 0.8975 0.5712 0.6413 -0.0301 -0.0051 0.0387  111 HIS C CA  
2110 C C   . HIS C 29  ? 0.9007 0.5809 0.6318 -0.0532 -0.0010 0.0346  111 HIS C C   
2111 O O   . HIS C 29  ? 0.9013 0.6108 0.6456 -0.0566 0.0061  0.0253  111 HIS C O   
2112 C CB  . HIS C 29  ? 0.8926 0.5948 0.6466 -0.0300 -0.0090 0.0433  111 HIS C CB  
2113 C CG  . HIS C 29  ? 0.9546 0.6569 0.7257 -0.0116 -0.0167 0.0517  111 HIS C CG  
2114 N ND1 . HIS C 29  ? 1.0027 0.7356 0.7983 -0.0034 -0.0174 0.0497  111 HIS C ND1 
2115 C CD2 . HIS C 29  ? 1.0050 0.6823 0.7754 0.0001  -0.0246 0.0640  111 HIS C CD2 
2116 C CE1 . HIS C 29  ? 0.9505 0.6819 0.7631 0.0111  -0.0260 0.0615  111 HIS C CE1 
2117 N NE2 . HIS C 29  ? 0.9988 0.6977 0.7976 0.0152  -0.0299 0.0704  111 HIS C NE2 
2118 N N   . ALA C 30  ? 0.9337 0.5884 0.6414 -0.0694 -0.0058 0.0435  112 ALA C N   
2119 C CA  . ALA C 30  ? 0.9207 0.5893 0.6217 -0.0937 -0.0017 0.0440  112 ALA C CA  
2120 C C   . ALA C 30  ? 0.8633 0.5772 0.5774 -0.0970 0.0069  0.0413  112 ALA C C   
2121 O O   . ALA C 30  ? 0.7862 0.5293 0.5140 -0.1042 0.0151  0.0351  112 ALA C O   
2122 C CB  . ALA C 30  ? 0.9742 0.6116 0.6484 -0.1116 -0.0078 0.0577  112 ALA C CB  
2123 N N   . LYS C 31  ? 0.8954 0.6132 0.6039 -0.0912 0.0044  0.0463  113 LYS C N   
2124 C CA  . LYS C 31  ? 0.8658 0.6165 0.5777 -0.0930 0.0126  0.0423  113 LYS C CA  
2125 C C   . LYS C 31  ? 0.8154 0.5944 0.5537 -0.0812 0.0196  0.0289  113 LYS C C   
2126 O O   . LYS C 31  ? 0.8067 0.6135 0.5509 -0.0849 0.0305  0.0235  113 LYS C O   
2127 C CB  . LYS C 31  ? 0.8735 0.6159 0.5712 -0.0877 0.0040  0.0488  113 LYS C CB  
2128 C CG  . LYS C 31  ? 0.9034 0.6524 0.6219 -0.0685 -0.0029 0.0438  113 LYS C CG  
2129 C CD  . LYS C 31  ? 0.9889 0.7328 0.6961 -0.0662 -0.0155 0.0517  113 LYS C CD  
2130 C CE  . LYS C 31  ? 1.0955 0.8121 0.7995 -0.0607 -0.0302 0.0663  113 LYS C CE  
2131 N NZ  . LYS C 31  ? 1.1090 0.8319 0.8308 -0.0476 -0.0441 0.0723  113 LYS C NZ  
2132 N N   . CYS C 32  ? 0.7499 0.5213 0.5034 -0.0661 0.0150  0.0241  114 CYS C N   
2133 C CA  . CYS C 32  ? 0.7166 0.5118 0.4928 -0.0545 0.0206  0.0132  114 CYS C CA  
2134 C C   . CYS C 32  ? 0.7226 0.5288 0.5084 -0.0599 0.0266  0.0069  114 CYS C C   
2135 O O   . CYS C 32  ? 0.7212 0.5529 0.5237 -0.0547 0.0328  -0.0006 114 CYS C O   
2136 C CB  . CYS C 32  ? 0.7373 0.5233 0.5265 -0.0361 0.0149  0.0129  114 CYS C CB  
2137 S SG  . CYS C 32  ? 0.7578 0.5477 0.5500 -0.0290 0.0051  0.0202  114 CYS C SG  
2138 N N   . LEU C 33  ? 0.7503 0.5360 0.5248 -0.0709 0.0230  0.0105  115 LEU C N   
2139 C CA  . LEU C 33  ? 0.7786 0.5775 0.5603 -0.0825 0.0253  0.0075  115 LEU C CA  
2140 C C   . LEU C 33  ? 0.7937 0.6213 0.5801 -0.0994 0.0324  0.0132  115 LEU C C   
2141 O O   . LEU C 33  ? 0.7410 0.5877 0.5402 -0.1106 0.0335  0.0138  115 LEU C O   
2142 C CB  . LEU C 33  ? 0.8268 0.5879 0.5907 -0.0908 0.0165  0.0092  115 LEU C CB  
2143 C CG  . LEU C 33  ? 0.8891 0.6204 0.6461 -0.0725 0.0135  0.0026  115 LEU C CG  
2144 C CD1 . LEU C 33  ? 0.9181 0.5998 0.6491 -0.0725 0.0068  0.0081  115 LEU C CD1 
2145 C CD2 . LEU C 33  ? 0.9541 0.6864 0.7119 -0.0755 0.0120  -0.0053 115 LEU C CD2 
2146 N N   . ARG C 34  ? 0.7685 0.6005 0.5449 -0.1015 0.0373  0.0185  116 ARG C N   
2147 C CA  . ARG C 34  ? 0.7615 0.6157 0.5367 -0.1175 0.0471  0.0261  116 ARG C CA  
2148 C C   . ARG C 34  ? 0.7499 0.5961 0.5226 -0.1397 0.0422  0.0355  116 ARG C C   
2149 O O   . ARG C 34  ? 0.7504 0.6285 0.5403 -0.1530 0.0493  0.0406  116 ARG C O   
2150 C CB  . ARG C 34  ? 0.8129 0.7097 0.6114 -0.1110 0.0608  0.0202  116 ARG C CB  
2151 C CG  . ARG C 34  ? 0.8803 0.7792 0.6839 -0.0898 0.0617  0.0089  116 ARG C CG  
2152 C CD  . ARG C 34  ? 0.9144 0.8491 0.7386 -0.0815 0.0753  0.0031  116 ARG C CD  
2153 N NE  . ARG C 34  ? 1.0033 0.9468 0.8128 -0.0815 0.0895  0.0042  116 ARG C NE  
2154 C CZ  . ARG C 34  ? 1.0471 0.9798 0.8401 -0.0699 0.0921  -0.0033 116 ARG C CZ  
2155 N NH1 . ARG C 34  ? 1.0468 0.9647 0.8423 -0.0585 0.0810  -0.0104 116 ARG C NH1 
2156 N NH2 . ARG C 34  ? 1.0615 0.9969 0.8333 -0.0707 0.1061  -0.0031 116 ARG C NH2 
2157 N N   . LEU C 35  ? 0.7401 0.5425 0.4919 -0.1437 0.0295  0.0390  117 LEU C N   
2158 C CA  . LEU C 35  ? 0.7734 0.5563 0.5149 -0.1671 0.0220  0.0485  117 LEU C CA  
2159 C C   . LEU C 35  ? 0.8032 0.6037 0.5404 -0.1875 0.0305  0.0627  117 LEU C C   
2160 O O   . LEU C 35  ? 0.8216 0.6263 0.5467 -0.1825 0.0386  0.0662  117 LEU C O   
2161 C CB  . LEU C 35  ? 0.8300 0.5546 0.5434 -0.1642 0.0088  0.0499  117 LEU C CB  
2162 C CG  . LEU C 35  ? 0.8537 0.5551 0.5669 -0.1495 0.0018  0.0378  117 LEU C CG  
2163 C CD1 . LEU C 35  ? 0.9271 0.5666 0.6095 -0.1495 -0.0091 0.0405  117 LEU C CD1 
2164 C CD2 . LEU C 35  ? 0.8022 0.5275 0.5320 -0.1612 0.0004  0.0332  117 LEU C CD2 
2165 N N   . THR C 36  ? 0.8120 0.6222 0.5574 -0.2122 0.0283  0.0721  118 THR C N   
2166 C CA  . THR C 36  ? 0.8748 0.6983 0.6152 -0.2348 0.0365  0.0889  118 THR C CA  
2167 C C   . THR C 36  ? 0.8266 0.6058 0.5432 -0.2596 0.0224  0.1013  118 THR C C   
2168 O O   . THR C 36  ? 0.9365 0.7212 0.6451 -0.2804 0.0284  0.1176  118 THR C O   
2169 C CB  . THR C 36  ? 0.8398 0.7255 0.6176 -0.2459 0.0503  0.0950  118 THR C CB  
2170 O OG1 . THR C 36  ? 0.8395 0.7322 0.6384 -0.2586 0.0372  0.0947  118 THR C OG1 
2171 C CG2 . THR C 36  ? 0.7189 0.6430 0.5150 -0.2206 0.0668  0.0840  118 THR C CG2 
2172 N N   . SER C 37  ? 0.8438 0.5765 0.5457 -0.2581 0.0050  0.0944  119 SER C N   
2173 C CA  . SER C 37  ? 1.0010 0.6766 0.6717 -0.2778 -0.0097 0.1040  119 SER C CA  
2174 C C   . SER C 37  ? 0.9697 0.5884 0.6169 -0.2565 -0.0218 0.0909  119 SER C C   
2175 O O   . SER C 37  ? 0.9617 0.5917 0.6209 -0.2309 -0.0187 0.0762  119 SER C O   
2176 C CB  . SER C 37  ? 0.9234 0.6065 0.6041 -0.3124 -0.0184 0.1139  119 SER C CB  
2177 O OG  . SER C 37  ? 0.8892 0.6126 0.6019 -0.3108 -0.0193 0.1052  119 SER C OG  
2178 N N   . GLU C 38  ? 1.0729 0.6312 0.6872 -0.2659 -0.0337 0.0972  120 GLU C N   
2179 C CA  . GLU C 38  ? 1.1207 0.6226 0.7118 -0.2422 -0.0420 0.0856  120 GLU C CA  
2180 C C   . GLU C 38  ? 1.1527 0.6273 0.7342 -0.2513 -0.0528 0.0752  120 GLU C C   
2181 O O   . GLU C 38  ? 1.1927 0.6586 0.7675 -0.2839 -0.0625 0.0831  120 GLU C O   
2182 C CB  . GLU C 38  ? 1.2580 0.6990 0.8142 -0.2423 -0.0495 0.0969  120 GLU C CB  
2183 C CG  . GLU C 38  ? 1.3707 0.7751 0.9155 -0.2061 -0.0504 0.0893  120 GLU C CG  
2184 C CD  . GLU C 38  ? 1.4686 0.8589 1.0022 -0.1976 -0.0514 0.1041  120 GLU C CD  
2185 O OE1 . GLU C 38  ? 1.5126 0.8884 1.0283 -0.2218 -0.0554 0.1206  120 GLU C OE1 
2186 O OE2 . GLU C 38  ? 1.4631 0.8582 1.0062 -0.1676 -0.0490 0.1007  120 GLU C OE2 
2187 N N   . PRO C 39  ? 1.1255 0.5886 0.7058 -0.2254 -0.0518 0.0584  121 PRO C N   
2188 C CA  . PRO C 39  ? 1.2250 0.6519 0.7848 -0.2335 -0.0629 0.0476  121 PRO C CA  
2189 C C   . PRO C 39  ? 1.4011 0.7455 0.9134 -0.2471 -0.0764 0.0512  121 PRO C C   
2190 O O   . PRO C 39  ? 1.4155 0.7197 0.9086 -0.2337 -0.0750 0.0567  121 PRO C O   
2191 C CB  . PRO C 39  ? 1.1563 0.5811 0.7185 -0.1972 -0.0548 0.0310  121 PRO C CB  
2192 C CG  . PRO C 39  ? 1.1064 0.5965 0.7083 -0.1807 -0.0409 0.0332  121 PRO C CG  
2193 C CD  . PRO C 39  ? 1.0933 0.5855 0.6941 -0.1908 -0.0399 0.0492  121 PRO C CD  
2194 N N   . GLU C 40  ? 1.6014 0.9184 1.0938 -0.2742 -0.0913 0.0486  122 GLU C N   
2195 C CA  . GLU C 40  ? 1.6989 0.9390 1.1455 -0.2985 -0.1074 0.0544  122 GLU C CA  
2196 C C   . GLU C 40  ? 1.7704 0.9226 1.1659 -0.2743 -0.1102 0.0391  122 GLU C C   
2197 O O   . GLU C 40  ? 1.8538 0.9434 1.2176 -0.2672 -0.1120 0.0441  122 GLU C O   
2198 C CB  . GLU C 40  ? 1.7249 0.9756 1.1732 -0.3428 -0.1249 0.0602  122 GLU C CB  
2199 N N   . GLY C 41  ? 1.7049 0.8493 1.0897 -0.2606 -0.1097 0.0212  123 GLY C N   
2200 C CA  . GLY C 41  ? 1.7358 0.7982 1.0695 -0.2356 -0.1086 0.0057  123 GLY C CA  
2201 C C   . GLY C 41  ? 1.6741 0.7583 1.0216 -0.1934 -0.0901 -0.0084 123 GLY C C   
2202 O O   . GLY C 41  ? 1.6779 0.8097 1.0641 -0.1680 -0.0751 -0.0031 123 GLY C O   
2203 N N   . ASP C 42  ? 1.6272 0.6783 0.9423 -0.1872 -0.0916 -0.0254 124 ASP C N   
2204 C CA  . ASP C 42  ? 1.5636 0.6391 0.8917 -0.1497 -0.0732 -0.0377 124 ASP C CA  
2205 C C   . ASP C 42  ? 1.4362 0.6103 0.8235 -0.1542 -0.0692 -0.0338 124 ASP C C   
2206 O O   . ASP C 42  ? 1.4393 0.6442 0.8368 -0.1853 -0.0829 -0.0314 124 ASP C O   
2207 C CB  . ASP C 42  ? 1.6929 0.7150 0.9695 -0.1432 -0.0752 -0.0550 124 ASP C CB  
2208 C CG  . ASP C 42  ? 1.8051 0.7658 1.0436 -0.1147 -0.0660 -0.0595 124 ASP C CG  
2209 O OD1 . ASP C 42  ? 1.8712 0.7974 1.0701 -0.1045 -0.0635 -0.0719 124 ASP C OD1 
2210 O OD2 . ASP C 42  ? 1.8226 0.7692 1.0695 -0.1025 -0.0612 -0.0499 124 ASP C OD2 
2211 N N   . TRP C 43  ? 1.3398 0.5620 0.7662 -0.1229 -0.0510 -0.0326 125 TRP C N   
2212 C CA  . TRP C 43  ? 1.2179 0.5294 0.7007 -0.1240 -0.0455 -0.0276 125 TRP C CA  
2213 C C   . TRP C 43  ? 1.1871 0.5208 0.6782 -0.1001 -0.0340 -0.0395 125 TRP C C   
2214 O O   . TRP C 43  ? 1.1585 0.4682 0.6395 -0.0681 -0.0199 -0.0455 125 TRP C O   
2215 C CB  . TRP C 43  ? 1.1476 0.4961 0.6668 -0.1113 -0.0363 -0.0154 125 TRP C CB  
2216 C CG  . TRP C 43  ? 1.0756 0.5063 0.6454 -0.1123 -0.0302 -0.0110 125 TRP C CG  
2217 C CD1 . TRP C 43  ? 1.0343 0.5125 0.6280 -0.1392 -0.0359 -0.0039 125 TRP C CD1 
2218 C CD2 . TRP C 43  ? 1.0151 0.4885 0.6177 -0.0847 -0.0164 -0.0129 125 TRP C CD2 
2219 N NE1 . TRP C 43  ? 0.9612 0.5036 0.5960 -0.1278 -0.0255 -0.0029 125 TRP C NE1 
2220 C CE2 . TRP C 43  ? 0.9415 0.4806 0.5811 -0.0963 -0.0150 -0.0085 125 TRP C CE2 
2221 C CE3 . TRP C 43  ? 0.9940 0.4569 0.5995 -0.0516 -0.0048 -0.0166 125 TRP C CE3 
2222 C CZ2 . TRP C 43  ? 0.8887 0.4756 0.5619 -0.0775 -0.0044 -0.0095 125 TRP C CZ2 
2223 C CZ3 . TRP C 43  ? 0.9333 0.4502 0.5776 -0.0354 0.0046  -0.0155 125 TRP C CZ3 
2224 C CH2 . TRP C 43  ? 0.8767 0.4513 0.5514 -0.0492 0.0038  -0.0128 125 TRP C CH2 
2225 N N   . PHE C 44  ? 1.1910 0.5719 0.7024 -0.1153 -0.0396 -0.0410 126 PHE C N   
2226 C CA  . PHE C 44  ? 1.1763 0.5888 0.7022 -0.0954 -0.0293 -0.0491 126 PHE C CA  
2227 C C   . PHE C 44  ? 1.1008 0.5926 0.6852 -0.0903 -0.0214 -0.0414 126 PHE C C   
2228 O O   . PHE C 44  ? 1.0924 0.6239 0.7030 -0.1119 -0.0284 -0.0324 126 PHE C O   
2229 C CB  . PHE C 44  ? 1.1929 0.5952 0.6944 -0.1139 -0.0428 -0.0564 126 PHE C CB  
2230 C CG  . PHE C 44  ? 1.2909 0.6108 0.7286 -0.1265 -0.0549 -0.0642 126 PHE C CG  
2231 C CD1 . PHE C 44  ? 1.3759 0.6291 0.7738 -0.1028 -0.0437 -0.0715 126 PHE C CD1 
2232 C CD2 . PHE C 44  ? 1.3412 0.6480 0.7581 -0.1621 -0.0783 -0.0634 126 PHE C CD2 
2233 C CE1 . PHE C 44  ? 1.4784 0.6450 0.8095 -0.1134 -0.0543 -0.0802 126 PHE C CE1 
2234 C CE2 . PHE C 44  ? 1.4513 0.6738 0.8025 -0.1765 -0.0920 -0.0714 126 PHE C CE2 
2235 C CZ  . PHE C 44  ? 1.5147 0.6631 0.8196 -0.1515 -0.0793 -0.0809 126 PHE C CZ  
2236 N N   . CYS C 45  ? 1.0452 0.5577 0.6483 -0.0617 -0.0061 -0.0444 127 CYS C N   
2237 C CA  . CYS C 45  ? 0.9728 0.5483 0.6244 -0.0543 0.0016  -0.0379 127 CYS C CA  
2238 C C   . CYS C 45  ? 0.9154 0.5394 0.5908 -0.0624 -0.0007 -0.0394 127 CYS C C   
2239 O O   . CYS C 45  ? 0.9061 0.5171 0.5619 -0.0704 -0.0080 -0.0451 127 CYS C O   
2240 C CB  . CYS C 45  ? 0.9934 0.5694 0.6564 -0.0231 0.0163  -0.0384 127 CYS C CB  
2241 S SG  . CYS C 45  ? 1.0428 0.6358 0.7121 -0.0026 0.0280  -0.0465 127 CYS C SG  
2242 N N   . PRO C 46  ? 0.8601 0.5381 0.5753 -0.0605 0.0045  -0.0341 128 PRO C N   
2243 C CA  . PRO C 46  ? 0.8084 0.5308 0.5475 -0.0658 0.0029  -0.0345 128 PRO C CA  
2244 C C   . PRO C 46  ? 0.8146 0.5325 0.5462 -0.0506 0.0066  -0.0419 128 PRO C C   
2245 O O   . PRO C 46  ? 0.8088 0.5417 0.5422 -0.0600 -0.0011 -0.0427 128 PRO C O   
2246 C CB  . PRO C 46  ? 0.6729 0.4409 0.4482 -0.0601 0.0115  -0.0292 128 PRO C CB  
2247 C CG  . PRO C 46  ? 0.6866 0.4394 0.4547 -0.0664 0.0111  -0.0233 128 PRO C CG  
2248 C CD  . PRO C 46  ? 0.8117 0.5097 0.5475 -0.0580 0.0094  -0.0265 128 PRO C CD  
2249 N N   . GLU C 47  ? 0.7938 0.4941 0.5187 -0.0279 0.0180  -0.0455 129 GLU C N   
2250 C CA  . GLU C 47  ? 0.8425 0.5383 0.5580 -0.0142 0.0238  -0.0512 129 GLU C CA  
2251 C C   . GLU C 47  ? 0.9074 0.5572 0.5765 -0.0227 0.0156  -0.0581 129 GLU C C   
2252 O O   . GLU C 47  ? 0.9200 0.5749 0.5797 -0.0264 0.0106  -0.0608 129 GLU C O   
2253 C CB  . GLU C 47  ? 0.9160 0.6063 0.6381 0.0113  0.0396  -0.0509 129 GLU C CB  
2254 C CG  . GLU C 47  ? 0.9456 0.6767 0.7091 0.0177  0.0444  -0.0440 129 GLU C CG  
2255 C CD  . GLU C 47  ? 0.9749 0.7479 0.7654 0.0179  0.0455  -0.0432 129 GLU C CD  
2256 O OE1 . GLU C 47  ? 0.9896 0.7671 0.7724 0.0110  0.0405  -0.0461 129 GLU C OE1 
2257 O OE2 . GLU C 47  ? 0.9787 0.7777 0.7968 0.0249  0.0500  -0.0391 129 GLU C OE2 
2258 N N   . CYS C 48  ? 0.9307 0.5315 0.5667 -0.0268 0.0125  -0.0606 130 CYS C N   
2259 C CA  . CYS C 48  ? 1.0012 0.5477 0.5842 -0.0372 0.0029  -0.0685 130 CYS C CA  
2260 C C   . CYS C 48  ? 1.0204 0.5822 0.6038 -0.0680 -0.0187 -0.0655 130 CYS C C   
2261 O O   . CYS C 48  ? 1.0650 0.6035 0.6151 -0.0776 -0.0296 -0.0707 130 CYS C O   
2262 C CB  . CYS C 48  ? 1.0489 0.5361 0.5971 -0.0349 0.0039  -0.0713 130 CYS C CB  
2263 S SG  . CYS C 48  ? 1.0784 0.5395 0.6182 0.0041  0.0291  -0.0747 130 CYS C SG  
2264 N N   . GLU C 49  ? 1.0791 0.6807 0.6995 -0.0842 -0.0252 -0.0561 131 GLU C N   
2265 C CA  . GLU C 49  ? 1.0744 0.6963 0.7022 -0.1136 -0.0449 -0.0502 131 GLU C CA  
2266 C C   . GLU C 49  ? 1.0007 0.6724 0.6574 -0.1109 -0.0470 -0.0475 131 GLU C C   
2267 O O   . GLU C 49  ? 1.0589 0.7275 0.7012 -0.1272 -0.0642 -0.0467 131 GLU C O   
2268 C CB  . GLU C 49  ? 1.1756 0.8255 0.8338 -0.1307 -0.0478 -0.0393 131 GLU C CB  
2269 C CG  . GLU C 49  ? 1.3282 0.9837 0.9857 -0.1652 -0.0693 -0.0314 131 GLU C CG  
2270 C CD  . GLU C 49  ? 1.3957 1.1134 1.1051 -0.1781 -0.0673 -0.0174 131 GLU C CD  
2271 O OE1 . GLU C 49  ? 1.4021 1.1172 1.1171 -0.1779 -0.0584 -0.0130 131 GLU C OE1 
2272 O OE2 . GLU C 49  ? 1.4075 1.1768 1.1514 -0.1868 -0.0736 -0.0099 131 GLU C OE2 
2273 N N   . LYS C 50  ? 0.9002 0.6146 0.5953 -0.0908 -0.0314 -0.0455 132 LYS C N   
2274 C CA  . LYS C 50  ? 0.8587 0.6122 0.5772 -0.0835 -0.0313 -0.0434 132 LYS C CA  
2275 C C   . LYS C 50  ? 0.9309 0.6485 0.6076 -0.0792 -0.0363 -0.0505 132 LYS C C   
2276 O O   . LYS C 50  ? 0.9622 0.6918 0.6367 -0.0911 -0.0516 -0.0472 132 LYS C O   
2277 C CB  . LYS C 50  ? 0.7828 0.5686 0.5351 -0.0604 -0.0127 -0.0428 132 LYS C CB  
2278 C CG  . LYS C 50  ? 0.7919 0.6347 0.5922 -0.0636 -0.0116 -0.0346 132 LYS C CG  
2279 C CD  . LYS C 50  ? 0.7791 0.6468 0.6040 -0.0416 0.0027  -0.0355 132 LYS C CD  
2280 N N   . ILE C 51  ? 0.9113 0.5842 0.5533 -0.0617 -0.0233 -0.0593 133 ILE C N   
2281 C CA  . ILE C 51  ? 0.9040 0.5381 0.4992 -0.0557 -0.0240 -0.0666 133 ILE C CA  
2282 C C   . ILE C 51  ? 1.0042 0.6008 0.5557 -0.0819 -0.0477 -0.0692 133 ILE C C   
2283 O O   . ILE C 51  ? 1.0336 0.6271 0.5649 -0.0898 -0.0607 -0.0691 133 ILE C O   
2284 C CB  . ILE C 51  ? 0.8936 0.4860 0.4604 -0.0310 -0.0025 -0.0745 133 ILE C CB  
2285 C CG1 . ILE C 51  ? 0.8646 0.4983 0.4751 -0.0079 0.0172  -0.0699 133 ILE C CG1 
2286 C CG2 . ILE C 51  ? 0.9109 0.4525 0.4171 -0.0262 -0.0015 -0.0833 133 ILE C CG2 
2287 C CD1 . ILE C 51  ? 0.8660 0.4713 0.4622 0.0169  0.0390  -0.0735 133 ILE C CD1 
2288 N N   . THR C 52  ? 1.0333 0.5990 0.5681 -0.0976 -0.0558 -0.0704 134 THR C N   
2289 C CA  . THR C 52  ? 1.1021 0.6259 0.5918 -0.1261 -0.0809 -0.0726 134 THR C CA  
2290 C C   . THR C 52  ? 1.0970 0.6707 0.6171 -0.1492 -0.1038 -0.0614 134 THR C C   
2291 O O   . THR C 52  ? 1.1556 0.7045 0.6377 -0.1651 -0.1242 -0.0630 134 THR C O   
2292 C CB  . THR C 52  ? 1.1069 0.5979 0.5844 -0.1424 -0.0871 -0.0722 134 THR C CB  
2293 O OG1 . THR C 52  ? 1.1529 0.5861 0.5923 -0.1201 -0.0686 -0.0827 134 THR C OG1 
2294 C CG2 . THR C 52  ? 1.1126 0.5669 0.5508 -0.1783 -0.1173 -0.0716 134 THR C CG2 
2295 N N   . VAL C 53  ? 1.0477 0.6919 0.6353 -0.1495 -0.1004 -0.0495 135 VAL C N   
2296 C CA  . VAL C 53  ? 1.0405 0.7388 0.6658 -0.1671 -0.1195 -0.0366 135 VAL C CA  
2297 C C   . VAL C 53  ? 1.0702 0.7819 0.6927 -0.1522 -0.1194 -0.0370 135 VAL C C   
2298 O O   . VAL C 53  ? 1.1297 0.8448 0.7409 -0.1689 -0.1428 -0.0315 135 VAL C O   
2299 C CB  . VAL C 53  ? 0.9336 0.7007 0.6292 -0.1674 -0.1112 -0.0242 135 VAL C CB  
2300 C CG1 . VAL C 53  ? 0.8953 0.7234 0.6360 -0.1792 -0.1271 -0.0095 135 VAL C CG1 
2301 C CG2 . VAL C 53  ? 0.9129 0.6670 0.6083 -0.1866 -0.1140 -0.0209 135 VAL C CG2 
2302 N N   . ALA C 54  ? 1.0406 0.7609 0.6742 -0.1222 -0.0949 -0.0418 136 ALA C N   
2303 C CA  . ALA C 54  ? 1.0041 0.7411 0.6403 -0.1080 -0.0931 -0.0399 136 ALA C CA  
2304 C C   . ALA C 54  ? 1.1187 0.7988 0.6860 -0.1119 -0.1032 -0.0476 136 ALA C C   
2305 O O   . ALA C 54  ? 1.1609 0.8527 0.7234 -0.1101 -0.1119 -0.0428 136 ALA C O   
2306 C CB  . ALA C 54  ? 0.8925 0.6457 0.5523 -0.0780 -0.0651 -0.0428 136 ALA C CB  
2307 N N   . GLU C 55  ? 1.1655 0.7810 0.6758 -0.1164 -0.1019 -0.0593 137 GLU C N   
2308 C CA  . GLU C 55  ? 1.2248 0.7749 0.6578 -0.1192 -0.1089 -0.0692 137 GLU C CA  
2309 C C   . GLU C 55  ? 1.3020 0.8191 0.6955 -0.1542 -0.1429 -0.0687 137 GLU C C   
2310 O O   . GLU C 55  ? 1.3971 0.8514 0.7167 -0.1603 -0.1522 -0.0780 137 GLU C O   
2311 C CB  . GLU C 55  ? 1.2488 0.7407 0.6374 -0.0971 -0.0824 -0.0835 137 GLU C CB  
2312 C CG  . GLU C 55  ? 1.2154 0.7320 0.6321 -0.0633 -0.0503 -0.0834 137 GLU C CG  
2313 C CD  . GLU C 55  ? 1.2722 0.7341 0.6473 -0.0403 -0.0240 -0.0951 137 GLU C CD  
2314 O OE1 . GLU C 55  ? 1.3482 0.7487 0.6705 -0.0487 -0.0297 -0.1047 137 GLU C OE1 
2315 O OE2 . GLU C 55  ? 1.2177 0.6979 0.6144 -0.0139 0.0021  -0.0936 137 GLU C OE2 
2316 N N   . CYS C 56  ? 1.3041 0.8600 0.7421 -0.1785 -0.1618 -0.0575 138 CYS C N   
2317 C CA  . CYS C 56  ? 1.3802 0.9134 0.7888 -0.2161 -0.1980 -0.0533 138 CYS C CA  
2318 C C   . CYS C 56  ? 1.3444 0.9183 0.7701 -0.2280 -0.2228 -0.0402 138 CYS C C   
2319 O O   . CYS C 56  ? 1.2459 0.8955 0.7440 -0.2201 -0.2196 -0.0261 138 CYS C O   
2320 C CB  . CYS C 56  ? 1.3942 0.9562 0.8470 -0.2395 -0.2081 -0.0435 138 CYS C CB  
2321 S SG  . CYS C 56  ? 1.4921 1.0461 0.9274 -0.2909 -0.2574 -0.0317 138 CYS C SG  
2322 N N   . ILE C 57  ? 1.4089 0.9296 0.7655 -0.2474 -0.2488 -0.0443 139 ILE C N   
2323 C CA  . ILE C 57  ? 1.4277 0.9791 0.7904 -0.2567 -0.2738 -0.0317 139 ILE C CA  
2324 C C   . ILE C 57  ? 1.3806 1.0157 0.8272 -0.2776 -0.2967 -0.0085 139 ILE C C   
2325 O O   . ILE C 57  ? 1.3460 1.0406 0.8404 -0.2700 -0.3029 0.0063  139 ILE C O   
2326 C CB  . ILE C 57  ? 1.5447 1.0178 0.8110 -0.2798 -0.3024 -0.0399 139 ILE C CB  
2327 C CG1 . ILE C 57  ? 1.6058 1.0025 0.7915 -0.2528 -0.2742 -0.0611 139 ILE C CG1 
2328 C CG2 . ILE C 57  ? 1.5503 1.0594 0.8270 -0.2946 -0.3349 -0.0231 139 ILE C CG2 
2329 C CD1 . ILE C 57  ? 1.7233 1.0484 0.8386 -0.2641 -0.2837 -0.0662 139 ILE C CD1 
2330 N N   . GLU C 58  ? 1.3813 1.0221 0.8477 -0.3035 -0.3087 -0.0038 140 GLU C N   
2331 C CA  . GLU C 58  ? 1.3160 1.0394 0.8654 -0.3238 -0.3273 0.0199  140 GLU C CA  
2332 C C   . GLU C 58  ? 1.2151 1.0153 0.8509 -0.2955 -0.2957 0.0278  140 GLU C C   
2333 O O   . GLU C 58  ? 1.1840 1.0604 0.8935 -0.3042 -0.3057 0.0484  140 GLU C O   
2334 C CB  . GLU C 58  ? 1.3442 1.0477 0.8856 -0.3625 -0.3486 0.0238  140 GLU C CB  
2335 N N   . THR C 59  ? 1.1791 0.9616 0.8077 -0.2621 -0.2583 0.0128  141 THR C N   
2336 C CA  . THR C 59  ? 1.1179 0.9648 0.8193 -0.2363 -0.2296 0.0185  141 THR C CA  
2337 C C   . THR C 59  ? 1.0656 0.9048 0.7591 -0.1984 -0.2013 0.0081  141 THR C C   
2338 O O   . THR C 59  ? 0.9818 0.8517 0.7164 -0.1764 -0.1744 0.0070  141 THR C O   
2339 C CB  . THR C 59  ? 1.1030 0.9507 0.8232 -0.2396 -0.2123 0.0156  141 THR C CB  
2340 O OG1 . THR C 59  ? 1.1588 0.9273 0.8105 -0.2372 -0.2035 -0.0031 141 THR C OG1 
2341 C CG2 . THR C 59  ? 1.0985 0.9816 0.8546 -0.2747 -0.2350 0.0327  141 THR C CG2 
2342 N N   . GLN C 60  ? 1.0829 0.8819 0.7235 -0.1918 -0.2071 0.0014  142 GLN C N   
2343 C CA  . GLN C 60  ? 1.0398 0.8346 0.6763 -0.1584 -0.1802 -0.0059 142 GLN C CA  
2344 C C   . GLN C 60  ? 0.9778 0.8404 0.6786 -0.1442 -0.1788 0.0091  142 GLN C C   
2345 O O   . GLN C 60  ? 0.9297 0.8396 0.6722 -0.1586 -0.2003 0.0254  142 GLN C O   
2346 C CB  . GLN C 60  ? 1.1079 0.8372 0.6648 -0.1554 -0.1837 -0.0166 142 GLN C CB  
2347 C CG  . GLN C 60  ? 1.1868 0.9137 0.7197 -0.1763 -0.2185 -0.0067 142 GLN C CG  
2348 C CD  . GLN C 60  ? 1.2797 0.9339 0.7224 -0.1749 -0.2212 -0.0185 142 GLN C CD  
2349 O OE1 . GLN C 60  ? 1.2936 0.9079 0.7003 -0.1526 -0.1922 -0.0326 142 GLN C OE1 
2350 N NE2 . GLN C 60  ? 1.3341 0.9713 0.7393 -0.1988 -0.2562 -0.0118 142 GLN C NE2 
2351 N N   . SER C 61  ? 0.9470 0.8142 0.6576 -0.1151 -0.1529 0.0045  143 SER C N   
2352 C CA  . SER C 61  ? 0.8772 0.7994 0.6439 -0.0988 -0.1488 0.0170  143 SER C CA  
2353 C C   . SER C 61  ? 0.9021 0.8219 0.6493 -0.1006 -0.1697 0.0266  143 SER C C   
2354 O O   . SER C 61  ? 0.9546 0.8238 0.6368 -0.1095 -0.1806 0.0205  143 SER C O   
2355 C CB  . SER C 61  ? 0.8167 0.7397 0.5973 -0.0704 -0.1169 0.0095  143 SER C CB  
2356 O OG  . SER C 61  ? 0.8463 0.7269 0.5775 -0.0596 -0.1093 0.0026  143 SER C OG  
2357 N N   . LYS C 62  ? 0.8737 0.8459 0.6750 -0.0904 -0.1741 0.0419  144 LYS C N   
2358 C CA  . LYS C 62  ? 0.8973 0.8715 0.6856 -0.0909 -0.1955 0.0542  144 LYS C CA  
2359 C C   . LYS C 62  ? 0.9029 0.8287 0.6359 -0.0756 -0.1817 0.0453  144 LYS C C   
2360 O O   . LYS C 62  ? 0.9441 0.8418 0.6295 -0.0836 -0.2004 0.0493  144 LYS C O   
2361 C CB  . LYS C 62  ? 0.9036 0.9424 0.7649 -0.0774 -0.1985 0.0726  144 LYS C CB  
2362 C CG  . LYS C 62  ? 0.9718 1.0607 0.8790 -0.0979 -0.2259 0.0902  144 LYS C CG  
2363 C CD  . LYS C 62  ? 0.9731 1.1307 0.9618 -0.0787 -0.2200 0.1074  144 LYS C CD  
2364 C CE  . LYS C 62  ? 0.9946 1.1583 0.9871 -0.0615 -0.2295 0.1203  144 LYS C CE  
2365 N NZ  . LYS C 62  ? 0.9930 1.2157 1.0413 -0.0665 -0.2569 0.1464  144 LYS C NZ  
2366 N N   . ALA C 63  ? 0.8526 0.7681 0.5896 -0.0553 -0.1497 0.0342  145 ALA C N   
2367 C CA  . ALA C 63  ? 0.8813 0.7527 0.5679 -0.0424 -0.1334 0.0265  145 ALA C CA  
2368 C C   . ALA C 63  ? 0.9574 0.7691 0.5701 -0.0548 -0.1347 0.0131  145 ALA C C   
2369 O O   . ALA C 63  ? 1.0224 0.7949 0.5795 -0.0514 -0.1327 0.0111  145 ALA C O   
2370 C CB  . ALA C 63  ? 0.8072 0.6863 0.5220 -0.0204 -0.1009 0.0199  145 ALA C CB  
2371 N N   . MET C 64  ? 1.0051 0.8051 0.6124 -0.0682 -0.1365 0.0040  146 MET C N   
2372 C CA  . MET C 64  ? 1.1351 0.8709 0.6686 -0.0773 -0.1357 -0.0102 146 MET C CA  
2373 C C   . MET C 64  ? 1.2062 0.9130 0.6874 -0.1014 -0.1694 -0.0066 146 MET C C   
2374 O O   . MET C 64  ? 1.2677 0.9137 0.6724 -0.1031 -0.1679 -0.0165 146 MET C O   
2375 C CB  . MET C 64  ? 1.2045 0.9304 0.7454 -0.0834 -0.1273 -0.0207 146 MET C CB  
2376 C CG  . MET C 64  ? 1.2261 0.9598 0.7944 -0.0601 -0.0934 -0.0276 146 MET C CG  
2377 S SD  . MET C 64  ? 1.2756 0.9831 0.8114 -0.0346 -0.0665 -0.0311 146 MET C SD  
2378 C CE  . MET C 64  ? 1.3550 0.9829 0.7931 -0.0425 -0.0694 -0.0441 146 MET C CE  
2379 N N   . THR C 65  ? 1.2259 0.9744 0.7459 -0.1202 -0.1998 0.0079  147 THR C N   
2380 C CA  . THR C 65  ? 1.3660 1.0925 0.8407 -0.1454 -0.2370 0.0148  147 THR C CA  
2381 C C   . THR C 65  ? 1.3998 1.0935 0.8192 -0.1355 -0.2372 0.0163  147 THR C C   
2382 O O   . THR C 65  ? 1.4811 1.1156 0.8192 -0.1500 -0.2524 0.0097  147 THR C O   
2383 C CB  . THR C 65  ? 1.4021 1.1957 0.9447 -0.1612 -0.2675 0.0363  147 THR C CB  
2384 O OG1 . THR C 65  ? 1.4315 1.2632 1.0079 -0.1438 -0.2687 0.0515  147 THR C OG1 
2385 C CG2 . THR C 65  ? 1.3206 1.1645 0.9368 -0.1618 -0.2570 0.0387  147 THR C CG2 
2386 N N   . MET C 66  ? 1.3233 1.0502 0.7808 -0.1115 -0.2199 0.0247  148 MET C N   
2387 C CA  . MET C 66  ? 1.3427 1.0478 0.7573 -0.1034 -0.2223 0.0312  148 MET C CA  
2388 C C   . MET C 66  ? 1.3019 0.9575 0.6624 -0.0840 -0.1866 0.0170  148 MET C C   
2389 O O   . MET C 66  ? 1.3095 0.9434 0.6292 -0.0767 -0.1839 0.0223  148 MET C O   
2390 C CB  . MET C 66  ? 1.3369 1.1019 0.8205 -0.0890 -0.2255 0.0507  148 MET C CB  
2391 C CG  . MET C 66  ? 1.3066 1.0998 0.8447 -0.0627 -0.1897 0.0475  148 MET C CG  
2392 S SD  . MET C 66  ? 1.3182 1.1666 0.9231 -0.0456 -0.1953 0.0697  148 MET C SD  
2393 C CE  . MET C 66  ? 1.2893 1.2000 0.9658 -0.0598 -0.2239 0.0829  148 MET C CE  
2394 N N   . LEU C 67  ? 1.2537 0.8918 0.6129 -0.0754 -0.1592 0.0010  149 LEU C N   
2395 C CA  . LEU C 67  ? 1.2532 0.8493 0.5672 -0.0561 -0.1241 -0.0107 149 LEU C CA  
2396 C C   . LEU C 67  ? 1.3242 0.8536 0.5636 -0.0646 -0.1208 -0.0289 149 LEU C C   
2397 O O   . LEU C 67  ? 1.3572 0.8831 0.6061 -0.0788 -0.1322 -0.0357 149 LEU C O   
2398 C CB  . LEU C 67  ? 1.1677 0.7991 0.5454 -0.0341 -0.0913 -0.0126 149 LEU C CB  
2399 C CG  . LEU C 67  ? 1.0856 0.7667 0.5244 -0.0191 -0.0830 0.0014  149 LEU C CG  
2400 C CD1 . LEU C 67  ? 1.0480 0.7417 0.5225 0.0002  -0.0489 -0.0043 149 LEU C CD1 
2401 C CD2 . LEU C 67  ? 1.1261 0.7886 0.5236 -0.0152 -0.0851 0.0112  149 LEU C CD2 
2402 N N   . THR C 68  ? 1.3520 0.8259 0.5148 -0.0556 -0.1041 -0.0362 150 THR C N   
2403 C CA  . THR C 68  ? 1.4050 0.8130 0.5007 -0.0529 -0.0875 -0.0554 150 THR C CA  
2404 C C   . THR C 68  ? 1.4035 0.8245 0.5373 -0.0260 -0.0457 -0.0616 150 THR C C   
2405 O O   . THR C 68  ? 1.3865 0.8596 0.5856 -0.0108 -0.0292 -0.0515 150 THR C O   
2406 C CB  . THR C 68  ? 1.4587 0.8005 0.4556 -0.0519 -0.0830 -0.0609 150 THR C CB  
2407 O OG1 . THR C 68  ? 1.4596 0.8065 0.4559 -0.0250 -0.0453 -0.0572 150 THR C OG1 
2408 C CG2 . THR C 68  ? 1.4590 0.8041 0.4362 -0.0747 -0.1227 -0.0485 150 THR C CG2 
2409 N N   . ILE C 69  ? 1.4395 0.8100 0.5308 -0.0206 -0.0298 -0.0777 151 ILE C N   
2410 C CA  . ILE C 69  ? 1.3896 0.7735 0.5193 0.0047  0.0072  -0.0818 151 ILE C CA  
2411 C C   . ILE C 69  ? 1.3943 0.7867 0.5225 0.0293  0.0409  -0.0753 151 ILE C C   
2412 O O   . ILE C 69  ? 1.3575 0.7932 0.5491 0.0467  0.0644  -0.0691 151 ILE C O   
2413 C CB  . ILE C 69  ? 1.4335 0.7550 0.5121 0.0070  0.0164  -0.0994 151 ILE C CB  
2414 C CG1 . ILE C 69  ? 1.3658 0.7115 0.5004 0.0278  0.0441  -0.1010 151 ILE C CG1 
2415 C CG2 . ILE C 69  ? 1.5473 0.8178 0.5681 0.0159  0.0313  -0.1034 151 ILE C CG2 
2416 C CD1 . ILE C 69  ? 1.4388 0.7382 0.5487 0.0256  0.0439  -0.1131 151 ILE C CD1 
2417 N N   . GLU C 70  ? 1.4639 0.8178 0.5214 0.0285  0.0415  -0.0747 152 GLU C N   
2418 C CA  A GLU C 70  ? 1.4782 0.8411 0.5360 0.0498  0.0744  -0.0662 152 GLU C CA  
2419 C CA  B GLU C 70  ? 1.4784 0.8410 0.5357 0.0497  0.0743  -0.0662 152 GLU C CA  
2420 C C   . GLU C 70  ? 1.4072 0.8322 0.5281 0.0499  0.0696  -0.0480 152 GLU C C   
2421 O O   . GLU C 70  ? 1.3859 0.8455 0.5550 0.0676  0.0975  -0.0397 152 GLU C O   
2422 C CB  A GLU C 70  ? 1.5684 0.8859 0.5605 0.0463  0.0736  -0.0674 152 GLU C CB  
2423 C CB  B GLU C 70  ? 1.5675 0.8852 0.5589 0.0458  0.0728  -0.0671 152 GLU C CB  
2424 C CG  A GLU C 70  ? 1.5777 0.8987 0.5650 0.0677  0.1101  -0.0595 152 GLU C CG  
2425 C CG  B GLU C 70  ? 1.6369 0.8988 0.5846 0.0494  0.0820  -0.0816 152 GLU C CG  
2426 C CD  A GLU C 70  ? 1.6462 0.9328 0.5706 0.0592  0.1012  -0.0565 152 GLU C CD  
2427 C CD  B GLU C 70  ? 1.6483 0.8795 0.5703 0.0237  0.0449  -0.0911 152 GLU C CD  
2428 O OE1 A GLU C 70  ? 1.7186 0.9605 0.5963 0.0668  0.1174  -0.0646 152 GLU C OE1 
2429 O OE1 B GLU C 70  ? 1.6085 0.8656 0.5484 0.0023  0.0108  -0.0858 152 GLU C OE1 
2430 O OE2 A GLU C 70  ? 1.6540 0.9573 0.5748 0.0453  0.0770  -0.0453 152 GLU C OE2 
2431 O OE2 B GLU C 70  ? 1.6976 0.8794 0.5830 0.0249  0.0497  -0.1023 152 GLU C OE2 
2432 N N   . GLN C 71  ? 1.3703 0.8128 0.4992 0.0299  0.0332  -0.0397 153 GLN C N   
2433 C CA  . GLN C 71  ? 1.2806 0.7821 0.4776 0.0304  0.0257  -0.0221 153 GLN C CA  
2434 C C   . GLN C 71  ? 1.2129 0.7661 0.4981 0.0394  0.0373  -0.0209 153 GLN C C   
2435 O O   . GLN C 71  ? 1.2029 0.7887 0.5331 0.0524  0.0568  -0.0110 153 GLN C O   
2436 C CB  . GLN C 71  ? 1.2295 0.7439 0.4288 0.0087  -0.0174 -0.0139 153 GLN C CB  
2437 C CG  . GLN C 71  ? 1.3000 0.7630 0.4095 -0.0032 -0.0344 -0.0132 153 GLN C CG  
2438 C CD  . GLN C 71  ? 1.3343 0.8042 0.4414 -0.0287 -0.0818 -0.0075 153 GLN C CD  
2439 O OE1 . GLN C 71  ? 1.3087 0.8009 0.4568 -0.0404 -0.0998 -0.0113 153 GLN C OE1 
2440 N NE2 . GLN C 71  ? 1.4041 0.8555 0.4626 -0.0382 -0.1028 0.0032  153 GLN C NE2 
2441 N N   . LEU C 72  ? 1.1597 0.7174 0.4666 0.0310  0.0250  -0.0305 154 LEU C N   
2442 C CA  . LEU C 72  ? 1.0697 0.6718 0.4528 0.0380  0.0343  -0.0300 154 LEU C CA  
2443 C C   . LEU C 72  ? 1.0901 0.6912 0.4838 0.0593  0.0714  -0.0314 154 LEU C C   
2444 O O   . LEU C 72  ? 1.0400 0.6831 0.4961 0.0674  0.0822  -0.0240 154 LEU C O   
2445 C CB  . LEU C 72  ? 1.0410 0.6394 0.4333 0.0250  0.0176  -0.0400 154 LEU C CB  
2446 C CG  . LEU C 72  ? 0.9759 0.6071 0.4311 0.0327  0.0301  -0.0421 154 LEU C CG  
2447 C CD1 . LEU C 72  ? 0.8137 0.5017 0.3392 0.0350  0.0268  -0.0306 154 LEU C CD1 
2448 C CD2 . LEU C 72  ? 0.9621 0.5813 0.4143 0.0179  0.0136  -0.0511 154 LEU C CD2 
2449 N N   . SER C 73  ? 1.1312 0.6843 0.4640 0.0688  0.0914  -0.0399 155 SER C N   
2450 C CA  . SER C 73  ? 1.1199 0.6773 0.4671 0.0910  0.1285  -0.0380 155 SER C CA  
2451 C C   . SER C 73  ? 1.0708 0.6603 0.4456 0.0981  0.1423  -0.0215 155 SER C C   
2452 O O   . SER C 73  ? 1.0310 0.6566 0.4621 0.1087  0.1604  -0.0137 155 SER C O   
2453 C CB  . SER C 73  ? 1.2369 0.7339 0.5085 0.1025  0.1496  -0.0495 155 SER C CB  
2454 O OG  . SER C 73  ? 1.3564 0.8194 0.5604 0.0989  0.1484  -0.0476 155 SER C OG  
2455 N N   . TYR C 74  ? 1.0749 0.6505 0.4101 0.0906  0.1318  -0.0148 156 TYR C N   
2456 C CA  A TYR C 74  ? 1.0666 0.6695 0.4258 0.0948  0.1420  0.0025  156 TYR C CA  
2457 C CA  B TYR C 74  ? 1.0668 0.6696 0.4257 0.0945  0.1414  0.0026  156 TYR C CA  
2458 C C   . TYR C 74  ? 0.9975 0.6538 0.4392 0.0904  0.1293  0.0112  156 TYR C C   
2459 O O   . TYR C 74  ? 0.9680 0.6536 0.4547 0.0984  0.1474  0.0218  156 TYR C O   
2460 C CB  A TYR C 74  ? 1.1223 0.6985 0.4224 0.0852  0.1267  0.0088  156 TYR C CB  
2461 C CB  B TYR C 74  ? 1.1209 0.6973 0.4215 0.0840  0.1240  0.0084  156 TYR C CB  
2462 C CG  A TYR C 74  ? 1.2066 0.7232 0.4137 0.0896  0.1412  0.0007  156 TYR C CG  
2463 C CG  B TYR C 74  ? 1.1117 0.6980 0.4107 0.0883  0.1370  0.0265  156 TYR C CG  
2464 C CD1 A TYR C 74  ? 1.2280 0.7208 0.4127 0.1065  0.1743  -0.0090 156 TYR C CD1 
2465 C CD1 B TYR C 74  ? 1.1194 0.7013 0.4075 0.1032  0.1750  0.0326  156 TYR C CD1 
2466 C CD2 A TYR C 74  ? 1.2074 0.6895 0.3467 0.0777  0.1217  0.0033  156 TYR C CD2 
2467 C CD2 B TYR C 74  ? 1.0882 0.6875 0.3954 0.0774  0.1113  0.0392  156 TYR C CD2 
2468 C CE1 A TYR C 74  ? 1.2545 0.6973 0.3691 0.1106  0.1859  -0.0170 156 TYR C CE1 
2469 C CE1 B TYR C 74  ? 1.1306 0.7211 0.4163 0.1044  0.1867  0.0512  156 TYR C CE1 
2470 C CE2 A TYR C 74  ? 1.2961 0.7218 0.3504 0.0804  0.1334  -0.0052 156 TYR C CE2 
2471 C CE2 B TYR C 74  ? 1.0659 0.6695 0.3681 0.0800  0.1216  0.0569  156 TYR C CE2 
2472 C CZ  A TYR C 74  ? 1.3334 0.7453 0.3892 0.0963  0.1643  -0.0156 156 TYR C CZ  
2473 C CZ  B TYR C 74  ? 1.1099 0.7086 0.4004 0.0921  0.1590  0.0629  156 TYR C CZ  
2474 O OH  A TYR C 74  ? 1.4181 0.7845 0.4164 0.0988  0.1731  -0.0235 156 TYR C OH  
2475 O OH  B TYR C 74  ? 1.1026 0.7061 0.3890 0.0923  0.1690  0.0823  156 TYR C OH  
2476 N N   . LEU C 75  ? 0.9728 0.6419 0.4350 0.0775  0.0988  0.0074  157 LEU C N   
2477 C CA  . LEU C 75  ? 0.8826 0.5969 0.4171 0.0756  0.0892  0.0132  157 LEU C CA  
2478 C C   . LEU C 75  ? 0.8490 0.5832 0.4285 0.0842  0.1077  0.0092  157 LEU C C   
2479 O O   . LEU C 75  ? 0.8533 0.6177 0.4827 0.0873  0.1135  0.0176  157 LEU C O   
2480 C CB  . LEU C 75  ? 0.8565 0.5819 0.4047 0.0625  0.0577  0.0094  157 LEU C CB  
2481 C CG  . LEU C 75  ? 0.9150 0.6253 0.4240 0.0522  0.0335  0.0153  157 LEU C CG  
2482 C CD1 . LEU C 75  ? 0.8956 0.6333 0.4397 0.0409  0.0032  0.0171  157 LEU C CD1 
2483 C CD2 . LEU C 75  ? 0.8999 0.6098 0.3998 0.0574  0.0395  0.0304  157 LEU C CD2 
2484 N N   . LEU C 76  ? 0.8482 0.5623 0.4080 0.0878  0.1160  -0.0027 158 LEU C N   
2485 C CA  . LEU C 76  ? 0.8505 0.5829 0.4522 0.0966  0.1317  -0.0048 158 LEU C CA  
2486 C C   . LEU C 76  ? 0.8740 0.6201 0.4938 0.1093  0.1592  0.0069  158 LEU C C   
2487 O O   . LEU C 76  ? 0.8148 0.5934 0.4892 0.1114  0.1640  0.0132  158 LEU C O   
2488 C CB  . LEU C 76  ? 0.8673 0.5695 0.4391 0.0997  0.1358  -0.0185 158 LEU C CB  
2489 C CG  . LEU C 76  ? 0.8664 0.5625 0.4334 0.0841  0.1081  -0.0279 158 LEU C CG  
2490 C CD1 . LEU C 76  ? 0.8823 0.5423 0.4171 0.0859  0.1117  -0.0408 158 LEU C CD1 
2491 C CD2 . LEU C 76  ? 0.7787 0.5196 0.4099 0.0772  0.0943  -0.0236 158 LEU C CD2 
2492 N N   . LYS C 77  ? 0.9072 0.6291 0.4811 0.1165  0.1771  0.0109  159 LYS C N   
2493 C CA  . LYS C 77  ? 0.9069 0.6470 0.5013 0.1268  0.2041  0.0257  159 LYS C CA  
2494 C C   . LYS C 77  ? 0.8917 0.6674 0.5369 0.1179  0.1937  0.0394  159 LYS C C   
2495 O O   . LYS C 77  ? 0.9094 0.7160 0.6058 0.1204  0.2043  0.0491  159 LYS C O   
2496 C CB  . LYS C 77  ? 0.9454 0.6531 0.4766 0.1339  0.2235  0.0293  159 LYS C CB  
2497 N N   . PHE C 78  ? 0.8713 0.6418 0.5037 0.1069  0.1709  0.0408  160 PHE C N   
2498 C CA  . PHE C 78  ? 0.8669 0.6642 0.5447 0.0999  0.1601  0.0523  160 PHE C CA  
2499 C C   . PHE C 78  ? 0.8294 0.6541 0.5642 0.0975  0.1522  0.0480  160 PHE C C   
2500 O O   . PHE C 78  ? 0.8040 0.6503 0.5803 0.0950  0.1552  0.0580  160 PHE C O   
2501 C CB  . PHE C 78  ? 0.8808 0.6683 0.5396 0.0916  0.1351  0.0536  160 PHE C CB  
2502 C CG  . PHE C 78  ? 0.9470 0.7123 0.5582 0.0915  0.1400  0.0640  160 PHE C CG  
2503 C CD1 . PHE C 78  ? 0.9610 0.7330 0.5811 0.0931  0.1573  0.0807  160 PHE C CD1 
2504 C CD2 . PHE C 78  ? 0.9908 0.7278 0.5468 0.0876  0.1258  0.0587  160 PHE C CD2 
2505 C CE1 . PHE C 78  ? 0.9946 0.7450 0.5678 0.0924  0.1628  0.0920  160 PHE C CE1 
2506 C CE2 . PHE C 78  ? 1.0451 0.7588 0.5517 0.0866  0.1289  0.0691  160 PHE C CE2 
2507 C CZ  . PHE C 78  ? 1.0578 0.7780 0.5723 0.0898  0.1486  0.0858  160 PHE C CZ  
2508 N N   . ALA C 79  ? 0.8021 0.6234 0.5360 0.0964  0.1410  0.0335  161 ALA C N   
2509 C CA  . ALA C 79  ? 0.7717 0.6155 0.5521 0.0936  0.1333  0.0290  161 ALA C CA  
2510 C C   . ALA C 79  ? 0.7607 0.6199 0.5706 0.1001  0.1520  0.0340  161 ALA C C   
2511 O O   . ALA C 79  ? 0.6730 0.5544 0.5259 0.0960  0.1480  0.0386  161 ALA C O   
2512 C CB  . ALA C 79  ? 0.7410 0.5764 0.5099 0.0899  0.1185  0.0145  161 ALA C CB  
2513 N N   . ILE C 80  ? 0.7777 0.6247 0.5646 0.1107  0.1720  0.0338  162 ILE C N   
2514 C CA  . ILE C 80  ? 0.7953 0.6621 0.6154 0.1192  0.1913  0.0423  162 ILE C CA  
2515 C C   . ILE C 80  ? 0.7913 0.6828 0.6451 0.1145  0.1975  0.0604  162 ILE C C   
2516 O O   . ILE C 80  ? 0.7369 0.6556 0.6387 0.1111  0.1966  0.0686  162 ILE C O   
2517 C CB  . ILE C 80  ? 0.8733 0.7196 0.6585 0.1352  0.2160  0.0404  162 ILE C CB  
2518 C CG1 . ILE C 80  ? 0.9154 0.7423 0.6851 0.1401  0.2110  0.0251  162 ILE C CG1 
2519 C CG2 . ILE C 80  ? 0.8933 0.7673 0.7162 0.1456  0.2406  0.0565  162 ILE C CG2 
2520 C CD1 . ILE C 80  ? 0.9364 0.7909 0.7590 0.1413  0.2078  0.0281  162 ILE C CD1 
2521 N N   . GLN C 81  ? 0.8535 0.7339 0.6809 0.1124  0.2020  0.0679  163 GLN C N   
2522 C CA  . GLN C 81  ? 0.8736 0.7736 0.7305 0.1054  0.2068  0.0864  163 GLN C CA  
2523 C C   . GLN C 81  ? 0.7830 0.6965 0.6785 0.0922  0.1837  0.0866  163 GLN C C   
2524 O O   . GLN C 81  ? 0.7598 0.6956 0.6967 0.0855  0.1855  0.0991  163 GLN C O   
2525 C CB  . GLN C 81  ? 0.9926 0.8732 0.8090 0.1040  0.2117  0.0942  163 GLN C CB  
2526 C CG  . GLN C 81  ? 1.1204 0.9822 0.8899 0.1170  0.2369  0.0943  163 GLN C CG  
2527 C CD  . GLN C 81  ? 1.1896 1.0752 0.9843 0.1248  0.2679  0.1118  163 GLN C CD  
2528 O OE1 . GLN C 81  ? 1.1761 1.0935 1.0251 0.1250  0.2716  0.1182  163 GLN C OE1 
2529 N NE2 . GLN C 81  ? 1.2600 1.1319 1.0160 0.1304  0.2902  0.1216  163 GLN C NE2 
2530 N N   . LYS C 82  ? 0.7534 0.6530 0.6358 0.0882  0.1621  0.0731  164 LYS C N   
2531 C CA  . LYS C 82  ? 0.7695 0.6772 0.6833 0.0785  0.1435  0.0716  164 LYS C CA  
2532 C C   . LYS C 82  ? 0.7723 0.6977 0.7199 0.0769  0.1411  0.0675  164 LYS C C   
2533 O O   . LYS C 82  ? 0.7973 0.7307 0.7731 0.0675  0.1303  0.0706  164 LYS C O   
2534 C CB  . LYS C 82  ? 0.8369 0.7299 0.7323 0.0773  0.1244  0.0599  164 LYS C CB  
2535 C CG  . LYS C 82  ? 0.9203 0.8005 0.8021 0.0747  0.1181  0.0691  164 LYS C CG  
2536 C CD  . LYS C 82  ? 0.9497 0.8141 0.7931 0.0787  0.1103  0.0643  164 LYS C CD  
2537 C CE  . LYS C 82  ? 0.9614 0.8166 0.8028 0.0772  0.0957  0.0707  164 LYS C CE  
2538 N NZ  . LYS C 82  ? 1.0652 0.9163 0.9170 0.0727  0.1017  0.0867  164 LYS C NZ  
2539 N N   . MET C 83  ? 0.7602 0.6882 0.7025 0.0856  0.1501  0.0611  165 MET C N   
2540 C CA  . MET C 83  ? 0.7247 0.6692 0.6987 0.0844  0.1466  0.0596  165 MET C CA  
2541 C C   . MET C 83  ? 0.7488 0.7194 0.7620 0.0826  0.1573  0.0777  165 MET C C   
2542 O O   . MET C 83  ? 0.7415 0.7277 0.7875 0.0749  0.1467  0.0809  165 MET C O   
2543 C CB  . MET C 83  ? 0.7152 0.6509 0.6714 0.0946  0.1515  0.0481  165 MET C CB  
2544 C CG  . MET C 83  ? 0.7160 0.6326 0.6441 0.0918  0.1366  0.0317  165 MET C CG  
2545 S SD  . MET C 83  ? 0.7767 0.6701 0.6671 0.1016  0.1437  0.0198  165 MET C SD  
2546 C CE  . MET C 83  ? 0.7143 0.6204 0.6353 0.1035  0.1414  0.0185  165 MET C CE  
2547 N N   . LYS C 84  ? 0.7587 0.7356 0.7695 0.0884  0.1777  0.0912  166 LYS C N   
2548 C CA  . LYS C 84  ? 0.7299 0.7386 0.7846 0.0863  0.1895  0.1119  166 LYS C CA  
2549 C C   . LYS C 84  ? 0.7031 0.7195 0.7819 0.0673  0.1767  0.1245  166 LYS C C   
2550 O O   . LYS C 84  ? 0.6866 0.7127 0.7743 0.0631  0.1888  0.1418  166 LYS C O   
2551 C CB  . LYS C 84  ? 0.7687 0.7836 0.8133 0.1009  0.2200  0.1229  166 LYS C CB  
2552 C CG  . LYS C 84  ? 0.8248 0.8282 0.8466 0.1204  0.2342  0.1117  166 LYS C CG  
2553 C CD  . LYS C 84  ? 0.8721 0.8729 0.8725 0.1371  0.2672  0.1203  166 LYS C CD  
2554 C CE  . LYS C 84  ? 0.9145 0.8995 0.8811 0.1310  0.2729  0.1256  166 LYS C CE  
2555 N NZ  . LYS C 84  ? 0.9911 0.9678 0.9264 0.1488  0.3074  0.1319  166 LYS C NZ  
2556 N N   . GLN C 85  ? 0.7219 0.7302 0.8077 0.0553  0.1525  0.1155  167 GLN C N   
2557 C CA  . GLN C 85  ? 0.6894 0.6975 0.7946 0.0365  0.1379  0.1254  167 GLN C CA  
2558 C C   . GLN C 85  ? 0.7333 0.7764 0.8883 0.0267  0.1408  0.1470  167 GLN C C   
2559 O O   . GLN C 85  ? 0.7475 0.8158 0.9265 0.0350  0.1482  0.1509  167 GLN C O   
2560 C CB  . GLN C 85  ? 0.6373 0.6249 0.7335 0.0285  0.1135  0.1090  167 GLN C CB  
2561 C CG  . GLN C 85  ? 0.6598 0.6179 0.7170 0.0348  0.1090  0.0937  167 GLN C CG  
2562 C CD  . GLN C 85  ? 0.7202 0.6648 0.7645 0.0316  0.1129  0.1041  167 GLN C CD  
2563 O OE1 . GLN C 85  ? 0.7453 0.6915 0.8082 0.0180  0.1095  0.1188  167 GLN C OE1 
2564 N NE2 . GLN C 85  ? 0.7434 0.6731 0.7547 0.0423  0.1180  0.0977  167 GLN C NE2 
2565 N N   . PRO C 86  ? 0.7913 0.8371 0.9645 0.0086  0.1342  0.1630  168 PRO C N   
2566 C CA  . PRO C 86  ? 0.7732 0.8554 0.9993 -0.0056 0.1316  0.1855  168 PRO C CA  
2567 C C   . PRO C 86  ? 0.7222 0.8088 0.9663 -0.0143 0.1080  0.1784  168 PRO C C   
2568 O O   . PRO C 86  ? 0.6617 0.7173 0.8846 -0.0254 0.0855  0.1642  168 PRO C O   
2569 C CB  . PRO C 86  ? 0.7979 0.8689 1.0284 -0.0270 0.1238  0.2003  168 PRO C CB  
2570 C CG  . PRO C 86  ? 0.8163 0.8400 0.9958 -0.0233 0.1165  0.1817  168 PRO C CG  
2571 C CD  . PRO C 86  ? 0.8190 0.8372 0.9669 0.0012  0.1318  0.1652  168 PRO C CD  
2572 N N   . GLY C 87  ? 0.7176 0.8420 0.9995 -0.0079 0.1143  0.1892  169 GLY C N   
2573 C CA  . GLY C 87  ? 0.6805 0.8127 0.9790 -0.0129 0.0938  0.1846  169 GLY C CA  
2574 C C   . GLY C 87  ? 0.6533 0.7925 0.9457 0.0110  0.1056  0.1743  169 GLY C C   
2575 O O   . GLY C 87  ? 0.5959 0.7436 0.9029 0.0089  0.0901  0.1728  169 GLY C O   
2576 N N   . THR C 88  ? 0.6786 0.8107 0.9464 0.0327  0.1314  0.1676  170 THR C N   
2577 C CA  . THR C 88  ? 0.6746 0.7982 0.9221 0.0545  0.1411  0.1532  170 THR C CA  
2578 C C   . THR C 88  ? 0.7122 0.8678 0.9895 0.0745  0.1672  0.1690  170 THR C C   
2579 O O   . THR C 88  ? 0.7667 0.9075 1.0180 0.0959  0.1829  0.1576  170 THR C O   
2580 C CB  . THR C 88  ? 0.6371 0.7212 0.8270 0.0638  0.1480  0.1313  170 THR C CB  
2581 O OG1 . THR C 88  ? 0.5780 0.6614 0.7560 0.0694  0.1692  0.1393  170 THR C OG1 
2582 C CG2 . THR C 88  ? 0.6319 0.6875 0.7969 0.0482  0.1244  0.1165  170 THR C CG2 
2583 N N   . ASP C 89  ? 0.6873 0.8859 1.0195 0.0680  0.1718  0.1958  171 ASP C N   
2584 C CA  . ASP C 89  ? 0.6707 0.9048 1.0364 0.0894  0.2018  0.2143  171 ASP C CA  
2585 C C   . ASP C 89  ? 0.6334 0.8709 1.0063 0.1103  0.2043  0.2092  171 ASP C C   
2586 O O   . ASP C 89  ? 0.6502 0.8873 1.0149 0.1374  0.2333  0.2093  171 ASP C O   
2587 C CB  . ASP C 89  ? 0.7268 1.0137 1.1604 0.0746  0.2012  0.2469  171 ASP C CB  
2588 C CG  . ASP C 89  ? 0.8023 1.0812 1.2304 0.0480  0.1913  0.2530  171 ASP C CG  
2589 O OD1 . ASP C 89  ? 0.8235 1.0731 1.2300 0.0266  0.1611  0.2400  171 ASP C OD1 
2590 O OD2 . ASP C 89  ? 0.8167 1.1167 1.2607 0.0492  0.2150  0.2717  171 ASP C OD2 
2591 N N   . ALA C 90  ? 0.5826 0.8184 0.9656 0.0986  0.1744  0.2045  172 ALA C N   
2592 C CA  . ALA C 90  ? 0.6019 0.8402 0.9932 0.1167  0.1738  0.2024  172 ALA C CA  
2593 C C   . ALA C 90  ? 0.6317 0.8244 0.9638 0.1380  0.1886  0.1775  172 ALA C C   
2594 O O   . ALA C 90  ? 0.6486 0.8385 0.9838 0.1573  0.1943  0.1766  172 ALA C O   
2595 C CB  . ALA C 90  ? 0.5944 0.8324 0.9967 0.0965  0.1364  0.2006  172 ALA C CB  
2596 N N   . PHE C 91  ? 0.6283 0.7842 0.9070 0.1343  0.1932  0.1585  173 PHE C N   
2597 C CA  . PHE C 91  ? 0.6570 0.7685 0.8784 0.1493  0.2021  0.1355  173 PHE C CA  
2598 C C   . PHE C 91  ? 0.7367 0.8307 0.9233 0.1647  0.2320  0.1319  173 PHE C C   
2599 O O   . PHE C 91  ? 0.7751 0.8278 0.9079 0.1741  0.2376  0.1124  173 PHE C O   
2600 C CB  . PHE C 91  ? 0.5993 0.6777 0.7811 0.1312  0.1768  0.1139  173 PHE C CB  
2601 C CG  . PHE C 91  ? 0.5654 0.6551 0.7712 0.1141  0.1483  0.1161  173 PHE C CG  
2602 C CD1 . PHE C 91  ? 0.5563 0.6475 0.7725 0.1210  0.1403  0.1169  173 PHE C CD1 
2603 C CD2 . PHE C 91  ? 0.5847 0.6796 0.7989 0.0910  0.1293  0.1180  173 PHE C CD2 
2604 C CE1 . PHE C 91  ? 0.5490 0.6479 0.7814 0.1041  0.1129  0.1194  173 PHE C CE1 
2605 C CE2 . PHE C 91  ? 0.5789 0.6781 0.8069 0.0745  0.1027  0.1189  173 PHE C CE2 
2606 C CZ  . PHE C 91  ? 0.5668 0.6691 0.8034 0.0806  0.0944  0.1199  173 PHE C CZ  
2607 N N   . GLN C 92  ? 0.7586 0.8814 0.9717 0.1662  0.2508  0.1507  174 GLN C N   
2608 C CA  . GLN C 92  ? 0.8029 0.9049 0.9745 0.1784  0.2782  0.1469  174 GLN C CA  
2609 C C   . GLN C 92  ? 0.8546 0.9497 1.0154 0.2099  0.3110  0.1485  174 GLN C C   
2610 O O   . GLN C 92  ? 0.9228 0.9804 1.0262 0.2219  0.3299  0.1361  174 GLN C O   
2611 C CB  . GLN C 92  ? 0.8123 0.9431 1.0096 0.1656  0.2861  0.1666  174 GLN C CB  
2612 C CG  . GLN C 92  ? 0.8087 0.9379 1.0117 0.1356  0.2537  0.1641  174 GLN C CG  
2613 C CD  . GLN C 92  ? 0.8254 0.9610 1.0283 0.1224  0.2602  0.1769  174 GLN C CD  
2614 O OE1 . GLN C 92  ? 0.8940 1.0354 1.0886 0.1345  0.2896  0.1874  174 GLN C OE1 
2615 N NE2 . GLN C 92  ? 0.7691 0.8998 0.9771 0.0980  0.2336  0.1759  174 GLN C NE2 
2616 N N   . LYS C 93  ? 0.8394 0.9662 1.0505 0.2243  0.3175  0.1631  175 LYS C N   
2617 C CA  . LYS C 93  ? 0.8242 0.9450 1.0302 0.2583  0.3507  0.1663  175 LYS C CA  
2618 C C   . LYS C 93  ? 0.8008 0.9210 1.0281 0.2691  0.3377  0.1646  175 LYS C C   
2619 O O   . LYS C 93  ? 0.8148 0.9625 1.0851 0.2513  0.3083  0.1724  175 LYS C O   
2620 C CB  . LYS C 93  ? 0.8143 0.9786 1.0645 0.2632  0.3701  0.1924  175 LYS C CB  
2621 N N   . PRO C 94  ? 0.8045 0.8834 0.9900 0.2891  0.3482  0.1523  176 PRO C N   
2622 C CA  . PRO C 94  ? 0.7937 0.8650 0.9930 0.2995  0.3354  0.1504  176 PRO C CA  
2623 C C   . PRO C 94  ? 0.8034 0.9374 1.0873 0.3008  0.3281  0.1788  176 PRO C C   
2624 O O   . PRO C 94  ? 0.8433 1.0192 1.1685 0.3028  0.3419  0.2001  176 PRO C O   
2625 C CB  . PRO C 94  ? 0.8035 0.8249 0.9482 0.3214  0.3545  0.1380  176 PRO C CB  
2626 C CG  . PRO C 94  ? 0.8295 0.8135 0.9099 0.3167  0.3671  0.1227  176 PRO C CG  
2627 C CD  . PRO C 94  ? 0.8331 0.8636 0.9502 0.3013  0.3697  0.1382  176 PRO C CD  
2628 N N   . VAL C 95  ? 0.7781 0.9180 1.0870 0.2983  0.3045  0.1803  177 VAL C N   
2629 C CA  . VAL C 95  ? 0.7350 0.9345 1.1240 0.2956  0.2901  0.2083  177 VAL C CA  
2630 C C   . VAL C 95  ? 0.7612 0.9698 1.1672 0.3196  0.3094  0.2214  177 VAL C C   
2631 O O   . VAL C 95  ? 0.7830 0.9455 1.1465 0.3389  0.3179  0.2072  177 VAL C O   
2632 C CB  . VAL C 95  ? 0.7078 0.8997 1.1025 0.2821  0.2541  0.2042  177 VAL C CB  
2633 C CG1 . VAL C 95  ? 0.6886 0.9445 1.1642 0.2716  0.2332  0.2343  177 VAL C CG1 
2634 C CG2 . VAL C 95  ? 0.6577 0.8150 1.0003 0.2499  0.2286  0.1801  177 VAL C CG2 
2635 N N   . PRO C 96  ? 0.8092 1.0744 1.2762 0.3189  0.3164  0.2485  178 PRO C N   
2636 C CA  . PRO C 96  ? 0.8809 1.1567 1.3665 0.3444  0.3377  0.2621  178 PRO C CA  
2637 C C   . PRO C 96  ? 0.9094 1.2001 1.4337 0.3528  0.3185  0.2738  178 PRO C C   
2638 O O   . PRO C 96  ? 0.8878 1.2121 1.4571 0.3340  0.2873  0.2863  178 PRO C O   
2639 C CB  . PRO C 96  ? 0.8643 1.2000 1.4062 0.3364  0.3486  0.2893  178 PRO C CB  
2640 C CG  . PRO C 96  ? 0.8030 1.1490 1.3433 0.3064  0.3351  0.2859  178 PRO C CG  
2641 C CD  . PRO C 96  ? 0.7616 1.0819 1.2817 0.2943  0.3064  0.2686  178 PRO C CD  
2642 N N   . LEU C 97  ? 0.9604 1.2234 1.4647 0.3809  0.3362  0.2701  179 LEU C N   
2643 C CA  . LEU C 97  ? 0.9837 1.2643 1.5293 0.3915  0.3204  0.2850  179 LEU C CA  
2644 C C   . LEU C 97  ? 0.9691 1.3262 1.6016 0.3876  0.3154  0.3207  179 LEU C C   
2645 O O   . LEU C 97  ? 0.9325 1.3176 1.6110 0.3850  0.2905  0.3373  179 LEU C O   
2646 C CB  . LEU C 97  ? 1.0771 1.3088 1.5817 0.4236  0.3418  0.2736  179 LEU C CB  
2647 C CG  . LEU C 97  ? 1.1224 1.2730 1.5378 0.4266  0.3448  0.2391  179 LEU C CG  
2648 C CD1 . LEU C 97  ? 1.2019 1.3084 1.5654 0.4521  0.3807  0.2272  179 LEU C CD1 
2649 C CD2 . LEU C 97  ? 1.1045 1.2245 1.5084 0.4273  0.3185  0.2319  179 LEU C CD2 
2650 N N   . GLU C 98  ? 0.9976 1.3879 1.6521 0.3859  0.3371  0.3339  180 GLU C N   
2651 C CA  . GLU C 98  ? 0.9929 1.4576 1.7312 0.3775  0.3304  0.3693  180 GLU C CA  
2652 C C   . GLU C 98  ? 0.9327 1.4344 1.7122 0.3409  0.2895  0.3808  180 GLU C C   
2653 O O   . GLU C 98  ? 0.9193 1.4715 1.7640 0.3312  0.2670  0.4075  180 GLU C O   
2654 C CB  . GLU C 98  ? 0.9963 1.4837 1.7436 0.3822  0.3630  0.3803  180 GLU C CB  
2655 N N   . GLN C 99  ? 0.9172 1.3929 1.6582 0.3198  0.2779  0.3611  181 GLN C N   
2656 C CA  . GLN C 99  ? 0.9150 1.4188 1.6886 0.2851  0.2381  0.3697  181 GLN C CA  
2657 C C   . GLN C 99  ? 0.9383 1.4221 1.7041 0.2825  0.2058  0.3626  181 GLN C C   
2658 O O   . GLN C 99  ? 0.9249 1.4430 1.7345 0.2594  0.1696  0.3802  181 GLN C O   
2659 C CB  . GLN C 99  ? 0.8500 1.3360 1.5891 0.2640  0.2387  0.3533  181 GLN C CB  
2660 N N   . HIS C 100 ? 0.9677 1.3935 1.6750 0.3037  0.2162  0.3378  182 HIS C N   
2661 C CA  . HIS C 100 ? 0.9699 1.3701 1.6628 0.3020  0.1869  0.3306  182 HIS C CA  
2662 C C   . HIS C 100 ? 1.0088 1.3663 1.6681 0.3352  0.2056  0.3203  182 HIS C C   
2663 O O   . HIS C 100 ? 1.0469 1.3437 1.6391 0.3471  0.2207  0.2930  182 HIS C O   
2664 C CB  . HIS C 100 ? 1.0001 1.3621 1.6453 0.2848  0.1720  0.3070  182 HIS C CB  
2665 C CG  . HIS C 100 ? 1.0244 1.4195 1.6938 0.2537  0.1574  0.3132  182 HIS C CG  
2666 N ND1 . HIS C 100 ? 1.0137 1.4135 1.6852 0.2175  0.1140  0.3144  182 HIS C ND1 
2667 C CD2 . HIS C 100 ? 1.0334 1.4422 1.7032 0.2456  0.1773  0.3123  182 HIS C CD2 
2668 C CE1 . HIS C 100 ? 1.0036 1.4177 1.6781 0.1898  0.1080  0.3139  182 HIS C CE1 
2669 N NE2 . HIS C 100 ? 1.0080 1.4306 1.6854 0.2064  0.1457  0.3141  182 HIS C NE2 
2670 N N   . PRO C 101 ? 0.9859 1.3718 1.6896 0.3500  0.2038  0.3419  183 PRO C N   
2671 C CA  . PRO C 101 ? 0.9898 1.3343 1.6627 0.3835  0.2244  0.3329  183 PRO C CA  
2672 C C   . PRO C 101 ? 0.9399 1.2260 1.5625 0.3860  0.2059  0.3138  183 PRO C C   
2673 O O   . PRO C 101 ? 0.9647 1.1952 1.5362 0.4089  0.2254  0.2958  183 PRO C O   
2674 C CB  . PRO C 101 ? 0.9944 1.3926 1.7380 0.3950  0.2209  0.3648  183 PRO C CB  
2675 C CG  . PRO C 101 ? 0.9732 1.4272 1.7734 0.3623  0.1834  0.3872  183 PRO C CG  
2676 C CD  . PRO C 101 ? 0.9673 1.4227 1.7500 0.3365  0.1831  0.3759  183 PRO C CD  
2677 N N   . ASP C 102 ? 0.8906 1.1839 1.5224 0.3618  0.1684  0.3176  184 ASP C N   
2678 C CA  . ASP C 102 ? 0.9112 1.1488 1.4951 0.3630  0.1501  0.3026  184 ASP C CA  
2679 C C   . ASP C 102 ? 0.8938 1.0760 1.4085 0.3548  0.1573  0.2724  184 ASP C C   
2680 O O   . ASP C 102 ? 0.9135 1.0474 1.3853 0.3518  0.1415  0.2602  184 ASP C O   
2681 C CB  . ASP C 102 ? 0.9215 1.1871 1.5403 0.3407  0.1050  0.3221  184 ASP C CB  
2682 C CG  . ASP C 102 ? 0.9227 1.2176 1.5562 0.3068  0.0827  0.3246  184 ASP C CG  
2683 O OD1 . ASP C 102 ? 0.9204 1.2384 1.5651 0.3011  0.1019  0.3218  184 ASP C OD1 
2684 O OD2 . ASP C 102 ? 0.9121 1.2026 1.5397 0.2837  0.0451  0.3284  184 ASP C OD2 
2685 N N   . TYR C 103 ? 0.8415 1.0280 1.3428 0.3509  0.1805  0.2612  185 TYR C N   
2686 C CA  . TYR C 103 ? 0.8298 0.9743 1.2744 0.3382  0.1821  0.2357  185 TYR C CA  
2687 C C   . TYR C 103 ? 0.8806 0.9475 1.2511 0.3513  0.1905  0.2106  185 TYR C C   
2688 O O   . TYR C 103 ? 0.8832 0.9115 1.2045 0.3273  0.1683  0.1920  185 TYR C O   
2689 C CB  . TYR C 103 ? 0.8229 0.9822 1.2624 0.3347  0.2081  0.2289  185 TYR C CB  
2690 C CG  . TYR C 103 ? 0.8016 0.9327 1.1891 0.3062  0.1988  0.2043  185 TYR C CG  
2691 C CD1 . TYR C 103 ? 0.7517 0.9109 1.1558 0.2703  0.1693  0.2072  185 TYR C CD1 
2692 C CD2 . TYR C 103 ? 0.8381 0.9117 1.1547 0.3120  0.2177  0.1770  185 TYR C CD2 
2693 C CE1 . TYR C 103 ? 0.7542 0.8859 1.1085 0.2443  0.1609  0.1839  185 TYR C CE1 
2694 C CE2 . TYR C 103 ? 0.8099 0.8605 1.0798 0.2837  0.2067  0.1552  185 TYR C CE2 
2695 C CZ  . TYR C 103 ? 0.7656 0.8464 1.0562 0.2517  0.1797  0.1590  185 TYR C CZ  
2696 O OH  . TYR C 103 ? 0.7259 0.7839 0.9726 0.2273  0.1705  0.1384  185 TYR C OH  
2697 N N   . ALA C 104 ? 0.9096 0.9498 1.2573 0.3751  0.2160  0.2044  186 ALA C N   
2698 C CA  . ALA C 104 ? 0.9022 0.8653 1.1765 0.3849  0.2233  0.1803  186 ALA C CA  
2699 C C   . ALA C 104 ? 0.8981 0.8332 1.1644 0.3827  0.1962  0.1837  186 ALA C C   
2700 O O   . ALA C 104 ? 0.9240 0.7930 1.1267 0.3808  0.1940  0.1636  186 ALA C O   
2701 C CB  . ALA C 104 ? 0.9616 0.9048 1.2190 0.4113  0.2535  0.1771  186 ALA C CB  
2702 N N   . GLU C 105 ? 0.8603 0.8429 1.1873 0.3802  0.1734  0.2099  187 GLU C N   
2703 C CA  . GLU C 105 ? 0.8821 0.8387 1.2001 0.3764  0.1454  0.2163  187 GLU C CA  
2704 C C   . GLU C 105 ? 0.8392 0.7750 1.1132 0.3364  0.1182  0.1990  187 GLU C C   
2705 O O   . GLU C 105 ? 0.8354 0.7343 1.0770 0.3261  0.0977  0.1955  187 GLU C O   
2706 C CB  . GLU C 105 ? 0.8992 0.9145 1.2888 0.3780  0.1240  0.2481  187 GLU C CB  
2707 N N   . TYR C 106 ? 0.8073 0.7654 1.0764 0.3118  0.1180  0.1874  188 TYR C N   
2708 C CA  . TYR C 106 ? 0.7560 0.6976 0.9832 0.2738  0.0951  0.1691  188 TYR C CA  
2709 C C   . TYR C 106 ? 0.7244 0.6299 0.8957 0.2647  0.1112  0.1409  188 TYR C C   
2710 O O   . TYR C 106 ? 0.7096 0.5831 0.8343 0.2415  0.0972  0.1237  188 TYR C O   
2711 C CB  . TYR C 106 ? 0.7453 0.7427 1.0131 0.2472  0.0730  0.1807  188 TYR C CB  
2712 C CG  . TYR C 106 ? 0.7470 0.7809 1.0650 0.2462  0.0479  0.2083  188 TYR C CG  
2713 C CD1 . TYR C 106 ? 0.7541 0.7679 1.0487 0.2285  0.0186  0.2095  188 TYR C CD1 
2714 C CD2 . TYR C 106 ? 0.7684 0.8589 1.1580 0.2619  0.0528  0.2351  188 TYR C CD2 
2715 C CE1 . TYR C 106 ? 0.7829 0.8282 1.1199 0.2264  -0.0075 0.2361  188 TYR C CE1 
2716 C CE2 . TYR C 106 ? 0.7902 0.9174 1.2290 0.2597  0.0264  0.2630  188 TYR C CE2 
2717 C CZ  . TYR C 106 ? 0.7820 0.8846 1.1922 0.2418  -0.0050 0.2630  188 TYR C CZ  
2718 O OH  . TYR C 106 ? 0.7665 0.9041 1.2225 0.2382  -0.0341 0.2918  188 TYR C OH  
2719 N N   . ILE C 107 ? 0.6991 0.6102 0.8737 0.2817  0.1396  0.1369  189 ILE C N   
2720 C CA  . ILE C 107 ? 0.7167 0.6003 0.8420 0.2702  0.1512  0.1128  189 ILE C CA  
2721 C C   . ILE C 107 ? 0.7910 0.6150 0.8664 0.2935  0.1742  0.0989  189 ILE C C   
2722 O O   . ILE C 107 ? 0.8468 0.6711 0.9322 0.3230  0.2024  0.1042  189 ILE C O   
2723 C CB  . ILE C 107 ? 0.6912 0.6188 0.8460 0.2672  0.1641  0.1172  189 ILE C CB  
2724 C CG1 . ILE C 107 ? 0.6445 0.6238 0.8448 0.2424  0.1388  0.1309  189 ILE C CG1 
2725 C CG2 . ILE C 107 ? 0.6816 0.5781 0.7828 0.2561  0.1739  0.0937  189 ILE C CG2 
2726 C CD1 . ILE C 107 ? 0.6400 0.6007 0.8083 0.2119  0.1099  0.1182  189 ILE C CD1 
2727 N N   . PHE C 108 ? 0.8407 0.6119 0.8597 0.2793  0.1627  0.0810  190 PHE C N   
2728 C CA  . PHE C 108 ? 0.9165 0.6211 0.8787 0.2960  0.1795  0.0660  190 PHE C CA  
2729 C C   . PHE C 108 ? 0.9279 0.6160 0.8535 0.2964  0.1992  0.0493  190 PHE C C   
2730 O O   . PHE C 108 ? 1.0418 0.6809 0.9260 0.3176  0.2206  0.0397  190 PHE C O   
2731 C CB  . PHE C 108 ? 0.9831 0.6390 0.8986 0.2751  0.1578  0.0542  190 PHE C CB  
2732 C CG  . PHE C 108 ? 1.0684 0.6481 0.9218 0.2883  0.1699  0.0394  190 PHE C CG  
2733 C CD1 . PHE C 108 ? 1.1002 0.6481 0.9531 0.3214  0.1842  0.0475  190 PHE C CD1 
2734 C CD2 . PHE C 108 ? 1.1070 0.6453 0.9020 0.2672  0.1658  0.0181  190 PHE C CD2 
2735 C CE1 . PHE C 108 ? 1.1965 0.6756 0.9885 0.3267  0.1915  0.0320  190 PHE C CE1 
2736 C CE2 . PHE C 108 ? 1.1694 0.6324 0.9023 0.2760  0.1739  0.0041  190 PHE C CE2 
2737 C CZ  . PHE C 108 ? 1.2184 0.6516 0.9483 0.3042  0.1863  0.0104  190 PHE C CZ  
2738 N N   . HIS C 109 ? 0.8963 0.6189 0.8309 0.2736  0.1921  0.0453  191 HIS C N   
2739 C CA  . HIS C 109 ? 0.9211 0.6246 0.8149 0.2693  0.2054  0.0294  191 HIS C CA  
2740 C C   . HIS C 109 ? 0.8765 0.6385 0.8119 0.2618  0.2090  0.0384  191 HIS C C   
2741 O O   . HIS C 109 ? 0.8254 0.6093 0.7664 0.2349  0.1901  0.0347  191 HIS C O   
2742 C CB  . HIS C 109 ? 0.9512 0.6166 0.7921 0.2413  0.1863  0.0101  191 HIS C CB  
2743 C CG  . HIS C 109 ? 0.9987 0.6317 0.7879 0.2390  0.1977  -0.0061 191 HIS C CG  
2744 N ND1 . HIS C 109 ? 0.9702 0.6277 0.7584 0.2188  0.1908  -0.0112 191 HIS C ND1 
2745 C CD2 . HIS C 109 ? 1.0533 0.6281 0.7865 0.2546  0.2146  -0.0180 191 HIS C CD2 
2746 C CE1 . HIS C 109 ? 1.0134 0.6322 0.7489 0.2208  0.2012  -0.0242 191 HIS C CE1 
2747 N NE2 . HIS C 109 ? 1.0831 0.6497 0.7818 0.2416  0.2157  -0.0294 191 HIS C NE2 
2748 N N   . PRO C 110 ? 0.8774 0.6650 0.8428 0.2857  0.2343  0.0512  192 PRO C N   
2749 C CA  . PRO C 110 ? 0.8203 0.6646 0.8294 0.2771  0.2372  0.0631  192 PRO C CA  
2750 C C   . PRO C 110 ? 0.8275 0.6565 0.7946 0.2616  0.2398  0.0478  192 PRO C C   
2751 O O   . PRO C 110 ? 0.8876 0.6644 0.7931 0.2635  0.2457  0.0300  192 PRO C O   
2752 C CB  . PRO C 110 ? 0.8103 0.6802 0.8573 0.3094  0.2679  0.0813  192 PRO C CB  
2753 C CG  . PRO C 110 ? 0.8669 0.6974 0.8946 0.3315  0.2742  0.0795  192 PRO C CG  
2754 C CD  . PRO C 110 ? 0.8984 0.6622 0.8562 0.3211  0.2627  0.0555  192 PRO C CD  
2755 N N   . MET C 111 ? 0.7777 0.6505 0.7770 0.2447  0.2325  0.0555  193 MET C N   
2756 C CA  . MET C 111 ? 0.7851 0.6472 0.7498 0.2303  0.2330  0.0440  193 MET C CA  
2757 C C   . MET C 111 ? 0.7564 0.6694 0.7663 0.2206  0.2336  0.0590  193 MET C C   
2758 O O   . MET C 111 ? 0.7298 0.6813 0.7891 0.2096  0.2177  0.0716  193 MET C O   
2759 C CB  . MET C 111 ? 0.7915 0.6284 0.7212 0.2055  0.2066  0.0268  193 MET C CB  
2760 C CG  . MET C 111 ? 0.8486 0.6687 0.7378 0.1932  0.2060  0.0149  193 MET C CG  
2761 S SD  . MET C 111 ? 0.9568 0.7256 0.7810 0.2120  0.2320  0.0043  193 MET C SD  
2762 C CE  . MET C 111 ? 0.9847 0.6992 0.7699 0.2183  0.2259  -0.0087 193 MET C CE  
2763 N N   . ASP C 112 ? 0.8197 0.7287 0.8085 0.2233  0.2509  0.0580  194 ASP C N   
2764 C CA  . ASP C 112 ? 0.8392 0.7896 0.8639 0.2124  0.2522  0.0721  194 ASP C CA  
2765 C C   . ASP C 112 ? 0.8469 0.7732 0.8235 0.2037  0.2555  0.0613  194 ASP C C   
2766 O O   . ASP C 112 ? 0.8420 0.7230 0.7604 0.2089  0.2601  0.0450  194 ASP C O   
2767 C CB  . ASP C 112 ? 0.9303 0.9182 1.0011 0.2318  0.2786  0.0946  194 ASP C CB  
2768 C CG  . ASP C 112 ? 1.0680 1.0255 1.1010 0.2603  0.3123  0.0905  194 ASP C CG  
2769 O OD1 . ASP C 112 ? 1.0901 1.0204 1.1078 0.2784  0.3178  0.0840  194 ASP C OD1 
2770 O OD2 . ASP C 112 ? 1.1446 1.1000 1.1572 0.2642  0.3332  0.0931  194 ASP C OD2 
2771 N N   . LEU C 113 ? 0.8356 0.7904 0.8359 0.1892  0.2509  0.0714  195 LEU C N   
2772 C CA  . LEU C 113 ? 0.8359 0.7705 0.7948 0.1801  0.2511  0.0640  195 LEU C CA  
2773 C C   . LEU C 113 ? 0.9173 0.8293 0.8358 0.1987  0.2817  0.0641  195 LEU C C   
2774 O O   . LEU C 113 ? 0.9977 0.8729 0.8590 0.1954  0.2804  0.0513  195 LEU C O   
2775 C CB  . LEU C 113 ? 0.7531 0.7200 0.7469 0.1624  0.2415  0.0771  195 LEU C CB  
2776 C CG  . LEU C 113 ? 0.6373 0.6221 0.6654 0.1439  0.2127  0.0768  195 LEU C CG  
2777 C CD1 . LEU C 113 ? 0.6205 0.6372 0.6887 0.1303  0.2088  0.0941  195 LEU C CD1 
2778 C CD2 . LEU C 113 ? 0.5570 0.5133 0.5486 0.1321  0.1914  0.0576  195 LEU C CD2 
2779 N N   . CYS C 114 ? 0.8893 0.8227 0.8353 0.2186  0.3095  0.0792  196 CYS C N   
2780 C CA  . CYS C 114 ? 0.9061 0.8141 0.8081 0.2393  0.3429  0.0786  196 CYS C CA  
2781 C C   . CYS C 114 ? 0.9260 0.7742 0.7619 0.2497  0.3429  0.0562  196 CYS C C   
2782 O O   . CYS C 114 ? 0.9966 0.8035 0.7692 0.2488  0.3469  0.0456  196 CYS C O   
2783 C CB  . CYS C 114 ? 0.9545 0.9002 0.9054 0.2573  0.3686  0.1001  196 CYS C CB  
2784 S SG  . CYS C 114 ? 1.0651 0.9880 0.9704 0.2700  0.3971  0.1035  196 CYS C SG  
2785 N N   . THR C 115 ? 0.8575 0.6984 0.7066 0.2551  0.3324  0.0498  197 THR C N   
2786 C CA  . THR C 115 ? 0.8955 0.6776 0.6842 0.2586  0.3253  0.0297  197 THR C CA  
2787 C C   . THR C 115 ? 0.9085 0.6558 0.6448 0.2384  0.3034  0.0114  197 THR C C   
2788 O O   . THR C 115 ? 0.9079 0.6052 0.5778 0.2375  0.3032  -0.0023 197 THR C O   
2789 C CB  . THR C 115 ? 0.8913 0.6753 0.7092 0.2666  0.3170  0.0295  197 THR C CB  
2790 O OG1 . THR C 115 ? 0.8522 0.6716 0.7211 0.2846  0.3347  0.0487  197 THR C OG1 
2791 C CG2 . THR C 115 ? 0.8391 0.5594 0.5943 0.2683  0.3093  0.0101  197 THR C CG2 
2792 N N   . LEU C 116 ? 0.8842 0.6617 0.6556 0.2149  0.2747  0.0134  198 LEU C N   
2793 C CA  . LEU C 116 ? 0.9105 0.6695 0.6471 0.1927  0.2503  0.0015  198 LEU C CA  
2794 C C   . LEU C 116 ? 1.0305 0.7679 0.7183 0.1937  0.2624  0.0005  198 LEU C C   
2795 O O   . LEU C 116 ? 1.1216 0.8152 0.7485 0.1873  0.2535  -0.0134 198 LEU C O   
2796 C CB  . LEU C 116 ? 0.8402 0.6421 0.6275 0.1731  0.2274  0.0086  198 LEU C CB  
2797 C CG  . LEU C 116 ? 0.8345 0.6443 0.6459 0.1617  0.2039  0.0031  198 LEU C CG  
2798 C CD1 . LEU C 116 ? 0.8179 0.6674 0.6752 0.1464  0.1881  0.0113  198 LEU C CD1 
2799 C CD2 . LEU C 116 ? 0.8461 0.6187 0.6106 0.1504  0.1866  -0.0134 198 LEU C CD2 
2800 N N   . GLU C 117 ? 1.0101 0.7776 0.7232 0.2003  0.2818  0.0165  199 GLU C N   
2801 C CA  . GLU C 117 ? 1.0360 0.7855 0.7037 0.2008  0.2946  0.0186  199 GLU C CA  
2802 C C   . GLU C 117 ? 1.1008 0.7944 0.6962 0.2163  0.3131  0.0064  199 GLU C C   
2803 O O   . GLU C 117 ? 1.1646 0.8169 0.6967 0.2066  0.3015  -0.0051 199 GLU C O   
2804 C CB  . GLU C 117 ? 1.0666 0.8601 0.7796 0.2062  0.3160  0.0407  199 GLU C CB  
2805 C CG  . GLU C 117 ? 1.1599 0.9477 0.8421 0.1981  0.3199  0.0474  199 GLU C CG  
2806 C CD  . GLU C 117 ? 1.2098 1.0481 0.9508 0.1931  0.3288  0.0709  199 GLU C CD  
2807 O OE1 . GLU C 117 ? 1.1849 1.0640 0.9929 0.1898  0.3223  0.0802  199 GLU C OE1 
2808 O OE2 . GLU C 117 ? 1.2675 1.1026 0.9855 0.1907  0.3408  0.0809  199 GLU C OE2 
2809 N N   . LYS C 118 ? 1.0682 0.7634 0.6815 0.2343  0.3309  0.0109  200 LYS C N   
2810 C CA  . LYS C 118 ? 1.1286 0.7730 0.6835 0.2443  0.3402  0.0014  200 LYS C CA  
2811 C C   . LYS C 118 ? 1.1535 0.7440 0.6523 0.2330  0.3162  -0.0198 200 LYS C C   
2812 O O   . LYS C 118 ? 1.2407 0.7822 0.6724 0.2290  0.3130  -0.0301 200 LYS C O   
2813 C CB  . LYS C 118 ? 1.1584 0.8144 0.7457 0.2672  0.3626  0.0103  200 LYS C CB  
2814 C CG  . LYS C 118 ? 1.1675 0.8877 0.8293 0.2764  0.3815  0.0339  200 LYS C CG  
2815 C CD  . LYS C 118 ? 1.2970 1.0226 0.9452 0.2832  0.4057  0.0454  200 LYS C CD  
2816 C CE  . LYS C 118 ? 1.2842 1.0740 0.9978 0.2768  0.4129  0.0680  200 LYS C CE  
2817 N NZ  . LYS C 118 ? 1.3210 1.1227 1.0309 0.2842  0.4393  0.0830  200 LYS C NZ  
2818 N N   . ASN C 119 ? 1.1032 0.7015 0.6278 0.2261  0.2981  -0.0257 201 ASN C N   
2819 C CA  . ASN C 119 ? 1.1440 0.6940 0.6198 0.2125  0.2741  -0.0439 201 ASN C CA  
2820 C C   . ASN C 119 ? 1.1376 0.6706 0.5694 0.1911  0.2534  -0.0515 201 ASN C C   
2821 O O   . ASN C 119 ? 1.2228 0.7059 0.5921 0.1811  0.2402  -0.0633 201 ASN C O   
2822 C CB  . ASN C 119 ? 1.1332 0.6978 0.6481 0.2086  0.2597  -0.0469 201 ASN C CB  
2823 C CG  . ASN C 119 ? 1.1801 0.7600 0.7369 0.2288  0.2757  -0.0383 201 ASN C CG  
2824 O OD1 . ASN C 119 ? 1.2939 0.8729 0.8505 0.2467  0.2984  -0.0306 201 ASN C OD1 
2825 N ND2 . ASN C 119 ? 1.1303 0.7222 0.7208 0.2265  0.2637  -0.0391 201 ASN C ND2 
2826 N N   . ALA C 120 ? 1.0196 0.5959 0.4884 0.1812  0.2455  -0.0431 202 ALA C N   
2827 C CA  . ALA C 120 ? 1.0238 0.5946 0.4632 0.1611  0.2239  -0.0442 202 ALA C CA  
2828 C C   . ALA C 120 ? 1.1373 0.6644 0.5040 0.1678  0.2395  -0.0469 202 ALA C C   
2829 O O   . ALA C 120 ? 1.1983 0.6860 0.5066 0.1530  0.2194  -0.0562 202 ALA C O   
2830 C CB  . ALA C 120 ? 0.9383 0.5684 0.4412 0.1522  0.2156  -0.0288 202 ALA C CB  
2831 N N   . LYS C 121 ? 1.1265 0.6679 0.5097 0.1857  0.2688  -0.0355 203 LYS C N   
2832 C CA  . LYS C 121 ? 1.2180 0.7273 0.5467 0.1890  0.2800  -0.0346 203 LYS C CA  
2833 C C   . LYS C 121 ? 1.3175 0.7646 0.5835 0.1880  0.2724  -0.0505 203 LYS C C   
2834 O O   . LYS C 121 ? 1.3711 0.7777 0.5735 0.1775  0.2615  -0.0567 203 LYS C O   
2835 C CB  . LYS C 121 ? 1.1921 0.7306 0.5544 0.2090  0.3146  -0.0188 203 LYS C CB  
2836 N N   . LYS C 122 ? 1.3070 0.7440 0.5891 0.1978  0.2763  -0.0563 204 LYS C N   
2837 C CA  . LYS C 122 ? 1.3416 0.7179 0.5690 0.1974  0.2696  -0.0704 204 LYS C CA  
2838 C C   . LYS C 122 ? 1.3416 0.6904 0.5379 0.1714  0.2328  -0.0832 204 LYS C C   
2839 O O   . LYS C 122 ? 1.3873 0.6897 0.5477 0.1665  0.2218  -0.0942 204 LYS C O   
2840 C CB  . LYS C 122 ? 1.2608 0.6403 0.5215 0.2179  0.2871  -0.0687 204 LYS C CB  
2841 N N   . LYS C 123 ? 1.3096 0.6892 0.5220 0.1549  0.2146  -0.0798 205 LYS C N   
2842 C CA  . LYS C 123 ? 1.3267 0.6892 0.5115 0.1278  0.1779  -0.0884 205 LYS C CA  
2843 C C   . LYS C 123 ? 1.3438 0.6903 0.5368 0.1201  0.1626  -0.0980 205 LYS C C   
2844 O O   . LYS C 123 ? 1.4581 0.7629 0.6068 0.1010  0.1381  -0.1073 205 LYS C O   
2845 C CB  . LYS C 123 ? 1.3954 0.7090 0.5062 0.1141  0.1633  -0.0936 205 LYS C CB  
2846 N N   . MET C 124 ? 1.2965 0.6766 0.5476 0.1333  0.1757  -0.0941 206 MET C N   
2847 C CA  . MET C 124 ? 1.3695 0.7349 0.6300 0.1268  0.1626  -0.1015 206 MET C CA  
2848 C C   . MET C 124 ? 1.2792 0.6895 0.5915 0.1116  0.1430  -0.0988 206 MET C C   
2849 O O   . MET C 124 ? 1.2806 0.7008 0.6277 0.1122  0.1401  -0.0987 206 MET C O   
2850 C CB  . MET C 124 ? 1.5171 0.8798 0.8020 0.1517  0.1876  -0.0984 206 MET C CB  
2851 C CG  . MET C 124 ? 1.5479 0.9670 0.8989 0.1737  0.2135  -0.0847 206 MET C CG  
2852 S SD  . MET C 124 ? 1.6244 1.0401 1.0027 0.2022  0.2390  -0.0788 206 MET C SD  
2853 C CE  . MET C 124 ? 1.7360 1.0776 1.0320 0.2072  0.2456  -0.0884 206 MET C CE  
2854 N N   . TYR C 125 ? 1.1897 0.6390 0.5244 0.0954  0.1251  -0.0911 207 TYR C N   
2855 C CA  . TYR C 125 ? 1.1294 0.6279 0.5217 0.0754  0.0992  -0.0848 207 TYR C CA  
2856 C C   . TYR C 125 ? 1.1459 0.6338 0.5073 0.0495  0.0680  -0.0865 207 TYR C C   
2857 O O   . TYR C 125 ? 1.1827 0.6738 0.5251 0.0473  0.0646  -0.0820 207 TYR C O   
2858 C CB  . TYR C 125 ? 1.0415 0.6056 0.5040 0.0825  0.1070  -0.0712 207 TYR C CB  
2859 C CG  . TYR C 125 ? 1.0265 0.6075 0.5259 0.1045  0.1331  -0.0667 207 TYR C CG  
2860 C CD1 . TYR C 125 ? 1.0482 0.6410 0.5544 0.1231  0.1588  -0.0588 207 TYR C CD1 
2861 C CD2 . TYR C 125 ? 0.9950 0.5803 0.5222 0.1059  0.1316  -0.0684 207 TYR C CD2 
2862 C CE1 . TYR C 125 ? 1.0496 0.6629 0.5952 0.1424  0.1814  -0.0519 207 TYR C CE1 
2863 C CE2 . TYR C 125 ? 0.9928 0.5953 0.5558 0.1258  0.1527  -0.0621 207 TYR C CE2 
2864 C CZ  . TYR C 125 ? 1.0338 0.6522 0.6082 0.1440  0.1772  -0.0535 207 TYR C CZ  
2865 O OH  . TYR C 125 ? 1.0439 0.6852 0.6603 0.1629  0.1967  -0.0445 207 TYR C OH  
2866 N N   . GLY C 126 ? 1.1359 0.6131 0.4944 0.0291  0.0445  -0.0909 208 GLY C N   
2867 C CA  . GLY C 126 ? 1.1760 0.6485 0.5125 0.0022  0.0122  -0.0900 208 GLY C CA  
2868 C C   . GLY C 126 ? 1.1422 0.6824 0.5454 -0.0099 -0.0056 -0.0772 208 GLY C C   
2869 O O   . GLY C 126 ? 1.2078 0.7546 0.6036 -0.0311 -0.0332 -0.0729 208 GLY C O   
2870 N N   . CYS C 127 ? 1.0457 0.6359 0.5136 0.0033  0.0088  -0.0703 209 CYS C N   
2871 C CA  . CYS C 127 ? 1.0351 0.6848 0.5639 -0.0055 -0.0052 -0.0596 209 CYS C CA  
2872 C C   . CYS C 127 ? 0.9801 0.6682 0.5616 0.0136  0.0163  -0.0546 209 CYS C C   
2873 O O   . CYS C 127 ? 1.0166 0.6902 0.5951 0.0293  0.0377  -0.0583 209 CYS C O   
2874 C CB  . CYS C 127 ? 1.0893 0.7513 0.6390 -0.0261 -0.0247 -0.0592 209 CYS C CB  
2875 S SG  . CYS C 127 ? 1.1162 0.7707 0.6841 -0.0192 -0.0087 -0.0649 209 CYS C SG  
2876 N N   . THR C 128 ? 0.8657 0.6015 0.4955 0.0123  0.0098  -0.0454 210 THR C N   
2877 C CA  . THR C 128 ? 0.8095 0.5758 0.4836 0.0277  0.0273  -0.0410 210 THR C CA  
2878 C C   . THR C 128 ? 0.7910 0.5658 0.4922 0.0296  0.0348  -0.0444 210 THR C C   
2879 O O   . THR C 128 ? 0.8017 0.5849 0.5234 0.0430  0.0515  -0.0429 210 THR C O   
2880 C CB  . THR C 128 ? 0.7713 0.5780 0.4842 0.0266  0.0184  -0.0316 210 THR C CB  
2881 O OG1 . THR C 128 ? 0.7839 0.6168 0.5258 0.0143  0.0033  -0.0300 210 THR C OG1 
2882 C CG2 . THR C 128 ? 0.8073 0.6027 0.4903 0.0241  0.0085  -0.0267 210 THR C CG2 
2883 N N   . GLU C 129 ? 0.7851 0.5574 0.4860 0.0149  0.0216  -0.0473 211 GLU C N   
2884 C CA  . GLU C 129 ? 0.7463 0.5238 0.4682 0.0152  0.0273  -0.0493 211 GLU C CA  
2885 C C   . GLU C 129 ? 0.8250 0.5654 0.5201 0.0271  0.0422  -0.0548 211 GLU C C   
2886 O O   . GLU C 129 ? 0.8280 0.5786 0.5475 0.0377  0.0541  -0.0530 211 GLU C O   
2887 C CB  . GLU C 129 ? 0.7000 0.4805 0.4238 -0.0050 0.0104  -0.0494 211 GLU C CB  
2888 C CG  . GLU C 129 ? 0.7042 0.5305 0.4672 -0.0132 0.0001  -0.0419 211 GLU C CG  
2889 C CD  . GLU C 129 ? 0.8309 0.6604 0.5812 -0.0239 -0.0176 -0.0377 211 GLU C CD  
2890 O OE1 . GLU C 129 ? 0.9134 0.7080 0.6202 -0.0233 -0.0205 -0.0414 211 GLU C OE1 
2891 O OE2 . GLU C 129 ? 0.8360 0.7036 0.6199 -0.0327 -0.0285 -0.0299 211 GLU C OE2 
2892 N N   . ALA C 130 ? 0.8987 0.5941 0.5422 0.0259  0.0412  -0.0611 212 ALA C N   
2893 C CA  . ALA C 130 ? 0.8929 0.5504 0.5080 0.0427  0.0597  -0.0661 212 ALA C CA  
2894 C C   . ALA C 130 ? 0.8727 0.5558 0.5187 0.0632  0.0805  -0.0596 212 ALA C C   
2895 O O   . ALA C 130 ? 0.8599 0.5461 0.5258 0.0759  0.0934  -0.0574 212 ALA C O   
2896 C CB  . ALA C 130 ? 0.9053 0.5099 0.4543 0.0413  0.0584  -0.0741 212 ALA C CB  
2897 N N   . PHE C 131 ? 0.8399 0.5452 0.4954 0.0646  0.0814  -0.0543 213 PHE C N   
2898 C CA  . PHE C 131 ? 0.8368 0.5632 0.5176 0.0811  0.1004  -0.0466 213 PHE C CA  
2899 C C   . PHE C 131 ? 0.7729 0.5383 0.5096 0.0824  0.1009  -0.0402 213 PHE C C   
2900 O O   . PHE C 131 ? 0.7605 0.5334 0.5174 0.0954  0.1157  -0.0352 213 PHE C O   
2901 C CB  . PHE C 131 ? 0.8643 0.6013 0.5392 0.0800  0.0996  -0.0413 213 PHE C CB  
2902 C CG  . PHE C 131 ? 0.8531 0.6073 0.5490 0.0947  0.1199  -0.0320 213 PHE C CG  
2903 C CD1 . PHE C 131 ? 0.8853 0.6165 0.5557 0.1104  0.1424  -0.0316 213 PHE C CD1 
2904 C CD2 . PHE C 131 ? 0.7956 0.5876 0.5368 0.0927  0.1174  -0.0230 213 PHE C CD2 
2905 C CE1 . PHE C 131 ? 0.8728 0.6256 0.5682 0.1226  0.1620  -0.0202 213 PHE C CE1 
2906 C CE2 . PHE C 131 ? 0.7997 0.6076 0.5617 0.1026  0.1342  -0.0126 213 PHE C CE2 
2907 C CZ  . PHE C 131 ? 0.8238 0.6157 0.5661 0.1169  0.1565  -0.0101 213 PHE C CZ  
2908 N N   . LEU C 132 ? 0.6974 0.4881 0.4593 0.0693  0.0851  -0.0396 214 LEU C N   
2909 C CA  . LEU C 132 ? 0.6358 0.4572 0.4419 0.0698  0.0852  -0.0348 214 LEU C CA  
2910 C C   . LEU C 132 ? 0.6460 0.4577 0.4558 0.0719  0.0873  -0.0364 214 LEU C C   
2911 O O   . LEU C 132 ? 0.6162 0.4444 0.4549 0.0779  0.0924  -0.0307 214 LEU C O   
2912 C CB  . LEU C 132 ? 0.5878 0.4334 0.4137 0.0579  0.0710  -0.0348 214 LEU C CB  
2913 C CG  . LEU C 132 ? 0.5549 0.4226 0.4133 0.0550  0.0685  -0.0333 214 LEU C CG  
2914 C CD1 . LEU C 132 ? 0.5134 0.3968 0.3969 0.0624  0.0756  -0.0270 214 LEU C CD1 
2915 C CD2 . LEU C 132 ? 0.4690 0.3540 0.3375 0.0451  0.0577  -0.0347 214 LEU C CD2 
2916 N N   . ALA C 133 ? 0.6599 0.4427 0.4393 0.0658  0.0815  -0.0431 215 ALA C N   
2917 C CA  . ALA C 133 ? 0.6125 0.3798 0.3907 0.0678  0.0825  -0.0438 215 ALA C CA  
2918 C C   . ALA C 133 ? 0.6681 0.4228 0.4459 0.0880  0.1001  -0.0402 215 ALA C C   
2919 O O   . ALA C 133 ? 0.7085 0.4729 0.5108 0.0948  0.1031  -0.0343 215 ALA C O   
2920 C CB  . ALA C 133 ? 0.6207 0.3537 0.3622 0.0554  0.0720  -0.0512 215 ALA C CB  
2921 N N   . ASP C 134 ? 0.6853 0.4198 0.4359 0.0985  0.1123  -0.0424 216 ASP C N   
2922 C CA  . ASP C 134 ? 0.7533 0.4822 0.5087 0.1205  0.1333  -0.0369 216 ASP C CA  
2923 C C   . ASP C 134 ? 0.7371 0.5124 0.5446 0.1257  0.1389  -0.0242 216 ASP C C   
2924 O O   . ASP C 134 ? 0.7331 0.5209 0.5687 0.1382  0.1477  -0.0154 216 ASP C O   
2925 C CB  . ASP C 134 ? 0.8424 0.5387 0.5522 0.1303  0.1474  -0.0421 216 ASP C CB  
2926 C CG  . ASP C 134 ? 0.9327 0.5934 0.6190 0.1522  0.1673  -0.0437 216 ASP C CG  
2927 O OD1 . ASP C 134 ? 0.9091 0.5666 0.6123 0.1583  0.1666  -0.0412 216 ASP C OD1 
2928 O OD2 . ASP C 134 ? 1.0391 0.6733 0.6879 0.1646  0.1845  -0.0470 216 ASP C OD2 
2929 N N   . ALA C 135 ? 0.7063 0.5068 0.5281 0.1152  0.1320  -0.0222 217 ALA C N   
2930 C CA  . ALA C 135 ? 0.6782 0.5168 0.5445 0.1168  0.1352  -0.0104 217 ALA C CA  
2931 C C   . ALA C 135 ? 0.6647 0.5226 0.5653 0.1127  0.1254  -0.0055 217 ALA C C   
2932 O O   . ALA C 135 ? 0.6399 0.5204 0.5748 0.1195  0.1309  0.0063  217 ALA C O   
2933 C CB  . ALA C 135 ? 0.6485 0.5023 0.5186 0.1053  0.1267  -0.0104 217 ALA C CB  
2934 N N   . LYS C 136 ? 0.6798 0.5298 0.5710 0.1005  0.1103  -0.0131 218 LYS C N   
2935 C CA  . LYS C 136 ? 0.6469 0.5120 0.5628 0.0940  0.0993  -0.0091 218 LYS C CA  
2936 C C   . LYS C 136 ? 0.6447 0.5075 0.5746 0.1064  0.1048  -0.0008 218 LYS C C   
2937 O O   . LYS C 136 ? 0.5943 0.4751 0.5506 0.1027  0.0959  0.0069  218 LYS C O   
2938 C CB  . LYS C 136 ? 0.6231 0.4773 0.5208 0.0798  0.0862  -0.0180 218 LYS C CB  
2939 C CG  . LYS C 136 ? 0.5912 0.4598 0.4906 0.0685  0.0790  -0.0224 218 LYS C CG  
2940 C CD  . LYS C 136 ? 0.6123 0.4756 0.4978 0.0554  0.0691  -0.0291 218 LYS C CD  
2941 C CE  . LYS C 136 ? 0.6116 0.4945 0.5063 0.0480  0.0640  -0.0314 218 LYS C CE  
2942 N NZ  . LYS C 136 ? 0.6094 0.4965 0.4994 0.0359  0.0567  -0.0350 218 LYS C NZ  
2943 N N   . TRP C 137 ? 0.6572 0.4964 0.5683 0.1218  0.1187  -0.0016 219 TRP C N   
2944 C CA  . TRP C 137 ? 0.6561 0.4960 0.5860 0.1388  0.1271  0.0087  219 TRP C CA  
2945 C C   . TRP C 137 ? 0.6108 0.4931 0.5907 0.1428  0.1297  0.0250  219 TRP C C   
2946 O O   . TRP C 137 ? 0.5739 0.4721 0.5837 0.1461  0.1233  0.0364  219 TRP C O   
2947 C CB  . TRP C 137 ? 0.7362 0.5430 0.6361 0.1585  0.1471  0.0049  219 TRP C CB  
2948 C CG  . TRP C 137 ? 0.8042 0.5621 0.6584 0.1571  0.1427  -0.0072 219 TRP C CG  
2949 C CD1 . TRP C 137 ? 0.8376 0.5572 0.6417 0.1524  0.1441  -0.0209 219 TRP C CD1 
2950 C CD2 . TRP C 137 ? 0.8153 0.5549 0.6682 0.1587  0.1345  -0.0051 219 TRP C CD2 
2951 N NE1 . TRP C 137 ? 0.8486 0.5265 0.6207 0.1496  0.1370  -0.0279 219 TRP C NE1 
2952 C CE2 . TRP C 137 ? 0.8474 0.5361 0.6485 0.1539  0.1319  -0.0182 219 TRP C CE2 
2953 C CE3 . TRP C 137 ? 0.7786 0.5381 0.6672 0.1623  0.1273  0.0077  219 TRP C CE3 
2954 C CZ2 . TRP C 137 ? 0.8542 0.5102 0.6386 0.1526  0.1237  -0.0190 219 TRP C CZ2 
2955 C CZ3 . TRP C 137 ? 0.7922 0.5206 0.6638 0.1625  0.1192  0.0074  219 TRP C CZ3 
2956 C CH2 . TRP C 137 ? 0.8386 0.5151 0.6587 0.1578  0.1182  -0.0059 219 TRP C CH2 
2957 N N   . ILE C 138 ? 0.6587 0.5593 0.6480 0.1410  0.1370  0.0276  220 ILE C N   
2958 C CA  . ILE C 138 ? 0.6630 0.6037 0.7000 0.1408  0.1380  0.0443  220 ILE C CA  
2959 C C   . ILE C 138 ? 0.6449 0.6036 0.7057 0.1242  0.1149  0.0487  220 ILE C C   
2960 O O   . ILE C 138 ? 0.6797 0.6624 0.7779 0.1265  0.1097  0.0638  220 ILE C O   
2961 C CB  . ILE C 138 ? 0.5955 0.5463 0.6309 0.1359  0.1458  0.0448  220 ILE C CB  
2962 C CG1 . ILE C 138 ? 0.6143 0.5457 0.6221 0.1531  0.1699  0.0421  220 ILE C CG1 
2963 C CG2 . ILE C 138 ? 0.5143 0.5044 0.5980 0.1300  0.1433  0.0625  220 ILE C CG2 
2964 C CD1 . ILE C 138 ? 0.6176 0.5576 0.6216 0.1497  0.1791  0.0454  220 ILE C CD1 
2965 N N   . LEU C 139 ? 0.6270 0.5736 0.6650 0.1076  0.1007  0.0361  221 LEU C N   
2966 C CA  . LEU C 139 ? 0.6236 0.5807 0.6739 0.0918  0.0805  0.0380  221 LEU C CA  
2967 C C   . LEU C 139 ? 0.5986 0.5476 0.6481 0.0939  0.0716  0.0410  221 LEU C C   
2968 O O   . LEU C 139 ? 0.5674 0.5336 0.6424 0.0892  0.0590  0.0528  221 LEU C O   
2969 C CB  . LEU C 139 ? 0.5940 0.5393 0.6186 0.0775  0.0723  0.0237  221 LEU C CB  
2970 C CG  . LEU C 139 ? 0.5645 0.5100 0.5865 0.0622  0.0546  0.0210  221 LEU C CG  
2971 C CD1 . LEU C 139 ? 0.5883 0.5534 0.6408 0.0564  0.0438  0.0346  221 LEU C CD1 
2972 C CD2 . LEU C 139 ? 0.5198 0.4590 0.5242 0.0531  0.0523  0.0094  221 LEU C CD2 
2973 N N   . HIS C 140 ? 0.5766 0.4975 0.5951 0.0989  0.0759  0.0313  222 HIS C N   
2974 C CA  . HIS C 140 ? 0.5853 0.4927 0.5988 0.1015  0.0684  0.0349  222 HIS C CA  
2975 C C   . HIS C 140 ? 0.5858 0.5121 0.6368 0.1162  0.0705  0.0534  222 HIS C C   
2976 O O   . HIS C 140 ? 0.5661 0.5032 0.6344 0.1111  0.0548  0.0640  222 HIS C O   
2977 C CB  . HIS C 140 ? 0.6277 0.4986 0.6033 0.1072  0.0766  0.0235  222 HIS C CB  
2978 C CG  . HIS C 140 ? 0.6790 0.5276 0.6445 0.1118  0.0712  0.0274  222 HIS C CG  
2979 N ND1 . HIS C 140 ? 0.6876 0.5320 0.6447 0.0969  0.0549  0.0279  222 HIS C ND1 
2980 C CD2 . HIS C 140 ? 0.7093 0.5336 0.6669 0.1301  0.0810  0.0306  222 HIS C CD2 
2981 C CE1 . HIS C 140 ? 0.7173 0.5374 0.6640 0.1046  0.0532  0.0328  222 HIS C CE1 
2982 N NE2 . HIS C 140 ? 0.7262 0.5324 0.6734 0.1254  0.0687  0.0341  222 HIS C NE2 
2983 N N   . ASN C 141 ? 0.5521 0.4854 0.6174 0.1345  0.0899  0.0588  223 ASN C N   
2984 C CA  . ASN C 141 ? 0.6058 0.5607 0.7114 0.1525  0.0958  0.0781  223 ASN C CA  
2985 C C   . ASN C 141 ? 0.6171 0.6156 0.7697 0.1413  0.0822  0.0948  223 ASN C C   
2986 O O   . ASN C 141 ? 0.6229 0.6427 0.8108 0.1458  0.0724  0.1126  223 ASN C O   
2987 C CB  . ASN C 141 ? 0.6051 0.5559 0.7111 0.1762  0.1241  0.0794  223 ASN C CB  
2988 C CG  . ASN C 141 ? 0.6333 0.5342 0.6884 0.1868  0.1353  0.0635  223 ASN C CG  
2989 O OD1 . ASN C 141 ? 0.6771 0.5504 0.7090 0.1819  0.1231  0.0576  223 ASN C OD1 
2990 N ND2 . ASN C 141 ? 0.6292 0.5149 0.6633 0.2004  0.1581  0.0571  223 ASN C ND2 
2991 N N   . CYS C 142 ? 0.6086 0.6191 0.7615 0.1258  0.0797  0.0901  224 CYS C N   
2992 C CA  . CYS C 142 ? 0.6138 0.6578 0.8037 0.1101  0.0631  0.1040  224 CYS C CA  
2993 C C   . CYS C 142 ? 0.6305 0.6693 0.8146 0.0942  0.0360  0.1053  224 CYS C C   
2994 O O   . CYS C 142 ? 0.6343 0.6990 0.8542 0.0889  0.0200  0.1236  224 CYS C O   
2995 C CB  . CYS C 142 ? 0.5945 0.6398 0.7746 0.0953  0.0638  0.0957  224 CYS C CB  
2996 S SG  . CYS C 142 ? 0.5868 0.6691 0.8126 0.0766  0.0466  0.1147  224 CYS C SG  
2997 N N   . ILE C 143 ? 0.6344 0.6408 0.7733 0.0855  0.0300  0.0874  225 ILE C N   
2998 C CA  . ILE C 143 ? 0.6250 0.6231 0.7508 0.0701  0.0067  0.0880  225 ILE C CA  
2999 C C   . ILE C 143 ? 0.6461 0.6471 0.7884 0.0816  0.0004  0.1030  225 ILE C C   
3000 O O   . ILE C 143 ? 0.6564 0.6700 0.8146 0.0721  -0.0213 0.1166  225 ILE C O   
3001 C CB  . ILE C 143 ? 0.5845 0.5507 0.6604 0.0601  0.0063  0.0670  225 ILE C CB  
3002 C CG1 . ILE C 143 ? 0.5386 0.5047 0.6032 0.0489  0.0090  0.0550  225 ILE C CG1 
3003 C CG2 . ILE C 143 ? 0.5760 0.5296 0.6323 0.0472  -0.0135 0.0685  225 ILE C CG2 
3004 C CD1 . ILE C 143 ? 0.4436 0.3862 0.4686 0.0434  0.0134  0.0366  225 ILE C CD1 
3005 N N   . ILE C 144 ? 0.6533 0.6401 0.7905 0.1028  0.0183  0.1016  226 ILE C N   
3006 C CA  . ILE C 144 ? 0.6682 0.6522 0.8190 0.1169  0.0136  0.1160  226 ILE C CA  
3007 C C   . ILE C 144 ? 0.6280 0.6556 0.8386 0.1246  0.0075  0.1416  226 ILE C C   
3008 O O   . ILE C 144 ? 0.6087 0.6475 0.8377 0.1206  -0.0137 0.1577  226 ILE C O   
3009 C CB  . ILE C 144 ? 0.7100 0.6629 0.8391 0.1394  0.0356  0.1082  226 ILE C CB  
3010 C CG1 . ILE C 144 ? 0.7235 0.6349 0.7969 0.1268  0.0334  0.0879  226 ILE C CG1 
3011 C CG2 . ILE C 144 ? 0.7086 0.6619 0.8617 0.1608  0.0350  0.1265  226 ILE C CG2 
3012 C CD1 . ILE C 144 ? 0.7482 0.6270 0.7920 0.1405  0.0541  0.0747  226 ILE C CD1 
3013 N N   . TYR C 145 ? 0.6338 0.6890 0.8770 0.1342  0.0249  0.1476  227 TYR C N   
3014 C CA  . TYR C 145 ? 0.6590 0.7602 0.9662 0.1454  0.0236  0.1752  227 TYR C CA  
3015 C C   . TYR C 145 ? 0.6375 0.7746 0.9771 0.1198  -0.0008 0.1884  227 TYR C C   
3016 O O   . TYR C 145 ? 0.5973 0.7708 0.9867 0.1203  -0.0161 0.2137  227 TYR C O   
3017 C CB  . TYR C 145 ? 0.6790 0.7948 1.0094 0.1714  0.0575  0.1794  227 TYR C CB  
3018 C CG  . TYR C 145 ? 0.7207 0.8892 1.1232 0.1871  0.0612  0.2103  227 TYR C CG  
3019 C CD1 . TYR C 145 ? 0.7589 0.9290 1.1835 0.2169  0.0714  0.2241  227 TYR C CD1 
3020 C CD2 . TYR C 145 ? 0.7235 0.9406 1.1744 0.1730  0.0558  0.2271  227 TYR C CD2 
3021 C CE1 . TYR C 145 ? 0.7559 0.9803 1.2535 0.2336  0.0761  0.2550  227 TYR C CE1 
3022 C CE2 . TYR C 145 ? 0.7188 0.9913 1.2431 0.1861  0.0591  0.2586  227 TYR C CE2 
3023 C CZ  . TYR C 145 ? 0.7401 1.0185 1.2893 0.2173  0.0699  0.2727  227 TYR C CZ  
3024 O OH  . TYR C 145 ? 0.7717 1.1105 1.3998 0.2324  0.0745  0.3060  227 TYR C OH  
3025 N N   . ASN C 146 ? 0.6434 0.7693 0.9555 0.0972  -0.0064 0.1728  228 ASN C N   
3026 C CA  . ASN C 146 ? 0.6303 0.7799 0.9641 0.0711  -0.0301 0.1828  228 ASN C CA  
3027 C C   . ASN C 146 ? 0.6333 0.7527 0.9217 0.0454  -0.0572 0.1698  228 ASN C C   
3028 O O   . ASN C 146 ? 0.6097 0.7404 0.9083 0.0222  -0.0812 0.1777  228 ASN C O   
3029 C CB  . ASN C 146 ? 0.5976 0.7572 0.9378 0.0650  -0.0151 0.1779  228 ASN C CB  
3030 C CG  . ASN C 146 ? 0.5826 0.7800 0.9736 0.0857  0.0096  0.1960  228 ASN C CG  
3031 O OD1 . ASN C 146 ? 0.5838 0.7727 0.9611 0.0980  0.0367  0.1860  228 ASN C OD1 
3032 N ND2 . ASN C 146 ? 0.5927 0.8335 1.0430 0.0902  0.0007  0.2241  228 ASN C ND2 
3033 N N   . GLY C 147 ? 0.6789 0.7589 0.9157 0.0481  -0.0533 0.1503  229 GLY C N   
3034 C CA  . GLY C 147 ? 0.7408 0.7926 0.9325 0.0254  -0.0749 0.1384  229 GLY C CA  
3035 C C   . GLY C 147 ? 0.7621 0.7927 0.9182 0.0131  -0.0680 0.1165  229 GLY C C   
3036 O O   . GLY C 147 ? 0.7419 0.7861 0.9163 0.0120  -0.0588 0.1164  229 GLY C O   
3037 N N   . GLY C 148 ? 0.7808 0.7779 0.8856 0.0040  -0.0723 0.0992  230 GLY C N   
3038 C CA  . GLY C 148 ? 0.7965 0.7720 0.8663 -0.0029 -0.0626 0.0779  230 GLY C CA  
3039 C C   . GLY C 148 ? 0.8151 0.7901 0.8848 -0.0207 -0.0753 0.0769  230 GLY C C   
3040 O O   . GLY C 148 ? 0.8410 0.8054 0.8969 -0.0213 -0.0636 0.0635  230 GLY C O   
3041 N N   . ASN C 149 ? 0.8253 0.8094 0.9093 -0.0360 -0.1005 0.0916  231 ASN C N   
3042 C CA  . ASN C 149 ? 0.8825 0.8601 0.9629 -0.0560 -0.1156 0.0913  231 ASN C CA  
3043 C C   . ASN C 149 ? 0.8122 0.8267 0.9499 -0.0576 -0.1171 0.1110  231 ASN C C   
3044 O O   . ASN C 149 ? 0.7865 0.7991 0.9287 -0.0779 -0.1352 0.1165  231 ASN C O   
3045 C CB  . ASN C 149 ? 1.0050 0.9618 1.0549 -0.0775 -0.1459 0.0935  231 ASN C CB  
3046 C CG  . ASN C 149 ? 1.0793 0.9903 1.0619 -0.0831 -0.1425 0.0691  231 ASN C CG  
3047 O OD1 . ASN C 149 ? 1.0460 0.9463 1.0112 -0.0700 -0.1180 0.0525  231 ASN C OD1 
3048 N ND2 . ASN C 149 ? 1.1638 1.0484 1.1081 -0.1025 -0.1669 0.0680  231 ASN C ND2 
3049 N N   . HIS C 150 ? 0.7777 0.8234 0.9565 -0.0370 -0.0974 0.1218  232 HIS C N   
3050 C CA  . HIS C 150 ? 0.7296 0.8141 0.9644 -0.0365 -0.0937 0.1419  232 HIS C CA  
3051 C C   . HIS C 150 ? 0.7205 0.7953 0.9470 -0.0405 -0.0800 0.1320  232 HIS C C   
3052 O O   . HIS C 150 ? 0.7361 0.7807 0.9214 -0.0345 -0.0659 0.1101  232 HIS C O   
3053 C CB  . HIS C 150 ? 0.7152 0.8310 0.9898 -0.0098 -0.0721 0.1549  232 HIS C CB  
3054 C CG  . HIS C 150 ? 0.7037 0.8691 1.0454 -0.0090 -0.0723 0.1831  232 HIS C CG  
3055 N ND1 . HIS C 150 ? 0.6799 0.8623 1.0446 -0.0112 -0.0581 0.1884  232 HIS C ND1 
3056 C CD2 . HIS C 150 ? 0.6830 0.8875 1.0766 -0.0062 -0.0847 0.2096  232 HIS C CD2 
3057 C CE1 . HIS C 150 ? 0.6775 0.9093 1.1064 -0.0108 -0.0603 0.2172  232 HIS C CE1 
3058 N NE2 . HIS C 150 ? 0.6775 0.9252 1.1273 -0.0069 -0.0764 0.2308  232 HIS C NE2 
3059 N N   . LYS C 151 ? 0.7411 0.6448 1.0255 0.1194  -0.1059 0.0500  233 LYS C N   
3060 C CA  . LYS C 151 ? 0.6966 0.6186 1.0211 0.1076  -0.1163 0.0675  233 LYS C CA  
3061 C C   . LYS C 151 ? 0.6442 0.6052 0.9549 0.0989  -0.0675 0.0784  233 LYS C C   
3062 O O   . LYS C 151 ? 0.6295 0.5960 0.9255 0.0947  -0.0629 0.0713  233 LYS C O   
3063 C CB  . LYS C 151 ? 0.6767 0.6087 1.0877 0.0957  -0.1515 0.1063  233 LYS C CB  
3064 C CG  . LYS C 151 ? 0.7090 0.5952 1.1475 0.0995  -0.2200 0.0993  233 LYS C CG  
3065 C CD  . LYS C 151 ? 0.7271 0.6320 1.2642 0.0790  -0.2549 0.1504  233 LYS C CD  
3066 N N   . LEU C 152 ? 0.6229 0.6090 0.9353 0.1000  -0.0339 0.0938  234 LEU C N   
3067 C CA  . LEU C 152 ? 0.6036 0.6195 0.8922 0.0997  0.0080  0.0993  234 LEU C CA  
3068 C C   . LEU C 152 ? 0.6192 0.6127 0.8390 0.1004  0.0230  0.0672  234 LEU C C   
3069 O O   . LEU C 152 ? 0.6189 0.6259 0.8255 0.0955  0.0384  0.0671  234 LEU C O   
3070 C CB  . LEU C 152 ? 0.5352 0.5720 0.8219 0.1114  0.0348  0.1111  234 LEU C CB  
3071 C CG  . LEU C 152 ? 0.5176 0.5897 0.8797 0.1113  0.0211  0.1487  234 LEU C CG  
3072 C CD1 . LEU C 152 ? 0.4986 0.5871 0.8550 0.1295  0.0416  0.1540  234 LEU C CD1 
3073 C CD2 . LEU C 152 ? 0.4974 0.6239 0.9123 0.1023  0.0260  0.1873  234 LEU C CD2 
3074 N N   . THR C 153 ? 0.6183 0.5815 0.7971 0.1057  0.0167  0.0436  235 THR C N   
3075 C CA  . THR C 153 ? 0.6138 0.5672 0.7365 0.1041  0.0277  0.0215  235 THR C CA  
3076 C C   . THR C 153 ? 0.5741 0.5341 0.7009 0.1022  0.0138  0.0134  235 THR C C   
3077 O O   . THR C 153 ? 0.5849 0.5541 0.6825 0.0972  0.0303  0.0060  235 THR C O   
3078 C CB  . THR C 153 ? 0.6560 0.5876 0.7426 0.1106  0.0197  0.0060  235 THR C CB  
3079 O OG1 . THR C 153 ? 0.7003 0.6217 0.7799 0.1115  0.0319  0.0128  235 THR C OG1 
3080 C CG2 . THR C 153 ? 0.6428 0.5797 0.6805 0.1075  0.0299  -0.0072 235 THR C CG2 
3081 N N   . GLN C 154 ? 0.5330 0.4849 0.6968 0.1068  -0.0215 0.0148  236 GLN C N   
3082 C CA  A GLN C 154 ? 0.5504 0.5027 0.7190 0.1085  -0.0419 0.0055  236 GLN C CA  
3083 C CA  B GLN C 154 ? 0.5501 0.5026 0.7179 0.1085  -0.0414 0.0053  236 GLN C CA  
3084 C C   . GLN C 154 ? 0.5476 0.5239 0.7392 0.0936  -0.0238 0.0247  236 GLN C C   
3085 O O   . GLN C 154 ? 0.5597 0.5426 0.7299 0.0921  -0.0178 0.0136  236 GLN C O   
3086 C CB  A GLN C 154 ? 0.5635 0.4906 0.7699 0.1174  -0.0950 0.0042  236 GLN C CB  
3087 C CB  B GLN C 154 ? 0.5641 0.4911 0.7673 0.1181  -0.0942 0.0027  236 GLN C CB  
3088 C CG  A GLN C 154 ? 0.5884 0.4882 0.7586 0.1416  -0.1207 -0.0235 236 GLN C CG  
3089 C CG  B GLN C 154 ? 0.5843 0.4854 0.7587 0.1385  -0.1150 -0.0184 236 GLN C CG  
3090 C CD  A GLN C 154 ? 0.6425 0.5051 0.8506 0.1529  -0.1826 -0.0253 236 GLN C CD  
3091 C CD  B GLN C 154 ? 0.5883 0.5010 0.6933 0.1516  -0.0896 -0.0421 236 GLN C CD  
3092 O OE1 A GLN C 154 ? 0.6597 0.5039 0.8854 0.1553  -0.1991 -0.0188 236 GLN C OE1 
3093 O OE1 B GLN C 154 ? 0.5956 0.5254 0.6740 0.1570  -0.0822 -0.0550 236 GLN C OE1 
3094 N NE2 A GLN C 154 ? 0.5961 0.4418 0.8162 0.1606  -0.2227 -0.0349 236 GLN C NE2 
3095 N NE2 B GLN C 154 ? 0.5920 0.5001 0.6713 0.1558  -0.0776 -0.0439 236 GLN C NE2 
3096 N N   . ILE C 155 ? 0.5212 0.5169 0.7549 0.0849  -0.0133 0.0553  237 ILE C N   
3097 C CA  . ILE C 155 ? 0.5186 0.5446 0.7692 0.0753  0.0069  0.0767  237 ILE C CA  
3098 C C   . ILE C 155 ? 0.5123 0.5417 0.7054 0.0773  0.0446  0.0615  237 ILE C C   
3099 O O   . ILE C 155 ? 0.4588 0.4963 0.6398 0.0720  0.0530  0.0592  237 ILE C O   
3100 C CB  . ILE C 155 ? 0.4946 0.5559 0.8010 0.0717  0.0132  0.1175  237 ILE C CB  
3101 C CG1 . ILE C 155 ? 0.4656 0.5201 0.8374 0.0644  -0.0331 0.1378  237 ILE C CG1 
3102 C CG2 . ILE C 155 ? 0.4815 0.5830 0.8040 0.0657  0.0334  0.1436  237 ILE C CG2 
3103 C CD1 . ILE C 155 ? 0.4822 0.5234 0.8791 0.0541  -0.0705 0.1399  237 ILE C CD1 
3104 N N   . ALA C 156 ? 0.5282 0.5467 0.6866 0.0840  0.0623  0.0519  238 ALA C N   
3105 C CA  . ALA C 156 ? 0.5593 0.5713 0.6659 0.0844  0.0874  0.0398  238 ALA C CA  
3106 C C   . ALA C 156 ? 0.5649 0.5684 0.6409 0.0774  0.0830  0.0204  238 ALA C C   
3107 O O   . ALA C 156 ? 0.5746 0.5794 0.6245 0.0723  0.0969  0.0168  238 ALA C O   
3108 C CB  . ALA C 156 ? 0.6123 0.6049 0.6900 0.0914  0.0952  0.0335  238 ALA C CB  
3109 N N   . LYS C 157 ? 0.5482 0.5460 0.6259 0.0806  0.0619  0.0079  239 LYS C N   
3110 C CA  . LYS C 157 ? 0.5433 0.5481 0.5970 0.0807  0.0573  -0.0082 239 LYS C CA  
3111 C C   . LYS C 157 ? 0.5239 0.5393 0.5977 0.0766  0.0520  -0.0058 239 LYS C C   
3112 O O   . LYS C 157 ? 0.5287 0.5539 0.5807 0.0717  0.0619  -0.0125 239 LYS C O   
3113 C CB  . LYS C 157 ? 0.5144 0.5158 0.5613 0.0960  0.0335  -0.0236 239 LYS C CB  
3114 C CG  . LYS C 157 ? 0.5265 0.5222 0.5455 0.0987  0.0409  -0.0248 239 LYS C CG  
3115 C CD  . LYS C 157 ? 0.6252 0.6156 0.6378 0.1196  0.0151  -0.0386 239 LYS C CD  
3116 C CE  . LYS C 157 ? 0.7488 0.7562 0.7175 0.1247  0.0261  -0.0414 239 LYS C CE  
3117 N NZ  . LYS C 157 ? 0.8248 0.8167 0.7842 0.1411  0.0090  -0.0469 239 LYS C NZ  
3118 N N   . VAL C 158 ? 0.4775 0.4923 0.5965 0.0760  0.0342  0.0081  240 VAL C N   
3119 C CA  . VAL C 158 ? 0.4456 0.4694 0.5844 0.0696  0.0265  0.0142  240 VAL C CA  
3120 C C   . VAL C 158 ? 0.4836 0.5207 0.6051 0.0612  0.0588  0.0244  240 VAL C C   
3121 O O   . VAL C 158 ? 0.4993 0.5402 0.6041 0.0572  0.0627  0.0160  240 VAL C O   
3122 C CB  . VAL C 158 ? 0.4701 0.4928 0.6682 0.0656  -0.0043 0.0363  240 VAL C CB  
3123 C CG1 . VAL C 158 ? 0.4296 0.4603 0.6462 0.0567  -0.0143 0.0451  240 VAL C CG1 
3124 C CG2 . VAL C 158 ? 0.4529 0.4502 0.6633 0.0776  -0.0465 0.0219  240 VAL C CG2 
3125 N N   . VAL C 159 ? 0.4843 0.5272 0.6041 0.0628  0.0803  0.0396  241 VAL C N   
3126 C CA  . VAL C 159 ? 0.4843 0.5368 0.5831 0.0630  0.1045  0.0469  241 VAL C CA  
3127 C C   . VAL C 159 ? 0.4851 0.5183 0.5318 0.0603  0.1144  0.0255  241 VAL C C   
3128 O O   . VAL C 159 ? 0.4958 0.5285 0.5230 0.0574  0.1221  0.0233  241 VAL C O   
3129 C CB  . VAL C 159 ? 0.5136 0.5827 0.6189 0.0753  0.1228  0.0672  241 VAL C CB  
3130 C CG1 . VAL C 159 ? 0.4987 0.5944 0.6649 0.0749  0.1109  0.0955  241 VAL C CG1 
3131 C CG2 . VAL C 159 ? 0.5211 0.5667 0.5823 0.0855  0.1343  0.0523  241 VAL C CG2 
3132 N N   . ILE C 160 ? 0.4832 0.5019 0.5096 0.0594  0.1108  0.0130  242 ILE C N   
3133 C CA  . ILE C 160 ? 0.4959 0.5037 0.4838 0.0512  0.1152  0.0025  242 ILE C CA  
3134 C C   . ILE C 160 ? 0.5061 0.5313 0.4980 0.0449  0.1075  -0.0057 242 ILE C C   
3135 O O   . ILE C 160 ? 0.5173 0.5425 0.4901 0.0364  0.1116  -0.0080 242 ILE C O   
3136 C CB  . ILE C 160 ? 0.5190 0.5134 0.4864 0.0489  0.1127  -0.0006 242 ILE C CB  
3137 C CG1 . ILE C 160 ? 0.5651 0.5305 0.5070 0.0527  0.1181  0.0025  242 ILE C CG1 
3138 C CG2 . ILE C 160 ? 0.5210 0.5257 0.4697 0.0367  0.1095  -0.0036 242 ILE C CG2 
3139 C CD1 . ILE C 160 ? 0.5372 0.5041 0.4910 0.0705  0.1267  0.0090  242 ILE C CD1 
3140 N N   . LYS C 161 ? 0.5213 0.5588 0.5388 0.0517  0.0919  -0.0106 243 LYS C N   
3141 C CA  . LYS C 161 ? 0.5165 0.5705 0.5344 0.0532  0.0814  -0.0221 243 LYS C CA  
3142 C C   . LYS C 161 ? 0.5151 0.5690 0.5449 0.0470  0.0820  -0.0169 243 LYS C C   
3143 O O   . LYS C 161 ? 0.4803 0.5437 0.4975 0.0427  0.0833  -0.0239 243 LYS C O   
3144 C CB  . LYS C 161 ? 0.5352 0.5935 0.5684 0.0695  0.0561  -0.0341 243 LYS C CB  
3145 C CG  . LYS C 161 ? 0.6195 0.7040 0.6315 0.0813  0.0507  -0.0506 243 LYS C CG  
3146 C CD  . LYS C 161 ? 0.7318 0.8218 0.7367 0.1057  0.0311  -0.0650 243 LYS C CD  
3147 C CE  . LYS C 161 ? 0.8428 0.9261 0.8368 0.1023  0.0426  -0.0561 243 LYS C CE  
3148 N NZ  . LYS C 161 ? 0.9178 1.0049 0.8998 0.1299  0.0218  -0.0711 243 LYS C NZ  
3149 N N   . ILE C 162 ? 0.5075 0.5566 0.5635 0.0464  0.0812  -0.0010 244 ILE C N   
3150 C CA  . ILE C 162 ? 0.5061 0.5598 0.5694 0.0407  0.0852  0.0095  244 ILE C CA  
3151 C C   . ILE C 162 ? 0.5423 0.5885 0.5662 0.0375  0.1061  0.0068  244 ILE C C   
3152 O O   . ILE C 162 ? 0.5392 0.5858 0.5529 0.0325  0.1060  0.0030  244 ILE C O   
3153 C CB  . ILE C 162 ? 0.4685 0.5329 0.5692 0.0411  0.0842  0.0370  244 ILE C CB  
3154 C CG1 . ILE C 162 ? 0.4101 0.4740 0.5570 0.0392  0.0501  0.0428  244 ILE C CG1 
3155 C CG2 . ILE C 162 ? 0.4169 0.4938 0.5127 0.0391  0.0985  0.0531  244 ILE C CG2 
3156 C CD1 . ILE C 162 ? 0.4101 0.4885 0.6024 0.0368  0.0451  0.0751  244 ILE C CD1 
3157 N N   . CYS C 163 ? 0.5187 0.5520 0.5191 0.0413  0.1185  0.0076  245 CYS C N   
3158 C CA  . CYS C 163 ? 0.5542 0.5674 0.5143 0.0403  0.1270  0.0032  245 CYS C CA  
3159 C C   . CYS C 163 ? 0.5729 0.5852 0.5196 0.0264  0.1193  -0.0071 245 CYS C C   
3160 O O   . CYS C 163 ? 0.5841 0.5893 0.5165 0.0218  0.1182  -0.0091 245 CYS C O   
3161 C CB  . CYS C 163 ? 0.5867 0.5786 0.5241 0.0480  0.1315  0.0031  245 CYS C CB  
3162 S SG  . CYS C 163 ? 0.6914 0.6441 0.5768 0.0540  0.1294  -0.0035 245 CYS C SG  
3163 N N   . GLU C 164 ? 0.5643 0.5896 0.5159 0.0211  0.1139  -0.0110 246 GLU C N   
3164 C CA  . GLU C 164 ? 0.6073 0.6527 0.5548 0.0105  0.1087  -0.0140 246 GLU C CA  
3165 C C   . GLU C 164 ? 0.5917 0.6512 0.5510 0.0113  0.1043  -0.0202 246 GLU C C   
3166 O O   . GLU C 164 ? 0.5376 0.5971 0.4870 0.0013  0.1025  -0.0195 246 GLU C O   
3167 C CB  . GLU C 164 ? 0.6524 0.7282 0.6075 0.0149  0.1055  -0.0158 246 GLU C CB  
3168 C CG  . GLU C 164 ? 0.7915 0.8625 0.7316 0.0061  0.1073  -0.0047 246 GLU C CG  
3169 C CD  . GLU C 164 ? 0.8987 0.9938 0.8433 0.0181  0.1060  -0.0065 246 GLU C CD  
3170 O OE1 . GLU C 164 ? 0.9280 1.0160 0.8617 0.0116  0.1065  0.0041  246 GLU C OE1 
3171 O OE2 . GLU C 164 ? 0.9301 1.0471 0.8863 0.0361  0.1000  -0.0194 246 GLU C OE2 
3172 N N   . HIS C 165 ? 0.6270 0.6942 0.6098 0.0221  0.0973  -0.0249 247 HIS C N   
3173 C CA  . HIS C 165 ? 0.5874 0.6645 0.5837 0.0239  0.0864  -0.0315 247 HIS C CA  
3174 C C   . HIS C 165 ? 0.6171 0.6771 0.6026 0.0158  0.0927  -0.0248 247 HIS C C   
3175 O O   . HIS C 165 ? 0.6368 0.7024 0.6166 0.0104  0.0885  -0.0301 247 HIS C O   
3176 C CB  . HIS C 165 ? 0.5670 0.6428 0.5929 0.0346  0.0686  -0.0329 247 HIS C CB  
3177 C CG  . HIS C 165 ? 0.5734 0.6499 0.6163 0.0361  0.0498  -0.0372 247 HIS C CG  
3178 N ND1 . HIS C 165 ? 0.5747 0.6404 0.6332 0.0282  0.0484  -0.0206 247 HIS C ND1 
3179 C CD2 . HIS C 165 ? 0.5592 0.6475 0.6058 0.0472  0.0289  -0.0553 247 HIS C CD2 
3180 C CE1 . HIS C 165 ? 0.5696 0.6349 0.6426 0.0295  0.0256  -0.0271 247 HIS C CE1 
3181 N NE2 . HIS C 165 ? 0.5815 0.6575 0.6465 0.0428  0.0121  -0.0507 247 HIS C NE2 
3182 N N   . GLU C 166 ? 0.6062 0.6491 0.5860 0.0186  0.1028  -0.0129 248 GLU C N   
3183 C CA  . GLU C 166 ? 0.6124 0.6419 0.5737 0.0189  0.1087  -0.0074 248 GLU C CA  
3184 C C   . GLU C 166 ? 0.6495 0.6573 0.5752 0.0125  0.1085  -0.0148 248 GLU C C   
3185 O O   . GLU C 166 ? 0.6890 0.6880 0.6023 0.0089  0.1037  -0.0176 248 GLU C O   
3186 C CB  . GLU C 166 ? 0.6178 0.6468 0.5781 0.0316  0.1212  0.0089  248 GLU C CB  
3187 C CG  . GLU C 166 ? 0.6636 0.7170 0.6702 0.0321  0.1155  0.0260  248 GLU C CG  
3188 C CD  . GLU C 166 ? 0.7646 0.8281 0.7947 0.0249  0.1016  0.0338  248 GLU C CD  
3189 O OE1 . GLU C 166 ? 0.8302 0.8974 0.8465 0.0280  0.1101  0.0453  248 GLU C OE1 
3190 O OE2 . GLU C 166 ? 0.7803 0.8460 0.8402 0.0192  0.0788  0.0279  248 GLU C OE2 
3191 N N   . MET C 167 ? 0.6537 0.6493 0.5649 0.0093  0.1085  -0.0157 249 MET C N   
3192 C CA  . MET C 167 ? 0.6609 0.6331 0.5471 -0.0022 0.0979  -0.0171 249 MET C CA  
3193 C C   . MET C 167 ? 0.6107 0.6088 0.5133 -0.0173 0.0898  -0.0181 249 MET C C   
3194 O O   . MET C 167 ? 0.5941 0.5748 0.4833 -0.0256 0.0789  -0.0181 249 MET C O   
3195 C CB  . MET C 167 ? 0.6583 0.6188 0.5364 -0.0085 0.0935  -0.0123 249 MET C CB  
3196 C CG  . MET C 167 ? 0.7361 0.6681 0.5940 0.0091  0.0983  -0.0135 249 MET C CG  
3197 S SD  . MET C 167 ? 0.8325 0.7243 0.6474 0.0321  0.0955  -0.0205 249 MET C SD  
3198 C CE  . MET C 167 ? 0.7406 0.6736 0.5798 0.0510  0.1199  -0.0127 249 MET C CE  
3199 N N   . ASN C 168 ? 0.5810 0.6214 0.5112 -0.0167 0.0924  -0.0199 250 ASN C N   
3200 C CA  . ASN C 168 ? 0.6030 0.6794 0.5483 -0.0231 0.0860  -0.0217 250 ASN C CA  
3201 C C   . ASN C 168 ? 0.6102 0.6776 0.5570 -0.0203 0.0808  -0.0295 250 ASN C C   
3202 O O   . ASN C 168 ? 0.6243 0.6968 0.5703 -0.0303 0.0730  -0.0284 250 ASN C O   
3203 C CB  . ASN C 168 ? 0.6685 0.7917 0.6336 -0.0112 0.0874  -0.0271 250 ASN C CB  
3204 C CG  . ASN C 168 ? 0.7778 0.9508 0.7558 -0.0095 0.0822  -0.0292 250 ASN C CG  
3205 O OD1 . ASN C 168 ? 0.8191 1.0043 0.8068 0.0050  0.0743  -0.0442 250 ASN C OD1 
3206 N ND2 . ASN C 168 ? 0.8187 1.0236 0.7993 -0.0240 0.0837  -0.0114 250 ASN C ND2 
3207 N N   . GLU C 169 ? 0.6109 0.6658 0.5627 -0.0090 0.0830  -0.0330 251 GLU C N   
3208 C CA  . GLU C 169 ? 0.6185 0.6651 0.5720 -0.0080 0.0766  -0.0356 251 GLU C CA  
3209 C C   . GLU C 169 ? 0.6801 0.6946 0.6028 -0.0137 0.0763  -0.0327 251 GLU C C   
3210 O O   . GLU C 169 ? 0.7553 0.7682 0.6760 -0.0197 0.0667  -0.0367 251 GLU C O   
3211 C CB  . GLU C 169 ? 0.6433 0.6854 0.6115 0.0010  0.0771  -0.0286 251 GLU C CB  
3212 C CG  . GLU C 169 ? 0.7659 0.8274 0.7659 0.0077  0.0643  -0.0336 251 GLU C CG  
3213 C CD  . GLU C 169 ? 0.8955 0.9683 0.9117 0.0112  0.0424  -0.0464 251 GLU C CD  
3214 O OE1 . GLU C 169 ? 0.9025 0.9870 0.9088 0.0086  0.0413  -0.0561 251 GLU C OE1 
3215 O OE2 . GLU C 169 ? 0.9517 1.0212 0.9932 0.0172  0.0219  -0.0459 251 GLU C OE2 
3216 N N   . ILE C 170 ? 0.6683 0.6536 0.5639 -0.0080 0.0829  -0.0280 252 ILE C N   
3217 C CA  . ILE C 170 ? 0.6879 0.6326 0.5450 -0.0057 0.0750  -0.0298 252 ILE C CA  
3218 C C   . ILE C 170 ? 0.7338 0.6727 0.5922 -0.0253 0.0569  -0.0306 252 ILE C C   
3219 O O   . ILE C 170 ? 0.7793 0.6962 0.6227 -0.0287 0.0431  -0.0338 252 ILE C O   
3220 C CB  . ILE C 170 ? 0.6979 0.6120 0.5225 0.0101  0.0795  -0.0288 252 ILE C CB  
3221 C CG1 . ILE C 170 ? 0.6532 0.5829 0.4771 0.0319  0.0981  -0.0214 252 ILE C CG1 
3222 C CG2 . ILE C 170 ? 0.6279 0.4894 0.4075 0.0148  0.0594  -0.0357 252 ILE C CG2 
3223 C CD1 . ILE C 170 ? 0.6273 0.5453 0.4288 0.0522  0.1070  -0.0193 252 ILE C CD1 
3224 N N   . GLU C 171 ? 0.7277 0.6923 0.6076 -0.0389 0.0558  -0.0238 253 GLU C N   
3225 C CA  . GLU C 171 ? 0.7088 0.6822 0.5998 -0.0608 0.0383  -0.0137 253 GLU C CA  
3226 C C   . GLU C 171 ? 0.6540 0.6708 0.5724 -0.0664 0.0367  -0.0152 253 GLU C C   
3227 O O   . GLU C 171 ? 0.7005 0.7153 0.6242 -0.0819 0.0194  -0.0075 253 GLU C O   
3228 C CB  . GLU C 171 ? 0.7174 0.7176 0.6249 -0.0728 0.0395  0.0014  253 GLU C CB  
3229 C CG  . GLU C 171 ? 0.7854 0.7332 0.6647 -0.0718 0.0305  0.0046  253 GLU C CG  
3230 C CD  . GLU C 171 ? 0.8818 0.7747 0.7408 -0.0862 -0.0035 0.0120  253 GLU C CD  
3231 O OE1 . GLU C 171 ? 0.9396 0.8434 0.8140 -0.1022 -0.0182 0.0196  253 GLU C OE1 
3232 O OE2 . GLU C 171 ? 0.9019 0.7386 0.7301 -0.0804 -0.0202 0.0099  253 GLU C OE2 
3233 N N   . VAL C 172 ? 0.6167 0.6691 0.5532 -0.0527 0.0490  -0.0253 254 VAL C N   
3234 C CA  . VAL C 172 ? 0.6127 0.7012 0.5705 -0.0516 0.0432  -0.0315 254 VAL C CA  
3235 C C   . VAL C 172 ? 0.6728 0.7219 0.6140 -0.0542 0.0319  -0.0369 254 VAL C C   
3236 O O   . VAL C 172 ? 0.6968 0.7564 0.6473 -0.0651 0.0189  -0.0340 254 VAL C O   
3237 C CB  . VAL C 172 ? 0.5820 0.7010 0.5569 -0.0317 0.0486  -0.0450 254 VAL C CB  
3238 C CG1 . VAL C 172 ? 0.5952 0.7271 0.5817 -0.0251 0.0366  -0.0569 254 VAL C CG1 
3239 C CG2 . VAL C 172 ? 0.5849 0.7578 0.5755 -0.0246 0.0547  -0.0420 254 VAL C CG2 
3240 N N   . CYS C 173 ? 0.6824 0.6916 0.5999 -0.0428 0.0368  -0.0421 255 CYS C N   
3241 C CA  . CYS C 173 ? 0.6808 0.6503 0.5718 -0.0404 0.0277  -0.0454 255 CYS C CA  
3242 C C   . CYS C 173 ? 0.6676 0.6036 0.5254 -0.0233 0.0383  -0.0435 255 CYS C C   
3243 O O   . CYS C 173 ? 0.6102 0.5630 0.4799 -0.0135 0.0502  -0.0393 255 CYS C O   
3244 C CB  . CYS C 173 ? 0.6599 0.6470 0.5688 -0.0386 0.0210  -0.0523 255 CYS C CB  
3245 S SG  . CYS C 173 ? 0.7154 0.6543 0.5879 -0.0357 0.0081  -0.0547 255 CYS C SG  
3246 N N   . PRO C 174 ? 0.6821 0.5729 0.4986 -0.0170 0.0306  -0.0446 256 PRO C N   
3247 C CA  . PRO C 174 ? 0.7020 0.5700 0.4795 0.0090  0.0417  -0.0435 256 PRO C CA  
3248 C C   . PRO C 174 ? 0.7397 0.6189 0.5123 0.0206  0.0489  -0.0385 256 PRO C C   
3249 O O   . PRO C 174 ? 0.7185 0.6178 0.4895 0.0369  0.0670  -0.0260 256 PRO C O   
3250 C CB  . PRO C 174 ? 0.7111 0.5202 0.4384 0.0181  0.0197  -0.0524 256 PRO C CB  
3251 C CG  . PRO C 174 ? 0.7204 0.5254 0.4731 -0.0112 -0.0014 -0.0503 256 PRO C CG  
3252 C CD  . PRO C 174 ? 0.6774 0.5366 0.4813 -0.0309 0.0059  -0.0456 256 PRO C CD  
3253 N N   . GLU C 175 ? 0.8141 0.6841 0.5868 0.0117  0.0337  -0.0438 257 GLU C N   
3254 C CA  . GLU C 175 ? 0.8310 0.7065 0.5939 0.0222  0.0368  -0.0367 257 GLU C CA  
3255 C C   . GLU C 175 ? 0.7392 0.6591 0.5522 0.0132  0.0453  -0.0233 257 GLU C C   
3256 O O   . GLU C 175 ? 0.7330 0.6720 0.5474 0.0237  0.0565  -0.0035 257 GLU C O   
3257 C CB  . GLU C 175 ? 0.8823 0.7309 0.6320 0.0143  0.0141  -0.0474 257 GLU C CB  
3258 C CG  . GLU C 175 ? 0.9998 0.7942 0.7023 0.0218  -0.0056 -0.0598 257 GLU C CG  
3259 C CD  . GLU C 175 ? 1.0885 0.8553 0.7860 0.0098  -0.0333 -0.0686 257 GLU C CD  
3260 O OE1 . GLU C 175 ? 1.1482 0.8885 0.8052 0.0277  -0.0403 -0.0720 257 GLU C OE1 
3261 O OE2 . GLU C 175 ? 1.1018 0.8785 0.8363 -0.0158 -0.0479 -0.0696 257 GLU C OE2 
3262 N N   . CYS C 176 ? 0.6861 0.6251 0.5409 -0.0041 0.0364  -0.0314 258 CYS C N   
3263 C CA  . CYS C 176 ? 0.6555 0.6259 0.5549 -0.0083 0.0356  -0.0236 258 CYS C CA  
3264 C C   . CYS C 176 ? 0.6345 0.6187 0.5392 0.0005  0.0528  -0.0059 258 CYS C C   
3265 O O   . CYS C 176 ? 0.6225 0.6244 0.5488 0.0016  0.0530  0.0159  258 CYS C O   
3266 C CB  . CYS C 176 ? 0.6680 0.6577 0.5974 -0.0165 0.0258  -0.0397 258 CYS C CB  
3267 S SG  . CYS C 176 ? 0.7561 0.7536 0.7035 -0.0219 0.0019  -0.0545 258 CYS C SG  
3268 N N   . TYR C 177 ? 0.5868 0.5644 0.4749 0.0055  0.0648  -0.0113 259 TYR C N   
3269 C CA  . TYR C 177 ? 0.5629 0.5559 0.4588 0.0147  0.0807  0.0034  259 TYR C CA  
3270 C C   . TYR C 177 ? 0.5941 0.5986 0.4731 0.0312  0.0943  0.0273  259 TYR C C   
3271 O O   . TYR C 177 ? 0.5564 0.5930 0.4698 0.0305  0.0986  0.0531  259 TYR C O   
3272 C CB  . TYR C 177 ? 0.5933 0.5696 0.4656 0.0191  0.0879  -0.0078 259 TYR C CB  
3273 C CG  . TYR C 177 ? 0.5928 0.5853 0.4762 0.0284  0.1025  0.0042  259 TYR C CG  
3274 C CD1 . TYR C 177 ? 0.5609 0.5746 0.4865 0.0192  0.0993  0.0060  259 TYR C CD1 
3275 C CD2 . TYR C 177 ? 0.6193 0.6067 0.4688 0.0509  0.1172  0.0124  259 TYR C CD2 
3276 C CE1 . TYR C 177 ? 0.5661 0.5934 0.5051 0.0267  0.1100  0.0181  259 TYR C CE1 
3277 C CE2 . TYR C 177 ? 0.6350 0.6428 0.4982 0.0608  0.1308  0.0248  259 TYR C CE2 
3278 C CZ  . TYR C 177 ? 0.6150 0.6414 0.5254 0.0458  0.1270  0.0287  259 TYR C CZ  
3279 O OH  . TYR C 177 ? 0.6227 0.6672 0.5489 0.0545  0.1377  0.0416  259 TYR C OH  
3280 N N   . LEU C 178 ? 0.6337 0.6153 0.4602 0.0480  0.0982  0.0217  260 LEU C N   
3281 C CA  . LEU C 178 ? 0.6816 0.6845 0.4831 0.0725  0.1141  0.0451  260 LEU C CA  
3282 C C   . LEU C 178 ? 0.6999 0.7357 0.5380 0.0606  0.1098  0.0732  260 LEU C C   
3283 O O   . LEU C 178 ? 0.6939 0.7757 0.5534 0.0676  0.1232  0.1095  260 LEU C O   
3284 C CB  . LEU C 178 ? 0.6991 0.6632 0.4294 0.0980  0.1110  0.0275  260 LEU C CB  
3285 C CG  . LEU C 178 ? 0.7371 0.7278 0.4310 0.1301  0.1259  0.0496  260 LEU C CG  
3286 C CD1 . LEU C 178 ? 0.7416 0.7774 0.4301 0.1592  0.1519  0.0716  260 LEU C CD1 
3287 C CD2 . LEU C 178 ? 0.7806 0.7204 0.4020 0.1547  0.1119  0.0249  260 LEU C CD2 
3288 N N   . ALA C 179 ? 0.7243 0.7404 0.5742 0.0417  0.0886  0.0608  261 ALA C N   
3289 C CA  . ALA C 179 ? 0.7777 0.8172 0.6619 0.0293  0.0774  0.0876  261 ALA C CA  
3290 C C   . ALA C 179 ? 0.7324 0.8010 0.6829 0.0120  0.0679  0.1106  261 ALA C C   
3291 O O   . ALA C 179 ? 0.7186 0.8188 0.7029 0.0045  0.0619  0.1501  261 ALA C O   
3292 C CB  . ALA C 179 ? 0.5900 0.5991 0.4740 0.0148  0.0525  0.0657  261 ALA C CB  
3293 N N   . ALA C 180 ? 0.6761 0.7348 0.6466 0.0057  0.0630  0.0897  262 ALA C N   
3294 C CA  . ALA C 180 ? 0.6205 0.6973 0.6491 -0.0069 0.0476  0.1069  262 ALA C CA  
3295 C C   . ALA C 180 ? 0.6667 0.7806 0.7084 0.0017  0.0693  0.1409  262 ALA C C   
3296 O O   . ALA C 180 ? 0.6532 0.7918 0.7494 -0.0105 0.0547  0.1736  262 ALA C O   
3297 C CB  . ALA C 180 ? 0.5058 0.5622 0.5446 -0.0106 0.0342  0.0714  262 ALA C CB  
3298 N N   . CYS C 181 ? 0.7141 0.8314 0.7083 0.0239  0.0994  0.1343  263 CYS C N   
3299 C CA  . CYS C 181 ? 0.7405 0.9007 0.7427 0.0390  0.1225  0.1660  263 CYS C CA  
3300 C C   . CYS C 181 ? 0.7720 0.9842 0.7842 0.0454  0.1325  0.2154  263 CYS C C   
3301 O O   . CYS C 181 ? 0.7587 1.0221 0.8237 0.0382  0.1333  0.2619  263 CYS C O   
3302 C CB  . CYS C 181 ? 0.7818 0.9245 0.7242 0.0665  0.1457  0.1399  263 CYS C CB  
3303 S SG  . CYS C 181 ? 0.7929 0.8935 0.7390 0.0549  0.1356  0.0994  263 CYS C SG  
3304 N N   . GLN C 182 ? 0.8300 1.0335 0.7963 0.0574  0.1371  0.2103  264 GLN C N   
3305 C CA  . GLN C 182 ? 0.8798 1.1417 0.8505 0.0672  0.1494  0.2612  264 GLN C CA  
3306 C C   . GLN C 182 ? 0.8765 1.1558 0.9185 0.0307  0.1192  0.2998  264 GLN C C   
3307 O O   . GLN C 182 ? 0.8887 1.2340 0.9747 0.0254  0.1236  0.3607  264 GLN C O   
3308 C CB  . GLN C 182 ? 0.9507 1.1941 0.8440 0.0955  0.1607  0.2423  264 GLN C CB  
3309 C CG  . GLN C 182 ? 0.9973 1.2402 0.8221 0.1408  0.1872  0.2223  264 GLN C CG  
3310 C CD  . GLN C 182 ? 1.0987 1.2867 0.8433 0.1648  0.1819  0.1825  264 GLN C CD  
3311 O OE1 . GLN C 182 ? 1.1283 1.2702 0.8729 0.1417  0.1588  0.1611  264 GLN C OE1 
3312 N NE2 . GLN C 182 ? 1.1723 1.3626 0.8463 0.2144  0.1992  0.1711  264 GLN C NE2 
3313 N N   . LYS C 183 ? 0.8519 1.0758 0.9084 0.0063  0.0852  0.2681  265 LYS C N   
3314 C CA  . LYS C 183 ? 0.7610 0.9838 0.8800 -0.0258 0.0449  0.2954  265 LYS C CA  
3315 C C   . LYS C 183 ? 0.8143 1.0783 0.9338 -0.0273 0.0476  0.3451  265 LYS C C   
3316 O O   . LYS C 183 ? 0.8384 1.1505 1.0182 -0.0463 0.0337  0.4066  265 LYS C O   
3317 C CB  . LYS C 183 ? 0.6154 0.8576 0.8093 -0.0459 0.0228  0.3258  265 LYS C CB  
3318 N N   . ARG C 184 ? 0.8276 1.0728 0.8809 -0.0081 0.0625  0.3210  266 ARG C N   
3319 C CA  . ARG C 184 ? 0.8702 1.1508 0.9147 -0.0064 0.0645  0.3640  266 ARG C CA  
3320 C C   . ARG C 184 ? 0.9209 1.1662 1.0085 -0.0412 0.0159  0.3679  266 ARG C C   
3321 O O   . ARG C 184 ? 0.9221 1.1249 1.0511 -0.0631 -0.0200 0.3434  266 ARG C O   
3322 C CB  . ARG C 184 ? 0.8671 1.1347 0.8199 0.0315  0.0931  0.3349  266 ARG C CB  
3323 C CG  . ARG C 184 ? 0.8917 1.1962 0.7979 0.0730  0.1348  0.3354  266 ARG C CG  
3324 C CD  . ARG C 184 ? 0.9621 1.2353 0.7704 0.1151  0.1508  0.2978  266 ARG C CD  
3325 N NE  . ARG C 184 ? 1.0096 1.2942 0.7674 0.1579  0.1797  0.2811  266 ARG C NE  
3326 C CZ  . ARG C 184 ? 1.0791 1.4396 0.8135 0.1978  0.2117  0.3194  266 ARG C CZ  
3327 N NH1 . ARG C 184 ? 1.1333 1.5714 0.8966 0.1967  0.2203  0.3806  266 ARG C NH1 
3328 N NH2 . ARG C 184 ? 1.0906 1.4508 0.7758 0.2398  0.2318  0.2957  266 ARG C NH2 
3329 N N   . ASP C 185 ? 1.0172 1.2793 1.0909 -0.0424 0.0121  0.3978  267 ASP C N   
3330 C CA  . ASP C 185 ? 1.0365 1.2662 1.1497 -0.0740 -0.0372 0.4067  267 ASP C CA  
3331 C C   . ASP C 185 ? 0.9969 1.1454 1.0874 -0.0758 -0.0618 0.3322  267 ASP C C   
3332 O O   . ASP C 185 ? 1.0143 1.1345 1.0402 -0.0553 -0.0437 0.2906  267 ASP C O   
3333 C CB  . ASP C 185 ? 1.1945 1.4567 1.2828 -0.0698 -0.0310 0.4484  267 ASP C CB  
3334 C CG  . ASP C 185 ? 1.3034 1.6556 1.4454 -0.0825 -0.0257 0.5408  267 ASP C CG  
3335 O OD1 . ASP C 185 ? 1.3581 1.7665 1.4672 -0.0651 -0.0003 0.5831  267 ASP C OD1 
3336 O OD2 . ASP C 185 ? 1.3056 1.6765 1.5241 -0.1088 -0.0486 0.5742  267 ASP C OD2 
3337 N N   . ASN C 186 ? 0.8587 0.9725 1.0028 -0.0976 -0.1062 0.3173  268 ASN C N   
3338 C CA  . ASN C 186 ? 0.8177 0.8691 0.9474 -0.0956 -0.1317 0.2514  268 ASN C CA  
3339 C C   . ASN C 186 ? 0.7685 0.8074 0.8455 -0.0720 -0.0941 0.1994  268 ASN C C   
3340 O O   . ASN C 186 ? 0.7870 0.7936 0.8258 -0.0635 -0.0941 0.1568  268 ASN C O   
3341 C CB  . ASN C 186 ? 0.8114 0.8332 0.9225 -0.1003 -0.1555 0.2416  268 ASN C CB  
3342 C CG  . ASN C 186 ? 0.8417 0.8574 1.0097 -0.1269 -0.2086 0.2822  268 ASN C CG  
3343 O OD1 . ASN C 186 ? 0.8551 0.8523 1.0764 -0.1404 -0.2518 0.2839  268 ASN C OD1 
3344 N ND2 . ASN C 186 ? 0.8755 0.9010 1.0306 -0.1335 -0.2120 0.3144  268 ASN C ND2 
3345 N N   . TRP C 187 ? 0.6908 0.7558 0.7693 -0.0632 -0.0655 0.2064  269 TRP C N   
3346 C CA  . TRP C 187 ? 0.6459 0.7000 0.6738 -0.0422 -0.0315 0.1660  269 TRP C CA  
3347 C C   . TRP C 187 ? 0.6174 0.6312 0.6404 -0.0431 -0.0497 0.1110  269 TRP C C   
3348 O O   . TRP C 187 ? 0.6465 0.6426 0.6253 -0.0320 -0.0335 0.0793  269 TRP C O   
3349 C CB  . TRP C 187 ? 0.6441 0.7296 0.6848 -0.0351 -0.0068 0.1824  269 TRP C CB  
3350 C CG  . TRP C 187 ? 0.6400 0.7208 0.7384 -0.0506 -0.0355 0.1829  269 TRP C CG  
3351 C CD1 . TRP C 187 ? 0.6557 0.7554 0.8155 -0.0694 -0.0640 0.2268  269 TRP C CD1 
3352 C CD2 . TRP C 187 ? 0.6208 0.6753 0.7215 -0.0473 -0.0443 0.1387  269 TRP C CD2 
3353 N NE1 . TRP C 187 ? 0.6454 0.7226 0.8417 -0.0753 -0.0941 0.2072  269 TRP C NE1 
3354 C CE2 . TRP C 187 ? 0.6163 0.6694 0.7741 -0.0595 -0.0794 0.1525  269 TRP C CE2 
3355 C CE3 . TRP C 187 ? 0.5800 0.6145 0.6414 -0.0351 -0.0286 0.0925  269 TRP C CE3 
3356 C CZ2 . TRP C 187 ? 0.5757 0.6083 0.7436 -0.0535 -0.0966 0.1167  269 TRP C CZ2 
3357 C CZ3 . TRP C 187 ? 0.5326 0.5573 0.6100 -0.0331 -0.0416 0.0638  269 TRP C CZ3 
3358 C CH2 . TRP C 187 ? 0.5493 0.5730 0.6750 -0.0390 -0.0739 0.0732  269 TRP C CH2 
3359 N N   . PHE C 188 ? 0.6033 0.6043 0.6711 -0.0540 -0.0870 0.1012  270 PHE C N   
3360 C CA  . PHE C 188 ? 0.5648 0.5428 0.6277 -0.0478 -0.1030 0.0522  270 PHE C CA  
3361 C C   . PHE C 188 ? 0.5804 0.5392 0.6172 -0.0467 -0.1117 0.0315  270 PHE C C   
3362 O O   . PHE C 188 ? 0.5997 0.5528 0.6225 -0.0390 -0.1109 -0.0049 270 PHE C O   
3363 C CB  . PHE C 188 ? 0.5750 0.5419 0.6844 -0.0502 -0.1478 0.0441  270 PHE C CB  
3364 C CG  . PHE C 188 ? 0.5506 0.5129 0.6529 -0.0338 -0.1553 -0.0035 270 PHE C CG  
3365 C CD1 . PHE C 188 ? 0.5239 0.5023 0.6194 -0.0245 -0.1311 -0.0156 270 PHE C CD1 
3366 C CD2 . PHE C 188 ? 0.5491 0.4978 0.6504 -0.0249 -0.1852 -0.0339 270 PHE C CD2 
3367 C CE1 . PHE C 188 ? 0.5133 0.5004 0.6016 -0.0073 -0.1351 -0.0534 270 PHE C CE1 
3368 C CE2 . PHE C 188 ? 0.5323 0.4936 0.6264 -0.0043 -0.1881 -0.0735 270 PHE C CE2 
3369 C CZ  . PHE C 188 ? 0.5126 0.4962 0.6003 0.0043  -0.1621 -0.0812 270 PHE C CZ  
3370 N N   . CYS C 189 ? 0.5921 0.5462 0.6234 -0.0541 -0.1194 0.0571  271 CYS C N   
3371 C CA  . CYS C 189 ? 0.6555 0.5873 0.6647 -0.0536 -0.1330 0.0373  271 CYS C CA  
3372 C C   . CYS C 189 ? 0.7048 0.6300 0.6585 -0.0441 -0.1018 0.0280  271 CYS C C   
3373 O O   . CYS C 189 ? 0.7575 0.6622 0.6918 -0.0441 -0.1139 0.0129  271 CYS C O   
3374 C CB  . CYS C 189 ? 0.6662 0.5901 0.6944 -0.0664 -0.1631 0.0684  271 CYS C CB  
3375 S SG  . CYS C 189 ? 0.6807 0.5952 0.7754 -0.0789 -0.2180 0.0805  271 CYS C SG  
3376 N N   . GLU C 190 ? 0.7097 0.6467 0.6366 -0.0343 -0.0678 0.0351  272 GLU C N   
3377 C CA  . GLU C 190 ? 0.7928 0.7118 0.6622 -0.0210 -0.0485 0.0237  272 GLU C CA  
3378 C C   . GLU C 190 ? 0.7758 0.6777 0.6394 -0.0225 -0.0527 -0.0134 272 GLU C C   
3379 O O   . GLU C 190 ? 0.7757 0.6913 0.6567 -0.0236 -0.0439 -0.0227 272 GLU C O   
3380 C CB  . GLU C 190 ? 0.8886 0.8233 0.7273 -0.0039 -0.0165 0.0428  272 GLU C CB  
3381 C CG  . GLU C 190 ? 0.9853 0.9540 0.8285 0.0008  -0.0066 0.0884  272 GLU C CG  
3382 C CD  . GLU C 190 ? 1.0635 1.0240 0.8839 0.0023  -0.0187 0.1020  272 GLU C CD  
3383 O OE1 . GLU C 190 ? 1.0755 1.0004 0.8461 0.0142  -0.0220 0.0764  272 GLU C OE1 
3384 O OE2 . GLU C 190 ? 1.0924 1.0804 0.9472 -0.0100 -0.0290 0.1412  272 GLU C OE2 
3385 N N   . PRO C 191 ? 0.7547 0.6313 0.5970 -0.0236 -0.0667 -0.0306 273 PRO C N   
3386 C CA  . PRO C 191 ? 0.7637 0.6329 0.6058 -0.0279 -0.0710 -0.0553 273 PRO C CA  
3387 C C   . PRO C 191 ? 0.7841 0.6400 0.5927 -0.0197 -0.0531 -0.0553 273 PRO C C   
3388 O O   . PRO C 191 ? 0.7676 0.6050 0.5317 -0.0035 -0.0421 -0.0451 273 PRO C O   
3389 C CB  . PRO C 191 ? 0.7837 0.6249 0.6072 -0.0304 -0.0924 -0.0658 273 PRO C CB  
3390 C CG  . PRO C 191 ? 0.7868 0.6265 0.6137 -0.0300 -0.1026 -0.0524 273 PRO C CG  
3391 C CD  . PRO C 191 ? 0.7970 0.6532 0.6179 -0.0225 -0.0817 -0.0248 273 PRO C CD  
3392 N N   . CYS C 192 ? 0.7801 0.6484 0.6090 -0.0282 -0.0522 -0.0658 274 CYS C N   
3393 C CA  . CYS C 192 ? 0.8104 0.6573 0.6109 -0.0248 -0.0461 -0.0673 274 CYS C CA  
3394 C C   . CYS C 192 ? 0.8316 0.6396 0.6089 -0.0301 -0.0703 -0.0765 274 CYS C C   
3395 O O   . CYS C 192 ? 0.7854 0.5975 0.5820 -0.0408 -0.0880 -0.0821 274 CYS C O   
3396 C CB  . CYS C 192 ? 0.8399 0.7201 0.6755 -0.0342 -0.0369 -0.0678 274 CYS C CB  
3397 S SG  . CYS C 192 ? 0.9152 0.8323 0.7794 -0.0276 -0.0174 -0.0588 274 CYS C SG  
3398 N N   . SER C 193 ? 0.8898 0.6570 0.6262 -0.0215 -0.0757 -0.0783 275 SER C N   
3399 C CA  . SER C 193 ? 0.9321 0.6472 0.6410 -0.0248 -0.1086 -0.0859 275 SER C CA  
3400 C C   . SER C 193 ? 0.9236 0.6630 0.6858 -0.0548 -0.1277 -0.0825 275 SER C C   
3401 O O   . SER C 193 ? 0.9391 0.6552 0.7006 -0.0631 -0.1553 -0.0857 275 SER C O   
3402 C CB  . SER C 193 ? 0.9917 0.6570 0.6534 -0.0096 -0.1186 -0.0895 275 SER C CB  
3403 O OG  . SER C 193 ? 1.0535 0.6992 0.6569 0.0265  -0.1040 -0.0932 275 SER C OG  
3404 N N   . ASN C 194 ? 1.0017 0.7923 0.8101 -0.0696 -0.1143 -0.0735 276 ASN C N   
3405 C CA  . ASN C 194 ? 0.9908 0.8346 0.8570 -0.0918 -0.1230 -0.0657 276 ASN C CA  
3406 C C   . ASN C 194 ? 0.9289 0.8342 0.8288 -0.0843 -0.1004 -0.0712 276 ASN C C   
3407 O O   . ASN C 194 ? 0.9091 0.8532 0.8275 -0.0808 -0.0798 -0.0681 276 ASN C O   
3408 C CB  . ASN C 194 ? 1.0682 0.9345 0.9629 -0.1116 -0.1289 -0.0473 276 ASN C CB  
3409 C CG  . ASN C 194 ? 1.1195 1.0459 1.0724 -0.1341 -0.1425 -0.0307 276 ASN C CG  
3410 O OD1 . ASN C 194 ? 1.1293 1.0573 1.0928 -0.1369 -0.1583 -0.0351 276 ASN C OD1 
3411 N ND2 . ASN C 194 ? 1.1284 1.1124 1.1208 -0.1486 -0.1352 -0.0089 276 ASN C ND2 
3412 N N   . PRO C 195 ? 0.8005 0.7106 0.7072 -0.0797 -0.1086 -0.0807 277 PRO C N   
3413 C CA  . PRO C 195 ? 0.7392 0.6848 0.6660 -0.0673 -0.0966 -0.0890 277 PRO C CA  
3414 C C   . PRO C 195 ? 0.6852 0.7028 0.6591 -0.0665 -0.0920 -0.0902 277 PRO C C   
3415 O O   . PRO C 195 ? 0.6860 0.7407 0.6878 -0.0747 -0.1028 -0.0861 277 PRO C O   
3416 C CB  . PRO C 195 ? 0.7301 0.6529 0.6490 -0.0643 -0.1152 -0.0976 277 PRO C CB  
3417 C CG  . PRO C 195 ? 0.7545 0.6605 0.6720 -0.0777 -0.1360 -0.0951 277 PRO C CG  
3418 C CD  . PRO C 195 ? 0.8033 0.6802 0.6990 -0.0852 -0.1350 -0.0845 277 PRO C CD  
3419 N N   . HIS C 196 ? 0.6361 0.6773 0.6185 -0.0540 -0.0772 -0.0942 278 HIS C N   
3420 C CA  . HIS C 196 ? 0.6244 0.7338 0.6413 -0.0423 -0.0737 -0.0998 278 HIS C CA  
3421 C C   . HIS C 196 ? 0.5852 0.7187 0.6208 -0.0278 -0.0932 -0.1169 278 HIS C C   
3422 O O   . HIS C 196 ? 0.6046 0.7000 0.6298 -0.0217 -0.1070 -0.1272 278 HIS C O   
3423 C CB  . HIS C 196 ? 0.6238 0.7375 0.6387 -0.0290 -0.0608 -0.1035 278 HIS C CB  
3424 C CG  . HIS C 196 ? 0.6594 0.7348 0.6495 -0.0391 -0.0444 -0.0901 278 HIS C CG  
3425 N ND1 . HIS C 196 ? 0.6629 0.7490 0.6514 -0.0505 -0.0334 -0.0767 278 HIS C ND1 
3426 C CD2 . HIS C 196 ? 0.6724 0.7036 0.6393 -0.0374 -0.0387 -0.0860 278 HIS C CD2 
3427 C CE1 . HIS C 196 ? 0.6806 0.7239 0.6417 -0.0523 -0.0232 -0.0706 278 HIS C CE1 
3428 N NE2 . HIS C 196 ? 0.6858 0.7011 0.6337 -0.0430 -0.0235 -0.0752 278 HIS C NE2 
3429 N N   . PRO C 197 ? 0.5418 0.7419 0.6063 -0.0208 -0.0964 -0.1175 279 PRO C N   
3430 C CA  . PRO C 197 ? 0.5167 0.7427 0.5968 -0.0003 -0.1171 -0.1374 279 PRO C CA  
3431 C C   . PRO C 197 ? 0.4919 0.7124 0.5679 0.0288  -0.1281 -0.1606 279 PRO C C   
3432 O O   . PRO C 197 ? 0.5017 0.7370 0.5754 0.0399  -0.1163 -0.1613 279 PRO C O   
3433 C CB  . PRO C 197 ? 0.5109 0.8306 0.6247 0.0068  -0.1112 -0.1274 279 PRO C CB  
3434 C CG  . PRO C 197 ? 0.4730 0.7983 0.5915 -0.0237 -0.0944 -0.0953 279 PRO C CG  
3435 C CD  . PRO C 197 ? 0.4729 0.7355 0.5596 -0.0296 -0.0823 -0.0965 279 PRO C CD  
3436 N N   . LEU C 198 ? 0.4116 0.5425 0.4695 -0.0873 -0.0574 -0.0608 280 LEU C N   
3437 C CA  . LEU C 198 ? 0.4060 0.5401 0.4689 -0.0769 -0.0564 -0.0644 280 LEU C CA  
3438 C C   . LEU C 198 ? 0.4097 0.5675 0.4883 -0.0707 -0.0540 -0.0692 280 LEU C C   
3439 O O   . LEU C 198 ? 0.4145 0.5926 0.5069 -0.0704 -0.0564 -0.0687 280 LEU C O   
3440 C CB  . LEU C 198 ? 0.4720 0.5949 0.5342 -0.0723 -0.0641 -0.0637 280 LEU C CB  
3441 C CG  . LEU C 198 ? 0.5303 0.6353 0.5757 -0.0741 -0.0659 -0.0579 280 LEU C CG  
3442 C CD1 . LEU C 198 ? 0.5577 0.6547 0.6040 -0.0692 -0.0707 -0.0541 280 LEU C CD1 
3443 C CD2 . LEU C 198 ? 0.4807 0.5796 0.5123 -0.0747 -0.0584 -0.0551 280 LEU C CD2 
3444 N N   . VAL C 199 ? 0.4157 0.5748 0.4913 -0.0642 -0.0497 -0.0741 281 VAL C N   
3445 C CA  . VAL C 199 ? 0.4371 0.6185 0.5207 -0.0545 -0.0455 -0.0799 281 VAL C CA  
3446 C C   . VAL C 199 ? 0.4940 0.6613 0.5706 -0.0441 -0.0491 -0.0904 281 VAL C C   
3447 O O   . VAL C 199 ? 0.3821 0.5281 0.4500 -0.0494 -0.0532 -0.0909 281 VAL C O   
3448 C CB  . VAL C 199 ? 0.4106 0.6100 0.4916 -0.0582 -0.0355 -0.0755 281 VAL C CB  
3449 C CG1 . VAL C 199 ? 0.3649 0.5732 0.4526 -0.0716 -0.0334 -0.0652 281 VAL C CG1 
3450 C CG2 . VAL C 199 ? 0.3653 0.5489 0.4301 -0.0608 -0.0331 -0.0744 281 VAL C CG2 
3451 N N   . TRP C 200 ? 0.4907 0.6710 0.5704 -0.0291 -0.0480 -0.0985 282 TRP C N   
3452 C CA  . TRP C 200 ? 0.4939 0.6602 0.5604 -0.0184 -0.0505 -0.1120 282 TRP C CA  
3453 C C   . TRP C 200 ? 0.5034 0.6909 0.5629 -0.0184 -0.0424 -0.1135 282 TRP C C   
3454 O O   . TRP C 200 ? 0.4886 0.7084 0.5534 -0.0109 -0.0334 -0.1107 282 TRP C O   
3455 C CB  . TRP C 200 ? 0.4785 0.6454 0.5442 0.0036  -0.0525 -0.1217 282 TRP C CB  
3456 C CG  . TRP C 200 ? 0.4878 0.6354 0.5585 0.0077  -0.0601 -0.1184 282 TRP C CG  
3457 C CD1 . TRP C 200 ? 0.5060 0.6785 0.5918 0.0152  -0.0592 -0.1111 282 TRP C CD1 
3458 C CD2 . TRP C 200 ? 0.5231 0.6247 0.5832 0.0042  -0.0702 -0.1205 282 TRP C CD2 
3459 N NE1 . TRP C 200 ? 0.5460 0.6908 0.6295 0.0198  -0.0679 -0.1087 282 TRP C NE1 
3460 C CE2 . TRP C 200 ? 0.5437 0.6424 0.6109 0.0129  -0.0741 -0.1135 282 TRP C CE2 
3461 C CE3 . TRP C 200 ? 0.5065 0.5726 0.5530 -0.0074 -0.0769 -0.1257 282 TRP C CE3 
3462 C CZ2 . TRP C 200 ? 0.5338 0.5906 0.5923 0.0120  -0.0830 -0.1102 282 TRP C CZ2 
3463 C CZ3 . TRP C 200 ? 0.5082 0.5340 0.5489 -0.0119 -0.0860 -0.1222 282 TRP C CZ3 
3464 C CH2 . TRP C 200 ? 0.5095 0.5287 0.5550 -0.0015 -0.0883 -0.1138 282 TRP C CH2 
3465 N N   . ALA C 201 ? 0.5289 0.7036 0.5775 -0.0269 -0.0453 -0.1157 283 ALA C N   
3466 C CA  . ALA C 201 ? 0.5271 0.7212 0.5657 -0.0248 -0.0393 -0.1172 283 ALA C CA  
3467 C C   . ALA C 201 ? 0.5668 0.7532 0.5897 -0.0131 -0.0456 -0.1359 283 ALA C C   
3468 O O   . ALA C 201 ? 0.6352 0.7901 0.6531 -0.0140 -0.0568 -0.1462 283 ALA C O   
3469 C CB  . ALA C 201 ? 0.5109 0.7020 0.5456 -0.0381 -0.0396 -0.1082 283 ALA C CB  
3470 N N   . LYS C 202 ? 0.5594 0.7712 0.5716 -0.0019 -0.0389 -0.1402 284 LYS C N   
3471 C CA  . LYS C 202 ? 0.6072 0.8097 0.5984 0.0111  -0.0462 -0.1611 284 LYS C CA  
3472 C C   . LYS C 202 ? 0.6217 0.8471 0.5975 0.0123  -0.0441 -0.1635 284 LYS C C   
3473 O O   . LYS C 202 ? 0.6288 0.8887 0.6043 0.0204  -0.0308 -0.1531 284 LYS C O   
3474 C CB  . LYS C 202 ? 0.5821 0.7928 0.5681 0.0360  -0.0413 -0.1705 284 LYS C CB  
3475 C CG  . LYS C 202 ? 0.5840 0.7735 0.5408 0.0519  -0.0508 -0.1957 284 LYS C CG  
3476 C CD  . LYS C 202 ? 0.5955 0.7568 0.5443 0.0719  -0.0554 -0.2086 284 LYS C CD  
3477 C CE  . LYS C 202 ? 0.6550 0.7723 0.5694 0.0804  -0.0706 -0.2359 284 LYS C CE  
3478 N NZ  . LYS C 202 ? 0.6450 0.7780 0.5412 0.0747  -0.0740 -0.2451 284 LYS C NZ  
3479 N N   . LEU C 203 ? 0.6057 0.8138 0.5688 0.0034  -0.0580 -0.1759 285 LEU C N   
3480 C CA  . LEU C 203 ? 0.6257 0.8553 0.5697 0.0072  -0.0608 -0.1838 285 LEU C CA  
3481 C C   . LEU C 203 ? 0.7065 0.9215 0.6230 0.0241  -0.0698 -0.2107 285 LEU C C   
3482 O O   . LEU C 203 ? 0.7354 0.9110 0.6461 0.0276  -0.0788 -0.2252 285 LEU C O   
3483 C CB  . LEU C 203 ? 0.6012 0.8290 0.5488 -0.0145 -0.0726 -0.1809 285 LEU C CB  
3484 C CG  . LEU C 203 ? 0.5504 0.7898 0.5186 -0.0275 -0.0652 -0.1566 285 LEU C CG  
3485 C CD1 . LEU C 203 ? 0.4748 0.7118 0.4493 -0.0480 -0.0787 -0.1555 285 LEU C CD1 
3486 C CD2 . LEU C 203 ? 0.5571 0.8320 0.5203 -0.0166 -0.0509 -0.1419 285 LEU C CD2 
3487 N N   . LYS C 204 ? 0.6975 0.9417 0.5930 0.0371  -0.0676 -0.2177 286 LYS C N   
3488 C CA  . LYS C 204 ? 0.7185 0.9465 0.5808 0.0547  -0.0780 -0.2466 286 LYS C CA  
3489 C C   . LYS C 204 ? 0.7532 0.9319 0.6065 0.0346  -0.1022 -0.2659 286 LYS C C   
3490 O O   . LYS C 204 ? 0.7467 0.9283 0.6137 0.0079  -0.1116 -0.2580 286 LYS C O   
3491 C CB  . LYS C 204 ? 0.7202 0.9891 0.5583 0.0692  -0.0746 -0.2512 286 LYS C CB  
3492 N N   . GLY C 205 ? 0.8182 0.9507 0.6492 0.0476  -0.1117 -0.2892 287 GLY C N   
3493 C CA  . GLY C 205 ? 0.8476 0.9226 0.6622 0.0292  -0.1363 -0.3103 287 GLY C CA  
3494 C C   . GLY C 205 ? 0.8436 0.8882 0.6860 -0.0013 -0.1432 -0.2956 287 GLY C C   
3495 O O   . GLY C 205 ? 0.9075 0.9123 0.7417 -0.0257 -0.1640 -0.3072 287 GLY C O   
3496 N N   . PHE C 206 ? 0.7837 0.8463 0.6575 -0.0020 -0.1272 -0.2701 288 PHE C N   
3497 C CA  . PHE C 206 ? 0.7566 0.7962 0.6556 -0.0267 -0.1310 -0.2537 288 PHE C CA  
3498 C C   . PHE C 206 ? 0.7463 0.7732 0.6566 -0.0092 -0.1189 -0.2440 288 PHE C C   
3499 O O   . PHE C 206 ? 0.6997 0.7630 0.6158 0.0122  -0.1024 -0.2371 288 PHE C O   
3500 C CB  . PHE C 206 ? 0.6677 0.7542 0.5940 -0.0471 -0.1244 -0.2295 288 PHE C CB  
3501 C CG  . PHE C 206 ? 0.6265 0.6961 0.5739 -0.0752 -0.1313 -0.2145 288 PHE C CG  
3502 C CD1 . PHE C 206 ? 0.6704 0.7152 0.6133 -0.1016 -0.1509 -0.2225 288 PHE C CD1 
3503 C CD2 . PHE C 206 ? 0.5700 0.6509 0.5410 -0.0763 -0.1184 -0.1916 288 PHE C CD2 
3504 C CE1 . PHE C 206 ? 0.6656 0.7016 0.6297 -0.1281 -0.1554 -0.2047 288 PHE C CE1 
3505 C CE2 . PHE C 206 ? 0.5839 0.6542 0.5719 -0.0990 -0.1231 -0.1764 288 PHE C CE2 
3506 C CZ  . PHE C 206 ? 0.6205 0.6708 0.6064 -0.1244 -0.1403 -0.1813 288 PHE C CZ  
3507 N N   . PRO C 207 ? 0.7496 0.7288 0.6636 -0.0182 -0.1270 -0.2418 289 PRO C N   
3508 C CA  . PRO C 207 ? 0.7260 0.6972 0.6495 0.0010  -0.1170 -0.2329 289 PRO C CA  
3509 C C   . PRO C 207 ? 0.6947 0.7142 0.6500 -0.0043 -0.1015 -0.2072 289 PRO C C   
3510 O O   . PRO C 207 ? 0.6832 0.7286 0.6531 -0.0248 -0.0994 -0.1939 289 PRO C O   
3511 C CB  . PRO C 207 ? 0.7698 0.6778 0.6887 -0.0125 -0.1309 -0.2329 289 PRO C CB  
3512 C CG  . PRO C 207 ? 0.8130 0.6899 0.7152 -0.0376 -0.1495 -0.2468 289 PRO C CG  
3513 C CD  . PRO C 207 ? 0.7754 0.7115 0.6882 -0.0487 -0.1449 -0.2429 289 PRO C CD  
3514 N N   . PHE C 208 ? 0.6406 0.6722 0.6048 0.0158  -0.0912 -0.2007 290 PHE C N   
3515 C CA  . PHE C 208 ? 0.5681 0.6318 0.5598 0.0082  -0.0806 -0.1782 290 PHE C CA  
3516 C C   . PHE C 208 ? 0.5648 0.6096 0.5678 -0.0179 -0.0871 -0.1648 290 PHE C C   
3517 O O   . PHE C 208 ? 0.6221 0.6236 0.6176 -0.0260 -0.0987 -0.1683 290 PHE C O   
3518 C CB  . PHE C 208 ? 0.5473 0.6167 0.5464 0.0299  -0.0751 -0.1748 290 PHE C CB  
3519 C CG  . PHE C 208 ? 0.6574 0.7698 0.6556 0.0536  -0.0632 -0.1788 290 PHE C CG  
3520 C CD1 . PHE C 208 ? 0.5049 0.6681 0.5208 0.0465  -0.0506 -0.1643 290 PHE C CD1 
3521 C CD2 . PHE C 208 ? 0.6666 0.7674 0.6440 0.0837  -0.0642 -0.1961 290 PHE C CD2 
3522 C CE1 . PHE C 208 ? 0.5595 0.7667 0.5767 0.0652  -0.0386 -0.1639 290 PHE C CE1 
3523 C CE2 . PHE C 208 ? 0.6549 0.8037 0.6319 0.1075  -0.0515 -0.1975 290 PHE C CE2 
3524 C CZ  . PHE C 208 ? 0.6254 0.8308 0.6246 0.0965  -0.0383 -0.1800 290 PHE C CZ  
3525 N N   . TRP C 209 ? 0.4893 0.5656 0.5084 -0.0304 -0.0792 -0.1484 291 TRP C N   
3526 C CA  . TRP C 209 ? 0.5327 0.6011 0.5600 -0.0520 -0.0833 -0.1353 291 TRP C CA  
3527 C C   . TRP C 209 ? 0.4924 0.5818 0.5339 -0.0544 -0.0742 -0.1179 291 TRP C C   
3528 O O   . TRP C 209 ? 0.5062 0.6235 0.5513 -0.0488 -0.0647 -0.1144 291 TRP C O   
3529 C CB  . TRP C 209 ? 0.5054 0.5886 0.5288 -0.0664 -0.0864 -0.1365 291 TRP C CB  
3530 C CG  . TRP C 209 ? 0.4816 0.5509 0.5102 -0.0880 -0.0951 -0.1279 291 TRP C CG  
3531 C CD1 . TRP C 209 ? 0.4895 0.5773 0.5299 -0.0986 -0.0903 -0.1093 291 TRP C CD1 
3532 C CD2 . TRP C 209 ? 0.5222 0.5565 0.5437 -0.1022 -0.1097 -0.1359 291 TRP C CD2 
3533 N NE1 . TRP C 209 ? 0.4737 0.5488 0.5182 -0.1183 -0.0996 -0.1029 291 TRP C NE1 
3534 C CE2 . TRP C 209 ? 0.5151 0.5554 0.5491 -0.1238 -0.1123 -0.1184 291 TRP C CE2 
3535 C CE3 . TRP C 209 ? 0.6040 0.5996 0.6071 -0.0985 -0.1212 -0.1561 291 TRP C CE3 
3536 C CZ2 . TRP C 209 ? 0.5592 0.5717 0.5922 -0.1465 -0.1259 -0.1179 291 TRP C CZ2 
3537 C CZ3 . TRP C 209 ? 0.6317 0.5893 0.6293 -0.1210 -0.1367 -0.1586 291 TRP C CZ3 
3538 C CH2 . TRP C 209 ? 0.6185 0.5862 0.6332 -0.1470 -0.1389 -0.1383 291 TRP C CH2 
3539 N N   . PRO C 210 ? 0.5039 0.5784 0.5510 -0.0632 -0.0775 -0.1067 292 PRO C N   
3540 C CA  . PRO C 210 ? 0.4446 0.5343 0.4994 -0.0643 -0.0710 -0.0932 292 PRO C CA  
3541 C C   . PRO C 210 ? 0.4323 0.5437 0.4854 -0.0710 -0.0643 -0.0861 292 PRO C C   
3542 O O   . PRO C 210 ? 0.4536 0.5694 0.5040 -0.0792 -0.0664 -0.0847 292 PRO C O   
3543 C CB  . PRO C 210 ? 0.4720 0.5397 0.5279 -0.0707 -0.0770 -0.0836 292 PRO C CB  
3544 C CG  . PRO C 210 ? 0.5274 0.5791 0.5793 -0.0833 -0.0841 -0.0859 292 PRO C CG  
3545 C CD  . PRO C 210 ? 0.4635 0.5070 0.5078 -0.0750 -0.0874 -0.1043 292 PRO C CD  
3546 N N   . ALA C 211 ? 0.4012 0.5260 0.4550 -0.0676 -0.0570 -0.0811 293 ALA C N   
3547 C CA  . ALA C 211 ? 0.4425 0.5807 0.4893 -0.0695 -0.0501 -0.0747 293 ALA C CA  
3548 C C   . ALA C 211 ? 0.4254 0.5613 0.4686 -0.0694 -0.0450 -0.0670 293 ALA C C   
3549 O O   . ALA C 211 ? 0.4038 0.5378 0.4534 -0.0697 -0.0465 -0.0681 293 ALA C O   
3550 C CB  . ALA C 211 ? 0.3712 0.5261 0.4142 -0.0647 -0.0460 -0.0812 293 ALA C CB  
3551 N N   . LYS C 212 ? 0.4074 0.5430 0.4385 -0.0687 -0.0401 -0.0594 294 LYS C N   
3552 C CA  . LYS C 212 ? 0.4204 0.5447 0.4403 -0.0685 -0.0356 -0.0539 294 LYS C CA  
3553 C C   . LYS C 212 ? 0.4402 0.5723 0.4574 -0.0677 -0.0284 -0.0527 294 LYS C C   
3554 O O   . LYS C 212 ? 0.4096 0.5536 0.4208 -0.0618 -0.0237 -0.0512 294 LYS C O   
3555 C CB  . LYS C 212 ? 0.4272 0.5422 0.4293 -0.0628 -0.0330 -0.0463 294 LYS C CB  
3556 C CG  . LYS C 212 ? 0.4318 0.5455 0.4357 -0.0630 -0.0380 -0.0439 294 LYS C CG  
3557 C CD  . LYS C 212 ? 0.4604 0.5728 0.4452 -0.0528 -0.0333 -0.0353 294 LYS C CD  
3558 C CE  . LYS C 212 ? 0.4914 0.6075 0.4773 -0.0526 -0.0367 -0.0298 294 LYS C CE  
3559 N NZ  . LYS C 212 ? 0.5184 0.6497 0.4906 -0.0402 -0.0302 -0.0194 294 LYS C NZ  
3560 N N   . ALA C 213 ? 0.4518 0.5807 0.4736 -0.0745 -0.0277 -0.0517 295 ALA C N   
3561 C CA  . ALA C 213 ? 0.4701 0.6038 0.4877 -0.0769 -0.0196 -0.0456 295 ALA C CA  
3562 C C   . ALA C 213 ? 0.5173 0.6203 0.5104 -0.0771 -0.0160 -0.0370 295 ALA C C   
3563 O O   . ALA C 213 ? 0.5464 0.6248 0.5322 -0.0867 -0.0198 -0.0353 295 ALA C O   
3564 C CB  . ALA C 213 ? 0.4758 0.6244 0.5112 -0.0870 -0.0205 -0.0453 295 ALA C CB  
3565 N N   . LEU C 214 ? 0.5614 0.6644 0.5390 -0.0654 -0.0096 -0.0319 296 LEU C N   
3566 C CA  . LEU C 214 ? 0.5837 0.6532 0.5325 -0.0588 -0.0057 -0.0238 296 LEU C CA  
3567 C C   . LEU C 214 ? 0.5987 0.6470 0.5352 -0.0659 0.0005  -0.0139 296 LEU C C   
3568 O O   . LEU C 214 ? 0.6086 0.6134 0.5189 -0.0655 0.0007  -0.0091 296 LEU C O   
3569 C CB  . LEU C 214 ? 0.6174 0.6997 0.5537 -0.0399 -0.0013 -0.0199 296 LEU C CB  
3570 C CG  . LEU C 214 ? 0.6622 0.7687 0.6105 -0.0355 -0.0067 -0.0256 296 LEU C CG  
3571 C CD1 . LEU C 214 ? 0.6748 0.8143 0.6228 -0.0235 -0.0037 -0.0220 296 LEU C CD1 
3572 C CD2 . LEU C 214 ? 0.6865 0.7712 0.6208 -0.0302 -0.0093 -0.0247 296 LEU C CD2 
3573 N N   . ARG C 215 ? 0.6076 0.6834 0.5590 -0.0714 0.0059  -0.0098 297 ARG C N   
3574 C CA  . ARG C 215 ? 0.6578 0.7197 0.5992 -0.0796 0.0138  0.0042  297 ARG C CA  
3575 C C   . ARG C 215 ? 0.6567 0.7650 0.6194 -0.0820 0.0202  0.0073  297 ARG C C   
3576 O O   . ARG C 215 ? 0.6578 0.8014 0.6339 -0.0717 0.0189  -0.0028 297 ARG C O   
3577 C CB  . ARG C 215 ? 0.6568 0.6913 0.5654 -0.0632 0.0213  0.0155  297 ARG C CB  
3578 C CG  . ARG C 215 ? 0.6426 0.7103 0.5500 -0.0414 0.0242  0.0131  297 ARG C CG  
3579 C CD  . ARG C 215 ? 0.7311 0.7795 0.6070 -0.0229 0.0327  0.0272  297 ARG C CD  
3580 N NE  . ARG C 215 ? 0.7463 0.8316 0.6216 -0.0019 0.0328  0.0244  297 ARG C NE  
3581 C CZ  . ARG C 215 ? 0.7909 0.8856 0.6467 0.0177  0.0399  0.0361  297 ARG C CZ  
3582 N NH1 . ARG C 215 ? 0.8674 0.9312 0.7002 0.0204  0.0489  0.0526  297 ARG C NH1 
3583 N NH2 . ARG C 215 ? 0.7834 0.9193 0.6426 0.0336  0.0374  0.0326  297 ARG C NH2 
3584 N N   . ASP C 216 ? 0.7089 0.8150 0.6719 -0.0958 0.0271  0.0219  298 ASP C N   
3585 C CA  . ASP C 216 ? 0.7306 0.8838 0.7106 -0.0970 0.0361  0.0291  298 ASP C CA  
3586 C C   . ASP C 216 ? 0.7765 0.9198 0.7351 -0.0942 0.0486  0.0497  298 ASP C C   
3587 O O   . ASP C 216 ? 0.8300 0.9262 0.7698 -0.1061 0.0497  0.0628  298 ASP C O   
3588 C CB  . ASP C 216 ? 0.8352 1.0111 0.8429 -0.1193 0.0343  0.0325  298 ASP C CB  
3589 C CG  . ASP C 216 ? 0.9130 1.0799 0.9344 -0.1274 0.0206  0.0178  298 ASP C CG  
3590 O OD1 . ASP C 216 ? 0.9149 1.1021 0.9467 -0.1132 0.0157  0.0025  298 ASP C OD1 
3591 O OD2 . ASP C 216 ? 0.9612 1.0992 0.9812 -0.1484 0.0138  0.0217  298 ASP C OD2 
3592 N N   . LYS C 217 ? 0.7388 0.9233 0.6972 -0.0779 0.0573  0.0525  299 LYS C N   
3593 C CA  . LYS C 217 ? 0.7668 0.9517 0.7065 -0.0741 0.0707  0.0750  299 LYS C CA  
3594 C C   . LYS C 217 ? 0.7968 1.0446 0.7500 -0.0652 0.0797  0.0766  299 LYS C C   
3595 O O   . LYS C 217 ? 0.7776 1.0555 0.7316 -0.0455 0.0763  0.0592  299 LYS C O   
3596 C CB  . LYS C 217 ? 0.7056 0.8648 0.6125 -0.0516 0.0723  0.0783  299 LYS C CB  
3597 N N   . ASP C 218 ? 0.8712 1.1386 0.8335 -0.0802 0.0907  0.0975  300 ASP C N   
3598 C CA  . ASP C 218 ? 0.9099 1.2384 0.8780 -0.0686 0.1035  0.1056  300 ASP C CA  
3599 C C   . ASP C 218 ? 0.8909 1.2654 0.8762 -0.0519 0.0979  0.0796  300 ASP C C   
3600 O O   . ASP C 218 ? 0.8648 1.2677 0.8368 -0.0271 0.1001  0.0693  300 ASP C O   
3601 C CB  . ASP C 218 ? 0.9311 1.2596 0.8667 -0.0476 0.1133  0.1189  300 ASP C CB  
3602 N N   . GLY C 219 ? 0.9100 1.2882 0.9220 -0.0651 0.0895  0.0685  301 GLY C N   
3603 C CA  . GLY C 219 ? 0.8825 1.2963 0.9090 -0.0489 0.0843  0.0457  301 GLY C CA  
3604 C C   . GLY C 219 ? 0.8520 1.2394 0.8686 -0.0350 0.0698  0.0187  301 GLY C C   
3605 O O   . GLY C 219 ? 0.8473 1.2555 0.8687 -0.0192 0.0650  -0.0010 301 GLY C O   
3606 N N   . GLN C 220 ? 0.7564 1.0987 0.7584 -0.0395 0.0629  0.0179  302 GLN C N   
3607 C CA  . GLN C 220 ? 0.6943 1.0172 0.6908 -0.0305 0.0496  -0.0039 302 GLN C CA  
3608 C C   . GLN C 220 ? 0.6476 0.9296 0.6509 -0.0465 0.0402  -0.0052 302 GLN C C   
3609 O O   . GLN C 220 ? 0.7041 0.9636 0.7074 -0.0625 0.0432  0.0097  302 GLN C O   
3610 C CB  . GLN C 220 ? 0.6968 1.0170 0.6682 -0.0157 0.0497  -0.0045 302 GLN C CB  
3611 C CG  . GLN C 220 ? 0.7115 1.0718 0.6699 0.0018  0.0582  -0.0031 302 GLN C CG  
3612 C CD  . GLN C 220 ? 0.7796 1.1555 0.7326 0.0168  0.0474  -0.0295 302 GLN C CD  
3613 O OE1 . GLN C 220 ? 0.7996 1.1871 0.7633 0.0207  0.0440  -0.0445 302 GLN C OE1 
3614 N NE2 . GLN C 220 ? 0.8035 1.1788 0.7387 0.0254  0.0408  -0.0353 302 GLN C NE2 
3615 N N   . VAL C 221 ? 0.5601 0.8306 0.5676 -0.0430 0.0284  -0.0229 303 VAL C N   
3616 C CA  . VAL C 221 ? 0.5388 0.7727 0.5469 -0.0534 0.0201  -0.0241 303 VAL C CA  
3617 C C   . VAL C 221 ? 0.5071 0.7320 0.5033 -0.0435 0.0135  -0.0328 303 VAL C C   
3618 O O   . VAL C 221 ? 0.5089 0.7536 0.5050 -0.0341 0.0096  -0.0448 303 VAL C O   
3619 C CB  . VAL C 221 ? 0.5519 0.7845 0.5812 -0.0628 0.0120  -0.0323 303 VAL C CB  
3620 C CG1 . VAL C 221 ? 0.5635 0.8247 0.6102 -0.0701 0.0182  -0.0245 303 VAL C CG1 
3621 C CG2 . VAL C 221 ? 0.5409 0.7789 0.5764 -0.0531 0.0031  -0.0501 303 VAL C CG2 
3622 N N   . ASP C 222 ? 0.5579 0.7543 0.5423 -0.0453 0.0121  -0.0263 304 ASP C N   
3623 C CA  . ASP C 222 ? 0.5831 0.7790 0.5576 -0.0359 0.0077  -0.0294 304 ASP C CA  
3624 C C   . ASP C 222 ? 0.5838 0.7701 0.5707 -0.0425 -0.0026 -0.0394 304 ASP C C   
3625 O O   . ASP C 222 ? 0.6159 0.7768 0.5995 -0.0471 -0.0042 -0.0357 304 ASP C O   
3626 C CB  . ASP C 222 ? 0.6815 0.8547 0.6330 -0.0286 0.0139  -0.0149 304 ASP C CB  
3627 C CG  . ASP C 222 ? 0.7723 0.9582 0.7146 -0.0150 0.0113  -0.0146 304 ASP C CG  
3628 O OD1 . ASP C 222 ? 0.8139 1.0303 0.7676 -0.0146 0.0046  -0.0245 304 ASP C OD1 
3629 O OD2 . ASP C 222 ? 0.8278 0.9934 0.7504 -0.0046 0.0154  -0.0043 304 ASP C OD2 
3630 N N   . ALA C 223 ? 0.5307 0.7339 0.5289 -0.0427 -0.0101 -0.0520 305 ALA C N   
3631 C CA  . ALA C 223 ? 0.5175 0.7097 0.5278 -0.0499 -0.0194 -0.0596 305 ALA C CA  
3632 C C   . ALA C 223 ? 0.5219 0.7190 0.5295 -0.0497 -0.0243 -0.0577 305 ALA C C   
3633 O O   . ALA C 223 ? 0.5036 0.7226 0.5077 -0.0462 -0.0260 -0.0595 305 ALA C O   
3634 C CB  . ALA C 223 ? 0.4846 0.6837 0.5059 -0.0504 -0.0253 -0.0735 305 ALA C CB  
3635 N N   . ARG C 224 ? 0.5025 0.6844 0.5116 -0.0535 -0.0266 -0.0530 306 ARG C N   
3636 C CA  . ARG C 224 ? 0.4644 0.6578 0.4762 -0.0554 -0.0311 -0.0492 306 ARG C CA  
3637 C C   . ARG C 224 ? 0.4036 0.5878 0.4298 -0.0670 -0.0405 -0.0560 306 ARG C C   
3638 O O   . ARG C 224 ? 0.3767 0.5410 0.4054 -0.0691 -0.0416 -0.0555 306 ARG C O   
3639 C CB  . ARG C 224 ? 0.5271 0.7142 0.5260 -0.0470 -0.0255 -0.0372 306 ARG C CB  
3640 C CG  . ARG C 224 ? 0.6443 0.8650 0.6407 -0.0397 -0.0240 -0.0289 306 ARG C CG  
3641 C CD  . ARG C 224 ? 0.7367 0.9629 0.7226 -0.0282 -0.0190 -0.0166 306 ARG C CD  
3642 N NE  . ARG C 224 ? 0.8740 1.0682 0.8342 -0.0129 -0.0110 -0.0131 306 ARG C NE  
3643 C CZ  . ARG C 224 ? 0.9427 1.1338 0.8841 0.0025  -0.0039 -0.0079 306 ARG C CZ  
3644 N NH1 . ARG C 224 ? 0.9194 1.1454 0.8657 0.0070  -0.0034 -0.0053 306 ARG C NH1 
3645 N NH2 . ARG C 224 ? 0.9894 1.1390 0.9044 0.0132  0.0016  -0.0053 306 ARG C NH2 
3646 N N   . PHE C 225 ? 0.4088 0.6055 0.4421 -0.0747 -0.0483 -0.0622 307 PHE C N   
3647 C CA  . PHE C 225 ? 0.3981 0.5766 0.4403 -0.0852 -0.0582 -0.0705 307 PHE C CA  
3648 C C   . PHE C 225 ? 0.3844 0.5583 0.4334 -0.0947 -0.0614 -0.0594 307 PHE C C   
3649 O O   . PHE C 225 ? 0.4007 0.5991 0.4524 -0.0990 -0.0605 -0.0486 307 PHE C O   
3650 C CB  . PHE C 225 ? 0.4486 0.6347 0.4906 -0.0920 -0.0674 -0.0827 307 PHE C CB  
3651 C CG  . PHE C 225 ? 0.4982 0.6884 0.5311 -0.0805 -0.0646 -0.0947 307 PHE C CG  
3652 C CD1 . PHE C 225 ? 0.5245 0.6937 0.5553 -0.0744 -0.0664 -0.1070 307 PHE C CD1 
3653 C CD2 . PHE C 225 ? 0.5494 0.7675 0.5745 -0.0727 -0.0588 -0.0918 307 PHE C CD2 
3654 C CE1 . PHE C 225 ? 0.5440 0.7238 0.5660 -0.0614 -0.0618 -0.1162 307 PHE C CE1 
3655 C CE2 . PHE C 225 ? 0.5812 0.8063 0.5965 -0.0613 -0.0547 -0.1003 307 PHE C CE2 
3656 C CZ  . PHE C 225 ? 0.5690 0.7766 0.5833 -0.0559 -0.0557 -0.1124 307 PHE C CZ  
3657 N N   . PHE C 226 ? 0.3867 0.5339 0.4385 -0.0965 -0.0647 -0.0604 308 PHE C N   
3658 C CA  . PHE C 226 ? 0.4301 0.5702 0.4877 -0.1072 -0.0690 -0.0496 308 PHE C CA  
3659 C C   . PHE C 226 ? 0.5075 0.6506 0.5721 -0.1253 -0.0789 -0.0510 308 PHE C C   
3660 O O   . PHE C 226 ? 0.4922 0.6334 0.5544 -0.1282 -0.0851 -0.0653 308 PHE C O   
3661 C CB  . PHE C 226 ? 0.4356 0.5452 0.4928 -0.1036 -0.0719 -0.0508 308 PHE C CB  
3662 C CG  . PHE C 226 ? 0.4334 0.5445 0.4848 -0.0924 -0.0651 -0.0456 308 PHE C CG  
3663 C CD1 . PHE C 226 ? 0.3900 0.5057 0.4371 -0.0919 -0.0623 -0.0318 308 PHE C CD1 
3664 C CD2 . PHE C 226 ? 0.4051 0.5153 0.4539 -0.0832 -0.0619 -0.0542 308 PHE C CD2 
3665 C CE1 . PHE C 226 ? 0.3875 0.5001 0.4240 -0.0818 -0.0584 -0.0301 308 PHE C CE1 
3666 C CE2 . PHE C 226 ? 0.3950 0.5037 0.4373 -0.0776 -0.0583 -0.0504 308 PHE C CE2 
3667 C CZ  . PHE C 226 ? 0.4018 0.5085 0.4361 -0.0766 -0.0575 -0.0400 308 PHE C CZ  
3668 N N   . GLY C 227 ? 0.5540 0.7046 0.6263 -0.1387 -0.0808 -0.0354 309 GLY C N   
3669 C CA  . GLY C 227 ? 0.4410 0.5992 0.5227 -0.1620 -0.0911 -0.0330 309 GLY C CA  
3670 C C   . GLY C 227 ? 0.4874 0.6950 0.5746 -0.1650 -0.0900 -0.0306 309 GLY C C   
3671 O O   . GLY C 227 ? 0.4791 0.7258 0.5774 -0.1735 -0.0873 -0.0126 309 GLY C O   
3672 N N   . GLN C 228 ? 0.4569 0.6689 0.5364 -0.1560 -0.0913 -0.0470 310 GLN C N   
3673 C CA  . GLN C 228 ? 0.4609 0.7199 0.5444 -0.1597 -0.0935 -0.0461 310 GLN C CA  
3674 C C   . GLN C 228 ? 0.4534 0.7494 0.5327 -0.1376 -0.0789 -0.0341 310 GLN C C   
3675 O O   . GLN C 228 ? 0.4518 0.7973 0.5379 -0.1386 -0.0784 -0.0240 310 GLN C O   
3676 C CB  . GLN C 228 ? 0.4637 0.7118 0.5367 -0.1588 -0.1024 -0.0688 310 GLN C CB  
3677 C CG  . GLN C 228 ? 0.4972 0.7157 0.5706 -0.1836 -0.1208 -0.0816 310 GLN C CG  
3678 C CD  . GLN C 228 ? 0.5434 0.7062 0.6143 -0.1872 -0.1227 -0.0821 310 GLN C CD  
3679 O OE1 . GLN C 228 ? 0.5331 0.6644 0.5926 -0.1679 -0.1175 -0.0922 310 GLN C OE1 
3680 N NE2 . GLN C 228 ? 0.5115 0.6663 0.5940 -0.2113 -0.1295 -0.0685 310 GLN C NE2 
3681 N N   . HIS C 229 ? 0.4075 0.6798 0.4745 -0.1176 -0.0680 -0.0349 311 HIS C N   
3682 C CA  . HIS C 229 ? 0.4165 0.7042 0.4730 -0.0964 -0.0547 -0.0236 311 HIS C CA  
3683 C C   . HIS C 229 ? 0.4149 0.7253 0.4609 -0.0812 -0.0499 -0.0258 311 HIS C C   
3684 O O   . HIS C 229 ? 0.4558 0.7754 0.4892 -0.0619 -0.0394 -0.0158 311 HIS C O   
3685 C CB  . HIS C 229 ? 0.3685 0.6880 0.4319 -0.0971 -0.0506 -0.0040 311 HIS C CB  
3686 C CG  . HIS C 229 ? 0.4241 0.7207 0.4933 -0.1079 -0.0525 0.0021  311 HIS C CG  
3687 N ND1 . HIS C 229 ? 0.4444 0.7707 0.5252 -0.1175 -0.0517 0.0204  311 HIS C ND1 
3688 C CD2 . HIS C 229 ? 0.4420 0.6930 0.5067 -0.1095 -0.0548 -0.0057 311 HIS C CD2 
3689 C CE1 . HIS C 229 ? 0.4534 0.7488 0.5344 -0.1243 -0.0531 0.0239  311 HIS C CE1 
3690 N NE2 . HIS C 229 ? 0.4383 0.6879 0.5093 -0.1185 -0.0555 0.0077  311 HIS C NE2 
3691 N N   . ASP C 230 ? 0.4358 0.7517 0.4823 -0.0867 -0.0572 -0.0386 312 ASP C N   
3692 C CA  . ASP C 230 ? 0.4984 0.8306 0.5311 -0.0692 -0.0512 -0.0397 312 ASP C CA  
3693 C C   . ASP C 230 ? 0.5326 0.8272 0.5525 -0.0589 -0.0439 -0.0469 312 ASP C C   
3694 O O   . ASP C 230 ? 0.5256 0.7873 0.5492 -0.0650 -0.0448 -0.0526 312 ASP C O   
3695 C CB  . ASP C 230 ? 0.5617 0.9238 0.5977 -0.0779 -0.0625 -0.0494 312 ASP C CB  
3696 C CG  . ASP C 230 ? 0.6578 0.9888 0.6939 -0.0912 -0.0732 -0.0697 312 ASP C CG  
3697 O OD1 . ASP C 230 ? 0.6874 0.9865 0.7316 -0.1040 -0.0777 -0.0728 312 ASP C OD1 
3698 O OD2 . ASP C 230 ? 0.6807 1.0187 0.7059 -0.0860 -0.0770 -0.0823 312 ASP C OD2 
3699 N N   . ARG C 231 ? 0.5542 0.8577 0.5596 -0.0434 -0.0365 -0.0445 313 ARG C N   
3700 C CA  . ARG C 231 ? 0.5365 0.8121 0.5306 -0.0352 -0.0278 -0.0460 313 ARG C CA  
3701 C C   . ARG C 231 ? 0.5616 0.8540 0.5484 -0.0300 -0.0280 -0.0534 313 ARG C C   
3702 O O   . ARG C 231 ? 0.6061 0.9316 0.5880 -0.0244 -0.0309 -0.0518 313 ARG C O   
3703 C CB  . ARG C 231 ? 0.5641 0.8253 0.5411 -0.0201 -0.0159 -0.0311 313 ARG C CB  
3704 N N   . ALA C 232 ? 0.5390 0.8141 0.5249 -0.0304 -0.0250 -0.0607 314 ALA C N   
3705 C CA  . ALA C 232 ? 0.5614 0.8537 0.5379 -0.0226 -0.0233 -0.0673 314 ALA C CA  
3706 C C   . ALA C 232 ? 0.5416 0.8187 0.5178 -0.0202 -0.0138 -0.0659 314 ALA C C   
3707 O O   . ALA C 232 ? 0.5050 0.7604 0.4929 -0.0282 -0.0143 -0.0676 314 ALA C O   
3708 C CB  . ALA C 232 ? 0.4065 0.7096 0.3860 -0.0292 -0.0373 -0.0869 314 ALA C CB  
3709 N N   . TRP C 233 ? 0.5535 0.8479 0.5171 -0.0093 -0.0054 -0.0613 315 TRP C N   
3710 C CA  . TRP C 233 ? 0.5149 0.8066 0.4805 -0.0083 0.0047  -0.0568 315 TRP C CA  
3711 C C   . TRP C 233 ? 0.5376 0.8366 0.5107 -0.0069 -0.0007 -0.0752 315 TRP C C   
3712 O O   . TRP C 233 ? 0.5782 0.8890 0.5430 -0.0009 -0.0093 -0.0911 315 TRP C O   
3713 C CB  . TRP C 233 ? 0.4730 0.7839 0.4216 0.0034  0.0169  -0.0426 315 TRP C CB  
3714 C CG  . TRP C 233 ? 0.5136 0.8079 0.4503 0.0053  0.0240  -0.0227 315 TRP C CG  
3715 C CD1 . TRP C 233 ? 0.5657 0.8698 0.4869 0.0171  0.0230  -0.0164 315 TRP C CD1 
3716 C CD2 . TRP C 233 ? 0.5493 0.8111 0.4855 -0.0034 0.0318  -0.0070 315 TRP C CD2 
3717 N NE1 . TRP C 233 ? 0.6125 0.8887 0.5207 0.0205  0.0312  0.0024  315 TRP C NE1 
3718 C CE2 . TRP C 233 ? 0.5953 0.8407 0.5107 0.0064  0.0360  0.0076  315 TRP C CE2 
3719 C CE3 . TRP C 233 ? 0.5557 0.8013 0.5058 -0.0185 0.0345  -0.0040 315 TRP C CE3 
3720 C CZ2 . TRP C 233 ? 0.5887 0.7916 0.4922 0.0018  0.0424  0.0231  315 TRP C CZ2 
3721 C CZ3 . TRP C 233 ? 0.5885 0.7977 0.5303 -0.0277 0.0396  0.0116  315 TRP C CZ3 
3722 C CH2 . TRP C 233 ? 0.6141 0.7972 0.5305 -0.0174 0.0432  0.0241  315 TRP C CH2 
3723 N N   . VAL C 234 ? 0.5194 0.8108 0.5063 -0.0115 0.0032  -0.0735 316 VAL C N   
3724 C CA  . VAL C 234 ? 0.5113 0.8117 0.5032 -0.0039 0.0008  -0.0885 316 VAL C CA  
3725 C C   . VAL C 234 ? 0.4955 0.8186 0.4953 -0.0010 0.0145  -0.0758 316 VAL C C   
3726 O O   . VAL C 234 ? 0.4825 0.8003 0.4903 -0.0132 0.0214  -0.0577 316 VAL C O   
3727 C CB  . VAL C 234 ? 0.4915 0.7653 0.4961 -0.0111 -0.0108 -0.0997 316 VAL C CB  
3728 C CG1 . VAL C 234 ? 0.4509 0.7084 0.4486 -0.0166 -0.0241 -0.1104 316 VAL C CG1 
3729 C CG2 . VAL C 234 ? 0.4817 0.7402 0.5011 -0.0245 -0.0086 -0.0859 316 VAL C CG2 
3730 N N   . PRO C 235 ? 0.4964 0.8459 0.4926 0.0148  0.0187  -0.0843 317 PRO C N   
3731 C CA  . PRO C 235 ? 0.4999 0.8830 0.5073 0.0171  0.0331  -0.0691 317 PRO C CA  
3732 C C   . PRO C 235 ? 0.4905 0.8686 0.5242 0.0032  0.0318  -0.0623 317 PRO C C   
3733 O O   . PRO C 235 ? 0.4934 0.8573 0.5349 0.0065  0.0219  -0.0762 317 PRO C O   
3734 C CB  . PRO C 235 ? 0.4886 0.9001 0.4841 0.0426  0.0356  -0.0847 317 PRO C CB  
3735 C CG  . PRO C 235 ? 0.4925 0.8701 0.4760 0.0486  0.0186  -0.1110 317 PRO C CG  
3736 C CD  . PRO C 235 ? 0.4907 0.8406 0.4704 0.0316  0.0101  -0.1082 317 PRO C CD  
3737 N N   . ILE C 236 ? 0.5306 0.9189 0.5760 -0.0131 0.0408  -0.0400 318 ILE C N   
3738 C CA  . ILE C 236 ? 0.5699 0.9630 0.6409 -0.0289 0.0390  -0.0321 318 ILE C CA  
3739 C C   . ILE C 236 ? 0.5952 1.0251 0.6810 -0.0121 0.0395  -0.0413 318 ILE C C   
3740 O O   . ILE C 236 ? 0.5974 1.0228 0.6996 -0.0155 0.0311  -0.0462 318 ILE C O   
3741 C CB  . ILE C 236 ? 0.5974 1.0023 0.6764 -0.0501 0.0493  -0.0061 318 ILE C CB  
3742 C CG1 . ILE C 236 ? 0.5305 0.9365 0.6344 -0.0725 0.0437  0.0015  318 ILE C CG1 
3743 C CG2 . ILE C 236 ? 0.6626 1.1219 0.7450 -0.0407 0.0651  0.0070  318 ILE C CG2 
3744 C CD1 . ILE C 236 ? 0.5126 0.8768 0.6149 -0.0777 0.0291  -0.0114 318 ILE C CD1 
3745 N N   . ASN C 237 ? 0.6204 1.0876 0.6974 0.0101  0.0494  -0.0441 319 ASN C N   
3746 C CA  . ASN C 237 ? 0.6586 1.1718 0.7488 0.0299  0.0544  -0.0476 319 ASN C CA  
3747 C C   . ASN C 237 ? 0.6553 1.1436 0.7361 0.0523  0.0423  -0.0736 319 ASN C C   
3748 O O   . ASN C 237 ? 0.6619 1.1822 0.7521 0.0728  0.0450  -0.0775 319 ASN C O   
3749 C CB  . ASN C 237 ? 0.7074 1.2707 0.7866 0.0496  0.0708  -0.0408 319 ASN C CB  
3750 C CG  . ASN C 237 ? 0.7800 1.3195 0.8240 0.0636  0.0691  -0.0547 319 ASN C CG  
3751 O OD1 . ASN C 237 ? 0.8065 1.3315 0.8295 0.0876  0.0617  -0.0797 319 ASN C OD1 
3752 N ND2 . ASN C 237 ? 0.8110 1.3425 0.8461 0.0482  0.0745  -0.0388 319 ASN C ND2 
3753 N N   . ASN C 238 ? 0.6494 1.0833 0.7116 0.0499  0.0294  -0.0899 320 ASN C N   
3754 C CA  . ASN C 238 ? 0.6787 1.0767 0.7334 0.0628  0.0159  -0.1107 320 ASN C CA  
3755 C C   . ASN C 238 ? 0.6665 1.0188 0.7281 0.0393  0.0034  -0.1094 320 ASN C C   
3756 O O   . ASN C 238 ? 0.6902 0.9995 0.7375 0.0396  -0.0084 -0.1238 320 ASN C O   
3757 C CB  . ASN C 238 ? 0.7468 1.1232 0.7688 0.0842  0.0107  -0.1340 320 ASN C CB  
3758 C CG  . ASN C 238 ? 0.8397 1.1959 0.8508 0.1102  0.0029  -0.1538 320 ASN C CG  
3759 O OD1 . ASN C 238 ? 0.8561 1.2323 0.8852 0.1202  0.0057  -0.1480 320 ASN C OD1 
3760 N ND2 . ASN C 238 ? 0.8946 1.2100 0.8747 0.1215  -0.0079 -0.1773 320 ASN C ND2 
3761 N N   . CYS C 239 ? 0.6403 1.0022 0.7227 0.0177  0.0058  -0.0914 321 CYS C N   
3762 C CA  . CYS C 239 ? 0.6122 0.9368 0.6995 -0.0025 -0.0043 -0.0883 321 CYS C CA  
3763 C C   . CYS C 239 ? 0.5986 0.9382 0.7087 -0.0070 -0.0078 -0.0815 321 CYS C C   
3764 O O   . CYS C 239 ? 0.5986 0.9823 0.7269 -0.0104 -0.0002 -0.0694 321 CYS C O   
3765 C CB  . CYS C 239 ? 0.6161 0.9317 0.6990 -0.0229 0.0000  -0.0748 321 CYS C CB  
3766 S SG  . CYS C 239 ? 0.6340 0.9024 0.7123 -0.0407 -0.0106 -0.0734 321 CYS C SG  
3767 N N   . TYR C 240 ? 0.5557 0.8634 0.6655 -0.0075 -0.0194 -0.0879 322 TYR C N   
3768 C CA  . TYR C 240 ? 0.5031 0.8263 0.6316 -0.0067 -0.0248 -0.0834 322 TYR C CA  
3769 C C   . TYR C 240 ? 0.5580 0.8466 0.6852 -0.0242 -0.0350 -0.0801 322 TYR C C   
3770 O O   . TYR C 240 ? 0.6181 0.8667 0.7292 -0.0280 -0.0394 -0.0851 322 TYR C O   
3771 C CB  . TYR C 240 ? 0.4677 0.7912 0.5932 0.0221  -0.0284 -0.0949 322 TYR C CB  
3772 C CG  . TYR C 240 ? 0.5023 0.8536 0.6205 0.0465  -0.0188 -0.1022 322 TYR C CG  
3773 C CD1 . TYR C 240 ? 0.5127 0.8354 0.6052 0.0549  -0.0184 -0.1160 322 TYR C CD1 
3774 C CD2 . TYR C 240 ? 0.5292 0.9404 0.6653 0.0618  -0.0104 -0.0951 322 TYR C CD2 
3775 C CE1 . TYR C 240 ? 0.5654 0.9120 0.6457 0.0793  -0.0103 -0.1246 322 TYR C CE1 
3776 C CE2 . TYR C 240 ? 0.5623 1.0022 0.6883 0.0882  -0.0001 -0.1016 322 TYR C CE2 
3777 C CZ  . TYR C 240 ? 0.5991 1.0034 0.6948 0.0976  -0.0003 -0.1174 322 TYR C CZ  
3778 O OH  . TYR C 240 ? 0.6677 1.0978 0.7473 0.1259  0.0091  -0.1261 322 TYR C OH  
3779 N N   . LEU C 241 ? 0.5148 0.8236 0.6589 -0.0349 -0.0392 -0.0713 323 LEU C N   
3780 C CA  . LEU C 241 ? 0.5164 0.7958 0.6561 -0.0478 -0.0495 -0.0693 323 LEU C CA  
3781 C C   . LEU C 241 ? 0.5638 0.8150 0.6948 -0.0316 -0.0572 -0.0765 323 LEU C C   
3782 O O   . LEU C 241 ? 0.6237 0.8855 0.7581 -0.0104 -0.0576 -0.0816 323 LEU C O   
3783 C CB  . LEU C 241 ? 0.5138 0.8243 0.6722 -0.0615 -0.0549 -0.0606 323 LEU C CB  
3784 C CG  . LEU C 241 ? 0.5045 0.8287 0.6682 -0.0860 -0.0500 -0.0512 323 LEU C CG  
3785 C CD1 . LEU C 241 ? 0.4772 0.8366 0.6621 -0.1030 -0.0583 -0.0435 323 LEU C CD1 
3786 C CD2 . LEU C 241 ? 0.4676 0.7415 0.6067 -0.0994 -0.0501 -0.0515 323 LEU C CD2 
3787 N N   . MET C 242 ? 0.5572 0.7707 0.6744 -0.0406 -0.0627 -0.0759 324 MET C N   
3788 C CA  . MET C 242 ? 0.5418 0.7247 0.6497 -0.0301 -0.0696 -0.0787 324 MET C CA  
3789 C C   . MET C 242 ? 0.5237 0.7224 0.6416 -0.0152 -0.0760 -0.0767 324 MET C C   
3790 O O   . MET C 242 ? 0.4586 0.6875 0.5895 -0.0209 -0.0794 -0.0710 324 MET C O   
3791 C CB  . MET C 242 ? 0.5346 0.6889 0.6299 -0.0433 -0.0734 -0.0733 324 MET C CB  
3792 C CG  . MET C 242 ? 0.5590 0.6823 0.6450 -0.0367 -0.0792 -0.0720 324 MET C CG  
3793 S SD  . MET C 242 ? 0.6093 0.7087 0.6884 -0.0260 -0.0788 -0.0822 324 MET C SD  
3794 C CE  . MET C 242 ? 0.5433 0.6484 0.6177 -0.0388 -0.0716 -0.0866 324 MET C CE  
3795 N N   . SER C 243 ? 0.5291 0.7058 0.6392 0.0040  -0.0787 -0.0816 325 SER C N   
3796 C CA  . SER C 243 ? 0.5020 0.6899 0.6174 0.0260  -0.0839 -0.0797 325 SER C CA  
3797 C C   . SER C 243 ? 0.5512 0.6865 0.6480 0.0361  -0.0902 -0.0797 325 SER C C   
3798 O O   . SER C 243 ? 0.5998 0.6957 0.6829 0.0245  -0.0904 -0.0820 325 SER C O   
3799 C CB  . SER C 243 ? 0.5109 0.7311 0.6340 0.0487  -0.0777 -0.0863 325 SER C CB  
3800 O OG  . SER C 243 ? 0.5445 0.7260 0.6477 0.0619  -0.0757 -0.0984 325 SER C OG  
3801 N N   . LYS C 244 ? 0.5893 0.7259 0.6860 0.0580  -0.0956 -0.0755 326 LYS C N   
3802 C CA  . LYS C 244 ? 0.6565 0.7374 0.7330 0.0701  -0.1014 -0.0737 326 LYS C CA  
3803 C C   . LYS C 244 ? 0.7472 0.7934 0.8075 0.0889  -0.0999 -0.0874 326 LYS C C   
3804 O O   . LYS C 244 ? 0.7977 0.7845 0.8379 0.0848  -0.1044 -0.0895 326 LYS C O   
3805 C CB  . LYS C 244 ? 0.6333 0.7245 0.7115 0.0892  -0.1081 -0.0625 326 LYS C CB  
3806 C CG  . LYS C 244 ? 0.6349 0.7479 0.7204 0.0702  -0.1124 -0.0508 326 LYS C CG  
3807 C CD  . LYS C 244 ? 0.6491 0.7976 0.7424 0.0891  -0.1197 -0.0418 326 LYS C CD  
3808 N N   . GLU C 245 ? 0.7826 0.8641 0.8493 0.1082  -0.0940 -0.0968 327 GLU C N   
3809 C CA  . GLU C 245 ? 0.8875 0.9360 0.9331 0.1288  -0.0926 -0.1130 327 GLU C CA  
3810 C C   . GLU C 245 ? 0.9094 0.9709 0.9559 0.1113  -0.0861 -0.1236 327 GLU C C   
3811 O O   . GLU C 245 ? 0.8694 0.9862 0.9367 0.0996  -0.0786 -0.1191 327 GLU C O   
3812 C CB  . GLU C 245 ? 0.9217 1.0006 0.9675 0.1705  -0.0892 -0.1169 327 GLU C CB  
3813 N N   . ILE C 246 ? 0.9614 0.9697 0.9839 0.1082  -0.0902 -0.1367 328 ILE C N   
3814 C CA  . ILE C 246 ? 0.9912 1.0072 1.0100 0.0926  -0.0862 -0.1473 328 ILE C CA  
3815 C C   . ILE C 246 ? 1.0014 1.0553 1.0169 0.1198  -0.0774 -0.1590 328 ILE C C   
3816 O O   . ILE C 246 ? 1.0455 1.0898 1.0475 0.1541  -0.0778 -0.1667 328 ILE C O   
3817 C CB  . ILE C 246 ? 1.0508 1.0003 1.0449 0.0786  -0.0965 -0.1578 328 ILE C CB  
3818 C CG1 . ILE C 246 ? 1.0839 0.9971 1.0803 0.0584  -0.1043 -0.1424 328 ILE C CG1 
3819 C CG2 . ILE C 246 ? 0.9645 0.9291 0.9583 0.0570  -0.0943 -0.1649 328 ILE C CG2 
3820 C CD1 . ILE C 246 ? 1.1103 0.9466 1.0797 0.0600  -0.1163 -0.1488 328 ILE C CD1 
3821 N N   . PRO C 247 ? 0.9412 1.0395 0.9671 0.1084  -0.0684 -0.1590 329 PRO C N   
3822 C CA  . PRO C 247 ? 0.9513 1.0909 0.9731 0.1344  -0.0582 -0.1677 329 PRO C CA  
3823 C C   . PRO C 247 ? 1.0427 1.1390 1.0277 0.1627  -0.0626 -0.1909 329 PRO C C   
3824 O O   . PRO C 247 ? 1.0744 1.1975 1.0520 0.1985  -0.0555 -0.1973 329 PRO C O   
3825 C CB  . PRO C 247 ? 0.8783 1.0544 0.9112 0.1101  -0.0500 -0.1621 329 PRO C CB  
3826 C CG  . PRO C 247 ? 0.8318 1.0116 0.8863 0.0793  -0.0523 -0.1449 329 PRO C CG  
3827 C CD  . PRO C 247 ? 0.8778 1.0004 0.9225 0.0750  -0.0650 -0.1462 329 PRO C CD  
3828 N N   . PHE C 248 ? 1.0863 1.1192 1.0469 0.1478  -0.0743 -0.2039 330 PHE C N   
3829 C CA  . PHE C 248 ? 1.1215 1.0953 1.0413 0.1712  -0.0834 -0.2283 330 PHE C CA  
3830 C C   . PHE C 248 ? 1.2222 1.1157 1.1265 0.1480  -0.1004 -0.2315 330 PHE C C   
3831 O O   . PHE C 248 ? 1.2504 1.1341 1.1728 0.1322  -0.1031 -0.2136 330 PHE C O   
3832 C CB  . PHE C 248 ? 1.0379 1.0282 0.9381 0.1764  -0.0801 -0.2458 330 PHE C CB  
3833 N N   . SER C 249 ? 1.2786 1.1160 1.1492 0.1440  -0.1126 -0.2532 331 SER C N   
3834 C CA  . SER C 249 ? 1.2820 1.0415 1.1379 0.1181  -0.1300 -0.2549 331 SER C CA  
3835 C C   . SER C 249 ? 1.2385 0.9845 1.0878 0.0813  -0.1409 -0.2643 331 SER C C   
3836 O O   . SER C 249 ? 1.2157 0.9135 1.0623 0.0499  -0.1545 -0.2604 331 SER C O   
3837 C CB  . SER C 249 ? 1.3519 1.0317 1.1660 0.1493  -0.1402 -0.2726 331 SER C CB  
3838 O OG  . SER C 249 ? 1.3089 1.0089 1.1299 0.1867  -0.1301 -0.2626 331 SER C OG  
3839 N N   . LYS C 252 ? 1.2442 0.7298 1.0170 -0.0438 -0.2219 -0.3003 334 LYS C N   
3840 C CA  . LYS C 252 ? 1.2527 0.8251 1.0549 -0.0627 -0.2151 -0.2945 334 LYS C CA  
3841 C C   . LYS C 252 ? 1.3506 0.9321 1.1762 -0.1173 -0.2270 -0.2789 334 LYS C C   
3842 O O   . LYS C 252 ? 1.4489 0.9827 1.2538 -0.1452 -0.2488 -0.2942 334 LYS C O   
3843 C CB  . LYS C 252 ? 1.1281 0.7799 0.9655 -0.0425 -0.1904 -0.2727 334 LYS C CB  
3844 N N   . THR C 253 ? 1.3261 0.9724 1.1940 -0.1325 -0.2132 -0.2487 335 THR C N   
3845 C CA  . THR C 253 ? 1.3355 1.0016 1.2299 -0.1793 -0.2204 -0.2276 335 THR C CA  
3846 C C   . THR C 253 ? 1.3327 1.0025 1.2516 -0.1829 -0.2088 -0.1955 335 THR C C   
3847 O O   . THR C 253 ? 1.2620 0.9979 1.2119 -0.1868 -0.1946 -0.1735 335 THR C O   
3848 C CB  . THR C 253 ? 1.2477 0.9992 1.1650 -0.1913 -0.2154 -0.2237 335 THR C CB  
3849 O OG1 . THR C 253 ? 1.1151 0.9291 1.0622 -0.1789 -0.1938 -0.1997 335 THR C OG1 
3850 C CG2 . THR C 253 ? 1.2917 1.0555 1.1848 -0.1665 -0.2165 -0.2519 335 THR C CG2 
3851 N N   . LYS C 254 ? 0.9842 0.9020 1.1046 -0.0035 -0.0263 -0.1880 336 LYS C N   
3852 C CA  . LYS C 254 ? 0.9278 0.8169 1.0507 0.0033  -0.0312 -0.1555 336 LYS C CA  
3853 C C   . LYS C 254 ? 0.8924 0.7838 0.9985 -0.0134 -0.0336 -0.1295 336 LYS C C   
3854 O O   . LYS C 254 ? 0.8678 0.7691 0.9618 -0.0073 -0.0370 -0.1054 336 LYS C O   
3855 C CB  . LYS C 254 ? 0.9365 0.7673 1.0793 0.0088  -0.0322 -0.1571 336 LYS C CB  
3856 N N   . SER C 255 ? 0.8625 0.7482 0.9678 -0.0353 -0.0311 -0.1359 337 SER C N   
3857 C CA  . SER C 255 ? 0.8308 0.7097 0.9245 -0.0507 -0.0310 -0.1102 337 SER C CA  
3858 C C   . SER C 255 ? 0.7622 0.6839 0.8344 -0.0467 -0.0305 -0.0958 337 SER C C   
3859 O O   . SER C 255 ? 0.7734 0.6855 0.8313 -0.0439 -0.0324 -0.0699 337 SER C O   
3860 C CB  . SER C 255 ? 0.8741 0.7477 0.9770 -0.0768 -0.0268 -0.1235 337 SER C CB  
3861 O OG  . SER C 255 ? 0.9011 0.7897 0.9934 -0.0925 -0.0235 -0.1037 337 SER C OG  
3862 N N   . ILE C 256 ? 0.7202 0.6875 0.7876 -0.0454 -0.0278 -0.1123 338 ILE C N   
3863 C CA  . ILE C 256 ? 0.6859 0.6879 0.7328 -0.0395 -0.0257 -0.0987 338 ILE C CA  
3864 C C   . ILE C 256 ? 0.6497 0.6466 0.6880 -0.0224 -0.0282 -0.0860 338 ILE C C   
3865 O O   . ILE C 256 ? 0.5698 0.5708 0.5898 -0.0200 -0.0275 -0.0676 338 ILE C O   
3866 C CB  . ILE C 256 ? 0.7049 0.7560 0.7487 -0.0383 -0.0230 -0.1170 338 ILE C CB  
3867 C CG1 . ILE C 256 ? 0.7700 0.8286 0.8221 -0.0286 -0.0240 -0.1411 338 ILE C CG1 
3868 C CG2 . ILE C 256 ? 0.6950 0.7629 0.7483 -0.0580 -0.0220 -0.1269 338 ILE C CG2 
3869 C CD1 . ILE C 256 ? 0.7893 0.8985 0.8300 -0.0218 -0.0219 -0.1535 338 ILE C CD1 
3870 N N   . PHE C 257 ? 0.6647 0.6537 0.7172 -0.0112 -0.0304 -0.0971 339 PHE C N   
3871 C CA  . PHE C 257 ? 0.6281 0.6162 0.6795 0.0024  -0.0335 -0.0852 339 PHE C CA  
3872 C C   . PHE C 257 ? 0.6618 0.6201 0.7075 -0.0001 -0.0404 -0.0605 339 PHE C C   
3873 O O   . PHE C 257 ? 0.6571 0.6226 0.6879 0.0020  -0.0427 -0.0456 339 PHE C O   
3874 C CB  . PHE C 257 ? 0.6090 0.5964 0.6822 0.0156  -0.0334 -0.1021 339 PHE C CB  
3875 C CG  . PHE C 257 ? 0.5408 0.5356 0.6207 0.0287  -0.0365 -0.0910 339 PHE C CG  
3876 C CD1 . PHE C 257 ? 0.4757 0.5049 0.5485 0.0334  -0.0312 -0.0918 339 PHE C CD1 
3877 C CD2 . PHE C 257 ? 0.5742 0.5435 0.6687 0.0356  -0.0448 -0.0784 339 PHE C CD2 
3878 C CE1 . PHE C 257 ? 0.5053 0.5455 0.5883 0.0414  -0.0336 -0.0825 339 PHE C CE1 
3879 C CE2 . PHE C 257 ? 0.5652 0.5503 0.6700 0.0464  -0.0494 -0.0689 339 PHE C CE2 
3880 C CZ  . PHE C 257 ? 0.5313 0.5528 0.6320 0.0475  -0.0436 -0.0720 339 PHE C CZ  
3881 N N   . ASN C 258 ? 0.6805 0.6037 0.7357 -0.0053 -0.0436 -0.0559 340 ASN C N   
3882 C CA  . ASN C 258 ? 0.7390 0.6353 0.7839 -0.0070 -0.0505 -0.0297 340 ASN C CA  
3883 C C   . ASN C 258 ? 0.7435 0.6488 0.7602 -0.0186 -0.0472 -0.0153 340 ASN C C   
3884 O O   . ASN C 258 ? 0.7469 0.6470 0.7454 -0.0170 -0.0527 0.0031  340 ASN C O   
3885 C CB  . ASN C 258 ? 0.8090 0.6623 0.8664 -0.0113 -0.0520 -0.0245 340 ASN C CB  
3886 C CG  . ASN C 258 ? 0.8568 0.6929 0.9403 0.0056  -0.0560 -0.0339 340 ASN C CG  
3887 O OD1 . ASN C 258 ? 0.8575 0.7166 0.9497 0.0214  -0.0597 -0.0376 340 ASN C OD1 
3888 N ND2 . ASN C 258 ? 0.8846 0.6802 0.9826 0.0025  -0.0538 -0.0386 340 ASN C ND2 
3889 N N   . SER C 259 ? 0.6993 0.6206 0.7120 -0.0297 -0.0383 -0.0245 341 SER C N   
3890 C CA  . SER C 259 ? 0.6637 0.5995 0.6514 -0.0359 -0.0328 -0.0131 341 SER C CA  
3891 C C   . SER C 259 ? 0.6576 0.6113 0.6288 -0.0253 -0.0335 -0.0111 341 SER C C   
3892 O O   . SER C 259 ? 0.6920 0.6370 0.6405 -0.0258 -0.0353 0.0036  341 SER C O   
3893 C CB  . SER C 259 ? 0.6536 0.6146 0.6465 -0.0459 -0.0238 -0.0250 341 SER C CB  
3894 O OG  . SER C 259 ? 0.7271 0.6673 0.7354 -0.0604 -0.0227 -0.0259 341 SER C OG  
3895 N N   . ALA C 260 ? 0.5709 0.5479 0.5515 -0.0170 -0.0316 -0.0260 342 ALA C N   
3896 C CA  . ALA C 260 ? 0.5724 0.5625 0.5389 -0.0093 -0.0302 -0.0231 342 ALA C CA  
3897 C C   . ALA C 260 ? 0.6126 0.5863 0.5764 -0.0074 -0.0398 -0.0119 342 ALA C C   
3898 O O   . ALA C 260 ? 0.6069 0.5778 0.5493 -0.0090 -0.0399 -0.0036 342 ALA C O   
3899 C CB  . ALA C 260 ? 0.5143 0.5307 0.4924 -0.0010 -0.0261 -0.0385 342 ALA C CB  
3900 N N   . MET C 261 ? 0.6374 0.6009 0.6231 -0.0034 -0.0482 -0.0125 343 MET C N   
3901 C CA  . MET C 261 ? 0.6117 0.5672 0.5990 -0.0003 -0.0600 -0.0007 343 MET C CA  
3902 C C   . MET C 261 ? 0.6564 0.5931 0.6154 -0.0083 -0.0650 0.0168  343 MET C C   
3903 O O   . MET C 261 ? 0.6767 0.6161 0.6194 -0.0106 -0.0711 0.0233  343 MET C O   
3904 C CB  . MET C 261 ? 0.6243 0.5704 0.6413 0.0093  -0.0675 -0.0021 343 MET C CB  
3905 C CG  . MET C 261 ? 0.6793 0.6496 0.7231 0.0204  -0.0648 -0.0176 343 MET C CG  
3906 S SD  . MET C 261 ? 0.7117 0.7128 0.7528 0.0196  -0.0659 -0.0152 343 MET C SD  
3907 C CE  . MET C 261 ? 0.6497 0.6755 0.6963 0.0232  -0.0499 -0.0343 343 MET C CE  
3908 N N   . GLN C 262 ? 0.6978 0.6160 0.6497 -0.0142 -0.0620 0.0237  344 GLN C N   
3909 C CA  . GLN C 262 ? 0.7230 0.6261 0.6436 -0.0218 -0.0638 0.0408  344 GLN C CA  
3910 C C   . GLN C 262 ? 0.6453 0.5591 0.5370 -0.0255 -0.0566 0.0379  344 GLN C C   
3911 O O   . GLN C 262 ? 0.6515 0.5585 0.5165 -0.0285 -0.0622 0.0463  344 GLN C O   
3912 C CB  . GLN C 262 ? 0.8481 0.7351 0.7672 -0.0303 -0.0562 0.0476  344 GLN C CB  
3913 C CG  . GLN C 262 ? 0.9797 0.8402 0.9159 -0.0284 -0.0636 0.0580  344 GLN C CG  
3914 C CD  . GLN C 262 ? 1.0944 0.9359 1.0258 -0.0418 -0.0540 0.0675  344 GLN C CD  
3915 O OE1 . GLN C 262 ? 1.1169 0.9607 1.0205 -0.0508 -0.0470 0.0787  344 GLN C OE1 
3916 N NE2 . GLN C 262 ? 1.1298 0.9522 1.0886 -0.0441 -0.0520 0.0617  344 GLN C NE2 
3917 N N   . GLU C 263 ? 0.5812 0.5110 0.4766 -0.0243 -0.0442 0.0255  345 GLU C N   
3918 C CA  . GLU C 263 ? 0.6102 0.5450 0.4791 -0.0241 -0.0353 0.0235  345 GLU C CA  
3919 C C   . GLU C 263 ? 0.6130 0.5466 0.4750 -0.0228 -0.0416 0.0210  345 GLU C C   
3920 O O   . GLU C 263 ? 0.6398 0.5619 0.4724 -0.0267 -0.0410 0.0235  345 GLU C O   
3921 C CB  . GLU C 263 ? 0.6112 0.5667 0.4890 -0.0195 -0.0225 0.0134  345 GLU C CB  
3922 C CG  . GLU C 263 ? 0.6524 0.6104 0.5044 -0.0153 -0.0109 0.0136  345 GLU C CG  
3923 C CD  . GLU C 263 ? 0.7114 0.6956 0.5746 -0.0070 -0.0009 0.0060  345 GLU C CD  
3924 O OE1 . GLU C 263 ? 0.7613 0.7591 0.6212 -0.0061 0.0080  0.0074  345 GLU C OE1 
3925 O OE2 . GLU C 263 ? 0.7115 0.7071 0.5871 -0.0011 -0.0019 -0.0007 345 GLU C OE2 
3926 N N   . MET C 264 ? 0.5828 0.5288 0.4724 -0.0188 -0.0470 0.0149  346 MET C N   
3927 C CA  . MET C 264 ? 0.5798 0.5298 0.4702 -0.0209 -0.0533 0.0132  346 MET C CA  
3928 C C   . MET C 264 ? 0.6168 0.5567 0.4944 -0.0275 -0.0687 0.0222  346 MET C C   
3929 O O   . MET C 264 ? 0.6088 0.5444 0.4677 -0.0353 -0.0721 0.0207  346 MET C O   
3930 C CB  . MET C 264 ? 0.5237 0.4948 0.4497 -0.0147 -0.0548 0.0060  346 MET C CB  
3931 C CG  . MET C 264 ? 0.5322 0.5144 0.4630 -0.0190 -0.0557 0.0034  346 MET C CG  
3932 S SD  . MET C 264 ? 0.5679 0.5787 0.5441 -0.0126 -0.0644 0.0000  346 MET C SD  
3933 C CE  . MET C 264 ? 0.4815 0.4854 0.4614 -0.0128 -0.0859 0.0115  346 MET C CE  
3934 N N   . GLU C 265 ? 0.6063 0.5411 0.4918 -0.0249 -0.0786 0.0318  347 GLU C N   
3935 C CA  . GLU C 265 ? 0.6177 0.5475 0.4898 -0.0285 -0.0955 0.0434  347 GLU C CA  
3936 C C   . GLU C 265 ? 0.6928 0.6062 0.5180 -0.0374 -0.0928 0.0474  347 GLU C C   
3937 O O   . GLU C 265 ? 0.7383 0.6519 0.5425 -0.0442 -0.1054 0.0496  347 GLU C O   
3938 C CB  . GLU C 265 ? 0.6353 0.5588 0.5256 -0.0206 -0.1046 0.0561  347 GLU C CB  
3939 C CG  . GLU C 265 ? 0.6991 0.6405 0.6314 -0.0099 -0.1142 0.0534  347 GLU C CG  
3940 C CD  . GLU C 265 ? 0.8547 0.7820 0.8116 0.0013  -0.1140 0.0587  347 GLU C CD  
3941 O OE1 . GLU C 265 ? 0.9423 0.8446 0.8825 -0.0025 -0.1086 0.0677  347 GLU C OE1 
3942 O OE2 . GLU C 265 ? 0.8629 0.8032 0.8566 0.0135  -0.1175 0.0529  347 GLU C OE2 
3943 N N   . VAL C 266 ? 0.6591 0.5617 0.4678 -0.0374 -0.0767 0.0473  348 VAL C N   
3944 C CA  . VAL C 266 ? 0.6477 0.5372 0.4123 -0.0431 -0.0691 0.0475  348 VAL C CA  
3945 C C   . VAL C 266 ? 0.6719 0.5584 0.4225 -0.0470 -0.0661 0.0337  348 VAL C C   
3946 O O   . VAL C 266 ? 0.7312 0.6063 0.4478 -0.0547 -0.0709 0.0308  348 VAL C O   
3947 C CB  . VAL C 266 ? 0.6319 0.5195 0.3904 -0.0405 -0.0498 0.0485  348 VAL C CB  
3948 C CG1 . VAL C 266 ? 0.5892 0.4658 0.3036 -0.0429 -0.0389 0.0464  348 VAL C CG1 
3949 C CG2 . VAL C 266 ? 0.5611 0.4465 0.3323 -0.0416 -0.0513 0.0623  348 VAL C CG2 
3950 N N   . TYR C 267 ? 0.6716 0.5660 0.4457 -0.0426 -0.0572 0.0248  349 TYR C N   
3951 C CA  . TYR C 267 ? 0.6876 0.5738 0.4509 -0.0473 -0.0528 0.0142  349 TYR C CA  
3952 C C   . TYR C 267 ? 0.7204 0.6105 0.4849 -0.0596 -0.0713 0.0121  349 TYR C C   
3953 O O   . TYR C 267 ? 0.7478 0.6214 0.4839 -0.0702 -0.0722 0.0041  349 TYR C O   
3954 C CB  . TYR C 267 ? 0.6646 0.5622 0.4549 -0.0399 -0.0414 0.0096  349 TYR C CB  
3955 C CG  . TYR C 267 ? 0.6923 0.5782 0.4753 -0.0456 -0.0351 0.0023  349 TYR C CG  
3956 C CD1 . TYR C 267 ? 0.6800 0.5767 0.4832 -0.0561 -0.0453 -0.0003 349 TYR C CD1 
3957 C CD2 . TYR C 267 ? 0.7222 0.5863 0.4803 -0.0401 -0.0178 -0.0009 349 TYR C CD2 
3958 C CE1 . TYR C 267 ? 0.7325 0.6158 0.5302 -0.0651 -0.0380 -0.0058 349 TYR C CE1 
3959 C CE2 . TYR C 267 ? 0.7508 0.5960 0.5015 -0.0457 -0.0105 -0.0056 349 TYR C CE2 
3960 C CZ  . TYR C 267 ? 0.7543 0.6077 0.5242 -0.0604 -0.0204 -0.0080 349 TYR C CZ  
3961 O OH  . TYR C 267 ? 0.7919 0.6240 0.5555 -0.0702 -0.0119 -0.0118 349 TYR C OH  
3962 N N   . VAL C 268 ? 0.6588 0.5715 0.4564 -0.0581 -0.0865 0.0181  350 VAL C N   
3963 C CA  . VAL C 268 ? 0.6234 0.5509 0.4289 -0.0686 -0.1060 0.0171  350 VAL C CA  
3964 C C   . VAL C 268 ? 0.6669 0.5827 0.4306 -0.0773 -0.1183 0.0195  350 VAL C C   
3965 O O   . VAL C 268 ? 0.6661 0.5824 0.4144 -0.0920 -0.1282 0.0105  350 VAL C O   
3966 C CB  . VAL C 268 ? 0.5918 0.5485 0.4421 -0.0597 -0.1195 0.0251  350 VAL C CB  
3967 C CG1 . VAL C 268 ? 0.5557 0.5354 0.4137 -0.0682 -0.1431 0.0273  350 VAL C CG1 
3968 C CG2 . VAL C 268 ? 0.5626 0.5354 0.4512 -0.0537 -0.1078 0.0186  350 VAL C CG2 
3969 N N   . GLU C 269 ? 0.6964 0.6031 0.4405 -0.0698 -0.1178 0.0313  351 GLU C N   
3970 C CA  . GLU C 269 ? 0.7022 0.5997 0.4007 -0.0770 -0.1277 0.0349  351 GLU C CA  
3971 C C   . GLU C 269 ? 0.7524 0.6256 0.4091 -0.0867 -0.1151 0.0180  351 GLU C C   
3972 O O   . GLU C 269 ? 0.8103 0.6805 0.4370 -0.0999 -0.1274 0.0090  351 GLU C O   
3973 C CB  . GLU C 269 ? 0.6613 0.5511 0.3453 -0.0680 -0.1241 0.0528  351 GLU C CB  
3974 C CG  . GLU C 269 ? 0.7105 0.5944 0.3443 -0.0736 -0.1339 0.0607  351 GLU C CG  
3975 C CD  . GLU C 269 ? 0.9159 0.8216 0.5499 -0.0793 -0.1633 0.0643  351 GLU C CD  
3976 O OE1 . GLU C 269 ? 0.7770 0.6818 0.3651 -0.0887 -0.1736 0.0609  351 GLU C OE1 
3977 O OE2 . GLU C 269 ? 0.8595 0.7870 0.5404 -0.0736 -0.1761 0.0693  351 GLU C OE2 
3978 N N   . ASN C 270 ? 0.7256 0.5819 0.3804 -0.0797 -0.0912 0.0122  352 ASN C N   
3979 C CA  . ASN C 270 ? 0.7636 0.5916 0.3806 -0.0844 -0.0766 -0.0037 352 ASN C CA  
3980 C C   . ASN C 270 ? 0.7320 0.5529 0.3535 -0.0994 -0.0831 -0.0189 352 ASN C C   
3981 O O   . ASN C 270 ? 0.7851 0.5829 0.3682 -0.1112 -0.0835 -0.0337 352 ASN C O   
3982 C CB  . ASN C 270 ? 0.7954 0.6126 0.4171 -0.0700 -0.0510 -0.0042 352 ASN C CB  
3983 C CG  . ASN C 270 ? 0.8284 0.6496 0.4358 -0.0603 -0.0410 0.0066  352 ASN C CG  
3984 O OD1 . ASN C 270 ? 0.8385 0.6589 0.4163 -0.0648 -0.0482 0.0122  352 ASN C OD1 
3985 N ND2 . ASN C 270 ? 0.8331 0.6624 0.4618 -0.0480 -0.0247 0.0104  352 ASN C ND2 
3986 N N   . ILE C 271 ? 0.6976 0.5379 0.3651 -0.1008 -0.0872 -0.0169 353 ILE C N   
3987 C CA  . ILE C 271 ? 0.7666 0.6035 0.4429 -0.1187 -0.0920 -0.0295 353 ILE C CA  
3988 C C   . ILE C 271 ? 0.8415 0.6945 0.5065 -0.1367 -0.1181 -0.0347 353 ILE C C   
3989 O O   . ILE C 271 ? 0.8987 0.7343 0.5408 -0.1564 -0.1216 -0.0515 353 ILE C O   
3990 C CB  . ILE C 271 ? 0.7938 0.6541 0.5224 -0.1159 -0.0883 -0.0245 353 ILE C CB  
3991 C CG1 . ILE C 271 ? 0.8472 0.6927 0.5804 -0.1336 -0.0816 -0.0360 353 ILE C CG1 
3992 C CG2 . ILE C 271 ? 0.8367 0.7404 0.6045 -0.1162 -0.1092 -0.0160 353 ILE C CG2 
3993 C CD1 . ILE C 271 ? 0.9022 0.7113 0.6208 -0.1249 -0.0552 -0.0377 353 ILE C CD1 
3994 N N   . ARG C 272 ? 0.7889 0.6734 0.4663 -0.1299 -0.1370 -0.0205 354 ARG C N   
3995 C CA  . ARG C 272 ? 0.8021 0.7081 0.4663 -0.1437 -0.1642 -0.0225 354 ARG C CA  
3996 C C   . ARG C 272 ? 0.8307 0.7083 0.4303 -0.1528 -0.1642 -0.0344 354 ARG C C   
3997 O O   . ARG C 272 ? 0.8542 0.7384 0.4338 -0.1728 -0.1820 -0.0483 354 ARG C O   
3998 C CB  . ARG C 272 ? 0.7991 0.7392 0.4865 -0.1291 -0.1824 -0.0006 354 ARG C CB  
3999 C CG  . ARG C 272 ? 0.7787 0.7595 0.5256 -0.1287 -0.1951 0.0035  354 ARG C CG  
4000 C CD  . ARG C 272 ? 0.7322 0.7325 0.5122 -0.1061 -0.2004 0.0246  354 ARG C CD  
4001 N NE  . ARG C 272 ? 0.6740 0.7119 0.5133 -0.1032 -0.2064 0.0248  354 ARG C NE  
4002 C CZ  . ARG C 272 ? 0.6364 0.6932 0.5159 -0.0827 -0.2091 0.0384  354 ARG C CZ  
4003 N NH1 . ARG C 272 ? 0.6140 0.6516 0.4815 -0.0655 -0.2072 0.0541  354 ARG C NH1 
4004 N NH2 . ARG C 272 ? 0.5846 0.6787 0.5168 -0.0802 -0.2123 0.0357  354 ARG C NH2 
4005 N N   . ARG C 273 ? 0.8349 0.6844 0.4011 -0.1392 -0.1446 -0.0308 355 ARG C N   
4006 C CA  . ARG C 273 ? 0.8854 0.7089 0.3880 -0.1465 -0.1416 -0.0444 355 ARG C CA  
4007 C C   . ARG C 273 ? 0.9003 0.6834 0.3816 -0.1586 -0.1255 -0.0706 355 ARG C C   
4008 O O   . ARG C 273 ? 0.9469 0.7121 0.3822 -0.1738 -0.1316 -0.0902 355 ARG C O   
4009 C CB  . ARG C 273 ? 0.9306 0.7428 0.4046 -0.1284 -0.1248 -0.0314 355 ARG C CB  
4010 C CG  . ARG C 273 ? 0.9223 0.7623 0.4250 -0.1147 -0.1327 -0.0032 355 ARG C CG  
4011 C CD  . ARG C 273 ? 0.9235 0.7526 0.3992 -0.1018 -0.1140 0.0095  355 ARG C CD  
4012 N NE  . ARG C 273 ? 0.9059 0.7554 0.3951 -0.0947 -0.1265 0.0364  355 ARG C NE  
4013 C CZ  . ARG C 273 ? 0.8932 0.7388 0.3675 -0.0863 -0.1135 0.0539  355 ARG C CZ  
4014 N NH1 . ARG C 273 ? 0.8578 0.6873 0.3060 -0.0828 -0.0874 0.0464  355 ARG C NH1 
4015 N NH2 . ARG C 273 ? 0.8897 0.7474 0.3769 -0.0811 -0.1259 0.0798  355 ARG C NH2 
4016 N N   . LYS C 274 ? 0.8597 0.6257 0.3710 -0.1518 -0.1052 -0.0714 356 LYS C N   
4017 C CA  . LYS C 274 ? 0.9059 0.6262 0.3971 -0.1611 -0.0881 -0.0928 356 LYS C CA  
4018 C C   . LYS C 274 ? 0.9423 0.6654 0.4468 -0.1904 -0.1048 -0.1083 356 LYS C C   
4019 O O   . LYS C 274 ? 1.0077 0.6961 0.4747 -0.2086 -0.1041 -0.1320 356 LYS C O   
4020 C CB  . LYS C 274 ? 0.8701 0.5728 0.3870 -0.1431 -0.0619 -0.0851 356 LYS C CB  
4021 N N   . PHE C 275 ? 0.9293 0.6946 0.4878 -0.1963 -0.1194 -0.0967 357 PHE C N   
4022 C CA  . PHE C 275 ? 0.9332 0.7071 0.5166 -0.2245 -0.1305 -0.1091 357 PHE C CA  
4023 C C   . PHE C 275 ? 0.9154 0.7454 0.5182 -0.2402 -0.1648 -0.1079 357 PHE C C   
4024 O O   . PHE C 275 ? 0.9208 0.7595 0.5323 -0.2697 -0.1779 -0.1241 357 PHE C O   
4025 C CB  . PHE C 275 ? 0.9334 0.7138 0.5686 -0.2200 -0.1152 -0.0979 357 PHE C CB  
4026 C CG  . PHE C 275 ? 0.9838 0.7100 0.6020 -0.2085 -0.0837 -0.0997 357 PHE C CG  
4027 C CD1 . PHE C 275 ? 1.0481 0.7200 0.6364 -0.2264 -0.0718 -0.1192 357 PHE C CD1 
4028 C CD2 . PHE C 275 ? 0.9846 0.7141 0.6173 -0.1794 -0.0664 -0.0820 357 PHE C CD2 
4029 C CE1 . PHE C 275 ? 1.0710 0.6912 0.6441 -0.2114 -0.0425 -0.1179 357 PHE C CE1 
4030 C CE2 . PHE C 275 ? 0.9808 0.6667 0.5994 -0.1659 -0.0392 -0.0813 357 PHE C CE2 
4031 C CZ  . PHE C 275 ? 1.0047 0.6354 0.5934 -0.1800 -0.0270 -0.0977 357 PHE C CZ  
4032 N N   . GLY C 276 ? 0.8883 0.7564 0.4995 -0.2219 -0.1796 -0.0886 358 GLY C N   
4033 C CA  . GLY C 276 ? 0.8700 0.7912 0.4945 -0.2308 -0.2131 -0.0841 358 GLY C CA  
4034 C C   . GLY C 276 ? 0.8376 0.8120 0.5301 -0.2210 -0.2234 -0.0655 358 GLY C C   
4035 O O   . GLY C 276 ? 0.8337 0.8559 0.5419 -0.2180 -0.2505 -0.0547 358 GLY C O   
4036 N N   . VAL C 277 ? 0.7995 0.7679 0.5313 -0.2139 -0.2023 -0.0609 359 VAL C N   
4037 C CA  . VAL C 277 ? 0.7944 0.8130 0.5904 -0.2040 -0.2088 -0.0465 359 VAL C CA  
4038 C C   . VAL C 277 ? 0.7585 0.7604 0.5743 -0.1804 -0.1827 -0.0352 359 VAL C C   
4039 O O   . VAL C 277 ? 0.8103 0.7671 0.6012 -0.1780 -0.1586 -0.0405 359 VAL C O   
4040 C CB  . VAL C 277 ? 0.8083 0.8595 0.6459 -0.2308 -0.2154 -0.0577 359 VAL C CB  
4041 C CG1 . VAL C 277 ? 0.8308 0.9233 0.6661 -0.2516 -0.2491 -0.0657 359 VAL C CG1 
4042 C CG2 . VAL C 277 ? 0.8312 0.8326 0.6526 -0.2504 -0.1903 -0.0734 359 VAL C CG2 
4043 N N   . PHE C 278 ? 0.7085 0.7483 0.5691 -0.1615 -0.1883 -0.0202 360 PHE C N   
4044 C CA  . PHE C 278 ? 0.6852 0.7263 0.5800 -0.1467 -0.1669 -0.0149 360 PHE C CA  
4045 C C   . PHE C 278 ? 0.7022 0.8000 0.6551 -0.1382 -0.1801 -0.0069 360 PHE C C   
4046 O O   . PHE C 278 ? 0.7456 0.8635 0.7073 -0.1220 -0.1974 0.0049  360 PHE C O   
4047 C CB  . PHE C 278 ? 0.6992 0.7112 0.5758 -0.1227 -0.1517 -0.0059 360 PHE C CB  
4048 C CG  . PHE C 278 ? 0.6743 0.6947 0.5861 -0.1078 -0.1331 -0.0026 360 PHE C CG  
4049 C CD1 . PHE C 278 ? 0.6317 0.6843 0.5842 -0.0902 -0.1394 0.0058  360 PHE C CD1 
4050 C CD2 . PHE C 278 ? 0.6804 0.6765 0.5829 -0.1106 -0.1095 -0.0084 360 PHE C CD2 
4051 C CE1 . PHE C 278 ? 0.6208 0.6823 0.6015 -0.0776 -0.1225 0.0052  360 PHE C CE1 
4052 C CE2 . PHE C 278 ? 0.6458 0.6542 0.5759 -0.0972 -0.0938 -0.0057 360 PHE C CE2 
4053 C CZ  . PHE C 278 ? 0.6259 0.6677 0.5940 -0.0818 -0.1002 -0.0006 360 PHE C CZ  
4054 N N   . ASN C 279 ? 0.6329 0.7557 0.6252 -0.1471 -0.1706 -0.0116 361 ASN C N   
4055 C CA  . ASN C 279 ? 0.6005 0.7836 0.6513 -0.1394 -0.1815 -0.0060 361 ASN C CA  
4056 C C   . ASN C 279 ? 0.5685 0.7561 0.6476 -0.1147 -0.1618 -0.0006 361 ASN C C   
4057 O O   . ASN C 279 ? 0.5754 0.7489 0.6548 -0.1186 -0.1382 -0.0051 361 ASN C O   
4058 C CB  . ASN C 279 ? 0.5525 0.7718 0.6326 -0.1685 -0.1856 -0.0153 361 ASN C CB  
4059 C CG  . ASN C 279 ? 0.6759 0.8915 0.7273 -0.1944 -0.2065 -0.0243 361 ASN C CG  
4060 O OD1 . ASN C 279 ? 0.7656 1.0083 0.8158 -0.1888 -0.2333 -0.0193 361 ASN C OD1 
4061 N ND2 . ASN C 279 ? 0.6205 0.8041 0.6487 -0.2231 -0.1954 -0.0379 361 ASN C ND2 
4062 N N   . TYR C 280 ? 0.5651 0.7693 0.6645 -0.0886 -0.1715 0.0090  362 TYR C N   
4063 C CA  . TYR C 280 ? 0.5340 0.7491 0.6656 -0.0657 -0.1558 0.0102  362 TYR C CA  
4064 C C   . TYR C 280 ? 0.5902 0.8617 0.7758 -0.0693 -0.1514 0.0062  362 TYR C C   
4065 O O   . TYR C 280 ? 0.6202 0.9337 0.8307 -0.0836 -0.1677 0.0062  362 TYR C O   
4066 C CB  . TYR C 280 ? 0.4770 0.6891 0.6169 -0.0381 -0.1672 0.0204  362 TYR C CB  
4067 C CG  . TYR C 280 ? 0.5240 0.6811 0.6189 -0.0312 -0.1609 0.0243  362 TYR C CG  
4068 C CD1 . TYR C 280 ? 0.4842 0.6175 0.5754 -0.0203 -0.1397 0.0190  362 TYR C CD1 
4069 C CD2 . TYR C 280 ? 0.5651 0.6986 0.6209 -0.0370 -0.1758 0.0326  362 TYR C CD2 
4070 C CE1 . TYR C 280 ? 0.4667 0.5574 0.5223 -0.0167 -0.1340 0.0221  362 TYR C CE1 
4071 C CE2 . TYR C 280 ? 0.5732 0.6617 0.5909 -0.0321 -0.1677 0.0370  362 TYR C CE2 
4072 C CZ  . TYR C 280 ? 0.5352 0.6039 0.5559 -0.0226 -0.1469 0.0317  362 TYR C CZ  
4073 O OH  . TYR C 280 ? 0.5820 0.6134 0.5705 -0.0201 -0.1389 0.0357  362 TYR C OH  
4074 N N   . SER C 281 ? 0.5896 0.8660 0.7931 -0.0573 -0.1290 0.0021  363 SER C N   
4075 C CA  . SER C 281 ? 0.6017 0.9326 0.8543 -0.0600 -0.1194 -0.0014 363 SER C CA  
4076 C C   . SER C 281 ? 0.5935 0.9627 0.8921 -0.0294 -0.1233 0.0001  363 SER C C   
4077 O O   . SER C 281 ? 0.5285 0.8705 0.8173 -0.0054 -0.1274 0.0026  363 SER C O   
4078 C CB  . SER C 281 ? 0.6190 0.9361 0.8604 -0.0661 -0.0898 -0.0064 363 SER C CB  
4079 O OG  . SER C 281 ? 0.6733 0.9737 0.8929 -0.0971 -0.0847 -0.0069 363 SER C OG  
4080 N N   . PRO C 282 ? 0.6141 1.0468 0.9656 -0.0296 -0.1216 -0.0014 364 PRO C N   
4081 C CA  . PRO C 282 ? 0.5926 1.0608 0.9891 0.0031  -0.1171 -0.0032 364 PRO C CA  
4082 C C   . PRO C 282 ? 0.5655 1.0059 0.9468 0.0184  -0.0903 -0.0126 364 PRO C C   
4083 O O   . PRO C 282 ? 0.5697 0.9833 0.9178 0.0024  -0.0727 -0.0162 364 PRO C O   
4084 C CB  . PRO C 282 ? 0.5909 1.1377 1.0450 -0.0065 -0.1155 -0.0040 364 PRO C CB  
4085 C CG  . PRO C 282 ? 0.5878 1.1309 1.0225 -0.0487 -0.1129 -0.0044 364 PRO C CG  
4086 C CD  . PRO C 282 ? 0.5960 1.0735 0.9715 -0.0599 -0.1271 -0.0016 364 PRO C CD  
4087 N N   . PHE C 283 ? 0.5803 1.0258 0.9849 0.0511  -0.0886 -0.0167 365 PHE C N   
4088 C CA  . PHE C 283 ? 0.5667 0.9933 0.9623 0.0685  -0.0655 -0.0299 365 PHE C CA  
4089 C C   . PHE C 283 ? 0.5428 0.9976 0.9396 0.0543  -0.0397 -0.0367 365 PHE C C   
4090 O O   . PHE C 283 ? 0.5445 1.0563 0.9794 0.0460  -0.0345 -0.0347 365 PHE C O   
4091 C CB  . PHE C 283 ? 0.6080 1.0556 1.0458 0.1045  -0.0665 -0.0355 365 PHE C CB  
4092 C CG  . PHE C 283 ? 0.6394 1.0692 1.0701 0.1236  -0.0445 -0.0534 365 PHE C CG  
4093 C CD1 . PHE C 283 ? 0.6858 1.0539 1.0719 0.1230  -0.0421 -0.0592 365 PHE C CD1 
4094 C CD2 . PHE C 283 ? 0.6433 1.1213 1.1127 0.1421  -0.0263 -0.0659 365 PHE C CD2 
4095 C CE1 . PHE C 283 ? 0.7133 1.0675 1.0917 0.1384  -0.0236 -0.0790 365 PHE C CE1 
4096 C CE2 . PHE C 283 ? 0.6845 1.1460 1.1431 0.1596  -0.0062 -0.0860 365 PHE C CE2 
4097 C CZ  . PHE C 283 ? 0.6961 1.0951 1.1085 0.1568  -0.0060 -0.0933 365 PHE C CZ  
4098 N N   . ARG C 284 ? 0.5336 0.9508 0.8885 0.0505  -0.0236 -0.0428 366 ARG C N   
4099 C CA  . ARG C 284 ? 0.5019 0.9400 0.8497 0.0410  0.0023  -0.0468 366 ARG C CA  
4100 C C   . ARG C 284 ? 0.4790 0.9467 0.8386 0.0111  0.0053  -0.0355 366 ARG C C   
4101 O O   . ARG C 284 ? 0.4583 0.9783 0.8505 0.0074  0.0212  -0.0359 366 ARG C O   
4102 C CB  . ARG C 284 ? 0.5161 0.9948 0.8955 0.0661  0.0202  -0.0609 366 ARG C CB  
4103 C CG  . ARG C 284 ? 0.5511 0.9939 0.9039 0.0874  0.0272  -0.0771 366 ARG C CG  
4104 C CD  . ARG C 284 ? 0.5619 1.0441 0.9416 0.1120  0.0471  -0.0951 366 ARG C CD  
4105 N NE  . ARG C 284 ? 0.5898 1.0550 0.9298 0.1153  0.0646  -0.1091 366 ARG C NE  
4106 C CZ  . ARG C 284 ? 0.6080 1.1066 0.9373 0.1100  0.0880  -0.1109 366 ARG C CZ  
4107 N NH1 . ARG C 284 ? 0.6146 1.1635 0.9729 0.0991  0.0990  -0.0996 366 ARG C NH1 
4108 N NH2 . ARG C 284 ? 0.6432 1.1279 0.9327 0.1143  0.1005  -0.1232 366 ARG C NH2 
4109 N N   . THR C 285 ? 0.4909 0.9243 0.8236 -0.0118 -0.0090 -0.0263 367 THR C N   
4110 C CA  . THR C 285 ? 0.4926 0.9373 0.8255 -0.0446 -0.0036 -0.0180 367 THR C CA  
4111 C C   . THR C 285 ? 0.5121 0.9194 0.7997 -0.0545 0.0183  -0.0144 367 THR C C   
4112 O O   . THR C 285 ? 0.5587 0.9118 0.8014 -0.0523 0.0139  -0.0136 367 THR C O   
4113 C CB  . THR C 285 ? 0.5219 0.9452 0.8441 -0.0655 -0.0284 -0.0127 367 THR C CB  
4114 O OG1 . THR C 285 ? 0.3851 0.8429 0.7448 -0.0533 -0.0520 -0.0130 367 THR C OG1 
4115 C CG2 . THR C 285 ? 0.4056 0.8387 0.7312 -0.1023 -0.0216 -0.0077 367 THR C CG2 
4116 N N   . PRO C 286 ? 0.5062 0.9421 0.8036 -0.0646 0.0422  -0.0103 368 PRO C N   
4117 C CA  . PRO C 286 ? 0.5011 0.9027 0.7533 -0.0684 0.0635  -0.0037 368 PRO C CA  
4118 C C   . PRO C 286 ? 0.5635 0.9097 0.7783 -0.0927 0.0590  0.0060  368 PRO C C   
4119 O O   . PRO C 286 ? 0.5832 0.9335 0.8131 -0.1204 0.0545  0.0105  368 PRO C O   
4120 C CB  . PRO C 286 ? 0.4822 0.9341 0.7594 -0.0762 0.0896  0.0017  368 PRO C CB  
4121 C CG  . PRO C 286 ? 0.4644 0.9810 0.8010 -0.0650 0.0837  -0.0076 368 PRO C CG  
4122 C CD  . PRO C 286 ? 0.4909 0.9967 0.8425 -0.0696 0.0525  -0.0102 368 PRO C CD  
4123 N N   . TYR C 287 ? 0.6128 0.9086 0.7797 -0.0820 0.0604  0.0075  369 TYR C N   
4124 C CA  . TYR C 287 ? 0.6211 0.8606 0.7483 -0.0995 0.0613  0.0164  369 TYR C CA  
4125 C C   . TYR C 287 ? 0.6339 0.8732 0.7597 -0.1218 0.0837  0.0299  369 TYR C C   
4126 O O   . TYR C 287 ? 0.6424 0.9072 0.7701 -0.1143 0.1048  0.0365  369 TYR C O   
4127 C CB  . TYR C 287 ? 0.6203 0.8184 0.7016 -0.0796 0.0639  0.0175  369 TYR C CB  
4128 C CG  . TYR C 287 ? 0.6569 0.7975 0.6971 -0.0917 0.0693  0.0276  369 TYR C CG  
4129 C CD1 . TYR C 287 ? 0.6912 0.7949 0.7185 -0.1043 0.0534  0.0236  369 TYR C CD1 
4130 C CD2 . TYR C 287 ? 0.6779 0.7999 0.6900 -0.0885 0.0908  0.0414  369 TYR C CD2 
4131 C CE1 . TYR C 287 ? 0.7179 0.7651 0.7067 -0.1130 0.0602  0.0302  369 TYR C CE1 
4132 C CE2 . TYR C 287 ? 0.7168 0.7817 0.6922 -0.0957 0.0970  0.0514  369 TYR C CE2 
4133 C CZ  . TYR C 287 ? 0.7381 0.7647 0.7029 -0.1077 0.0823  0.0443  369 TYR C CZ  
4134 O OH  . TYR C 287 ? 0.7955 0.7623 0.7234 -0.1127 0.0902  0.0516  369 TYR C OH  
4135 N N   . THR C 288 ? 0.6450 0.8545 0.7660 -0.1504 0.0798  0.0335  370 THR C N   
4136 C CA  . THR C 288 ? 0.6785 0.8708 0.7920 -0.1748 0.1019  0.0478  370 THR C CA  
4137 C C   . THR C 288 ? 0.7334 0.8479 0.7949 -0.1782 0.1050  0.0541  370 THR C C   
4138 O O   . THR C 288 ? 0.6629 0.7452 0.7043 -0.1717 0.0866  0.0443  370 THR C O   
4139 C CB  . THR C 288 ? 0.6481 0.8703 0.8042 -0.2109 0.0979  0.0453  370 THR C CB  
4140 O OG1 . THR C 288 ? 0.7091 0.9268 0.8732 -0.2186 0.0686  0.0309  370 THR C OG1 
4141 C CG2 . THR C 288 ? 0.5419 0.8440 0.7498 -0.2074 0.1058  0.0449  370 THR C CG2 
4142 N N   . PRO C 289 ? 0.8270 0.9092 0.8650 -0.1863 0.1293  0.0716  371 PRO C N   
4143 C CA  . PRO C 289 ? 0.9139 0.9183 0.9043 -0.1872 0.1340  0.0784  371 PRO C CA  
4144 C C   . PRO C 289 ? 1.0356 1.0039 1.0273 -0.2176 0.1198  0.0658  371 PRO C C   
4145 O O   . PRO C 289 ? 0.9831 0.9804 1.0112 -0.2483 0.1149  0.0597  371 PRO C O   
4146 C CB  . PRO C 289 ? 0.8586 0.8425 0.8325 -0.1932 0.1643  0.1028  371 PRO C CB  
4147 C CG  . PRO C 289 ? 0.7960 0.8517 0.7994 -0.1854 0.1750  0.1079  371 PRO C CG  
4148 C CD  . PRO C 289 ? 0.6381 0.7517 0.6912 -0.1947 0.1552  0.0878  371 PRO C CD  
4149 N N   . ASN C 290 ? 1.2745 1.1835 1.2262 -0.2084 0.1128  0.0604  372 ASN C N   
4150 C CA  . ASN C 290 ? 1.3337 1.2005 1.2751 -0.2343 0.0998  0.0454  372 ASN C CA  
4151 C C   . ASN C 290 ? 1.2899 1.2109 1.2695 -0.2494 0.0732  0.0277  372 ASN C C   
4152 O O   . ASN C 290 ? 1.3111 1.2260 1.3020 -0.2833 0.0638  0.0166  372 ASN C O   
4153 C CB  . ASN C 290 ? 1.4689 1.2867 1.4032 -0.2681 0.1185  0.0527  372 ASN C CB  
4154 C CG  . ASN C 290 ? 1.5580 1.3095 1.4486 -0.2504 0.1437  0.0723  372 ASN C CG  
4155 O OD1 . ASN C 290 ? 1.5762 1.2968 1.4322 -0.2196 0.1417  0.0722  372 ASN C OD1 
4156 N ND2 . ASN C 290 ? 1.5844 1.3163 1.4778 -0.2689 0.1680  0.0911  372 ASN C ND2 
4157 N N   . SER C 291 ? 1.1190 1.0941 1.1193 -0.2245 0.0608  0.0251  373 SER C N   
4158 C CA  . SER C 291 ? 1.0257 1.0542 1.0632 -0.2324 0.0355  0.0122  373 SER C CA  
4159 C C   . SER C 291 ? 0.9944 0.9876 1.0062 -0.2440 0.0143  -0.0024 373 SER C C   
4160 O O   . SER C 291 ? 1.0327 0.9714 0.9992 -0.2309 0.0166  -0.0042 373 SER C O   
4161 C CB  . SER C 291 ? 0.9459 1.0217 1.0017 -0.1988 0.0275  0.0123  373 SER C CB  
4162 O OG  . SER C 291 ? 0.9222 1.0577 1.0233 -0.2037 0.0077  0.0048  373 SER C OG  
4163 N N   . GLN C 292 ? 0.9623 0.9905 1.0029 -0.2689 -0.0060 -0.0133 374 GLN C N   
4164 C CA  . GLN C 292 ? 0.9591 0.9637 0.9747 -0.2809 -0.0290 -0.0286 374 GLN C CA  
4165 C C   . GLN C 292 ? 0.8591 0.9228 0.9020 -0.2727 -0.0588 -0.0338 374 GLN C C   
4166 O O   . GLN C 292 ? 0.8831 0.9327 0.9014 -0.2793 -0.0797 -0.0447 374 GLN C O   
4167 C CB  . GLN C 292 ? 1.0673 1.0444 1.0787 -0.3249 -0.0284 -0.0397 374 GLN C CB  
4168 C CG  . GLN C 292 ? 1.1479 1.0477 1.1222 -0.3320 0.0002  -0.0346 374 GLN C CG  
4169 C CD  . GLN C 292 ? 1.2332 1.0589 1.1485 -0.3284 -0.0022 -0.0472 374 GLN C CD  
4170 O OE1 . GLN C 292 ? 1.3145 1.0853 1.2068 -0.3566 0.0038  -0.0586 374 GLN C OE1 
4171 N NE2 . GLN C 292 ? 1.2139 1.0373 1.1049 -0.2944 -0.0099 -0.0464 374 GLN C NE2 
4172 N N   . TYR C 293 ? 0.7533 0.8801 0.8428 -0.2557 -0.0605 -0.0257 375 TYR C N   
4173 C CA  . TYR C 293 ? 0.6841 0.8697 0.8066 -0.2472 -0.0882 -0.0280 375 TYR C CA  
4174 C C   . TYR C 293 ? 0.6510 0.8087 0.7344 -0.2289 -0.1068 -0.0305 375 TYR C C   
4175 O O   . TYR C 293 ? 0.6622 0.8435 0.7488 -0.2362 -0.1337 -0.0355 375 TYR C O   
4176 C CB  . TYR C 293 ? 0.5998 0.8428 0.7702 -0.2215 -0.0816 -0.0191 375 TYR C CB  
4177 C CG  . TYR C 293 ? 0.5641 0.8625 0.7689 -0.2051 -0.1087 -0.0187 375 TYR C CG  
4178 C CD1 . TYR C 293 ? 0.5857 0.9498 0.8398 -0.2225 -0.1253 -0.0212 375 TYR C CD1 
4179 C CD2 . TYR C 293 ? 0.5362 0.8209 0.7249 -0.1725 -0.1179 -0.0146 375 TYR C CD2 
4180 C CE1 . TYR C 293 ? 0.5636 0.9792 0.8494 -0.2035 -0.1510 -0.0181 375 TYR C CE1 
4181 C CE2 . TYR C 293 ? 0.5171 0.8452 0.7349 -0.1555 -0.1418 -0.0109 375 TYR C CE2 
4182 C CZ  . TYR C 293 ? 0.5358 0.9294 0.8015 -0.1690 -0.1588 -0.0120 375 TYR C CZ  
4183 O OH  . TYR C 293 ? 0.5188 0.9568 0.8137 -0.1483 -0.1834 -0.0058 375 TYR C OH  
4184 N N   . GLN C 294 ? 0.6343 0.7450 0.6801 -0.2058 -0.0929 -0.0261 376 GLN C N   
4185 C CA  . GLN C 294 ? 0.6399 0.7279 0.6517 -0.1878 -0.1068 -0.0260 376 GLN C CA  
4186 C C   . GLN C 294 ? 0.6597 0.7130 0.6287 -0.2087 -0.1198 -0.0370 376 GLN C C   
4187 O O   . GLN C 294 ? 0.6812 0.7332 0.6286 -0.1995 -0.1378 -0.0367 376 GLN C O   
4188 C CB  . GLN C 294 ? 0.6146 0.6650 0.5994 -0.1622 -0.0873 -0.0200 376 GLN C CB  
4189 C CG  . GLN C 294 ? 0.5766 0.6607 0.5947 -0.1362 -0.0821 -0.0124 376 GLN C CG  
4190 C CD  . GLN C 294 ? 0.5908 0.6434 0.5841 -0.1160 -0.0626 -0.0088 376 GLN C CD  
4191 O OE1 . GLN C 294 ? 0.6261 0.6334 0.5774 -0.1168 -0.0553 -0.0099 376 GLN C OE1 
4192 N NE2 . GLN C 294 ? 0.5112 0.5904 0.5309 -0.0973 -0.0539 -0.0059 376 GLN C NE2 
4193 N N   . MET C 295 ? 0.6636 0.6868 0.6177 -0.2368 -0.1104 -0.0470 377 MET C N   
4194 C CA  . MET C 295 ? 0.7618 0.7464 0.6713 -0.2577 -0.1206 -0.0622 377 MET C CA  
4195 C C   . MET C 295 ? 0.8068 0.8293 0.7388 -0.2920 -0.1432 -0.0744 377 MET C C   
4196 O O   . MET C 295 ? 0.8704 0.8603 0.7671 -0.3168 -0.1503 -0.0916 377 MET C O   
4197 C CB  . MET C 295 ? 0.8652 0.7783 0.7357 -0.2650 -0.0944 -0.0680 377 MET C CB  
4198 C CG  . MET C 295 ? 0.9294 0.8042 0.7674 -0.2321 -0.0768 -0.0593 377 MET C CG  
4199 S SD  . MET C 295 ? 1.0661 0.9327 0.8621 -0.2154 -0.0940 -0.0629 377 MET C SD  
4200 C CE  . MET C 295 ? 1.0001 0.9142 0.8308 -0.1821 -0.0983 -0.0435 377 MET C CE  
4201 N N   . LEU C 296 ? 0.7775 0.8703 0.7676 -0.2938 -0.1549 -0.0675 378 LEU C N   
4202 C CA  . LEU C 296 ? 0.8089 0.9494 0.8278 -0.3271 -0.1776 -0.0787 378 LEU C CA  
4203 C C   . LEU C 296 ? 0.8811 1.0405 0.8760 -0.3260 -0.2112 -0.0847 378 LEU C C   
4204 O O   . LEU C 296 ? 0.9055 1.0816 0.8974 -0.2941 -0.2221 -0.0714 378 LEU C O   
4205 C CB  . LEU C 296 ? 0.7676 0.9860 0.8598 -0.3246 -0.1793 -0.0681 378 LEU C CB  
4206 C CG  . LEU C 296 ? 0.7298 0.9481 0.8530 -0.3416 -0.1508 -0.0653 378 LEU C CG  
4207 C CD1 . LEU C 296 ? 0.6973 1.0004 0.8915 -0.3321 -0.1530 -0.0549 378 LEU C CD1 
4208 C CD2 . LEU C 296 ? 0.7485 0.9460 0.8647 -0.3898 -0.1506 -0.0818 378 LEU C CD2 
4209 N N   . LEU C 297 ? 0.9112 1.0664 0.8868 -0.3622 -0.2273 -0.1048 379 LEU C N   
4210 C CA  . LEU C 297 ? 0.9262 1.1072 0.8767 -0.3644 -0.2616 -0.1113 379 LEU C CA  
4211 C C   . LEU C 297 ? 0.8872 1.1604 0.8950 -0.3523 -0.2892 -0.0973 379 LEU C C   
4212 O O   . LEU C 297 ? 0.9037 1.1993 0.8956 -0.3309 -0.3126 -0.0876 379 LEU C O   
4213 C CB  . LEU C 297 ? 0.9604 1.1219 0.8808 -0.4097 -0.2735 -0.1400 379 LEU C CB  
4214 C CG  . LEU C 297 ? 0.9927 1.0556 0.8532 -0.4170 -0.2451 -0.1544 379 LEU C CG  
4215 C CD1 . LEU C 297 ? 1.0013 1.0318 0.8369 -0.4507 -0.2467 -0.1827 379 LEU C CD1 
4216 C CD2 . LEU C 297 ? 0.9706 0.9919 0.7754 -0.3803 -0.2396 -0.1460 379 LEU C CD2 
4217 N N   . ASP C 298 ? 0.8583 1.1857 0.9321 -0.3645 -0.2860 -0.0946 380 ASP C N   
4218 C CA  . ASP C 298 ? 0.8963 1.3121 1.0315 -0.3454 -0.3068 -0.0793 380 ASP C CA  
4219 C C   . ASP C 298 ? 0.9115 1.3496 1.1037 -0.3323 -0.2799 -0.0677 380 ASP C C   
4220 O O   . ASP C 298 ? 0.9228 1.3803 1.1504 -0.3626 -0.2671 -0.0754 380 ASP C O   
4221 C CB  . ASP C 298 ? 0.9719 1.4512 1.1381 -0.3692 -0.3338 -0.0910 380 ASP C CB  
4222 C CG  . ASP C 298 ? 0.9888 1.5479 1.2014 -0.3370 -0.3592 -0.0738 380 ASP C CG  
4223 O OD1 . ASP C 298 ? 0.9552 1.5231 1.1791 -0.3021 -0.3573 -0.0529 380 ASP C OD1 
4224 O OD2 . ASP C 298 ? 1.0318 1.6414 1.2688 -0.3455 -0.3810 -0.0811 380 ASP C OD2 
4225 N N   . PRO C 299 ? 0.9120 1.3466 1.1125 -0.2892 -0.2694 -0.0498 381 PRO C N   
4226 C CA  . PRO C 299 ? 0.8939 1.3532 1.1456 -0.2749 -0.2438 -0.0410 381 PRO C CA  
4227 C C   . PRO C 299 ? 0.9136 1.4665 1.2408 -0.2880 -0.2544 -0.0408 381 PRO C C   
4228 O O   . PRO C 299 ? 0.9270 1.4999 1.2927 -0.2982 -0.2301 -0.0407 381 PRO C O   
4229 C CB  . PRO C 299 ? 0.8663 1.3139 1.1131 -0.2265 -0.2410 -0.0251 381 PRO C CB  
4230 C CG  . PRO C 299 ? 0.8636 1.2569 1.0442 -0.2204 -0.2548 -0.0250 381 PRO C CG  
4231 C CD  . PRO C 299 ? 0.8872 1.3002 1.0534 -0.2533 -0.2815 -0.0372 381 PRO C CD  
4232 N N   . THR C 300 ? 0.9108 1.5257 1.2602 -0.2879 -0.2902 -0.0398 382 THR C N   
4233 C CA  . THR C 300 ? 0.8731 1.5859 1.2970 -0.3028 -0.3036 -0.0410 382 THR C CA  
4234 C C   . THR C 300 ? 0.9051 1.6085 1.3362 -0.3505 -0.2889 -0.0581 382 THR C C   
4235 O O   . THR C 300 ? 0.9106 1.6670 1.4018 -0.3592 -0.2758 -0.0574 382 THR C O   
4236 C CB  . THR C 300 ? 0.8914 1.6429 1.3185 -0.2873 -0.3402 -0.0393 382 THR C CB  
4237 O OG1 . THR C 300 ? 0.9776 1.7017 1.3650 -0.3233 -0.3531 -0.0583 382 THR C OG1 
4238 C CG2 . THR C 300 ? 0.8489 1.5749 1.2380 -0.2484 -0.3555 -0.0231 382 THR C CG2 
4239 N N   . ASN C 301 ? 0.9361 1.5691 1.3059 -0.3803 -0.2886 -0.0732 383 ASN C N   
4240 C CA  . ASN C 301 ? 0.9544 1.5714 1.3251 -0.4254 -0.2813 -0.0914 383 ASN C CA  
4241 C C   . ASN C 301 ? 0.9913 1.5131 1.3061 -0.4491 -0.2539 -0.0995 383 ASN C C   
4242 O O   . ASN C 301 ? 1.0557 1.5122 1.3071 -0.4598 -0.2607 -0.1132 383 ASN C O   
4243 C CB  . ASN C 301 ? 0.9404 1.5699 1.2933 -0.4372 -0.3141 -0.1063 383 ASN C CB  
4244 C CG  . ASN C 301 ? 0.9546 1.5494 1.2947 -0.4839 -0.3073 -0.1281 383 ASN C CG  
4245 O OD1 . ASN C 301 ? 0.9451 1.5454 1.3221 -0.5084 -0.2843 -0.1289 383 ASN C OD1 
4246 N ND2 . ASN C 301 ? 0.9891 1.5439 1.2742 -0.4960 -0.3254 -0.1458 383 ASN C ND2 
4247 N N   . PRO C 302 ? 0.9458 1.4564 1.2808 -0.4553 -0.2209 -0.0907 384 PRO C N   
4248 C CA  . PRO C 302 ? 0.9320 1.3444 1.2123 -0.4704 -0.1916 -0.0948 384 PRO C CA  
4249 C C   . PRO C 302 ? 0.9237 1.2822 1.1730 -0.5116 -0.1913 -0.1156 384 PRO C C   
4250 O O   . PRO C 302 ? 0.9164 1.1844 1.1043 -0.5184 -0.1770 -0.1228 384 PRO C O   
4251 C CB  . PRO C 302 ? 0.9360 1.3614 1.2552 -0.4642 -0.1559 -0.0788 384 PRO C CB  
4252 C CG  . PRO C 302 ? 0.8861 1.3925 1.2556 -0.4245 -0.1653 -0.0650 384 PRO C CG  
4253 C CD  . PRO C 302 ? 0.8833 1.4619 1.2824 -0.4344 -0.2063 -0.0736 384 PRO C CD  
4254 N N   . SER C 303 ? 0.9262 1.3328 1.2147 -0.5343 -0.2056 -0.1257 385 SER C N   
4255 C CA  . SER C 303 ? 0.9995 1.3516 1.2621 -0.5720 -0.2027 -0.1461 385 SER C CA  
4256 C C   . SER C 303 ? 1.0419 1.3303 1.2310 -0.5689 -0.2191 -0.1645 385 SER C C   
4257 O O   . SER C 303 ? 1.1021 1.3185 1.2529 -0.5935 -0.2087 -0.1815 385 SER C O   
4258 C CB  . SER C 303 ? 1.0075 1.4330 1.3295 -0.5967 -0.2195 -0.1544 385 SER C CB  
4259 O OG  . SER C 303 ? 1.0163 1.4879 1.3354 -0.5866 -0.2582 -0.1647 385 SER C OG  
4260 N N   . ALA C 304 ? 1.0118 1.3231 1.1795 -0.5376 -0.2429 -0.1605 386 ALA C N   
4261 C CA  . ALA C 304 ? 1.0681 1.3213 1.1628 -0.5312 -0.2554 -0.1756 386 ALA C CA  
4262 C C   . ALA C 304 ? 1.1070 1.2583 1.1402 -0.5268 -0.2265 -0.1769 386 ALA C C   
4263 O O   . ALA C 304 ? 1.1460 1.2355 1.1175 -0.5280 -0.2283 -0.1938 386 ALA C O   
4264 C CB  . ALA C 304 ? 1.0322 1.3337 1.1193 -0.4959 -0.2841 -0.1650 386 ALA C CB  
4265 N N   . GLY C 305 ? 1.1070 1.2410 1.1549 -0.5198 -0.1992 -0.1597 387 GLY C N   
4266 C CA  . GLY C 305 ? 1.1467 1.1854 1.1385 -0.5132 -0.1715 -0.1593 387 GLY C CA  
4267 C C   . GLY C 305 ? 1.1321 1.1571 1.0896 -0.4658 -0.1727 -0.1461 387 GLY C C   
4268 O O   . GLY C 305 ? 1.0658 1.1530 1.0454 -0.4400 -0.1929 -0.1343 387 GLY C O   
4269 N N   . THR C 306 ? 1.1748 1.1144 1.0788 -0.4503 -0.1483 -0.1467 388 THR C N   
4270 C CA  . THR C 306 ? 1.1100 1.0281 0.9826 -0.4036 -0.1410 -0.1326 388 THR C CA  
4271 C C   . THR C 306 ? 1.1245 0.9856 0.9273 -0.4006 -0.1468 -0.1503 388 THR C C   
4272 O O   . THR C 306 ? 1.1587 0.9862 0.9324 -0.4333 -0.1529 -0.1752 388 THR C O   
4273 C CB  . THR C 306 ? 1.1004 0.9785 0.9747 -0.3814 -0.1053 -0.1146 388 THR C CB  
4274 O OG1 . THR C 306 ? 1.1750 0.9763 1.0188 -0.4034 -0.0830 -0.1252 388 THR C OG1 
4275 C CG2 . THR C 306 ? 1.0395 0.9804 0.9790 -0.3796 -0.0988 -0.0967 388 THR C CG2 
4276 N N   . ALA C 307 ? 1.1033 0.9552 0.8794 -0.3619 -0.1440 -0.1385 389 ALA C N   
4277 C CA  . ALA C 307 ? 1.1662 0.9655 0.8755 -0.3539 -0.1436 -0.1524 389 ALA C CA  
4278 C C   . ALA C 307 ? 1.2715 0.9839 0.9435 -0.3564 -0.1122 -0.1623 389 ALA C C   
4279 O O   . ALA C 307 ? 1.2569 0.9475 0.9449 -0.3406 -0.0865 -0.1464 389 ALA C O   
4280 C CB  . ALA C 307 ? 1.0434 0.8588 0.7399 -0.3133 -0.1456 -0.1343 389 ALA C CB  
4281 N N   . LYS C 308 ? 1.3922 1.0544 1.0125 -0.3749 -0.1144 -0.1891 390 LYS C N   
4282 C CA  . LYS C 308 ? 1.4671 1.0399 1.0499 -0.3781 -0.0852 -0.2017 390 LYS C CA  
4283 C C   . LYS C 308 ? 1.4656 1.0014 1.0172 -0.3335 -0.0616 -0.1885 390 LYS C C   
4284 O O   . LYS C 308 ? 1.4715 0.9616 1.0238 -0.3192 -0.0335 -0.1781 390 LYS C O   
4285 C CB  . LYS C 308 ? 1.5458 1.0809 1.0862 -0.4053 -0.0936 -0.2355 390 LYS C CB  
4286 N N   . GLY D 3   ? 1.3615 0.6028 0.8490 -0.1133 0.0303  0.2802  85  GLY D N   
4287 C CA  . GLY D 3   ? 1.3259 0.5917 0.7967 -0.0759 0.0010  0.2672  85  GLY D CA  
4288 C C   . GLY D 3   ? 1.2770 0.6169 0.7493 -0.0679 0.0003  0.2631  85  GLY D C   
4289 O O   . GLY D 3   ? 1.2787 0.6262 0.7111 -0.0336 -0.0140 0.2685  85  GLY D O   
4290 N N   . ARG D 4   ? 1.2145 0.6112 0.7350 -0.0981 0.0141  0.2512  86  ARG D N   
4291 C CA  . ARG D 4   ? 1.1248 0.5839 0.6481 -0.0932 0.0205  0.2466  86  ARG D CA  
4292 C C   . ARG D 4   ? 1.0007 0.5300 0.5792 -0.0928 0.0047  0.2153  86  ARG D C   
4293 O O   . ARG D 4   ? 0.9762 0.5522 0.5610 -0.0896 0.0112  0.2086  86  ARG D O   
4294 C CB  . ARG D 4   ? 1.1025 0.5693 0.6311 -0.1232 0.0575  0.2646  86  ARG D CB  
4295 N N   . ASN D 5   ? 0.9997 0.5331 0.6135 -0.0952 -0.0137 0.1964  87  ASN D N   
4296 C CA  . ASN D 5   ? 0.9323 0.5270 0.5938 -0.0963 -0.0258 0.1712  87  ASN D CA  
4297 C C   . ASN D 5   ? 0.9129 0.5060 0.5802 -0.0770 -0.0510 0.1529  87  ASN D C   
4298 O O   . ASN D 5   ? 0.9533 0.4981 0.5983 -0.0654 -0.0588 0.1564  87  ASN D O   
4299 C CB  . ASN D 5   ? 0.9089 0.5321 0.6227 -0.1287 -0.0163 0.1653  87  ASN D CB  
4300 C CG  . ASN D 5   ? 0.9300 0.5833 0.6580 -0.1447 0.0095  0.1779  87  ASN D CG  
4301 O OD1 . ASN D 5   ? 0.9183 0.6265 0.6796 -0.1437 0.0119  0.1682  87  ASN D OD1 
4302 N ND2 . ASN D 5   ? 0.9605 0.5769 0.6650 -0.1591 0.0318  0.2004  87  ASN D ND2 
4303 N N   . ASP D 6   ? 0.8506 0.4957 0.5484 -0.0727 -0.0606 0.1340  88  ASP D N   
4304 C CA  . ASP D 6   ? 0.8479 0.5052 0.5629 -0.0612 -0.0782 0.1150  88  ASP D CA  
4305 C C   . ASP D 6   ? 0.8194 0.4532 0.5492 -0.0780 -0.0794 0.1079  88  ASP D C   
4306 O O   . ASP D 6   ? 0.8047 0.4253 0.5434 -0.1038 -0.0689 0.1148  88  ASP D O   
4307 C CB  . ASP D 6   ? 0.8176 0.5309 0.5623 -0.0612 -0.0813 0.1007  88  ASP D CB  
4308 C CG  . ASP D 6   ? 0.8118 0.5435 0.5667 -0.0447 -0.0961 0.0842  88  ASP D CG  
4309 O OD1 . ASP D 6   ? 0.8581 0.5660 0.6011 -0.0297 -0.1046 0.0817  88  ASP D OD1 
4310 O OD2 . ASP D 6   ? 0.7896 0.5592 0.5660 -0.0463 -0.0967 0.0744  88  ASP D OD2 
4311 N N   . PHE D 7   ? 0.8331 0.4640 0.5661 -0.0644 -0.0917 0.0919  89  PHE D N   
4312 C CA  . PHE D 7   ? 0.8842 0.4967 0.6263 -0.0795 -0.0944 0.0784  89  PHE D CA  
4313 C C   . PHE D 7   ? 0.8332 0.4938 0.6001 -0.0817 -0.1012 0.0605  89  PHE D C   
4314 O O   . PHE D 7   ? 0.8707 0.5240 0.6414 -0.0960 -0.1052 0.0475  89  PHE D O   
4315 C CB  . PHE D 7   ? 0.8193 0.3722 0.5341 -0.0610 -0.0983 0.0741  89  PHE D CB  
4316 N N   . TYR D 8   ? 0.7691 0.4750 0.5491 -0.0699 -0.1024 0.0596  90  TYR D N   
4317 C CA  . TYR D 8   ? 0.7086 0.4535 0.5066 -0.0702 -0.1057 0.0471  90  TYR D CA  
4318 C C   . TYR D 8   ? 0.6949 0.4781 0.5147 -0.0829 -0.1014 0.0545  90  TYR D C   
4319 O O   . TYR D 8   ? 0.7467 0.5398 0.5688 -0.0794 -0.0954 0.0636  90  TYR D O   
4320 C CB  . TYR D 8   ? 0.6783 0.4417 0.4781 -0.0474 -0.1080 0.0395  90  TYR D CB  
4321 C CG  . TYR D 8   ? 0.6924 0.4265 0.4774 -0.0278 -0.1115 0.0313  90  TYR D CG  
4322 C CD1 . TYR D 8   ? 0.7195 0.4225 0.4872 -0.0114 -0.1147 0.0404  90  TYR D CD1 
4323 C CD2 . TYR D 8   ? 0.6832 0.4189 0.4678 -0.0225 -0.1105 0.0152  90  TYR D CD2 
4324 C CE1 . TYR D 8   ? 0.7853 0.4593 0.5412 0.0123  -0.1177 0.0342  90  TYR D CE1 
4325 C CE2 . TYR D 8   ? 0.7052 0.4132 0.4777 -0.0002 -0.1107 0.0060  90  TYR D CE2 
4326 C CZ  . TYR D 8   ? 0.7737 0.4508 0.5346 0.0183  -0.1148 0.0157  90  TYR D CZ  
4327 O OH  . TYR D 8   ? 0.8572 0.5053 0.6081 0.0461  -0.1147 0.0073  90  TYR D OH  
4328 N N   . CYS D 9   ? 0.6600 0.4635