data_5Y41
# 
_entry.id   5Y41 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.325 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5Y41         
WWPDB D_1300004623 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5Y41 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sreekanth, R.' 1 ? 
'Lescar, J.'    2 ? 
'Yoon, H.S.'    3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1552-4469 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'PGE1 and PGA1 bind to Nurr1 and activate its transcriptional function.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41589-020-0553-6 
_citation.pdbx_database_id_PubMed   32451509 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rajan, S.'    1  ?                   
primary 'Jang, Y.'     2  0000-0003-1574-9009 
primary 'Kim, C.H.'    3  ?                   
primary 'Kim, W.'      4  ?                   
primary 'Toh, H.T.'    5  ?                   
primary 'Jeon, J.'     6  ?                   
primary 'Song, B.'     7  ?                   
primary 'Serra, A.'    8  ?                   
primary 'Lescar, J.'   9  ?                   
primary 'Yoo, J.Y.'    10 ?                   
primary 'Beldar, S.'   11 ?                   
primary 'Ye, H.'       12 ?                   
primary 'Kang, C.'     13 ?                   
primary 'Liu, X.W.'    14 ?                   
primary 'Feitosa, M.'  15 ?                   
primary 'Kim, Y.'      16 ?                   
primary 'Hwang, D.'    17 ?                   
primary 'Goh, G.'      18 ?                   
primary 'Lim, K.L.'    19 ?                   
primary 'Park, H.M.'   20 ?                   
primary 'Lee, C.H.'    21 ?                   
primary 'Oh, S.F.'     22 0000-0002-0280-7903 
primary 'Petsko, G.A.' 23 0000-0003-3668-3694 
primary 'Yoon, H.S.'   24 0000-0002-8243-3904 
primary 'Kim, K.S.'    25 0000-0002-6081-9857 
# 
_cell.entry_id           5Y41 
_cell.length_a           88.520 
_cell.length_b           131.460 
_cell.length_c           47.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5Y41 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Nuclear receptor subfamily 4 group A member 2'          30576.256 2   ? ? 'UNP residues 328-598' ? 
2 non-polymer syn '(13E,15S)-15-hydroxy-9-oxoprosta-10,13-dien-1-oic acid' 336.466   2   ? ? ?                      ? 
3 non-polymer syn 'TRIETHYLENE GLYCOL'                                     150.173   1   ? ? ?                      ? 
4 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                  106.120   1   ? ? ?                      ? 
5 non-polymer syn 'CHLORIDE ION'                                           35.453    2   ? ? ?                      ? 
6 non-polymer syn 'MAGNESIUM ION'                                          24.305    1   ? ? ?                      ? 
7 water       nat water                                                    18.015    318 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Immediate-early response protein NOT,Orphan nuclear receptor NURR1,Transcriptionally-inducible nuclear receptor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFY
DLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIV
EFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCT
QGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFY
DLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIV
EFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCT
QGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   LYS n 
1 4   GLU n 
1 5   VAL n 
1 6   VAL n 
1 7   ARG n 
1 8   THR n 
1 9   ASP n 
1 10  SER n 
1 11  LEU n 
1 12  LYS n 
1 13  GLY n 
1 14  ARG n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  LEU n 
1 19  PRO n 
1 20  SER n 
1 21  LYS n 
1 22  PRO n 
1 23  LYS n 
1 24  SER n 
1 25  PRO n 
1 26  GLN n 
1 27  GLU n 
1 28  PRO n 
1 29  SER n 
1 30  PRO n 
1 31  PRO n 
1 32  SER n 
1 33  PRO n 
1 34  PRO n 
1 35  VAL n 
1 36  SER n 
1 37  LEU n 
1 38  ILE n 
1 39  SER n 
1 40  ALA n 
1 41  LEU n 
1 42  VAL n 
1 43  ARG n 
1 44  ALA n 
1 45  HIS n 
1 46  VAL n 
1 47  ASP n 
1 48  SER n 
1 49  ASN n 
1 50  PRO n 
1 51  ALA n 
1 52  MET n 
1 53  THR n 
1 54  SER n 
1 55  LEU n 
1 56  ASP n 
1 57  TYR n 
1 58  SER n 
1 59  ARG n 
1 60  PHE n 
1 61  GLN n 
1 62  ALA n 
1 63  ASN n 
1 64  PRO n 
1 65  ASP n 
1 66  TYR n 
1 67  GLN n 
1 68  MET n 
1 69  SER n 
1 70  GLY n 
1 71  ASP n 
1 72  ASP n 
1 73  THR n 
1 74  GLN n 
1 75  HIS n 
1 76  ILE n 
1 77  GLN n 
1 78  GLN n 
1 79  PHE n 
1 80  TYR n 
1 81  ASP n 
1 82  LEU n 
1 83  LEU n 
1 84  THR n 
1 85  GLY n 
1 86  SER n 
1 87  MET n 
1 88  GLU n 
1 89  ILE n 
1 90  ILE n 
1 91  ARG n 
1 92  GLY n 
1 93  TRP n 
1 94  ALA n 
1 95  GLU n 
1 96  LYS n 
1 97  ILE n 
1 98  PRO n 
1 99  GLY n 
1 100 PHE n 
1 101 ALA n 
1 102 ASP n 
1 103 LEU n 
1 104 PRO n 
1 105 LYS n 
1 106 ALA n 
1 107 ASP n 
1 108 GLN n 
1 109 ASP n 
1 110 LEU n 
1 111 LEU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 PHE n 
1 117 LEU n 
1 118 GLU n 
1 119 LEU n 
1 120 PHE n 
1 121 VAL n 
1 122 LEU n 
1 123 ARG n 
1 124 LEU n 
1 125 ALA n 
1 126 TYR n 
1 127 ARG n 
1 128 SER n 
1 129 ASN n 
1 130 PRO n 
1 131 VAL n 
1 132 GLU n 
1 133 GLY n 
1 134 LYS n 
1 135 LEU n 
1 136 ILE n 
1 137 PHE n 
1 138 CYS n 
1 139 ASN n 
1 140 GLY n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 HIS n 
1 145 ARG n 
1 146 LEU n 
1 147 GLN n 
1 148 CYS n 
1 149 VAL n 
1 150 ARG n 
1 151 GLY n 
1 152 PHE n 
1 153 GLY n 
1 154 GLU n 
1 155 TRP n 
1 156 ILE n 
1 157 ASP n 
1 158 SER n 
1 159 ILE n 
1 160 VAL n 
1 161 GLU n 
1 162 PHE n 
1 163 SER n 
1 164 SER n 
1 165 ASN n 
1 166 LEU n 
1 167 GLN n 
1 168 ASN n 
1 169 MET n 
1 170 ASN n 
1 171 ILE n 
1 172 ASP n 
1 173 ILE n 
1 174 SER n 
1 175 ALA n 
1 176 PHE n 
1 177 SER n 
1 178 CYS n 
1 179 ILE n 
1 180 ALA n 
1 181 ALA n 
1 182 LEU n 
1 183 ALA n 
1 184 MET n 
1 185 VAL n 
1 186 THR n 
1 187 GLU n 
1 188 ARG n 
1 189 HIS n 
1 190 GLY n 
1 191 LEU n 
1 192 LYS n 
1 193 GLU n 
1 194 PRO n 
1 195 LYS n 
1 196 ARG n 
1 197 VAL n 
1 198 GLU n 
1 199 GLU n 
1 200 LEU n 
1 201 GLN n 
1 202 ASN n 
1 203 LYS n 
1 204 ILE n 
1 205 VAL n 
1 206 ASN n 
1 207 CYS n 
1 208 LEU n 
1 209 LYS n 
1 210 ASP n 
1 211 HIS n 
1 212 VAL n 
1 213 THR n 
1 214 PHE n 
1 215 ASN n 
1 216 ASN n 
1 217 GLY n 
1 218 GLY n 
1 219 LEU n 
1 220 ASN n 
1 221 ARG n 
1 222 PRO n 
1 223 ASN n 
1 224 TYR n 
1 225 LEU n 
1 226 SER n 
1 227 LYS n 
1 228 LEU n 
1 229 LEU n 
1 230 GLY n 
1 231 LYS n 
1 232 LEU n 
1 233 PRO n 
1 234 GLU n 
1 235 LEU n 
1 236 ARG n 
1 237 THR n 
1 238 LEU n 
1 239 CYS n 
1 240 THR n 
1 241 GLN n 
1 242 GLY n 
1 243 LEU n 
1 244 GLN n 
1 245 ARG n 
1 246 ILE n 
1 247 PHE n 
1 248 TYR n 
1 249 LEU n 
1 250 LYS n 
1 251 LEU n 
1 252 GLU n 
1 253 ASP n 
1 254 LEU n 
1 255 VAL n 
1 256 PRO n 
1 257 PRO n 
1 258 PRO n 
1 259 ALA n 
1 260 ILE n 
1 261 ILE n 
1 262 ASP n 
1 263 LYS n 
1 264 LEU n 
1 265 PHE n 
1 266 LEU n 
1 267 ASP n 
1 268 THR n 
1 269 LEU n 
1 270 PRO n 
1 271 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   271 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR4A2, NOT, NURR1, TINUR' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-SUMO 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NR4A2_HUMAN 
_struct_ref.pdbx_db_accession          P43354 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFY
DLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIV
EFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCT
QGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
;
_struct_ref.pdbx_align_begin           328 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5Y41 A 1 ? 271 ? P43354 328 ? 598 ? 328 598 
2 1 5Y41 B 1 ? 271 ? P43354 328 ? 598 ? 328 598 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                  ?                         'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                 ?                         'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                               ?                         'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                          ?                         'C4 H7 N O4'     
133.103 
CL  non-polymer         . 'CHLORIDE ION'                                           ?                         'Cl -1'          
35.453  
CYS 'L-peptide linking' y CYSTEINE                                                 ?                         'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                ?                         'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                          ?                         'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                  ?                         'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                ?                         'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                    ?                         'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                               ?                         'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                  ?                         'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                   ?                         'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                               ?                         'C5 H11 N O2 S'  
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                          ?                         'Mg 2'           
24.305  
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                                  ?                         'C4 H10 O3'      
106.120 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'                                     ?                         'C6 H14 O4'      
150.173 
PHE 'L-peptide linking' y PHENYLALANINE                                            ?                         'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                  ?                         'C5 H9 N O2'     
115.130 
RPG non-polymer         . '(13E,15S)-15-hydroxy-9-oxoprosta-10,13-dien-1-oic acid' 'PROSTAGLANDIN A1 (PGA1)' 'C20 H32 O4'     
336.466 
SER 'L-peptide linking' y SERINE                                                   ?                         'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                ?                         'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                               ?                         'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                 ?                         'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                   ?                         'C5 H11 N O2'    
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5Y41 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.14 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, MES pH 5.5 and MgCl2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-09-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00003 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00003 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5Y41 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.05 
_reflns.d_resolution_low                 75 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       35308 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.8 
_reflns.pdbx_Rmerge_I_obs                0.071 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.05 
_reflns_shell.d_res_low                   2.16 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5050 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.616 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5Y41 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     34059 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.05 
_refine.ls_percent_reflns_obs                    99.40 
_refine.ls_R_factor_obs                          0.20719 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20571 
_refine.ls_R_factor_R_free                       0.25288 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.0 
_refine.ls_number_reflns_R_free                  1071 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.918 
_refine.B_iso_mean                               40.897 
_refine.aniso_B[1][1]                            -0.20 
_refine.aniso_B[2][2]                            -1.19 
_refine.aniso_B[3][3]                            1.39 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1OVL 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.205 
_refine.pdbx_overall_ESU_R_Free                  0.182 
_refine.overall_SU_ML                            0.174 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.609 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3696 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         68 
_refine_hist.number_atoms_solvent             318 
_refine_hist.number_atoms_total               4082 
_refine_hist.d_res_high                       2.05 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.019  ? 3839 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.786  1.991  ? 5186 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.291  5.000  ? 460  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.519 24.318 ? 176  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.743 15.000 ? 660  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.205 15.000 ? 24   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.113  0.200  ? 588  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.021  ? 2868 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.071  2.197  ? 1852 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.738  3.284  ? 2308 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.913  2.489  ? 1987 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       6.459  32.115 ? 5936 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? 0.10 0.05 ? ? A 14694 'interatomic distance' 
'X-RAY DIFFRACTION' 2 1 2 ? 0.10 0.05 ? ? B 14694 'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.050 
_refine_ls_shell.d_res_low                        2.103 
_refine_ls_shell.number_reflns_R_work             2393 
_refine_ls_shell.R_factor_R_work                  0.501 
_refine_ls_shell.percent_reflns_obs               98.33 
_refine_ls_shell.R_factor_R_free                  0.417 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             83 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 362 A 598 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 362 B 598 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     5Y41 
_struct.title                        'Crystal Structure of LIGAND-BOUND NURR1-LBD' 
_struct.pdbx_descriptor              'Nuclear receptor subfamily 4 group A member 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5Y41 
_struct_keywords.text            'Nurr1, LBD, Prostaglandin, TRANSCRIPTION, MICHAEL ADDITION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 2 ? 
I N N 5 ? 
J N N 7 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 36  ? ASP A 47  ? SER A 363 ASP A 374 1 ? 12 
HELX_P HELX_P2  AA2 ALA A 51  ? LEU A 55  ? ALA A 378 LEU A 382 5 ? 5  
HELX_P HELX_P3  AA3 ASP A 72  ? LYS A 96  ? ASP A 399 LYS A 423 1 ? 25 
HELX_P HELX_P4  AA4 PRO A 104 ? SER A 128 ? PRO A 431 SER A 455 1 ? 25 
HELX_P HELX_P5  AA5 ASN A 129 ? GLU A 132 ? ASN A 456 GLU A 459 5 ? 4  
HELX_P HELX_P6  AA6 ARG A 145 ? GLY A 153 ? ARG A 472 GLY A 480 1 ? 9  
HELX_P HELX_P7  AA7 GLU A 154 ? ASN A 168 ? GLU A 481 ASN A 495 1 ? 15 
HELX_P HELX_P8  AA8 ASP A 172 ? VAL A 185 ? ASP A 499 VAL A 512 1 ? 14 
HELX_P HELX_P9  AA9 GLU A 193 ? ASN A 216 ? GLU A 520 ASN A 543 1 ? 24 
HELX_P HELX_P10 AB1 ARG A 221 ? GLY A 230 ? ARG A 548 GLY A 557 1 ? 10 
HELX_P HELX_P11 AB2 GLY A 230 ? ASP A 253 ? GLY A 557 ASP A 580 1 ? 24 
HELX_P HELX_P12 AB3 PRO A 258 ? LEU A 269 ? PRO A 585 LEU A 596 1 ? 12 
HELX_P HELX_P13 AB4 SER B 36  ? ASP B 47  ? SER B 363 ASP B 374 1 ? 12 
HELX_P HELX_P14 AB5 ALA B 51  ? LEU B 55  ? ALA B 378 LEU B 382 5 ? 5  
HELX_P HELX_P15 AB6 THR B 73  ? LYS B 96  ? THR B 400 LYS B 423 1 ? 24 
HELX_P HELX_P16 AB7 GLY B 99  ? LEU B 103 ? GLY B 426 LEU B 430 5 ? 5  
HELX_P HELX_P17 AB8 PRO B 104 ? SER B 128 ? PRO B 431 SER B 455 1 ? 25 
HELX_P HELX_P18 AB9 ASN B 129 ? GLU B 132 ? ASN B 456 GLU B 459 5 ? 4  
HELX_P HELX_P19 AC1 ARG B 145 ? GLY B 153 ? ARG B 472 GLY B 480 1 ? 9  
HELX_P HELX_P20 AC2 GLU B 154 ? ASN B 168 ? GLU B 481 ASN B 495 1 ? 15 
HELX_P HELX_P21 AC3 ASP B 172 ? VAL B 185 ? ASP B 499 VAL B 512 1 ? 14 
HELX_P HELX_P22 AC4 GLU B 193 ? ASN B 216 ? GLU B 520 ASN B 543 1 ? 24 
HELX_P HELX_P23 AC5 ARG B 221 ? ASP B 253 ? ARG B 548 ASP B 580 1 ? 33 
HELX_P HELX_P24 AC6 PRO B 258 ? LEU B 269 ? PRO B 585 LEU B 596 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale none ? A CYS 239 SG  ? ? ? 1_555 C RPG . C11 ? ? A CYS 566 A RPG 601 1_555 ? ? ? ? ? ? ? 1.643 ? 
metalc1 metalc ?    ? A PHE 271 O   ? ? ? 1_555 G MG  . MG  ? ? A PHE 598 A MG  605 1_555 ? ? ? ? ? ? ? 2.217 ? 
covale2 covale none ? B CYS 239 SG  ? ? ? 1_555 H RPG . C11 ? ? B CYS 566 B RPG 601 1_555 ? ? ? ? ? ? ? 1.616 ? 
metalc2 metalc ?    ? G MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  605 A HOH 736 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc3 metalc ?    ? G MG  .   MG  ? ? ? 1_555 J HOH . O   ? ? A MG  605 A HOH 784 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc4 metalc ?    ? B ASP 267 OD1 ? ? ? 1_555 G MG  . MG  ? ? B ASP 594 A MG  605 4_544 ? ? ? ? ? ? ? 2.179 ? 
metalc5 metalc ?    ? G MG  .   MG  ? ? ? 1_555 K HOH . O   ? ? A MG  605 B HOH 729 3_554 ? ? ? ? ? ? ? 1.930 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 134 ? ILE A 136 ? LYS A 461 ILE A 463 
AA1 2 VAL A 142 ? HIS A 144 ? VAL A 469 HIS A 471 
AA2 1 LYS B 134 ? ILE B 136 ? LYS B 461 ILE B 463 
AA2 2 VAL B 142 ? HIS B 144 ? VAL B 469 HIS B 471 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 135 ? N LEU A 462 O LEU A 143 ? O LEU A 470 
AA2 1 2 N LEU B 135 ? N LEU B 462 O LEU B 143 ? O LEU B 470 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A RPG 601 ? 13 'binding site for residue RPG A 601'                  
AC2 Software A PGE 602 ? 12 'binding site for residue PGE A 602'                  
AC3 Software A CL  604 ? 6  'binding site for residue CL A 604'                   
AC4 Software A MG  605 ? 6  'binding site for residue MG A 605'                   
AC5 Software B CL  602 ? 6  'binding site for residue CL B 602'                   
AC6 Software B RPG 601 ? 17 'binding site for Di-peptide RPG B 601 and CYS B 566' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 GLU A 113 ? GLU A 440 . ? 1_555 ? 
2  AC1 13 SER A 114 ? SER A 441 . ? 1_555 ? 
3  AC1 13 PHE A 116 ? PHE A 443 . ? 1_555 ? 
4  AC1 13 LEU A 117 ? LEU A 444 . ? 1_555 ? 
5  AC1 13 ARG A 236 ? ARG A 563 . ? 1_555 ? 
6  AC1 13 CYS A 239 ? CYS A 566 . ? 1_555 ? 
7  AC1 13 THR A 240 ? THR A 567 . ? 1_555 ? 
8  AC1 13 LEU A 264 ? LEU A 591 . ? 1_555 ? 
9  AC1 13 PHE A 265 ? PHE A 592 . ? 1_555 ? 
10 AC1 13 THR A 268 ? THR A 595 . ? 1_555 ? 
11 AC1 13 PRO A 270 ? PRO A 597 . ? 1_555 ? 
12 AC1 13 HOH J .   ? HOH A 799 . ? 1_555 ? 
13 AC1 13 ALA B 259 ? ALA B 586 . ? 4_444 ? 
14 AC2 12 ASP A 172 ? ASP A 499 . ? 1_555 ? 
15 AC2 12 ILE A 173 ? ILE A 500 . ? 1_555 ? 
16 AC2 12 SER A 174 ? SER A 501 . ? 1_555 ? 
17 AC2 12 HIS A 211 ? HIS A 538 . ? 1_555 ? 
18 AC2 12 PHE A 214 ? PHE A 541 . ? 1_555 ? 
19 AC2 12 ASN A 215 ? ASN A 542 . ? 1_555 ? 
20 AC2 12 HOH J .   ? HOH A 733 . ? 1_555 ? 
21 AC2 12 ILE B 38  ? ILE B 365 . ? 1_555 ? 
22 AC2 12 SER B 39  ? SER B 366 . ? 1_555 ? 
23 AC2 12 SER B 174 ? SER B 501 . ? 1_555 ? 
24 AC2 12 HIS B 211 ? HIS B 538 . ? 1_555 ? 
25 AC2 12 PHE B 214 ? PHE B 541 . ? 1_555 ? 
26 AC3 6  SER A 86  ? SER A 413 . ? 1_555 ? 
27 AC3 6  ILE A 90  ? ILE A 417 . ? 1_555 ? 
28 AC3 6  ARG A 123 ? ARG A 450 . ? 1_555 ? 
29 AC3 6  ARG A 127 ? ARG A 454 . ? 1_555 ? 
30 AC3 6  CYS A 138 ? CYS A 465 . ? 1_555 ? 
31 AC3 6  HOH J .   ? HOH A 769 . ? 1_555 ? 
32 AC4 6  PHE A 271 ? PHE A 598 . ? 1_555 ? 
33 AC4 6  HOH J .   ? HOH A 736 . ? 1_555 ? 
34 AC4 6  HOH J .   ? HOH A 784 . ? 1_555 ? 
35 AC4 6  ASP B 267 ? ASP B 594 . ? 4_444 ? 
36 AC4 6  PHE B 271 ? PHE B 598 . ? 3_554 ? 
37 AC4 6  HOH K .   ? HOH B 729 . ? 3_554 ? 
38 AC5 6  SER B 86  ? SER B 413 . ? 1_555 ? 
39 AC5 6  ILE B 90  ? ILE B 417 . ? 1_555 ? 
40 AC5 6  ARG B 123 ? ARG B 450 . ? 1_555 ? 
41 AC5 6  ARG B 127 ? ARG B 454 . ? 1_555 ? 
42 AC5 6  CYS B 138 ? CYS B 465 . ? 1_555 ? 
43 AC5 6  HOH K .   ? HOH B 727 . ? 1_555 ? 
44 AC6 17 GLU B 113 ? GLU B 440 . ? 1_555 ? 
45 AC6 17 SER B 114 ? SER B 441 . ? 1_555 ? 
46 AC6 17 PHE B 116 ? PHE B 443 . ? 1_555 ? 
47 AC6 17 LEU B 117 ? LEU B 444 . ? 1_555 ? 
48 AC6 17 ARG B 188 ? ARG B 515 . ? 1_555 ? 
49 AC6 17 HIS B 189 ? HIS B 516 . ? 1_555 ? 
50 AC6 17 LEU B 235 ? LEU B 562 . ? 1_555 ? 
51 AC6 17 ARG B 236 ? ARG B 563 . ? 1_555 ? 
52 AC6 17 THR B 237 ? THR B 564 . ? 1_555 ? 
53 AC6 17 LEU B 238 ? LEU B 565 . ? 1_555 ? 
54 AC6 17 THR B 240 ? THR B 567 . ? 1_555 ? 
55 AC6 17 GLN B 241 ? GLN B 568 . ? 1_555 ? 
56 AC6 17 GLY B 242 ? GLY B 569 . ? 1_555 ? 
57 AC6 17 LEU B 243 ? LEU B 570 . ? 1_555 ? 
58 AC6 17 ILE B 246 ? ILE B 573 . ? 1_555 ? 
59 AC6 17 THR B 268 ? THR B 595 . ? 1_555 ? 
60 AC6 17 HOH K .   ? HOH B 757 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5Y41 
_atom_sites.fract_transf_matrix[1][1]   0.011297 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007607 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021218 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 35  ? 0.440   -46.593 -10.029 1.00 54.32  ? 362 VAL A N   1 
ATOM   2    C  CA  . VAL A 1 35  ? 1.628   -45.682 -10.112 1.00 51.42  ? 362 VAL A CA  1 
ATOM   3    C  C   . VAL A 1 35  ? 1.287   -44.450 -9.265  1.00 51.96  ? 362 VAL A C   1 
ATOM   4    O  O   . VAL A 1 35  ? 0.220   -43.837 -9.491  1.00 52.83  ? 362 VAL A O   1 
ATOM   5    C  CB  . VAL A 1 35  ? 1.858   -45.259 -11.580 1.00 50.82  ? 362 VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 35  ? 3.160   -44.473 -11.767 1.00 49.57  ? 362 VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 35  ? 1.816   -46.477 -12.507 1.00 51.65  ? 362 VAL A CG2 1 
ATOM   8    N  N   . SER A 1 36  ? 2.141   -44.105 -8.286  1.00 48.56  ? 363 SER A N   1 
ATOM   9    C  CA  . SER A 1 36  ? 1.988   -42.853 -7.527  1.00 45.76  ? 363 SER A CA  1 
ATOM   10   C  C   . SER A 1 36  ? 2.155   -41.604 -8.431  1.00 43.56  ? 363 SER A C   1 
ATOM   11   O  O   . SER A 1 36  ? 2.771   -41.675 -9.512  1.00 41.99  ? 363 SER A O   1 
ATOM   12   C  CB  . SER A 1 36  ? 3.033   -42.823 -6.433  1.00 47.13  ? 363 SER A CB  1 
ATOM   13   O  OG  . SER A 1 36  ? 4.288   -42.475 -6.969  1.00 44.28  ? 363 SER A OG  1 
ATOM   14   N  N   . LEU A 1 37  ? 1.633   -40.464 -7.982  1.00 41.66  ? 364 LEU A N   1 
ATOM   15   C  CA  . LEU A 1 37  ? 1.722   -39.229 -8.771  1.00 39.18  ? 364 LEU A CA  1 
ATOM   16   C  C   . LEU A 1 37  ? 3.175   -38.809 -9.044  1.00 37.63  ? 364 LEU A C   1 
ATOM   17   O  O   . LEU A 1 37  ? 3.549   -38.472 -10.191 1.00 35.07  ? 364 LEU A O   1 
ATOM   18   C  CB  . LEU A 1 37  ? 0.906   -38.085 -8.142  1.00 40.31  ? 364 LEU A CB  1 
ATOM   19   C  CG  . LEU A 1 37  ? 1.006   -36.681 -8.790  1.00 39.21  ? 364 LEU A CG  1 
ATOM   20   C  CD1 . LEU A 1 37  ? 0.577   -36.698 -10.280 1.00 37.90  ? 364 LEU A CD1 1 
ATOM   21   C  CD2 . LEU A 1 37  ? 0.237   -35.610 -7.992  1.00 39.60  ? 364 LEU A CD2 1 
ATOM   22   N  N   . ILE A 1 38  ? 3.996   -38.833 -7.993  1.00 37.07  ? 365 ILE A N   1 
ATOM   23   C  CA  . ILE A 1 38  ? 5.406   -38.471 -8.120  1.00 34.81  ? 365 ILE A CA  1 
ATOM   24   C  C   . ILE A 1 38  ? 6.160   -39.377 -9.092  1.00 33.76  ? 365 ILE A C   1 
ATOM   25   O  O   . ILE A 1 38  ? 6.949   -38.862 -9.901  1.00 33.62  ? 365 ILE A O   1 
ATOM   26   C  CB  . ILE A 1 38  ? 6.113   -38.292 -6.741  1.00 37.59  ? 365 ILE A CB  1 
ATOM   27   C  CG1 . ILE A 1 38  ? 7.397   -37.468 -6.904  1.00 36.90  ? 365 ILE A CG1 1 
ATOM   28   C  CG2 . ILE A 1 38  ? 6.343   -39.630 -6.016  1.00 37.95  ? 365 ILE A CG2 1 
ATOM   29   C  CD1 . ILE A 1 38  ? 7.774   -36.709 -5.635  1.00 38.87  ? 365 ILE A CD1 1 
ATOM   30   N  N   . SER A 1 39  ? 5.878   -40.696 -9.066  1.00 34.13  ? 366 SER A N   1 
ATOM   31   C  CA  . SER A 1 39  ? 6.397   -41.646 -10.052 1.00 32.09  ? 366 SER A CA  1 
ATOM   32   C  C   . SER A 1 39  ? 5.999   -41.274 -11.464 1.00 30.22  ? 366 SER A C   1 
ATOM   33   O  O   . SER A 1 39  ? 6.828   -41.341 -12.364 1.00 29.63  ? 366 SER A O   1 
ATOM   34   C  CB  . SER A 1 39  ? 5.869   -43.076 -9.808  1.00 35.39  ? 366 SER A CB  1 
ATOM   35   O  OG  . SER A 1 39  ? 6.651   -43.764 -8.882  1.00 39.39  ? 366 SER A OG  1 
ATOM   36   N  N   . ALA A 1 40  ? 4.727   -40.925 -11.663 1.00 28.43  ? 367 ALA A N   1 
ATOM   37   C  CA  . ALA A 1 40  ? 4.281   -40.488 -12.964 1.00 27.81  ? 367 ALA A CA  1 
ATOM   38   C  C   . ALA A 1 40  ? 4.988   -39.179 -13.413 1.00 26.00  ? 367 ALA A C   1 
ATOM   39   O  O   . ALA A 1 40  ? 5.335   -39.047 -14.594 1.00 25.79  ? 367 ALA A O   1 
ATOM   40   C  CB  . ALA A 1 40  ? 2.766   -40.362 -13.011 1.00 27.76  ? 367 ALA A CB  1 
ATOM   41   N  N   . LEU A 1 41  ? 5.213   -38.254 -12.473 1.00 25.23  ? 368 LEU A N   1 
ATOM   42   C  CA  . LEU A 1 41  ? 5.918   -37.000 -12.780 1.00 23.90  ? 368 LEU A CA  1 
ATOM   43   C  C   . LEU A 1 41  ? 7.385   -37.263 -13.126 1.00 23.72  ? 368 LEU A C   1 
ATOM   44   O  O   . LEU A 1 41  ? 7.926   -36.618 -14.043 1.00 22.36  ? 368 LEU A O   1 
ATOM   45   C  CB  . LEU A 1 41  ? 5.800   -35.991 -11.618 1.00 24.70  ? 368 LEU A CB  1 
ATOM   46   C  CG  . LEU A 1 41  ? 4.326   -35.498 -11.343 1.00 25.49  ? 368 LEU A CG  1 
ATOM   47   C  CD1 . LEU A 1 41  ? 4.216   -34.665 -10.068 1.00 26.00  ? 368 LEU A CD1 1 
ATOM   48   C  CD2 . LEU A 1 41  ? 3.773   -34.711 -12.536 1.00 24.57  ? 368 LEU A CD2 1 
ATOM   49   N  N   . VAL A 1 42  ? 8.010   -38.222 -12.422 1.00 23.57  ? 369 VAL A N   1 
ATOM   50   C  CA  . VAL A 1 42  ? 9.413   -38.569 -12.694 1.00 24.37  ? 369 VAL A CA  1 
ATOM   51   C  C   . VAL A 1 42  ? 9.530   -39.212 -14.066 1.00 24.81  ? 369 VAL A C   1 
ATOM   52   O  O   . VAL A 1 42  ? 10.429  -38.842 -14.839 1.00 24.40  ? 369 VAL A O   1 
ATOM   53   C  CB  . VAL A 1 42  ? 10.040  -39.436 -11.558 1.00 24.91  ? 369 VAL A CB  1 
ATOM   54   C  CG1 . VAL A 1 42  ? 11.375  -40.045 -12.000 1.00 25.41  ? 369 VAL A CG1 1 
ATOM   55   C  CG2 . VAL A 1 42  ? 10.267  -38.523 -10.331 1.00 25.22  ? 369 VAL A CG2 1 
ATOM   56   N  N   . ARG A 1 43  ? 8.587   -40.104 -14.396 1.00 26.20  ? 370 ARG A N   1 
ATOM   57   C  CA  . ARG A 1 43  ? 8.606   -40.801 -15.677 1.00 28.00  ? 370 ARG A CA  1 
ATOM   58   C  C   . ARG A 1 43  ? 8.425   -39.787 -16.804 1.00 26.31  ? 370 ARG A C   1 
ATOM   59   O  O   . ARG A 1 43  ? 9.140   -39.877 -17.804 1.00 25.13  ? 370 ARG A O   1 
ATOM   60   C  CB  . ARG A 1 43  ? 7.535   -41.903 -15.784 1.00 32.57  ? 370 ARG A CB  1 
ATOM   61   C  CG  . ARG A 1 43  ? 7.490   -42.995 -14.703 1.00 41.51  ? 370 ARG A CG  1 
ATOM   62   C  CD  . ARG A 1 43  ? 8.736   -43.868 -14.486 1.00 45.83  ? 370 ARG A CD  1 
ATOM   63   N  NE  . ARG A 1 43  ? 8.653   -44.813 -13.322 1.00 52.04  ? 370 ARG A NE  1 
ATOM   64   C  CZ  . ARG A 1 43  ? 8.888   -44.488 -12.022 1.00 49.04  ? 370 ARG A CZ  1 
ATOM   65   N  NH1 . ARG A 1 43  ? 9.187   -43.219 -11.681 1.00 52.33  ? 370 ARG A NH1 1 
ATOM   66   N  NH2 . ARG A 1 43  ? 8.805   -45.396 -11.070 1.00 39.22  ? 370 ARG A NH2 1 
ATOM   67   N  N   . ALA A 1 44  ? 7.509   -38.819 -16.624 1.00 24.19  ? 371 ALA A N   1 
ATOM   68   C  CA  . ALA A 1 44  ? 7.241   -37.808 -17.624 1.00 24.94  ? 371 ALA A CA  1 
ATOM   69   C  C   . ALA A 1 44  ? 8.558   -37.048 -17.877 1.00 23.71  ? 371 ALA A C   1 
ATOM   70   O  O   . ALA A 1 44  ? 8.916   -36.815 -19.030 1.00 23.42  ? 371 ALA A O   1 
ATOM   71   C  CB  . ALA A 1 44  ? 6.128   -36.814 -17.136 1.00 24.50  ? 371 ALA A CB  1 
ATOM   72   N  N   . HIS A 1 45  ? 9.254   -36.685 -16.793 1.00 22.98  ? 372 HIS A N   1 
ATOM   73   C  CA  . HIS A 1 45  ? 10.545  -35.999 -16.921 1.00 23.65  ? 372 HIS A CA  1 
ATOM   74   C  C   . HIS A 1 45  ? 11.626  -36.853 -17.624 1.00 24.06  ? 372 HIS A C   1 
ATOM   75   O  O   . HIS A 1 45  ? 12.223  -36.428 -18.650 1.00 24.20  ? 372 HIS A O   1 
ATOM   76   C  CB  . HIS A 1 45  ? 11.049  -35.537 -15.558 1.00 23.00  ? 372 HIS A CB  1 
ATOM   77   C  CG  . HIS A 1 45  ? 12.421  -34.948 -15.628 1.00 23.15  ? 372 HIS A CG  1 
ATOM   78   N  ND1 . HIS A 1 45  ? 12.667  -33.675 -16.101 1.00 22.34  ? 372 HIS A ND1 1 
ATOM   79   C  CD2 . HIS A 1 45  ? 13.637  -35.495 -15.361 1.00 23.70  ? 372 HIS A CD2 1 
ATOM   80   C  CE1 . HIS A 1 45  ? 13.968  -33.444 -16.077 1.00 23.28  ? 372 HIS A CE1 1 
ATOM   81   N  NE2 . HIS A 1 45  ? 14.581  -34.535 -15.644 1.00 23.58  ? 372 HIS A NE2 1 
ATOM   82   N  N   . VAL A 1 46  ? 11.842  -38.061 -17.105 1.00 25.17  ? 373 VAL A N   1 
ATOM   83   C  CA  . VAL A 1 46  ? 12.910  -38.947 -17.639 1.00 25.69  ? 373 VAL A CA  1 
ATOM   84   C  C   . VAL A 1 46  ? 12.671  -39.312 -19.120 1.00 26.93  ? 373 VAL A C   1 
ATOM   85   O  O   . VAL A 1 46  ? 13.609  -39.285 -19.965 1.00 26.33  ? 373 VAL A O   1 
ATOM   86   C  CB  . VAL A 1 46  ? 13.086  -40.180 -16.740 1.00 25.75  ? 373 VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 46  ? 14.036  -41.188 -17.369 1.00 25.78  ? 373 VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 46  ? 13.600  -39.734 -15.373 1.00 24.27  ? 373 VAL A CG2 1 
ATOM   89   N  N   . ASP A 1 47  ? 11.413  -39.593 -19.458 1.00 26.78  ? 374 ASP A N   1 
ATOM   90   C  CA  . ASP A 1 47  ? 11.090  -39.986 -20.827 1.00 28.37  ? 374 ASP A CA  1 
ATOM   91   C  C   . ASP A 1 47  ? 10.951  -38.812 -21.777 1.00 29.33  ? 374 ASP A C   1 
ATOM   92   O  O   . ASP A 1 47  ? 10.643  -39.020 -22.944 1.00 32.00  ? 374 ASP A O   1 
ATOM   93   C  CB  . ASP A 1 47  ? 9.835   -40.846 -20.845 1.00 29.78  ? 374 ASP A CB  1 
ATOM   94   C  CG  . ASP A 1 47  ? 10.073  -42.224 -20.246 1.00 32.34  ? 374 ASP A CG  1 
ATOM   95   O  OD1 . ASP A 1 47  ? 11.264  -42.668 -20.189 1.00 33.86  ? 374 ASP A OD1 1 
ATOM   96   O  OD2 . ASP A 1 47  ? 9.078   -42.885 -19.892 1.00 32.01  ? 374 ASP A OD2 1 
ATOM   97   N  N   . SER A 1 48  ? 11.188  -37.585 -21.313 1.00 27.05  ? 375 SER A N   1 
ATOM   98   C  CA  . SER A 1 48  ? 11.194  -36.451 -22.244 1.00 27.47  ? 375 SER A CA  1 
ATOM   99   C  C   . SER A 1 48  ? 12.546  -35.706 -22.230 1.00 26.71  ? 375 SER A C   1 
ATOM   100  O  O   . SER A 1 48  ? 12.645  -34.554 -22.649 1.00 27.47  ? 375 SER A O   1 
ATOM   101  C  CB  . SER A 1 48  ? 10.052  -35.487 -21.885 1.00 25.59  ? 375 SER A CB  1 
ATOM   102  O  OG  . SER A 1 48  ? 10.207  -34.960 -20.562 1.00 24.81  ? 375 SER A OG  1 
ATOM   103  N  N   . ASN A 1 49  ? 13.576  -36.350 -21.728 1.00 26.72  ? 376 ASN A N   1 
ATOM   104  C  CA  . ASN A 1 49  ? 14.911  -35.744 -21.631 1.00 26.38  ? 376 ASN A CA  1 
ATOM   105  C  C   . ASN A 1 49  ? 15.921  -36.678 -22.272 1.00 27.26  ? 376 ASN A C   1 
ATOM   106  O  O   . ASN A 1 49  ? 15.734  -37.881 -22.248 1.00 27.78  ? 376 ASN A O   1 
ATOM   107  C  CB  . ASN A 1 49  ? 15.255  -35.415 -20.190 1.00 25.24  ? 376 ASN A CB  1 
ATOM   108  C  CG  . ASN A 1 49  ? 14.609  -34.105 -19.750 1.00 26.75  ? 376 ASN A CG  1 
ATOM   109  O  OD1 . ASN A 1 49  ? 15.140  -33.056 -20.059 1.00 26.55  ? 376 ASN A OD1 1 
ATOM   110  N  ND2 . ASN A 1 49  ? 13.443  -34.150 -19.081 1.00 25.07  ? 376 ASN A ND2 1 
ATOM   111  N  N   . PRO A 1 50  ? 16.996  -36.132 -22.844 1.00 28.02  ? 377 PRO A N   1 
ATOM   112  C  CA  . PRO A 1 50  ? 17.997  -37.072 -23.394 1.00 28.70  ? 377 PRO A CA  1 
ATOM   113  C  C   . PRO A 1 50  ? 18.720  -37.810 -22.254 1.00 29.43  ? 377 PRO A C   1 
ATOM   114  O  O   . PRO A 1 50  ? 18.726  -37.362 -21.094 1.00 30.79  ? 377 PRO A O   1 
ATOM   115  C  CB  . PRO A 1 50  ? 19.006  -36.148 -24.084 1.00 28.73  ? 377 PRO A CB  1 
ATOM   116  C  CG  . PRO A 1 50  ? 18.920  -34.877 -23.270 1.00 28.52  ? 377 PRO A CG  1 
ATOM   117  C  CD  . PRO A 1 50  ? 17.448  -34.726 -22.920 1.00 26.31  ? 377 PRO A CD  1 
ATOM   118  N  N   . ALA A 1 51  ? 19.245  -38.957 -22.572 1.00 30.22  ? 378 ALA A N   1 
ATOM   119  C  CA  . ALA A 1 51  ? 19.885  -39.804 -21.594 1.00 31.66  ? 378 ALA A CA  1 
ATOM   120  C  C   . ALA A 1 51  ? 21.388  -39.453 -21.564 1.00 31.80  ? 378 ALA A C   1 
ATOM   121  O  O   . ALA A 1 51  ? 22.023  -39.304 -22.600 1.00 30.74  ? 378 ALA A O   1 
ATOM   122  C  CB  . ALA A 1 51  ? 19.705  -41.265 -22.007 1.00 31.47  ? 378 ALA A CB  1 
ATOM   123  N  N   . MET A 1 52  ? 21.929  -39.319 -20.358 1.00 33.15  ? 379 MET A N   1 
ATOM   124  C  CA  . MET A 1 52  ? 23.364  -39.175 -20.146 1.00 37.00  ? 379 MET A CA  1 
ATOM   125  C  C   . MET A 1 52  ? 24.189  -40.230 -20.917 1.00 37.32  ? 379 MET A C   1 
ATOM   126  O  O   . MET A 1 52  ? 25.267  -39.972 -21.323 1.00 36.78  ? 379 MET A O   1 
ATOM   127  C  CB  . MET A 1 52  ? 23.656  -39.246 -18.645 1.00 40.85  ? 379 MET A CB  1 
ATOM   128  C  CG  . MET A 1 52  ? 25.123  -39.271 -18.282 1.00 48.18  ? 379 MET A CG  1 
ATOM   129  S  SD  . MET A 1 52  ? 25.562  -37.560 -18.019 1.00 58.71  ? 379 MET A SD  1 
ATOM   130  C  CE  . MET A 1 52  ? 25.527  -37.601 -16.217 1.00 53.07  ? 379 MET A CE  1 
ATOM   131  N  N   . THR A 1 53  ? 23.644  -41.427 -21.116 1.00 36.91  ? 380 THR A N   1 
ATOM   132  C  CA  . THR A 1 53  ? 24.360  -42.489 -21.807 1.00 38.91  ? 380 THR A CA  1 
ATOM   133  C  C   . THR A 1 53  ? 24.291  -42.401 -23.327 1.00 39.52  ? 380 THR A C   1 
ATOM   134  O  O   . THR A 1 53  ? 24.955  -43.162 -24.030 1.00 41.05  ? 380 THR A O   1 
ATOM   135  C  CB  . THR A 1 53  ? 23.904  -43.880 -21.331 1.00 39.24  ? 380 THR A CB  1 
ATOM   136  O  OG1 . THR A 1 53  ? 22.495  -44.039 -21.564 1.00 38.69  ? 380 THR A OG1 1 
ATOM   137  C  CG2 . THR A 1 53  ? 24.260  -44.049 -19.880 1.00 38.33  ? 380 THR A CG2 1 
ATOM   138  N  N   . SER A 1 54  ? 23.462  -41.524 -23.863 1.00 38.38  ? 381 SER A N   1 
ATOM   139  C  CA  . SER A 1 54  ? 23.517  -41.271 -25.317 1.00 41.23  ? 381 SER A CA  1 
ATOM   140  C  C   . SER A 1 54  ? 23.441  -39.782 -25.712 1.00 40.61  ? 381 SER A C   1 
ATOM   141  O  O   . SER A 1 54  ? 22.526  -39.320 -26.418 1.00 41.40  ? 381 SER A O   1 
ATOM   142  C  CB  . SER A 1 54  ? 22.476  -42.093 -26.063 1.00 42.25  ? 381 SER A CB  1 
ATOM   143  O  OG  . SER A 1 54  ? 21.210  -41.858 -25.502 1.00 39.55  ? 381 SER A OG  1 
ATOM   144  N  N   . LEU A 1 55  ? 24.416  -39.022 -25.212 1.00 38.57  ? 382 LEU A N   1 
ATOM   145  C  CA  . LEU A 1 55  ? 24.609  -37.609 -25.555 1.00 37.02  ? 382 LEU A CA  1 
ATOM   146  C  C   . LEU A 1 55  ? 25.323  -37.528 -26.888 1.00 39.22  ? 382 LEU A C   1 
ATOM   147  O  O   . LEU A 1 55  ? 26.125  -38.417 -27.206 1.00 41.06  ? 382 LEU A O   1 
ATOM   148  C  CB  . LEU A 1 55  ? 25.418  -36.906 -24.445 1.00 35.47  ? 382 LEU A CB  1 
ATOM   149  C  CG  . LEU A 1 55  ? 24.572  -36.653 -23.183 1.00 32.48  ? 382 LEU A CG  1 
ATOM   150  C  CD1 . LEU A 1 55  ? 25.360  -35.895 -22.150 1.00 31.42  ? 382 LEU A CD1 1 
ATOM   151  C  CD2 . LEU A 1 55  ? 23.168  -36.101 -23.458 1.00 29.01  ? 382 LEU A CD2 1 
ATOM   152  N  N   . ASP A 1 56  ? 25.086  -36.456 -27.646 1.00 38.49  ? 383 ASP A N   1 
ATOM   153  C  CA  . ASP A 1 56  ? 25.742  -36.290 -28.933 1.00 40.39  ? 383 ASP A CA  1 
ATOM   154  C  C   . ASP A 1 56  ? 26.783  -35.151 -28.863 1.00 39.89  ? 383 ASP A C   1 
ATOM   155  O  O   . ASP A 1 56  ? 26.425  -33.970 -28.795 1.00 38.24  ? 383 ASP A O   1 
ATOM   156  C  CB  . ASP A 1 56  ? 24.632  -36.040 -29.965 1.00 41.28  ? 383 ASP A CB  1 
ATOM   157  C  CG  . ASP A 1 56  ? 25.147  -35.753 -31.387 1.00 43.70  ? 383 ASP A CG  1 
ATOM   158  O  OD1 . ASP A 1 56  ? 26.354  -35.885 -31.687 1.00 45.35  ? 383 ASP A OD1 1 
ATOM   159  O  OD2 . ASP A 1 56  ? 24.285  -35.370 -32.200 1.00 45.35  ? 383 ASP A OD2 1 
ATOM   160  N  N   . TYR A 1 57  ? 28.048  -35.552 -28.850 1.00 42.36  ? 384 TYR A N   1 
ATOM   161  C  CA  . TYR A 1 57  ? 29.202  -34.645 -28.886 1.00 43.59  ? 384 TYR A CA  1 
ATOM   162  C  C   . TYR A 1 57  ? 29.683  -34.280 -30.268 1.00 44.45  ? 384 TYR A C   1 
ATOM   163  O  O   . TYR A 1 57  ? 30.641  -33.523 -30.363 1.00 47.70  ? 384 TYR A O   1 
ATOM   164  C  CB  . TYR A 1 57  ? 30.378  -35.254 -28.092 1.00 45.27  ? 384 TYR A CB  1 
ATOM   165  C  CG  . TYR A 1 57  ? 30.297  -34.947 -26.615 1.00 45.21  ? 384 TYR A CG  1 
ATOM   166  C  CD1 . TYR A 1 57  ? 30.902  -33.750 -26.135 1.00 46.39  ? 384 TYR A CD1 1 
ATOM   167  C  CD2 . TYR A 1 57  ? 29.670  -35.820 -25.701 1.00 43.76  ? 384 TYR A CD2 1 
ATOM   168  C  CE1 . TYR A 1 57  ? 30.843  -33.438 -24.784 1.00 46.80  ? 384 TYR A CE1 1 
ATOM   169  C  CE2 . TYR A 1 57  ? 29.573  -35.510 -24.345 1.00 45.01  ? 384 TYR A CE2 1 
ATOM   170  C  CZ  . TYR A 1 57  ? 30.217  -34.331 -23.894 1.00 46.52  ? 384 TYR A CZ  1 
ATOM   171  O  OH  . TYR A 1 57  ? 30.157  -33.979 -22.558 1.00 50.44  ? 384 TYR A OH  1 
ATOM   172  N  N   . SER A 1 58  ? 29.008  -34.761 -31.318 1.00 43.99  ? 385 SER A N   1 
ATOM   173  C  CA  . SER A 1 58  ? 29.506  -34.590 -32.716 1.00 46.53  ? 385 SER A CA  1 
ATOM   174  C  C   . SER A 1 58  ? 29.574  -33.136 -33.228 1.00 46.35  ? 385 SER A C   1 
ATOM   175  O  O   . SER A 1 58  ? 30.131  -32.882 -34.277 1.00 49.27  ? 385 SER A O   1 
ATOM   176  C  CB  . SER A 1 58  ? 28.661  -35.404 -33.697 1.00 46.31  ? 385 SER A CB  1 
ATOM   177  O  OG  . SER A 1 58  ? 27.385  -34.814 -33.833 1.00 43.62  ? 385 SER A OG  1 
ATOM   178  N  N   . ARG A 1 59  ? 28.996  -32.192 -32.502 1.00 44.14  ? 386 ARG A N   1 
ATOM   179  C  CA  . ARG A 1 59  ? 28.992  -30.787 -32.916 1.00 44.64  ? 386 ARG A CA  1 
ATOM   180  C  C   . ARG A 1 59  ? 29.674  -29.862 -31.909 1.00 42.84  ? 386 ARG A C   1 
ATOM   181  O  O   . ARG A 1 59  ? 29.790  -28.662 -32.167 1.00 41.92  ? 386 ARG A O   1 
ATOM   182  C  CB  . ARG A 1 59  ? 27.544  -30.325 -33.198 1.00 45.44  ? 386 ARG A CB  1 
ATOM   183  C  CG  . ARG A 1 59  ? 27.110  -30.834 -34.579 1.00 50.50  ? 386 ARG A CG  1 
ATOM   184  C  CD  . ARG A 1 59  ? 26.014  -30.044 -35.229 1.00 52.31  ? 386 ARG A CD  1 
ATOM   185  N  NE  . ARG A 1 59  ? 24.724  -30.464 -34.727 1.00 51.97  ? 386 ARG A NE  1 
ATOM   186  C  CZ  . ARG A 1 59  ? 23.743  -29.655 -34.320 1.00 52.44  ? 386 ARG A CZ  1 
ATOM   187  N  NH1 . ARG A 1 59  ? 23.865  -28.316 -34.361 1.00 52.36  ? 386 ARG A NH1 1 
ATOM   188  N  NH2 . ARG A 1 59  ? 22.614  -30.209 -33.870 1.00 49.93  ? 386 ARG A NH2 1 
ATOM   189  N  N   . PHE A 1 60  ? 30.115  -30.413 -30.761 1.00 41.19  ? 387 PHE A N   1 
ATOM   190  C  CA  . PHE A 1 60  ? 30.615  -29.598 -29.652 1.00 39.76  ? 387 PHE A CA  1 
ATOM   191  C  C   . PHE A 1 60  ? 31.976  -28.998 -29.985 1.00 43.48  ? 387 PHE A C   1 
ATOM   192  O  O   . PHE A 1 60  ? 32.807  -29.668 -30.606 1.00 44.40  ? 387 PHE A O   1 
ATOM   193  C  CB  . PHE A 1 60  ? 30.684  -30.434 -28.391 1.00 37.62  ? 387 PHE A CB  1 
ATOM   194  C  CG  . PHE A 1 60  ? 31.315  -29.747 -27.221 1.00 36.99  ? 387 PHE A CG  1 
ATOM   195  C  CD1 . PHE A 1 60  ? 30.583  -28.834 -26.453 1.00 34.81  ? 387 PHE A CD1 1 
ATOM   196  C  CD2 . PHE A 1 60  ? 32.685  -30.001 -26.875 1.00 38.55  ? 387 PHE A CD2 1 
ATOM   197  C  CE1 . PHE A 1 60  ? 31.183  -28.175 -25.378 1.00 35.09  ? 387 PHE A CE1 1 
ATOM   198  C  CE2 . PHE A 1 60  ? 33.267  -29.355 -25.798 1.00 38.86  ? 387 PHE A CE2 1 
ATOM   199  C  CZ  . PHE A 1 60  ? 32.509  -28.448 -25.037 1.00 37.64  ? 387 PHE A CZ  1 
ATOM   200  N  N   . GLN A 1 61  ? 32.197  -27.755 -29.554 1.00 45.18  ? 388 GLN A N   1 
ATOM   201  C  CA  . GLN A 1 61  ? 33.510  -27.114 -29.690 1.00 51.32  ? 388 GLN A CA  1 
ATOM   202  C  C   . GLN A 1 61  ? 33.806  -26.270 -28.469 1.00 52.42  ? 388 GLN A C   1 
ATOM   203  O  O   . GLN A 1 61  ? 33.156  -25.266 -28.244 1.00 52.30  ? 388 GLN A O   1 
ATOM   204  C  CB  . GLN A 1 61  ? 33.569  -26.211 -30.920 1.00 52.64  ? 388 GLN A CB  1 
ATOM   205  C  CG  . GLN A 1 61  ? 33.308  -26.863 -32.254 1.00 55.33  ? 388 GLN A CG  1 
ATOM   206  C  CD  . GLN A 1 61  ? 33.455  -25.865 -33.366 1.00 58.11  ? 388 GLN A CD  1 
ATOM   207  O  OE1 . GLN A 1 61  ? 34.355  -25.044 -33.337 1.00 62.73  ? 388 GLN A OE1 1 
ATOM   208  N  NE2 . GLN A 1 61  ? 32.578  -25.924 -34.354 1.00 57.83  ? 388 GLN A NE2 1 
ATOM   209  N  N   . ALA A 1 62  ? 34.817  -26.658 -27.706 1.00 56.35  ? 389 ALA A N   1 
ATOM   210  C  CA  . ALA A 1 62  ? 35.203  -25.960 -26.479 1.00 59.39  ? 389 ALA A CA  1 
ATOM   211  C  C   . ALA A 1 62  ? 35.716  -24.515 -26.730 1.00 63.30  ? 389 ALA A C   1 
ATOM   212  O  O   . ALA A 1 62  ? 35.774  -23.691 -25.818 1.00 67.45  ? 389 ALA A O   1 
ATOM   213  C  CB  . ALA A 1 62  ? 36.237  -26.793 -25.736 1.00 62.34  ? 389 ALA A CB  1 
ATOM   214  N  N   . ASN A 1 63  ? 36.030  -24.203 -27.987 1.00 64.60  ? 390 ASN A N   1 
ATOM   215  C  CA  . ASN A 1 63  ? 36.623  -22.942 -28.372 1.00 65.87  ? 390 ASN A CA  1 
ATOM   216  C  C   . ASN A 1 63  ? 36.369  -22.640 -29.868 1.00 65.89  ? 390 ASN A C   1 
ATOM   217  O  O   . ASN A 1 63  ? 37.318  -22.658 -30.665 1.00 67.08  ? 390 ASN A O   1 
ATOM   218  C  CB  . ASN A 1 63  ? 38.141  -23.005 -28.107 1.00 69.03  ? 390 ASN A CB  1 
ATOM   219  C  CG  . ASN A 1 63  ? 38.675  -21.721 -27.542 1.00 71.82  ? 390 ASN A CG  1 
ATOM   220  O  OD1 . ASN A 1 63  ? 37.920  -20.822 -27.163 1.00 73.83  ? 390 ASN A OD1 1 
ATOM   221  N  ND2 . ASN A 1 63  ? 39.986  -21.628 -27.453 1.00 74.84  ? 390 ASN A ND2 1 
ATOM   222  N  N   . PRO A 1 64  ? 35.104  -22.350 -30.252 1.00 63.46  ? 391 PRO A N   1 
ATOM   223  C  CA  . PRO A 1 64  ? 34.795  -22.299 -31.682 1.00 64.85  ? 391 PRO A CA  1 
ATOM   224  C  C   . PRO A 1 64  ? 35.425  -21.112 -32.434 1.00 68.72  ? 391 PRO A C   1 
ATOM   225  O  O   . PRO A 1 64  ? 35.796  -20.090 -31.820 1.00 67.59  ? 391 PRO A O   1 
ATOM   226  C  CB  . PRO A 1 64  ? 33.247  -22.220 -31.703 1.00 59.43  ? 391 PRO A CB  1 
ATOM   227  C  CG  . PRO A 1 64  ? 32.906  -21.495 -30.447 1.00 58.30  ? 391 PRO A CG  1 
ATOM   228  C  CD  . PRO A 1 64  ? 33.924  -21.973 -29.436 1.00 61.39  ? 391 PRO A CD  1 
ATOM   229  N  N   . ASP A 1 65  ? 35.532  -21.264 -33.754 1.00 73.66  ? 392 ASP A N   1 
ATOM   230  C  CA  . ASP A 1 65  ? 35.958  -20.172 -34.616 1.00 78.36  ? 392 ASP A CA  1 
ATOM   231  C  C   . ASP A 1 65  ? 34.761  -19.407 -35.169 1.00 78.00  ? 392 ASP A C   1 
ATOM   232  O  O   . ASP A 1 65  ? 34.722  -18.169 -35.122 1.00 80.56  ? 392 ASP A O   1 
ATOM   233  C  CB  . ASP A 1 65  ? 36.825  -20.697 -35.757 1.00 83.84  ? 392 ASP A CB  1 
ATOM   234  C  CG  . ASP A 1 65  ? 37.672  -19.614 -36.381 1.00 87.75  ? 392 ASP A CG  1 
ATOM   235  O  OD1 . ASP A 1 65  ? 37.123  -18.562 -36.794 1.00 87.65  ? 392 ASP A OD1 1 
ATOM   236  O  OD2 . ASP A 1 65  ? 38.902  -19.817 -36.456 1.00 92.12  ? 392 ASP A OD2 1 
ATOM   237  N  N   . ASP A 1 71  ? 26.629  -14.567 -36.134 1.00 79.32  ? 398 ASP A N   1 
ATOM   238  C  CA  . ASP A 1 71  ? 26.153  -13.812 -37.288 1.00 80.91  ? 398 ASP A CA  1 
ATOM   239  C  C   . ASP A 1 71  ? 25.661  -14.654 -38.449 1.00 78.85  ? 398 ASP A C   1 
ATOM   240  O  O   . ASP A 1 71  ? 24.798  -14.183 -39.212 1.00 81.29  ? 398 ASP A O   1 
ATOM   241  C  CB  . ASP A 1 71  ? 27.213  -12.832 -37.790 1.00 85.90  ? 398 ASP A CB  1 
ATOM   242  C  CG  . ASP A 1 71  ? 26.714  -11.401 -37.770 1.00 87.50  ? 398 ASP A CG  1 
ATOM   243  O  OD1 . ASP A 1 71  ? 27.208  -10.612 -36.923 1.00 91.70  ? 398 ASP A OD1 1 
ATOM   244  O  OD2 . ASP A 1 71  ? 25.827  -11.069 -38.596 1.00 86.94  ? 398 ASP A OD2 1 
ATOM   245  N  N   . ASP A 1 72  ? 26.215  -15.865 -38.598 1.00 72.50  ? 399 ASP A N   1 
ATOM   246  C  CA  . ASP A 1 72  ? 25.724  -16.824 -39.589 1.00 65.04  ? 399 ASP A CA  1 
ATOM   247  C  C   . ASP A 1 72  ? 24.214  -16.994 -39.456 1.00 57.64  ? 399 ASP A C   1 
ATOM   248  O  O   . ASP A 1 72  ? 23.655  -17.106 -38.342 1.00 53.04  ? 399 ASP A O   1 
ATOM   249  C  CB  . ASP A 1 72  ? 26.387  -18.216 -39.474 1.00 65.55  ? 399 ASP A CB  1 
ATOM   250  C  CG  . ASP A 1 72  ? 27.578  -18.399 -40.428 1.00 71.11  ? 399 ASP A CG  1 
ATOM   251  O  OD1 . ASP A 1 72  ? 27.594  -17.727 -41.496 1.00 72.99  ? 399 ASP A OD1 1 
ATOM   252  O  OD2 . ASP A 1 72  ? 28.491  -19.230 -40.121 1.00 69.66  ? 399 ASP A OD2 1 
ATOM   253  N  N   . THR A 1 73  ? 23.581  -17.036 -40.623 1.00 53.45  ? 400 THR A N   1 
ATOM   254  C  CA  . THR A 1 73  ? 22.218  -17.477 -40.797 1.00 50.89  ? 400 THR A CA  1 
ATOM   255  C  C   . THR A 1 73  ? 22.023  -18.920 -40.252 1.00 49.18  ? 400 THR A C   1 
ATOM   256  O  O   . THR A 1 73  ? 20.927  -19.277 -39.794 1.00 47.66  ? 400 THR A O   1 
ATOM   257  C  CB  . THR A 1 73  ? 21.788  -17.356 -42.297 1.00 51.87  ? 400 THR A CB  1 
ATOM   258  O  OG1 . THR A 1 73  ? 22.263  -18.474 -43.037 1.00 54.33  ? 400 THR A OG1 1 
ATOM   259  C  CG2 . THR A 1 73  ? 22.310  -16.106 -42.945 1.00 52.26  ? 400 THR A CG2 1 
ATOM   260  N  N   . GLN A 1 74  ? 23.108  -19.719 -40.298 1.00 49.49  ? 401 GLN A N   1 
ATOM   261  C  CA  . GLN A 1 74  ? 23.155  -21.064 -39.776 1.00 48.98  ? 401 GLN A CA  1 
ATOM   262  C  C   . GLN A 1 74  ? 22.892  -21.117 -38.287 1.00 43.63  ? 401 GLN A C   1 
ATOM   263  O  O   . GLN A 1 74  ? 22.094  -21.937 -37.858 1.00 41.15  ? 401 GLN A O   1 
ATOM   264  C  CB  . GLN A 1 74  ? 24.525  -21.701 -40.078 1.00 54.99  ? 401 GLN A CB  1 
ATOM   265  C  CG  . GLN A 1 74  ? 24.729  -21.997 -41.560 1.00 63.08  ? 401 GLN A CG  1 
ATOM   266  C  CD  . GLN A 1 74  ? 24.914  -23.491 -41.817 1.00 69.18  ? 401 GLN A CD  1 
ATOM   267  O  OE1 . GLN A 1 74  ? 24.145  -24.340 -41.308 1.00 72.99  ? 401 GLN A OE1 1 
ATOM   268  N  NE2 . GLN A 1 74  ? 25.954  -23.833 -42.590 1.00 70.80  ? 401 GLN A NE2 1 
ATOM   269  N  N   . HIS A 1 75  ? 23.576  -20.262 -37.524 1.00 41.54  ? 402 HIS A N   1 
ATOM   270  C  CA  . HIS A 1 75  ? 23.393  -20.201 -36.061 1.00 39.98  ? 402 HIS A CA  1 
ATOM   271  C  C   . HIS A 1 75  ? 21.962  -19.773 -35.682 1.00 36.63  ? 402 HIS A C   1 
ATOM   272  O  O   . HIS A 1 75  ? 21.401  -20.325 -34.747 1.00 35.74  ? 402 HIS A O   1 
ATOM   273  C  CB  . HIS A 1 75  ? 24.417  -19.268 -35.387 1.00 40.61  ? 402 HIS A CB  1 
ATOM   274  C  CG  . HIS A 1 75  ? 25.796  -19.815 -35.399 1.00 43.90  ? 402 HIS A CG  1 
ATOM   275  N  ND1 . HIS A 1 75  ? 26.730  -19.455 -36.350 1.00 47.29  ? 402 HIS A ND1 1 
ATOM   276  C  CD2 . HIS A 1 75  ? 26.407  -20.709 -34.590 1.00 44.27  ? 402 HIS A CD2 1 
ATOM   277  C  CE1 . HIS A 1 75  ? 27.863  -20.094 -36.118 1.00 47.58  ? 402 HIS A CE1 1 
ATOM   278  N  NE2 . HIS A 1 75  ? 27.689  -20.867 -35.060 1.00 46.39  ? 402 HIS A NE2 1 
ATOM   279  N  N   . ILE A 1 76  ? 21.382  -18.850 -36.455 1.00 35.31  ? 403 ILE A N   1 
ATOM   280  C  CA  . ILE A 1 76  ? 20.010  -18.414 -36.208 1.00 34.13  ? 403 ILE A CA  1 
ATOM   281  C  C   . ILE A 1 76  ? 19.040  -19.571 -36.478 1.00 33.40  ? 403 ILE A C   1 
ATOM   282  O  O   . ILE A 1 76  ? 18.182  -19.891 -35.632 1.00 31.72  ? 403 ILE A O   1 
ATOM   283  C  CB  . ILE A 1 76  ? 19.673  -17.146 -36.991 1.00 34.05  ? 403 ILE A CB  1 
ATOM   284  C  CG1 . ILE A 1 76  ? 20.608  -16.003 -36.541 1.00 35.30  ? 403 ILE A CG1 1 
ATOM   285  C  CG2 . ILE A 1 76  ? 18.217  -16.758 -36.754 1.00 32.74  ? 403 ILE A CG2 1 
ATOM   286  C  CD1 . ILE A 1 76  ? 20.595  -14.759 -37.420 1.00 36.99  ? 403 ILE A CD1 1 
ATOM   287  N  N   . GLN A 1 77  ? 19.231  -20.232 -37.630 1.00 35.26  ? 404 GLN A N   1 
ATOM   288  C  CA  . GLN A 1 77  ? 18.398  -21.343 -38.009 1.00 35.69  ? 404 GLN A CA  1 
ATOM   289  C  C   . GLN A 1 77  ? 18.425  -22.454 -36.954 1.00 34.57  ? 404 GLN A C   1 
ATOM   290  O  O   . GLN A 1 77  ? 17.369  -22.979 -36.551 1.00 32.26  ? 404 GLN A O   1 
ATOM   291  C  CB  . GLN A 1 77  ? 18.799  -21.859 -39.396 1.00 38.96  ? 404 GLN A CB  1 
ATOM   292  C  CG  . GLN A 1 77  ? 17.881  -22.988 -39.838 1.00 40.41  ? 404 GLN A CG  1 
ATOM   293  C  CD  . GLN A 1 77  ? 16.417  -22.556 -39.918 1.00 40.72  ? 404 GLN A CD  1 
ATOM   294  O  OE1 . GLN A 1 77  ? 16.109  -21.509 -40.504 1.00 41.39  ? 404 GLN A OE1 1 
ATOM   295  N  NE2 . GLN A 1 77  ? 15.508  -23.358 -39.324 1.00 39.25  ? 404 GLN A NE2 1 
ATOM   296  N  N   . GLN A 1 78  ? 19.614  -22.770 -36.472 1.00 35.04  ? 405 GLN A N   1 
ATOM   297  C  CA  . GLN A 1 78  ? 19.762  -23.792 -35.421 1.00 34.86  ? 405 GLN A CA  1 
ATOM   298  C  C   . GLN A 1 78  ? 19.085  -23.364 -34.111 1.00 31.93  ? 405 GLN A C   1 
ATOM   299  O  O   . GLN A 1 78  ? 18.441  -24.180 -33.447 1.00 31.46  ? 405 GLN A O   1 
ATOM   300  C  CB  . GLN A 1 78  ? 21.237  -24.139 -35.220 1.00 37.72  ? 405 GLN A CB  1 
ATOM   301  C  CG  . GLN A 1 78  ? 21.787  -24.754 -36.506 1.00 43.24  ? 405 GLN A CG  1 
ATOM   302  C  CD  . GLN A 1 78  ? 23.294  -24.918 -36.539 1.00 46.84  ? 405 GLN A CD  1 
ATOM   303  O  OE1 . GLN A 1 78  ? 24.013  -24.628 -35.572 1.00 49.63  ? 405 GLN A OE1 1 
ATOM   304  N  NE2 . GLN A 1 78  ? 23.792  -25.360 -37.686 1.00 48.21  ? 405 GLN A NE2 1 
ATOM   305  N  N   . PHE A 1 79  ? 19.207  -22.082 -33.767 1.00 29.77  ? 406 PHE A N   1 
ATOM   306  C  CA  . PHE A 1 79  ? 18.512  -21.527 -32.634 1.00 28.26  ? 406 PHE A CA  1 
ATOM   307  C  C   . PHE A 1 79  ? 16.966  -21.816 -32.774 1.00 27.52  ? 406 PHE A C   1 
ATOM   308  O  O   . PHE A 1 79  ? 16.323  -22.324 -31.852 1.00 27.12  ? 406 PHE A O   1 
ATOM   309  C  CB  . PHE A 1 79  ? 18.816  -20.011 -32.530 1.00 27.21  ? 406 PHE A CB  1 
ATOM   310  C  CG  . PHE A 1 79  ? 17.887  -19.274 -31.592 1.00 26.06  ? 406 PHE A CG  1 
ATOM   311  C  CD1 . PHE A 1 79  ? 17.994  -19.424 -30.159 1.00 25.23  ? 406 PHE A CD1 1 
ATOM   312  C  CD2 . PHE A 1 79  ? 16.855  -18.493 -32.100 1.00 25.64  ? 406 PHE A CD2 1 
ATOM   313  C  CE1 . PHE A 1 79  ? 17.108  -18.722 -29.328 1.00 24.44  ? 406 PHE A CE1 1 
ATOM   314  C  CE2 . PHE A 1 79  ? 15.958  -17.844 -31.263 1.00 24.84  ? 406 PHE A CE2 1 
ATOM   315  C  CZ  . PHE A 1 79  ? 16.075  -17.960 -29.879 1.00 24.37  ? 406 PHE A CZ  1 
ATOM   316  N  N   . TYR A 1 80  ? 16.400  -21.522 -33.939 1.00 28.55  ? 407 TYR A N   1 
ATOM   317  C  CA  . TYR A 1 80  ? 14.988  -21.847 -34.186 1.00 30.13  ? 407 TYR A CA  1 
ATOM   318  C  C   . TYR A 1 80  ? 14.665  -23.358 -34.141 1.00 29.83  ? 407 TYR A C   1 
ATOM   319  O  O   . TYR A 1 80  ? 13.637  -23.744 -33.553 1.00 28.97  ? 407 TYR A O   1 
ATOM   320  C  CB  . TYR A 1 80  ? 14.492  -21.294 -35.516 1.00 31.83  ? 407 TYR A CB  1 
ATOM   321  C  CG  . TYR A 1 80  ? 14.496  -19.793 -35.679 1.00 34.15  ? 407 TYR A CG  1 
ATOM   322  C  CD1 . TYR A 1 80  ? 14.162  -18.917 -34.630 1.00 33.54  ? 407 TYR A CD1 1 
ATOM   323  C  CD2 . TYR A 1 80  ? 14.799  -19.250 -36.939 1.00 36.06  ? 407 TYR A CD2 1 
ATOM   324  C  CE1 . TYR A 1 80  ? 14.178  -17.521 -34.827 1.00 35.93  ? 407 TYR A CE1 1 
ATOM   325  C  CE2 . TYR A 1 80  ? 14.806  -17.897 -37.140 1.00 38.64  ? 407 TYR A CE2 1 
ATOM   326  C  CZ  . TYR A 1 80  ? 14.517  -17.022 -36.097 1.00 37.78  ? 407 TYR A CZ  1 
ATOM   327  O  OH  . TYR A 1 80  ? 14.541  -15.672 -36.410 1.00 40.22  ? 407 TYR A OH  1 
ATOM   328  N  N   . ASP A 1 81  ? 15.520  -24.188 -34.760 1.00 30.62  ? 408 ASP A N   1 
ATOM   329  C  CA  . ASP A 1 81  ? 15.404  -25.642 -34.698 1.00 31.10  ? 408 ASP A CA  1 
ATOM   330  C  C   . ASP A 1 81  ? 15.408  -26.131 -33.265 1.00 30.65  ? 408 ASP A C   1 
ATOM   331  O  O   . ASP A 1 81  ? 14.598  -26.969 -32.909 1.00 31.78  ? 408 ASP A O   1 
ATOM   332  C  CB  . ASP A 1 81  ? 16.520  -26.352 -35.463 1.00 32.70  ? 408 ASP A CB  1 
ATOM   333  C  CG  . ASP A 1 81  ? 16.508  -26.073 -36.930 1.00 35.37  ? 408 ASP A CG  1 
ATOM   334  O  OD1 . ASP A 1 81  ? 15.545  -25.460 -37.447 1.00 34.99  ? 408 ASP A OD1 1 
ATOM   335  O  OD2 . ASP A 1 81  ? 17.528  -26.432 -37.574 1.00 38.46  ? 408 ASP A OD2 1 
ATOM   336  N  N   . LEU A 1 82  ? 16.280  -25.588 -32.425 1.00 29.88  ? 409 LEU A N   1 
ATOM   337  C  CA  . LEU A 1 82  ? 16.305  -26.034 -31.035 1.00 29.99  ? 409 LEU A CA  1 
ATOM   338  C  C   . LEU A 1 82  ? 15.002  -25.646 -30.320 1.00 29.63  ? 409 LEU A C   1 
ATOM   339  O  O   . LEU A 1 82  ? 14.514  -26.424 -29.514 1.00 26.78  ? 409 LEU A O   1 
ATOM   340  C  CB  . LEU A 1 82  ? 17.517  -25.488 -30.278 1.00 29.89  ? 409 LEU A CB  1 
ATOM   341  C  CG  . LEU A 1 82  ? 18.905  -26.018 -30.744 1.00 32.97  ? 409 LEU A CG  1 
ATOM   342  C  CD1 . LEU A 1 82  ? 20.041  -25.189 -30.148 1.00 32.89  ? 409 LEU A CD1 1 
ATOM   343  C  CD2 . LEU A 1 82  ? 19.153  -27.497 -30.422 1.00 32.15  ? 409 LEU A CD2 1 
ATOM   344  N  N   . LEU A 1 83  ? 14.456  -24.463 -30.610 1.00 28.37  ? 410 LEU A N   1 
ATOM   345  C  CA  . LEU A 1 83  ? 13.178  -24.109 -30.028 1.00 29.17  ? 410 LEU A CA  1 
ATOM   346  C  C   . LEU A 1 83  ? 12.046  -25.015 -30.545 1.00 29.86  ? 410 LEU A C   1 
ATOM   347  O  O   . LEU A 1 83  ? 11.222  -25.475 -29.758 1.00 30.54  ? 410 LEU A O   1 
ATOM   348  C  CB  . LEU A 1 83  ? 12.810  -22.629 -30.270 1.00 28.68  ? 410 LEU A CB  1 
ATOM   349  C  CG  . LEU A 1 83  ? 13.599  -21.513 -29.544 1.00 29.13  ? 410 LEU A CG  1 
ATOM   350  C  CD1 . LEU A 1 83  ? 13.126  -20.161 -30.062 1.00 28.95  ? 410 LEU A CD1 1 
ATOM   351  C  CD2 . LEU A 1 83  ? 13.531  -21.586 -28.007 1.00 28.86  ? 410 LEU A CD2 1 
ATOM   352  N  N   . THR A 1 84  ? 11.987  -25.242 -31.853 1.00 29.49  ? 411 THR A N   1 
ATOM   353  C  CA  . THR A 1 84  ? 10.847  -26.007 -32.401 1.00 30.63  ? 411 THR A CA  1 
ATOM   354  C  C   . THR A 1 84  ? 10.931  -27.497 -32.013 1.00 31.51  ? 411 THR A C   1 
ATOM   355  O  O   . THR A 1 84  ? 9.921   -28.078 -31.665 1.00 31.87  ? 411 THR A O   1 
ATOM   356  C  CB  . THR A 1 84  ? 10.659  -25.866 -33.930 1.00 30.47  ? 411 THR A CB  1 
ATOM   357  O  OG1 . THR A 1 84  ? 11.818  -26.355 -34.588 1.00 31.84  ? 411 THR A OG1 1 
ATOM   358  C  CG2 . THR A 1 84  ? 10.479  -24.436 -34.356 1.00 29.60  ? 411 THR A CG2 1 
ATOM   359  N  N   . GLY A 1 85  ? 12.137  -28.078 -32.055 1.00 32.02  ? 412 GLY A N   1 
ATOM   360  C  CA  . GLY A 1 85  ? 12.376  -29.462 -31.549 1.00 33.23  ? 412 GLY A CA  1 
ATOM   361  C  C   . GLY A 1 85  ? 11.985  -29.565 -30.081 1.00 32.81  ? 412 GLY A C   1 
ATOM   362  O  O   . GLY A 1 85  ? 11.300  -30.490 -29.693 1.00 34.26  ? 412 GLY A O   1 
ATOM   363  N  N   . SER A 1 86  ? 12.346  -28.591 -29.269 1.00 32.12  ? 413 SER A N   1 
ATOM   364  C  CA  . SER A 1 86  ? 11.963  -28.589 -27.865 1.00 33.45  ? 413 SER A CA  1 
ATOM   365  C  C   . SER A 1 86  ? 10.446  -28.474 -27.580 1.00 35.07  ? 413 SER A C   1 
ATOM   366  O  O   . SER A 1 86  ? 9.941   -29.117 -26.621 1.00 33.52  ? 413 SER A O   1 
ATOM   367  C  CB  . SER A 1 86  ? 12.770  -27.556 -27.125 1.00 35.73  ? 413 SER A CB  1 
ATOM   368  O  OG  . SER A 1 86  ? 12.067  -27.166 -25.949 1.00 45.50  ? 413 SER A OG  1 
ATOM   369  N  N   . MET A 1 87  ? 9.732   -27.696 -28.414 1.00 35.29  ? 414 MET A N   1 
ATOM   370  C  CA  . MET A 1 87  ? 8.269   -27.594 -28.344 1.00 37.47  ? 414 MET A CA  1 
ATOM   371  C  C   . MET A 1 87  ? 7.591   -28.962 -28.396 1.00 36.39  ? 414 MET A C   1 
ATOM   372  O  O   . MET A 1 87  ? 6.708   -29.246 -27.618 1.00 31.58  ? 414 MET A O   1 
ATOM   373  C  CB  . MET A 1 87  ? 7.697   -26.811 -29.524 1.00 40.19  ? 414 MET A CB  1 
ATOM   374  C  CG  . MET A 1 87  ? 7.720   -25.342 -29.348 1.00 43.31  ? 414 MET A CG  1 
ATOM   375  S  SD  . MET A 1 87  ? 6.742   -24.445 -30.553 1.00 51.45  ? 414 MET A SD  1 
ATOM   376  C  CE  . MET A 1 87  ? 5.214   -25.333 -30.336 1.00 43.52  ? 414 MET A CE  1 
ATOM   377  N  N   . GLU A 1 88  ? 8.007   -29.780 -29.345 1.00 38.38  ? 415 GLU A N   1 
ATOM   378  C  CA  . GLU A 1 88  ? 7.416   -31.100 -29.528 1.00 40.65  ? 415 GLU A CA  1 
ATOM   379  C  C   . GLU A 1 88  ? 7.665   -32.042 -28.331 1.00 37.03  ? 415 GLU A C   1 
ATOM   380  O  O   . GLU A 1 88  ? 6.745   -32.720 -27.857 1.00 36.40  ? 415 GLU A O   1 
ATOM   381  C  CB  . GLU A 1 88  ? 7.909   -31.740 -30.833 1.00 44.87  ? 415 GLU A CB  1 
ATOM   382  C  CG  . GLU A 1 88  ? 6.882   -32.742 -31.371 1.00 53.84  ? 415 GLU A CG  1 
ATOM   383  C  CD  . GLU A 1 88  ? 5.543   -32.075 -31.797 1.00 58.15  ? 415 GLU A CD  1 
ATOM   384  O  OE1 . GLU A 1 88  ? 4.547   -32.785 -32.018 1.00 64.91  ? 415 GLU A OE1 1 
ATOM   385  O  OE2 . GLU A 1 88  ? 5.448   -30.829 -31.902 1.00 62.98  ? 415 GLU A OE2 1 
ATOM   386  N  N   . ILE A 1 89  ? 8.908   -32.040 -27.846 1.00 34.15  ? 416 ILE A N   1 
ATOM   387  C  CA  . ILE A 1 89  ? 9.309   -32.884 -26.720 1.00 32.64  ? 416 ILE A CA  1 
ATOM   388  C  C   . ILE A 1 89  ? 8.601   -32.436 -25.429 1.00 29.32  ? 416 ILE A C   1 
ATOM   389  O  O   . ILE A 1 89  ? 8.069   -33.264 -24.707 1.00 29.20  ? 416 ILE A O   1 
ATOM   390  C  CB  . ILE A 1 89  ? 10.856  -32.988 -26.636 1.00 34.77  ? 416 ILE A CB  1 
ATOM   391  C  CG1 . ILE A 1 89  ? 11.329  -33.899 -27.744 1.00 38.78  ? 416 ILE A CG1 1 
ATOM   392  C  CG2 . ILE A 1 89  ? 11.284  -33.614 -25.327 1.00 33.85  ? 416 ILE A CG2 1 
ATOM   393  C  CD1 . ILE A 1 89  ? 12.662  -33.529 -28.331 1.00 45.26  ? 416 ILE A CD1 1 
ATOM   394  N  N   . ILE A 1 90  ? 8.505   -31.130 -25.205 1.00 26.87  ? 417 ILE A N   1 
ATOM   395  C  CA  . ILE A 1 90  ? 7.804   -30.595 -24.014 1.00 26.13  ? 417 ILE A CA  1 
ATOM   396  C  C   . ILE A 1 90  ? 6.283   -30.857 -24.069 1.00 26.90  ? 417 ILE A C   1 
ATOM   397  O  O   . ILE A 1 90  ? 5.651   -31.092 -23.041 1.00 26.04  ? 417 ILE A O   1 
ATOM   398  C  CB  . ILE A 1 90  ? 8.110   -29.093 -23.793 1.00 24.16  ? 417 ILE A CB  1 
ATOM   399  C  CG1 . ILE A 1 90  ? 9.619   -28.939 -23.502 1.00 23.28  ? 417 ILE A CG1 1 
ATOM   400  C  CG2 . ILE A 1 90  ? 7.250   -28.487 -22.673 1.00 22.07  ? 417 ILE A CG2 1 
ATOM   401  C  CD1 . ILE A 1 90  ? 10.075  -27.479 -23.383 1.00 23.35  ? 417 ILE A CD1 1 
ATOM   402  N  N   . ARG A 1 91  ? 5.726   -30.842 -25.275 1.00 29.39  ? 418 ARG A N   1 
ATOM   403  C  CA  . ARG A 1 91  ? 4.333   -31.166 -25.494 1.00 31.86  ? 418 ARG A CA  1 
ATOM   404  C  C   . ARG A 1 91  ? 4.113   -32.644 -25.091 1.00 30.28  ? 418 ARG A C   1 
ATOM   405  O  O   . ARG A 1 91  ? 3.146   -32.947 -24.411 1.00 30.56  ? 418 ARG A O   1 
ATOM   406  C  CB  . ARG A 1 91  ? 3.909   -30.892 -26.939 1.00 35.41  ? 418 ARG A CB  1 
ATOM   407  C  CG  . ARG A 1 91  ? 2.414   -31.070 -27.174 1.00 43.11  ? 418 ARG A CG  1 
ATOM   408  C  CD  . ARG A 1 91  ? 2.036   -31.007 -28.650 1.00 48.79  ? 418 ARG A CD  1 
ATOM   409  N  NE  . ARG A 1 91  ? 2.366   -29.714 -29.264 1.00 53.76  ? 418 ARG A NE  1 
ATOM   410  C  CZ  . ARG A 1 91  ? 1.691   -28.576 -29.085 1.00 55.34  ? 418 ARG A CZ  1 
ATOM   411  N  NH1 . ARG A 1 91  ? 0.606   -28.521 -28.292 1.00 57.08  ? 418 ARG A NH1 1 
ATOM   412  N  NH2 . ARG A 1 91  ? 2.113   -27.473 -29.714 1.00 57.41  ? 418 ARG A NH2 1 
ATOM   413  N  N   . GLY A 1 92  ? 5.026   -33.528 -25.479 1.00 29.06  ? 419 GLY A N   1 
ATOM   414  C  CA  . GLY A 1 92  ? 4.948   -34.945 -25.085 1.00 28.85  ? 419 GLY A CA  1 
ATOM   415  C  C   . GLY A 1 92  ? 5.097   -35.098 -23.564 1.00 28.49  ? 419 GLY A C   1 
ATOM   416  O  O   . GLY A 1 92  ? 4.375   -35.895 -22.937 1.00 28.44  ? 419 GLY A O   1 
ATOM   417  N  N   . TRP A 1 93  ? 6.029   -34.334 -22.971 1.00 24.92  ? 420 TRP A N   1 
ATOM   418  C  CA  . TRP A 1 93  ? 6.173   -34.299 -21.511 1.00 24.09  ? 420 TRP A CA  1 
ATOM   419  C  C   . TRP A 1 93  ? 4.826   -33.928 -20.841 1.00 23.35  ? 420 TRP A C   1 
ATOM   420  O  O   . TRP A 1 93  ? 4.392   -34.624 -19.924 1.00 22.83  ? 420 TRP A O   1 
ATOM   421  C  CB  . TRP A 1 93  ? 7.274   -33.322 -21.071 1.00 22.05  ? 420 TRP A CB  1 
ATOM   422  C  CG  . TRP A 1 93  ? 7.223   -32.945 -19.620 1.00 21.19  ? 420 TRP A CG  1 
ATOM   423  C  CD1 . TRP A 1 93  ? 7.711   -33.680 -18.553 1.00 21.35  ? 420 TRP A CD1 1 
ATOM   424  C  CD2 . TRP A 1 93  ? 6.676   -31.749 -19.065 1.00 20.51  ? 420 TRP A CD2 1 
ATOM   425  N  NE1 . TRP A 1 93  ? 7.504   -33.016 -17.376 1.00 21.70  ? 420 TRP A NE1 1 
ATOM   426  C  CE2 . TRP A 1 93  ? 6.882   -31.817 -17.652 1.00 20.79  ? 420 TRP A CE2 1 
ATOM   427  C  CE3 . TRP A 1 93  ? 6.052   -30.620 -19.619 1.00 20.43  ? 420 TRP A CE3 1 
ATOM   428  C  CZ2 . TRP A 1 93  ? 6.489   -30.792 -16.767 1.00 20.92  ? 420 TRP A CZ2 1 
ATOM   429  C  CZ3 . TRP A 1 93  ? 5.640   -29.573 -18.739 1.00 20.82  ? 420 TRP A CZ3 1 
ATOM   430  C  CH2 . TRP A 1 93  ? 5.862   -29.680 -17.317 1.00 21.32  ? 420 TRP A CH2 1 
ATOM   431  N  N   . ALA A 1 94  ? 4.195   -32.853 -21.331 1.00 22.80  ? 421 ALA A N   1 
ATOM   432  C  CA  . ALA A 1 94  ? 2.965   -32.303 -20.767 1.00 23.81  ? 421 ALA A CA  1 
ATOM   433  C  C   . ALA A 1 94  ? 1.817   -33.340 -20.799 1.00 25.66  ? 421 ALA A C   1 
ATOM   434  O  O   . ALA A 1 94  ? 1.114   -33.524 -19.794 1.00 24.76  ? 421 ALA A O   1 
ATOM   435  C  CB  . ALA A 1 94  ? 2.557   -31.034 -21.493 1.00 23.74  ? 421 ALA A CB  1 
ATOM   436  N  N   . GLU A 1 95  ? 1.696   -34.033 -21.924 1.00 27.01  ? 422 GLU A N   1 
ATOM   437  C  CA  . GLU A 1 95  ? 0.728   -35.106 -22.073 1.00 31.24  ? 422 GLU A CA  1 
ATOM   438  C  C   . GLU A 1 95  ? 0.954   -36.317 -21.162 1.00 31.41  ? 422 GLU A C   1 
ATOM   439  O  O   . GLU A 1 95  ? 0.016   -37.060 -20.901 1.00 31.03  ? 422 GLU A O   1 
ATOM   440  C  CB  . GLU A 1 95  ? 0.608   -35.486 -23.550 1.00 35.28  ? 422 GLU A CB  1 
ATOM   441  C  CG  . GLU A 1 95  ? -0.136  -34.339 -24.299 1.00 39.61  ? 422 GLU A CG  1 
ATOM   442  C  CD  . GLU A 1 95  ? -0.076  -34.422 -25.802 1.00 43.76  ? 422 GLU A CD  1 
ATOM   443  O  OE1 . GLU A 1 95  ? 0.374   -35.463 -26.317 1.00 48.06  ? 422 GLU A OE1 1 
ATOM   444  O  OE2 . GLU A 1 95  ? -0.500  -33.450 -26.485 1.00 45.69  ? 422 GLU A OE2 1 
ATOM   445  N  N   . LYS A 1 96  ? 2.169   -36.452 -20.628 1.00 30.28  ? 423 LYS A N   1 
ATOM   446  C  CA  . LYS A 1 96  ? 2.480   -37.508 -19.657 1.00 30.74  ? 423 LYS A CA  1 
ATOM   447  C  C   . LYS A 1 96  ? 2.217   -37.091 -18.198 1.00 29.42  ? 423 LYS A C   1 
ATOM   448  O  O   . LYS A 1 96  ? 2.389   -37.915 -17.290 1.00 28.49  ? 423 LYS A O   1 
ATOM   449  C  CB  . LYS A 1 96  ? 3.907   -38.051 -19.860 1.00 31.97  ? 423 LYS A CB  1 
ATOM   450  C  CG  . LYS A 1 96  ? 4.140   -38.826 -21.161 1.00 36.13  ? 423 LYS A CG  1 
ATOM   451  C  CD  . LYS A 1 96  ? 5.646   -39.105 -21.383 1.00 39.97  ? 423 LYS A CD  1 
ATOM   452  C  CE  . LYS A 1 96  ? 6.074   -39.362 -22.855 1.00 42.15  ? 423 LYS A CE  1 
ATOM   453  N  NZ  . LYS A 1 96  ? 7.008   -38.295 -23.437 1.00 41.41  ? 423 LYS A NZ  1 
ATOM   454  N  N   . ILE A 1 97  ? 1.811   -35.833 -17.969 1.00 27.67  ? 424 ILE A N   1 
ATOM   455  C  CA  . ILE A 1 97  ? 1.462   -35.364 -16.599 1.00 27.45  ? 424 ILE A CA  1 
ATOM   456  C  C   . ILE A 1 97  ? 0.030   -35.823 -16.294 1.00 28.15  ? 424 ILE A C   1 
ATOM   457  O  O   . ILE A 1 97  ? -0.886  -35.456 -17.017 1.00 27.96  ? 424 ILE A O   1 
ATOM   458  C  CB  . ILE A 1 97  ? 1.570   -33.817 -16.447 1.00 28.27  ? 424 ILE A CB  1 
ATOM   459  C  CG1 . ILE A 1 97  ? 3.022   -33.387 -16.574 1.00 28.02  ? 424 ILE A CG1 1 
ATOM   460  C  CG2 . ILE A 1 97  ? 0.991   -33.313 -15.117 1.00 27.42  ? 424 ILE A CG2 1 
ATOM   461  C  CD1 . ILE A 1 97  ? 3.078   -31.958 -17.041 1.00 30.37  ? 424 ILE A CD1 1 
ATOM   462  N  N   . PRO A 1 98  ? -0.167  -36.652 -15.236 1.00 28.24  ? 425 PRO A N   1 
ATOM   463  C  CA  . PRO A 1 98  ? -1.532  -37.124 -14.953 1.00 29.38  ? 425 PRO A CA  1 
ATOM   464  C  C   . PRO A 1 98  ? -2.496  -35.959 -14.775 1.00 29.80  ? 425 PRO A C   1 
ATOM   465  O  O   . PRO A 1 98  ? -2.147  -34.967 -14.146 1.00 30.37  ? 425 PRO A O   1 
ATOM   466  C  CB  . PRO A 1 98  ? -1.374  -37.919 -13.637 1.00 30.09  ? 425 PRO A CB  1 
ATOM   467  C  CG  . PRO A 1 98  ? 0.061   -38.319 -13.623 1.00 28.30  ? 425 PRO A CG  1 
ATOM   468  C  CD  . PRO A 1 98  ? 0.813   -37.188 -14.267 1.00 27.19  ? 425 PRO A CD  1 
ATOM   469  N  N   . GLY A 1 99  ? -3.672  -36.055 -15.375 1.00 30.65  ? 426 GLY A N   1 
ATOM   470  C  CA  . GLY A 1 99  ? -4.651  -34.981 -15.325 1.00 31.12  ? 426 GLY A CA  1 
ATOM   471  C  C   . GLY A 1 99  ? -4.556  -33.957 -16.456 1.00 31.16  ? 426 GLY A C   1 
ATOM   472  O  O   . GLY A 1 99  ? -5.559  -33.308 -16.785 1.00 32.69  ? 426 GLY A O   1 
ATOM   473  N  N   . PHE A 1 100 ? -3.373  -33.770 -17.051 1.00 29.11  ? 427 PHE A N   1 
ATOM   474  C  CA  . PHE A 1 100 ? -3.218  -32.724 -18.062 1.00 29.03  ? 427 PHE A CA  1 
ATOM   475  C  C   . PHE A 1 100 ? -4.075  -32.983 -19.299 1.00 30.22  ? 427 PHE A C   1 
ATOM   476  O  O   . PHE A 1 100 ? -4.754  -32.069 -19.800 1.00 30.79  ? 427 PHE A O   1 
ATOM   477  C  CB  . PHE A 1 100 ? -1.761  -32.530 -18.458 1.00 26.18  ? 427 PHE A CB  1 
ATOM   478  C  CG  . PHE A 1 100 ? -1.532  -31.392 -19.446 1.00 25.37  ? 427 PHE A CG  1 
ATOM   479  C  CD1 . PHE A 1 100 ? -1.376  -30.065 -18.998 1.00 24.71  ? 427 PHE A CD1 1 
ATOM   480  C  CD2 . PHE A 1 100 ? -1.486  -31.642 -20.829 1.00 25.07  ? 427 PHE A CD2 1 
ATOM   481  C  CE1 . PHE A 1 100 ? -1.175  -29.041 -19.899 1.00 24.12  ? 427 PHE A CE1 1 
ATOM   482  C  CE2 . PHE A 1 100 ? -1.269  -30.608 -21.724 1.00 24.82  ? 427 PHE A CE2 1 
ATOM   483  C  CZ  . PHE A 1 100 ? -1.092  -29.319 -21.262 1.00 24.03  ? 427 PHE A CZ  1 
ATOM   484  N  N   . ALA A 1 101 ? -4.020  -34.233 -19.787 1.00 31.46  ? 428 ALA A N   1 
ATOM   485  C  CA  . ALA A 1 101 ? -4.841  -34.657 -20.929 1.00 33.41  ? 428 ALA A CA  1 
ATOM   486  C  C   . ALA A 1 101 ? -6.325  -34.695 -20.609 1.00 34.84  ? 428 ALA A C   1 
ATOM   487  O  O   . ALA A 1 101 ? -7.140  -34.742 -21.525 1.00 36.46  ? 428 ALA A O   1 
ATOM   488  C  CB  . ALA A 1 101 ? -4.367  -35.991 -21.494 1.00 34.10  ? 428 ALA A CB  1 
ATOM   489  N  N   . ASP A 1 102 ? -6.689  -34.624 -19.327 1.00 35.66  ? 429 ASP A N   1 
ATOM   490  C  CA  . ASP A 1 102 ? -8.111  -34.572 -18.937 1.00 37.59  ? 429 ASP A CA  1 
ATOM   491  C  C   . ASP A 1 102 ? -8.719  -33.165 -19.086 1.00 37.96  ? 429 ASP A C   1 
ATOM   492  O  O   . ASP A 1 102 ? -9.955  -33.004 -19.043 1.00 39.36  ? 429 ASP A O   1 
ATOM   493  C  CB  . ASP A 1 102 ? -8.327  -35.046 -17.501 1.00 38.95  ? 429 ASP A CB  1 
ATOM   494  C  CG  . ASP A 1 102 ? -7.895  -36.508 -17.271 1.00 41.32  ? 429 ASP A CG  1 
ATOM   495  O  OD1 . ASP A 1 102 ? -7.786  -37.293 -18.268 1.00 40.94  ? 429 ASP A OD1 1 
ATOM   496  O  OD2 . ASP A 1 102 ? -7.679  -36.843 -16.057 1.00 40.75  ? 429 ASP A OD2 1 
ATOM   497  N  N   . LEU A 1 103 ? -7.874  -32.142 -19.231 1.00 36.50  ? 430 LEU A N   1 
ATOM   498  C  CA  . LEU A 1 103 ? -8.386  -30.766 -19.364 1.00 36.61  ? 430 LEU A CA  1 
ATOM   499  C  C   . LEU A 1 103 ? -8.925  -30.522 -20.758 1.00 36.63  ? 430 LEU A C   1 
ATOM   500  O  O   . LEU A 1 103 ? -8.472  -31.192 -21.679 1.00 35.96  ? 430 LEU A O   1 
ATOM   501  C  CB  . LEU A 1 103 ? -7.267  -29.746 -19.045 1.00 34.35  ? 430 LEU A CB  1 
ATOM   502  C  CG  . LEU A 1 103 ? -6.638  -29.889 -17.671 1.00 34.13  ? 430 LEU A CG  1 
ATOM   503  C  CD1 . LEU A 1 103 ? -5.368  -29.054 -17.696 1.00 31.44  ? 430 LEU A CD1 1 
ATOM   504  C  CD2 . LEU A 1 103 ? -7.644  -29.445 -16.584 1.00 35.52  ? 430 LEU A CD2 1 
ATOM   505  N  N   . PRO A 1 104 ? -9.852  -29.553 -20.932 1.00 38.37  ? 431 PRO A N   1 
ATOM   506  C  CA  . PRO A 1 104 ? -10.262 -29.209 -22.323 1.00 39.58  ? 431 PRO A CA  1 
ATOM   507  C  C   . PRO A 1 104 ? -9.068  -28.895 -23.193 1.00 38.03  ? 431 PRO A C   1 
ATOM   508  O  O   . PRO A 1 104 ? -8.029  -28.420 -22.690 1.00 36.48  ? 431 PRO A O   1 
ATOM   509  C  CB  . PRO A 1 104 ? -11.134 -27.956 -22.151 1.00 40.93  ? 431 PRO A CB  1 
ATOM   510  C  CG  . PRO A 1 104 ? -11.645 -28.029 -20.741 1.00 41.74  ? 431 PRO A CG  1 
ATOM   511  C  CD  . PRO A 1 104 ? -10.585 -28.754 -19.923 1.00 38.92  ? 431 PRO A CD  1 
ATOM   512  N  N   . LYS A 1 105 ? -9.186  -29.152 -24.493 1.00 39.58  ? 432 LYS A N   1 
ATOM   513  C  CA  . LYS A 1 105 ? -8.058  -28.915 -25.407 1.00 39.34  ? 432 LYS A CA  1 
ATOM   514  C  C   . LYS A 1 105 ? -7.527  -27.456 -25.333 1.00 37.99  ? 432 LYS A C   1 
ATOM   515  O  O   . LYS A 1 105 ? -6.291  -27.222 -25.317 1.00 35.53  ? 432 LYS A O   1 
ATOM   516  C  CB  . LYS A 1 105 ? -8.416  -29.343 -26.838 1.00 43.04  ? 432 LYS A CB  1 
ATOM   517  C  CG  . LYS A 1 105 ? -7.301  -29.133 -27.881 1.00 45.04  ? 432 LYS A CG  1 
ATOM   518  C  CD  . LYS A 1 105 ? -6.081  -29.974 -27.524 1.00 45.30  ? 432 LYS A CD  1 
ATOM   519  C  CE  . LYS A 1 105 ? -4.936  -29.765 -28.503 1.00 46.42  ? 432 LYS A CE  1 
ATOM   520  N  NZ  . LYS A 1 105 ? -3.787  -30.629 -28.090 1.00 47.22  ? 432 LYS A NZ  1 
ATOM   521  N  N   . ALA A 1 106 ? -8.456  -26.499 -25.290 1.00 37.91  ? 433 ALA A N   1 
ATOM   522  C  CA  . ALA A 1 106 ? -8.124  -25.072 -25.150 1.00 36.76  ? 433 ALA A CA  1 
ATOM   523  C  C   . ALA A 1 106 ? -7.308  -24.770 -23.879 1.00 34.53  ? 433 ALA A C   1 
ATOM   524  O  O   . ALA A 1 106 ? -6.402  -23.941 -23.913 1.00 33.62  ? 433 ALA A O   1 
ATOM   525  C  CB  . ALA A 1 106 ? -9.398  -24.232 -25.188 1.00 37.87  ? 433 ALA A CB  1 
ATOM   526  N  N   . ASP A 1 107 ? -7.621  -25.457 -22.778 1.00 34.08  ? 434 ASP A N   1 
ATOM   527  C  CA  . ASP A 1 107 ? -6.898  -25.286 -21.515 1.00 33.01  ? 434 ASP A CA  1 
ATOM   528  C  C   . ASP A 1 107 ? -5.483  -25.859 -21.634 1.00 31.07  ? 434 ASP A C   1 
ATOM   529  O  O   . ASP A 1 107 ? -4.505  -25.217 -21.220 1.00 30.17  ? 434 ASP A O   1 
ATOM   530  C  CB  . ASP A 1 107 ? -7.645  -25.954 -20.356 1.00 33.94  ? 434 ASP A CB  1 
ATOM   531  C  CG  . ASP A 1 107 ? -8.776  -25.124 -19.812 1.00 35.65  ? 434 ASP A CG  1 
ATOM   532  O  OD1 . ASP A 1 107 ? -9.033  -24.038 -20.349 1.00 35.54  ? 434 ASP A OD1 1 
ATOM   533  O  OD2 . ASP A 1 107 ? -9.408  -25.568 -18.809 1.00 37.48  ? 434 ASP A OD2 1 
ATOM   534  N  N   . GLN A 1 108 ? -5.379  -27.044 -22.225 1.00 30.94  ? 435 GLN A N   1 
ATOM   535  C  CA  . GLN A 1 108 ? -4.080  -27.641 -22.531 1.00 30.09  ? 435 GLN A CA  1 
ATOM   536  C  C   . GLN A 1 108 ? -3.181  -26.713 -23.361 1.00 29.05  ? 435 GLN A C   1 
ATOM   537  O  O   . GLN A 1 108 ? -2.018  -26.507 -22.975 1.00 27.29  ? 435 GLN A O   1 
ATOM   538  C  CB  . GLN A 1 108 ? -4.249  -28.974 -23.238 1.00 30.50  ? 435 GLN A CB  1 
ATOM   539  C  CG  . GLN A 1 108 ? -4.857  -30.047 -22.370 1.00 31.85  ? 435 GLN A CG  1 
ATOM   540  C  CD  . GLN A 1 108 ? -5.060  -31.325 -23.129 1.00 33.47  ? 435 GLN A CD  1 
ATOM   541  O  OE1 . GLN A 1 108 ? -6.170  -31.882 -23.152 1.00 37.29  ? 435 GLN A OE1 1 
ATOM   542  N  NE2 . GLN A 1 108 ? -4.044  -31.765 -23.805 1.00 32.14  ? 435 GLN A NE2 1 
ATOM   543  N  N   . ASP A 1 109 ? -3.729  -26.166 -24.460 1.00 30.02  ? 436 ASP A N   1 
ATOM   544  C  CA  . ASP A 1 109 ? -3.032  -25.212 -25.313 1.00 29.78  ? 436 ASP A CA  1 
ATOM   545  C  C   . ASP A 1 109 ? -2.655  -23.969 -24.539 1.00 29.31  ? 436 ASP A C   1 
ATOM   546  O  O   . ASP A 1 109 ? -1.522  -23.523 -24.646 1.00 27.89  ? 436 ASP A O   1 
ATOM   547  C  CB  . ASP A 1 109 ? -3.853  -24.783 -26.561 1.00 31.18  ? 436 ASP A CB  1 
ATOM   548  C  CG  . ASP A 1 109 ? -4.066  -25.907 -27.535 1.00 32.86  ? 436 ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1 109 ? -3.342  -26.904 -27.466 1.00 33.84  ? 436 ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1 109 ? -4.990  -25.823 -28.358 1.00 35.11  ? 436 ASP A OD2 1 
ATOM   551  N  N   . LEU A 1 110 ? -3.601  -23.396 -23.791 1.00 30.45  ? 437 LEU A N   1 
ATOM   552  C  CA  . LEU A 1 110 ? -3.268  -22.221 -22.994 1.00 30.92  ? 437 LEU A CA  1 
ATOM   553  C  C   . LEU A 1 110 ? -2.085  -22.499 -22.004 1.00 29.52  ? 437 LEU A C   1 
ATOM   554  O  O   . LEU A 1 110 ? -1.136  -21.700 -21.938 1.00 28.30  ? 437 LEU A O   1 
ATOM   555  C  CB  . LEU A 1 110 ? -4.476  -21.650 -22.266 1.00 32.10  ? 437 LEU A CB  1 
ATOM   556  C  CG  . LEU A 1 110 ? -4.270  -20.437 -21.341 1.00 32.89  ? 437 LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1 110 ? -3.674  -19.214 -22.055 1.00 32.54  ? 437 LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1 110 ? -5.661  -20.113 -20.740 1.00 34.75  ? 437 LEU A CD2 1 
ATOM   559  N  N   . LEU A 1 111 ? -2.172  -23.597 -21.256 1.00 28.26  ? 438 LEU A N   1 
ATOM   560  C  CA  . LEU A 1 111 ? -1.146  -23.934 -20.269 1.00 27.93  ? 438 LEU A CA  1 
ATOM   561  C  C   . LEU A 1 111 ? 0.217   -24.186 -20.923 1.00 27.43  ? 438 LEU A C   1 
ATOM   562  O  O   . LEU A 1 111 ? 1.228   -23.652 -20.458 1.00 26.44  ? 438 LEU A O   1 
ATOM   563  C  CB  . LEU A 1 111 ? -1.556  -25.126 -19.398 1.00 27.77  ? 438 LEU A CB  1 
ATOM   564  C  CG  . LEU A 1 111 ? -2.698  -24.938 -18.400 1.00 29.91  ? 438 LEU A CG  1 
ATOM   565  C  CD1 . LEU A 1 111 ? -2.977  -26.285 -17.710 1.00 30.81  ? 438 LEU A CD1 1 
ATOM   566  C  CD2 . LEU A 1 111 ? -2.453  -23.848 -17.346 1.00 29.35  ? 438 LEU A CD2 1 
ATOM   567  N  N   . PHE A 1 112 ? 0.220   -24.963 -21.998 1.00 28.17  ? 439 PHE A N   1 
ATOM   568  C  CA  . PHE A 1 112 ? 1.438   -25.319 -22.698 1.00 29.10  ? 439 PHE A CA  1 
ATOM   569  C  C   . PHE A 1 112 ? 2.109   -24.102 -23.332 1.00 29.73  ? 439 PHE A C   1 
ATOM   570  O  O   . PHE A 1 112 ? 3.328   -23.897 -23.187 1.00 27.39  ? 439 PHE A O   1 
ATOM   571  C  CB  . PHE A 1 112 ? 1.159   -26.347 -23.808 1.00 30.18  ? 439 PHE A CB  1 
ATOM   572  C  CG  . PHE A 1 112 ? 2.295   -26.532 -24.757 1.00 30.40  ? 439 PHE A CG  1 
ATOM   573  C  CD1 . PHE A 1 112 ? 3.455   -27.240 -24.357 1.00 31.89  ? 439 PHE A CD1 1 
ATOM   574  C  CD2 . PHE A 1 112 ? 2.238   -25.989 -26.016 1.00 31.53  ? 439 PHE A CD2 1 
ATOM   575  C  CE1 . PHE A 1 112 ? 4.536   -27.390 -25.239 1.00 32.48  ? 439 PHE A CE1 1 
ATOM   576  C  CE2 . PHE A 1 112 ? 3.317   -26.115 -26.906 1.00 33.71  ? 439 PHE A CE2 1 
ATOM   577  C  CZ  . PHE A 1 112 ? 4.456   -26.832 -26.531 1.00 32.57  ? 439 PHE A CZ  1 
ATOM   578  N  N   . GLU A 1 113 ? 1.307   -23.324 -24.057 1.00 30.02  ? 440 GLU A N   1 
ATOM   579  C  CA  . GLU A 1 113 ? 1.814   -22.187 -24.772 1.00 31.37  ? 440 GLU A CA  1 
ATOM   580  C  C   . GLU A 1 113 ? 2.338   -21.113 -23.838 1.00 30.43  ? 440 GLU A C   1 
ATOM   581  O  O   . GLU A 1 113 ? 3.399   -20.551 -24.109 1.00 29.54  ? 440 GLU A O   1 
ATOM   582  C  CB  . GLU A 1 113 ? 0.754   -21.616 -25.718 1.00 32.68  ? 440 GLU A CB  1 
ATOM   583  C  CG  . GLU A 1 113 ? 0.647   -22.513 -26.943 1.00 35.00  ? 440 GLU A CG  1 
ATOM   584  C  CD  . GLU A 1 113 ? -0.558  -22.219 -27.815 1.00 37.40  ? 440 GLU A CD  1 
ATOM   585  O  OE1 . GLU A 1 113 ? -1.157  -21.141 -27.688 1.00 38.64  ? 440 GLU A OE1 1 
ATOM   586  O  OE2 . GLU A 1 113 ? -0.867  -23.066 -28.666 1.00 40.80  ? 440 GLU A OE2 1 
ATOM   587  N  N   . SER A 1 114 ? 1.615   -20.849 -22.753 1.00 29.29  ? 441 SER A N   1 
ATOM   588  C  CA  . SER A 1 114 ? 2.032   -19.844 -21.765 1.00 29.20  ? 441 SER A CA  1 
ATOM   589  C  C   . SER A 1 114 ? 3.346   -20.233 -21.036 1.00 27.11  ? 441 SER A C   1 
ATOM   590  O  O   . SER A 1 114 ? 4.066   -19.343 -20.582 1.00 26.38  ? 441 SER A O   1 
ATOM   591  C  CB  . SER A 1 114 ? 0.973   -19.606 -20.699 1.00 29.49  ? 441 SER A CB  1 
ATOM   592  O  OG  . SER A 1 114 ? -0.263  -19.320 -21.282 1.00 33.66  ? 441 SER A OG  1 
ATOM   593  N  N   . ALA A 1 115 ? 3.596   -21.538 -20.914 1.00 25.33  ? 442 ALA A N   1 
ATOM   594  C  CA  . ALA A 1 115 ? 4.715   -22.063 -20.111 1.00 25.00  ? 442 ALA A CA  1 
ATOM   595  C  C   . ALA A 1 115 ? 5.925   -22.487 -20.975 1.00 22.80  ? 442 ALA A C   1 
ATOM   596  O  O   . ALA A 1 115 ? 6.990   -22.767 -20.455 1.00 22.19  ? 442 ALA A O   1 
ATOM   597  C  CB  . ALA A 1 115 ? 4.229   -23.268 -19.277 1.00 23.94  ? 442 ALA A CB  1 
ATOM   598  N  N   . PHE A 1 116 ? 5.736   -22.559 -22.270 1.00 22.84  ? 443 PHE A N   1 
ATOM   599  C  CA  . PHE A 1 116 ? 6.712   -23.186 -23.137 1.00 24.01  ? 443 PHE A CA  1 
ATOM   600  C  C   . PHE A 1 116 ? 8.152   -22.704 -22.961 1.00 24.69  ? 443 PHE A C   1 
ATOM   601  O  O   . PHE A 1 116 ? 9.047   -23.517 -22.731 1.00 24.92  ? 443 PHE A O   1 
ATOM   602  C  CB  . PHE A 1 116 ? 6.323   -23.208 -24.622 1.00 25.01  ? 443 PHE A CB  1 
ATOM   603  C  CG  . PHE A 1 116 ? 7.503   -23.417 -25.529 1.00 27.30  ? 443 PHE A CG  1 
ATOM   604  C  CD1 . PHE A 1 116 ? 8.197   -24.651 -25.542 1.00 26.75  ? 443 PHE A CD1 1 
ATOM   605  C  CD2 . PHE A 1 116 ? 7.983   -22.358 -26.322 1.00 28.09  ? 443 PHE A CD2 1 
ATOM   606  C  CE1 . PHE A 1 116 ? 9.344   -24.801 -26.313 1.00 27.81  ? 443 PHE A CE1 1 
ATOM   607  C  CE2 . PHE A 1 116 ? 9.093   -22.532 -27.156 1.00 28.25  ? 443 PHE A CE2 1 
ATOM   608  C  CZ  . PHE A 1 116 ? 9.780   -23.737 -27.128 1.00 27.27  ? 443 PHE A CZ  1 
ATOM   609  N  N   . LEU A 1 117 ? 8.363   -21.400 -23.029 1.00 24.99  ? 444 LEU A N   1 
ATOM   610  C  CA  . LEU A 1 117 ? 9.689   -20.834 -22.942 1.00 25.66  ? 444 LEU A CA  1 
ATOM   611  C  C   . LEU A 1 117 ? 10.261  -20.978 -21.535 1.00 25.80  ? 444 LEU A C   1 
ATOM   612  O  O   . LEU A 1 117 ? 11.463  -21.248 -21.357 1.00 25.67  ? 444 LEU A O   1 
ATOM   613  C  CB  . LEU A 1 117 ? 9.657   -19.337 -23.350 1.00 26.84  ? 444 LEU A CB  1 
ATOM   614  C  CG  . LEU A 1 117 ? 9.780   -19.025 -24.865 1.00 28.78  ? 444 LEU A CG  1 
ATOM   615  C  CD1 . LEU A 1 117 ? 9.713   -17.500 -25.140 1.00 28.47  ? 444 LEU A CD1 1 
ATOM   616  C  CD2 . LEU A 1 117 ? 11.072  -19.630 -25.445 1.00 28.31  ? 444 LEU A CD2 1 
ATOM   617  N  N   . GLU A 1 118 ? 9.406   -20.811 -20.529 1.00 25.73  ? 445 GLU A N   1 
ATOM   618  C  CA  . GLU A 1 118 ? 9.807   -21.110 -19.153 1.00 28.21  ? 445 GLU A CA  1 
ATOM   619  C  C   . GLU A 1 118 ? 10.311  -22.557 -19.007 1.00 28.27  ? 445 GLU A C   1 
ATOM   620  O  O   . GLU A 1 118 ? 11.392  -22.778 -18.431 1.00 28.98  ? 445 GLU A O   1 
ATOM   621  C  CB  . GLU A 1 118 ? 8.661   -20.817 -18.210 1.00 29.47  ? 445 GLU A CB  1 
ATOM   622  C  CG  . GLU A 1 118 ? 8.305   -19.335 -18.280 1.00 34.94  ? 445 GLU A CG  1 
ATOM   623  C  CD  . GLU A 1 118 ? 7.396   -18.845 -17.193 1.00 37.38  ? 445 GLU A CD  1 
ATOM   624  O  OE1 . GLU A 1 118 ? 6.796   -17.799 -17.392 1.00 42.67  ? 445 GLU A OE1 1 
ATOM   625  O  OE2 . GLU A 1 118 ? 7.325   -19.482 -16.139 1.00 42.34  ? 445 GLU A OE2 1 
ATOM   626  N  N   . LEU A 1 119 ? 9.580   -23.514 -19.616 1.00 26.98  ? 446 LEU A N   1 
ATOM   627  C  CA  . LEU A 1 119 ? 9.941   -24.926 -19.528 1.00 26.43  ? 446 LEU A CA  1 
ATOM   628  C  C   . LEU A 1 119 ? 11.216  -25.217 -20.309 1.00 25.74  ? 446 LEU A C   1 
ATOM   629  O  O   . LEU A 1 119 ? 12.063  -25.990 -19.839 1.00 24.12  ? 446 LEU A O   1 
ATOM   630  C  CB  . LEU A 1 119 ? 8.782   -25.826 -20.001 1.00 26.90  ? 446 LEU A CB  1 
ATOM   631  C  CG  . LEU A 1 119 ? 7.748   -26.276 -18.915 1.00 29.95  ? 446 LEU A CG  1 
ATOM   632  C  CD1 . LEU A 1 119 ? 8.347   -27.111 -17.786 1.00 31.53  ? 446 LEU A CD1 1 
ATOM   633  C  CD2 . LEU A 1 119 ? 7.053   -25.158 -18.226 1.00 33.23  ? 446 LEU A CD2 1 
ATOM   634  N  N   . PHE A 1 120 ? 11.336  -24.637 -21.519 1.00 25.03  ? 447 PHE A N   1 
ATOM   635  C  CA  . PHE A 1 120 ? 12.552  -24.787 -22.317 1.00 24.70  ? 447 PHE A CA  1 
ATOM   636  C  C   . PHE A 1 120 ? 13.779  -24.378 -21.467 1.00 24.74  ? 447 PHE A C   1 
ATOM   637  O  O   . PHE A 1 120 ? 14.751  -25.088 -21.432 1.00 26.85  ? 447 PHE A O   1 
ATOM   638  C  CB  . PHE A 1 120 ? 12.467  -23.888 -23.554 1.00 25.30  ? 447 PHE A CB  1 
ATOM   639  C  CG  . PHE A 1 120 ? 13.759  -23.788 -24.319 1.00 25.84  ? 447 PHE A CG  1 
ATOM   640  C  CD1 . PHE A 1 120 ? 14.169  -24.822 -25.178 1.00 24.63  ? 447 PHE A CD1 1 
ATOM   641  C  CD2 . PHE A 1 120 ? 14.564  -22.636 -24.211 1.00 26.21  ? 447 PHE A CD2 1 
ATOM   642  C  CE1 . PHE A 1 120 ? 15.368  -24.712 -25.887 1.00 25.82  ? 447 PHE A CE1 1 
ATOM   643  C  CE2 . PHE A 1 120 ? 15.764  -22.537 -24.939 1.00 26.04  ? 447 PHE A CE2 1 
ATOM   644  C  CZ  . PHE A 1 120 ? 16.162  -23.577 -25.769 1.00 25.14  ? 447 PHE A CZ  1 
ATOM   645  N  N   . VAL A 1 121 ? 13.680  -23.251 -20.762 1.00 24.31  ? 448 VAL A N   1 
ATOM   646  C  CA  . VAL A 1 121 ? 14.769  -22.711 -19.992 1.00 24.32  ? 448 VAL A CA  1 
ATOM   647  C  C   . VAL A 1 121 ? 15.022  -23.571 -18.733 1.00 24.26  ? 448 VAL A C   1 
ATOM   648  O  O   . VAL A 1 121 ? 16.181  -23.877 -18.420 1.00 23.29  ? 448 VAL A O   1 
ATOM   649  C  CB  . VAL A 1 121 ? 14.507  -21.227 -19.614 1.00 24.68  ? 448 VAL A CB  1 
ATOM   650  C  CG1 . VAL A 1 121 ? 15.518  -20.735 -18.600 1.00 25.68  ? 448 VAL A CG1 1 
ATOM   651  C  CG2 . VAL A 1 121 ? 14.528  -20.346 -20.871 1.00 24.23  ? 448 VAL A CG2 1 
ATOM   652  N  N   . LEU A 1 122 ? 13.940  -23.928 -18.028 1.00 23.15  ? 449 LEU A N   1 
ATOM   653  C  CA  . LEU A 1 122 ? 14.054  -24.688 -16.797 1.00 23.68  ? 449 LEU A CA  1 
ATOM   654  C  C   . LEU A 1 122 ? 14.750  -26.036 -17.024 1.00 22.47  ? 449 LEU A C   1 
ATOM   655  O  O   . LEU A 1 122 ? 15.695  -26.373 -16.310 1.00 22.51  ? 449 LEU A O   1 
ATOM   656  C  CB  . LEU A 1 122 ? 12.690  -24.891 -16.124 1.00 22.84  ? 449 LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 122 ? 12.741  -25.647 -14.790 1.00 23.09  ? 449 LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 122 ? 13.463  -24.882 -13.665 1.00 23.49  ? 449 LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 122 ? 11.339  -26.010 -14.303 1.00 23.76  ? 449 LEU A CD2 1 
ATOM   660  N  N   . ARG A 1 123 ? 14.316  -26.735 -18.056 1.00 22.63  ? 450 ARG A N   1 
ATOM   661  C  CA  . ARG A 1 123 ? 14.800  -28.079 -18.351 1.00 22.90  ? 450 ARG A CA  1 
ATOM   662  C  C   . ARG A 1 123 ? 16.195  -28.040 -18.938 1.00 23.54  ? 450 ARG A C   1 
ATOM   663  O  O   . ARG A 1 123 ? 16.990  -28.947 -18.691 1.00 23.54  ? 450 ARG A O   1 
ATOM   664  C  CB  . ARG A 1 123 ? 13.835  -28.752 -19.340 1.00 23.17  ? 450 ARG A CB  1 
ATOM   665  C  CG  . ARG A 1 123 ? 12.526  -29.209 -18.664 1.00 22.95  ? 450 ARG A CG  1 
ATOM   666  C  CD  . ARG A 1 123 ? 11.396  -29.349 -19.690 1.00 22.85  ? 450 ARG A CD  1 
ATOM   667  N  NE  . ARG A 1 123 ? 11.762  -30.166 -20.856 1.00 22.33  ? 450 ARG A NE  1 
ATOM   668  C  CZ  . ARG A 1 123 ? 11.546  -31.480 -20.984 1.00 22.00  ? 450 ARG A CZ  1 
ATOM   669  N  NH1 . ARG A 1 123 ? 10.959  -32.235 -19.995 1.00 21.69  ? 450 ARG A NH1 1 
ATOM   670  N  NH2 . ARG A 1 123 ? 11.927  -32.058 -22.115 1.00 21.21  ? 450 ARG A NH2 1 
ATOM   671  N  N   . LEU A 1 124 ? 16.471  -26.988 -19.724 1.00 23.36  ? 451 LEU A N   1 
ATOM   672  C  CA  . LEU A 1 124 ? 17.821  -26.744 -20.263 1.00 23.96  ? 451 LEU A CA  1 
ATOM   673  C  C   . LEU A 1 124 ? 18.789  -26.492 -19.120 1.00 24.39  ? 451 LEU A C   1 
ATOM   674  O  O   . LEU A 1 124 ? 19.885  -27.067 -19.085 1.00 26.42  ? 451 LEU A O   1 
ATOM   675  C  CB  . LEU A 1 124 ? 17.845  -25.552 -21.237 1.00 23.78  ? 451 LEU A CB  1 
ATOM   676  C  CG  . LEU A 1 124 ? 19.190  -25.219 -21.915 1.00 24.60  ? 451 LEU A CG  1 
ATOM   677  C  CD1 . LEU A 1 124 ? 19.796  -26.441 -22.647 1.00 24.68  ? 451 LEU A CD1 1 
ATOM   678  C  CD2 . LEU A 1 124 ? 19.035  -24.020 -22.862 1.00 23.37  ? 451 LEU A CD2 1 
ATOM   679  N  N   . ALA A 1 125 ? 18.378  -25.623 -18.198 1.00 24.61  ? 452 ALA A N   1 
ATOM   680  C  CA  . ALA A 1 125 ? 19.206  -25.259 -17.042 1.00 25.63  ? 452 ALA A CA  1 
ATOM   681  C  C   . ALA A 1 125 ? 19.471  -26.468 -16.124 1.00 25.90  ? 452 ALA A C   1 
ATOM   682  O  O   . ALA A 1 125 ? 20.562  -26.587 -15.577 1.00 26.31  ? 452 ALA A O   1 
ATOM   683  C  CB  . ALA A 1 125 ? 18.552  -24.121 -16.241 1.00 25.05  ? 452 ALA A CB  1 
ATOM   684  N  N   . TYR A 1 126 ? 18.466  -27.334 -15.946 1.00 24.91  ? 453 TYR A N   1 
ATOM   685  C  CA  . TYR A 1 126 ? 18.620  -28.495 -15.070 1.00 26.22  ? 453 TYR A CA  1 
ATOM   686  C  C   . TYR A 1 126 ? 19.584  -29.545 -15.624 1.00 26.61  ? 453 TYR A C   1 
ATOM   687  O  O   . TYR A 1 126 ? 20.345  -30.125 -14.875 1.00 27.30  ? 453 TYR A O   1 
ATOM   688  C  CB  . TYR A 1 126 ? 17.269  -29.146 -14.788 1.00 24.06  ? 453 TYR A CB  1 
ATOM   689  C  CG  . TYR A 1 126 ? 17.289  -30.172 -13.682 1.00 24.46  ? 453 TYR A CG  1 
ATOM   690  C  CD1 . TYR A 1 126 ? 17.610  -29.801 -12.354 1.00 25.23  ? 453 TYR A CD1 1 
ATOM   691  C  CD2 . TYR A 1 126 ? 16.996  -31.519 -13.942 1.00 23.64  ? 453 TYR A CD2 1 
ATOM   692  C  CE1 . TYR A 1 126 ? 17.622  -30.755 -11.329 1.00 25.89  ? 453 TYR A CE1 1 
ATOM   693  C  CE2 . TYR A 1 126 ? 16.996  -32.466 -12.925 1.00 23.86  ? 453 TYR A CE2 1 
ATOM   694  C  CZ  . TYR A 1 126 ? 17.313  -32.072 -11.627 1.00 25.28  ? 453 TYR A CZ  1 
ATOM   695  O  OH  . TYR A 1 126 ? 17.344  -32.975 -10.595 1.00 26.09  ? 453 TYR A OH  1 
ATOM   696  N  N   . ARG A 1 127 ? 19.520  -29.752 -16.935 1.00 27.04  ? 454 ARG A N   1 
ATOM   697  C  CA  . ARG A 1 127 ? 20.212  -30.815 -17.707 1.00 28.38  ? 454 ARG A CA  1 
ATOM   698  C  C   . ARG A 1 127 ? 21.661  -30.432 -17.952 1.00 28.74  ? 454 ARG A C   1 
ATOM   699  O  O   . ARG A 1 127 ? 22.482  -31.283 -18.174 1.00 30.52  ? 454 ARG A O   1 
ATOM   700  C  CB  . ARG A 1 127 ? 19.550  -30.825 -19.110 1.00 29.28  ? 454 ARG A CB  1 
ATOM   701  C  CG  . ARG A 1 127 ? 19.520  -32.090 -19.871 1.00 32.23  ? 454 ARG A CG  1 
ATOM   702  C  CD  . ARG A 1 127 ? 18.215  -32.256 -20.680 1.00 32.82  ? 454 ARG A CD  1 
ATOM   703  N  NE  . ARG A 1 127 ? 18.178  -31.126 -21.512 1.00 32.99  ? 454 ARG A NE  1 
ATOM   704  C  CZ  . ARG A 1 127 ? 17.130  -30.463 -21.957 1.00 31.59  ? 454 ARG A CZ  1 
ATOM   705  N  NH1 . ARG A 1 127 ? 15.829  -30.816 -21.779 1.00 29.88  ? 454 ARG A NH1 1 
ATOM   706  N  NH2 . ARG A 1 127 ? 17.473  -29.384 -22.623 1.00 31.57  ? 454 ARG A NH2 1 
ATOM   707  N  N   . SER A 1 128 ? 21.947  -29.139 -18.021 1.00 27.98  ? 455 SER A N   1 
ATOM   708  C  CA  . SER A 1 128 ? 23.230  -28.646 -18.520 1.00 29.34  ? 455 SER A CA  1 
ATOM   709  C  C   . SER A 1 128 ? 24.367  -28.714 -17.492 1.00 30.52  ? 455 SER A C   1 
ATOM   710  O  O   . SER A 1 128 ? 24.145  -29.034 -16.330 1.00 29.65  ? 455 SER A O   1 
ATOM   711  C  CB  . SER A 1 128 ? 23.075  -27.219 -19.085 1.00 29.83  ? 455 SER A CB  1 
ATOM   712  O  OG  . SER A 1 128 ? 22.221  -27.234 -20.240 1.00 29.58  ? 455 SER A OG  1 
ATOM   713  N  N   . ASN A 1 129 ? 25.583  -28.418 -17.937 1.00 32.47  ? 456 ASN A N   1 
ATOM   714  C  CA  . ASN A 1 129 ? 26.755  -28.371 -17.045 1.00 35.03  ? 456 ASN A CA  1 
ATOM   715  C  C   . ASN A 1 129 ? 27.317  -26.965 -17.112 1.00 36.02  ? 456 ASN A C   1 
ATOM   716  O  O   . ASN A 1 129 ? 28.225  -26.697 -17.910 1.00 37.66  ? 456 ASN A O   1 
ATOM   717  C  CB  . ASN A 1 129 ? 27.792  -29.444 -17.404 1.00 35.90  ? 456 ASN A CB  1 
ATOM   718  C  CG  . ASN A 1 129 ? 28.886  -29.593 -16.348 1.00 39.61  ? 456 ASN A CG  1 
ATOM   719  O  OD1 . ASN A 1 129 ? 29.124  -28.700 -15.501 1.00 41.09  ? 456 ASN A OD1 1 
ATOM   720  N  ND2 . ASN A 1 129 ? 29.593  -30.708 -16.418 1.00 39.61  ? 456 ASN A ND2 1 
ATOM   721  N  N   . PRO A 1 130 ? 26.766  -26.053 -16.283 1.00 36.37  ? 457 PRO A N   1 
ATOM   722  C  CA  . PRO A 1 130 ? 27.148  -24.616 -16.329 1.00 38.27  ? 457 PRO A CA  1 
ATOM   723  C  C   . PRO A 1 130 ? 28.627  -24.353 -16.033 1.00 41.58  ? 457 PRO A C   1 
ATOM   724  O  O   . PRO A 1 130 ? 29.212  -23.516 -16.727 1.00 43.63  ? 457 PRO A O   1 
ATOM   725  C  CB  . PRO A 1 130 ? 26.242  -23.970 -15.283 1.00 37.51  ? 457 PRO A CB  1 
ATOM   726  C  CG  . PRO A 1 130 ? 25.837  -25.105 -14.371 1.00 35.96  ? 457 PRO A CG  1 
ATOM   727  C  CD  . PRO A 1 130 ? 25.759  -26.319 -15.242 1.00 34.40  ? 457 PRO A CD  1 
ATOM   728  N  N   . VAL A 1 131 ? 29.220  -25.073 -15.067 1.00 42.28  ? 458 VAL A N   1 
ATOM   729  C  CA  . VAL A 1 131 ? 30.658  -24.954 -14.719 1.00 45.16  ? 458 VAL A CA  1 
ATOM   730  C  C   . VAL A 1 131 ? 31.566  -25.193 -15.938 1.00 46.11  ? 458 VAL A C   1 
ATOM   731  O  O   . VAL A 1 131 ? 32.608  -24.555 -16.086 1.00 47.36  ? 458 VAL A O   1 
ATOM   732  C  CB  . VAL A 1 131 ? 31.066  -25.972 -13.593 1.00 46.09  ? 458 VAL A CB  1 
ATOM   733  C  CG1 . VAL A 1 131 ? 32.562  -25.981 -13.367 1.00 48.58  ? 458 VAL A CG1 1 
ATOM   734  C  CG2 . VAL A 1 131 ? 30.370  -25.664 -12.274 1.00 45.46  ? 458 VAL A CG2 1 
ATOM   735  N  N   . GLU A 1 132 ? 31.170  -26.118 -16.808 1.00 45.42  ? 459 GLU A N   1 
ATOM   736  C  CA  . GLU A 1 132 ? 31.967  -26.389 -18.010 1.00 45.53  ? 459 GLU A CA  1 
ATOM   737  C  C   . GLU A 1 132 ? 31.479  -25.596 -19.233 1.00 42.10  ? 459 GLU A C   1 
ATOM   738  O  O   . GLU A 1 132 ? 32.041  -25.714 -20.305 1.00 42.37  ? 459 GLU A O   1 
ATOM   739  C  CB  . GLU A 1 132 ? 32.004  -27.887 -18.285 1.00 46.18  ? 459 GLU A CB  1 
ATOM   740  C  CG  . GLU A 1 132 ? 32.594  -28.681 -17.145 1.00 49.54  ? 459 GLU A CG  1 
ATOM   741  C  CD  . GLU A 1 132 ? 33.178  -30.018 -17.596 1.00 52.14  ? 459 GLU A CD  1 
ATOM   742  O  OE1 . GLU A 1 132 ? 32.470  -30.831 -18.205 1.00 50.36  ? 459 GLU A OE1 1 
ATOM   743  O  OE2 . GLU A 1 132 ? 34.397  -30.258 -17.360 1.00 60.43  ? 459 GLU A OE2 1 
ATOM   744  N  N   . GLY A 1 133 ? 30.440  -24.792 -19.053 1.00 39.35  ? 460 GLY A N   1 
ATOM   745  C  CA  . GLY A 1 133 ? 29.807  -24.067 -20.173 1.00 37.40  ? 460 GLY A CA  1 
ATOM   746  C  C   . GLY A 1 133 ? 29.150  -25.000 -21.192 1.00 35.38  ? 460 GLY A C   1 
ATOM   747  O  O   . GLY A 1 133 ? 29.096  -24.668 -22.380 1.00 35.32  ? 460 GLY A O   1 
ATOM   748  N  N   . LYS A 1 134 ? 28.653  -26.159 -20.719 1.00 33.65  ? 461 LYS A N   1 
ATOM   749  C  CA  . LYS A 1 134 ? 28.062  -27.169 -21.597 1.00 32.37  ? 461 LYS A CA  1 
ATOM   750  C  C   . LYS A 1 134 ? 26.533  -27.132 -21.527 1.00 29.85  ? 461 LYS A C   1 
ATOM   751  O  O   . LYS A 1 134 ? 25.963  -27.433 -20.492 1.00 28.46  ? 461 LYS A O   1 
ATOM   752  C  CB  . LYS A 1 134 ? 28.573  -28.577 -21.303 1.00 33.39  ? 461 LYS A CB  1 
ATOM   753  C  CG  . LYS A 1 134 ? 30.016  -28.803 -21.725 1.00 36.63  ? 461 LYS A CG  1 
ATOM   754  C  CD  . LYS A 1 134 ? 30.464  -30.220 -21.454 1.00 37.83  ? 461 LYS A CD  1 
ATOM   755  C  CE  . LYS A 1 134 ? 31.992  -30.253 -21.555 1.00 42.91  ? 461 LYS A CE  1 
ATOM   756  N  NZ  . LYS A 1 134 ? 32.351  -31.682 -21.693 1.00 44.58  ? 461 LYS A NZ  1 
ATOM   757  N  N   . LEU A 1 135 ? 25.921  -26.753 -22.643 1.00 28.60  ? 462 LEU A N   1 
ATOM   758  C  CA  . LEU A 1 135 ? 24.464  -26.754 -22.811 1.00 27.55  ? 462 LEU A CA  1 
ATOM   759  C  C   . LEU A 1 135 ? 24.101  -28.063 -23.429 1.00 27.70  ? 462 LEU A C   1 
ATOM   760  O  O   . LEU A 1 135 ? 24.748  -28.541 -24.413 1.00 29.02  ? 462 LEU A O   1 
ATOM   761  C  CB  . LEU A 1 135 ? 24.000  -25.579 -23.700 1.00 26.63  ? 462 LEU A CB  1 
ATOM   762  C  CG  . LEU A 1 135 ? 23.900  -24.152 -23.092 1.00 27.33  ? 462 LEU A CG  1 
ATOM   763  C  CD1 . LEU A 1 135 ? 23.009  -23.957 -21.853 1.00 25.70  ? 462 LEU A CD1 1 
ATOM   764  C  CD2 . LEU A 1 135 ? 25.262  -23.469 -22.865 1.00 29.45  ? 462 LEU A CD2 1 
ATOM   765  N  N   . ILE A 1 136 ? 23.092  -28.694 -22.839 1.00 27.03  ? 463 ILE A N   1 
ATOM   766  C  CA  . ILE A 1 136 ? 22.677  -30.004 -23.346 1.00 27.68  ? 463 ILE A CA  1 
ATOM   767  C  C   . ILE A 1 136 ? 21.223  -29.795 -23.747 1.00 26.78  ? 463 ILE A C   1 
ATOM   768  O  O   . ILE A 1 136 ? 20.360  -29.531 -22.882 1.00 26.36  ? 463 ILE A O   1 
ATOM   769  C  CB  . ILE A 1 136 ? 22.901  -31.128 -22.300 1.00 27.58  ? 463 ILE A CB  1 
ATOM   770  C  CG1 . ILE A 1 136 ? 24.384  -31.188 -21.908 1.00 29.94  ? 463 ILE A CG1 1 
ATOM   771  C  CG2 . ILE A 1 136 ? 22.441  -32.466 -22.852 1.00 27.79  ? 463 ILE A CG2 1 
ATOM   772  C  CD1 . ILE A 1 136 ? 24.739  -32.219 -20.832 1.00 31.48  ? 463 ILE A CD1 1 
ATOM   773  N  N   . PHE A 1 137 ? 20.971  -29.880 -25.049 1.00 27.54  ? 464 PHE A N   1 
ATOM   774  C  CA  . PHE A 1 137 ? 19.593  -29.675 -25.557 1.00 28.38  ? 464 PHE A CA  1 
ATOM   775  C  C   . PHE A 1 137 ? 18.761  -30.954 -25.478 1.00 28.93  ? 464 PHE A C   1 
ATOM   776  O  O   . PHE A 1 137 ? 19.323  -32.039 -25.263 1.00 28.61  ? 464 PHE A O   1 
ATOM   777  C  CB  . PHE A 1 137 ? 19.667  -29.011 -26.942 1.00 27.72  ? 464 PHE A CB  1 
ATOM   778  C  CG  . PHE A 1 137 ? 20.255  -27.623 -26.853 1.00 28.45  ? 464 PHE A CG  1 
ATOM   779  C  CD1 . PHE A 1 137 ? 19.470  -26.535 -26.435 1.00 26.69  ? 464 PHE A CD1 1 
ATOM   780  C  CD2 . PHE A 1 137 ? 21.623  -27.427 -27.050 1.00 28.55  ? 464 PHE A CD2 1 
ATOM   781  C  CE1 . PHE A 1 137 ? 20.026  -25.267 -26.290 1.00 27.59  ? 464 PHE A CE1 1 
ATOM   782  C  CE2 . PHE A 1 137 ? 22.180  -26.146 -26.914 1.00 28.84  ? 464 PHE A CE2 1 
ATOM   783  C  CZ  . PHE A 1 137 ? 21.374  -25.071 -26.539 1.00 28.48  ? 464 PHE A CZ  1 
ATOM   784  N  N   . CYS A 1 138 ? 17.452  -30.830 -25.673 1.00 30.72  ? 465 CYS A N   1 
ATOM   785  C  CA  . CYS A 1 138 ? 16.521  -31.957 -25.405 1.00 31.38  ? 465 CYS A CA  1 
ATOM   786  C  C   . CYS A 1 138 ? 16.776  -33.110 -26.349 1.00 31.08  ? 465 CYS A C   1 
ATOM   787  O  O   . CYS A 1 138 ? 16.416  -34.241 -26.011 1.00 33.79  ? 465 CYS A O   1 
ATOM   788  C  CB  . CYS A 1 138 ? 15.033  -31.512 -25.516 1.00 33.14  ? 465 CYS A CB  1 
ATOM   789  S  SG  . CYS A 1 138 ? 14.652  -31.039 -27.257 1.00 42.98  ? 465 CYS A SG  1 
ATOM   790  N  N   . ASN A 1 139 ? 17.353  -32.841 -27.529 1.00 29.86  ? 466 ASN A N   1 
ATOM   791  C  CA  . ASN A 1 139 ? 17.731  -33.945 -28.414 1.00 31.56  ? 466 ASN A CA  1 
ATOM   792  C  C   . ASN A 1 139 ? 19.100  -34.579 -28.067 1.00 31.89  ? 466 ASN A C   1 
ATOM   793  O  O   . ASN A 1 139 ? 19.591  -35.443 -28.814 1.00 34.25  ? 466 ASN A O   1 
ATOM   794  C  CB  . ASN A 1 139 ? 17.772  -33.454 -29.873 1.00 33.22  ? 466 ASN A CB  1 
ATOM   795  C  CG  . ASN A 1 139 ? 18.832  -32.363 -30.100 1.00 34.74  ? 466 ASN A CG  1 
ATOM   796  O  OD1 . ASN A 1 139 ? 19.390  -31.758 -29.155 1.00 32.04  ? 466 ASN A OD1 1 
ATOM   797  N  ND2 . ASN A 1 139 ? 19.119  -32.110 -31.372 1.00 37.24  ? 466 ASN A ND2 1 
ATOM   798  N  N   . GLY A 1 140 ? 19.731  -34.152 -26.970 1.00 30.12  ? 467 GLY A N   1 
ATOM   799  C  CA  . GLY A 1 140 ? 21.015  -34.771 -26.568 1.00 30.62  ? 467 GLY A CA  1 
ATOM   800  C  C   . GLY A 1 140 ? 22.276  -34.120 -27.150 1.00 31.24  ? 467 GLY A C   1 
ATOM   801  O  O   . GLY A 1 140 ? 23.394  -34.544 -26.848 1.00 31.52  ? 467 GLY A O   1 
ATOM   802  N  N   . VAL A 1 141 ? 22.081  -33.079 -27.973 1.00 30.23  ? 468 VAL A N   1 
ATOM   803  C  CA  . VAL A 1 141 ? 23.190  -32.344 -28.585 1.00 30.71  ? 468 VAL A CA  1 
ATOM   804  C  C   . VAL A 1 141 ? 23.865  -31.473 -27.514 1.00 29.73  ? 468 VAL A C   1 
ATOM   805  O  O   . VAL A 1 141 ? 23.180  -30.686 -26.825 1.00 27.46  ? 468 VAL A O   1 
ATOM   806  C  CB  . VAL A 1 141 ? 22.761  -31.496 -29.814 1.00 30.60  ? 468 VAL A CB  1 
ATOM   807  C  CG1 . VAL A 1 141 ? 23.881  -30.539 -30.246 1.00 31.76  ? 468 VAL A CG1 1 
ATOM   808  C  CG2 . VAL A 1 141 ? 22.415  -32.440 -30.978 1.00 31.30  ? 468 VAL A CG2 1 
ATOM   809  N  N   . VAL A 1 142 ? 25.200  -31.624 -27.405 1.00 29.88  ? 469 VAL A N   1 
ATOM   810  C  CA  . VAL A 1 142 ? 25.975  -30.836 -26.466 1.00 29.78  ? 469 VAL A CA  1 
ATOM   811  C  C   . VAL A 1 142 ? 26.736  -29.738 -27.242 1.00 30.67  ? 469 VAL A C   1 
ATOM   812  O  O   . VAL A 1 142 ? 27.475  -30.023 -28.226 1.00 31.63  ? 469 VAL A O   1 
ATOM   813  C  CB  . VAL A 1 142 ? 26.994  -31.700 -25.682 1.00 31.04  ? 469 VAL A CB  1 
ATOM   814  C  CG1 . VAL A 1 142 ? 27.839  -30.838 -24.713 1.00 30.86  ? 469 VAL A CG1 1 
ATOM   815  C  CG2 . VAL A 1 142 ? 26.288  -32.873 -24.980 1.00 30.04  ? 469 VAL A CG2 1 
ATOM   816  N  N   . LEU A 1 143 ? 26.521  -28.497 -26.796 1.00 29.51  ? 470 LEU A N   1 
ATOM   817  C  CA  . LEU A 1 143 ? 27.127  -27.333 -27.404 1.00 30.51  ? 470 LEU A CA  1 
ATOM   818  C  C   . LEU A 1 143 ? 27.729  -26.472 -26.295 1.00 30.58  ? 470 LEU A C   1 
ATOM   819  O  O   . LEU A 1 143 ? 27.156  -26.361 -25.205 1.00 28.68  ? 470 LEU A O   1 
ATOM   820  C  CB  . LEU A 1 143 ? 26.063  -26.503 -28.154 1.00 29.68  ? 470 LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 143 ? 25.450  -27.095 -29.431 1.00 30.30  ? 470 LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 143 ? 24.335  -26.180 -30.000 1.00 29.15  ? 470 LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 143 ? 26.460  -27.460 -30.534 1.00 30.99  ? 470 LEU A CD2 1 
ATOM   824  N  N   . HIS A 1 144 ? 28.853  -25.841 -26.590 1.00 31.87  ? 471 HIS A N   1 
ATOM   825  C  CA  . HIS A 1 144 ? 29.395  -24.866 -25.677 1.00 33.02  ? 471 HIS A CA  1 
ATOM   826  C  C   . HIS A 1 144 ? 28.592  -23.566 -25.684 1.00 31.81  ? 471 HIS A C   1 
ATOM   827  O  O   . HIS A 1 144 ? 28.046  -23.173 -26.727 1.00 31.08  ? 471 HIS A O   1 
ATOM   828  C  CB  . HIS A 1 144 ? 30.865  -24.554 -26.021 1.00 35.58  ? 471 HIS A CB  1 
ATOM   829  C  CG  . HIS A 1 144 ? 31.614  -23.913 -24.901 1.00 36.86  ? 471 HIS A CG  1 
ATOM   830  N  ND1 . HIS A 1 144 ? 31.653  -22.549 -24.713 1.00 37.25  ? 471 HIS A ND1 1 
ATOM   831  C  CD2 . HIS A 1 144 ? 32.380  -24.454 -23.917 1.00 38.59  ? 471 HIS A CD2 1 
ATOM   832  C  CE1 . HIS A 1 144 ? 32.396  -22.267 -23.653 1.00 39.13  ? 471 HIS A CE1 1 
ATOM   833  N  NE2 . HIS A 1 144 ? 32.860  -23.407 -23.153 1.00 39.71  ? 471 HIS A NE2 1 
ATOM   834  N  N   . ARG A 1 145 ? 28.561  -22.907 -24.523 1.00 32.36  ? 472 ARG A N   1 
ATOM   835  C  CA  . ARG A 1 145 ? 28.024  -21.566 -24.380 1.00 33.62  ? 472 ARG A CA  1 
ATOM   836  C  C   . ARG A 1 145 ? 28.493  -20.591 -25.503 1.00 34.85  ? 472 ARG A C   1 
ATOM   837  O  O   . ARG A 1 145 ? 27.695  -19.812 -26.065 1.00 35.06  ? 472 ARG A O   1 
ATOM   838  C  CB  . ARG A 1 145 ? 28.367  -21.003 -22.997 1.00 35.77  ? 472 ARG A CB  1 
ATOM   839  C  CG  . ARG A 1 145 ? 27.689  -19.653 -22.723 1.00 38.33  ? 472 ARG A CG  1 
ATOM   840  C  CD  . ARG A 1 145 ? 28.167  -18.990 -21.430 1.00 41.75  ? 472 ARG A CD  1 
ATOM   841  N  NE  . ARG A 1 145 ? 29.564  -18.627 -21.454 1.00 46.15  ? 472 ARG A NE  1 
ATOM   842  C  CZ  . ARG A 1 145 ? 30.085  -17.570 -22.104 1.00 48.88  ? 472 ARG A CZ  1 
ATOM   843  N  NH1 . ARG A 1 145 ? 29.319  -16.752 -22.846 1.00 49.44  ? 472 ARG A NH1 1 
ATOM   844  N  NH2 . ARG A 1 145 ? 31.396  -17.345 -22.022 1.00 51.06  ? 472 ARG A NH2 1 
ATOM   845  N  N   . LEU A 1 146 ? 29.767  -20.665 -25.835 1.00 36.20  ? 473 LEU A N   1 
ATOM   846  C  CA  . LEU A 1 146 ? 30.352  -19.845 -26.866 1.00 37.61  ? 473 LEU A CA  1 
ATOM   847  C  C   . LEU A 1 146 ? 29.842  -20.193 -28.266 1.00 37.00  ? 473 LEU A C   1 
ATOM   848  O  O   . LEU A 1 146 ? 29.832  -19.329 -29.166 1.00 36.59  ? 473 LEU A O   1 
ATOM   849  C  CB  . LEU A 1 146 ? 31.873  -19.936 -26.825 1.00 40.44  ? 473 LEU A CB  1 
ATOM   850  C  CG  . LEU A 1 146 ? 32.628  -19.019 -25.895 1.00 42.55  ? 473 LEU A CG  1 
ATOM   851  C  CD1 . LEU A 1 146 ? 34.115  -19.338 -26.040 1.00 44.82  ? 473 LEU A CD1 1 
ATOM   852  C  CD2 . LEU A 1 146 ? 32.306  -17.547 -26.125 1.00 43.00  ? 473 LEU A CD2 1 
ATOM   853  N  N   . GLN A 1 147 ? 29.412  -21.439 -28.457 1.00 34.98  ? 474 GLN A N   1 
ATOM   854  C  CA  . GLN A 1 147 ? 28.719  -21.797 -29.686 1.00 35.19  ? 474 GLN A CA  1 
ATOM   855  C  C   . GLN A 1 147 ? 27.292  -21.254 -29.738 1.00 34.51  ? 474 GLN A C   1 
ATOM   856  O  O   . GLN A 1 147 ? 26.780  -21.034 -30.805 1.00 36.14  ? 474 GLN A O   1 
ATOM   857  C  CB  . GLN A 1 147 ? 28.682  -23.296 -29.870 1.00 34.18  ? 474 GLN A CB  1 
ATOM   858  C  CG  . GLN A 1 147 ? 30.020  -23.923 -30.171 1.00 35.15  ? 474 GLN A CG  1 
ATOM   859  C  CD  . GLN A 1 147 ? 29.857  -25.407 -30.282 1.00 34.59  ? 474 GLN A CD  1 
ATOM   860  O  OE1 . GLN A 1 147 ? 29.655  -26.106 -29.269 1.00 33.24  ? 474 GLN A OE1 1 
ATOM   861  N  NE2 . GLN A 1 147 ? 29.893  -25.904 -31.514 1.00 34.97  ? 474 GLN A NE2 1 
ATOM   862  N  N   . CYS A 1 148 ? 26.656  -21.058 -28.602 1.00 33.86  ? 475 CYS A N   1 
ATOM   863  C  CA  . CYS A 1 148 ? 25.234  -20.624 -28.540 1.00 33.08  ? 475 CYS A CA  1 
ATOM   864  C  C   . CYS A 1 148 ? 25.030  -19.116 -28.707 1.00 33.51  ? 475 CYS A C   1 
ATOM   865  O  O   . CYS A 1 148 ? 23.941  -18.640 -29.002 1.00 32.45  ? 475 CYS A O   1 
ATOM   866  C  CB  . CYS A 1 148 ? 24.639  -21.109 -27.230 1.00 31.95  ? 475 CYS A CB  1 
ATOM   867  S  SG  . CYS A 1 148 ? 24.579  -22.908 -27.252 1.00 32.78  ? 475 CYS A SG  1 
ATOM   868  N  N   . VAL A 1 149 ? 26.111  -18.387 -28.471 1.00 36.11  ? 476 VAL A N   1 
ATOM   869  C  CA  . VAL A 1 149 ? 26.134  -16.929 -28.418 1.00 36.07  ? 476 VAL A CA  1 
ATOM   870  C  C   . VAL A 1 149 ? 25.628  -16.307 -29.727 1.00 35.66  ? 476 VAL A C   1 
ATOM   871  O  O   . VAL A 1 149 ? 24.804  -15.396 -29.708 1.00 34.62  ? 476 VAL A O   1 
ATOM   872  C  CB  . VAL A 1 149 ? 27.556  -16.472 -27.993 1.00 39.13  ? 476 VAL A CB  1 
ATOM   873  C  CG1 . VAL A 1 149 ? 28.032  -15.253 -28.773 1.00 40.78  ? 476 VAL A CG1 1 
ATOM   874  C  CG2 . VAL A 1 149 ? 27.545  -16.222 -26.484 1.00 39.35  ? 476 VAL A CG2 1 
ATOM   875  N  N   . ARG A 1 150 ? 26.039  -16.842 -30.858 1.00 36.53  ? 477 ARG A N   1 
ATOM   876  C  CA  . ARG A 1 150 ? 25.577  -16.300 -32.132 1.00 38.09  ? 477 ARG A CA  1 
ATOM   877  C  C   . ARG A 1 150 ? 24.071  -16.480 -32.411 1.00 36.30  ? 477 ARG A C   1 
ATOM   878  O  O   . ARG A 1 150 ? 23.466  -15.606 -33.028 1.00 35.17  ? 477 ARG A O   1 
ATOM   879  C  CB  . ARG A 1 150 ? 26.436  -16.791 -33.287 1.00 42.45  ? 477 ARG A CB  1 
ATOM   880  C  CG  . ARG A 1 150 ? 27.756  -15.964 -33.330 1.00 48.19  ? 477 ARG A CG  1 
ATOM   881  C  CD  . ARG A 1 150 ? 28.868  -16.576 -34.149 1.00 51.98  ? 477 ARG A CD  1 
ATOM   882  N  NE  . ARG A 1 150 ? 28.611  -16.446 -35.582 1.00 57.75  ? 477 ARG A NE  1 
ATOM   883  C  CZ  . ARG A 1 150 ? 29.436  -16.837 -36.568 1.00 61.46  ? 477 ARG A CZ  1 
ATOM   884  N  NH1 . ARG A 1 150 ? 30.621  -17.401 -36.302 1.00 64.37  ? 477 ARG A NH1 1 
ATOM   885  N  NH2 . ARG A 1 150 ? 29.057  -16.663 -37.834 1.00 61.17  ? 477 ARG A NH2 1 
ATOM   886  N  N   . GLY A 1 151 ? 23.473  -17.576 -31.935 1.00 33.60  ? 478 GLY A N   1 
ATOM   887  C  CA  . GLY A 1 151 ? 22.031  -17.813 -32.129 1.00 32.71  ? 478 GLY A CA  1 
ATOM   888  C  C   . GLY A 1 151 ? 21.170  -17.174 -31.030 1.00 31.18  ? 478 GLY A C   1 
ATOM   889  O  O   . GLY A 1 151 ? 20.190  -16.472 -31.317 1.00 30.26  ? 478 GLY A O   1 
ATOM   890  N  N   . PHE A 1 152 ? 21.592  -17.396 -29.784 1.00 30.34  ? 479 PHE A N   1 
ATOM   891  C  CA  . PHE A 1 152 ? 20.862  -17.018 -28.580 1.00 29.66  ? 479 PHE A CA  1 
ATOM   892  C  C   . PHE A 1 152 ? 21.148  -15.596 -28.115 1.00 31.04  ? 479 PHE A C   1 
ATOM   893  O  O   . PHE A 1 152 ? 20.408  -15.054 -27.287 1.00 30.05  ? 479 PHE A O   1 
ATOM   894  C  CB  . PHE A 1 152 ? 21.220  -17.980 -27.424 1.00 29.61  ? 479 PHE A CB  1 
ATOM   895  C  CG  . PHE A 1 152 ? 20.575  -19.347 -27.520 1.00 29.50  ? 479 PHE A CG  1 
ATOM   896  C  CD1 . PHE A 1 152 ? 19.502  -19.686 -26.680 1.00 28.86  ? 479 PHE A CD1 1 
ATOM   897  C  CD2 . PHE A 1 152 ? 21.064  -20.313 -28.430 1.00 29.19  ? 479 PHE A CD2 1 
ATOM   898  C  CE1 . PHE A 1 152 ? 18.926  -20.978 -26.762 1.00 28.94  ? 479 PHE A CE1 1 
ATOM   899  C  CE2 . PHE A 1 152 ? 20.485  -21.569 -28.523 1.00 29.10  ? 479 PHE A CE2 1 
ATOM   900  C  CZ  . PHE A 1 152 ? 19.408  -21.916 -27.686 1.00 28.48  ? 479 PHE A CZ  1 
ATOM   901  N  N   . GLY A 1 153 ? 22.250  -15.001 -28.588 1.00 32.59  ? 480 GLY A N   1 
ATOM   902  C  CA  . GLY A 1 153 ? 22.711  -13.712 -28.050 1.00 33.77  ? 480 GLY A CA  1 
ATOM   903  C  C   . GLY A 1 153 ? 22.989  -13.810 -26.557 1.00 34.29  ? 480 GLY A C   1 
ATOM   904  O  O   . GLY A 1 153 ? 23.353  -14.909 -26.090 1.00 34.73  ? 480 GLY A O   1 
ATOM   905  N  N   . GLU A 1 154 ? 22.699  -12.734 -25.824 1.00 34.72  ? 481 GLU A N   1 
ATOM   906  C  CA  . GLU A 1 154 ? 22.934  -12.639 -24.384 1.00 37.92  ? 481 GLU A CA  1 
ATOM   907  C  C   . GLU A 1 154 ? 22.126  -13.623 -23.553 1.00 35.16  ? 481 GLU A C   1 
ATOM   908  O  O   . GLU A 1 154 ? 22.538  -14.007 -22.472 1.00 36.43  ? 481 GLU A O   1 
ATOM   909  C  CB  . GLU A 1 154 ? 22.561  -11.239 -23.864 1.00 41.92  ? 481 GLU A CB  1 
ATOM   910  C  CG  . GLU A 1 154 ? 23.603  -10.164 -24.036 1.00 48.95  ? 481 GLU A CG  1 
ATOM   911  C  CD  . GLU A 1 154 ? 23.007  -8.748  -23.854 1.00 55.24  ? 481 GLU A CD  1 
ATOM   912  O  OE1 . GLU A 1 154 ? 23.382  -7.857  -24.672 1.00 59.53  ? 481 GLU A OE1 1 
ATOM   913  O  OE2 . GLU A 1 154 ? 22.165  -8.505  -22.921 1.00 54.81  ? 481 GLU A OE2 1 
ATOM   914  N  N   . TRP A 1 155 ? 20.944  -13.950 -24.044 1.00 32.29  ? 482 TRP A N   1 
ATOM   915  C  CA  . TRP A 1 155 ? 20.034  -14.863 -23.356 1.00 30.36  ? 482 TRP A CA  1 
ATOM   916  C  C   . TRP A 1 155 ? 20.739  -16.157 -22.885 1.00 30.94  ? 482 TRP A C   1 
ATOM   917  O  O   . TRP A 1 155 ? 20.468  -16.622 -21.760 1.00 31.41  ? 482 TRP A O   1 
ATOM   918  C  CB  . TRP A 1 155 ? 18.846  -15.179 -24.263 1.00 28.28  ? 482 TRP A CB  1 
ATOM   919  C  CG  . TRP A 1 155 ? 17.734  -15.965 -23.631 1.00 26.23  ? 482 TRP A CG  1 
ATOM   920  C  CD1 . TRP A 1 155 ? 17.293  -15.906 -22.325 1.00 25.95  ? 482 TRP A CD1 1 
ATOM   921  C  CD2 . TRP A 1 155 ? 16.877  -16.896 -24.301 1.00 24.79  ? 482 TRP A CD2 1 
ATOM   922  N  NE1 . TRP A 1 155 ? 16.226  -16.759 -22.165 1.00 25.36  ? 482 TRP A NE1 1 
ATOM   923  C  CE2 . TRP A 1 155 ? 15.949  -17.371 -23.358 1.00 23.86  ? 482 TRP A CE2 1 
ATOM   924  C  CE3 . TRP A 1 155 ? 16.799  -17.358 -25.629 1.00 24.33  ? 482 TRP A CE3 1 
ATOM   925  C  CZ2 . TRP A 1 155 ? 14.942  -18.299 -23.691 1.00 23.82  ? 482 TRP A CZ2 1 
ATOM   926  C  CZ3 . TRP A 1 155 ? 15.851  -18.269 -25.956 1.00 23.55  ? 482 TRP A CZ3 1 
ATOM   927  C  CH2 . TRP A 1 155 ? 14.891  -18.728 -24.994 1.00 23.67  ? 482 TRP A CH2 1 
ATOM   928  N  N   . ILE A 1 156 ? 21.694  -16.678 -23.677 1.00 30.01  ? 483 ILE A N   1 
ATOM   929  C  CA  . ILE A 1 156 ? 22.390  -17.904 -23.267 1.00 29.38  ? 483 ILE A CA  1 
ATOM   930  C  C   . ILE A 1 156 ? 23.182  -17.712 -21.962 1.00 31.22  ? 483 ILE A C   1 
ATOM   931  O  O   . ILE A 1 156 ? 23.161  -18.587 -21.102 1.00 29.81  ? 483 ILE A O   1 
ATOM   932  C  CB  . ILE A 1 156 ? 23.203  -18.601 -24.402 1.00 29.66  ? 483 ILE A CB  1 
ATOM   933  C  CG1 . ILE A 1 156 ? 23.407  -20.107 -24.066 1.00 29.09  ? 483 ILE A CG1 1 
ATOM   934  C  CG2 . ILE A 1 156 ? 24.548  -17.911 -24.699 1.00 31.07  ? 483 ILE A CG2 1 
ATOM   935  C  CD1 . ILE A 1 156 ? 22.145  -20.946 -24.115 1.00 27.73  ? 483 ILE A CD1 1 
ATOM   936  N  N   . ASP A 1 157 ? 23.815  -16.540 -21.815 1.00 34.01  ? 484 ASP A N   1 
ATOM   937  C  CA  . ASP A 1 157 ? 24.507  -16.154 -20.584 1.00 36.20  ? 484 ASP A CA  1 
ATOM   938  C  C   . ASP A 1 157 ? 23.566  -16.121 -19.377 1.00 34.94  ? 484 ASP A C   1 
ATOM   939  O  O   . ASP A 1 157 ? 23.908  -16.623 -18.336 1.00 35.12  ? 484 ASP A O   1 
ATOM   940  C  CB  . ASP A 1 157 ? 25.193  -14.788 -20.743 1.00 39.67  ? 484 ASP A CB  1 
ATOM   941  C  CG  . ASP A 1 157 ? 26.375  -14.827 -21.719 1.00 42.66  ? 484 ASP A CG  1 
ATOM   942  O  OD1 . ASP A 1 157 ? 26.863  -15.921 -22.039 1.00 42.85  ? 484 ASP A OD1 1 
ATOM   943  O  OD2 . ASP A 1 157 ? 26.854  -13.752 -22.163 1.00 47.23  ? 484 ASP A OD2 1 
ATOM   944  N  N   . SER A 1 158 ? 22.375  -15.542 -19.534 1.00 33.45  ? 485 SER A N   1 
ATOM   945  C  CA  . SER A 1 158 ? 21.346  -15.597 -18.481 1.00 33.52  ? 485 SER A CA  1 
ATOM   946  C  C   . SER A 1 158 ? 20.936  -17.039 -18.148 1.00 30.91  ? 485 SER A C   1 
ATOM   947  O  O   . SER A 1 158 ? 20.777  -17.389 -16.993 1.00 31.20  ? 485 SER A O   1 
ATOM   948  C  CB  . SER A 1 158 ? 20.099  -14.819 -18.889 1.00 32.40  ? 485 SER A CB  1 
ATOM   949  O  OG  . SER A 1 158 ? 20.471  -13.477 -19.117 1.00 34.56  ? 485 SER A OG  1 
ATOM   950  N  N   . ILE A 1 159 ? 20.789  -17.866 -19.172 1.00 29.45  ? 486 ILE A N   1 
ATOM   951  C  CA  . ILE A 1 159 ? 20.448  -19.282 -18.989 1.00 28.68  ? 486 ILE A CA  1 
ATOM   952  C  C   . ILE A 1 159 ? 21.515  -20.014 -18.148 1.00 30.73  ? 486 ILE A C   1 
ATOM   953  O  O   . ILE A 1 159 ? 21.163  -20.743 -17.203 1.00 32.05  ? 486 ILE A O   1 
ATOM   954  C  CB  . ILE A 1 159 ? 20.132  -19.968 -20.335 1.00 26.94  ? 486 ILE A CB  1 
ATOM   955  C  CG1 . ILE A 1 159 ? 18.794  -19.394 -20.899 1.00 26.31  ? 486 ILE A CG1 1 
ATOM   956  C  CG2 . ILE A 1 159 ? 20.095  -21.503 -20.192 1.00 24.60  ? 486 ILE A CG2 1 
ATOM   957  C  CD1 . ILE A 1 159 ? 18.486  -19.697 -22.361 1.00 25.44  ? 486 ILE A CD1 1 
ATOM   958  N  N   . VAL A 1 160 ? 22.786  -19.795 -18.463 1.00 32.72  ? 487 VAL A N   1 
ATOM   959  C  CA  . VAL A 1 160 ? 23.882  -20.495 -17.795 1.00 34.59  ? 487 VAL A CA  1 
ATOM   960  C  C   . VAL A 1 160 ? 23.974  -20.065 -16.315 1.00 36.84  ? 487 VAL A C   1 
ATOM   961  O  O   . VAL A 1 160 ? 24.199  -20.896 -15.421 1.00 36.98  ? 487 VAL A O   1 
ATOM   962  C  CB  . VAL A 1 160 ? 25.214  -20.249 -18.532 1.00 36.45  ? 487 VAL A CB  1 
ATOM   963  C  CG1 . VAL A 1 160 ? 26.428  -20.691 -17.688 1.00 37.28  ? 487 VAL A CG1 1 
ATOM   964  C  CG2 . VAL A 1 160 ? 25.210  -20.948 -19.879 1.00 36.10  ? 487 VAL A CG2 1 
ATOM   965  N  N   . GLU A 1 161 ? 23.789  -18.766 -16.084 1.00 38.33  ? 488 GLU A N   1 
ATOM   966  C  CA  . GLU A 1 161 ? 23.749  -18.183 -14.749 1.00 41.22  ? 488 GLU A CA  1 
ATOM   967  C  C   . GLU A 1 161 ? 22.644  -18.818 -13.909 1.00 38.48  ? 488 GLU A C   1 
ATOM   968  O  O   . GLU A 1 161 ? 22.894  -19.259 -12.797 1.00 39.88  ? 488 GLU A O   1 
ATOM   969  C  CB  . GLU A 1 161 ? 23.587  -16.659 -14.868 1.00 45.38  ? 488 GLU A CB  1 
ATOM   970  C  CG  . GLU A 1 161 ? 23.099  -15.924 -13.623 1.00 54.11  ? 488 GLU A CG  1 
ATOM   971  C  CD  . GLU A 1 161 ? 24.219  -15.299 -12.804 1.00 63.59  ? 488 GLU A CD  1 
ATOM   972  O  OE1 . GLU A 1 161 ? 24.849  -14.340 -13.338 1.00 67.26  ? 488 GLU A OE1 1 
ATOM   973  O  OE2 . GLU A 1 161 ? 24.461  -15.736 -11.631 1.00 69.74  ? 488 GLU A OE2 1 
ATOM   974  N  N   . PHE A 1 162 ? 21.432  -18.871 -14.461 1.00 35.02  ? 489 PHE A N   1 
ATOM   975  C  CA  . PHE A 1 162 ? 20.301  -19.524 -13.811 1.00 32.93  ? 489 PHE A CA  1 
ATOM   976  C  C   . PHE A 1 162 ? 20.564  -21.006 -13.568 1.00 31.37  ? 489 PHE A C   1 
ATOM   977  O  O   . PHE A 1 162 ? 20.205  -21.513 -12.502 1.00 30.98  ? 489 PHE A O   1 
ATOM   978  C  CB  . PHE A 1 162 ? 19.035  -19.371 -14.652 1.00 31.91  ? 489 PHE A CB  1 
ATOM   979  C  CG  . PHE A 1 162 ? 17.813  -19.987 -14.020 1.00 31.43  ? 489 PHE A CG  1 
ATOM   980  C  CD1 . PHE A 1 162 ? 17.198  -19.394 -12.881 1.00 32.91  ? 489 PHE A CD1 1 
ATOM   981  C  CD2 . PHE A 1 162 ? 17.282  -21.172 -14.540 1.00 29.64  ? 489 PHE A CD2 1 
ATOM   982  C  CE1 . PHE A 1 162 ? 16.073  -19.991 -12.312 1.00 33.29  ? 489 PHE A CE1 1 
ATOM   983  C  CE2 . PHE A 1 162 ? 16.162  -21.774 -13.958 1.00 29.95  ? 489 PHE A CE2 1 
ATOM   984  C  CZ  . PHE A 1 162 ? 15.553  -21.186 -12.842 1.00 30.66  ? 489 PHE A CZ  1 
ATOM   985  N  N   . SER A 1 163 ? 21.153  -21.690 -14.558 1.00 29.35  ? 490 SER A N   1 
ATOM   986  C  CA  . SER A 1 163 ? 21.574  -23.101 -14.427 1.00 30.26  ? 490 SER A CA  1 
ATOM   987  C  C   . SER A 1 163 ? 22.460  -23.288 -13.177 1.00 31.72  ? 490 SER A C   1 
ATOM   988  O  O   . SER A 1 163 ? 22.192  -24.164 -12.332 1.00 30.98  ? 490 SER A O   1 
ATOM   989  C  CB  . SER A 1 163 ? 22.294  -23.560 -15.697 1.00 29.13  ? 490 SER A CB  1 
ATOM   990  O  OG  . SER A 1 163 ? 22.650  -24.925 -15.644 1.00 29.45  ? 490 SER A OG  1 
ATOM   991  N  N   . SER A 1 164 ? 23.474  -22.427 -13.071 1.00 34.04  ? 491 SER A N   1 
ATOM   992  C  CA  . SER A 1 164 ? 24.390  -22.395 -11.952 1.00 37.11  ? 491 SER A CA  1 
ATOM   993  C  C   . SER A 1 164 ? 23.662  -22.237 -10.637 1.00 36.68  ? 491 SER A C   1 
ATOM   994  O  O   . SER A 1 164 ? 23.833  -23.048 -9.742  1.00 36.15  ? 491 SER A O   1 
ATOM   995  C  CB  . SER A 1 164 ? 25.387  -21.243 -12.136 1.00 41.23  ? 491 SER A CB  1 
ATOM   996  O  OG  . SER A 1 164 ? 26.369  -21.604 -13.071 1.00 44.00  ? 491 SER A OG  1 
ATOM   997  N  N   . ASN A 1 165 ? 22.821  -21.210 -10.547 1.00 37.39  ? 492 ASN A N   1 
ATOM   998  C  CA  . ASN A 1 165 ? 21.976  -21.010 -9.359  1.00 40.12  ? 492 ASN A CA  1 
ATOM   999  C  C   . ASN A 1 165 ? 21.022  -22.172 -9.059  1.00 38.84  ? 492 ASN A C   1 
ATOM   1000 O  O   . ASN A 1 165 ? 20.850  -22.548 -7.889  1.00 40.58  ? 492 ASN A O   1 
ATOM   1001 C  CB  . ASN A 1 165 ? 21.220  -19.671 -9.417  1.00 41.93  ? 492 ASN A CB  1 
ATOM   1002 C  CG  . ASN A 1 165 ? 22.163  -18.469 -9.488  1.00 45.53  ? 492 ASN A CG  1 
ATOM   1003 O  OD1 . ASN A 1 165 ? 21.847  -17.471 -10.110 1.00 48.17  ? 492 ASN A OD1 1 
ATOM   1004 N  ND2 . ASN A 1 165 ? 23.327  -18.575 -8.862  1.00 48.32  ? 492 ASN A ND2 1 
ATOM   1005 N  N   . LEU A 1 166 ? 20.461  -22.765 -10.101 1.00 36.12  ? 493 LEU A N   1 
ATOM   1006 C  CA  . LEU A 1 166 ? 19.510  -23.868 -9.935  1.00 36.61  ? 493 LEU A CA  1 
ATOM   1007 C  C   . LEU A 1 166 ? 20.227  -25.101 -9.362  1.00 37.64  ? 493 LEU A C   1 
ATOM   1008 O  O   . LEU A 1 166 ? 19.754  -25.729 -8.397  1.00 38.51  ? 493 LEU A O   1 
ATOM   1009 C  CB  . LEU A 1 166 ? 18.824  -24.195 -11.267 1.00 34.24  ? 493 LEU A CB  1 
ATOM   1010 C  CG  . LEU A 1 166 ? 17.606  -25.125 -11.349 1.00 34.87  ? 493 LEU A CG  1 
ATOM   1011 C  CD1 . LEU A 1 166 ? 16.356  -24.520 -10.674 1.00 33.16  ? 493 LEU A CD1 1 
ATOM   1012 C  CD2 . LEU A 1 166 ? 17.368  -25.482 -12.835 1.00 31.97  ? 493 LEU A CD2 1 
ATOM   1013 N  N   . GLN A 1 167 ? 21.377  -25.414 -9.944  1.00 38.05  ? 494 GLN A N   1 
ATOM   1014 C  CA  . GLN A 1 167 ? 22.128  -26.595 -9.561  1.00 38.89  ? 494 GLN A CA  1 
ATOM   1015 C  C   . GLN A 1 167 ? 22.763  -26.490 -8.190  1.00 40.73  ? 494 GLN A C   1 
ATOM   1016 O  O   . GLN A 1 167 ? 22.842  -27.493 -7.481  1.00 41.08  ? 494 GLN A O   1 
ATOM   1017 C  CB  . GLN A 1 167 ? 23.109  -26.989 -10.669 1.00 39.38  ? 494 GLN A CB  1 
ATOM   1018 C  CG  . GLN A 1 167 ? 22.304  -27.634 -11.812 1.00 38.11  ? 494 GLN A CG  1 
ATOM   1019 C  CD  . GLN A 1 167 ? 23.138  -28.154 -12.973 1.00 39.14  ? 494 GLN A CD  1 
ATOM   1020 O  OE1 . GLN A 1 167 ? 22.664  -28.210 -14.112 1.00 40.58  ? 494 GLN A OE1 1 
ATOM   1021 N  NE2 . GLN A 1 167 ? 24.379  -28.536 -12.706 1.00 39.92  ? 494 GLN A NE2 1 
ATOM   1022 N  N   . ASN A 1 168 ? 23.140  -25.275 -7.785  1.00 41.61  ? 495 ASN A N   1 
ATOM   1023 C  CA  . ASN A 1 168 ? 23.547  -25.005 -6.405  1.00 43.88  ? 495 ASN A CA  1 
ATOM   1024 C  C   . ASN A 1 168 ? 22.512  -25.383 -5.351  1.00 42.64  ? 495 ASN A C   1 
ATOM   1025 O  O   . ASN A 1 168 ? 22.861  -25.602 -4.191  1.00 43.55  ? 495 ASN A O   1 
ATOM   1026 C  CB  . ASN A 1 168 ? 23.881  -23.525 -6.239  1.00 47.58  ? 495 ASN A CB  1 
ATOM   1027 C  CG  . ASN A 1 168 ? 25.287  -23.188 -6.681  1.00 51.15  ? 495 ASN A CG  1 
ATOM   1028 O  OD1 . ASN A 1 168 ? 25.623  -22.011 -6.817  1.00 53.63  ? 495 ASN A OD1 1 
ATOM   1029 N  ND2 . ASN A 1 168 ? 26.118  -24.214 -6.909  1.00 52.27  ? 495 ASN A ND2 1 
ATOM   1030 N  N   . MET A 1 169 ? 21.250  -25.476 -5.752  1.00 40.25  ? 496 MET A N   1 
ATOM   1031 C  CA  . MET A 1 169 ? 20.218  -25.875 -4.815  1.00 40.80  ? 496 MET A CA  1 
ATOM   1032 C  C   . MET A 1 169 ? 20.083  -27.374 -4.584  1.00 39.33  ? 496 MET A C   1 
ATOM   1033 O  O   . MET A 1 169 ? 19.350  -27.766 -3.670  1.00 39.88  ? 496 MET A O   1 
ATOM   1034 C  CB  . MET A 1 169 ? 18.894  -25.282 -5.226  1.00 40.71  ? 496 MET A CB  1 
ATOM   1035 C  CG  . MET A 1 169 ? 18.879  -23.762 -5.174  1.00 43.46  ? 496 MET A CG  1 
ATOM   1036 S  SD  . MET A 1 169 ? 17.158  -23.294 -5.378  1.00 45.85  ? 496 MET A SD  1 
ATOM   1037 C  CE  . MET A 1 169 ? 16.351  -23.926 -3.882  1.00 47.32  ? 496 MET A CE  1 
ATOM   1038 N  N   . ASN A 1 170 ? 20.779  -28.199 -5.388  1.00 37.68  ? 497 ASN A N   1 
ATOM   1039 C  CA  . ASN A 1 170 ? 20.779  -29.671 -5.254  1.00 36.80  ? 497 ASN A CA  1 
ATOM   1040 C  C   . ASN A 1 170 ? 19.369  -30.232 -5.251  1.00 34.15  ? 497 ASN A C   1 
ATOM   1041 O  O   . ASN A 1 170 ? 18.918  -30.852 -4.296  1.00 34.53  ? 497 ASN A O   1 
ATOM   1042 C  CB  . ASN A 1 170 ? 21.555  -30.118 -4.020  1.00 39.77  ? 497 ASN A CB  1 
ATOM   1043 C  CG  . ASN A 1 170 ? 23.017  -29.723 -4.086  1.00 43.69  ? 497 ASN A CG  1 
ATOM   1044 O  OD1 . ASN A 1 170 ? 23.548  -29.080 -3.162  1.00 47.15  ? 497 ASN A OD1 1 
ATOM   1045 N  ND2 . ASN A 1 170 ? 23.679  -30.080 -5.186  1.00 42.78  ? 497 ASN A ND2 1 
ATOM   1046 N  N   . ILE A 1 171 ? 18.666  -29.984 -6.336  1.00 31.69  ? 498 ILE A N   1 
ATOM   1047 C  CA  . ILE A 1 171 ? 17.290  -30.396 -6.462  1.00 30.38  ? 498 ILE A CA  1 
ATOM   1048 C  C   . ILE A 1 171 ? 17.334  -31.774 -7.097  1.00 29.64  ? 498 ILE A C   1 
ATOM   1049 O  O   . ILE A 1 171 ? 17.849  -31.935 -8.236  1.00 29.36  ? 498 ILE A O   1 
ATOM   1050 C  CB  . ILE A 1 171 ? 16.513  -29.379 -7.330  1.00 28.94  ? 498 ILE A CB  1 
ATOM   1051 C  CG1 . ILE A 1 171 ? 16.653  -27.950 -6.741  1.00 29.85  ? 498 ILE A CG1 1 
ATOM   1052 C  CG2 . ILE A 1 171 ? 15.055  -29.823 -7.582  1.00 26.94  ? 498 ILE A CG2 1 
ATOM   1053 C  CD1 . ILE A 1 171 ? 16.318  -26.862 -7.771  1.00 29.70  ? 498 ILE A CD1 1 
ATOM   1054 N  N   . ASP A 1 172 ? 16.824  -32.771 -6.367  1.00 30.25  ? 499 ASP A N   1 
ATOM   1055 C  CA  . ASP A 1 172 ? 16.845  -34.144 -6.880  1.00 29.83  ? 499 ASP A CA  1 
ATOM   1056 C  C   . ASP A 1 172 ? 15.821  -34.290 -8.011  1.00 28.53  ? 499 ASP A C   1 
ATOM   1057 O  O   . ASP A 1 172 ? 14.988  -33.401 -8.225  1.00 28.54  ? 499 ASP A O   1 
ATOM   1058 C  CB  . ASP A 1 172 ? 16.690  -35.194 -5.768  1.00 30.33  ? 499 ASP A CB  1 
ATOM   1059 C  CG  . ASP A 1 172 ? 15.323  -35.182 -5.081  1.00 31.33  ? 499 ASP A CG  1 
ATOM   1060 O  OD1 . ASP A 1 172 ? 15.223  -35.604 -3.900  1.00 33.78  ? 499 ASP A OD1 1 
ATOM   1061 O  OD2 . ASP A 1 172 ? 14.327  -34.727 -5.619  1.00 30.13  ? 499 ASP A OD2 1 
ATOM   1062 N  N   . ILE A 1 173 ? 15.892  -35.401 -8.722  1.00 27.98  ? 500 ILE A N   1 
ATOM   1063 C  CA  . ILE A 1 173 ? 15.042  -35.661 -9.877  1.00 27.15  ? 500 ILE A CA  1 
ATOM   1064 C  C   . ILE A 1 173 ? 13.551  -35.591 -9.544  1.00 26.20  ? 500 ILE A C   1 
ATOM   1065 O  O   . ILE A 1 173 ? 12.791  -34.993 -10.297 1.00 25.57  ? 500 ILE A O   1 
ATOM   1066 C  CB  . ILE A 1 173 ? 15.463  -36.961 -10.623 1.00 27.32  ? 500 ILE A CB  1 
ATOM   1067 C  CG1 . ILE A 1 173 ? 16.830  -36.711 -11.283 1.00 27.32  ? 500 ILE A CG1 1 
ATOM   1068 C  CG2 . ILE A 1 173 ? 14.427  -37.341 -11.717 1.00 26.04  ? 500 ILE A CG2 1 
ATOM   1069 C  CD1 . ILE A 1 173 ? 17.610  -37.971 -11.616 1.00 28.73  ? 500 ILE A CD1 1 
ATOM   1070 N  N   . SER A 1 174 ? 13.171  -36.146 -8.388  1.00 26.57  ? 501 SER A N   1 
ATOM   1071 C  CA  . SER A 1 174 ? 11.774  -36.180 -7.983  1.00 27.00  ? 501 SER A CA  1 
ATOM   1072 C  C   . SER A 1 174 ? 11.262  -34.765 -7.705  1.00 26.80  ? 501 SER A C   1 
ATOM   1073 O  O   . SER A 1 174 ? 10.206  -34.414 -8.202  1.00 26.85  ? 501 SER A O   1 
ATOM   1074 C  CB  . SER A 1 174 ? 11.524  -37.094 -6.779  1.00 28.62  ? 501 SER A CB  1 
ATOM   1075 O  OG  . SER A 1 174 ? 11.808  -38.436 -7.122  1.00 30.16  ? 501 SER A OG  1 
ATOM   1076 N  N   . ALA A 1 175 ? 12.014  -33.962 -6.953  1.00 26.29  ? 502 ALA A N   1 
ATOM   1077 C  CA  . ALA A 1 175 ? 11.625  -32.569 -6.689  1.00 26.11  ? 502 ALA A CA  1 
ATOM   1078 C  C   . ALA A 1 175 ? 11.572  -31.747 -7.972  1.00 25.46  ? 502 ALA A C   1 
ATOM   1079 O  O   . ALA A 1 175 ? 10.619  -30.954 -8.161  1.00 25.00  ? 502 ALA A O   1 
ATOM   1080 C  CB  . ALA A 1 175 ? 12.521  -31.905 -5.653  1.00 26.39  ? 502 ALA A CB  1 
ATOM   1081 N  N   . PHE A 1 176 ? 12.562  -31.936 -8.858  1.00 23.65  ? 503 PHE A N   1 
ATOM   1082 C  CA  . PHE A 1 176 ? 12.565  -31.212 -10.110 1.00 23.08  ? 503 PHE A CA  1 
ATOM   1083 C  C   . PHE A 1 176 ? 11.332  -31.547 -10.978 1.00 22.95  ? 503 PHE A C   1 
ATOM   1084 O  O   . PHE A 1 176 ? 10.744  -30.643 -11.623 1.00 22.13  ? 503 PHE A O   1 
ATOM   1085 C  CB  . PHE A 1 176 ? 13.855  -31.470 -10.931 1.00 22.62  ? 503 PHE A CB  1 
ATOM   1086 C  CG  . PHE A 1 176 ? 13.860  -30.701 -12.199 1.00 22.62  ? 503 PHE A CG  1 
ATOM   1087 C  CD1 . PHE A 1 176 ? 14.151  -29.310 -12.179 1.00 22.85  ? 503 PHE A CD1 1 
ATOM   1088 C  CD2 . PHE A 1 176 ? 13.421  -31.281 -13.379 1.00 21.74  ? 503 PHE A CD2 1 
ATOM   1089 C  CE1 . PHE A 1 176 ? 14.080  -28.572 -13.351 1.00 23.06  ? 503 PHE A CE1 1 
ATOM   1090 C  CE2 . PHE A 1 176 ? 13.339  -30.512 -14.543 1.00 21.49  ? 503 PHE A CE2 1 
ATOM   1091 C  CZ  . PHE A 1 176 ? 13.687  -29.172 -14.545 1.00 21.58  ? 503 PHE A CZ  1 
ATOM   1092 N  N   . SER A 1 177 ? 10.983  -32.835 -11.027 1.00 22.74  ? 504 SER A N   1 
ATOM   1093 C  CA  . SER A 1 177 ? 9.845   -33.281 -11.814 1.00 23.30  ? 504 SER A CA  1 
ATOM   1094 C  C   . SER A 1 177 ? 8.571   -32.553 -11.377 1.00 23.30  ? 504 SER A C   1 
ATOM   1095 O  O   . SER A 1 177 ? 7.761   -32.258 -12.217 1.00 22.94  ? 504 SER A O   1 
ATOM   1096 C  CB  . SER A 1 177 ? 9.640   -34.805 -11.717 1.00 23.23  ? 504 SER A CB  1 
ATOM   1097 O  OG  . SER A 1 177 ? 10.788  -35.466 -12.248 1.00 25.81  ? 504 SER A OG  1 
ATOM   1098 N  N   . CYS A 1 178 ? 8.424   -32.313 -10.065 1.00 23.97  ? 505 CYS A N   1 
ATOM   1099 C  CA  . CYS A 1 178 ? 7.289   -31.586 -9.495  1.00 24.88  ? 505 CYS A CA  1 
ATOM   1100 C  C   . CYS A 1 178 ? 7.305   -30.112 -9.876  1.00 24.35  ? 505 CYS A C   1 
ATOM   1101 O  O   . CYS A 1 178 ? 6.271   -29.556 -10.270 1.00 23.97  ? 505 CYS A O   1 
ATOM   1102 C  CB  . CYS A 1 178 ? 7.271   -31.699 -7.966  1.00 25.71  ? 505 CYS A CB  1 
ATOM   1103 S  SG  . CYS A 1 178 ? 6.958   -33.390 -7.331  1.00 27.53  ? 505 CYS A SG  1 
ATOM   1104 N  N   . ILE A 1 179 ? 8.471   -29.498 -9.762  1.00 24.45  ? 506 ILE A N   1 
ATOM   1105 C  CA  . ILE A 1 179 ? 8.687   -28.057 -10.047 1.00 25.47  ? 506 ILE A CA  1 
ATOM   1106 C  C   . ILE A 1 179 ? 8.398   -27.740 -11.520 1.00 23.64  ? 506 ILE A C   1 
ATOM   1107 O  O   . ILE A 1 179 ? 7.711   -26.769 -11.826 1.00 23.39  ? 506 ILE A O   1 
ATOM   1108 C  CB  . ILE A 1 179 ? 10.143  -27.666 -9.682  1.00 26.71  ? 506 ILE A CB  1 
ATOM   1109 C  CG1 . ILE A 1 179 ? 10.326  -27.647 -8.163  1.00 28.97  ? 506 ILE A CG1 1 
ATOM   1110 C  CG2 . ILE A 1 179 ? 10.541  -26.321 -10.235 1.00 28.35  ? 506 ILE A CG2 1 
ATOM   1111 C  CD1 . ILE A 1 179 ? 9.564   -26.551 -7.453  1.00 32.06  ? 506 ILE A CD1 1 
ATOM   1112 N  N   . ALA A 1 180 ? 8.942   -28.561 -12.414 1.00 22.32  ? 507 ALA A N   1 
ATOM   1113 C  CA  . ALA A 1 180 ? 8.677   -28.479 -13.847 1.00 21.72  ? 507 ALA A CA  1 
ATOM   1114 C  C   . ALA A 1 180 ? 7.157   -28.539 -14.095 1.00 22.02  ? 507 ALA A C   1 
ATOM   1115 O  O   . ALA A 1 180 ? 6.627   -27.684 -14.815 1.00 22.01  ? 507 ALA A O   1 
ATOM   1116 C  CB  . ALA A 1 180 ? 9.382   -29.610 -14.585 1.00 20.44  ? 507 ALA A CB  1 
ATOM   1117 N  N   . ALA A 1 181 ? 6.478   -29.527 -13.510 1.00 22.08  ? 508 ALA A N   1 
ATOM   1118 C  CA  . ALA A 1 181 ? 5.018   -29.645 -13.653 1.00 23.65  ? 508 ALA A CA  1 
ATOM   1119 C  C   . ALA A 1 181 ? 4.308   -28.368 -13.170 1.00 24.25  ? 508 ALA A C   1 
ATOM   1120 O  O   . ALA A 1 181 ? 3.401   -27.880 -13.821 1.00 24.16  ? 508 ALA A O   1 
ATOM   1121 C  CB  . ALA A 1 181 ? 4.480   -30.875 -12.902 1.00 22.99  ? 508 ALA A CB  1 
ATOM   1122 N  N   . LEU A 1 182 ? 4.771   -27.820 -12.043 1.00 25.48  ? 509 LEU A N   1 
ATOM   1123 C  CA  . LEU A 1 182 ? 4.203   -26.600 -11.460 1.00 27.12  ? 509 LEU A CA  1 
ATOM   1124 C  C   . LEU A 1 182 ? 4.448   -25.349 -12.297 1.00 27.34  ? 509 LEU A C   1 
ATOM   1125 O  O   . LEU A 1 182 ? 3.697   -24.397 -12.163 1.00 28.89  ? 509 LEU A O   1 
ATOM   1126 C  CB  . LEU A 1 182 ? 4.695   -26.371 -10.032 1.00 27.78  ? 509 LEU A CB  1 
ATOM   1127 C  CG  . LEU A 1 182 ? 4.094   -27.369 -9.022  1.00 29.38  ? 509 LEU A CG  1 
ATOM   1128 C  CD1 . LEU A 1 182 ? 4.762   -27.232 -7.652  1.00 29.49  ? 509 LEU A CD1 1 
ATOM   1129 C  CD2 . LEU A 1 182 ? 2.573   -27.218 -8.863  1.00 29.89  ? 509 LEU A CD2 1 
ATOM   1130 N  N   . ALA A 1 183 ? 5.453   -25.356 -13.160 1.00 25.84  ? 510 ALA A N   1 
ATOM   1131 C  CA  . ALA A 1 183 ? 5.667   -24.217 -14.050 1.00 27.03  ? 510 ALA A CA  1 
ATOM   1132 C  C   . ALA A 1 183 ? 4.589   -24.234 -15.113 1.00 27.22  ? 510 ALA A C   1 
ATOM   1133 O  O   . ALA A 1 183 ? 4.223   -23.188 -15.663 1.00 26.27  ? 510 ALA A O   1 
ATOM   1134 C  CB  . ALA A 1 183 ? 7.043   -24.259 -14.701 1.00 25.64  ? 510 ALA A CB  1 
ATOM   1135 N  N   . MET A 1 184 ? 4.076   -25.418 -15.418 1.00 27.43  ? 511 MET A N   1 
ATOM   1136 C  CA  . MET A 1 184 ? 2.989   -25.474 -16.372 1.00 28.65  ? 511 MET A CA  1 
ATOM   1137 C  C   . MET A 1 184 ? 1.567   -25.539 -15.793 1.00 29.42  ? 511 MET A C   1 
ATOM   1138 O  O   . MET A 1 184 ? 0.693   -24.842 -16.277 1.00 31.27  ? 511 MET A O   1 
ATOM   1139 C  CB  . MET A 1 184 ? 3.239   -26.560 -17.375 1.00 29.59  ? 511 MET A CB  1 
ATOM   1140 C  CG  . MET A 1 184 ? 2.164   -26.464 -18.432 1.00 31.62  ? 511 MET A CG  1 
ATOM   1141 S  SD  . MET A 1 184 ? 2.218   -27.846 -19.516 1.00 34.59  ? 511 MET A SD  1 
ATOM   1142 C  CE  . MET A 1 184 ? 1.954   -29.253 -18.455 1.00 32.37  ? 511 MET A CE  1 
ATOM   1143 N  N   . VAL A 1 185 ? 1.355   -26.362 -14.773 1.00 28.41  ? 512 VAL A N   1 
ATOM   1144 C  CA  . VAL A 1 185 ? 0.070   -26.510 -14.146 1.00 29.58  ? 512 VAL A CA  1 
ATOM   1145 C  C   . VAL A 1 185 ? -0.095  -25.396 -13.121 1.00 31.10  ? 512 VAL A C   1 
ATOM   1146 O  O   . VAL A 1 185 ? 0.239   -25.544 -11.930 1.00 31.98  ? 512 VAL A O   1 
ATOM   1147 C  CB  . VAL A 1 185 ? -0.126  -27.909 -13.506 1.00 29.27  ? 512 VAL A CB  1 
ATOM   1148 C  CG1 . VAL A 1 185 ? -1.554  -28.039 -12.947 1.00 30.65  ? 512 VAL A CG1 1 
ATOM   1149 C  CG2 . VAL A 1 185 ? 0.197   -29.017 -14.519 1.00 27.41  ? 512 VAL A CG2 1 
ATOM   1150 N  N   . THR A 1 186 ? -0.617  -24.278 -13.601 1.00 31.57  ? 513 THR A N   1 
ATOM   1151 C  CA  . THR A 1 186 ? -0.653  -23.043 -12.828 1.00 34.77  ? 513 THR A CA  1 
ATOM   1152 C  C   . THR A 1 186 ? -1.786  -22.146 -13.349 1.00 36.81  ? 513 THR A C   1 
ATOM   1153 O  O   . THR A 1 186 ? -2.129  -22.226 -14.532 1.00 36.18  ? 513 THR A O   1 
ATOM   1154 C  CB  . THR A 1 186 ? 0.716   -22.302 -12.879 1.00 33.90  ? 513 THR A CB  1 
ATOM   1155 O  OG1 . THR A 1 186 ? 0.740   -21.272 -11.912 1.00 35.54  ? 513 THR A OG1 1 
ATOM   1156 C  CG2 . THR A 1 186 ? 1.044   -21.689 -14.260 1.00 33.97  ? 513 THR A CG2 1 
ATOM   1157 N  N   . GLU A 1 187 ? -2.343  -21.297 -12.487 1.00 39.76  ? 514 GLU A N   1 
ATOM   1158 C  CA  . GLU A 1 187 ? -3.348  -20.305 -12.900 1.00 43.73  ? 514 GLU A CA  1 
ATOM   1159 C  C   . GLU A 1 187 ? -2.931  -19.449 -14.113 1.00 41.80  ? 514 GLU A C   1 
ATOM   1160 O  O   . GLU A 1 187 ? -1.831  -18.919 -14.157 1.00 41.15  ? 514 GLU A O   1 
ATOM   1161 C  CB  . GLU A 1 187 ? -3.818  -19.409 -11.720 1.00 47.73  ? 514 GLU A CB  1 
ATOM   1162 C  CG  . GLU A 1 187 ? -5.089  -18.627 -12.070 1.00 55.35  ? 514 GLU A CG  1 
ATOM   1163 C  CD  . GLU A 1 187 ? -6.377  -19.479 -12.149 1.00 59.94  ? 514 GLU A CD  1 
ATOM   1164 O  OE1 . GLU A 1 187 ? -6.315  -20.753 -12.280 1.00 61.29  ? 514 GLU A OE1 1 
ATOM   1165 O  OE2 . GLU A 1 187 ? -7.461  -18.854 -12.069 1.00 63.42  ? 514 GLU A OE2 1 
ATOM   1166 N  N   . ARG A 1 188 ? -3.798  -19.411 -15.126 1.00 40.77  ? 515 ARG A N   1 
ATOM   1167 C  CA  . ARG A 1 188 ? -3.639  -18.556 -16.301 1.00 40.18  ? 515 ARG A CA  1 
ATOM   1168 C  C   . ARG A 1 188 ? -4.987  -17.917 -16.518 1.00 42.83  ? 515 ARG A C   1 
ATOM   1169 O  O   . ARG A 1 188 ? -5.992  -18.541 -16.188 1.00 43.74  ? 515 ARG A O   1 
ATOM   1170 C  CB  . ARG A 1 188 ? -3.328  -19.372 -17.523 1.00 37.07  ? 515 ARG A CB  1 
ATOM   1171 C  CG  . ARG A 1 188 ? -1.997  -20.095 -17.491 1.00 36.12  ? 515 ARG A CG  1 
ATOM   1172 C  CD  . ARG A 1 188 ? -0.796  -19.168 -17.378 1.00 34.41  ? 515 ARG A CD  1 
ATOM   1173 N  NE  . ARG A 1 188 ? 0.403   -19.959 -17.478 1.00 32.64  ? 515 ARG A NE  1 
ATOM   1174 C  CZ  . ARG A 1 188 ? 1.627   -19.527 -17.232 1.00 32.57  ? 515 ARG A CZ  1 
ATOM   1175 N  NH1 . ARG A 1 188 ? 1.811   -18.278 -16.815 1.00 33.55  ? 515 ARG A NH1 1 
ATOM   1176 N  NH2 . ARG A 1 188 ? 2.658   -20.352 -17.384 1.00 30.10  ? 515 ARG A NH2 1 
ATOM   1177 N  N   . HIS A 1 189 ? -5.026  -16.697 -17.056 1.00 44.42  ? 516 HIS A N   1 
ATOM   1178 C  CA  . HIS A 1 189 ? -6.325  -16.057 -17.246 1.00 48.71  ? 516 HIS A CA  1 
ATOM   1179 C  C   . HIS A 1 189 ? -7.055  -16.694 -18.418 1.00 47.84  ? 516 HIS A C   1 
ATOM   1180 O  O   . HIS A 1 189 ? -6.429  -16.959 -19.456 1.00 45.77  ? 516 HIS A O   1 
ATOM   1181 C  CB  . HIS A 1 189 ? -6.276  -14.523 -17.366 1.00 50.80  ? 516 HIS A CB  1 
ATOM   1182 C  CG  . HIS A 1 189 ? -7.610  -13.889 -17.095 1.00 56.76  ? 516 HIS A CG  1 
ATOM   1183 N  ND1 . HIS A 1 189 ? -8.231  -13.021 -17.978 1.00 59.55  ? 516 HIS A ND1 1 
ATOM   1184 C  CD2 . HIS A 1 189 ? -8.468  -14.036 -16.049 1.00 57.91  ? 516 HIS A CD2 1 
ATOM   1185 C  CE1 . HIS A 1 189 ? -9.399  -12.650 -17.477 1.00 60.88  ? 516 HIS A CE1 1 
ATOM   1186 N  NE2 . HIS A 1 189 ? -9.567  -13.255 -16.313 1.00 61.01  ? 516 HIS A NE2 1 
ATOM   1187 N  N   . GLY A 1 190 ? -8.342  -17.000 -18.227 1.00 47.56  ? 517 GLY A N   1 
ATOM   1188 C  CA  . GLY A 1 190 ? -9.141  -17.543 -19.320 1.00 48.56  ? 517 GLY A CA  1 
ATOM   1189 C  C   . GLY A 1 190 ? -9.176  -19.067 -19.474 1.00 47.07  ? 517 GLY A C   1 
ATOM   1190 O  O   . GLY A 1 190 ? -9.483  -19.577 -20.549 1.00 50.90  ? 517 GLY A O   1 
ATOM   1191 N  N   . LEU A 1 191 ? -8.893  -19.791 -18.397 1.00 42.93  ? 518 LEU A N   1 
ATOM   1192 C  CA  . LEU A 1 191 ? -9.084  -21.244 -18.377 1.00 39.45  ? 518 LEU A CA  1 
ATOM   1193 C  C   . LEU A 1 191 ? -10.579 -21.611 -18.297 1.00 41.20  ? 518 LEU A C   1 
ATOM   1194 O  O   . LEU A 1 191 ? -11.330 -21.016 -17.546 1.00 40.84  ? 518 LEU A O   1 
ATOM   1195 C  CB  . LEU A 1 191 ? -8.357  -21.854 -17.190 1.00 37.37  ? 518 LEU A CB  1 
ATOM   1196 C  CG  . LEU A 1 191 ? -6.809  -21.917 -17.251 1.00 34.91  ? 518 LEU A CG  1 
ATOM   1197 C  CD1 . LEU A 1 191 ? -6.307  -22.026 -15.826 1.00 34.49  ? 518 LEU A CD1 1 
ATOM   1198 C  CD2 . LEU A 1 191 ? -6.327  -23.065 -18.125 1.00 32.65  ? 518 LEU A CD2 1 
ATOM   1199 N  N   . LYS A 1 192 ? -10.976 -22.610 -19.068 1.00 40.98  ? 519 LYS A N   1 
ATOM   1200 C  CA  . LYS A 1 192 ? -12.320 -23.179 -18.969 1.00 44.27  ? 519 LYS A CA  1 
ATOM   1201 C  C   . LYS A 1 192 ? -12.529 -23.987 -17.689 1.00 44.35  ? 519 LYS A C   1 
ATOM   1202 O  O   . LYS A 1 192 ? -13.617 -23.940 -17.135 1.00 46.21  ? 519 LYS A O   1 
ATOM   1203 C  CB  . LYS A 1 192 ? -12.636 -24.021 -20.204 1.00 45.34  ? 519 LYS A CB  1 
ATOM   1204 C  CG  . LYS A 1 192 ? -12.998 -23.127 -21.386 1.00 46.66  ? 519 LYS A CG  1 
ATOM   1205 C  CD  . LYS A 1 192 ? -12.649 -23.734 -22.726 1.00 46.91  ? 519 LYS A CD  1 
ATOM   1206 C  CE  . LYS A 1 192 ? -12.318 -22.549 -23.660 1.00 47.65  ? 519 LYS A CE  1 
ATOM   1207 N  NZ  . LYS A 1 192 ? -12.749 -22.932 -25.032 1.00 49.35  ? 519 LYS A NZ  1 
ATOM   1208 N  N   . GLU A 1 193 ? -11.507 -24.709 -17.219 1.00 41.36  ? 520 GLU A N   1 
ATOM   1209 C  CA  . GLU A 1 193 ? -11.618 -25.473 -15.964 1.00 41.54  ? 520 GLU A CA  1 
ATOM   1210 C  C   . GLU A 1 193 ? -10.555 -25.050 -14.914 1.00 40.24  ? 520 GLU A C   1 
ATOM   1211 O  O   . GLU A 1 193 ? -9.715  -25.868 -14.543 1.00 36.72  ? 520 GLU A O   1 
ATOM   1212 C  CB  . GLU A 1 193 ? -11.496 -26.979 -16.241 1.00 41.55  ? 520 GLU A CB  1 
ATOM   1213 C  CG  . GLU A 1 193 ? -12.412 -27.589 -17.282 1.00 43.14  ? 520 GLU A CG  1 
ATOM   1214 C  CD  . GLU A 1 193 ? -13.833 -27.724 -16.847 1.00 45.99  ? 520 GLU A CD  1 
ATOM   1215 O  OE1 . GLU A 1 193 ? -14.703 -27.834 -17.753 1.00 47.18  ? 520 GLU A OE1 1 
ATOM   1216 O  OE2 . GLU A 1 193 ? -14.084 -27.738 -15.611 1.00 46.98  ? 520 GLU A OE2 1 
ATOM   1217 N  N   . PRO A 1 194 ? -10.625 -23.784 -14.408 1.00 41.26  ? 521 PRO A N   1 
ATOM   1218 C  CA  . PRO A 1 194 ? -9.578  -23.329 -13.502 1.00 40.27  ? 521 PRO A CA  1 
ATOM   1219 C  C   . PRO A 1 194 ? -9.513  -24.089 -12.181 1.00 41.00  ? 521 PRO A C   1 
ATOM   1220 O  O   . PRO A 1 194 ? -8.412  -24.277 -11.659 1.00 39.53  ? 521 PRO A O   1 
ATOM   1221 C  CB  . PRO A 1 194 ? -9.912  -21.837 -13.293 1.00 41.46  ? 521 PRO A CB  1 
ATOM   1222 C  CG  . PRO A 1 194 ? -11.398 -21.745 -13.507 1.00 43.64  ? 521 PRO A CG  1 
ATOM   1223 C  CD  . PRO A 1 194 ? -11.647 -22.722 -14.628 1.00 43.26  ? 521 PRO A CD  1 
ATOM   1224 N  N   . LYS A 1 195 ? -10.653 -24.580 -11.678 1.00 44.27  ? 522 LYS A N   1 
ATOM   1225 C  CA  . LYS A 1 195 ? -10.667 -25.358 -10.428 1.00 46.12  ? 522 LYS A CA  1 
ATOM   1226 C  C   . LYS A 1 195 ? -9.919  -26.680 -10.549 1.00 43.91  ? 522 LYS A C   1 
ATOM   1227 O  O   . LYS A 1 195 ? -9.223  -27.102 -9.615  1.00 42.44  ? 522 LYS A O   1 
ATOM   1228 C  CB  . LYS A 1 195 ? -12.080 -25.608 -9.892  1.00 49.71  ? 522 LYS A CB  1 
ATOM   1229 C  CG  . LYS A 1 195 ? -12.840 -24.363 -9.480  1.00 55.59  ? 522 LYS A CG  1 
ATOM   1230 C  CD  . LYS A 1 195 ? -12.025 -23.332 -8.695  1.00 56.81  ? 522 LYS A CD  1 
ATOM   1231 C  CE  . LYS A 1 195 ? -12.831 -22.051 -8.490  1.00 59.64  ? 522 LYS A CE  1 
ATOM   1232 N  NZ  . LYS A 1 195 ? -14.224 -22.276 -7.989  1.00 63.57  ? 522 LYS A NZ  1 
ATOM   1233 N  N   . ARG A 1 196 ? -10.059 -27.319 -11.705 1.00 43.71  ? 523 ARG A N   1 
ATOM   1234 C  CA  . ARG A 1 196 ? -9.358  -28.564 -11.994 1.00 43.44  ? 523 ARG A CA  1 
ATOM   1235 C  C   . ARG A 1 196 ? -7.840  -28.339 -12.111 1.00 39.84  ? 523 ARG A C   1 
ATOM   1236 O  O   . ARG A 1 196 ? -7.062  -29.087 -11.557 1.00 38.78  ? 523 ARG A O   1 
ATOM   1237 C  CB  . ARG A 1 196 ? -9.954  -29.167 -13.266 1.00 46.65  ? 523 ARG A CB  1 
ATOM   1238 C  CG  . ARG A 1 196 ? -9.598  -30.597 -13.543 1.00 49.63  ? 523 ARG A CG  1 
ATOM   1239 C  CD  . ARG A 1 196 ? -10.617 -31.604 -13.082 1.00 55.71  ? 523 ARG A CD  1 
ATOM   1240 N  NE  . ARG A 1 196 ? -10.077 -32.891 -13.506 1.00 58.85  ? 523 ARG A NE  1 
ATOM   1241 C  CZ  . ARG A 1 196 ? -10.621 -33.677 -14.431 1.00 62.67  ? 523 ARG A CZ  1 
ATOM   1242 N  NH1 . ARG A 1 196 ? -11.740 -33.326 -15.039 1.00 65.91  ? 523 ARG A NH1 1 
ATOM   1243 N  NH2 . ARG A 1 196 ? -10.042 -34.817 -14.733 1.00 64.73  ? 523 ARG A NH2 1 
ATOM   1244 N  N   . VAL A 1 197 ? -7.421  -27.290 -12.808 1.00 38.78  ? 524 VAL A N   1 
ATOM   1245 C  CA  . VAL A 1 197 ? -6.009  -26.923 -12.852 1.00 36.88  ? 524 VAL A CA  1 
ATOM   1246 C  C   . VAL A 1 197 ? -5.493  -26.694 -11.419 1.00 37.50  ? 524 VAL A C   1 
ATOM   1247 O  O   . VAL A 1 197 ? -4.455  -27.219 -11.056 1.00 36.01  ? 524 VAL A O   1 
ATOM   1248 C  CB  . VAL A 1 197 ? -5.776  -25.691 -13.753 1.00 35.87  ? 524 VAL A CB  1 
ATOM   1249 C  CG1 . VAL A 1 197 ? -4.338  -25.129 -13.631 1.00 32.75  ? 524 VAL A CG1 1 
ATOM   1250 C  CG2 . VAL A 1 197 ? -6.126  -26.036 -15.197 1.00 35.07  ? 524 VAL A CG2 1 
ATOM   1251 N  N   . GLU A 1 198 ? -6.259  -25.956 -10.606 1.00 39.98  ? 525 GLU A N   1 
ATOM   1252 C  CA  . GLU A 1 198 ? -5.869  -25.675 -9.247  1.00 41.27  ? 525 GLU A CA  1 
ATOM   1253 C  C   . GLU A 1 198 ? -5.776  -26.913 -8.386  1.00 41.91  ? 525 GLU A C   1 
ATOM   1254 O  O   . GLU A 1 198 ? -4.877  -27.005 -7.563  1.00 42.71  ? 525 GLU A O   1 
ATOM   1255 C  CB  . GLU A 1 198 ? -6.783  -24.638 -8.585  1.00 45.27  ? 525 GLU A CB  1 
ATOM   1256 C  CG  . GLU A 1 198 ? -6.339  -24.432 -7.157  1.00 48.14  ? 525 GLU A CG  1 
ATOM   1257 C  CD  . GLU A 1 198 ? -7.004  -23.293 -6.419  1.00 53.50  ? 525 GLU A CD  1 
ATOM   1258 O  OE1 . GLU A 1 198 ? -8.235  -23.329 -6.211  1.00 55.59  ? 525 GLU A OE1 1 
ATOM   1259 O  OE2 . GLU A 1 198 ? -6.251  -22.376 -6.002  1.00 56.15  ? 525 GLU A OE2 1 
ATOM   1260 N  N   . GLU A 1 199 ? -6.695  -27.861 -8.546  1.00 42.28  ? 526 GLU A N   1 
ATOM   1261 C  CA  . GLU A 1 199 ? -6.611  -29.123 -7.810  1.00 42.05  ? 526 GLU A CA  1 
ATOM   1262 C  C   . GLU A 1 199 ? -5.370  -29.917 -8.211  1.00 39.28  ? 526 GLU A C   1 
ATOM   1263 O  O   . GLU A 1 199 ? -4.701  -30.511 -7.348  1.00 37.77  ? 526 GLU A O   1 
ATOM   1264 C  CB  . GLU A 1 199 ? -7.861  -29.975 -7.979  1.00 45.30  ? 526 GLU A CB  1 
ATOM   1265 C  CG  . GLU A 1 199 ? -9.005  -29.441 -7.105  1.00 52.11  ? 526 GLU A CG  1 
ATOM   1266 C  CD  . GLU A 1 199 ? -10.417 -29.783 -7.602  1.00 55.62  ? 526 GLU A CD  1 
ATOM   1267 O  OE1 . GLU A 1 199 ? -11.414 -29.302 -7.002  1.00 60.96  ? 526 GLU A OE1 1 
ATOM   1268 O  OE2 . GLU A 1 199 ? -10.568 -30.538 -8.581  1.00 56.71  ? 526 GLU A OE2 1 
ATOM   1269 N  N   . LEU A 1 200 ? -5.070  -29.949 -9.513  1.00 36.28  ? 527 LEU A N   1 
ATOM   1270 C  CA  . LEU A 1 200 ? -3.926  -30.670 -9.954  1.00 33.83  ? 527 LEU A CA  1 
ATOM   1271 C  C   . LEU A 1 200 ? -2.659  -29.991 -9.409  1.00 32.34  ? 527 LEU A C   1 
ATOM   1272 O  O   . LEU A 1 200 ? -1.738  -30.684 -8.938  1.00 31.41  ? 527 LEU A O   1 
ATOM   1273 C  CB  . LEU A 1 200 ? -3.912  -30.843 -11.493 1.00 32.80  ? 527 LEU A CB  1 
ATOM   1274 C  CG  . LEU A 1 200 ? -2.683  -31.557 -12.086 1.00 30.73  ? 527 LEU A CG  1 
ATOM   1275 C  CD1 . LEU A 1 200 ? -2.467  -32.940 -11.504 1.00 30.41  ? 527 LEU A CD1 1 
ATOM   1276 C  CD2 . LEU A 1 200 ? -2.798  -31.595 -13.614 1.00 30.95  ? 527 LEU A CD2 1 
ATOM   1277 N  N   . GLN A 1 201 ? -2.633  -28.658 -9.452  1.00 32.30  ? 528 GLN A N   1 
ATOM   1278 C  CA  . GLN A 1 201 ? -1.532  -27.879 -8.877  1.00 32.48  ? 528 GLN A CA  1 
ATOM   1279 C  C   . GLN A 1 201 ? -1.308  -28.298 -7.427  1.00 33.30  ? 528 GLN A C   1 
ATOM   1280 O  O   . GLN A 1 201 ? -0.204  -28.682 -7.056  1.00 32.39  ? 528 GLN A O   1 
ATOM   1281 C  CB  . GLN A 1 201 ? -1.849  -26.377 -8.941  1.00 33.35  ? 528 GLN A CB  1 
ATOM   1282 C  CG  . GLN A 1 201 ? -0.682  -25.449 -8.628  1.00 33.76  ? 528 GLN A CG  1 
ATOM   1283 C  CD  . GLN A 1 201 ? -1.092  -23.988 -8.586  1.00 35.50  ? 528 GLN A CD  1 
ATOM   1284 O  OE1 . GLN A 1 201 ? -1.979  -23.611 -7.835  1.00 39.62  ? 528 GLN A OE1 1 
ATOM   1285 N  NE2 . GLN A 1 201 ? -0.469  -23.174 -9.385  1.00 35.54  ? 528 GLN A NE2 1 
ATOM   1286 N  N   . ASN A 1 202 ? -2.373  -28.238 -6.633  1.00 35.58  ? 529 ASN A N   1 
ATOM   1287 C  CA  . ASN A 1 202 ? -2.318  -28.596 -5.228  1.00 38.13  ? 529 ASN A CA  1 
ATOM   1288 C  C   . ASN A 1 202 ? -1.862  -30.022 -4.962  1.00 38.02  ? 529 ASN A C   1 
ATOM   1289 O  O   . ASN A 1 202 ? -1.117  -30.249 -4.002  1.00 37.95  ? 529 ASN A O   1 
ATOM   1290 C  CB  . ASN A 1 202 ? -3.661  -28.308 -4.552  1.00 41.68  ? 529 ASN A CB  1 
ATOM   1291 C  CG  . ASN A 1 202 ? -3.998  -26.805 -4.545  1.00 45.05  ? 529 ASN A CG  1 
ATOM   1292 O  OD1 . ASN A 1 202 ? -3.140  -25.927 -4.825  1.00 45.82  ? 529 ASN A OD1 1 
ATOM   1293 N  ND2 . ASN A 1 202 ? -5.258  -26.503 -4.275  1.00 47.71  ? 529 ASN A ND2 1 
ATOM   1294 N  N   . LYS A 1 203 ? -2.292  -30.979 -5.793  1.00 37.38  ? 530 LYS A N   1 
ATOM   1295 C  CA  . LYS A 1 203 ? -1.834  -32.367 -5.652  1.00 37.77  ? 530 LYS A CA  1 
ATOM   1296 C  C   . LYS A 1 203 ? -0.327  -32.419 -5.843  1.00 35.31  ? 530 LYS A C   1 
ATOM   1297 O  O   . LYS A 1 203 ? 0.374   -33.079 -5.057  1.00 35.03  ? 530 LYS A O   1 
ATOM   1298 C  CB  . LYS A 1 203 ? -2.496  -33.291 -6.669  1.00 38.58  ? 530 LYS A CB  1 
ATOM   1299 C  CG  . LYS A 1 203 ? -3.757  -33.976 -6.207  1.00 43.14  ? 530 LYS A CG  1 
ATOM   1300 C  CD  . LYS A 1 203 ? -4.469  -34.448 -7.459  1.00 45.77  ? 530 LYS A CD  1 
ATOM   1301 C  CE  . LYS A 1 203 ? -5.511  -35.486 -7.139  1.00 49.32  ? 530 LYS A CE  1 
ATOM   1302 N  NZ  . LYS A 1 203 ? -6.825  -34.810 -7.025  1.00 54.12  ? 530 LYS A NZ  1 
ATOM   1303 N  N   . ILE A 1 204 ? 0.171   -31.713 -6.864  1.00 33.04  ? 531 ILE A N   1 
ATOM   1304 C  CA  . ILE A 1 204 ? 1.606   -31.710 -7.158  1.00 30.61  ? 531 ILE A CA  1 
ATOM   1305 C  C   . ILE A 1 204 ? 2.395   -31.030 -6.016  1.00 31.02  ? 531 ILE A C   1 
ATOM   1306 O  O   . ILE A 1 204 ? 3.436   -31.531 -5.626  1.00 30.53  ? 531 ILE A O   1 
ATOM   1307 C  CB  . ILE A 1 204 ? 1.916   -31.095 -8.543  1.00 29.78  ? 531 ILE A CB  1 
ATOM   1308 C  CG1 . ILE A 1 204 ? 1.157   -31.844 -9.652  1.00 28.51  ? 531 ILE A CG1 1 
ATOM   1309 C  CG2 . ILE A 1 204 ? 3.440   -31.096 -8.820  1.00 27.62  ? 531 ILE A CG2 1 
ATOM   1310 C  CD1 . ILE A 1 204 ? 1.096   -31.056 -10.975 1.00 28.06  ? 531 ILE A CD1 1 
ATOM   1311 N  N   . VAL A 1 205 ? 1.875   -29.927 -5.478  1.00 31.76  ? 532 VAL A N   1 
ATOM   1312 C  CA  . VAL A 1 205 ? 2.503   -29.212 -4.376  1.00 33.56  ? 532 VAL A CA  1 
ATOM   1313 C  C   . VAL A 1 205 ? 2.660   -30.170 -3.178  1.00 35.80  ? 532 VAL A C   1 
ATOM   1314 O  O   . VAL A 1 205 ? 3.743   -30.255 -2.589  1.00 34.70  ? 532 VAL A O   1 
ATOM   1315 C  CB  . VAL A 1 205 ? 1.757   -27.889 -4.019  1.00 34.72  ? 532 VAL A CB  1 
ATOM   1316 C  CG1 . VAL A 1 205 ? 2.219   -27.322 -2.684  1.00 36.29  ? 532 VAL A CG1 1 
ATOM   1317 C  CG2 . VAL A 1 205 ? 1.964   -26.825 -5.113  1.00 33.41  ? 532 VAL A CG2 1 
ATOM   1318 N  N   . ASN A 1 206 ? 1.597   -30.915 -2.875  1.00 38.01  ? 533 ASN A N   1 
ATOM   1319 C  CA  . ASN A 1 206 ? 1.591   -31.870 -1.779  1.00 41.47  ? 533 ASN A CA  1 
ATOM   1320 C  C   . ASN A 1 206 ? 2.563   -33.069 -1.942  1.00 41.19  ? 533 ASN A C   1 
ATOM   1321 O  O   . ASN A 1 206 ? 3.146   -33.493 -0.954  1.00 41.26  ? 533 ASN A O   1 
ATOM   1322 C  CB  . ASN A 1 206 ? 0.178   -32.339 -1.519  1.00 43.95  ? 533 ASN A CB  1 
ATOM   1323 C  CG  . ASN A 1 206 ? -0.701  -31.239 -0.942  1.00 47.91  ? 533 ASN A CG  1 
ATOM   1324 O  OD1 . ASN A 1 206 ? -0.254  -30.211 -0.395  1.00 49.74  ? 533 ASN A OD1 1 
ATOM   1325 N  ND2 . ASN A 1 206 ? -1.994  -31.484 -1.009  1.00 49.77  ? 533 ASN A ND2 1 
ATOM   1326 N  N   . CYS A 1 207 ? 2.710   -33.597 -3.174  1.00 40.52  ? 534 CYS A N   1 
ATOM   1327 C  CA  . CYS A 1 207 ? 3.751   -34.555 -3.523  1.00 39.58  ? 534 CYS A CA  1 
ATOM   1328 C  C   . CYS A 1 207 ? 5.085   -34.031 -3.164  1.00 37.18  ? 534 CYS A C   1 
ATOM   1329 O  O   . CYS A 1 207 ? 5.879   -34.737 -2.586  1.00 38.15  ? 534 CYS A O   1 
ATOM   1330 C  CB  . CYS A 1 207 ? 3.872   -34.714 -5.049  1.00 42.04  ? 534 CYS A CB  1 
ATOM   1331 S  SG  . CYS A 1 207 ? 2.821   -35.964 -5.623  1.00 54.27  ? 534 CYS A SG  1 
ATOM   1332 N  N   . LEU A 1 208 ? 5.349   -32.820 -3.637  1.00 34.94  ? 535 LEU A N   1 
ATOM   1333 C  CA  . LEU A 1 208 ? 6.636   -32.155 -3.463  1.00 33.97  ? 535 LEU A CA  1 
ATOM   1334 C  C   . LEU A 1 208 ? 6.930   -31.996 -1.973  1.00 34.44  ? 535 LEU A C   1 
ATOM   1335 O  O   . LEU A 1 208 ? 8.010   -32.392 -1.534  1.00 33.50  ? 535 LEU A O   1 
ATOM   1336 C  CB  . LEU A 1 208 ? 6.667   -30.806 -4.202  1.00 32.33  ? 535 LEU A CB  1 
ATOM   1337 C  CG  . LEU A 1 208 ? 7.917   -29.930 -4.102  1.00 32.62  ? 535 LEU A CG  1 
ATOM   1338 C  CD1 . LEU A 1 208 ? 9.177   -30.690 -4.538  1.00 30.75  ? 535 LEU A CD1 1 
ATOM   1339 C  CD2 . LEU A 1 208 ? 7.755   -28.668 -4.965  1.00 31.25  ? 535 LEU A CD2 1 
ATOM   1340 N  N   . LYS A 1 209 ? 5.952   -31.468 -1.220  1.00 35.93  ? 536 LYS A N   1 
ATOM   1341 C  CA  . LYS A 1 209 ? 6.058   -31.266 0.225   1.00 38.45  ? 536 LYS A CA  1 
ATOM   1342 C  C   . LYS A 1 209 ? 6.401   -32.564 0.948   1.00 38.99  ? 536 LYS A C   1 
ATOM   1343 O  O   . LYS A 1 209 ? 7.353   -32.587 1.734   1.00 39.37  ? 536 LYS A O   1 
ATOM   1344 C  CB  . LYS A 1 209 ? 4.779   -30.697 0.824   1.00 40.94  ? 536 LYS A CB  1 
ATOM   1345 C  CG  . LYS A 1 209 ? 4.571   -29.213 0.560   1.00 41.89  ? 536 LYS A CG  1 
ATOM   1346 C  CD  . LYS A 1 209 ? 3.373   -28.708 1.373   1.00 44.38  ? 536 LYS A CD  1 
ATOM   1347 C  CE  . LYS A 1 209 ? 3.012   -27.267 1.022   1.00 44.99  ? 536 LYS A CE  1 
ATOM   1348 N  NZ  . LYS A 1 209 ? 1.979   -26.710 1.938   1.00 48.46  ? 536 LYS A NZ  1 
ATOM   1349 N  N   . ASP A 1 210 ? 5.645   -33.631 0.660   1.00 38.60  ? 537 ASP A N   1 
ATOM   1350 C  CA  . ASP A 1 210 ? 5.849   -34.927 1.290   1.00 40.32  ? 537 ASP A CA  1 
ATOM   1351 C  C   . ASP A 1 210 ? 7.202   -35.482 0.912   1.00 39.72  ? 537 ASP A C   1 
ATOM   1352 O  O   . ASP A 1 210 ? 7.907   -35.999 1.774   1.00 40.33  ? 537 ASP A O   1 
ATOM   1353 C  CB  . ASP A 1 210 ? 4.760   -35.915 0.925   1.00 40.64  ? 537 ASP A CB  1 
ATOM   1354 C  CG  . ASP A 1 210 ? 3.417   -35.557 1.549   1.00 44.91  ? 537 ASP A CG  1 
ATOM   1355 O  OD1 . ASP A 1 210 ? 3.339   -34.838 2.593   1.00 46.73  ? 537 ASP A OD1 1 
ATOM   1356 O  OD2 . ASP A 1 210 ? 2.407   -35.995 0.975   1.00 46.17  ? 537 ASP A OD2 1 
ATOM   1357 N  N   . HIS A 1 211 ? 7.569   -35.326 -0.367  1.00 37.26  ? 538 HIS A N   1 
ATOM   1358 C  CA  . HIS A 1 211 ? 8.860   -35.761 -0.834  1.00 37.08  ? 538 HIS A CA  1 
ATOM   1359 C  C   . HIS A 1 211 ? 10.015  -35.076 -0.067  1.00 37.98  ? 538 HIS A C   1 
ATOM   1360 O  O   . HIS A 1 211 ? 10.903  -35.764 0.452   1.00 39.23  ? 538 HIS A O   1 
ATOM   1361 C  CB  . HIS A 1 211 ? 9.022   -35.575 -2.350  1.00 34.83  ? 538 HIS A CB  1 
ATOM   1362 C  CG  . HIS A 1 211 ? 10.346  -36.028 -2.840  1.00 34.45  ? 538 HIS A CG  1 
ATOM   1363 N  ND1 . HIS A 1 211 ? 11.392  -35.163 -3.068  1.00 35.00  ? 538 HIS A ND1 1 
ATOM   1364 C  CD2 . HIS A 1 211 ? 10.817  -37.268 -3.072  1.00 34.20  ? 538 HIS A CD2 1 
ATOM   1365 C  CE1 . HIS A 1 211 ? 12.454  -35.864 -3.428  1.00 35.41  ? 538 HIS A CE1 1 
ATOM   1366 N  NE2 . HIS A 1 211 ? 12.123  -37.142 -3.461  1.00 35.06  ? 538 HIS A NE2 1 
ATOM   1367 N  N   . VAL A 1 212 ? 9.985   -33.754 0.009   1.00 38.34  ? 539 VAL A N   1 
ATOM   1368 C  CA  . VAL A 1 212 ? 11.024  -32.969 0.701   1.00 40.13  ? 539 VAL A CA  1 
ATOM   1369 C  C   . VAL A 1 212 ? 11.157  -33.374 2.165   1.00 42.34  ? 539 VAL A C   1 
ATOM   1370 O  O   . VAL A 1 212 ? 12.271  -33.613 2.647   1.00 43.75  ? 539 VAL A O   1 
ATOM   1371 C  CB  . VAL A 1 212 ? 10.811  -31.431 0.519   1.00 39.57  ? 539 VAL A CB  1 
ATOM   1372 C  CG1 . VAL A 1 212 ? 11.758  -30.619 1.398   1.00 40.50  ? 539 VAL A CG1 1 
ATOM   1373 C  CG2 . VAL A 1 212 ? 11.050  -31.078 -0.942  1.00 37.29  ? 539 VAL A CG2 1 
ATOM   1374 N  N   . THR A 1 213 ? 10.022  -33.479 2.850   1.00 43.95  ? 540 THR A N   1 
ATOM   1375 C  CA  . THR A 1 213 ? 9.960   -33.892 4.259   1.00 46.10  ? 540 THR A CA  1 
ATOM   1376 C  C   . THR A 1 213 ? 10.488  -35.325 4.468   1.00 46.95  ? 540 THR A C   1 
ATOM   1377 O  O   . THR A 1 213 ? 11.328  -35.535 5.340   1.00 48.31  ? 540 THR A O   1 
ATOM   1378 C  CB  . THR A 1 213 ? 8.529   -33.769 4.794   1.00 46.69  ? 540 THR A CB  1 
ATOM   1379 O  OG1 . THR A 1 213 ? 8.076   -32.433 4.596   1.00 46.44  ? 540 THR A OG1 1 
ATOM   1380 C  CG2 . THR A 1 213 ? 8.465   -34.126 6.253   1.00 49.06  ? 540 THR A CG2 1 
ATOM   1381 N  N   . PHE A 1 214 ? 10.022  -36.279 3.651   1.00 46.49  ? 541 PHE A N   1 
ATOM   1382 C  CA  . PHE A 1 214 ? 10.523  -37.653 3.687   1.00 47.41  ? 541 PHE A CA  1 
ATOM   1383 C  C   . PHE A 1 214 ? 12.052  -37.714 3.519   1.00 48.03  ? 541 PHE A C   1 
ATOM   1384 O  O   . PHE A 1 214 ? 12.729  -38.410 4.274   1.00 47.89  ? 541 PHE A O   1 
ATOM   1385 C  CB  . PHE A 1 214 ? 9.845   -38.533 2.635   1.00 47.01  ? 541 PHE A CB  1 
ATOM   1386 C  CG  . PHE A 1 214 ? 10.471  -39.906 2.498   1.00 48.73  ? 541 PHE A CG  1 
ATOM   1387 C  CD1 . PHE A 1 214 ? 10.008  -40.977 3.272   1.00 49.60  ? 541 PHE A CD1 1 
ATOM   1388 C  CD2 . PHE A 1 214 ? 11.549  -40.124 1.599   1.00 47.79  ? 541 PHE A CD2 1 
ATOM   1389 C  CE1 . PHE A 1 214 ? 10.587  -42.238 3.154   1.00 50.80  ? 541 PHE A CE1 1 
ATOM   1390 C  CE2 . PHE A 1 214 ? 12.139  -41.386 1.496   1.00 49.31  ? 541 PHE A CE2 1 
ATOM   1391 C  CZ  . PHE A 1 214 ? 11.655  -42.437 2.274   1.00 50.12  ? 541 PHE A CZ  1 
ATOM   1392 N  N   . ASN A 1 215 ? 12.585  -36.996 2.528   1.00 47.23  ? 542 ASN A N   1 
ATOM   1393 C  CA  . ASN A 1 215 ? 14.031  -36.967 2.293   1.00 48.67  ? 542 ASN A CA  1 
ATOM   1394 C  C   . ASN A 1 215 ? 14.815  -36.227 3.363   1.00 51.61  ? 542 ASN A C   1 
ATOM   1395 O  O   . ASN A 1 215 ? 16.033  -36.305 3.407   1.00 54.46  ? 542 ASN A O   1 
ATOM   1396 C  CB  . ASN A 1 215 ? 14.360  -36.459 0.912   1.00 47.15  ? 542 ASN A CB  1 
ATOM   1397 C  CG  . ASN A 1 215 ? 14.076  -37.512 -0.138  1.00 48.14  ? 542 ASN A CG  1 
ATOM   1398 O  OD1 . ASN A 1 215 ? 14.939  -38.332 -0.487  1.00 47.30  ? 542 ASN A OD1 1 
ATOM   1399 N  ND2 . ASN A 1 215 ? 12.804  -37.578 -0.552  1.00 49.89  ? 542 ASN A ND2 1 
ATOM   1400 N  N   . ASN A 1 216 ? 14.114  -35.509 4.226   1.00 52.30  ? 543 ASN A N   1 
ATOM   1401 C  CA  . ASN A 1 216 ? 14.757  -34.877 5.350   1.00 54.08  ? 543 ASN A CA  1 
ATOM   1402 C  C   . ASN A 1 216 ? 14.479  -35.646 6.644   1.00 56.46  ? 543 ASN A C   1 
ATOM   1403 O  O   . ASN A 1 216 ? 14.484  -35.082 7.757   1.00 57.67  ? 543 ASN A O   1 
ATOM   1404 C  CB  . ASN A 1 216 ? 14.311  -33.428 5.453   1.00 54.59  ? 543 ASN A CB  1 
ATOM   1405 C  CG  . ASN A 1 216 ? 15.334  -32.583 6.146   1.00 57.49  ? 543 ASN A CG  1 
ATOM   1406 O  OD1 . ASN A 1 216 ? 16.494  -32.532 5.718   1.00 57.67  ? 543 ASN A OD1 1 
ATOM   1407 N  ND2 . ASN A 1 216 ? 14.927  -31.919 7.234   1.00 60.78  ? 543 ASN A ND2 1 
ATOM   1408 N  N   . GLY A 1 217 ? 14.221  -36.943 6.480   1.00 55.99  ? 544 GLY A N   1 
ATOM   1409 C  CA  . GLY A 1 217 ? 14.022  -37.853 7.608   1.00 58.66  ? 544 GLY A CA  1 
ATOM   1410 C  C   . GLY A 1 217 ? 12.803  -37.528 8.458   1.00 60.10  ? 544 GLY A C   1 
ATOM   1411 O  O   . GLY A 1 217 ? 12.786  -37.812 9.643   1.00 62.34  ? 544 GLY A O   1 
ATOM   1412 N  N   . GLY A 1 218 ? 11.783  -36.930 7.848   1.00 59.73  ? 545 GLY A N   1 
ATOM   1413 C  CA  . GLY A 1 218 ? 10.524  -36.684 8.536   1.00 62.30  ? 545 GLY A CA  1 
ATOM   1414 C  C   . GLY A 1 218 ? 10.324  -35.290 9.083   1.00 64.94  ? 545 GLY A C   1 
ATOM   1415 O  O   . GLY A 1 218 ? 9.233   -35.006 9.574   1.00 66.51  ? 545 GLY A O   1 
ATOM   1416 N  N   . LEU A 1 219 ? 11.349  -34.429 9.000   1.00 66.41  ? 546 LEU A N   1 
ATOM   1417 C  CA  . LEU A 1 219 ? 11.186  -33.018 9.382   1.00 68.93  ? 546 LEU A CA  1 
ATOM   1418 C  C   . LEU A 1 219 ? 10.997  -32.112 8.179   1.00 66.80  ? 546 LEU A C   1 
ATOM   1419 O  O   . LEU A 1 219 ? 11.585  -32.333 7.108   1.00 64.98  ? 546 LEU A O   1 
ATOM   1420 C  CB  . LEU A 1 219 ? 12.264  -32.479 10.325  1.00 74.35  ? 546 LEU A CB  1 
ATOM   1421 C  CG  . LEU A 1 219 ? 13.749  -32.794 10.409  1.00 76.80  ? 546 LEU A CG  1 
ATOM   1422 C  CD1 . LEU A 1 219 ? 14.524  -31.470 10.468  1.00 79.31  ? 546 LEU A CD1 1 
ATOM   1423 C  CD2 . LEU A 1 219 ? 13.950  -33.625 11.687  1.00 78.11  ? 546 LEU A CD2 1 
ATOM   1424 N  N   . ASN A 1 220 ? 10.165  -31.093 8.367   1.00 66.01  ? 547 ASN A N   1 
ATOM   1425 C  CA  . ASN A 1 220 ? 9.836   -30.150 7.310   1.00 63.01  ? 547 ASN A CA  1 
ATOM   1426 C  C   . ASN A 1 220 ? 11.002  -29.263 6.950   1.00 60.32  ? 547 ASN A C   1 
ATOM   1427 O  O   . ASN A 1 220 ? 11.898  -29.024 7.770   1.00 61.54  ? 547 ASN A O   1 
ATOM   1428 C  CB  . ASN A 1 220 ? 8.626   -29.310 7.719   1.00 65.47  ? 547 ASN A CB  1 
ATOM   1429 C  CG  . ASN A 1 220 ? 7.369   -30.133 7.783   1.00 67.10  ? 547 ASN A CG  1 
ATOM   1430 O  OD1 . ASN A 1 220 ? 7.155   -31.029 6.949   1.00 64.58  ? 547 ASN A OD1 1 
ATOM   1431 N  ND2 . ASN A 1 220 ? 6.548   -29.875 8.796   1.00 69.85  ? 547 ASN A ND2 1 
ATOM   1432 N  N   . ARG A 1 221 ? 10.990  -28.805 5.704   1.00 54.94  ? 548 ARG A N   1 
ATOM   1433 C  CA  . ARG A 1 221 ? 11.914  -27.777 5.257   1.00 53.96  ? 548 ARG A CA  1 
ATOM   1434 C  C   . ARG A 1 221 ? 11.126  -26.656 4.561   1.00 51.75  ? 548 ARG A C   1 
ATOM   1435 O  O   . ARG A 1 221 ? 11.263  -26.476 3.336   1.00 48.43  ? 548 ARG A O   1 
ATOM   1436 C  CB  . ARG A 1 221 ? 13.000  -28.368 4.348   1.00 53.27  ? 548 ARG A CB  1 
ATOM   1437 C  CG  . ARG A 1 221 ? 13.865  -29.464 4.963   1.00 55.06  ? 548 ARG A CG  1 
ATOM   1438 C  CD  . ARG A 1 221 ? 14.687  -30.101 3.857   1.00 54.83  ? 548 ARG A CD  1 
ATOM   1439 N  NE  . ARG A 1 221 ? 15.877  -29.316 3.506   1.00 56.60  ? 548 ARG A NE  1 
ATOM   1440 C  CZ  . ARG A 1 221 ? 16.634  -29.514 2.429   1.00 54.52  ? 548 ARG A CZ  1 
ATOM   1441 N  NH1 . ARG A 1 221 ? 16.348  -30.478 1.561   1.00 52.51  ? 548 ARG A NH1 1 
ATOM   1442 N  NH2 . ARG A 1 221 ? 17.683  -28.736 2.217   1.00 55.77  ? 548 ARG A NH2 1 
ATOM   1443 N  N   . PRO A 1 222 ? 10.298  -25.895 5.338   1.00 52.29  ? 549 PRO A N   1 
ATOM   1444 C  CA  . PRO A 1 222 ? 9.378   -24.916 4.713   1.00 50.76  ? 549 PRO A CA  1 
ATOM   1445 C  C   . PRO A 1 222 ? 10.090  -23.783 3.994   1.00 49.12  ? 549 PRO A C   1 
ATOM   1446 O  O   . PRO A 1 222 ? 9.601   -23.335 2.962   1.00 46.79  ? 549 PRO A O   1 
ATOM   1447 C  CB  . PRO A 1 222 ? 8.535   -24.401 5.885   1.00 53.30  ? 549 PRO A CB  1 
ATOM   1448 C  CG  . PRO A 1 222 ? 9.302   -24.751 7.113   1.00 56.05  ? 549 PRO A CG  1 
ATOM   1449 C  CD  . PRO A 1 222 ? 10.174  -25.916 6.809   1.00 54.22  ? 549 PRO A CD  1 
ATOM   1450 N  N   . ASN A 1 223 ? 11.226  -23.322 4.544   1.00 50.27  ? 550 ASN A N   1 
ATOM   1451 C  CA  . ASN A 1 223 ? 12.075  -22.332 3.859   1.00 50.03  ? 550 ASN A CA  1 
ATOM   1452 C  C   . ASN A 1 223 ? 12.733  -22.910 2.614   1.00 48.25  ? 550 ASN A C   1 
ATOM   1453 O  O   . ASN A 1 223 ? 12.857  -22.211 1.606   1.00 46.32  ? 550 ASN A O   1 
ATOM   1454 C  CB  . ASN A 1 223 ? 13.141  -21.741 4.768   1.00 51.99  ? 550 ASN A CB  1 
ATOM   1455 C  CG  . ASN A 1 223 ? 12.613  -20.643 5.707   1.00 54.85  ? 550 ASN A CG  1 
ATOM   1456 O  OD1 . ASN A 1 223 ? 13.380  -20.149 6.520   1.00 56.78  ? 550 ASN A OD1 1 
ATOM   1457 N  ND2 . ASN A 1 223 ? 11.329  -20.278 5.627   1.00 54.31  ? 550 ASN A ND2 1 
ATOM   1458 N  N   . TYR A 1 224 ? 13.152  -24.178 2.659   1.00 48.57  ? 551 TYR A N   1 
ATOM   1459 C  CA  . TYR A 1 224 ? 13.705  -24.803 1.442   1.00 46.59  ? 551 TYR A CA  1 
ATOM   1460 C  C   . TYR A 1 224 ? 12.642  -24.925 0.344   1.00 45.23  ? 551 TYR A C   1 
ATOM   1461 O  O   . TYR A 1 224 ? 12.889  -24.618 -0.827  1.00 43.95  ? 551 TYR A O   1 
ATOM   1462 C  CB  . TYR A 1 224 ? 14.376  -26.150 1.726   1.00 46.70  ? 551 TYR A CB  1 
ATOM   1463 C  CG  . TYR A 1 224 ? 14.949  -26.788 0.464   1.00 45.74  ? 551 TYR A CG  1 
ATOM   1464 C  CD1 . TYR A 1 224 ? 16.155  -26.317 -0.090  1.00 45.52  ? 551 TYR A CD1 1 
ATOM   1465 C  CD2 . TYR A 1 224 ? 14.287  -27.844 -0.176  1.00 44.44  ? 551 TYR A CD2 1 
ATOM   1466 C  CE1 . TYR A 1 224 ? 16.692  -26.865 -1.243  1.00 44.14  ? 551 TYR A CE1 1 
ATOM   1467 C  CE2 . TYR A 1 224 ? 14.822  -28.420 -1.325  1.00 43.52  ? 551 TYR A CE2 1 
ATOM   1468 C  CZ  . TYR A 1 224 ? 16.030  -27.924 -1.853  1.00 43.39  ? 551 TYR A CZ  1 
ATOM   1469 O  OH  . TYR A 1 224 ? 16.541  -28.483 -2.987  1.00 41.29  ? 551 TYR A OH  1 
ATOM   1470 N  N   . LEU A 1 225 ? 11.460  -25.386 0.723   1.00 45.64  ? 552 LEU A N   1 
ATOM   1471 C  CA  . LEU A 1 225 ? 10.328  -25.457 -0.196  1.00 44.44  ? 552 LEU A CA  1 
ATOM   1472 C  C   . LEU A 1 225 ? 10.011  -24.064 -0.808  1.00 43.95  ? 552 LEU A C   1 
ATOM   1473 O  O   . LEU A 1 225 ? 9.792   -23.943 -2.019  1.00 39.91  ? 552 LEU A O   1 
ATOM   1474 C  CB  . LEU A 1 225 ? 9.115   -26.077 0.486   1.00 45.72  ? 552 LEU A CB  1 
ATOM   1475 C  CG  . LEU A 1 225 ? 7.910   -26.270 -0.435  1.00 45.75  ? 552 LEU A CG  1 
ATOM   1476 C  CD1 . LEU A 1 225 ? 7.955   -27.592 -1.153  1.00 45.86  ? 552 LEU A CD1 1 
ATOM   1477 C  CD2 . LEU A 1 225 ? 6.594   -26.119 0.308   1.00 49.12  ? 552 LEU A CD2 1 
ATOM   1478 N  N   . SER A 1 226 ? 10.033  -23.023 0.029   1.00 47.26  ? 553 SER A N   1 
ATOM   1479 C  CA  . SER A 1 226 ? 9.861   -21.642 -0.462  1.00 47.89  ? 553 SER A CA  1 
ATOM   1480 C  C   . SER A 1 226 ? 10.899  -21.248 -1.485  1.00 46.76  ? 553 SER A C   1 
ATOM   1481 O  O   . SER A 1 226 ? 10.555  -20.686 -2.508  1.00 45.87  ? 553 SER A O   1 
ATOM   1482 C  CB  . SER A 1 226 ? 9.862   -20.649 0.669   1.00 50.40  ? 553 SER A CB  1 
ATOM   1483 O  OG  . SER A 1 226 ? 8.575   -20.639 1.184   1.00 53.90  ? 553 SER A OG  1 
ATOM   1484 N  N   . LYS A 1 227 ? 12.161  -21.559 -1.228  1.00 48.10  ? 554 LYS A N   1 
ATOM   1485 C  CA  . LYS A 1 227 ? 13.238  -21.176 -2.147  1.00 49.33  ? 554 LYS A CA  1 
ATOM   1486 C  C   . LYS A 1 227 ? 13.089  -21.929 -3.467  1.00 45.98  ? 554 LYS A C   1 
ATOM   1487 O  O   . LYS A 1 227 ? 13.293  -21.382 -4.540  1.00 46.57  ? 554 LYS A O   1 
ATOM   1488 C  CB  . LYS A 1 227 ? 14.606  -21.427 -1.516  1.00 52.20  ? 554 LYS A CB  1 
ATOM   1489 C  CG  . LYS A 1 227 ? 15.689  -20.567 -2.144  1.00 54.80  ? 554 LYS A CG  1 
ATOM   1490 C  CD  . LYS A 1 227 ? 17.001  -20.620 -1.372  1.00 58.16  ? 554 LYS A CD  1 
ATOM   1491 C  CE  . LYS A 1 227 ? 18.171  -20.192 -2.276  1.00 60.16  ? 554 LYS A CE  1 
ATOM   1492 N  NZ  . LYS A 1 227 ? 19.531  -20.426 -1.691  1.00 61.86  ? 554 LYS A NZ  1 
ATOM   1493 N  N   . LEU A 1 228 ? 12.702  -23.194 -3.357  1.00 44.25  ? 555 LEU A N   1 
ATOM   1494 C  CA  . LEU A 1 228 ? 12.411  -24.062 -4.476  1.00 41.74  ? 555 LEU A CA  1 
ATOM   1495 C  C   . LEU A 1 228 ? 11.296  -23.516 -5.395  1.00 39.63  ? 555 LEU A C   1 
ATOM   1496 O  O   . LEU A 1 228 ? 11.502  -23.374 -6.634  1.00 38.43  ? 555 LEU A O   1 
ATOM   1497 C  CB  . LEU A 1 228 ? 12.063  -25.422 -3.918  1.00 42.63  ? 555 LEU A CB  1 
ATOM   1498 C  CG  . LEU A 1 228 ? 12.154  -26.672 -4.727  1.00 43.83  ? 555 LEU A CG  1 
ATOM   1499 C  CD1 . LEU A 1 228 ? 13.472  -26.718 -5.506  1.00 45.80  ? 555 LEU A CD1 1 
ATOM   1500 C  CD2 . LEU A 1 228 ? 11.985  -27.869 -3.789  1.00 44.22  ? 555 LEU A CD2 1 
ATOM   1501 N  N   . LEU A 1 229 ? 10.149  -23.197 -4.803  1.00 37.98  ? 556 LEU A N   1 
ATOM   1502 C  CA  . LEU A 1 229 ? 9.039   -22.602 -5.552  1.00 39.02  ? 556 LEU A CA  1 
ATOM   1503 C  C   . LEU A 1 229 ? 9.379   -21.202 -6.046  1.00 39.79  ? 556 LEU A C   1 
ATOM   1504 O  O   . LEU A 1 229 ? 8.854   -20.765 -7.061  1.00 41.27  ? 556 LEU A O   1 
ATOM   1505 C  CB  . LEU A 1 229 ? 7.736   -22.597 -4.733  1.00 39.28  ? 556 LEU A CB  1 
ATOM   1506 C  CG  . LEU A 1 229 ? 7.228   -24.002 -4.381  1.00 39.77  ? 556 LEU A CG  1 
ATOM   1507 C  CD1 . LEU A 1 229 ? 6.133   -23.936 -3.329  1.00 41.36  ? 556 LEU A CD1 1 
ATOM   1508 C  CD2 . LEU A 1 229 ? 6.750   -24.770 -5.602  1.00 37.84  ? 556 LEU A CD2 1 
ATOM   1509 N  N   . GLY A 1 230 ? 10.250  -20.500 -5.316  1.00 40.48  ? 557 GLY A N   1 
ATOM   1510 C  CA  . GLY A 1 230 ? 10.809  -19.196 -5.729  1.00 41.56  ? 557 GLY A CA  1 
ATOM   1511 C  C   . GLY A 1 230 ? 11.609  -19.187 -7.021  1.00 40.29  ? 557 GLY A C   1 
ATOM   1512 O  O   . GLY A 1 230 ? 11.810  -18.130 -7.622  1.00 40.14  ? 557 GLY A O   1 
ATOM   1513 N  N   . LYS A 1 231 ? 12.082  -20.358 -7.466  1.00 38.97  ? 558 LYS A N   1 
ATOM   1514 C  CA  . LYS A 1 231 ? 12.684  -20.458 -8.791  1.00 38.49  ? 558 LYS A CA  1 
ATOM   1515 C  C   . LYS A 1 231 ? 11.691  -20.230 -9.938  1.00 38.23  ? 558 LYS A C   1 
ATOM   1516 O  O   . LYS A 1 231 ? 12.094  -19.820 -11.016 1.00 37.90  ? 558 LYS A O   1 
ATOM   1517 C  CB  . LYS A 1 231 ? 13.426  -21.784 -8.970  1.00 38.06  ? 558 LYS A CB  1 
ATOM   1518 C  CG  . LYS A 1 231 ? 14.732  -21.842 -8.182  1.00 38.80  ? 558 LYS A CG  1 
ATOM   1519 C  CD  . LYS A 1 231 ? 15.847  -21.105 -8.933  1.00 38.25  ? 558 LYS A CD  1 
ATOM   1520 C  CE  . LYS A 1 231 ? 17.045  -20.701 -8.076  1.00 39.26  ? 558 LYS A CE  1 
ATOM   1521 N  NZ  . LYS A 1 231 ? 16.551  -19.590 -7.229  1.00 40.77  ? 558 LYS A NZ  1 
ATOM   1522 N  N   . LEU A 1 232 ? 10.410  -20.495 -9.701  1.00 37.85  ? 559 LEU A N   1 
ATOM   1523 C  CA  . LEU A 1 232 ? 9.371   -20.299 -10.718 1.00 38.73  ? 559 LEU A CA  1 
ATOM   1524 C  C   . LEU A 1 232 ? 9.207   -18.840 -11.233 1.00 39.33  ? 559 LEU A C   1 
ATOM   1525 O  O   . LEU A 1 232 ? 9.267   -18.655 -12.449 1.00 38.24  ? 559 LEU A O   1 
ATOM   1526 C  CB  . LEU A 1 232 ? 8.039   -20.911 -10.283 1.00 38.66  ? 559 LEU A CB  1 
ATOM   1527 C  CG  . LEU A 1 232 ? 8.077   -22.431 -10.170 1.00 39.83  ? 559 LEU A CG  1 
ATOM   1528 C  CD1 . LEU A 1 232 ? 6.812   -22.971 -9.491  1.00 40.43  ? 559 LEU A CD1 1 
ATOM   1529 C  CD2 . LEU A 1 232 ? 8.267   -23.015 -11.551 1.00 38.36  ? 559 LEU A CD2 1 
ATOM   1530 N  N   . PRO A 1 233 ? 9.031   -17.825 -10.331 1.00 41.66  ? 560 PRO A N   1 
ATOM   1531 C  CA  . PRO A 1 233 ? 8.974   -16.413 -10.786 1.00 43.25  ? 560 PRO A CA  1 
ATOM   1532 C  C   . PRO A 1 233 ? 10.191  -15.974 -11.591 1.00 43.65  ? 560 PRO A C   1 
ATOM   1533 O  O   . PRO A 1 233 ? 10.031  -15.237 -12.534 1.00 45.09  ? 560 PRO A O   1 
ATOM   1534 C  CB  . PRO A 1 233 ? 8.900   -15.605 -9.479  1.00 45.01  ? 560 PRO A CB  1 
ATOM   1535 C  CG  . PRO A 1 233 ? 8.294   -16.542 -8.508  1.00 45.28  ? 560 PRO A CG  1 
ATOM   1536 C  CD  . PRO A 1 233 ? 8.808   -17.905 -8.867  1.00 42.97  ? 560 PRO A CD  1 
ATOM   1537 N  N   . GLU A 1 234 ? 11.379  -16.451 -11.242 1.00 43.48  ? 561 GLU A N   1 
ATOM   1538 C  CA  . GLU A 1 234 ? 12.627  -16.205 -11.993 1.00 41.95  ? 561 GLU A CA  1 
ATOM   1539 C  C   . GLU A 1 234 ? 12.584  -16.702 -13.458 1.00 40.74  ? 561 GLU A C   1 
ATOM   1540 O  O   . GLU A 1 234 ? 13.219  -16.123 -14.354 1.00 41.03  ? 561 GLU A O   1 
ATOM   1541 C  CB  . GLU A 1 234 ? 13.824  -16.797 -11.221 1.00 44.02  ? 561 GLU A CB  1 
ATOM   1542 C  CG  . GLU A 1 234 ? 13.950  -16.264 -9.773  1.00 48.35  ? 561 GLU A CG  1 
ATOM   1543 C  CD  . GLU A 1 234 ? 15.148  -16.802 -8.980  1.00 51.40  ? 561 GLU A CD  1 
ATOM   1544 O  OE1 . GLU A 1 234 ? 15.300  -16.414 -7.788  1.00 55.02  ? 561 GLU A OE1 1 
ATOM   1545 O  OE2 . GLU A 1 234 ? 15.969  -17.580 -9.524  1.00 49.89  ? 561 GLU A OE2 1 
ATOM   1546 N  N   . LEU A 1 235 ? 11.815  -17.762 -13.714 1.00 37.79  ? 562 LEU A N   1 
ATOM   1547 C  CA  . LEU A 1 235 ? 11.607  -18.220 -15.081 1.00 36.90  ? 562 LEU A CA  1 
ATOM   1548 C  C   . LEU A 1 235 ? 10.896  -17.180 -15.949 1.00 36.38  ? 562 LEU A C   1 
ATOM   1549 O  O   . LEU A 1 235 ? 11.056  -17.185 -17.160 1.00 37.09  ? 562 LEU A O   1 
ATOM   1550 C  CB  . LEU A 1 235 ? 10.798  -19.532 -15.133 1.00 33.70  ? 562 LEU A CB  1 
ATOM   1551 C  CG  . LEU A 1 235 ? 11.504  -20.801 -14.672 1.00 31.71  ? 562 LEU A CG  1 
ATOM   1552 C  CD1 . LEU A 1 235 ? 10.497  -21.958 -14.671 1.00 28.99  ? 562 LEU A CD1 1 
ATOM   1553 C  CD2 . LEU A 1 235 ? 12.781  -21.112 -15.477 1.00 29.93  ? 562 LEU A CD2 1 
ATOM   1554 N  N   . ARG A 1 236 ? 10.087  -16.327 -15.346 1.00 37.44  ? 563 ARG A N   1 
ATOM   1555 C  CA  . ARG A 1 236 ? 9.353   -15.320 -16.119 1.00 38.80  ? 563 ARG A CA  1 
ATOM   1556 C  C   . ARG A 1 236 ? 10.302  -14.353 -16.822 1.00 37.14  ? 563 ARG A C   1 
ATOM   1557 O  O   . ARG A 1 236 ? 10.132  -14.087 -18.018 1.00 36.67  ? 563 ARG A O   1 
ATOM   1558 C  CB  . ARG A 1 236 ? 8.328   -14.561 -15.269 1.00 42.87  ? 563 ARG A CB  1 
ATOM   1559 C  CG  . ARG A 1 236 ? 7.231   -13.973 -16.125 1.00 48.20  ? 563 ARG A CG  1 
ATOM   1560 C  CD  . ARG A 1 236 ? 6.497   -12.794 -15.496 1.00 53.90  ? 563 ARG A CD  1 
ATOM   1561 N  NE  . ARG A 1 236 ? 5.659   -12.161 -16.532 1.00 58.64  ? 563 ARG A NE  1 
ATOM   1562 C  CZ  . ARG A 1 236 ? 5.865   -10.955 -17.074 1.00 60.92  ? 563 ARG A CZ  1 
ATOM   1563 N  NH1 . ARG A 1 236 ? 6.854   -10.166 -16.649 1.00 58.64  ? 563 ARG A NH1 1 
ATOM   1564 N  NH2 . ARG A 1 236 ? 5.028   -10.509 -18.017 1.00 62.02  ? 563 ARG A NH2 1 
ATOM   1565 N  N   . THR A 1 237 ? 11.303  -13.855 -16.093 1.00 36.42  ? 564 THR A N   1 
ATOM   1566 C  CA  . THR A 1 237 ? 12.351  -12.999 -16.639 1.00 37.17  ? 564 THR A CA  1 
ATOM   1567 C  C   . THR A 1 237 ? 13.078  -13.677 -17.784 1.00 33.92  ? 564 THR A C   1 
ATOM   1568 O  O   . THR A 1 237 ? 13.273  -13.074 -18.803 1.00 32.34  ? 564 THR A O   1 
ATOM   1569 C  CB  . THR A 1 237 ? 13.371  -12.618 -15.563 1.00 39.28  ? 564 THR A CB  1 
ATOM   1570 O  OG1 . THR A 1 237 ? 12.628  -12.196 -14.426 1.00 46.23  ? 564 THR A OG1 1 
ATOM   1571 C  CG2 . THR A 1 237 ? 14.262  -11.479 -16.038 1.00 39.86  ? 564 THR A CG2 1 
ATOM   1572 N  N   . LEU A 1 238 ? 13.444  -14.936 -17.596 1.00 32.17  ? 565 LEU A N   1 
ATOM   1573 C  CA  . LEU A 1 238 ? 14.121  -15.719 -18.645 1.00 31.16  ? 565 LEU A CA  1 
ATOM   1574 C  C   . LEU A 1 238 ? 13.257  -15.903 -19.889 1.00 30.12  ? 565 LEU A C   1 
ATOM   1575 O  O   . LEU A 1 238 ? 13.764  -15.942 -20.991 1.00 29.47  ? 565 LEU A O   1 
ATOM   1576 C  CB  . LEU A 1 238 ? 14.640  -17.059 -18.058 1.00 29.38  ? 565 LEU A CB  1 
ATOM   1577 C  CG  . LEU A 1 238 ? 15.776  -16.778 -17.070 1.00 31.32  ? 565 LEU A CG  1 
ATOM   1578 C  CD1 . LEU A 1 238 ? 15.839  -17.819 -15.971 1.00 30.40  ? 565 LEU A CD1 1 
ATOM   1579 C  CD2 . LEU A 1 238 ? 17.128  -16.614 -17.788 1.00 31.01  ? 565 LEU A CD2 1 
ATOM   1580 N  N   . CYS A 1 239 ? 11.945  -15.985 -19.685 1.00 29.60  ? 566 CYS A N   1 
ATOM   1581 C  CA  . CYS A 1 239 ? 10.986  -16.084 -20.769 1.00 30.35  ? 566 CYS A CA  1 
ATOM   1582 C  C   . CYS A 1 239 ? 10.958  -14.791 -21.581 1.00 29.02  ? 566 CYS A C   1 
ATOM   1583 O  O   . CYS A 1 239 ? 11.092  -14.818 -22.806 1.00 27.53  ? 566 CYS A O   1 
ATOM   1584 C  CB  . CYS A 1 239 ? 9.588   -16.468 -20.247 1.00 31.03  ? 566 CYS A CB  1 
ATOM   1585 S  SG  . CYS A 1 239 ? 8.238   -16.208 -21.419 1.00 33.09  ? 566 CYS A SG  1 
ATOM   1586 N  N   . THR A 1 240 ? 10.851  -13.678 -20.875 1.00 28.56  ? 567 THR A N   1 
ATOM   1587 C  CA  . THR A 1 240 ? 10.886  -12.363 -21.486 1.00 30.57  ? 567 THR A CA  1 
ATOM   1588 C  C   . THR A 1 240 ? 12.197  -12.143 -22.255 1.00 29.80  ? 567 THR A C   1 
ATOM   1589 O  O   . THR A 1 240 ? 12.183  -11.562 -23.320 1.00 29.12  ? 567 THR A O   1 
ATOM   1590 C  CB  . THR A 1 240 ? 10.685  -11.245 -20.409 1.00 31.59  ? 567 THR A CB  1 
ATOM   1591 O  OG1 . THR A 1 240 ? 9.508   -11.545 -19.682 1.00 32.17  ? 567 THR A OG1 1 
ATOM   1592 C  CG2 . THR A 1 240 ? 10.422  -9.922  -21.069 1.00 32.68  ? 567 THR A CG2 1 
ATOM   1593 N  N   . GLN A 1 241 ? 13.323  -12.610 -21.717 1.00 29.04  ? 568 GLN A N   1 
ATOM   1594 C  CA  . GLN A 1 241 ? 14.589  -12.474 -22.441 1.00 29.78  ? 568 GLN A CA  1 
ATOM   1595 C  C   . GLN A 1 241 ? 14.589  -13.315 -23.699 1.00 28.17  ? 568 GLN A C   1 
ATOM   1596 O  O   . GLN A 1 241 ? 15.183  -12.935 -24.638 1.00 26.87  ? 568 GLN A O   1 
ATOM   1597 C  CB  . GLN A 1 241 ? 15.800  -12.801 -21.587 1.00 32.27  ? 568 GLN A CB  1 
ATOM   1598 C  CG  . GLN A 1 241 ? 15.916  -11.925 -20.360 1.00 37.26  ? 568 GLN A CG  1 
ATOM   1599 C  CD  . GLN A 1 241 ? 17.131  -12.264 -19.524 1.00 41.77  ? 568 GLN A CD  1 
ATOM   1600 O  OE1 . GLN A 1 241 ? 18.151  -12.709 -20.049 1.00 45.25  ? 568 GLN A OE1 1 
ATOM   1601 N  NE2 . GLN A 1 241 ? 17.064  -11.989 -18.234 1.00 45.41  ? 568 GLN A NE2 1 
ATOM   1602 N  N   . GLY A 1 242 ? 13.941  -14.486 -23.684 1.00 26.66  ? 569 GLY A N   1 
ATOM   1603 C  CA  . GLY A 1 242 ? 13.757  -15.287 -24.894 1.00 26.80  ? 569 GLY A CA  1 
ATOM   1604 C  C   . GLY A 1 242 ? 12.870  -14.589 -25.924 1.00 28.08  ? 569 GLY A C   1 
ATOM   1605 O  O   . GLY A 1 242 ? 13.217  -14.584 -27.101 1.00 29.63  ? 569 GLY A O   1 
ATOM   1606 N  N   . LEU A 1 243 ? 11.767  -13.990 -25.480 1.00 26.99  ? 570 LEU A N   1 
ATOM   1607 C  CA  . LEU A 1 243 ? 10.953  -13.169 -26.348 1.00 28.23  ? 570 LEU A CA  1 
ATOM   1608 C  C   . LEU A 1 243 ? 11.721  -12.000 -26.984 1.00 27.64  ? 570 LEU A C   1 
ATOM   1609 O  O   . LEU A 1 243 ? 11.592  -11.743 -28.174 1.00 27.33  ? 570 LEU A O   1 
ATOM   1610 C  CB  . LEU A 1 243 ? 9.726   -12.632 -25.604 1.00 30.41  ? 570 LEU A CB  1 
ATOM   1611 C  CG  . LEU A 1 243 ? 8.521   -13.551 -25.416 1.00 32.15  ? 570 LEU A CG  1 
ATOM   1612 C  CD1 . LEU A 1 243 ? 7.471   -12.756 -24.683 1.00 35.13  ? 570 LEU A CD1 1 
ATOM   1613 C  CD2 . LEU A 1 243 ? 7.927   -14.078 -26.718 1.00 32.55  ? 570 LEU A CD2 1 
ATOM   1614 N  N   . GLN A 1 244 ? 12.538  -11.321 -26.190 1.00 27.33  ? 571 GLN A N   1 
ATOM   1615 C  CA  . GLN A 1 244 ? 13.398  -10.220 -26.654 1.00 28.47  ? 571 GLN A CA  1 
ATOM   1616 C  C   . GLN A 1 244 ? 14.353  -10.685 -27.782 1.00 27.62  ? 571 GLN A C   1 
ATOM   1617 O  O   . GLN A 1 244 ? 14.595  -9.963  -28.749 1.00 26.83  ? 571 GLN A O   1 
ATOM   1618 C  CB  . GLN A 1 244 ? 14.202  -9.663  -25.465 1.00 30.07  ? 571 GLN A CB  1 
ATOM   1619 C  CG  . GLN A 1 244 ? 15.247  -8.640  -25.837 1.00 33.55  ? 571 GLN A CG  1 
ATOM   1620 C  CD  . GLN A 1 244 ? 16.088  -8.189  -24.660 1.00 35.18  ? 571 GLN A CD  1 
ATOM   1621 O  OE1 . GLN A 1 244 ? 16.631  -9.004  -23.938 1.00 38.96  ? 571 GLN A OE1 1 
ATOM   1622 N  NE2 . GLN A 1 244 ? 16.246  -6.913  -24.503 1.00 36.37  ? 571 GLN A NE2 1 
ATOM   1623 N  N   . ARG A 1 245 ? 14.896  -11.896 -27.644 1.00 26.94  ? 572 ARG A N   1 
ATOM   1624 C  CA  . ARG A 1 245 ? 15.795  -12.438 -28.652 1.00 26.44  ? 572 ARG A CA  1 
ATOM   1625 C  C   . ARG A 1 245 ? 15.048  -12.707 -29.964 1.00 25.63  ? 572 ARG A C   1 
ATOM   1626 O  O   . ARG A 1 245 ? 15.520  -12.353 -31.041 1.00 26.64  ? 572 ARG A O   1 
ATOM   1627 C  CB  . ARG A 1 245 ? 16.505  -13.700 -28.158 1.00 26.47  ? 572 ARG A CB  1 
ATOM   1628 C  CG  . ARG A 1 245 ? 17.411  -14.313 -29.210 1.00 27.17  ? 572 ARG A CG  1 
ATOM   1629 C  CD  . ARG A 1 245 ? 18.556  -13.348 -29.524 1.00 29.26  ? 572 ARG A CD  1 
ATOM   1630 N  NE  . ARG A 1 245 ? 19.432  -13.833 -30.560 1.00 30.17  ? 572 ARG A NE  1 
ATOM   1631 C  CZ  . ARG A 1 245 ? 20.442  -13.130 -31.032 1.00 33.31  ? 572 ARG A CZ  1 
ATOM   1632 N  NH1 . ARG A 1 245 ? 20.709  -11.913 -30.532 1.00 34.80  ? 572 ARG A NH1 1 
ATOM   1633 N  NH2 . ARG A 1 245 ? 21.243  -13.654 -31.955 1.00 34.75  ? 572 ARG A NH2 1 
ATOM   1634 N  N   . ILE A 1 246 ? 13.876  -13.317 -29.871 1.00 24.21  ? 573 ILE A N   1 
ATOM   1635 C  CA  . ILE A 1 246 ? 13.057  -13.550 -31.061 1.00 24.34  ? 573 ILE A CA  1 
ATOM   1636 C  C   . ILE A 1 246 ? 12.671  -12.235 -31.711 1.00 24.60  ? 573 ILE A C   1 
ATOM   1637 O  O   . ILE A 1 246 ? 12.732  -12.128 -32.941 1.00 25.33  ? 573 ILE A O   1 
ATOM   1638 C  CB  . ILE A 1 246 ? 11.809  -14.409 -30.728 1.00 24.03  ? 573 ILE A CB  1 
ATOM   1639 C  CG1 . ILE A 1 246 ? 12.266  -15.798 -30.289 1.00 23.61  ? 573 ILE A CG1 1 
ATOM   1640 C  CG2 . ILE A 1 246 ? 10.908  -14.522 -31.943 1.00 24.47  ? 573 ILE A CG2 1 
ATOM   1641 C  CD1 . ILE A 1 246 ? 11.259  -16.587 -29.431 1.00 22.87  ? 573 ILE A CD1 1 
ATOM   1642 N  N   . PHE A 1 247 ? 12.263  -11.250 -30.887 1.00 23.71  ? 574 PHE A N   1 
ATOM   1643 C  CA  . PHE A 1 247 ? 11.960  -9.892  -31.338 1.00 24.68  ? 574 PHE A CA  1 
ATOM   1644 C  C   . PHE A 1 247 ? 13.123  -9.313  -32.136 1.00 25.57  ? 574 PHE A C   1 
ATOM   1645 O  O   . PHE A 1 247 ? 12.944  -8.783  -33.252 1.00 25.77  ? 574 PHE A O   1 
ATOM   1646 C  CB  . PHE A 1 247 ? 11.627  -8.966  -30.124 1.00 24.86  ? 574 PHE A CB  1 
ATOM   1647 C  CG  . PHE A 1 247 ? 11.387  -7.516  -30.486 1.00 25.90  ? 574 PHE A CG  1 
ATOM   1648 C  CD1 . PHE A 1 247 ? 10.149  -7.075  -30.979 1.00 26.31  ? 574 PHE A CD1 1 
ATOM   1649 C  CD2 . PHE A 1 247 ? 12.410  -6.580  -30.348 1.00 26.56  ? 574 PHE A CD2 1 
ATOM   1650 C  CE1 . PHE A 1 247 ? 9.951   -5.702  -31.296 1.00 27.62  ? 574 PHE A CE1 1 
ATOM   1651 C  CE2 . PHE A 1 247 ? 12.210  -5.233  -30.665 1.00 27.30  ? 574 PHE A CE2 1 
ATOM   1652 C  CZ  . PHE A 1 247 ? 10.978  -4.800  -31.135 1.00 27.96  ? 574 PHE A CZ  1 
ATOM   1653 N  N   . TYR A 1 248 ? 14.313  -9.389  -31.547 1.00 25.91  ? 575 TYR A N   1 
ATOM   1654 C  CA  . TYR A 1 248 ? 15.493  -8.879  -32.198 1.00 27.52  ? 575 TYR A CA  1 
ATOM   1655 C  C   . TYR A 1 248 ? 15.747  -9.576  -33.558 1.00 28.01  ? 575 TYR A C   1 
ATOM   1656 O  O   . TYR A 1 248 ? 15.944  -8.915  -34.600 1.00 28.37  ? 575 TYR A O   1 
ATOM   1657 C  CB  . TYR A 1 248 ? 16.703  -9.027  -31.279 1.00 28.74  ? 575 TYR A CB  1 
ATOM   1658 C  CG  . TYR A 1 248 ? 17.949  -8.542  -31.959 1.00 30.81  ? 575 TYR A CG  1 
ATOM   1659 C  CD1 . TYR A 1 248 ? 18.262  -7.190  -31.943 1.00 31.93  ? 575 TYR A CD1 1 
ATOM   1660 C  CD2 . TYR A 1 248 ? 18.788  -9.435  -32.667 1.00 31.63  ? 575 TYR A CD2 1 
ATOM   1661 C  CE1 . TYR A 1 248 ? 19.396  -6.708  -32.566 1.00 34.13  ? 575 TYR A CE1 1 
ATOM   1662 C  CE2 . TYR A 1 248 ? 19.937  -8.957  -33.313 1.00 33.59  ? 575 TYR A CE2 1 
ATOM   1663 C  CZ  . TYR A 1 248 ? 20.223  -7.581  -33.250 1.00 34.78  ? 575 TYR A CZ  1 
ATOM   1664 O  OH  . TYR A 1 248 ? 21.307  -7.040  -33.864 1.00 37.22  ? 575 TYR A OH  1 
ATOM   1665 N  N   . LEU A 1 249 ? 15.746  -10.917 -33.537 1.00 27.39  ? 576 LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 249 ? 15.971  -11.703 -34.760 1.00 28.64  ? 576 LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 249 ? 14.942  -11.439 -35.818 1.00 29.92  ? 576 LEU A C   1 
ATOM   1668 O  O   . LEU A 1 249 ? 15.289  -11.341 -37.006 1.00 31.15  ? 576 LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 249 ? 16.036  -13.215 -34.468 1.00 27.72  ? 576 LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 249 ? 17.257  -13.614 -33.631 1.00 27.38  ? 576 LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 249 ? 17.046  -15.069 -33.259 1.00 26.66  ? 576 LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 249 ? 18.536  -13.423 -34.427 1.00 28.36  ? 576 LEU A CD2 1 
ATOM   1673 N  N   . LYS A 1 250 ? 13.685  -11.292 -35.416 1.00 29.67  ? 577 LYS A N   1 
ATOM   1674 C  CA  . LYS A 1 250 ? 12.616  -10.935 -36.374 1.00 31.90  ? 577 LYS A CA  1 
ATOM   1675 C  C   . LYS A 1 250 ? 12.825  -9.565  -37.012 1.00 33.36  ? 577 LYS A C   1 
ATOM   1676 O  O   . LYS A 1 250 ? 12.664  -9.390  -38.235 1.00 33.81  ? 577 LYS A O   1 
ATOM   1677 C  CB  . LYS A 1 250 ? 11.217  -11.067 -35.720 1.00 31.82  ? 577 LYS A CB  1 
ATOM   1678 C  CG  . LYS A 1 250 ? 10.059  -10.819 -36.676 1.00 33.78  ? 577 LYS A CG  1 
ATOM   1679 C  CD  . LYS A 1 250 ? 8.725   -11.098 -35.967 1.00 33.29  ? 577 LYS A CD  1 
ATOM   1680 C  CE  . LYS A 1 250 ? 7.584   -10.752 -36.906 1.00 35.78  ? 577 LYS A CE  1 
ATOM   1681 N  NZ  . LYS A 1 250 ? 7.515   -11.804 -37.970 1.00 36.26  ? 577 LYS A NZ  1 
ATOM   1682 N  N   . LEU A 1 251 ? 13.193  -8.587  -36.198 1.00 33.90  ? 578 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 251 ? 13.509  -7.265  -36.735 1.00 37.28  ? 578 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 251 ? 14.791  -7.285  -37.603 1.00 38.64  ? 578 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 251 ? 14.856  -6.638  -38.626 1.00 40.44  ? 578 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 251 ? 13.666  -6.305  -35.578 1.00 39.07  ? 578 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 251 ? 13.196  -4.882  -35.425 1.00 43.04  ? 578 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 251 ? 11.870  -4.534  -36.076 1.00 43.13  ? 578 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 251 ? 13.098  -4.828  -33.925 1.00 42.03  ? 578 LEU A CD2 1 
ATOM   1690 N  N   . GLU A 1 252 ? 15.798  -8.053  -37.203 1.00 39.51  ? 579 GLU A N   1 
ATOM   1691 C  CA  . GLU A 1 252 ? 17.021  -8.138  -37.990 1.00 42.23  ? 579 GLU A CA  1 
ATOM   1692 C  C   . GLU A 1 252 ? 16.699  -8.762  -39.369 1.00 43.31  ? 579 GLU A C   1 
ATOM   1693 O  O   . GLU A 1 252 ? 17.178  -8.301  -40.400 1.00 44.27  ? 579 GLU A O   1 
ATOM   1694 C  CB  . GLU A 1 252 ? 18.091  -8.925  -37.259 1.00 42.15  ? 579 GLU A CB  1 
ATOM   1695 C  CG  . GLU A 1 252 ? 19.356  -9.075  -38.086 1.00 46.01  ? 579 GLU A CG  1 
ATOM   1696 C  CD  . GLU A 1 252 ? 20.425  -9.906  -37.420 1.00 47.65  ? 579 GLU A CD  1 
ATOM   1697 O  OE1 . GLU A 1 252 ? 21.527  -9.329  -37.236 1.00 51.35  ? 579 GLU A OE1 1 
ATOM   1698 O  OE2 . GLU A 1 252 ? 20.165  -11.095 -37.078 1.00 45.09  ? 579 GLU A OE2 1 
ATOM   1699 N  N   . ASP A 1 253 ? 15.853  -9.789  -39.363 1.00 43.09  ? 580 ASP A N   1 
ATOM   1700 C  CA  . ASP A 1 253 ? 15.272  -10.301 -40.593 1.00 45.33  ? 580 ASP A CA  1 
ATOM   1701 C  C   . ASP A 1 253 ? 16.301  -10.944 -41.527 1.00 46.35  ? 580 ASP A C   1 
ATOM   1702 O  O   . ASP A 1 253 ? 16.138  -10.963 -42.732 1.00 47.60  ? 580 ASP A O   1 
ATOM   1703 C  CB  . ASP A 1 253 ? 14.536  -9.173  -41.337 1.00 47.66  ? 580 ASP A CB  1 
ATOM   1704 C  CG  . ASP A 1 253 ? 13.606  -9.691  -42.409 1.00 49.55  ? 580 ASP A CG  1 
ATOM   1705 O  OD1 . ASP A 1 253 ? 13.078  -10.821 -42.220 1.00 49.09  ? 580 ASP A OD1 1 
ATOM   1706 O  OD2 . ASP A 1 253 ? 13.414  -8.965  -43.419 1.00 51.58  ? 580 ASP A OD2 1 
ATOM   1707 N  N   . LEU A 1 254 ? 17.366  -11.486 -40.964 1.00 46.53  ? 581 LEU A N   1 
ATOM   1708 C  CA  . LEU A 1 254 ? 18.309  -12.262 -41.736 1.00 47.70  ? 581 LEU A CA  1 
ATOM   1709 C  C   . LEU A 1 254 ? 17.702  -13.670 -41.994 1.00 46.76  ? 581 LEU A C   1 
ATOM   1710 O  O   . LEU A 1 254 ? 17.654  -14.125 -43.130 1.00 47.61  ? 581 LEU A O   1 
ATOM   1711 C  CB  . LEU A 1 254 ? 19.584  -12.353 -40.953 1.00 49.22  ? 581 LEU A CB  1 
ATOM   1712 C  CG  . LEU A 1 254 ? 20.897  -12.259 -41.729 1.00 53.96  ? 581 LEU A CG  1 
ATOM   1713 C  CD1 . LEU A 1 254 ? 21.259  -10.804 -42.075 1.00 55.74  ? 581 LEU A CD1 1 
ATOM   1714 C  CD2 . LEU A 1 254 ? 21.967  -12.960 -40.896 1.00 53.04  ? 581 LEU A CD2 1 
ATOM   1715 N  N   . VAL A 1 255 ? 17.225  -14.316 -40.926 1.00 43.64  ? 582 VAL A N   1 
ATOM   1716 C  CA  . VAL A 1 255 ? 16.431  -15.529 -41.010 1.00 42.88  ? 582 VAL A CA  1 
ATOM   1717 C  C   . VAL A 1 255 ? 15.163  -15.260 -40.193 1.00 41.02  ? 582 VAL A C   1 
ATOM   1718 O  O   . VAL A 1 255 ? 15.220  -15.242 -38.967 1.00 39.22  ? 582 VAL A O   1 
ATOM   1719 C  CB  . VAL A 1 255 ? 17.143  -16.796 -40.456 1.00 42.24  ? 582 VAL A CB  1 
ATOM   1720 C  CG1 . VAL A 1 255 ? 16.418  -18.072 -40.894 1.00 41.64  ? 582 VAL A CG1 1 
ATOM   1721 C  CG2 . VAL A 1 255 ? 18.589  -16.849 -40.871 1.00 43.29  ? 582 VAL A CG2 1 
ATOM   1722 N  N   . PRO A 1 256 ? 14.025  -15.085 -40.876 1.00 41.36  ? 583 PRO A N   1 
ATOM   1723 C  CA  . PRO A 1 256 ? 12.725  -14.962 -40.236 1.00 40.49  ? 583 PRO A CA  1 
ATOM   1724 C  C   . PRO A 1 256 ? 12.377  -16.194 -39.411 1.00 39.07  ? 583 PRO A C   1 
ATOM   1725 O  O   . PRO A 1 256 ? 12.806  -17.283 -39.753 1.00 38.31  ? 583 PRO A O   1 
ATOM   1726 C  CB  . PRO A 1 256 ? 11.748  -14.850 -41.412 1.00 42.43  ? 583 PRO A CB  1 
ATOM   1727 C  CG  . PRO A 1 256 ? 12.580  -14.592 -42.638 1.00 45.50  ? 583 PRO A CG  1 
ATOM   1728 C  CD  . PRO A 1 256 ? 14.022  -14.562 -42.260 1.00 45.10  ? 583 PRO A CD  1 
ATOM   1729 N  N   . PRO A 1 257 ? 11.619  -16.036 -38.296 1.00 38.04  ? 584 PRO A N   1 
ATOM   1730 C  CA  . PRO A 1 257 ? 11.305  -17.244 -37.521 1.00 37.02  ? 584 PRO A CA  1 
ATOM   1731 C  C   . PRO A 1 257 ? 10.353  -18.174 -38.303 1.00 37.56  ? 584 PRO A C   1 
ATOM   1732 O  O   . PRO A 1 257 ? 9.594   -17.682 -39.148 1.00 39.20  ? 584 PRO A O   1 
ATOM   1733 C  CB  . PRO A 1 257 ? 10.635  -16.716 -36.256 1.00 34.24  ? 584 PRO A CB  1 
ATOM   1734 C  CG  . PRO A 1 257 ? 10.149  -15.384 -36.628 1.00 35.21  ? 584 PRO A CG  1 
ATOM   1735 C  CD  . PRO A 1 257 ? 11.074  -14.821 -37.663 1.00 37.26  ? 584 PRO A CD  1 
ATOM   1736 N  N   . PRO A 1 258 ? 10.426  -19.494 -38.067 1.00 37.09  ? 585 PRO A N   1 
ATOM   1737 C  CA  . PRO A 1 258 ? 9.481   -20.312 -38.826 1.00 39.04  ? 585 PRO A CA  1 
ATOM   1738 C  C   . PRO A 1 258 ? 8.052   -20.111 -38.282 1.00 39.29  ? 585 PRO A C   1 
ATOM   1739 O  O   . PRO A 1 258 ? 7.880   -19.602 -37.144 1.00 36.63  ? 585 PRO A O   1 
ATOM   1740 C  CB  . PRO A 1 258 ? 9.976   -21.727 -38.583 1.00 37.63  ? 585 PRO A CB  1 
ATOM   1741 C  CG  . PRO A 1 258 ? 10.620  -21.674 -37.233 1.00 35.73  ? 585 PRO A CG  1 
ATOM   1742 C  CD  . PRO A 1 258 ? 11.235  -20.292 -37.132 1.00 35.39  ? 585 PRO A CD  1 
ATOM   1743 N  N   . ALA A 1 259 ? 7.066   -20.519 -39.076 1.00 40.12  ? 586 ALA A N   1 
ATOM   1744 C  CA  . ALA A 1 259 ? 5.675   -20.106 -38.872 1.00 39.86  ? 586 ALA A CA  1 
ATOM   1745 C  C   . ALA A 1 259 ? 5.161   -20.370 -37.444 1.00 38.36  ? 586 ALA A C   1 
ATOM   1746 O  O   . ALA A 1 259 ? 4.538   -19.500 -36.854 1.00 36.64  ? 586 ALA A O   1 
ATOM   1747 C  CB  . ALA A 1 259 ? 4.787   -20.758 -39.926 1.00 42.84  ? 586 ALA A CB  1 
ATOM   1748 N  N   . ILE A 1 260 ? 5.490   -21.528 -36.879 1.00 36.43  ? 587 ILE A N   1 
ATOM   1749 C  CA  . ILE A 1 260 ? 4.993   -21.880 -35.553 1.00 37.01  ? 587 ILE A CA  1 
ATOM   1750 C  C   . ILE A 1 260 ? 5.539   -20.990 -34.426 1.00 34.49  ? 587 ILE A C   1 
ATOM   1751 O  O   . ILE A 1 260 ? 4.786   -20.632 -33.497 1.00 32.83  ? 587 ILE A O   1 
ATOM   1752 C  CB  . ILE A 1 260 ? 5.171   -23.388 -35.226 1.00 38.97  ? 587 ILE A CB  1 
ATOM   1753 C  CG1 . ILE A 1 260 ? 4.409   -23.784 -33.943 1.00 39.71  ? 587 ILE A CG1 1 
ATOM   1754 C  CG2 . ILE A 1 260 ? 6.638   -23.793 -35.151 1.00 39.01  ? 587 ILE A CG2 1 
ATOM   1755 C  CD1 . ILE A 1 260 ? 2.893   -23.636 -34.063 1.00 44.40  ? 587 ILE A CD1 1 
ATOM   1756 N  N   . ILE A 1 261 ? 6.808   -20.577 -34.573 1.00 33.51  ? 588 ILE A N   1 
ATOM   1757 C  CA  . ILE A 1 261 ? 7.438   -19.652 -33.621 1.00 31.39  ? 588 ILE A CA  1 
ATOM   1758 C  C   . ILE A 1 261 ? 6.858   -18.258 -33.800 1.00 30.11  ? 588 ILE A C   1 
ATOM   1759 O  O   . ILE A 1 261 ? 6.481   -17.632 -32.839 1.00 28.49  ? 588 ILE A O   1 
ATOM   1760 C  CB  . ILE A 1 261 ? 8.985   -19.622 -33.751 1.00 32.10  ? 588 ILE A CB  1 
ATOM   1761 C  CG1 . ILE A 1 261 ? 9.581   -21.000 -33.429 1.00 32.78  ? 588 ILE A CG1 1 
ATOM   1762 C  CG2 . ILE A 1 261 ? 9.583   -18.549 -32.838 1.00 30.10  ? 588 ILE A CG2 1 
ATOM   1763 C  CD1 . ILE A 1 261 ? 9.144   -21.630 -32.111 1.00 34.47  ? 588 ILE A CD1 1 
ATOM   1764 N  N   . ASP A 1 262 ? 6.763   -17.810 -35.054 1.00 31.34  ? 589 ASP A N   1 
ATOM   1765 C  CA  . ASP A 1 262 ? 6.214   -16.508 -35.411 1.00 32.46  ? 589 ASP A CA  1 
ATOM   1766 C  C   . ASP A 1 262 ? 4.805   -16.338 -34.862 1.00 32.34  ? 589 ASP A C   1 
ATOM   1767 O  O   . ASP A 1 262 ? 4.508   -15.326 -34.250 1.00 31.36  ? 589 ASP A O   1 
ATOM   1768 C  CB  . ASP A 1 262 ? 6.160   -16.383 -36.933 1.00 33.79  ? 589 ASP A CB  1 
ATOM   1769 C  CG  . ASP A 1 262 ? 6.303   -14.938 -37.412 1.00 34.84  ? 589 ASP A CG  1 
ATOM   1770 O  OD1 . ASP A 1 262 ? 6.997   -14.110 -36.799 1.00 35.51  ? 589 ASP A OD1 1 
ATOM   1771 O  OD2 . ASP A 1 262 ? 5.731   -14.639 -38.440 1.00 36.53  ? 589 ASP A OD2 1 
ATOM   1772 N  N   . LYS A 1 263 ? 3.962   -17.334 -35.097 1.00 34.22  ? 590 LYS A N   1 
ATOM   1773 C  CA  . LYS A 1 263 ? 2.582   -17.316 -34.653 1.00 36.48  ? 590 LYS A CA  1 
ATOM   1774 C  C   . LYS A 1 263 ? 2.494   -17.239 -33.129 1.00 33.95  ? 590 LYS A C   1 
ATOM   1775 O  O   . LYS A 1 263 ? 1.838   -16.327 -32.608 1.00 33.56  ? 590 LYS A O   1 
ATOM   1776 C  CB  . LYS A 1 263 ? 1.789   -18.514 -35.218 1.00 41.11  ? 590 LYS A CB  1 
ATOM   1777 C  CG  . LYS A 1 263 ? 0.339   -18.510 -34.715 1.00 46.59  ? 590 LYS A CG  1 
ATOM   1778 C  CD  . LYS A 1 263 ? -0.713  -19.149 -35.626 1.00 51.90  ? 590 LYS A CD  1 
ATOM   1779 C  CE  . LYS A 1 263 ? -1.040  -20.606 -35.236 1.00 56.05  ? 590 LYS A CE  1 
ATOM   1780 N  NZ  . LYS A 1 263 ? -1.376  -20.833 -33.788 1.00 57.75  ? 590 LYS A NZ  1 
ATOM   1781 N  N   . LEU A 1 264 ? 3.177   -18.139 -32.426 1.00 31.09  ? 591 LEU A N   1 
ATOM   1782 C  CA  . LEU A 1 264 ? 3.190   -18.089 -30.956 1.00 31.27  ? 591 LEU A CA  1 
ATOM   1783 C  C   . LEU A 1 264 ? 3.786   -16.764 -30.408 1.00 29.78  ? 591 LEU A C   1 
ATOM   1784 O  O   . LEU A 1 264 ? 3.244   -16.195 -29.464 1.00 30.92  ? 591 LEU A O   1 
ATOM   1785 C  CB  . LEU A 1 264 ? 3.935   -19.288 -30.350 1.00 31.25  ? 591 LEU A CB  1 
ATOM   1786 C  CG  . LEU A 1 264 ? 3.224   -20.635 -30.504 1.00 36.33  ? 591 LEU A CG  1 
ATOM   1787 C  CD1 . LEU A 1 264 ? 4.023   -21.758 -29.817 1.00 36.80  ? 591 LEU A CD1 1 
ATOM   1788 C  CD2 . LEU A 1 264 ? 1.806   -20.569 -29.928 1.00 36.39  ? 591 LEU A CD2 1 
ATOM   1789 N  N   . PHE A 1 265 ? 4.859   -16.286 -31.046 1.00 27.85  ? 592 PHE A N   1 
ATOM   1790 C  CA  . PHE A 1 265 ? 5.519   -15.027 -30.665 1.00 27.18  ? 592 PHE A CA  1 
ATOM   1791 C  C   . PHE A 1 265 ? 4.518   -13.864 -30.788 1.00 28.08  ? 592 PHE A C   1 
ATOM   1792 O  O   . PHE A 1 265 ? 4.269   -13.149 -29.808 1.00 26.67  ? 592 PHE A O   1 
ATOM   1793 C  CB  . PHE A 1 265 ? 6.776   -14.763 -31.518 1.00 26.03  ? 592 PHE A CB  1 
ATOM   1794 C  CG  . PHE A 1 265 ? 7.396   -13.419 -31.270 1.00 26.30  ? 592 PHE A CG  1 
ATOM   1795 C  CD1 . PHE A 1 265 ? 8.109   -13.133 -30.075 1.00 25.12  ? 592 PHE A CD1 1 
ATOM   1796 C  CD2 . PHE A 1 265 ? 7.192   -12.398 -32.197 1.00 26.84  ? 592 PHE A CD2 1 
ATOM   1797 C  CE1 . PHE A 1 265 ? 8.618   -11.874 -29.855 1.00 25.29  ? 592 PHE A CE1 1 
ATOM   1798 C  CE2 . PHE A 1 265 ? 7.755   -11.127 -31.983 1.00 27.31  ? 592 PHE A CE2 1 
ATOM   1799 C  CZ  . PHE A 1 265 ? 8.464   -10.882 -30.811 1.00 26.25  ? 592 PHE A CZ  1 
ATOM   1800 N  N   . LEU A 1 266 ? 3.950   -13.716 -31.985 1.00 29.12  ? 593 LEU A N   1 
ATOM   1801 C  CA  . LEU A 1 266 ? 3.012   -12.628 -32.286 1.00 30.82  ? 593 LEU A CA  1 
ATOM   1802 C  C   . LEU A 1 266 ? 1.728   -12.676 -31.426 1.00 31.93  ? 593 LEU A C   1 
ATOM   1803 O  O   . LEU A 1 266 ? 1.273   -11.611 -30.948 1.00 32.31  ? 593 LEU A O   1 
ATOM   1804 C  CB  . LEU A 1 266 ? 2.659   -12.569 -33.787 1.00 31.66  ? 593 LEU A CB  1 
ATOM   1805 C  CG  . LEU A 1 266 ? 3.827   -12.148 -34.725 1.00 32.68  ? 593 LEU A CG  1 
ATOM   1806 C  CD1 . LEU A 1 266 ? 3.469   -12.300 -36.205 1.00 33.60  ? 593 LEU A CD1 1 
ATOM   1807 C  CD2 . LEU A 1 266 ? 4.376   -10.736 -34.484 1.00 32.80  ? 593 LEU A CD2 1 
ATOM   1808 N  N   . ASP A 1 267 ? 1.163   -13.880 -31.227 1.00 32.34  ? 594 ASP A N   1 
ATOM   1809 C  CA  . ASP A 1 267 ? -0.046  -14.061 -30.409 1.00 35.11  ? 594 ASP A CA  1 
ATOM   1810 C  C   . ASP A 1 267 ? 0.144   -13.651 -28.931 1.00 35.04  ? 594 ASP A C   1 
ATOM   1811 O  O   . ASP A 1 267 ? -0.767  -13.152 -28.310 1.00 33.89  ? 594 ASP A O   1 
ATOM   1812 C  CB  . ASP A 1 267 ? -0.525  -15.525 -30.456 1.00 35.96  ? 594 ASP A CB  1 
ATOM   1813 C  CG  . ASP A 1 267 ? -1.228  -15.882 -31.763 1.00 39.39  ? 594 ASP A CG  1 
ATOM   1814 O  OD1 . ASP A 1 267 ? -1.509  -14.977 -32.594 1.00 40.90  ? 594 ASP A OD1 1 
ATOM   1815 O  OD2 . ASP A 1 267 ? -1.466  -17.105 -31.948 1.00 42.30  ? 594 ASP A OD2 1 
ATOM   1816 N  N   . THR A 1 268 ? 1.324   -13.924 -28.387 1.00 35.57  ? 595 THR A N   1 
ATOM   1817 C  CA  . THR A 1 268 ? 1.779   -13.502 -27.054 1.00 38.41  ? 595 THR A CA  1 
ATOM   1818 C  C   . THR A 1 268 ? 1.928   -11.975 -26.823 1.00 39.47  ? 595 THR A C   1 
ATOM   1819 O  O   . THR A 1 268 ? 1.694   -11.499 -25.745 1.00 41.87  ? 595 THR A O   1 
ATOM   1820 C  CB  . THR A 1 268 ? 3.164   -14.152 -26.821 1.00 41.39  ? 595 THR A CB  1 
ATOM   1821 O  OG1 . THR A 1 268 ? 3.040   -15.584 -26.848 1.00 42.83  ? 595 THR A OG1 1 
ATOM   1822 C  CG2 . THR A 1 268 ? 3.843   -13.761 -25.519 1.00 44.19  ? 595 THR A CG2 1 
ATOM   1823 N  N   . LEU A 1 269 ? 2.289   -11.228 -27.859 1.00 40.11  ? 596 LEU A N   1 
ATOM   1824 C  CA  . LEU A 1 269 ? 2.447   -9.781  -27.748 1.00 41.72  ? 596 LEU A CA  1 
ATOM   1825 C  C   . LEU A 1 269 ? 1.190   -8.999  -27.367 1.00 45.43  ? 596 LEU A C   1 
ATOM   1826 O  O   . LEU A 1 269 ? 0.128   -9.149  -28.016 1.00 46.60  ? 596 LEU A O   1 
ATOM   1827 C  CB  . LEU A 1 269 ? 3.046   -9.176  -29.026 1.00 40.47  ? 596 LEU A CB  1 
ATOM   1828 C  CG  . LEU A 1 269 ? 4.483   -9.664  -29.366 1.00 39.85  ? 596 LEU A CG  1 
ATOM   1829 C  CD1 . LEU A 1 269 ? 5.106   -8.740  -30.406 1.00 39.87  ? 596 LEU A CD1 1 
ATOM   1830 C  CD2 . LEU A 1 269 ? 5.439   -9.870  -28.168 1.00 37.68  ? 596 LEU A CD2 1 
ATOM   1831 N  N   . PRO A 1 270 ? 1.305   -8.106  -26.341 1.00 45.56  ? 597 PRO A N   1 
ATOM   1832 C  CA  . PRO A 1 270 ? 0.235   -7.215  -25.903 1.00 45.50  ? 597 PRO A CA  1 
ATOM   1833 C  C   . PRO A 1 270 ? -0.093  -6.107  -26.865 1.00 45.54  ? 597 PRO A C   1 
ATOM   1834 O  O   . PRO A 1 270 ? -0.791  -5.184  -26.490 1.00 46.72  ? 597 PRO A O   1 
ATOM   1835 C  CB  . PRO A 1 270 ? 0.800   -6.594  -24.622 1.00 46.48  ? 597 PRO A CB  1 
ATOM   1836 C  CG  . PRO A 1 270 ? 1.833   -7.529  -24.171 1.00 47.10  ? 597 PRO A CG  1 
ATOM   1837 C  CD  . PRO A 1 270 ? 2.455   -8.015  -25.430 1.00 45.28  ? 597 PRO A CD  1 
ATOM   1838 N  N   . PHE A 1 271 ? 0.455   -6.129  -28.075 1.00 44.24  ? 598 PHE A N   1 
ATOM   1839 C  CA  . PHE A 1 271 ? 0.246   -5.028  -29.053 1.00 44.54  ? 598 PHE A CA  1 
ATOM   1840 C  C   . PHE A 1 271 ? 0.409   -5.526  -30.481 1.00 43.68  ? 598 PHE A C   1 
ATOM   1841 O  O   . PHE A 1 271 ? 0.211   -4.776  -31.436 1.00 43.88  ? 598 PHE A O   1 
ATOM   1842 C  CB  . PHE A 1 271 ? 1.233   -3.850  -28.809 1.00 43.32  ? 598 PHE A CB  1 
ATOM   1843 C  CG  . PHE A 1 271 ? 2.630   -4.294  -28.458 1.00 39.76  ? 598 PHE A CG  1 
ATOM   1844 C  CD1 . PHE A 1 271 ? 3.532   -4.744  -29.443 1.00 38.78  ? 598 PHE A CD1 1 
ATOM   1845 C  CD2 . PHE A 1 271 ? 3.038   -4.313  -27.115 1.00 38.73  ? 598 PHE A CD2 1 
ATOM   1846 C  CE1 . PHE A 1 271 ? 4.816   -5.215  -29.079 1.00 36.19  ? 598 PHE A CE1 1 
ATOM   1847 C  CE2 . PHE A 1 271 ? 4.316   -4.787  -26.757 1.00 36.15  ? 598 PHE A CE2 1 
ATOM   1848 C  CZ  . PHE A 1 271 ? 5.202   -5.212  -27.740 1.00 35.51  ? 598 PHE A CZ  1 
ATOM   1849 O  OXT . PHE A 1 271 ? 0.772   -6.674  -30.706 1.00 42.68  ? 598 PHE A OXT 1 
ATOM   1850 N  N   . PRO B 1 33  ? 23.532  -28.035 -0.043  1.00 63.95  ? 360 PRO B N   1 
ATOM   1851 C  CA  . PRO B 1 33  ? 22.991  -28.893 1.034   1.00 63.98  ? 360 PRO B CA  1 
ATOM   1852 C  C   . PRO B 1 33  ? 22.550  -30.291 0.511   1.00 61.68  ? 360 PRO B C   1 
ATOM   1853 O  O   . PRO B 1 33  ? 21.566  -30.379 -0.221  1.00 61.06  ? 360 PRO B O   1 
ATOM   1854 C  CB  . PRO B 1 33  ? 21.822  -28.069 1.614   1.00 64.38  ? 360 PRO B CB  1 
ATOM   1855 C  CG  . PRO B 1 33  ? 21.556  -26.953 0.627   1.00 65.95  ? 360 PRO B CG  1 
ATOM   1856 C  CD  . PRO B 1 33  ? 22.560  -27.023 -0.512  1.00 65.78  ? 360 PRO B CD  1 
ATOM   1857 N  N   . PRO B 1 34  ? 23.276  -31.374 0.898   1.00 60.80  ? 361 PRO B N   1 
ATOM   1858 C  CA  . PRO B 1 34  ? 23.270  -32.665 0.172   1.00 58.49  ? 361 PRO B CA  1 
ATOM   1859 C  C   . PRO B 1 34  ? 21.903  -33.346 -0.059  1.00 54.17  ? 361 PRO B C   1 
ATOM   1860 O  O   . PRO B 1 34  ? 21.033  -33.358 0.800   1.00 55.01  ? 361 PRO B O   1 
ATOM   1861 C  CB  . PRO B 1 34  ? 24.161  -33.574 1.052   1.00 59.10  ? 361 PRO B CB  1 
ATOM   1862 C  CG  . PRO B 1 34  ? 23.987  -33.001 2.426   1.00 61.24  ? 361 PRO B CG  1 
ATOM   1863 C  CD  . PRO B 1 34  ? 23.955  -31.512 2.204   1.00 62.61  ? 361 PRO B CD  1 
ATOM   1864 N  N   . VAL B 1 35  ? 21.760  -33.900 -1.247  1.00 50.02  ? 362 VAL B N   1 
ATOM   1865 C  CA  . VAL B 1 35  ? 20.707  -34.827 -1.583  1.00 46.49  ? 362 VAL B CA  1 
ATOM   1866 C  C   . VAL B 1 35  ? 20.805  -36.060 -0.610  1.00 44.57  ? 362 VAL B C   1 
ATOM   1867 O  O   . VAL B 1 35  ? 21.895  -36.435 -0.136  1.00 42.74  ? 362 VAL B O   1 
ATOM   1868 C  CB  . VAL B 1 35  ? 20.831  -35.081 -3.137  1.00 45.83  ? 362 VAL B CB  1 
ATOM   1869 C  CG1 . VAL B 1 35  ? 20.611  -36.514 -3.551  1.00 42.88  ? 362 VAL B CG1 1 
ATOM   1870 C  CG2 . VAL B 1 35  ? 19.920  -34.126 -3.930  1.00 44.64  ? 362 VAL B CG2 1 
ATOM   1871 N  N   . SER B 1 36  ? 19.648  -36.628 -0.272  1.00 41.90  ? 363 SER B N   1 
ATOM   1872 C  CA  . SER B 1 36  ? 19.545  -37.906 0.442   1.00 39.92  ? 363 SER B CA  1 
ATOM   1873 C  C   . SER B 1 36  ? 20.208  -39.079 -0.308  1.00 38.00  ? 363 SER B C   1 
ATOM   1874 O  O   . SER B 1 36  ? 20.381  -39.020 -1.543  1.00 35.97  ? 363 SER B O   1 
ATOM   1875 C  CB  . SER B 1 36  ? 18.090  -38.240 0.674   1.00 38.75  ? 363 SER B CB  1 
ATOM   1876 O  OG  . SER B 1 36  ? 17.537  -38.702 -0.546  1.00 37.75  ? 363 SER B OG  1 
ATOM   1877 N  N   . LEU B 1 37  ? 20.562  -40.142 0.423   1.00 36.63  ? 364 LEU B N   1 
ATOM   1878 C  CA  . LEU B 1 37  ? 21.130  -41.335 -0.194  1.00 35.23  ? 364 LEU B CA  1 
ATOM   1879 C  C   . LEU B 1 37  ? 20.273  -41.935 -1.334  1.00 32.99  ? 364 LEU B C   1 
ATOM   1880 O  O   . LEU B 1 37  ? 20.797  -42.225 -2.427  1.00 31.54  ? 364 LEU B O   1 
ATOM   1881 C  CB  . LEU B 1 37  ? 21.450  -42.428 0.877   1.00 35.91  ? 364 LEU B CB  1 
ATOM   1882 C  CG  . LEU B 1 37  ? 21.968  -43.799 0.392   1.00 34.77  ? 364 LEU B CG  1 
ATOM   1883 C  CD1 . LEU B 1 37  ? 23.248  -43.669 -0.406  1.00 34.34  ? 364 LEU B CD1 1 
ATOM   1884 C  CD2 . LEU B 1 37  ? 22.160  -44.726 1.599   1.00 36.23  ? 364 LEU B CD2 1 
ATOM   1885 N  N   . ILE B 1 38  ? 18.980  -42.129 -1.060  1.00 32.49  ? 365 ILE B N   1 
ATOM   1886 C  CA  . ILE B 1 38  ? 18.071  -42.699 -2.060  1.00 32.04  ? 365 ILE B CA  1 
ATOM   1887 C  C   . ILE B 1 38  ? 17.986  -41.818 -3.339  1.00 30.94  ? 365 ILE B C   1 
ATOM   1888 O  O   . ILE B 1 38  ? 17.995  -42.346 -4.448  1.00 30.37  ? 365 ILE B O   1 
ATOM   1889 C  CB  . ILE B 1 38  ? 16.677  -43.076 -1.469  1.00 32.87  ? 365 ILE B CB  1 
ATOM   1890 C  CG1 . ILE B 1 38  ? 15.948  -44.034 -2.428  1.00 32.24  ? 365 ILE B CG1 1 
ATOM   1891 C  CG2 . ILE B 1 38  ? 15.846  -41.838 -1.093  1.00 33.52  ? 365 ILE B CG2 1 
ATOM   1892 C  CD1 . ILE B 1 38  ? 14.656  -44.613 -1.914  1.00 33.26  ? 365 ILE B CD1 1 
ATOM   1893 N  N   . SER B 1 39  ? 17.970  -40.493 -3.163  1.00 31.46  ? 366 SER B N   1 
ATOM   1894 C  CA  . SER B 1 39  ? 18.042  -39.535 -4.276  1.00 31.52  ? 366 SER B CA  1 
ATOM   1895 C  C   . SER B 1 39  ? 19.305  -39.692 -5.090  1.00 30.19  ? 366 SER B C   1 
ATOM   1896 O  O   . SER B 1 39  ? 19.265  -39.645 -6.311  1.00 29.32  ? 366 SER B O   1 
ATOM   1897 C  CB  . SER B 1 39  ? 17.964  -38.085 -3.779  1.00 33.23  ? 366 SER B CB  1 
ATOM   1898 O  OG  . SER B 1 39  ? 16.617  -37.749 -3.549  1.00 33.82  ? 366 SER B OG  1 
ATOM   1899 N  N   . ALA B 1 40  ? 20.429  -39.854 -4.410  1.00 30.71  ? 367 ALA B N   1 
ATOM   1900 C  CA  . ALA B 1 40  ? 21.696  -40.104 -5.105  1.00 30.34  ? 367 ALA B CA  1 
ATOM   1901 C  C   . ALA B 1 40  ? 21.664  -41.448 -5.854  1.00 28.73  ? 367 ALA B C   1 
ATOM   1902 O  O   . ALA B 1 40  ? 22.184  -41.553 -6.957  1.00 28.52  ? 367 ALA B O   1 
ATOM   1903 C  CB  . ALA B 1 40  ? 22.877  -40.008 -4.145  1.00 30.63  ? 367 ALA B CB  1 
ATOM   1904 N  N   . LEU B 1 41  ? 21.036  -42.463 -5.265  1.00 28.05  ? 368 LEU B N   1 
ATOM   1905 C  CA  . LEU B 1 41  ? 20.890  -43.775 -5.916  1.00 26.24  ? 368 LEU B CA  1 
ATOM   1906 C  C   . LEU B 1 41  ? 19.984  -43.686 -7.135  1.00 25.64  ? 368 LEU B C   1 
ATOM   1907 O  O   . LEU B 1 41  ? 20.261  -44.329 -8.138  1.00 24.66  ? 368 LEU B O   1 
ATOM   1908 C  CB  . LEU B 1 41  ? 20.399  -44.846 -4.926  1.00 26.49  ? 368 LEU B CB  1 
ATOM   1909 C  CG  . LEU B 1 41  ? 21.341  -45.167 -3.727  1.00 27.81  ? 368 LEU B CG  1 
ATOM   1910 C  CD1 . LEU B 1 41  ? 20.678  -46.078 -2.672  1.00 28.18  ? 368 LEU B CD1 1 
ATOM   1911 C  CD2 . LEU B 1 41  ? 22.661  -45.728 -4.227  1.00 26.94  ? 368 LEU B CD2 1 
ATOM   1912 N  N   . VAL B 1 42  ? 18.922  -42.869 -7.054  1.00 26.45  ? 369 VAL B N   1 
ATOM   1913 C  CA  . VAL B 1 42  ? 18.017  -42.679 -8.194  1.00 26.35  ? 369 VAL B CA  1 
ATOM   1914 C  C   . VAL B 1 42  ? 18.756  -41.980 -9.340  1.00 26.35  ? 369 VAL B C   1 
ATOM   1915 O  O   . VAL B 1 42  ? 18.647  -42.417 -10.493 1.00 25.01  ? 369 VAL B O   1 
ATOM   1916 C  CB  . VAL B 1 42  ? 16.678  -41.972 -7.813  1.00 27.30  ? 369 VAL B CB  1 
ATOM   1917 C  CG1 . VAL B 1 42  ? 15.934  -41.463 -9.052  1.00 26.84  ? 369 VAL B CG1 1 
ATOM   1918 C  CG2 . VAL B 1 42  ? 15.832  -42.933 -7.006  1.00 27.21  ? 369 VAL B CG2 1 
ATOM   1919 N  N   . ARG B 1 43  ? 19.533  -40.944 -8.994  1.00 27.41  ? 370 ARG B N   1 
ATOM   1920 C  CA  . ARG B 1 43  ? 20.267  -40.205 -9.982  1.00 29.53  ? 370 ARG B CA  1 
ATOM   1921 C  C   . ARG B 1 43  ? 21.295  -41.117 -10.696 1.00 27.89  ? 370 ARG B C   1 
ATOM   1922 O  O   . ARG B 1 43  ? 21.456  -41.051 -11.907 1.00 27.08  ? 370 ARG B O   1 
ATOM   1923 C  CB  . ARG B 1 43  ? 20.901  -38.952 -9.363  1.00 33.27  ? 370 ARG B CB  1 
ATOM   1924 C  CG  . ARG B 1 43  ? 21.969  -38.207 -10.167 1.00 38.66  ? 370 ARG B CG  1 
ATOM   1925 C  CD  . ARG B 1 43  ? 21.434  -37.560 -11.424 1.00 42.19  ? 370 ARG B CD  1 
ATOM   1926 N  NE  . ARG B 1 43  ? 20.826  -36.248 -11.194 1.00 46.64  ? 370 ARG B NE  1 
ATOM   1927 C  CZ  . ARG B 1 43  ? 20.262  -35.471 -12.128 1.00 49.18  ? 370 ARG B CZ  1 
ATOM   1928 N  NH1 . ARG B 1 43  ? 20.202  -35.852 -13.429 1.00 46.72  ? 370 ARG B NH1 1 
ATOM   1929 N  NH2 . ARG B 1 43  ? 19.750  -34.286 -11.741 1.00 50.77  ? 370 ARG B NH2 1 
ATOM   1930 N  N   . ALA B 1 44  ? 21.970  -41.953 -9.913  1.00 26.65  ? 371 ALA B N   1 
ATOM   1931 C  CA  . ALA B 1 44  ? 22.978  -42.863 -10.429 1.00 26.20  ? 371 ALA B CA  1 
ATOM   1932 C  C   . ALA B 1 44  ? 22.293  -43.801 -11.436 1.00 24.88  ? 371 ALA B C   1 
ATOM   1933 O  O   . ALA B 1 44  ? 22.820  -44.050 -12.514 1.00 24.24  ? 371 ALA B O   1 
ATOM   1934 C  CB  . ALA B 1 44  ? 23.616  -43.666 -9.270  1.00 26.46  ? 371 ALA B CB  1 
ATOM   1935 N  N   . HIS B 1 45  ? 21.102  -44.293 -11.081 1.00 24.22  ? 372 HIS B N   1 
ATOM   1936 C  CA  . HIS B 1 45  ? 20.321  -45.128 -11.975 1.00 23.61  ? 372 HIS B CA  1 
ATOM   1937 C  C   . HIS B 1 45  ? 19.891  -44.391 -13.269 1.00 23.66  ? 372 HIS B C   1 
ATOM   1938 O  O   . HIS B 1 45  ? 20.162  -44.854 -14.392 1.00 22.53  ? 372 HIS B O   1 
ATOM   1939 C  CB  . HIS B 1 45  ? 19.095  -45.681 -11.274 1.00 24.06  ? 372 HIS B CB  1 
ATOM   1940 C  CG  . HIS B 1 45  ? 18.229  -46.481 -12.187 1.00 25.31  ? 372 HIS B CG  1 
ATOM   1941 N  ND1 . HIS B 1 45  ? 18.532  -47.795 -12.516 1.00 24.30  ? 372 HIS B ND1 1 
ATOM   1942 C  CD2 . HIS B 1 45  ? 17.110  -46.147 -12.886 1.00 25.87  ? 372 HIS B CD2 1 
ATOM   1943 C  CE1 . HIS B 1 45  ? 17.608  -48.242 -13.350 1.00 25.68  ? 372 HIS B CE1 1 
ATOM   1944 N  NE2 . HIS B 1 45  ? 16.753  -47.257 -13.614 1.00 26.55  ? 372 HIS B NE2 1 
ATOM   1945 N  N   . VAL B 1 46  ? 19.238  -43.237 -13.106 1.00 24.17  ? 373 VAL B N   1 
ATOM   1946 C  CA  . VAL B 1 46  ? 18.735  -42.463 -14.246 1.00 24.87  ? 373 VAL B CA  1 
ATOM   1947 C  C   . VAL B 1 46  ? 19.874  -42.041 -15.228 1.00 25.70  ? 373 VAL B C   1 
ATOM   1948 O  O   . VAL B 1 46  ? 19.732  -42.141 -16.474 1.00 25.42  ? 373 VAL B O   1 
ATOM   1949 C  CB  . VAL B 1 46  ? 17.907  -41.257 -13.753 1.00 25.76  ? 373 VAL B CB  1 
ATOM   1950 C  CG1 . VAL B 1 46  ? 17.577  -40.278 -14.897 1.00 26.90  ? 373 VAL B CG1 1 
ATOM   1951 C  CG2 . VAL B 1 46  ? 16.663  -41.739 -13.065 1.00 25.52  ? 373 VAL B CG2 1 
ATOM   1952 N  N   . ASP B 1 47  ? 21.003  -41.614 -14.667 1.00 25.91  ? 374 ASP B N   1 
ATOM   1953 C  CA  . ASP B 1 47  ? 22.114  -41.190 -15.500 1.00 28.60  ? 374 ASP B CA  1 
ATOM   1954 C  C   . ASP B 1 47  ? 22.959  -42.336 -16.080 1.00 28.11  ? 374 ASP B C   1 
ATOM   1955 O  O   . ASP B 1 47  ? 23.939  -42.084 -16.764 1.00 30.04  ? 374 ASP B O   1 
ATOM   1956 C  CB  . ASP B 1 47  ? 23.006  -40.225 -14.726 1.00 29.58  ? 374 ASP B CB  1 
ATOM   1957 C  CG  . ASP B 1 47  ? 22.339  -38.876 -14.523 1.00 31.46  ? 374 ASP B CG  1 
ATOM   1958 O  OD1 . ASP B 1 47  ? 21.336  -38.542 -15.186 1.00 31.60  ? 374 ASP B OD1 1 
ATOM   1959 O  OD2 . ASP B 1 47  ? 22.864  -38.137 -13.714 1.00 33.31  ? 374 ASP B OD2 1 
ATOM   1960 N  N   . SER B 1 48  ? 22.580  -43.574 -15.810 1.00 26.46  ? 375 SER B N   1 
ATOM   1961 C  CA  . SER B 1 48  ? 23.286  -44.696 -16.405 1.00 26.27  ? 375 SER B CA  1 
ATOM   1962 C  C   . SER B 1 48  ? 22.368  -45.607 -17.253 1.00 26.42  ? 375 SER B C   1 
ATOM   1963 O  O   . SER B 1 48  ? 22.710  -46.763 -17.552 1.00 25.97  ? 375 SER B O   1 
ATOM   1964 C  CB  . SER B 1 48  ? 23.996  -45.513 -15.295 1.00 25.07  ? 375 SER B CB  1 
ATOM   1965 O  OG  . SER B 1 48  ? 23.070  -46.068 -14.384 1.00 22.83  ? 375 SER B OG  1 
ATOM   1966 N  N   . ASN B 1 49  ? 21.174  -45.108 -17.552 1.00 27.68  ? 376 ASN B N   1 
ATOM   1967 C  CA  . ASN B 1 49  ? 20.148  -45.900 -18.251 1.00 28.16  ? 376 ASN B CA  1 
ATOM   1968 C  C   . ASN B 1 49  ? 19.579  -45.112 -19.405 1.00 29.77  ? 376 ASN B C   1 
ATOM   1969 O  O   . ASN B 1 49  ? 19.576  -43.908 -19.363 1.00 29.98  ? 376 ASN B O   1 
ATOM   1970 C  CB  . ASN B 1 49  ? 19.050  -46.350 -17.284 1.00 27.07  ? 376 ASN B CB  1 
ATOM   1971 C  CG  . ASN B 1 49  ? 19.472  -47.559 -16.514 1.00 27.76  ? 376 ASN B CG  1 
ATOM   1972 O  OD1 . ASN B 1 49  ? 19.403  -48.670 -17.011 1.00 28.77  ? 376 ASN B OD1 1 
ATOM   1973 N  ND2 . ASN B 1 49  ? 19.937  -47.362 -15.284 1.00 26.87  ? 376 ASN B ND2 1 
ATOM   1974 N  N   . PRO B 1 50  ? 19.101  -45.786 -20.458 1.00 31.29  ? 377 PRO B N   1 
ATOM   1975 C  CA  . PRO B 1 50  ? 18.501  -45.012 -21.538 1.00 33.90  ? 377 PRO B CA  1 
ATOM   1976 C  C   . PRO B 1 50  ? 17.119  -44.491 -21.129 1.00 34.05  ? 377 PRO B C   1 
ATOM   1977 O  O   . PRO B 1 50  ? 16.551  -44.905 -20.109 1.00 32.82  ? 377 PRO B O   1 
ATOM   1978 C  CB  . PRO B 1 50  ? 18.408  -46.055 -22.665 1.00 35.23  ? 377 PRO B CB  1 
ATOM   1979 C  CG  . PRO B 1 50  ? 18.104  -47.338 -21.907 1.00 33.80  ? 377 PRO B CG  1 
ATOM   1980 C  CD  . PRO B 1 50  ? 18.992  -47.241 -20.699 1.00 31.65  ? 377 PRO B CD  1 
ATOM   1981 N  N   . ALA B 1 51  ? 16.554  -43.595 -21.917 1.00 35.84  ? 378 ALA B N   1 
ATOM   1982 C  CA  . ALA B 1 51  ? 15.154  -43.214 -21.716 1.00 37.60  ? 378 ALA B CA  1 
ATOM   1983 C  C   . ALA B 1 51  ? 14.333  -43.589 -22.955 1.00 39.82  ? 378 ALA B C   1 
ATOM   1984 O  O   . ALA B 1 51  ? 14.897  -44.023 -23.952 1.00 39.06  ? 378 ALA B O   1 
ATOM   1985 C  CB  . ALA B 1 51  ? 15.045  -41.715 -21.367 1.00 38.09  ? 378 ALA B CB  1 
ATOM   1986 N  N   . MET B 1 52  ? 13.017  -43.400 -22.905 1.00 43.73  ? 379 MET B N   1 
ATOM   1987 C  CA  . MET B 1 52  ? 12.170  -43.547 -24.100 1.00 48.76  ? 379 MET B CA  1 
ATOM   1988 C  C   . MET B 1 52  ? 12.680  -42.757 -25.297 1.00 49.91  ? 379 MET B C   1 
ATOM   1989 O  O   . MET B 1 52  ? 12.535  -43.197 -26.422 1.00 52.53  ? 379 MET B O   1 
ATOM   1990 C  CB  . MET B 1 52  ? 10.706  -43.187 -23.807 1.00 53.86  ? 379 MET B CB  1 
ATOM   1991 C  CG  . MET B 1 52  ? 9.946   -44.211 -22.941 1.00 57.09  ? 379 MET B CG  1 
ATOM   1992 S  SD  . MET B 1 52  ? 9.767   -45.939 -23.494 1.00 62.31  ? 379 MET B SD  1 
ATOM   1993 C  CE  . MET B 1 52  ? 8.563   -45.713 -24.821 1.00 61.66  ? 379 MET B CE  1 
ATOM   1994 N  N   . THR B 1 53  ? 13.323  -41.625 -25.050 1.00 49.60  ? 380 THR B N   1 
ATOM   1995 C  CA  . THR B 1 53  ? 13.850  -40.784 -26.141 1.00 50.77  ? 380 THR B CA  1 
ATOM   1996 C  C   . THR B 1 53  ? 15.164  -41.319 -26.747 1.00 49.94  ? 380 THR B C   1 
ATOM   1997 O  O   . THR B 1 53  ? 15.516  -40.949 -27.841 1.00 51.40  ? 380 THR B O   1 
ATOM   1998 C  CB  . THR B 1 53  ? 14.085  -39.329 -25.657 1.00 51.35  ? 380 THR B CB  1 
ATOM   1999 O  OG1 . THR B 1 53  ? 14.988  -39.344 -24.525 1.00 50.33  ? 380 THR B OG1 1 
ATOM   2000 C  CG2 . THR B 1 53  ? 12.820  -38.725 -25.230 1.00 51.42  ? 380 THR B CG2 1 
ATOM   2001 N  N   . SER B 1 54  ? 15.863  -42.193 -26.030 1.00 47.19  ? 381 SER B N   1 
ATOM   2002 C  CA  . SER B 1 54  ? 17.127  -42.677 -26.530 1.00 48.11  ? 381 SER B CA  1 
ATOM   2003 C  C   . SER B 1 54  ? 17.006  -44.066 -27.106 1.00 47.07  ? 381 SER B C   1 
ATOM   2004 O  O   . SER B 1 54  ? 18.057  -44.660 -27.335 1.00 48.15  ? 381 SER B O   1 
ATOM   2005 C  CB  . SER B 1 54  ? 18.243  -42.637 -25.432 1.00 44.60  ? 381 SER B CB  1 
ATOM   2006 O  OG  . SER B 1 54  ? 17.827  -43.298 -24.284 1.00 40.89  ? 381 SER B OG  1 
ATOM   2007 N  N   . LEU B 1 55  ? 15.779  -44.573 -27.335 1.00 47.75  ? 382 LEU B N   1 
ATOM   2008 C  CA  . LEU B 1 55  ? 15.615  -45.946 -27.860 1.00 46.15  ? 382 LEU B CA  1 
ATOM   2009 C  C   . LEU B 1 55  ? 16.001  -46.063 -29.324 1.00 47.58  ? 382 LEU B C   1 
ATOM   2010 O  O   . LEU B 1 55  ? 15.612  -45.267 -30.164 1.00 49.02  ? 382 LEU B O   1 
ATOM   2011 C  CB  . LEU B 1 55  ? 14.255  -46.559 -27.602 1.00 45.93  ? 382 LEU B CB  1 
ATOM   2012 C  CG  . LEU B 1 55  ? 13.883  -46.857 -26.155 1.00 44.88  ? 382 LEU B CG  1 
ATOM   2013 C  CD1 . LEU B 1 55  ? 12.841  -47.976 -26.088 1.00 45.34  ? 382 LEU B CD1 1 
ATOM   2014 C  CD2 . LEU B 1 55  ? 15.056  -47.283 -25.259 1.00 42.32  ? 382 LEU B CD2 1 
ATOM   2015 N  N   . ASP B 1 56  ? 16.848  -47.050 -29.581 1.00 45.70  ? 383 ASP B N   1 
ATOM   2016 C  CA  . ASP B 1 56  ? 17.496  -47.186 -30.878 1.00 47.34  ? 383 ASP B CA  1 
ATOM   2017 C  C   . ASP B 1 56  ? 17.037  -48.510 -31.467 1.00 47.55  ? 383 ASP B C   1 
ATOM   2018 O  O   . ASP B 1 56  ? 17.444  -49.597 -31.015 1.00 46.08  ? 383 ASP B O   1 
ATOM   2019 C  CB  . ASP B 1 56  ? 19.034  -47.094 -30.688 1.00 46.46  ? 383 ASP B CB  1 
ATOM   2020 C  CG  . ASP B 1 56  ? 19.838  -47.347 -31.958 1.00 47.29  ? 383 ASP B CG  1 
ATOM   2021 O  OD1 . ASP B 1 56  ? 19.310  -47.536 -33.056 1.00 48.61  ? 383 ASP B OD1 1 
ATOM   2022 O  OD2 . ASP B 1 56  ? 21.070  -47.368 -31.832 1.00 47.43  ? 383 ASP B OD2 1 
ATOM   2023 N  N   . TYR B 1 57  ? 16.164  -48.405 -32.461 1.00 49.64  ? 384 TYR B N   1 
ATOM   2024 C  CA  . TYR B 1 57  ? 15.634  -49.555 -33.209 1.00 51.75  ? 384 TYR B CA  1 
ATOM   2025 C  C   . TYR B 1 57  ? 16.460  -49.920 -34.443 1.00 52.84  ? 384 TYR B C   1 
ATOM   2026 O  O   . TYR B 1 57  ? 16.042  -50.785 -35.212 1.00 52.46  ? 384 TYR B O   1 
ATOM   2027 C  CB  . TYR B 1 57  ? 14.163  -49.323 -33.654 1.00 55.10  ? 384 TYR B CB  1 
ATOM   2028 C  CG  . TYR B 1 57  ? 13.172  -49.439 -32.523 1.00 55.96  ? 384 TYR B CG  1 
ATOM   2029 C  CD1 . TYR B 1 57  ? 12.694  -50.680 -32.092 1.00 54.99  ? 384 TYR B CD1 1 
ATOM   2030 C  CD2 . TYR B 1 57  ? 12.742  -48.286 -31.827 1.00 56.64  ? 384 TYR B CD2 1 
ATOM   2031 C  CE1 . TYR B 1 57  ? 11.817  -50.780 -31.018 1.00 54.95  ? 384 TYR B CE1 1 
ATOM   2032 C  CE2 . TYR B 1 57  ? 11.855  -48.377 -30.750 1.00 56.17  ? 384 TYR B CE2 1 
ATOM   2033 C  CZ  . TYR B 1 57  ? 11.402  -49.631 -30.356 1.00 55.59  ? 384 TYR B CZ  1 
ATOM   2034 O  OH  . TYR B 1 57  ? 10.531  -49.744 -29.297 1.00 56.91  ? 384 TYR B OH  1 
ATOM   2035 N  N   . SER B 1 58  ? 17.617  -49.284 -34.642 1.00 53.37  ? 385 SER B N   1 
ATOM   2036 C  CA  . SER B 1 58  ? 18.410  -49.465 -35.895 1.00 57.68  ? 385 SER B CA  1 
ATOM   2037 C  C   . SER B 1 58  ? 19.016  -50.874 -36.071 1.00 57.74  ? 385 SER B C   1 
ATOM   2038 O  O   . SER B 1 58  ? 19.510  -51.188 -37.137 1.00 58.90  ? 385 SER B O   1 
ATOM   2039 C  CB  . SER B 1 58  ? 19.536  -48.433 -36.002 1.00 56.92  ? 385 SER B CB  1 
ATOM   2040 O  OG  . SER B 1 58  ? 20.544  -48.725 -35.036 1.00 53.56  ? 385 SER B OG  1 
ATOM   2041 N  N   . ARG B 1 59  ? 18.972  -51.706 -35.031 1.00 57.74  ? 386 ARG B N   1 
ATOM   2042 C  CA  . ARG B 1 59  ? 19.414  -53.104 -35.166 1.00 59.31  ? 386 ARG B CA  1 
ATOM   2043 C  C   . ARG B 1 59  ? 18.318  -54.134 -34.932 1.00 58.68  ? 386 ARG B C   1 
ATOM   2044 O  O   . ARG B 1 59  ? 18.538  -55.302 -35.175 1.00 59.63  ? 386 ARG B O   1 
ATOM   2045 C  CB  . ARG B 1 59  ? 20.651  -53.373 -34.308 1.00 58.76  ? 386 ARG B CB  1 
ATOM   2046 C  CG  . ARG B 1 59  ? 21.908  -52.848 -34.956 1.00 65.54  ? 386 ARG B CG  1 
ATOM   2047 C  CD  . ARG B 1 59  ? 22.966  -52.339 -33.972 1.00 69.32  ? 386 ARG B CD  1 
ATOM   2048 N  NE  . ARG B 1 59  ? 23.886  -51.462 -34.698 1.00 77.87  ? 386 ARG B NE  1 
ATOM   2049 C  CZ  . ARG B 1 59  ? 25.219  -51.550 -34.704 1.00 81.27  ? 386 ARG B CZ  1 
ATOM   2050 N  NH1 . ARG B 1 59  ? 25.867  -52.466 -33.977 1.00 79.38  ? 386 ARG B NH1 1 
ATOM   2051 N  NH2 . ARG B 1 59  ? 25.911  -50.680 -35.440 1.00 85.51  ? 386 ARG B NH2 1 
ATOM   2052 N  N   . PHE B 1 60  ? 17.140  -53.684 -34.515 1.00 57.99  ? 387 PHE B N   1 
ATOM   2053 C  CA  . PHE B 1 60  ? 16.048  -54.557 -34.083 1.00 58.00  ? 387 PHE B CA  1 
ATOM   2054 C  C   . PHE B 1 60  ? 15.420  -55.275 -35.258 1.00 61.51  ? 387 PHE B C   1 
ATOM   2055 O  O   . PHE B 1 60  ? 15.251  -54.693 -36.316 1.00 64.69  ? 387 PHE B O   1 
ATOM   2056 C  CB  . PHE B 1 60  ? 14.977  -53.751 -33.346 1.00 55.77  ? 387 PHE B CB  1 
ATOM   2057 C  CG  . PHE B 1 60  ? 13.776  -54.553 -32.932 1.00 55.45  ? 387 PHE B CG  1 
ATOM   2058 C  CD1 . PHE B 1 60  ? 13.812  -55.367 -31.802 1.00 53.00  ? 387 PHE B CD1 1 
ATOM   2059 C  CD2 . PHE B 1 60  ? 12.589  -54.456 -33.649 1.00 58.72  ? 387 PHE B CD2 1 
ATOM   2060 C  CE1 . PHE B 1 60  ? 12.694  -56.075 -31.374 1.00 53.63  ? 387 PHE B CE1 1 
ATOM   2061 C  CE2 . PHE B 1 60  ? 11.449  -55.173 -33.258 1.00 59.51  ? 387 PHE B CE2 1 
ATOM   2062 C  CZ  . PHE B 1 60  ? 11.502  -55.993 -32.127 1.00 57.34  ? 387 PHE B CZ  1 
ATOM   2063 N  N   . GLN B 1 61  ? 15.070  -56.543 -35.054 1.00 63.97  ? 388 GLN B N   1 
ATOM   2064 C  CA  . GLN B 1 61  ? 14.310  -57.322 -36.037 1.00 69.28  ? 388 GLN B CA  1 
ATOM   2065 C  C   . GLN B 1 61  ? 13.297  -58.216 -35.343 1.00 71.73  ? 388 GLN B C   1 
ATOM   2066 O  O   . GLN B 1 61  ? 13.673  -59.133 -34.621 1.00 70.67  ? 388 GLN B O   1 
ATOM   2067 C  CB  . GLN B 1 61  ? 15.253  -58.193 -36.847 1.00 68.64  ? 388 GLN B CB  1 
ATOM   2068 C  CG  . GLN B 1 61  ? 14.727  -58.587 -38.195 1.00 72.88  ? 388 GLN B CG  1 
ATOM   2069 C  CD  . GLN B 1 61  ? 15.669  -59.541 -38.886 1.00 73.63  ? 388 GLN B CD  1 
ATOM   2070 O  OE1 . GLN B 1 61  ? 16.895  -59.442 -38.741 1.00 72.43  ? 388 GLN B OE1 1 
ATOM   2071 N  NE2 . GLN B 1 61  ? 15.107  -60.492 -39.615 1.00 75.80  ? 388 GLN B NE2 1 
ATOM   2072 N  N   . ALA B 1 62  ? 12.021  -57.949 -35.575 1.00 80.11  ? 389 ALA B N   1 
ATOM   2073 C  CA  . ALA B 1 62  ? 10.928  -58.695 -34.949 1.00 84.99  ? 389 ALA B CA  1 
ATOM   2074 C  C   . ALA B 1 62  ? 10.858  -60.188 -35.331 1.00 89.22  ? 389 ALA B C   1 
ATOM   2075 O  O   . ALA B 1 62  ? 10.241  -60.979 -34.604 1.00 92.02  ? 389 ALA B O   1 
ATOM   2076 C  CB  . ALA B 1 62  ? 9.598   -57.992 -35.226 1.00 86.80  ? 389 ALA B CB  1 
ATOM   2077 N  N   . ASN B 1 63  ? 11.495  -60.586 -36.437 1.00 91.11  ? 390 ASN B N   1 
ATOM   2078 C  CA  . ASN B 1 63  ? 11.185  -61.903 -37.028 1.00 92.72  ? 390 ASN B CA  1 
ATOM   2079 C  C   . ASN B 1 63  ? 12.287  -62.695 -37.754 1.00 93.11  ? 390 ASN B C   1 
ATOM   2080 O  O   . ASN B 1 63  ? 12.019  -63.263 -38.823 1.00 97.16  ? 390 ASN B O   1 
ATOM   2081 C  CB  . ASN B 1 63  ? 9.935   -61.768 -37.914 1.00 96.67  ? 390 ASN B CB  1 
ATOM   2082 C  CG  . ASN B 1 63  ? 9.923   -60.466 -38.706 1.00 98.51  ? 390 ASN B CG  1 
ATOM   2083 O  OD1 . ASN B 1 63  ? 10.646  -59.519 -38.367 1.00 95.92  ? 390 ASN B OD1 1 
ATOM   2084 N  ND2 . ASN B 1 63  ? 9.137   -60.425 -39.778 1.00 101.45 ? 390 ASN B ND2 1 
ATOM   2085 N  N   . PRO B 1 64  ? 13.499  -62.816 -37.159 1.00 91.85  ? 391 PRO B N   1 
ATOM   2086 C  CA  . PRO B 1 64  ? 14.581  -63.450 -37.954 1.00 92.01  ? 391 PRO B CA  1 
ATOM   2087 C  C   . PRO B 1 64  ? 14.432  -64.949 -38.169 1.00 93.85  ? 391 PRO B C   1 
ATOM   2088 O  O   . PRO B 1 64  ? 14.392  -65.381 -39.320 1.00 95.14  ? 391 PRO B O   1 
ATOM   2089 C  CB  . PRO B 1 64  ? 15.844  -63.162 -37.149 1.00 88.82  ? 391 PRO B CB  1 
ATOM   2090 C  CG  . PRO B 1 64  ? 15.375  -62.974 -35.750 1.00 85.71  ? 391 PRO B CG  1 
ATOM   2091 C  CD  . PRO B 1 64  ? 13.929  -62.542 -35.766 1.00 87.90  ? 391 PRO B CD  1 
ATOM   2092 N  N   . ASP B 1 72  ? 27.259  -66.692 -37.822 1.00 71.25  ? 399 ASP B N   1 
ATOM   2093 C  CA  . ASP B 1 72  ? 26.685  -65.671 -36.939 1.00 68.81  ? 399 ASP B CA  1 
ATOM   2094 C  C   . ASP B 1 72  ? 27.684  -65.209 -35.865 1.00 65.33  ? 399 ASP B C   1 
ATOM   2095 O  O   . ASP B 1 72  ? 27.353  -64.962 -34.688 1.00 61.14  ? 399 ASP B O   1 
ATOM   2096 C  CB  . ASP B 1 72  ? 25.302  -66.094 -36.384 1.00 70.88  ? 399 ASP B CB  1 
ATOM   2097 C  CG  . ASP B 1 72  ? 25.314  -67.461 -35.692 1.00 71.90  ? 399 ASP B CG  1 
ATOM   2098 O  OD1 . ASP B 1 72  ? 26.281  -68.238 -35.868 1.00 75.86  ? 399 ASP B OD1 1 
ATOM   2099 O  OD2 . ASP B 1 72  ? 24.330  -67.773 -34.982 1.00 69.80  ? 399 ASP B OD2 1 
ATOM   2100 N  N   . THR B 1 73  ? 28.922  -65.076 -36.335 1.00 63.54  ? 400 THR B N   1 
ATOM   2101 C  CA  . THR B 1 73  ? 29.993  -64.399 -35.619 1.00 59.42  ? 400 THR B CA  1 
ATOM   2102 C  C   . THR B 1 73  ? 29.609  -62.916 -35.325 1.00 57.15  ? 400 THR B C   1 
ATOM   2103 O  O   . THR B 1 73  ? 30.095  -62.320 -34.361 1.00 53.22  ? 400 THR B O   1 
ATOM   2104 C  CB  . THR B 1 73  ? 31.338  -64.515 -36.388 1.00 60.75  ? 400 THR B CB  1 
ATOM   2105 O  OG1 . THR B 1 73  ? 31.373  -63.559 -37.440 1.00 63.73  ? 400 THR B OG1 1 
ATOM   2106 C  CG2 . THR B 1 73  ? 31.526  -65.876 -37.006 1.00 61.96  ? 400 THR B CG2 1 
ATOM   2107 N  N   . GLN B 1 74  ? 28.733  -62.353 -36.157 1.00 57.16  ? 401 GLN B N   1 
ATOM   2108 C  CA  . GLN B 1 74  ? 28.214  -61.000 -36.003 1.00 55.89  ? 401 GLN B CA  1 
ATOM   2109 C  C   . GLN B 1 74  ? 27.416  -60.859 -34.702 1.00 51.37  ? 401 GLN B C   1 
ATOM   2110 O  O   . GLN B 1 74  ? 27.586  -59.882 -33.963 1.00 47.36  ? 401 GLN B O   1 
ATOM   2111 C  CB  . GLN B 1 74  ? 27.297  -60.560 -37.162 1.00 60.35  ? 401 GLN B CB  1 
ATOM   2112 C  CG  . GLN B 1 74  ? 27.631  -61.001 -38.575 1.00 68.93  ? 401 GLN B CG  1 
ATOM   2113 C  CD  . GLN B 1 74  ? 28.828  -60.280 -39.165 1.00 73.37  ? 401 GLN B CD  1 
ATOM   2114 O  OE1 . GLN B 1 74  ? 28.900  -59.047 -39.133 1.00 77.23  ? 401 GLN B OE1 1 
ATOM   2115 N  NE2 . GLN B 1 74  ? 29.770  -61.048 -39.721 1.00 74.82  ? 401 GLN B NE2 1 
ATOM   2116 N  N   . HIS B 1 75  ? 26.536  -61.822 -34.437 1.00 48.71  ? 402 HIS B N   1 
ATOM   2117 C  CA  . HIS B 1 75  ? 25.737  -61.811 -33.210 1.00 46.52  ? 402 HIS B CA  1 
ATOM   2118 C  C   . HIS B 1 75  ? 26.606  -61.992 -31.961 1.00 42.59  ? 402 HIS B C   1 
ATOM   2119 O  O   . HIS B 1 75  ? 26.347  -61.348 -30.951 1.00 40.62  ? 402 HIS B O   1 
ATOM   2120 C  CB  . HIS B 1 75  ? 24.617  -62.843 -33.270 1.00 49.27  ? 402 HIS B CB  1 
ATOM   2121 C  CG  . HIS B 1 75  ? 23.530  -62.492 -34.238 1.00 52.03  ? 402 HIS B CG  1 
ATOM   2122 N  ND1 . HIS B 1 75  ? 23.496  -62.986 -35.526 1.00 54.78  ? 402 HIS B ND1 1 
ATOM   2123 C  CD2 . HIS B 1 75  ? 22.473  -61.653 -34.125 1.00 52.08  ? 402 HIS B CD2 1 
ATOM   2124 C  CE1 . HIS B 1 75  ? 22.457  -62.474 -36.161 1.00 56.62  ? 402 HIS B CE1 1 
ATOM   2125 N  NE2 . HIS B 1 75  ? 21.819  -61.667 -35.331 1.00 56.05  ? 402 HIS B NE2 1 
ATOM   2126 N  N   . ILE B 1 76  ? 27.656  -62.807 -32.054 1.00 40.59  ? 403 ILE B N   1 
ATOM   2127 C  CA  . ILE B 1 76  ? 28.626  -62.966 -30.966 1.00 38.54  ? 403 ILE B CA  1 
ATOM   2128 C  C   . ILE B 1 76  ? 29.360  -61.648 -30.716 1.00 39.33  ? 403 ILE B C   1 
ATOM   2129 O  O   . ILE B 1 76  ? 29.434  -61.192 -29.596 1.00 37.89  ? 403 ILE B O   1 
ATOM   2130 C  CB  . ILE B 1 76  ? 29.572  -64.155 -31.218 1.00 38.26  ? 403 ILE B CB  1 
ATOM   2131 C  CG1 . ILE B 1 76  ? 28.741  -65.453 -31.305 1.00 37.88  ? 403 ILE B CG1 1 
ATOM   2132 C  CG2 . ILE B 1 76  ? 30.683  -64.231 -30.163 1.00 36.81  ? 403 ILE B CG2 1 
ATOM   2133 C  CD1 . ILE B 1 76  ? 29.503  -66.674 -31.821 1.00 38.24  ? 403 ILE B CD1 1 
ATOM   2134 N  N   . GLN B 1 77  ? 29.829  -61.005 -31.781 1.00 40.93  ? 404 GLN B N   1 
ATOM   2135 C  CA  . GLN B 1 77  ? 30.571  -59.745 -31.685 1.00 40.94  ? 404 GLN B CA  1 
ATOM   2136 C  C   . GLN B 1 77  ? 29.693  -58.676 -31.007 1.00 38.79  ? 404 GLN B C   1 
ATOM   2137 O  O   . GLN B 1 77  ? 30.148  -57.948 -30.095 1.00 37.36  ? 404 GLN B O   1 
ATOM   2138 C  CB  . GLN B 1 77  ? 31.004  -59.300 -33.104 1.00 44.38  ? 404 GLN B CB  1 
ATOM   2139 C  CG  . GLN B 1 77  ? 32.456  -58.945 -33.366 1.00 47.57  ? 404 GLN B CG  1 
ATOM   2140 C  CD  . GLN B 1 77  ? 32.955  -59.535 -34.698 1.00 51.14  ? 404 GLN B CD  1 
ATOM   2141 O  OE1 . GLN B 1 77  ? 32.262  -59.506 -35.728 1.00 52.81  ? 404 GLN B OE1 1 
ATOM   2142 N  NE2 . GLN B 1 77  ? 34.165  -60.074 -34.678 1.00 51.73  ? 404 GLN B NE2 1 
ATOM   2143 N  N   . GLN B 1 78  ? 28.425  -58.604 -31.419 1.00 38.63  ? 405 GLN B N   1 
ATOM   2144 C  CA  . GLN B 1 78  ? 27.498  -57.667 -30.805 1.00 38.83  ? 405 GLN B CA  1 
ATOM   2145 C  C   . GLN B 1 78  ? 27.258  -57.975 -29.306 1.00 35.52  ? 405 GLN B C   1 
ATOM   2146 O  O   . GLN B 1 78  ? 27.232  -57.077 -28.463 1.00 33.86  ? 405 GLN B O   1 
ATOM   2147 C  CB  . GLN B 1 78  ? 26.182  -57.597 -31.584 1.00 41.80  ? 405 GLN B CB  1 
ATOM   2148 C  CG  . GLN B 1 78  ? 25.320  -56.452 -31.050 1.00 45.40  ? 405 GLN B CG  1 
ATOM   2149 C  CD  . GLN B 1 78  ? 24.471  -55.766 -32.120 1.00 51.02  ? 405 GLN B CD  1 
ATOM   2150 O  OE1 . GLN B 1 78  ? 24.009  -56.412 -33.080 1.00 53.50  ? 405 GLN B OE1 1 
ATOM   2151 N  NE2 . GLN B 1 78  ? 24.281  -54.450 -31.972 1.00 52.54  ? 405 GLN B NE2 1 
ATOM   2152 N  N   . PHE B 1 79  ? 27.137  -59.257 -29.001 1.00 34.30  ? 406 PHE B N   1 
ATOM   2153 C  CA  . PHE B 1 79  ? 27.050  -59.725 -27.624 1.00 32.71  ? 406 PHE B CA  1 
ATOM   2154 C  C   . PHE B 1 79  ? 28.246  -59.198 -26.812 1.00 30.77  ? 406 PHE B C   1 
ATOM   2155 O  O   . PHE B 1 79  ? 28.040  -58.602 -25.760 1.00 28.34  ? 406 PHE B O   1 
ATOM   2156 C  CB  . PHE B 1 79  ? 26.919  -61.269 -27.613 1.00 33.76  ? 406 PHE B CB  1 
ATOM   2157 C  CG  . PHE B 1 79  ? 27.240  -61.916 -26.283 1.00 33.80  ? 406 PHE B CG  1 
ATOM   2158 C  CD1 . PHE B 1 79  ? 26.331  -61.871 -25.238 1.00 33.78  ? 406 PHE B CD1 1 
ATOM   2159 C  CD2 . PHE B 1 79  ? 28.440  -62.593 -26.100 1.00 33.21  ? 406 PHE B CD2 1 
ATOM   2160 C  CE1 . PHE B 1 79  ? 26.596  -62.471 -23.999 1.00 34.14  ? 406 PHE B CE1 1 
ATOM   2161 C  CE2 . PHE B 1 79  ? 28.709  -63.239 -24.882 1.00 33.34  ? 406 PHE B CE2 1 
ATOM   2162 C  CZ  . PHE B 1 79  ? 27.773  -63.193 -23.833 1.00 33.35  ? 406 PHE B CZ  1 
ATOM   2163 N  N   . TYR B 1 80  ? 29.477  -59.353 -27.330 1.00 30.59  ? 407 TYR B N   1 
ATOM   2164 C  CA  . TYR B 1 80  ? 30.657  -58.761 -26.674 1.00 28.86  ? 407 TYR B CA  1 
ATOM   2165 C  C   . TYR B 1 80  ? 30.591  -57.227 -26.514 1.00 29.67  ? 407 TYR B C   1 
ATOM   2166 O  O   . TYR B 1 80  ? 30.893  -56.692 -25.426 1.00 28.69  ? 407 TYR B O   1 
ATOM   2167 C  CB  . TYR B 1 80  ? 31.943  -59.159 -27.404 1.00 29.29  ? 407 TYR B CB  1 
ATOM   2168 C  CG  . TYR B 1 80  ? 32.318  -60.638 -27.394 1.00 29.44  ? 407 TYR B CG  1 
ATOM   2169 C  CD1 . TYR B 1 80  ? 32.011  -61.498 -26.297 1.00 27.56  ? 407 TYR B CD1 1 
ATOM   2170 C  CD2 . TYR B 1 80  ? 33.000  -61.181 -28.481 1.00 30.69  ? 407 TYR B CD2 1 
ATOM   2171 C  CE1 . TYR B 1 80  ? 32.407  -62.836 -26.315 1.00 28.18  ? 407 TYR B CE1 1 
ATOM   2172 C  CE2 . TYR B 1 80  ? 33.426  -62.533 -28.501 1.00 31.44  ? 407 TYR B CE2 1 
ATOM   2173 C  CZ  . TYR B 1 80  ? 33.096  -63.348 -27.435 1.00 29.78  ? 407 TYR B CZ  1 
ATOM   2174 O  OH  . TYR B 1 80  ? 33.516  -64.640 -27.508 1.00 31.32  ? 407 TYR B OH  1 
ATOM   2175 N  N   . ASP B 1 81  ? 30.228  -56.523 -27.602 1.00 31.30  ? 408 ASP B N   1 
ATOM   2176 C  CA  . ASP B 1 81  ? 30.067  -55.055 -27.562 1.00 31.66  ? 408 ASP B CA  1 
ATOM   2177 C  C   . ASP B 1 81  ? 29.061  -54.624 -26.522 1.00 29.58  ? 408 ASP B C   1 
ATOM   2178 O  O   . ASP B 1 81  ? 29.323  -53.689 -25.782 1.00 27.72  ? 408 ASP B O   1 
ATOM   2179 C  CB  . ASP B 1 81  ? 29.675  -54.523 -28.930 1.00 35.04  ? 408 ASP B CB  1 
ATOM   2180 C  CG  . ASP B 1 81  ? 30.822  -54.663 -29.931 1.00 39.09  ? 408 ASP B CG  1 
ATOM   2181 O  OD1 . ASP B 1 81  ? 31.978  -54.984 -29.528 1.00 40.04  ? 408 ASP B OD1 1 
ATOM   2182 O  OD2 . ASP B 1 81  ? 30.590  -54.453 -31.137 1.00 43.40  ? 408 ASP B OD2 1 
ATOM   2183 N  N   . LEU B 1 82  ? 27.946  -55.346 -26.416 1.00 28.72  ? 409 LEU B N   1 
ATOM   2184 C  CA  . LEU B 1 82  ? 26.967  -54.983 -25.408 1.00 28.49  ? 409 LEU B CA  1 
ATOM   2185 C  C   . LEU B 1 82  ? 27.505  -55.182 -24.010 1.00 27.84  ? 409 LEU B C   1 
ATOM   2186 O  O   . LEU B 1 82  ? 27.245  -54.352 -23.145 1.00 29.00  ? 409 LEU B O   1 
ATOM   2187 C  CB  . LEU B 1 82  ? 25.640  -55.747 -25.590 1.00 28.49  ? 409 LEU B CB  1 
ATOM   2188 C  CG  . LEU B 1 82  ? 24.837  -55.520 -26.891 1.00 30.03  ? 409 LEU B CG  1 
ATOM   2189 C  CD1 . LEU B 1 82  ? 23.816  -56.651 -27.089 1.00 29.85  ? 409 LEU B CD1 1 
ATOM   2190 C  CD2 . LEU B 1 82  ? 24.215  -54.116 -26.949 1.00 29.99  ? 409 LEU B CD2 1 
ATOM   2191 N  N   . LEU B 1 83  ? 28.257  -56.279 -23.777 1.00 27.70  ? 410 LEU B N   1 
ATOM   2192 C  CA  . LEU B 1 83  ? 28.864  -56.482 -22.477 1.00 26.82  ? 410 LEU B CA  1 
ATOM   2193 C  C   . LEU B 1 83  ? 29.909  -55.382 -22.188 1.00 27.52  ? 410 LEU B C   1 
ATOM   2194 O  O   . LEU B 1 83  ? 29.934  -54.856 -21.073 1.00 27.06  ? 410 LEU B O   1 
ATOM   2195 C  CB  . LEU B 1 83  ? 29.532  -57.871 -22.355 1.00 26.93  ? 410 LEU B CB  1 
ATOM   2196 C  CG  . LEU B 1 83  ? 28.688  -59.162 -22.269 1.00 27.20  ? 410 LEU B CG  1 
ATOM   2197 C  CD1 . LEU B 1 83  ? 29.573  -60.394 -22.298 1.00 27.39  ? 410 LEU B CD1 1 
ATOM   2198 C  CD2 . LEU B 1 83  ? 27.770  -59.214 -21.062 1.00 25.66  ? 410 LEU B CD2 1 
ATOM   2199 N  N   . THR B 1 84  ? 30.783  -55.076 -23.148 1.00 28.24  ? 411 THR B N   1 
ATOM   2200 C  CA  . THR B 1 84  ? 31.871  -54.111 -22.854 1.00 30.22  ? 411 THR B CA  1 
ATOM   2201 C  C   . THR B 1 84  ? 31.345  -52.684 -22.693 1.00 31.04  ? 411 THR B C   1 
ATOM   2202 O  O   . THR B 1 84  ? 31.794  -51.980 -21.789 1.00 30.30  ? 411 THR B O   1 
ATOM   2203 C  CB  . THR B 1 84  ? 33.038  -54.137 -23.854 1.00 31.68  ? 411 THR B CB  1 
ATOM   2204 O  OG1 . THR B 1 84  ? 32.538  -53.792 -25.147 1.00 33.45  ? 411 THR B OG1 1 
ATOM   2205 C  CG2 . THR B 1 84  ? 33.657  -55.556 -23.944 1.00 30.74  ? 411 THR B CG2 1 
ATOM   2206 N  N   . GLY B 1 85  ? 30.396  -52.277 -23.546 1.00 31.88  ? 412 GLY B N   1 
ATOM   2207 C  CA  . GLY B 1 85  ? 29.663  -50.991 -23.375 1.00 34.26  ? 412 GLY B CA  1 
ATOM   2208 C  C   . GLY B 1 85  ? 29.024  -50.887 -21.985 1.00 34.05  ? 412 GLY B C   1 
ATOM   2209 O  O   . GLY B 1 85  ? 29.202  -49.914 -21.257 1.00 35.38  ? 412 GLY B O   1 
ATOM   2210 N  N   . SER B 1 86  ? 28.344  -51.939 -21.590 1.00 34.79  ? 413 SER B N   1 
ATOM   2211 C  CA  . SER B 1 86  ? 27.709  -51.969 -20.270 1.00 35.69  ? 413 SER B CA  1 
ATOM   2212 C  C   . SER B 1 86  ? 28.685  -51.933 -19.058 1.00 35.20  ? 413 SER B C   1 
ATOM   2213 O  O   . SER B 1 86  ? 28.359  -51.354 -18.011 1.00 34.47  ? 413 SER B O   1 
ATOM   2214 C  CB  . SER B 1 86  ? 26.771  -53.161 -20.220 1.00 37.95  ? 413 SER B CB  1 
ATOM   2215 O  OG  . SER B 1 86  ? 26.596  -53.567 -18.870 1.00 45.49  ? 413 SER B OG  1 
ATOM   2216 N  N   . MET B 1 87  ? 29.870  -52.541 -19.199 1.00 36.07  ? 414 MET B N   1 
ATOM   2217 C  CA  . MET B 1 87  ? 30.939  -52.481 -18.177 1.00 36.79  ? 414 MET B CA  1 
ATOM   2218 C  C   . MET B 1 87  ? 31.278  -51.063 -17.781 1.00 35.19  ? 414 MET B C   1 
ATOM   2219 O  O   . MET B 1 87  ? 31.342  -50.735 -16.589 1.00 33.30  ? 414 MET B O   1 
ATOM   2220 C  CB  . MET B 1 87  ? 32.234  -53.115 -18.658 1.00 36.63  ? 414 MET B CB  1 
ATOM   2221 C  CG  . MET B 1 87  ? 32.281  -54.598 -18.449 1.00 40.17  ? 414 MET B CG  1 
ATOM   2222 S  SD  . MET B 1 87  ? 33.903  -55.206 -19.054 1.00 42.99  ? 414 MET B SD  1 
ATOM   2223 C  CE  . MET B 1 87  ? 33.348  -56.865 -19.371 1.00 38.79  ? 414 MET B CE  1 
ATOM   2224 N  N   . GLU B 1 88  ? 31.498  -50.229 -18.788 1.00 35.74  ? 415 GLU B N   1 
ATOM   2225 C  CA  . GLU B 1 88  ? 31.885  -48.848 -18.534 1.00 37.92  ? 415 GLU B CA  1 
ATOM   2226 C  C   . GLU B 1 88  ? 30.739  -48.046 -17.845 1.00 35.70  ? 415 GLU B C   1 
ATOM   2227 O  O   . GLU B 1 88  ? 30.978  -47.301 -16.895 1.00 35.17  ? 415 GLU B O   1 
ATOM   2228 C  CB  . GLU B 1 88  ? 32.310  -48.213 -19.846 1.00 44.10  ? 415 GLU B CB  1 
ATOM   2229 C  CG  . GLU B 1 88  ? 33.082  -46.900 -19.690 1.00 51.99  ? 415 GLU B CG  1 
ATOM   2230 C  CD  . GLU B 1 88  ? 34.484  -47.065 -19.073 1.00 60.51  ? 415 GLU B CD  1 
ATOM   2231 O  OE1 . GLU B 1 88  ? 35.198  -46.025 -19.077 1.00 66.95  ? 415 GLU B OE1 1 
ATOM   2232 O  OE2 . GLU B 1 88  ? 34.894  -48.188 -18.596 1.00 61.28  ? 415 GLU B OE2 1 
ATOM   2233 N  N   . ILE B 1 89  ? 29.513  -48.233 -18.327 1.00 31.96  ? 416 ILE B N   1 
ATOM   2234 C  CA  . ILE B 1 89  ? 28.343  -47.543 -17.803 1.00 31.72  ? 416 ILE B CA  1 
ATOM   2235 C  C   . ILE B 1 89  ? 28.045  -47.978 -16.363 1.00 29.35  ? 416 ILE B C   1 
ATOM   2236 O  O   . ILE B 1 89  ? 27.818  -47.127 -15.513 1.00 28.55  ? 416 ILE B O   1 
ATOM   2237 C  CB  . ILE B 1 89  ? 27.164  -47.643 -18.808 1.00 31.28  ? 416 ILE B CB  1 
ATOM   2238 C  CG1 . ILE B 1 89  ? 27.459  -46.642 -19.937 1.00 33.71  ? 416 ILE B CG1 1 
ATOM   2239 C  CG2 . ILE B 1 89  ? 25.823  -47.346 -18.177 1.00 30.38  ? 416 ILE B CG2 1 
ATOM   2240 C  CD1 . ILE B 1 89  ? 26.965  -47.121 -21.280 1.00 36.46  ? 416 ILE B CD1 1 
ATOM   2241 N  N   . ILE B 1 90  ? 28.165  -49.275 -16.074 1.00 27.39  ? 417 ILE B N   1 
ATOM   2242 C  CA  . ILE B 1 90  ? 27.933  -49.782 -14.708 1.00 26.60  ? 417 ILE B CA  1 
ATOM   2243 C  C   . ILE B 1 90  ? 29.017  -49.313 -13.735 1.00 28.79  ? 417 ILE B C   1 
ATOM   2244 O  O   . ILE B 1 90  ? 28.732  -49.033 -12.549 1.00 27.89  ? 417 ILE B O   1 
ATOM   2245 C  CB  . ILE B 1 90  ? 27.751  -51.315 -14.696 1.00 26.17  ? 417 ILE B CB  1 
ATOM   2246 C  CG1 . ILE B 1 90  ? 26.446  -51.661 -15.492 1.00 26.51  ? 417 ILE B CG1 1 
ATOM   2247 C  CG2 . ILE B 1 90  ? 27.674  -51.862 -13.258 1.00 25.58  ? 417 ILE B CG2 1 
ATOM   2248 C  CD1 . ILE B 1 90  ? 26.177  -53.169 -15.641 1.00 26.99  ? 417 ILE B CD1 1 
ATOM   2249 N  N   . ARG B 1 91  ? 30.252  -49.207 -14.245 1.00 29.52  ? 418 ARG B N   1 
ATOM   2250 C  CA  . ARG B 1 91  ? 31.350  -48.679 -13.462 1.00 33.02  ? 418 ARG B CA  1 
ATOM   2251 C  C   . ARG B 1 91  ? 31.043  -47.215 -13.090 1.00 31.09  ? 418 ARG B C   1 
ATOM   2252 O  O   . ARG B 1 91  ? 31.239  -46.828 -11.940 1.00 31.07  ? 418 ARG B O   1 
ATOM   2253 C  CB  . ARG B 1 91  ? 32.685  -48.808 -14.240 1.00 37.13  ? 418 ARG B CB  1 
ATOM   2254 C  CG  . ARG B 1 91  ? 33.909  -48.400 -13.490 1.00 44.10  ? 418 ARG B CG  1 
ATOM   2255 C  CD  . ARG B 1 91  ? 35.145  -48.561 -14.394 1.00 51.00  ? 418 ARG B CD  1 
ATOM   2256 N  NE  . ARG B 1 91  ? 35.685  -49.922 -14.394 1.00 53.72  ? 418 ARG B NE  1 
ATOM   2257 C  CZ  . ARG B 1 91  ? 35.724  -50.760 -15.435 1.00 58.01  ? 418 ARG B CZ  1 
ATOM   2258 N  NH1 . ARG B 1 91  ? 35.216  -50.403 -16.627 1.00 59.01  ? 418 ARG B NH1 1 
ATOM   2259 N  NH2 . ARG B 1 91  ? 36.258  -51.980 -15.271 1.00 58.85  ? 418 ARG B NH2 1 
ATOM   2260 N  N   . GLY B 1 92  ? 30.540  -46.435 -14.046 1.00 29.12  ? 419 GLY B N   1 
ATOM   2261 C  CA  . GLY B 1 92  ? 30.147  -45.040 -13.776 1.00 29.75  ? 419 GLY B CA  1 
ATOM   2262 C  C   . GLY B 1 92  ? 29.003  -44.952 -12.775 1.00 28.42  ? 419 GLY B C   1 
ATOM   2263 O  O   . GLY B 1 92  ? 29.034  -44.113 -11.847 1.00 28.90  ? 419 GLY B O   1 
ATOM   2264 N  N   . TRP B 1 93  ? 28.027  -45.855 -12.929 1.00 26.63  ? 420 TRP B N   1 
ATOM   2265 C  CA  . TRP B 1 93  ? 26.932  -45.979 -11.960 1.00 26.85  ? 420 TRP B CA  1 
ATOM   2266 C  C   . TRP B 1 93  ? 27.474  -46.210 -10.540 1.00 27.29  ? 420 TRP B C   1 
ATOM   2267 O  O   . TRP B 1 93  ? 27.075  -45.502 -9.601  1.00 27.98  ? 420 TRP B O   1 
ATOM   2268 C  CB  . TRP B 1 93  ? 25.950  -47.088 -12.383 1.00 25.29  ? 420 TRP B CB  1 
ATOM   2269 C  CG  . TRP B 1 93  ? 25.033  -47.524 -11.300 1.00 24.98  ? 420 TRP B CG  1 
ATOM   2270 C  CD1 . TRP B 1 93  ? 23.841  -46.930 -10.929 1.00 25.05  ? 420 TRP B CD1 1 
ATOM   2271 C  CD2 . TRP B 1 93  ? 25.188  -48.672 -10.456 1.00 24.66  ? 420 TRP B CD2 1 
ATOM   2272 N  NE1 . TRP B 1 93  ? 23.259  -47.630 -9.899  1.00 23.38  ? 420 TRP B NE1 1 
ATOM   2273 C  CE2 . TRP B 1 93  ? 24.069  -48.693 -9.574  1.00 24.40  ? 420 TRP B CE2 1 
ATOM   2274 C  CE3 . TRP B 1 93  ? 26.177  -49.686 -10.348 1.00 24.52  ? 420 TRP B CE3 1 
ATOM   2275 C  CZ2 . TRP B 1 93  ? 23.897  -49.711 -8.594  1.00 25.15  ? 420 TRP B CZ2 1 
ATOM   2276 C  CZ3 . TRP B 1 93  ? 26.039  -50.678 -9.357  1.00 25.40  ? 420 TRP B CZ3 1 
ATOM   2277 C  CH2 . TRP B 1 93  ? 24.900  -50.701 -8.500  1.00 25.54  ? 420 TRP B CH2 1 
ATOM   2278 N  N   . ALA B 1 94  ? 28.399  -47.170 -10.414 1.00 27.35  ? 421 ALA B N   1 
ATOM   2279 C  CA  . ALA B 1 94  ? 28.960  -47.592 -9.120  1.00 29.46  ? 421 ALA B CA  1 
ATOM   2280 C  C   . ALA B 1 94  ? 29.679  -46.434 -8.407  1.00 31.58  ? 421 ALA B C   1 
ATOM   2281 O  O   . ALA B 1 94  ? 29.490  -46.211 -7.208  1.00 31.50  ? 421 ALA B O   1 
ATOM   2282 C  CB  . ALA B 1 94  ? 29.920  -48.764 -9.296  1.00 29.34  ? 421 ALA B CB  1 
ATOM   2283 N  N   . GLU B 1 95  ? 30.433  -45.670 -9.178  1.00 33.77  ? 422 GLU B N   1 
ATOM   2284 C  CA  . GLU B 1 95  ? 31.163  -44.510 -8.658  1.00 37.73  ? 422 GLU B CA  1 
ATOM   2285 C  C   . GLU B 1 95  ? 30.221  -43.373 -8.228  1.00 38.53  ? 422 GLU B C   1 
ATOM   2286 O  O   . GLU B 1 95  ? 30.634  -42.535 -7.425  1.00 39.67  ? 422 GLU B O   1 
ATOM   2287 C  CB  . GLU B 1 95  ? 32.174  -44.029 -9.673  1.00 40.39  ? 422 GLU B CB  1 
ATOM   2288 C  CG  . GLU B 1 95  ? 33.256  -45.064 -9.996  1.00 44.74  ? 422 GLU B CG  1 
ATOM   2289 C  CD  . GLU B 1 95  ? 34.171  -44.637 -11.136 1.00 48.08  ? 422 GLU B CD  1 
ATOM   2290 O  OE1 . GLU B 1 95  ? 33.991  -43.523 -11.676 1.00 52.33  ? 422 GLU B OE1 1 
ATOM   2291 O  OE2 . GLU B 1 95  ? 35.078  -45.404 -11.505 1.00 50.10  ? 422 GLU B OE2 1 
ATOM   2292 N  N   . LYS B 1 96  ? 28.956  -43.396 -8.685  1.00 36.23  ? 423 LYS B N   1 
ATOM   2293 C  CA  . LYS B 1 96  ? 27.975  -42.419 -8.255  1.00 37.68  ? 423 LYS B CA  1 
ATOM   2294 C  C   . LYS B 1 96  ? 27.206  -42.847 -6.988  1.00 37.17  ? 423 LYS B C   1 
ATOM   2295 O  O   . LYS B 1 96  ? 26.340  -42.091 -6.499  1.00 38.11  ? 423 LYS B O   1 
ATOM   2296 C  CB  . LYS B 1 96  ? 27.000  -42.059 -9.391  1.00 38.36  ? 423 LYS B CB  1 
ATOM   2297 C  CG  . LYS B 1 96  ? 27.600  -41.276 -10.563 1.00 42.13  ? 423 LYS B CG  1 
ATOM   2298 C  CD  . LYS B 1 96  ? 26.592  -41.198 -11.735 1.00 43.59  ? 423 LYS B CD  1 
ATOM   2299 C  CE  . LYS B 1 96  ? 26.851  -40.038 -12.716 1.00 46.66  ? 423 LYS B CE  1 
ATOM   2300 N  NZ  . LYS B 1 96  ? 25.629  -39.128 -12.816 1.00 51.11  ? 423 LYS B NZ  1 
ATOM   2301 N  N   . ILE B 1 97  ? 27.505  -44.047 -6.455  1.00 35.05  ? 424 ILE B N   1 
ATOM   2302 C  CA  . ILE B 1 97  ? 26.884  -44.515 -5.192  1.00 33.48  ? 424 ILE B CA  1 
ATOM   2303 C  C   . ILE B 1 97  ? 27.639  -43.851 -4.035  1.00 34.11  ? 424 ILE B C   1 
ATOM   2304 O  O   . ILE B 1 97  ? 28.843  -44.056 -3.921  1.00 34.96  ? 424 ILE B O   1 
ATOM   2305 C  CB  . ILE B 1 97  ? 26.894  -46.052 -5.066  1.00 32.70  ? 424 ILE B CB  1 
ATOM   2306 C  CG1 . ILE B 1 97  ? 25.971  -46.680 -6.102  1.00 31.46  ? 424 ILE B CG1 1 
ATOM   2307 C  CG2 . ILE B 1 97  ? 26.488  -46.516 -3.664  1.00 33.41  ? 424 ILE B CG2 1 
ATOM   2308 C  CD1 . ILE B 1 97  ? 26.370  -48.104 -6.429  1.00 32.06  ? 424 ILE B CD1 1 
ATOM   2309 N  N   . PRO B 1 98  ? 26.951  -43.047 -3.186  1.00 33.03  ? 425 PRO B N   1 
ATOM   2310 C  CA  . PRO B 1 98  ? 27.690  -42.369 -2.117  1.00 34.89  ? 425 PRO B CA  1 
ATOM   2311 C  C   . PRO B 1 98  ? 28.415  -43.378 -1.229  1.00 35.33  ? 425 PRO B C   1 
ATOM   2312 O  O   . PRO B 1 98  ? 27.849  -44.467 -0.916  1.00 33.43  ? 425 PRO B O   1 
ATOM   2313 C  CB  . PRO B 1 98  ? 26.602  -41.619 -1.329  1.00 35.74  ? 425 PRO B CB  1 
ATOM   2314 C  CG  . PRO B 1 98  ? 25.498  -41.441 -2.327  1.00 34.11  ? 425 PRO B CG  1 
ATOM   2315 C  CD  . PRO B 1 98  ? 25.524  -42.702 -3.175  1.00 32.20  ? 425 PRO B CD  1 
ATOM   2316 N  N   . GLY B 1 99  ? 29.672  -43.066 -0.889  1.00 36.66  ? 426 GLY B N   1 
ATOM   2317 C  CA  . GLY B 1 99  ? 30.472  -43.989 -0.106  1.00 37.90  ? 426 GLY B CA  1 
ATOM   2318 C  C   . GLY B 1 99  ? 31.271  -45.024 -0.899  1.00 37.77  ? 426 GLY B C   1 
ATOM   2319 O  O   . GLY B 1 99  ? 32.277  -45.541 -0.389  1.00 40.10  ? 426 GLY B O   1 
ATOM   2320 N  N   . PHE B 1 100 ? 30.882  -45.328 -2.135  1.00 35.72  ? 427 PHE B N   1 
ATOM   2321 C  CA  . PHE B 1 100 ? 31.590  -46.358 -2.901  1.00 35.83  ? 427 PHE B CA  1 
ATOM   2322 C  C   . PHE B 1 100 ? 33.025  -45.939 -3.223  1.00 37.60  ? 427 PHE B C   1 
ATOM   2323 O  O   . PHE B 1 100 ? 33.936  -46.720 -3.086  1.00 37.28  ? 427 PHE B O   1 
ATOM   2324 C  CB  . PHE B 1 100 ? 30.834  -46.734 -4.181  1.00 34.41  ? 427 PHE B CB  1 
ATOM   2325 C  CG  . PHE B 1 100 ? 31.472  -47.843 -4.980  1.00 34.03  ? 427 PHE B CG  1 
ATOM   2326 C  CD1 . PHE B 1 100 ? 31.169  -49.169 -4.703  1.00 33.81  ? 427 PHE B CD1 1 
ATOM   2327 C  CD2 . PHE B 1 100 ? 32.334  -47.555 -6.029  1.00 34.12  ? 427 PHE B CD2 1 
ATOM   2328 C  CE1 . PHE B 1 100 ? 31.717  -50.225 -5.471  1.00 34.18  ? 427 PHE B CE1 1 
ATOM   2329 C  CE2 . PHE B 1 100 ? 32.904  -48.582 -6.780  1.00 34.62  ? 427 PHE B CE2 1 
ATOM   2330 C  CZ  . PHE B 1 100 ? 32.613  -49.928 -6.495  1.00 34.15  ? 427 PHE B CZ  1 
ATOM   2331 N  N   . ALA B 1 101 ? 33.195  -44.703 -3.665  1.00 39.46  ? 428 ALA B N   1 
ATOM   2332 C  CA  . ALA B 1 101 ? 34.526  -44.105 -3.895  1.00 42.81  ? 428 ALA B CA  1 
ATOM   2333 C  C   . ALA B 1 101 ? 35.350  -43.928 -2.622  1.00 45.60  ? 428 ALA B C   1 
ATOM   2334 O  O   . ALA B 1 101 ? 36.557  -43.761 -2.713  1.00 47.90  ? 428 ALA B O   1 
ATOM   2335 C  CB  . ALA B 1 101 ? 34.437  -42.790 -4.672  1.00 43.61  ? 428 ALA B CB  1 
ATOM   2336 N  N   . ASP B 1 102 ? 34.712  -44.015 -1.456  1.00 46.09  ? 429 ASP B N   1 
ATOM   2337 C  CA  . ASP B 1 102 ? 35.446  -43.985 -0.178  1.00 49.97  ? 429 ASP B CA  1 
ATOM   2338 C  C   . ASP B 1 102 ? 36.105  -45.310 0.189   1.00 50.62  ? 429 ASP B C   1 
ATOM   2339 O  O   . ASP B 1 102 ? 36.937  -45.346 1.090   1.00 52.59  ? 429 ASP B O   1 
ATOM   2340 C  CB  . ASP B 1 102 ? 34.550  -43.533 0.992   1.00 51.93  ? 429 ASP B CB  1 
ATOM   2341 C  CG  . ASP B 1 102 ? 34.013  -42.116 0.822   1.00 53.46  ? 429 ASP B CG  1 
ATOM   2342 O  OD1 . ASP B 1 102 ? 34.689  -41.318 0.116   1.00 54.41  ? 429 ASP B OD1 1 
ATOM   2343 O  OD2 . ASP B 1 102 ? 32.931  -41.803 1.402   1.00 53.42  ? 429 ASP B OD2 1 
ATOM   2344 N  N   . LEU B 1 103 ? 35.721  -46.395 -0.486  1.00 48.01  ? 430 LEU B N   1 
ATOM   2345 C  CA  . LEU B 1 103 ? 36.299  -47.714 -0.190  1.00 49.87  ? 430 LEU B CA  1 
ATOM   2346 C  C   . LEU B 1 103 ? 37.707  -47.791 -0.809  1.00 52.26  ? 430 LEU B C   1 
ATOM   2347 O  O   . LEU B 1 103 ? 37.971  -47.103 -1.806  1.00 53.08  ? 430 LEU B O   1 
ATOM   2348 C  CB  . LEU B 1 103 ? 35.426  -48.850 -0.731  1.00 46.35  ? 430 LEU B CB  1 
ATOM   2349 C  CG  . LEU B 1 103 ? 33.969  -48.828 -0.249  1.00 44.54  ? 430 LEU B CG  1 
ATOM   2350 C  CD1 . LEU B 1 103 ? 33.098  -49.739 -1.103  1.00 41.32  ? 430 LEU B CD1 1 
ATOM   2351 C  CD2 . LEU B 1 103 ? 33.870  -49.226 1.208   1.00 46.79  ? 430 LEU B CD2 1 
ATOM   2352 N  N   . PRO B 1 104 ? 38.602  -48.639 -0.252  1.00 53.81  ? 431 PRO B N   1 
ATOM   2353 C  CA  . PRO B 1 104 ? 39.896  -48.855 -0.928  1.00 55.65  ? 431 PRO B CA  1 
ATOM   2354 C  C   . PRO B 1 104 ? 39.714  -49.229 -2.395  1.00 53.66  ? 431 PRO B C   1 
ATOM   2355 O  O   . PRO B 1 104 ? 38.700  -49.838 -2.754  1.00 50.79  ? 431 PRO B O   1 
ATOM   2356 C  CB  . PRO B 1 104 ? 40.498  -50.044 -0.162  1.00 56.99  ? 431 PRO B CB  1 
ATOM   2357 C  CG  . PRO B 1 104 ? 39.925  -49.910 1.205   1.00 57.42  ? 431 PRO B CG  1 
ATOM   2358 C  CD  . PRO B 1 104 ? 38.512  -49.412 1.002   1.00 55.04  ? 431 PRO B CD  1 
ATOM   2359 N  N   . LYS B 1 105 ? 40.683  -48.884 -3.233  1.00 55.22  ? 432 LYS B N   1 
ATOM   2360 C  CA  . LYS B 1 105 ? 40.554  -49.157 -4.675  1.00 53.76  ? 432 LYS B CA  1 
ATOM   2361 C  C   . LYS B 1 105 ? 40.320  -50.649 -4.976  1.00 51.71  ? 432 LYS B C   1 
ATOM   2362 O  O   . LYS B 1 105 ? 39.467  -51.021 -5.826  1.00 50.24  ? 432 LYS B O   1 
ATOM   2363 C  CB  . LYS B 1 105 ? 41.775  -48.607 -5.463  1.00 57.28  ? 432 LYS B CB  1 
ATOM   2364 C  CG  . LYS B 1 105 ? 41.700  -48.795 -6.983  1.00 57.92  ? 432 LYS B CG  1 
ATOM   2365 C  CD  . LYS B 1 105 ? 40.446  -48.116 -7.563  1.00 56.43  ? 432 LYS B CD  1 
ATOM   2366 C  CE  . LYS B 1 105 ? 40.247  -48.381 -9.030  1.00 55.95  ? 432 LYS B CE  1 
ATOM   2367 N  NZ  . LYS B 1 105 ? 38.995  -47.678 -9.406  1.00 53.22  ? 432 LYS B NZ  1 
ATOM   2368 N  N   . ALA B 1 106 ? 41.085  -51.498 -4.278  1.00 51.92  ? 433 ALA B N   1 
ATOM   2369 C  CA  . ALA B 1 106 ? 40.976  -52.953 -4.364  1.00 50.31  ? 433 ALA B CA  1 
ATOM   2370 C  C   . ALA B 1 106 ? 39.551  -53.441 -4.033  1.00 47.12  ? 433 ALA B C   1 
ATOM   2371 O  O   . ALA B 1 106 ? 39.056  -54.354 -4.668  1.00 45.81  ? 433 ALA B O   1 
ATOM   2372 C  CB  . ALA B 1 106 ? 42.007  -53.612 -3.447  1.00 52.66  ? 433 ALA B CB  1 
ATOM   2373 N  N   . ASP B 1 107 ? 38.908  -52.818 -3.043  1.00 47.10  ? 434 ASP B N   1 
ATOM   2374 C  CA  . ASP B 1 107 ? 37.563  -53.165 -2.625  1.00 45.80  ? 434 ASP B CA  1 
ATOM   2375 C  C   . ASP B 1 107 ? 36.555  -52.759 -3.710  1.00 42.99  ? 434 ASP B C   1 
ATOM   2376 O  O   . ASP B 1 107 ? 35.669  -53.534 -4.068  1.00 41.16  ? 434 ASP B O   1 
ATOM   2377 C  CB  . ASP B 1 107 ? 37.211  -52.513 -1.279  1.00 46.68  ? 434 ASP B CB  1 
ATOM   2378 C  CG  . ASP B 1 107 ? 37.793  -53.268 -0.086  1.00 49.41  ? 434 ASP B CG  1 
ATOM   2379 O  OD1 . ASP B 1 107 ? 38.505  -54.268 -0.292  1.00 50.52  ? 434 ASP B OD1 1 
ATOM   2380 O  OD2 . ASP B 1 107 ? 37.537  -52.851 1.071   1.00 50.85  ? 434 ASP B OD2 1 
ATOM   2381 N  N   . GLN B 1 108 ? 36.715  -51.551 -4.243  1.00 42.92  ? 435 GLN B N   1 
ATOM   2382 C  CA  . GLN B 1 108 ? 35.909  -51.099 -5.374  1.00 40.82  ? 435 GLN B CA  1 
ATOM   2383 C  C   . GLN B 1 108 ? 35.973  -52.066 -6.572  1.00 39.88  ? 435 GLN B C   1 
ATOM   2384 O  O   . GLN B 1 108 ? 34.910  -52.451 -7.112  1.00 36.87  ? 435 GLN B O   1 
ATOM   2385 C  CB  . GLN B 1 108 ? 36.313  -49.706 -5.806  1.00 40.60  ? 435 GLN B CB  1 
ATOM   2386 C  CG  . GLN B 1 108 ? 36.006  -48.638 -4.791  1.00 41.14  ? 435 GLN B CG  1 
ATOM   2387 C  CD  . GLN B 1 108 ? 36.514  -47.298 -5.249  1.00 42.06  ? 435 GLN B CD  1 
ATOM   2388 O  OE1 . GLN B 1 108 ? 37.252  -46.620 -4.515  1.00 45.77  ? 435 GLN B OE1 1 
ATOM   2389 N  NE2 . GLN B 1 108 ? 36.163  -46.913 -6.476  1.00 39.58  ? 435 GLN B NE2 1 
ATOM   2390 N  N   . ASP B 1 109 ? 37.203  -52.444 -6.966  1.00 40.36  ? 436 ASP B N   1 
ATOM   2391 C  CA  . ASP B 1 109 ? 37.429  -53.415 -8.047  1.00 39.15  ? 436 ASP B CA  1 
ATOM   2392 C  C   . ASP B 1 109 ? 36.818  -54.763 -7.698  1.00 38.71  ? 436 ASP B C   1 
ATOM   2393 O  O   . ASP B 1 109 ? 36.156  -55.353 -8.537  1.00 37.09  ? 436 ASP B O   1 
ATOM   2394 C  CB  . ASP B 1 109 ? 38.933  -53.621 -8.363  1.00 41.83  ? 436 ASP B CB  1 
ATOM   2395 C  CG  . ASP B 1 109 ? 39.590  -52.392 -8.942  1.00 43.04  ? 436 ASP B CG  1 
ATOM   2396 O  OD1 . ASP B 1 109 ? 38.876  -51.493 -9.413  1.00 43.18  ? 436 ASP B OD1 1 
ATOM   2397 O  OD2 . ASP B 1 109 ? 40.823  -52.289 -8.907  1.00 45.99  ? 436 ASP B OD2 1 
ATOM   2398 N  N   . LEU B 1 110 ? 37.059  -55.265 -6.484  1.00 39.94  ? 437 LEU B N   1 
ATOM   2399 C  CA  . LEU B 1 110 ? 36.443  -56.533 -6.085  1.00 40.18  ? 437 LEU B CA  1 
ATOM   2400 C  C   . LEU B 1 110 ? 34.897  -56.494 -6.175  1.00 37.88  ? 437 LEU B C   1 
ATOM   2401 O  O   . LEU B 1 110 ? 34.289  -57.413 -6.746  1.00 36.74  ? 437 LEU B O   1 
ATOM   2402 C  CB  . LEU B 1 110 ? 36.903  -56.991 -4.693  1.00 42.96  ? 437 LEU B CB  1 
ATOM   2403 C  CG  . LEU B 1 110 ? 36.296  -58.292 -4.118  1.00 43.79  ? 437 LEU B CG  1 
ATOM   2404 C  CD1 . LEU B 1 110 ? 36.554  -59.517 -4.977  1.00 43.79  ? 437 LEU B CD1 1 
ATOM   2405 C  CD2 . LEU B 1 110 ? 36.905  -58.565 -2.775  1.00 46.98  ? 437 LEU B CD2 1 
ATOM   2406 N  N   . LEU B 1 111 ? 34.285  -55.441 -5.619  1.00 36.69  ? 438 LEU B N   1 
ATOM   2407 C  CA  . LEU B 1 111 ? 32.814  -55.301 -5.635  1.00 34.42  ? 438 LEU B CA  1 
ATOM   2408 C  C   . LEU B 1 111 ? 32.274  -55.216 -7.053  1.00 32.40  ? 438 LEU B C   1 
ATOM   2409 O  O   . LEU B 1 111 ? 31.327  -55.934 -7.386  1.00 30.06  ? 438 LEU B O   1 
ATOM   2410 C  CB  . LEU B 1 111 ? 32.325  -54.133 -4.784  1.00 33.64  ? 438 LEU B CB  1 
ATOM   2411 C  CG  . LEU B 1 111 ? 32.481  -54.241 -3.258  1.00 36.45  ? 438 LEU B CG  1 
ATOM   2412 C  CD1 . LEU B 1 111 ? 32.035  -52.941 -2.622  1.00 36.46  ? 438 LEU B CD1 1 
ATOM   2413 C  CD2 . LEU B 1 111 ? 31.729  -55.434 -2.634  1.00 36.71  ? 438 LEU B CD2 1 
ATOM   2414 N  N   . PHE B 1 112 ? 32.888  -54.359 -7.865  1.00 32.61  ? 439 PHE B N   1 
ATOM   2415 C  CA  . PHE B 1 112 ? 32.452  -54.158 -9.248  1.00 32.44  ? 439 PHE B CA  1 
ATOM   2416 C  C   . PHE B 1 112 ? 32.598  -55.425 -10.085 1.00 32.71  ? 439 PHE B C   1 
ATOM   2417 O  O   . PHE B 1 112 ? 31.658  -55.830 -10.797 1.00 33.13  ? 439 PHE B O   1 
ATOM   2418 C  CB  . PHE B 1 112 ? 33.232  -53.032 -9.926  1.00 32.76  ? 439 PHE B CB  1 
ATOM   2419 C  CG  . PHE B 1 112 ? 33.007  -52.972 -11.403 1.00 32.11  ? 439 PHE B CG  1 
ATOM   2420 C  CD1 . PHE B 1 112 ? 31.777  -52.491 -11.918 1.00 30.02  ? 439 PHE B CD1 1 
ATOM   2421 C  CD2 . PHE B 1 112 ? 33.985  -53.430 -12.295 1.00 32.85  ? 439 PHE B CD2 1 
ATOM   2422 C  CE1 . PHE B 1 112 ? 31.534  -52.468 -13.286 1.00 29.66  ? 439 PHE B CE1 1 
ATOM   2423 C  CE2 . PHE B 1 112 ? 33.741  -53.400 -13.672 1.00 33.15  ? 439 PHE B CE2 1 
ATOM   2424 C  CZ  . PHE B 1 112 ? 32.516  -52.923 -14.166 1.00 30.36  ? 439 PHE B CZ  1 
ATOM   2425 N  N   . GLU B 1 113 ? 33.778  -56.019 -10.032 1.00 34.20  ? 440 GLU B N   1 
ATOM   2426 C  CA  . GLU B 1 113 ? 34.078  -57.176 -10.852 1.00 35.76  ? 440 GLU B CA  1 
ATOM   2427 C  C   . GLU B 1 113 ? 33.235  -58.380 -10.505 1.00 33.74  ? 440 GLU B C   1 
ATOM   2428 O  O   . GLU B 1 113 ? 32.737  -59.040 -11.412 1.00 34.13  ? 440 GLU B O   1 
ATOM   2429 C  CB  . GLU B 1 113 ? 35.563  -57.498 -10.791 1.00 40.14  ? 440 GLU B CB  1 
ATOM   2430 C  CG  . GLU B 1 113 ? 36.351  -56.516 -11.639 1.00 44.27  ? 440 GLU B CG  1 
ATOM   2431 C  CD  . GLU B 1 113 ? 37.855  -56.627 -11.426 1.00 51.16  ? 440 GLU B CD  1 
ATOM   2432 O  OE1 . GLU B 1 113 ? 38.332  -57.645 -10.837 1.00 54.52  ? 440 GLU B OE1 1 
ATOM   2433 O  OE2 . GLU B 1 113 ? 38.574  -55.671 -11.816 1.00 53.86  ? 440 GLU B OE2 1 
ATOM   2434 N  N   . SER B 1 114 ? 33.035  -58.618 -9.204  1.00 33.56  ? 441 SER B N   1 
ATOM   2435 C  CA  . SER B 1 114 ? 32.191  -59.719 -8.743  1.00 34.11  ? 441 SER B CA  1 
ATOM   2436 C  C   . SER B 1 114 ? 30.717  -59.566 -9.123  1.00 33.40  ? 441 SER B C   1 
ATOM   2437 O  O   . SER B 1 114 ? 30.012  -60.565 -9.254  1.00 33.76  ? 441 SER B O   1 
ATOM   2438 C  CB  . SER B 1 114 ? 32.269  -59.867 -7.224  1.00 35.85  ? 441 SER B CB  1 
ATOM   2439 O  OG  . SER B 1 114 ? 33.596  -59.958 -6.788  1.00 39.21  ? 441 SER B OG  1 
ATOM   2440 N  N   . ALA B 1 115 ? 30.257  -58.317 -9.246  1.00 31.84  ? 442 ALA B N   1 
ATOM   2441 C  CA  . ALA B 1 115 ? 28.812  -57.986 -9.403  1.00 29.83  ? 442 ALA B CA  1 
ATOM   2442 C  C   . ALA B 1 115 ? 28.450  -57.645 -10.818 1.00 27.93  ? 442 ALA B C   1 
ATOM   2443 O  O   . ALA B 1 115 ? 27.252  -57.594 -11.140 1.00 27.62  ? 442 ALA B O   1 
ATOM   2444 C  CB  . ALA B 1 115 ? 28.423  -56.816 -8.491  1.00 29.12  ? 442 ALA B CB  1 
ATOM   2445 N  N   . PHE B 1 116 ? 29.471  -57.421 -11.670 1.00 27.35  ? 443 PHE B N   1 
ATOM   2446 C  CA  . PHE B 1 116 ? 29.214  -56.888 -12.993 1.00 27.45  ? 443 PHE B CA  1 
ATOM   2447 C  C   . PHE B 1 116 ? 28.102  -57.585 -13.772 1.00 27.52  ? 443 PHE B C   1 
ATOM   2448 O  O   . PHE B 1 116 ? 27.161  -56.939 -14.232 1.00 26.58  ? 443 PHE B O   1 
ATOM   2449 C  CB  . PHE B 1 116 ? 30.465  -56.738 -13.866 1.00 28.06  ? 443 PHE B CB  1 
ATOM   2450 C  CG  . PHE B 1 116 ? 30.126  -56.630 -15.340 1.00 27.58  ? 443 PHE B CG  1 
ATOM   2451 C  CD1 . PHE B 1 116 ? 29.479  -55.485 -15.835 1.00 26.77  ? 443 PHE B CD1 1 
ATOM   2452 C  CD2 . PHE B 1 116 ? 30.386  -57.707 -16.233 1.00 27.40  ? 443 PHE B CD2 1 
ATOM   2453 C  CE1 . PHE B 1 116 ? 29.118  -55.420 -17.178 1.00 26.17  ? 443 PHE B CE1 1 
ATOM   2454 C  CE2 . PHE B 1 116 ? 30.017  -57.614 -17.576 1.00 25.90  ? 443 PHE B CE2 1 
ATOM   2455 C  CZ  . PHE B 1 116 ? 29.378  -56.479 -18.043 1.00 26.05  ? 443 PHE B CZ  1 
ATOM   2456 N  N   . LEU B 1 117 ? 28.205  -58.901 -13.893 1.00 27.91  ? 444 LEU B N   1 
ATOM   2457 C  CA  . LEU B 1 117 ? 27.279  -59.661 -14.715 1.00 28.25  ? 444 LEU B CA  1 
ATOM   2458 C  C   . LEU B 1 117 ? 25.908  -59.746 -14.047 1.00 27.01  ? 444 LEU B C   1 
ATOM   2459 O  O   . LEU B 1 117 ? 24.897  -59.684 -14.718 1.00 26.56  ? 444 LEU B O   1 
ATOM   2460 C  CB  . LEU B 1 117 ? 27.897  -61.030 -15.010 1.00 28.90  ? 444 LEU B CB  1 
ATOM   2461 C  CG  . LEU B 1 117 ? 27.770  -61.659 -16.395 1.00 30.36  ? 444 LEU B CG  1 
ATOM   2462 C  CD1 . LEU B 1 117 ? 27.815  -60.676 -17.560 1.00 28.06  ? 444 LEU B CD1 1 
ATOM   2463 C  CD2 . LEU B 1 117 ? 28.842  -62.758 -16.541 1.00 30.64  ? 444 LEU B CD2 1 
ATOM   2464 N  N   . GLU B 1 118 ? 25.880  -59.856 -12.731 1.00 28.31  ? 445 GLU B N   1 
ATOM   2465 C  CA  . GLU B 1 118 ? 24.611  -59.712 -11.988 1.00 29.38  ? 445 GLU B CA  1 
ATOM   2466 C  C   . GLU B 1 118 ? 23.913  -58.382 -12.292 1.00 28.64  ? 445 GLU B C   1 
ATOM   2467 O  O   . GLU B 1 118 ? 22.720  -58.366 -12.603 1.00 27.99  ? 445 GLU B O   1 
ATOM   2468 C  CB  . GLU B 1 118 ? 24.806  -59.886 -10.491 1.00 31.29  ? 445 GLU B CB  1 
ATOM   2469 C  CG  . GLU B 1 118 ? 25.336  -61.246 -10.160 1.00 34.19  ? 445 GLU B CG  1 
ATOM   2470 C  CD  . GLU B 1 118 ? 25.288  -61.560 -8.677  1.00 39.14  ? 445 GLU B CD  1 
ATOM   2471 O  OE1 . GLU B 1 118 ? 26.087  -62.438 -8.229  1.00 44.64  ? 445 GLU B OE1 1 
ATOM   2472 O  OE2 . GLU B 1 118 ? 24.436  -61.001 -7.942  1.00 39.00  ? 445 GLU B OE2 1 
ATOM   2473 N  N   . LEU B 1 119 ? 24.686  -57.285 -12.285 1.00 28.94  ? 446 LEU B N   1 
ATOM   2474 C  CA  . LEU B 1 119 ? 24.127  -55.955 -12.566 1.00 28.33  ? 446 LEU B CA  1 
ATOM   2475 C  C   . LEU B 1 119 ? 23.685  -55.825 -14.006 1.00 26.91  ? 446 LEU B C   1 
ATOM   2476 O  O   . LEU B 1 119 ? 22.635  -55.239 -14.279 1.00 27.14  ? 446 LEU B O   1 
ATOM   2477 C  CB  . LEU B 1 119 ? 25.132  -54.847 -12.187 1.00 29.13  ? 446 LEU B CB  1 
ATOM   2478 C  CG  . LEU B 1 119 ? 25.153  -54.265 -10.774 1.00 30.76  ? 446 LEU B CG  1 
ATOM   2479 C  CD1 . LEU B 1 119 ? 23.839  -53.585 -10.426 1.00 32.83  ? 446 LEU B CD1 1 
ATOM   2480 C  CD2 . LEU B 1 119 ? 25.395  -55.309 -9.749  1.00 32.40  ? 446 LEU B CD2 1 
ATOM   2481 N  N   . PHE B 1 120 ? 24.499  -56.327 -14.942 1.00 25.57  ? 447 PHE B N   1 
ATOM   2482 C  CA  . PHE B 1 120 ? 24.126  -56.326 -16.350 1.00 24.62  ? 447 PHE B CA  1 
ATOM   2483 C  C   . PHE B 1 120 ? 22.749  -57.008 -16.535 1.00 24.86  ? 447 PHE B C   1 
ATOM   2484 O  O   . PHE B 1 120 ? 21.893  -56.476 -17.214 1.00 25.25  ? 447 PHE B O   1 
ATOM   2485 C  CB  . PHE B 1 120 ? 25.184  -57.057 -17.157 1.00 25.34  ? 447 PHE B CB  1 
ATOM   2486 C  CG  . PHE B 1 120 ? 24.799  -57.295 -18.591 1.00 26.31  ? 447 PHE B CG  1 
ATOM   2487 C  CD1 . PHE B 1 120 ? 24.910  -56.252 -19.545 1.00 26.68  ? 447 PHE B CD1 1 
ATOM   2488 C  CD2 . PHE B 1 120 ? 24.334  -58.562 -19.011 1.00 25.43  ? 447 PHE B CD2 1 
ATOM   2489 C  CE1 . PHE B 1 120 ? 24.548  -56.482 -20.882 1.00 27.22  ? 447 PHE B CE1 1 
ATOM   2490 C  CE2 . PHE B 1 120 ? 23.981  -58.771 -20.327 1.00 25.52  ? 447 PHE B CE2 1 
ATOM   2491 C  CZ  . PHE B 1 120 ? 24.087  -57.739 -21.261 1.00 26.41  ? 447 PHE B CZ  1 
ATOM   2492 N  N   . VAL B 1 121 ? 22.542  -58.145 -15.880 1.00 24.07  ? 448 VAL B N   1 
ATOM   2493 C  CA  . VAL B 1 121 ? 21.321  -58.908 -15.990 1.00 24.57  ? 448 VAL B CA  1 
ATOM   2494 C  C   . VAL B 1 121 ? 20.154  -58.190 -15.285 1.00 24.71  ? 448 VAL B C   1 
ATOM   2495 O  O   . VAL B 1 121 ? 19.045  -58.110 -15.824 1.00 25.32  ? 448 VAL B O   1 
ATOM   2496 C  CB  . VAL B 1 121 ? 21.516  -60.357 -15.420 1.00 24.43  ? 448 VAL B CB  1 
ATOM   2497 C  CG1 . VAL B 1 121 ? 20.176  -61.103 -15.334 1.00 25.10  ? 448 VAL B CG1 1 
ATOM   2498 C  CG2 . VAL B 1 121 ? 22.505  -61.159 -16.254 1.00 24.14  ? 448 VAL B CG2 1 
ATOM   2499 N  N   . LEU B 1 122 ? 20.403  -57.688 -14.078 1.00 24.99  ? 449 LEU B N   1 
ATOM   2500 C  CA  . LEU B 1 122 ? 19.355  -57.036 -13.290 1.00 26.27  ? 449 LEU B CA  1 
ATOM   2501 C  C   . LEU B 1 122 ? 18.787  -55.821 -14.004 1.00 26.13  ? 449 LEU B C   1 
ATOM   2502 O  O   . LEU B 1 122 ? 17.563  -55.668 -14.122 1.00 28.22  ? 449 LEU B O   1 
ATOM   2503 C  CB  . LEU B 1 122 ? 19.871  -56.622 -11.908 1.00 26.64  ? 449 LEU B CB  1 
ATOM   2504 C  CG  . LEU B 1 122 ? 18.833  -55.938 -10.999 1.00 28.35  ? 449 LEU B CG  1 
ATOM   2505 C  CD1 . LEU B 1 122 ? 17.669  -56.877 -10.570 1.00 28.96  ? 449 LEU B CD1 1 
ATOM   2506 C  CD2 . LEU B 1 122 ? 19.569  -55.346 -9.801  1.00 27.72  ? 449 LEU B CD2 1 
ATOM   2507 N  N   . ARG B 1 123 ? 19.693  -54.984 -14.528 1.00 24.77  ? 450 ARG B N   1 
ATOM   2508 C  CA  . ARG B 1 123 ? 19.334  -53.732 -15.159 1.00 23.35  ? 450 ARG B CA  1 
ATOM   2509 C  C   . ARG B 1 123 ? 18.688  -53.987 -16.484 1.00 23.76  ? 450 ARG B C   1 
ATOM   2510 O  O   . ARG B 1 123 ? 17.759  -53.232 -16.889 1.00 23.37  ? 450 ARG B O   1 
ATOM   2511 C  CB  . ARG B 1 123 ? 20.564  -52.860 -15.301 1.00 22.80  ? 450 ARG B CB  1 
ATOM   2512 C  CG  . ARG B 1 123 ? 21.032  -52.230 -13.990 1.00 22.87  ? 450 ARG B CG  1 
ATOM   2513 C  CD  . ARG B 1 123 ? 22.531  -51.829 -14.006 1.00 21.92  ? 450 ARG B CD  1 
ATOM   2514 N  NE  . ARG B 1 123 ? 22.871  -51.041 -15.199 1.00 22.88  ? 450 ARG B NE  1 
ATOM   2515 C  CZ  . ARG B 1 123 ? 22.894  -49.704 -15.278 1.00 22.79  ? 450 ARG B CZ  1 
ATOM   2516 N  NH1 . ARG B 1 123 ? 22.612  -48.930 -14.198 1.00 23.36  ? 450 ARG B NH1 1 
ATOM   2517 N  NH2 . ARG B 1 123 ? 23.244  -49.154 -16.433 1.00 21.51  ? 450 ARG B NH2 1 
ATOM   2518 N  N   . LEU B 1 124 ? 19.184  -55.025 -17.189 1.00 22.45  ? 451 LEU B N   1 
ATOM   2519 C  CA  . LEU B 1 124 ? 18.589  -55.446 -18.465 1.00 22.85  ? 451 LEU B CA  1 
ATOM   2520 C  C   . LEU B 1 124 ? 17.171  -55.937 -18.243 1.00 23.84  ? 451 LEU B C   1 
ATOM   2521 O  O   . LEU B 1 124 ? 16.267  -55.572 -18.989 1.00 24.80  ? 451 LEU B O   1 
ATOM   2522 C  CB  . LEU B 1 124 ? 19.417  -56.564 -19.124 1.00 22.90  ? 451 LEU B CB  1 
ATOM   2523 C  CG  . LEU B 1 124 ? 18.969  -57.172 -20.445 1.00 23.23  ? 451 LEU B CG  1 
ATOM   2524 C  CD1 . LEU B 1 124 ? 18.904  -56.005 -21.457 1.00 23.20  ? 451 LEU B CD1 1 
ATOM   2525 C  CD2 . LEU B 1 124 ? 19.908  -58.302 -20.882 1.00 22.58  ? 451 LEU B CD2 1 
ATOM   2526 N  N   . ALA B 1 125 ? 16.987  -56.784 -17.233 1.00 23.82  ? 452 ALA B N   1 
ATOM   2527 C  CA  . ALA B 1 125 ? 15.671  -57.316 -16.893 1.00 24.79  ? 452 ALA B CA  1 
ATOM   2528 C  C   . ALA B 1 125 ? 14.661  -56.234 -16.491 1.00 25.20  ? 452 ALA B C   1 
ATOM   2529 O  O   . ALA B 1 125 ? 13.477  -56.327 -16.826 1.00 27.40  ? 452 ALA B O   1 
ATOM   2530 C  CB  . ALA B 1 125 ? 15.784  -58.357 -15.795 1.00 23.96  ? 452 ALA B CB  1 
ATOM   2531 N  N   . TYR B 1 126 ? 15.117  -55.220 -15.770 1.00 25.36  ? 453 TYR B N   1 
ATOM   2532 C  CA  . TYR B 1 126 ? 14.219  -54.138 -15.318 1.00 26.37  ? 453 TYR B CA  1 
ATOM   2533 C  C   . TYR B 1 126 ? 13.742  -53.263 -16.485 1.00 28.14  ? 453 TYR B C   1 
ATOM   2534 O  O   . TYR B 1 126 ? 12.604  -52.868 -16.506 1.00 30.18  ? 453 TYR B O   1 
ATOM   2535 C  CB  . TYR B 1 126 ? 14.937  -53.274 -14.301 1.00 25.92  ? 453 TYR B CB  1 
ATOM   2536 C  CG  . TYR B 1 126 ? 14.087  -52.245 -13.631 1.00 26.98  ? 453 TYR B CG  1 
ATOM   2537 C  CD1 . TYR B 1 126 ? 12.997  -52.626 -12.803 1.00 28.12  ? 453 TYR B CD1 1 
ATOM   2538 C  CD2 . TYR B 1 126 ? 14.347  -50.875 -13.816 1.00 27.00  ? 453 TYR B CD2 1 
ATOM   2539 C  CE1 . TYR B 1 126 ? 12.196  -51.664 -12.191 1.00 28.87  ? 453 TYR B CE1 1 
ATOM   2540 C  CE2 . TYR B 1 126 ? 13.551  -49.904 -13.192 1.00 27.74  ? 453 TYR B CE2 1 
ATOM   2541 C  CZ  . TYR B 1 126 ? 12.489  -50.302 -12.395 1.00 28.64  ? 453 TYR B CZ  1 
ATOM   2542 O  OH  . TYR B 1 126 ? 11.733  -49.349 -11.772 1.00 29.90  ? 453 TYR B OH  1 
ATOM   2543 N  N   . ARG B 1 127 ? 14.624  -52.992 -17.436 1.00 28.08  ? 454 ARG B N   1 
ATOM   2544 C  CA  . ARG B 1 127 ? 14.473  -52.019 -18.527 1.00 29.94  ? 454 ARG B CA  1 
ATOM   2545 C  C   . ARG B 1 127 ? 13.711  -52.623 -19.675 1.00 30.14  ? 454 ARG B C   1 
ATOM   2546 O  O   . ARG B 1 127 ? 13.125  -51.899 -20.472 1.00 30.88  ? 454 ARG B O   1 
ATOM   2547 C  CB  . ARG B 1 127 ? 15.898  -51.768 -19.046 1.00 31.07  ? 454 ARG B CB  1 
ATOM   2548 C  CG  . ARG B 1 127 ? 16.215  -50.455 -19.713 1.00 34.47  ? 454 ARG B CG  1 
ATOM   2549 C  CD  . ARG B 1 127 ? 17.657  -50.033 -19.372 1.00 33.30  ? 454 ARG B CD  1 
ATOM   2550 N  NE  . ARG B 1 127 ? 18.438  -51.080 -19.855 1.00 32.72  ? 454 ARG B NE  1 
ATOM   2551 C  CZ  . ARG B 1 127 ? 19.594  -51.543 -19.427 1.00 29.74  ? 454 ARG B CZ  1 
ATOM   2552 N  NH1 . ARG B 1 127 ? 20.312  -50.992 -18.464 1.00 29.00  ? 454 ARG B NH1 1 
ATOM   2553 N  NH2 . ARG B 1 127 ? 20.018  -52.613 -20.065 1.00 27.75  ? 454 ARG B NH2 1 
ATOM   2554 N  N   . SER B 1 128 ? 13.772  -53.946 -19.813 1.00 29.51  ? 455 SER B N   1 
ATOM   2555 C  CA  . SER B 1 128 ? 13.295  -54.610 -21.038 1.00 30.53  ? 455 SER B CA  1 
ATOM   2556 C  C   . SER B 1 128 ? 11.769  -54.797 -21.092 1.00 32.55  ? 455 SER B C   1 
ATOM   2557 O  O   . SER B 1 128 ? 11.070  -54.500 -20.129 1.00 32.07  ? 455 SER B O   1 
ATOM   2558 C  CB  . SER B 1 128 ? 13.995  -55.963 -21.199 1.00 30.46  ? 455 SER B CB  1 
ATOM   2559 O  OG  . SER B 1 128 ? 15.393  -55.799 -21.410 1.00 29.02  ? 455 SER B OG  1 
ATOM   2560 N  N   . ASN B 1 129 ? 11.266  -55.274 -22.226 1.00 33.77  ? 456 ASN B N   1 
ATOM   2561 C  CA  . ASN B 1 129 ? 9.837   -55.552 -22.380 1.00 36.94  ? 456 ASN B CA  1 
ATOM   2562 C  C   . ASN B 1 129 ? 9.693   -57.030 -22.695 1.00 38.21  ? 456 ASN B C   1 
ATOM   2563 O  O   . ASN B 1 129 ? 9.659   -57.401 -23.869 1.00 38.74  ? 456 ASN B O   1 
ATOM   2564 C  CB  . ASN B 1 129 ? 9.174   -54.665 -23.452 1.00 38.26  ? 456 ASN B CB  1 
ATOM   2565 C  CG  . ASN B 1 129 ? 7.646   -54.740 -23.423 1.00 41.12  ? 456 ASN B CG  1 
ATOM   2566 O  OD1 . ASN B 1 129 ? 7.045   -55.690 -22.903 1.00 42.16  ? 456 ASN B OD1 1 
ATOM   2567 N  ND2 . ASN B 1 129 ? 7.012   -53.753 -24.015 1.00 42.23  ? 456 ASN B ND2 1 
ATOM   2568 N  N   . PRO B 1 130 ? 9.628   -57.875 -21.632 1.00 39.04  ? 457 PRO B N   1 
ATOM   2569 C  CA  . PRO B 1 130 ? 9.636   -59.340 -21.788 1.00 40.61  ? 457 PRO B CA  1 
ATOM   2570 C  C   . PRO B 1 130 ? 8.454   -59.880 -22.596 1.00 44.28  ? 457 PRO B C   1 
ATOM   2571 O  O   . PRO B 1 130 ? 8.654   -60.753 -23.429 1.00 45.53  ? 457 PRO B O   1 
ATOM   2572 C  CB  . PRO B 1 130 ? 9.638   -59.869 -20.332 1.00 39.77  ? 457 PRO B CB  1 
ATOM   2573 C  CG  . PRO B 1 130 ? 9.139   -58.736 -19.522 1.00 40.06  ? 457 PRO B CG  1 
ATOM   2574 C  CD  . PRO B 1 130 ? 9.609   -57.487 -20.210 1.00 38.07  ? 457 PRO B CD  1 
ATOM   2575 N  N   . VAL B 1 131 ? 7.254   -59.325 -22.378 1.00 46.66  ? 458 VAL B N   1 
ATOM   2576 C  CA  . VAL B 1 131 ? 6.028   -59.678 -23.092 1.00 50.05  ? 458 VAL B CA  1 
ATOM   2577 C  C   . VAL B 1 131 ? 6.185   -59.536 -24.615 1.00 51.56  ? 458 VAL B C   1 
ATOM   2578 O  O   . VAL B 1 131 ? 5.639   -60.321 -25.387 1.00 52.55  ? 458 VAL B O   1 
ATOM   2579 C  CB  . VAL B 1 131 ? 4.823   -58.815 -22.611 1.00 52.10  ? 458 VAL B CB  1 
ATOM   2580 C  CG1 . VAL B 1 131 ? 3.600   -58.982 -23.506 1.00 54.56  ? 458 VAL B CG1 1 
ATOM   2581 C  CG2 . VAL B 1 131 ? 4.463   -59.143 -21.162 1.00 52.98  ? 458 VAL B CG2 1 
ATOM   2582 N  N   . GLU B 1 132 ? 6.922   -58.519 -25.047 1.00 50.18  ? 459 GLU B N   1 
ATOM   2583 C  CA  . GLU B 1 132 ? 7.134   -58.316 -26.483 1.00 51.88  ? 459 GLU B CA  1 
ATOM   2584 C  C   . GLU B 1 132 ? 8.435   -58.953 -26.974 1.00 49.41  ? 459 GLU B C   1 
ATOM   2585 O  O   . GLU B 1 132 ? 8.751   -58.877 -28.158 1.00 51.04  ? 459 GLU B O   1 
ATOM   2586 C  CB  . GLU B 1 132 ? 7.058   -56.827 -26.831 1.00 54.27  ? 459 GLU B CB  1 
ATOM   2587 C  CG  . GLU B 1 132 ? 5.708   -56.233 -26.453 1.00 58.68  ? 459 GLU B CG  1 
ATOM   2588 C  CD  . GLU B 1 132 ? 5.369   -54.944 -27.143 1.00 61.44  ? 459 GLU B CD  1 
ATOM   2589 O  OE1 . GLU B 1 132 ? 6.203   -54.021 -27.217 1.00 61.93  ? 459 GLU B OE1 1 
ATOM   2590 O  OE2 . GLU B 1 132 ? 4.217   -54.836 -27.554 1.00 66.28  ? 459 GLU B OE2 1 
ATOM   2591 N  N   . GLY B 1 133 ? 9.183   -59.580 -26.065 1.00 45.02  ? 460 GLY B N   1 
ATOM   2592 C  CA  . GLY B 1 133 ? 10.494  -60.149 -26.392 1.00 42.66  ? 460 GLY B CA  1 
ATOM   2593 C  C   . GLY B 1 133 ? 11.515  -59.078 -26.752 1.00 40.26  ? 460 GLY B C   1 
ATOM   2594 O  O   . GLY B 1 133 ? 12.416  -59.341 -27.563 1.00 39.83  ? 460 GLY B O   1 
ATOM   2595 N  N   . LYS B 1 134 ? 11.388  -57.883 -26.148 1.00 38.04  ? 461 LYS B N   1 
ATOM   2596 C  CA  . LYS B 1 134 ? 12.294  -56.766 -26.436 1.00 36.20  ? 461 LYS B CA  1 
ATOM   2597 C  C   . LYS B 1 134 ? 13.307  -56.570 -25.332 1.00 33.79  ? 461 LYS B C   1 
ATOM   2598 O  O   . LYS B 1 134 ? 12.930  -56.221 -24.218 1.00 33.52  ? 461 LYS B O   1 
ATOM   2599 C  CB  . LYS B 1 134 ? 11.514  -55.466 -26.684 1.00 37.34  ? 461 LYS B CB  1 
ATOM   2600 C  CG  . LYS B 1 134 ? 10.720  -55.438 -28.007 1.00 39.70  ? 461 LYS B CG  1 
ATOM   2601 C  CD  . LYS B 1 134 ? 9.967   -54.130 -28.068 1.00 40.79  ? 461 LYS B CD  1 
ATOM   2602 C  CE  . LYS B 1 134 ? 9.609   -53.720 -29.486 1.00 43.65  ? 461 LYS B CE  1 
ATOM   2603 N  NZ  . LYS B 1 134 ? 8.412   -54.409 -30.024 1.00 46.47  ? 461 LYS B NZ  1 
ATOM   2604 N  N   . LEU B 1 135 ? 14.578  -56.853 -25.636 1.00 32.20  ? 462 LEU B N   1 
ATOM   2605 C  CA  . LEU B 1 135 ? 15.694  -56.583 -24.747 1.00 30.91  ? 462 LEU B CA  1 
ATOM   2606 C  C   . LEU B 1 135 ? 16.221  -55.188 -25.049 1.00 31.28  ? 462 LEU B C   1 
ATOM   2607 O  O   . LEU B 1 135 ? 16.414  -54.821 -26.220 1.00 32.56  ? 462 LEU B O   1 
ATOM   2608 C  CB  . LEU B 1 135 ? 16.785  -57.660 -24.887 1.00 30.48  ? 462 LEU B CB  1 
ATOM   2609 C  CG  . LEU B 1 135 ? 16.025  -58.824 -24.216 1.00 32.03  ? 462 LEU B CG  1 
ATOM   2610 C  CD1 . LEU B 1 135 ? 15.721  -60.004 -25.133 1.00 33.88  ? 462 LEU B CD1 1 
ATOM   2611 C  CD2 . LEU B 1 135 ? 16.407  -59.161 -22.788 1.00 29.31  ? 462 LEU B CD2 1 
ATOM   2612 N  N   . ILE B 1 136 ? 16.406  -54.420 -23.996 1.00 30.31  ? 463 ILE B N   1 
ATOM   2613 C  CA  . ILE B 1 136 ? 16.765  -53.024 -24.129 1.00 30.89  ? 463 ILE B CA  1 
ATOM   2614 C  C   . ILE B 1 136 ? 18.049  -52.839 -23.373 1.00 28.86  ? 463 ILE B C   1 
ATOM   2615 O  O   . ILE B 1 136 ? 18.105  -53.005 -22.190 1.00 28.71  ? 463 ILE B O   1 
ATOM   2616 C  CB  . ILE B 1 136 ? 15.616  -52.043 -23.705 1.00 30.53  ? 463 ILE B CB  1 
ATOM   2617 C  CG1 . ILE B 1 136 ? 14.349  -52.297 -24.538 1.00 33.09  ? 463 ILE B CG1 1 
ATOM   2618 C  CG2 . ILE B 1 136 ? 16.039  -50.613 -23.927 1.00 30.62  ? 463 ILE B CG2 1 
ATOM   2619 C  CD1 . ILE B 1 136 ? 13.124  -51.466 -24.136 1.00 33.26  ? 463 ILE B CD1 1 
ATOM   2620 N  N   . PHE B 1 137 ? 19.115  -52.549 -24.086 1.00 30.39  ? 464 PHE B N   1 
ATOM   2621 C  CA  . PHE B 1 137 ? 20.488  -52.410 -23.523 1.00 30.33  ? 464 PHE B CA  1 
ATOM   2622 C  C   . PHE B 1 137 ? 20.771  -50.987 -23.041 1.00 31.77  ? 464 PHE B C   1 
ATOM   2623 O  O   . PHE B 1 137 ? 19.953  -50.068 -23.319 1.00 32.11  ? 464 PHE B O   1 
ATOM   2624 C  CB  . PHE B 1 137 ? 21.496  -52.992 -24.518 1.00 29.48  ? 464 PHE B CB  1 
ATOM   2625 C  CG  . PHE B 1 137 ? 21.237  -54.488 -24.748 1.00 29.25  ? 464 PHE B CG  1 
ATOM   2626 C  CD1 . PHE B 1 137 ? 21.778  -55.421 -23.874 1.00 27.96  ? 464 PHE B CD1 1 
ATOM   2627 C  CD2 . PHE B 1 137 ? 20.373  -54.943 -25.745 1.00 29.90  ? 464 PHE B CD2 1 
ATOM   2628 C  CE1 . PHE B 1 137 ? 21.492  -56.779 -24.001 1.00 28.20  ? 464 PHE B CE1 1 
ATOM   2629 C  CE2 . PHE B 1 137 ? 20.084  -56.296 -25.894 1.00 30.42  ? 464 PHE B CE2 1 
ATOM   2630 C  CZ  . PHE B 1 137 ? 20.638  -57.225 -25.025 1.00 29.30  ? 464 PHE B CZ  1 
ATOM   2631 N  N   . CYS B 1 138 ? 21.856  -50.791 -22.261 1.00 31.43  ? 465 CYS B N   1 
ATOM   2632 C  CA  . CYS B 1 138 ? 22.011  -49.522 -21.506 1.00 34.51  ? 465 CYS B CA  1 
ATOM   2633 C  C   . CYS B 1 138 ? 22.213  -48.326 -22.406 1.00 35.68  ? 465 CYS B C   1 
ATOM   2634 O  O   . CYS B 1 138 ? 21.949  -47.205 -21.997 1.00 35.37  ? 465 CYS B O   1 
ATOM   2635 C  CB  . CYS B 1 138 ? 23.102  -49.547 -20.426 1.00 34.81  ? 465 CYS B CB  1 
ATOM   2636 S  SG  . CYS B 1 138 ? 24.744  -49.727 -21.131 1.00 42.98  ? 465 CYS B SG  1 
ATOM   2637 N  N   . ASN B 1 139 ? 22.652  -48.558 -23.630 1.00 36.78  ? 466 ASN B N   1 
ATOM   2638 C  CA  . ASN B 1 139 ? 22.737  -47.465 -24.611 1.00 40.15  ? 466 ASN B CA  1 
ATOM   2639 C  C   . ASN B 1 139 ? 21.417  -47.206 -25.357 1.00 40.95  ? 466 ASN B C   1 
ATOM   2640 O  O   . ASN B 1 139 ? 21.384  -46.385 -26.299 1.00 40.02  ? 466 ASN B O   1 
ATOM   2641 C  CB  . ASN B 1 139 ? 23.840  -47.758 -25.646 1.00 42.80  ? 466 ASN B CB  1 
ATOM   2642 C  CG  . ASN B 1 139 ? 23.581  -49.021 -26.440 1.00 45.69  ? 466 ASN B CG  1 
ATOM   2643 O  OD1 . ASN B 1 139 ? 22.736  -49.862 -26.082 1.00 45.36  ? 466 ASN B OD1 1 
ATOM   2644 N  ND2 . ASN B 1 139 ? 24.315  -49.171 -27.537 1.00 47.83  ? 466 ASN B ND2 1 
ATOM   2645 N  N   . GLY B 1 140 ? 20.345  -47.919 -24.989 1.00 38.28  ? 467 GLY B N   1 
ATOM   2646 C  CA  . GLY B 1 140 ? 19.047  -47.716 -25.690 1.00 37.27  ? 467 GLY B CA  1 
ATOM   2647 C  C   . GLY B 1 140 ? 18.815  -48.603 -26.902 1.00 35.76  ? 467 GLY B C   1 
ATOM   2648 O  O   . GLY B 1 140 ? 17.767  -48.501 -27.524 1.00 37.74  ? 467 GLY B O   1 
ATOM   2649 N  N   . VAL B 1 141 ? 19.785  -49.451 -27.249 1.00 34.18  ? 468 VAL B N   1 
ATOM   2650 C  CA  . VAL B 1 141 ? 19.637  -50.460 -28.327 1.00 34.39  ? 468 VAL B CA  1 
ATOM   2651 C  C   . VAL B 1 141 ? 18.598  -51.518 -27.995 1.00 33.07  ? 468 VAL B C   1 
ATOM   2652 O  O   . VAL B 1 141 ? 18.624  -52.110 -26.950 1.00 31.45  ? 468 VAL B O   1 
ATOM   2653 C  CB  . VAL B 1 141 ? 20.999  -51.118 -28.739 1.00 34.47  ? 468 VAL B CB  1 
ATOM   2654 C  CG1 . VAL B 1 141 ? 20.804  -52.393 -29.602 1.00 34.59  ? 468 VAL B CG1 1 
ATOM   2655 C  CG2 . VAL B 1 141 ? 21.831  -50.120 -29.535 1.00 36.10  ? 468 VAL B CG2 1 
ATOM   2656 N  N   . VAL B 1 142 ? 17.658  -51.698 -28.899 1.00 34.66  ? 469 VAL B N   1 
ATOM   2657 C  CA  . VAL B 1 142 ? 16.593  -52.689 -28.756 1.00 34.84  ? 469 VAL B CA  1 
ATOM   2658 C  C   . VAL B 1 142 ? 16.873  -53.854 -29.700 1.00 35.28  ? 469 VAL B C   1 
ATOM   2659 O  O   . VAL B 1 142 ? 17.046  -53.667 -30.879 1.00 36.68  ? 469 VAL B O   1 
ATOM   2660 C  CB  . VAL B 1 142 ? 15.174  -52.082 -29.030 1.00 36.31  ? 469 VAL B CB  1 
ATOM   2661 C  CG1 . VAL B 1 142 ? 14.098  -53.112 -28.785 1.00 36.46  ? 469 VAL B CG1 1 
ATOM   2662 C  CG2 . VAL B 1 142 ? 14.933  -50.843 -28.186 1.00 35.60  ? 469 VAL B CG2 1 
ATOM   2663 N  N   . LEU B 1 143 ? 16.864  -55.052 -29.144 1.00 35.11  ? 470 LEU B N   1 
ATOM   2664 C  CA  . LEU B 1 143 ? 17.037  -56.309 -29.887 1.00 36.12  ? 470 LEU B CA  1 
ATOM   2665 C  C   . LEU B 1 143 ? 15.963  -57.293 -29.475 1.00 37.18  ? 470 LEU B C   1 
ATOM   2666 O  O   . LEU B 1 143 ? 15.583  -57.347 -28.296 1.00 37.84  ? 470 LEU B O   1 
ATOM   2667 C  CB  . LEU B 1 143 ? 18.421  -56.925 -29.593 1.00 33.90  ? 470 LEU B CB  1 
ATOM   2668 C  CG  . LEU B 1 143 ? 19.686  -56.144 -30.024 1.00 34.24  ? 470 LEU B CG  1 
ATOM   2669 C  CD1 . LEU B 1 143 ? 20.984  -56.766 -29.480 1.00 32.75  ? 470 LEU B CD1 1 
ATOM   2670 C  CD2 . LEU B 1 143 ? 19.706  -56.060 -31.555 1.00 36.31  ? 470 LEU B CD2 1 
ATOM   2671 N  N   . HIS B 1 144 ? 15.474  -58.067 -30.430 1.00 38.84  ? 471 HIS B N   1 
ATOM   2672 C  CA  . HIS B 1 144 ? 14.525  -59.113 -30.111 1.00 40.96  ? 471 HIS B CA  1 
ATOM   2673 C  C   . HIS B 1 144 ? 15.219  -60.300 -29.445 1.00 40.93  ? 471 HIS B C   1 
ATOM   2674 O  O   . HIS B 1 144 ? 16.383  -60.607 -29.756 1.00 39.12  ? 471 HIS B O   1 
ATOM   2675 C  CB  . HIS B 1 144 ? 13.799  -59.607 -31.366 1.00 43.74  ? 471 HIS B CB  1 
ATOM   2676 C  CG  . HIS B 1 144 ? 12.539  -60.368 -31.072 1.00 45.63  ? 471 HIS B CG  1 
ATOM   2677 N  ND1 . HIS B 1 144 ? 12.528  -61.729 -30.855 1.00 45.45  ? 471 HIS B ND1 1 
ATOM   2678 C  CD2 . HIS B 1 144 ? 11.255  -59.951 -30.932 1.00 47.46  ? 471 HIS B CD2 1 
ATOM   2679 C  CE1 . HIS B 1 144 ? 11.290  -62.118 -30.620 1.00 48.09  ? 471 HIS B CE1 1 
ATOM   2680 N  NE2 . HIS B 1 144 ? 10.502  -61.061 -30.659 1.00 49.04  ? 471 HIS B NE2 1 
ATOM   2681 N  N   . ARG B 1 145 ? 14.485  -60.960 -28.548 1.00 42.28  ? 472 ARG B N   1 
ATOM   2682 C  CA  . ARG B 1 145 ? 14.906  -62.217 -27.927 1.00 43.74  ? 472 ARG B CA  1 
ATOM   2683 C  C   . ARG B 1 145 ? 15.469  -63.223 -28.946 1.00 44.23  ? 472 ARG B C   1 
ATOM   2684 O  O   . ARG B 1 145 ? 16.509  -63.841 -28.704 1.00 41.82  ? 472 ARG B O   1 
ATOM   2685 C  CB  . ARG B 1 145 ? 13.738  -62.823 -27.138 1.00 47.14  ? 472 ARG B CB  1 
ATOM   2686 C  CG  . ARG B 1 145 ? 14.158  -64.029 -26.315 1.00 49.23  ? 472 ARG B CG  1 
ATOM   2687 C  CD  . ARG B 1 145 ? 12.996  -64.749 -25.624 1.00 52.32  ? 472 ARG B CD  1 
ATOM   2688 N  NE  . ARG B 1 145 ? 12.025  -65.330 -26.547 1.00 56.31  ? 472 ARG B NE  1 
ATOM   2689 C  CZ  . ARG B 1 145 ? 12.221  -66.451 -27.262 1.00 59.85  ? 472 ARG B CZ  1 
ATOM   2690 N  NH1 . ARG B 1 145 ? 13.382  -67.124 -27.226 1.00 61.07  ? 472 ARG B NH1 1 
ATOM   2691 N  NH2 . ARG B 1 145 ? 11.275  -66.882 -28.073 1.00 60.49  ? 472 ARG B NH2 1 
ATOM   2692 N  N   . LEU B 1 146 ? 14.807  -63.335 -30.096 1.00 46.21  ? 473 LEU B N   1 
ATOM   2693 C  CA  . LEU B 1 146 ? 15.234  -64.227 -31.148 1.00 48.26  ? 473 LEU B CA  1 
ATOM   2694 C  C   . LEU B 1 146 ? 16.555  -63.811 -31.798 1.00 47.83  ? 473 LEU B C   1 
ATOM   2695 O  O   . LEU B 1 146 ? 17.305  -64.677 -32.289 1.00 47.72  ? 473 LEU B O   1 
ATOM   2696 C  CB  . LEU B 1 146 ? 14.131  -64.406 -32.161 1.00 52.29  ? 473 LEU B CB  1 
ATOM   2697 C  CG  . LEU B 1 146 ? 13.300  -65.702 -32.015 1.00 55.37  ? 473 LEU B CG  1 
ATOM   2698 C  CD1 . LEU B 1 146 ? 13.053  -66.190 -30.594 1.00 54.01  ? 473 LEU B CD1 1 
ATOM   2699 C  CD2 . LEU B 1 146 ? 11.983  -65.594 -32.763 1.00 58.56  ? 473 LEU B CD2 1 
ATOM   2700 N  N   . GLN B 1 147 ? 16.847  -62.509 -31.773 1.00 45.88  ? 474 GLN B N   1 
ATOM   2701 C  CA  . GLN B 1 147 ? 18.154  -62.040 -32.206 1.00 44.77  ? 474 GLN B CA  1 
ATOM   2702 C  C   . GLN B 1 147 ? 19.235  -62.343 -31.176 1.00 42.46  ? 474 GLN B C   1 
ATOM   2703 O  O   . GLN B 1 147 ? 20.385  -62.584 -31.533 1.00 42.38  ? 474 GLN B O   1 
ATOM   2704 C  CB  . GLN B 1 147 ? 18.152  -60.550 -32.448 1.00 44.15  ? 474 GLN B CB  1 
ATOM   2705 C  CG  . GLN B 1 147 ? 17.352  -60.086 -33.637 1.00 46.58  ? 474 GLN B CG  1 
ATOM   2706 C  CD  . GLN B 1 147 ? 17.425  -58.574 -33.702 1.00 47.22  ? 474 GLN B CD  1 
ATOM   2707 O  OE1 . GLN B 1 147 ? 16.776  -57.865 -32.901 1.00 46.67  ? 474 GLN B OE1 1 
ATOM   2708 N  NE2 . GLN B 1 147 ? 18.268  -58.065 -34.601 1.00 46.54  ? 474 GLN B NE2 1 
ATOM   2709 N  N   . CYS B 1 148 ? 18.860  -62.312 -29.892 1.00 41.49  ? 475 CYS B N   1 
ATOM   2710 C  CA  . CYS B 1 148 ? 19.807  -62.457 -28.801 1.00 38.50  ? 475 CYS B CA  1 
ATOM   2711 C  C   . CYS B 1 148 ? 20.261  -63.888 -28.595 1.00 38.83  ? 475 CYS B C   1 
ATOM   2712 O  O   . CYS B 1 148 ? 21.353  -64.093 -28.124 1.00 37.53  ? 475 CYS B O   1 
ATOM   2713 C  CB  . CYS B 1 148 ? 19.233  -61.891 -27.525 1.00 36.54  ? 475 CYS B CB  1 
ATOM   2714 S  SG  . CYS B 1 148 ? 19.079  -60.076 -27.542 1.00 38.25  ? 475 CYS B SG  1 
ATOM   2715 N  N   . VAL B 1 149 ? 19.439  -64.851 -29.003 1.00 40.98  ? 476 VAL B N   1 
ATOM   2716 C  CA  . VAL B 1 149 ? 19.700  -66.274 -28.943 1.00 43.05  ? 476 VAL B CA  1 
ATOM   2717 C  C   . VAL B 1 149 ? 21.037  -66.660 -29.554 1.00 43.67  ? 476 VAL B C   1 
ATOM   2718 O  O   . VAL B 1 149 ? 21.819  -67.397 -28.960 1.00 42.67  ? 476 VAL B O   1 
ATOM   2719 C  CB  . VAL B 1 149 ? 18.471  -67.047 -29.503 1.00 45.32  ? 476 VAL B CB  1 
ATOM   2720 C  CG1 . VAL B 1 149 ? 18.849  -68.189 -30.430 1.00 48.49  ? 476 VAL B CG1 1 
ATOM   2721 C  CG2 . VAL B 1 149 ? 17.620  -67.534 -28.358 1.00 45.41  ? 476 VAL B CG2 1 
ATOM   2722 N  N   . ARG B 1 150 ? 21.327  -66.090 -30.714 1.00 46.63  ? 477 ARG B N   1 
ATOM   2723 C  CA  . ARG B 1 150 ? 22.558  -66.400 -31.427 1.00 47.10  ? 477 ARG B CA  1 
ATOM   2724 C  C   . ARG B 1 150 ? 23.828  -65.940 -30.707 1.00 42.77  ? 477 ARG B C   1 
ATOM   2725 O  O   . ARG B 1 150 ? 24.833  -66.615 -30.783 1.00 42.77  ? 477 ARG B O   1 
ATOM   2726 C  CB  . ARG B 1 150 ? 22.469  -65.824 -32.838 1.00 52.31  ? 477 ARG B CB  1 
ATOM   2727 C  CG  . ARG B 1 150 ? 21.486  -66.519 -33.771 1.00 58.61  ? 477 ARG B CG  1 
ATOM   2728 C  CD  . ARG B 1 150 ? 21.103  -65.581 -34.914 1.00 63.72  ? 477 ARG B CD  1 
ATOM   2729 N  NE  . ARG B 1 150 ? 21.460  -66.162 -36.226 1.00 69.36  ? 477 ARG B NE  1 
ATOM   2730 C  CZ  . ARG B 1 150 ? 21.152  -65.630 -37.415 1.00 73.48  ? 477 ARG B CZ  1 
ATOM   2731 N  NH1 . ARG B 1 150 ? 20.470  -64.469 -37.515 1.00 73.13  ? 477 ARG B NH1 1 
ATOM   2732 N  NH2 . ARG B 1 150 ? 21.527  -66.279 -38.528 1.00 78.51  ? 477 ARG B NH2 1 
ATOM   2733 N  N   . GLY B 1 151 ? 23.773  -64.814 -29.997 1.00 39.60  ? 478 GLY B N   1 
ATOM   2734 C  CA  . GLY B 1 151 ? 24.937  -64.265 -29.303 1.00 37.57  ? 478 GLY B CA  1 
ATOM   2735 C  C   . GLY B 1 151 ? 25.012  -64.745 -27.867 1.00 37.41  ? 478 GLY B C   1 
ATOM   2736 O  O   . GLY B 1 151 ? 26.075  -65.174 -27.393 1.00 36.79  ? 478 GLY B O   1 
ATOM   2737 N  N   . PHE B 1 152 ? 23.870  -64.700 -27.182 1.00 36.16  ? 479 PHE B N   1 
ATOM   2738 C  CA  . PHE B 1 152 ? 23.762  -64.954 -25.738 1.00 35.42  ? 479 PHE B CA  1 
ATOM   2739 C  C   . PHE B 1 152 ? 23.563  -66.459 -25.433 1.00 35.03  ? 479 PHE B C   1 
ATOM   2740 O  O   . PHE B 1 152 ? 23.746  -66.875 -24.303 1.00 34.67  ? 479 PHE B O   1 
ATOM   2741 C  CB  . PHE B 1 152 ? 22.536  -64.170 -25.169 1.00 34.71  ? 479 PHE B CB  1 
ATOM   2742 C  CG  . PHE B 1 152 ? 22.765  -62.691 -24.990 1.00 34.80  ? 479 PHE B CG  1 
ATOM   2743 C  CD1 . PHE B 1 152 ? 22.895  -62.152 -23.714 1.00 33.74  ? 479 PHE B CD1 1 
ATOM   2744 C  CD2 . PHE B 1 152 ? 22.817  -61.808 -26.093 1.00 36.13  ? 479 PHE B CD2 1 
ATOM   2745 C  CE1 . PHE B 1 152 ? 23.095  -60.770 -23.537 1.00 34.47  ? 479 PHE B CE1 1 
ATOM   2746 C  CE2 . PHE B 1 152 ? 23.025  -60.429 -25.919 1.00 35.05  ? 479 PHE B CE2 1 
ATOM   2747 C  CZ  . PHE B 1 152 ? 23.181  -59.920 -24.637 1.00 33.73  ? 479 PHE B CZ  1 
ATOM   2748 N  N   . GLY B 1 153 ? 23.111  -67.232 -26.418 1.00 35.86  ? 480 GLY B N   1 
ATOM   2749 C  CA  . GLY B 1 153 ? 22.641  -68.576 -26.150 1.00 37.30  ? 480 GLY B CA  1 
ATOM   2750 C  C   . GLY B 1 153 ? 21.323  -68.509 -25.371 1.00 37.62  ? 480 GLY B C   1 
ATOM   2751 O  O   . GLY B 1 153 ? 20.696  -67.445 -25.206 1.00 35.11  ? 480 GLY B O   1 
ATOM   2752 N  N   . GLU B 1 154 ? 20.901  -69.680 -24.902 1.00 38.79  ? 481 GLU B N   1 
ATOM   2753 C  CA  . GLU B 1 154 ? 19.649  -69.864 -24.156 1.00 40.38  ? 481 GLU B CA  1 
ATOM   2754 C  C   . GLU B 1 154 ? 19.565  -69.102 -22.845 1.00 37.93  ? 481 GLU B C   1 
ATOM   2755 O  O   . GLU B 1 154 ? 18.480  -68.855 -22.360 1.00 38.46  ? 481 GLU B O   1 
ATOM   2756 C  CB  . GLU B 1 154 ? 19.355  -71.351 -23.952 1.00 45.42  ? 481 GLU B CB  1 
ATOM   2757 C  CG  . GLU B 1 154 ? 18.652  -71.986 -25.156 1.00 51.61  ? 481 GLU B CG  1 
ATOM   2758 C  CD  . GLU B 1 154 ? 18.383  -73.476 -24.981 1.00 56.64  ? 481 GLU B CD  1 
ATOM   2759 O  OE1 . GLU B 1 154 ? 18.670  -74.244 -25.928 1.00 59.53  ? 481 GLU B OE1 1 
ATOM   2760 O  OE2 . GLU B 1 154 ? 17.890  -73.881 -23.894 1.00 60.41  ? 481 GLU B OE2 1 
ATOM   2761 N  N   . TRP B 1 155 ? 20.702  -68.691 -22.296 1.00 35.07  ? 482 TRP B N   1 
ATOM   2762 C  CA  . TRP B 1 155 ? 20.800  -67.658 -21.265 1.00 33.47  ? 482 TRP B CA  1 
ATOM   2763 C  C   . TRP B 1 155 ? 19.786  -66.501 -21.455 1.00 33.80  ? 482 TRP B C   1 
ATOM   2764 O  O   . TRP B 1 155 ? 19.187  -66.046 -20.468 1.00 34.62  ? 482 TRP B O   1 
ATOM   2765 C  CB  . TRP B 1 155 ? 22.257  -67.133 -21.204 1.00 30.30  ? 482 TRP B CB  1 
ATOM   2766 C  CG  . TRP B 1 155 ? 22.551  -66.145 -20.128 1.00 28.81  ? 482 TRP B CG  1 
ATOM   2767 C  CD1 . TRP B 1 155 ? 22.035  -66.131 -18.849 1.00 28.52  ? 482 TRP B CD1 1 
ATOM   2768 C  CD2 . TRP B 1 155 ? 23.452  -65.011 -20.207 1.00 26.96  ? 482 TRP B CD2 1 
ATOM   2769 N  NE1 . TRP B 1 155 ? 22.572  -65.082 -18.136 1.00 26.97  ? 482 TRP B NE1 1 
ATOM   2770 C  CE2 . TRP B 1 155 ? 23.424  -64.371 -18.940 1.00 26.53  ? 482 TRP B CE2 1 
ATOM   2771 C  CE3 . TRP B 1 155 ? 24.277  -64.500 -21.207 1.00 25.80  ? 482 TRP B CE3 1 
ATOM   2772 C  CZ2 . TRP B 1 155 ? 24.205  -63.249 -18.646 1.00 25.90  ? 482 TRP B CZ2 1 
ATOM   2773 C  CZ3 . TRP B 1 155 ? 25.027  -63.393 -20.937 1.00 25.35  ? 482 TRP B CZ3 1 
ATOM   2774 C  CH2 . TRP B 1 155 ? 24.992  -62.769 -19.663 1.00 25.25  ? 482 TRP B CH2 1 
ATOM   2775 N  N   . ILE B 1 156 ? 19.577  -66.043 -22.698 1.00 34.14  ? 483 ILE B N   1 
ATOM   2776 C  CA  . ILE B 1 156 ? 18.639  -64.940 -22.923 1.00 33.47  ? 483 ILE B CA  1 
ATOM   2777 C  C   . ILE B 1 156 ? 17.204  -65.308 -22.505 1.00 33.83  ? 483 ILE B C   1 
ATOM   2778 O  O   . ILE B 1 156 ? 16.526  -64.479 -21.923 1.00 33.36  ? 483 ILE B O   1 
ATOM   2779 C  CB  . ILE B 1 156 ? 18.725  -64.295 -24.343 1.00 34.78  ? 483 ILE B CB  1 
ATOM   2780 C  CG1 . ILE B 1 156 ? 18.152  -62.848 -24.304 1.00 34.12  ? 483 ILE B CG1 1 
ATOM   2781 C  CG2 . ILE B 1 156 ? 18.020  -65.147 -25.404 1.00 36.23  ? 483 ILE B CG2 1 
ATOM   2782 C  CD1 . ILE B 1 156 ? 19.032  -61.873 -23.531 1.00 32.82  ? 483 ILE B CD1 1 
ATOM   2783 N  N   . ASP B 1 157 ? 16.789  -66.557 -22.735 1.00 34.89  ? 484 ASP B N   1 
ATOM   2784 C  CA  . ASP B 1 157 ? 15.513  -67.072 -22.247 1.00 36.56  ? 484 ASP B CA  1 
ATOM   2785 C  C   . ASP B 1 157 ? 15.402  -67.026 -20.734 1.00 35.42  ? 484 ASP B C   1 
ATOM   2786 O  O   . ASP B 1 157 ? 14.366  -66.610 -20.230 1.00 35.57  ? 484 ASP B O   1 
ATOM   2787 C  CB  . ASP B 1 157 ? 15.250  -68.500 -22.742 1.00 39.25  ? 484 ASP B CB  1 
ATOM   2788 C  CG  . ASP B 1 157 ? 14.988  -68.570 -24.237 1.00 41.58  ? 484 ASP B CG  1 
ATOM   2789 O  OD1 . ASP B 1 157 ? 14.766  -67.531 -24.879 1.00 41.15  ? 484 ASP B OD1 1 
ATOM   2790 O  OD2 . ASP B 1 157 ? 14.978  -69.715 -24.771 1.00 45.42  ? 484 ASP B OD2 1 
ATOM   2791 N  N   . SER B 1 158 ? 16.450  -67.416 -20.011 1.00 34.45  ? 485 SER B N   1 
ATOM   2792 C  CA  . SER B 1 158 ? 16.457  -67.220 -18.542 1.00 34.92  ? 485 SER B CA  1 
ATOM   2793 C  C   . SER B 1 158 ? 16.334  -65.747 -18.140 1.00 32.48  ? 485 SER B C   1 
ATOM   2794 O  O   . SER B 1 158 ? 15.604  -65.416 -17.208 1.00 32.44  ? 485 SER B O   1 
ATOM   2795 C  CB  . SER B 1 158 ? 17.740  -67.785 -17.929 1.00 35.54  ? 485 SER B CB  1 
ATOM   2796 O  OG  . SER B 1 158 ? 17.783  -69.175 -18.186 1.00 39.73  ? 485 SER B OG  1 
ATOM   2797 N  N   . ILE B 1 159 ? 17.039  -64.879 -18.861 1.00 30.85  ? 486 ILE B N   1 
ATOM   2798 C  CA  . ILE B 1 159 ? 16.970  -63.435 -18.609 1.00 29.85  ? 486 ILE B CA  1 
ATOM   2799 C  C   . ILE B 1 159 ? 15.532  -62.887 -18.786 1.00 30.76  ? 486 ILE B C   1 
ATOM   2800 O  O   . ILE B 1 159 ? 15.046  -62.139 -17.934 1.00 31.39  ? 486 ILE B O   1 
ATOM   2801 C  CB  . ILE B 1 159 ? 18.004  -62.664 -19.467 1.00 28.95  ? 486 ILE B CB  1 
ATOM   2802 C  CG1 . ILE B 1 159 ? 19.445  -63.003 -19.016 1.00 27.87  ? 486 ILE B CG1 1 
ATOM   2803 C  CG2 . ILE B 1 159 ? 17.763  -61.143 -19.413 1.00 27.55  ? 486 ILE B CG2 1 
ATOM   2804 C  CD1 . ILE B 1 159 ? 20.517  -62.643 -20.060 1.00 27.13  ? 486 ILE B CD1 1 
ATOM   2805 N  N   . VAL B 1 160 ? 14.853  -63.299 -19.846 1.00 31.79  ? 487 VAL B N   1 
ATOM   2806 C  CA  . VAL B 1 160 ? 13.513  -62.813 -20.165 1.00 34.40  ? 487 VAL B CA  1 
ATOM   2807 C  C   . VAL B 1 160 ? 12.506  -63.272 -19.113 1.00 36.25  ? 487 VAL B C   1 
ATOM   2808 O  O   . VAL B 1 160 ? 11.626  -62.515 -18.700 1.00 36.07  ? 487 VAL B O   1 
ATOM   2809 C  CB  . VAL B 1 160 ? 13.096  -63.243 -21.598 1.00 35.43  ? 487 VAL B CB  1 
ATOM   2810 C  CG1 . VAL B 1 160 ? 11.597  -63.087 -21.843 1.00 37.66  ? 487 VAL B CG1 1 
ATOM   2811 C  CG2 . VAL B 1 160 ? 13.910  -62.467 -22.630 1.00 34.66  ? 487 VAL B CG2 1 
ATOM   2812 N  N   . GLU B 1 161 ? 12.654  -64.527 -18.688 1.00 37.99  ? 488 GLU B N   1 
ATOM   2813 C  CA  . GLU B 1 161 ? 11.823  -65.118 -17.636 1.00 39.46  ? 488 GLU B CA  1 
ATOM   2814 C  C   . GLU B 1 161 ? 11.991  -64.326 -16.330 1.00 36.63  ? 488 GLU B C   1 
ATOM   2815 O  O   . GLU B 1 161 ? 11.010  -63.949 -15.716 1.00 36.76  ? 488 GLU B O   1 
ATOM   2816 C  CB  . GLU B 1 161 ? 12.194  -66.588 -17.481 1.00 42.75  ? 488 GLU B CB  1 
ATOM   2817 C  CG  . GLU B 1 161 ? 11.799  -67.265 -16.191 1.00 47.92  ? 488 GLU B CG  1 
ATOM   2818 C  CD  . GLU B 1 161 ? 11.873  -68.790 -16.339 1.00 53.50  ? 488 GLU B CD  1 
ATOM   2819 O  OE1 . GLU B 1 161 ? 12.854  -69.301 -16.983 1.00 56.09  ? 488 GLU B OE1 1 
ATOM   2820 O  OE2 . GLU B 1 161 ? 10.955  -69.481 -15.830 1.00 54.71  ? 488 GLU B OE2 1 
ATOM   2821 N  N   . PHE B 1 162 ? 13.232  -64.063 -15.937 1.00 33.64  ? 489 PHE B N   1 
ATOM   2822 C  CA  . PHE B 1 162 ? 13.522  -63.259 -14.764 1.00 32.41  ? 489 PHE B CA  1 
ATOM   2823 C  C   . PHE B 1 162 ? 12.963  -61.825 -14.893 1.00 32.50  ? 489 PHE B C   1 
ATOM   2824 O  O   . PHE B 1 162 ? 12.437  -61.292 -13.919 1.00 32.00  ? 489 PHE B O   1 
ATOM   2825 C  CB  . PHE B 1 162 ? 15.041  -63.193 -14.531 1.00 31.10  ? 489 PHE B CB  1 
ATOM   2826 C  CG  . PHE B 1 162 ? 15.434  -62.389 -13.331 1.00 29.94  ? 489 PHE B CG  1 
ATOM   2827 C  CD1 . PHE B 1 162 ? 15.223  -62.908 -12.036 1.00 30.90  ? 489 PHE B CD1 1 
ATOM   2828 C  CD2 . PHE B 1 162 ? 15.992  -61.120 -13.475 1.00 27.71  ? 489 PHE B CD2 1 
ATOM   2829 C  CE1 . PHE B 1 162 ? 15.577  -62.169 -10.901 1.00 30.74  ? 489 PHE B CE1 1 
ATOM   2830 C  CE2 . PHE B 1 162 ? 16.364  -60.357 -12.350 1.00 27.84  ? 489 PHE B CE2 1 
ATOM   2831 C  CZ  . PHE B 1 162 ? 16.153  -60.867 -11.069 1.00 29.12  ? 489 PHE B CZ  1 
ATOM   2832 N  N   . SER B 1 163 ? 13.113  -61.225 -16.086 1.00 32.09  ? 490 SER B N   1 
ATOM   2833 C  CA  . SER B 1 163 ? 12.524  -59.937 -16.414 1.00 32.47  ? 490 SER B CA  1 
ATOM   2834 C  C   . SER B 1 163 ? 11.010  -59.913 -16.130 1.00 35.53  ? 490 SER B C   1 
ATOM   2835 O  O   . SER B 1 163 ? 10.499  -59.017 -15.431 1.00 35.97  ? 490 SER B O   1 
ATOM   2836 C  CB  . SER B 1 163 ? 12.806  -59.570 -17.891 1.00 32.04  ? 490 SER B CB  1 
ATOM   2837 O  OG  . SER B 1 163 ? 12.297  -58.275 -18.231 1.00 32.81  ? 490 SER B OG  1 
ATOM   2838 N  N   . SER B 1 164 ? 10.330  -60.929 -16.648 1.00 37.41  ? 491 SER B N   1 
ATOM   2839 C  CA  . SER B 1 164 ? 8.911   -61.141 -16.461 1.00 41.63  ? 491 SER B CA  1 
ATOM   2840 C  C   . SER B 1 164 ? 8.562   -61.200 -14.984 1.00 43.10  ? 491 SER B C   1 
ATOM   2841 O  O   . SER B 1 164 ? 7.686   -60.452 -14.521 1.00 43.64  ? 491 SER B O   1 
ATOM   2842 C  CB  . SER B 1 164 ? 8.512   -62.441 -17.147 1.00 42.85  ? 491 SER B CB  1 
ATOM   2843 O  OG  . SER B 1 164 ? 7.157   -62.440 -17.370 1.00 48.93  ? 491 SER B OG  1 
ATOM   2844 N  N   . ASN B 1 165 ? 9.252   -62.064 -14.236 1.00 43.82  ? 492 ASN B N   1 
ATOM   2845 C  CA  . ASN B 1 165 ? 9.050   -62.140 -12.776 1.00 44.49  ? 492 ASN B CA  1 
ATOM   2846 C  C   . ASN B 1 165 ? 9.362   -60.839 -12.044 1.00 42.10  ? 492 ASN B C   1 
ATOM   2847 O  O   . ASN B 1 165 ? 8.636   -60.447 -11.116 1.00 42.18  ? 492 ASN B O   1 
ATOM   2848 C  CB  . ASN B 1 165 ? 9.811   -63.321 -12.159 1.00 46.97  ? 492 ASN B CB  1 
ATOM   2849 C  CG  . ASN B 1 165 ? 9.364   -64.671 -12.727 1.00 51.40  ? 492 ASN B CG  1 
ATOM   2850 O  OD1 . ASN B 1 165 ? 10.168  -65.590 -12.871 1.00 54.57  ? 492 ASN B OD1 1 
ATOM   2851 N  ND2 . ASN B 1 165 ? 8.105   -64.784 -13.078 1.00 53.12  ? 492 ASN B ND2 1 
ATOM   2852 N  N   . LEU B 1 166 ? 10.405  -60.146 -12.489 1.00 38.82  ? 493 LEU B N   1 
ATOM   2853 C  CA  . LEU B 1 166 ? 10.810  -58.898 -11.856 1.00 38.63  ? 493 LEU B CA  1 
ATOM   2854 C  C   . LEU B 1 166 ? 9.742   -57.804 -12.051 1.00 40.14  ? 493 LEU B C   1 
ATOM   2855 O  O   . LEU B 1 166 ? 9.348   -57.118 -11.128 1.00 39.82  ? 493 LEU B O   1 
ATOM   2856 C  CB  . LEU B 1 166 ? 12.186  -58.456 -12.384 1.00 35.20  ? 493 LEU B CB  1 
ATOM   2857 C  CG  . LEU B 1 166 ? 12.997  -57.376 -11.686 1.00 33.85  ? 493 LEU B CG  1 
ATOM   2858 C  CD1 . LEU B 1 166 ? 13.512  -57.837 -10.340 1.00 32.59  ? 493 LEU B CD1 1 
ATOM   2859 C  CD2 . LEU B 1 166 ? 14.164  -56.979 -12.583 1.00 32.20  ? 493 LEU B CD2 1 
ATOM   2860 N  N   . GLN B 1 167 ? 9.266   -57.692 -13.270 1.00 43.00  ? 494 GLN B N   1 
ATOM   2861 C  CA  . GLN B 1 167 ? 8.280   -56.679 -13.630 1.00 46.24  ? 494 GLN B CA  1 
ATOM   2862 C  C   . GLN B 1 167 ? 6.905   -56.904 -13.031 1.00 49.35  ? 494 GLN B C   1 
ATOM   2863 O  O   . GLN B 1 167 ? 6.230   -55.939 -12.671 1.00 50.94  ? 494 GLN B O   1 
ATOM   2864 C  CB  . GLN B 1 167 ? 8.250   -56.464 -15.144 1.00 45.81  ? 494 GLN B CB  1 
ATOM   2865 C  CG  . GLN B 1 167 ? 9.493   -55.647 -15.512 1.00 44.30  ? 494 GLN B CG  1 
ATOM   2866 C  CD  . GLN B 1 167 ? 9.624   -55.290 -16.956 1.00 43.84  ? 494 GLN B CD  1 
ATOM   2867 O  OE1 . GLN B 1 167 ? 10.733  -55.128 -17.437 1.00 45.05  ? 494 GLN B OE1 1 
ATOM   2868 N  NE2 . GLN B 1 167 ? 8.531   -55.143 -17.638 1.00 46.94  ? 494 GLN B NE2 1 
ATOM   2869 N  N   . ASN B 1 168 ? 6.540   -58.165 -12.846 1.00 50.51  ? 495 ASN B N   1 
ATOM   2870 C  CA  . ASN B 1 168 ? 5.352   -58.516 -12.067 1.00 52.50  ? 495 ASN B CA  1 
ATOM   2871 C  C   . ASN B 1 168 ? 5.347   -57.970 -10.636 1.00 52.52  ? 495 ASN B C   1 
ATOM   2872 O  O   . ASN B 1 168 ? 4.308   -57.877 -10.004 1.00 55.46  ? 495 ASN B O   1 
ATOM   2873 C  CB  . ASN B 1 168 ? 5.183   -60.027 -12.039 1.00 54.97  ? 495 ASN B CB  1 
ATOM   2874 C  CG  . ASN B 1 168 ? 4.515   -60.559 -13.297 1.00 57.77  ? 495 ASN B CG  1 
ATOM   2875 O  OD1 . ASN B 1 168 ? 4.476   -61.768 -13.520 1.00 59.56  ? 495 ASN B OD1 1 
ATOM   2876 N  ND2 . ASN B 1 168 ? 3.959   -59.659 -14.117 1.00 58.46  ? 495 ASN B ND2 1 
ATOM   2877 N  N   . MET B 1 169 ? 6.512   -57.637 -10.113 1.00 48.82  ? 496 MET B N   1 
ATOM   2878 C  CA  . MET B 1 169 ? 6.605   -57.054 -8.782  1.00 48.44  ? 496 MET B CA  1 
ATOM   2879 C  C   . MET B 1 169 ? 6.351   -55.546 -8.694  1.00 46.14  ? 496 MET B C   1 
ATOM   2880 O  O   . MET B 1 169 ? 6.256   -55.024 -7.600  1.00 45.18  ? 496 MET B O   1 
ATOM   2881 C  CB  . MET B 1 169 ? 7.945   -57.395 -8.168  1.00 48.98  ? 496 MET B CB  1 
ATOM   2882 C  CG  . MET B 1 169 ? 8.104   -58.895 -7.957  1.00 53.31  ? 496 MET B CG  1 
ATOM   2883 S  SD  . MET B 1 169 ? 9.414   -59.216 -6.807  1.00 59.36  ? 496 MET B SD  1 
ATOM   2884 C  CE  . MET B 1 169 ? 8.495   -58.667 -5.345  1.00 58.11  ? 496 MET B CE  1 
ATOM   2885 N  N   . ASN B 1 170 ? 6.249   -54.866 -9.839  1.00 44.54  ? 497 ASN B N   1 
ATOM   2886 C  CA  . ASN B 1 170 ? 5.913   -53.425 -9.904  1.00 44.37  ? 497 ASN B CA  1 
ATOM   2887 C  C   . ASN B 1 170 ? 6.846   -52.556 -9.053  1.00 42.06  ? 497 ASN B C   1 
ATOM   2888 O  O   . ASN B 1 170 ? 6.454   -51.910 -8.090  1.00 41.98  ? 497 ASN B O   1 
ATOM   2889 C  CB  . ASN B 1 170 ? 4.445   -53.180 -9.542  1.00 48.04  ? 497 ASN B CB  1 
ATOM   2890 C  CG  . ASN B 1 170 ? 3.501   -53.863 -10.515 1.00 51.46  ? 497 ASN B CG  1 
ATOM   2891 O  OD1 . ASN B 1 170 ? 2.623   -54.627 -10.117 1.00 56.51  ? 497 ASN B OD1 1 
ATOM   2892 N  ND2 . ASN B 1 170 ? 3.687   -53.608 -11.803 1.00 51.20  ? 497 ASN B ND2 1 
ATOM   2893 N  N   . ILE B 1 171 ? 8.106   -52.603 -9.424  1.00 38.97  ? 498 ILE B N   1 
ATOM   2894 C  CA  . ILE B 1 171 ? 9.142   -51.978 -8.645  1.00 36.34  ? 498 ILE B CA  1 
ATOM   2895 C  C   . ILE B 1 171 ? 9.346   -50.584 -9.223  1.00 34.16  ? 498 ILE B C   1 
ATOM   2896 O  O   . ILE B 1 171 ? 9.719   -50.451 -10.374 1.00 32.38  ? 498 ILE B O   1 
ATOM   2897 C  CB  . ILE B 1 171 ? 10.440  -52.824 -8.709  1.00 35.63  ? 498 ILE B CB  1 
ATOM   2898 C  CG1 . ILE B 1 171 ? 10.168  -54.281 -8.278  1.00 37.67  ? 498 ILE B CG1 1 
ATOM   2899 C  CG2 . ILE B 1 171 ? 11.548  -52.211 -7.871  1.00 34.40  ? 498 ILE B CG2 1 
ATOM   2900 C  CD1 . ILE B 1 171 ? 11.217  -55.274 -8.793  1.00 37.63  ? 498 ILE B CD1 1 
ATOM   2901 N  N   . ASP B 1 172 ? 9.096   -49.548 -8.437  1.00 34.48  ? 499 ASP B N   1 
ATOM   2902 C  CA  . ASP B 1 172 ? 9.327   -48.169 -8.917  1.00 34.22  ? 499 ASP B CA  1 
ATOM   2903 C  C   . ASP B 1 172 ? 10.834  -47.876 -9.004  1.00 31.90  ? 499 ASP B C   1 
ATOM   2904 O  O   . ASP B 1 172 ? 11.663  -48.650 -8.504  1.00 30.58  ? 499 ASP B O   1 
ATOM   2905 C  CB  . ASP B 1 172 ? 8.541   -47.109 -8.117  1.00 36.24  ? 499 ASP B CB  1 
ATOM   2906 C  CG  . ASP B 1 172 ? 9.049   -46.899 -6.683  1.00 37.66  ? 499 ASP B CG  1 
ATOM   2907 O  OD1 . ASP B 1 172 ? 8.356   -46.193 -5.936  1.00 39.55  ? 499 ASP B OD1 1 
ATOM   2908 O  OD2 . ASP B 1 172 ? 10.153  -47.362 -6.286  1.00 37.84  ? 499 ASP B OD2 1 
ATOM   2909 N  N   . ILE B 1 173 ? 11.168  -46.767 -9.647  1.00 31.11  ? 500 ILE B N   1 
ATOM   2910 C  CA  . ILE B 1 173 ? 12.551  -46.370 -9.870  1.00 30.78  ? 500 ILE B CA  1 
ATOM   2911 C  C   . ILE B 1 173 ? 13.360  -46.270 -8.581  1.00 28.48  ? 500 ILE B C   1 
ATOM   2912 O  O   . ILE B 1 173 ? 14.474  -46.781 -8.554  1.00 25.76  ? 500 ILE B O   1 
ATOM   2913 C  CB  . ILE B 1 173 ? 12.678  -45.128 -10.799 1.00 32.84  ? 500 ILE B CB  1 
ATOM   2914 C  CG1 . ILE B 1 173 ? 12.348  -45.575 -12.232 1.00 35.20  ? 500 ILE B CG1 1 
ATOM   2915 C  CG2 . ILE B 1 173 ? 14.112  -44.607 -10.848 1.00 30.93  ? 500 ILE B CG2 1 
ATOM   2916 C  CD1 . ILE B 1 173 ? 11.966  -44.456 -13.191 1.00 37.10  ? 500 ILE B CD1 1 
ATOM   2917 N  N   . SER B 1 174 ? 12.773  -45.693 -7.532  1.00 29.02  ? 501 SER B N   1 
ATOM   2918 C  CA  . SER B 1 174 ? 13.450  -45.528 -6.255  1.00 29.42  ? 501 SER B CA  1 
ATOM   2919 C  C   . SER B 1 174 ? 13.776  -46.882 -5.613  1.00 29.66  ? 501 SER B C   1 
ATOM   2920 O  O   . SER B 1 174 ? 14.925  -47.104 -5.220  1.00 30.14  ? 501 SER B O   1 
ATOM   2921 C  CB  . SER B 1 174 ? 12.652  -44.633 -5.302  1.00 30.78  ? 501 SER B CB  1 
ATOM   2922 O  OG  . SER B 1 174 ? 12.482  -43.319 -5.803  1.00 30.18  ? 501 SER B OG  1 
ATOM   2923 N  N   . ALA B 1 175 ? 12.799  -47.794 -5.550  1.00 29.77  ? 502 ALA B N   1 
ATOM   2924 C  CA  . ALA B 1 175 ? 13.065  -49.138 -5.006  1.00 29.91  ? 502 ALA B CA  1 
ATOM   2925 C  C   . ALA B 1 175 ? 14.105  -49.905 -5.835  1.00 28.99  ? 502 ALA B C   1 
ATOM   2926 O  O   . ALA B 1 175 ? 15.014  -50.555 -5.280  1.00 28.96  ? 502 ALA B O   1 
ATOM   2927 C  CB  . ALA B 1 175 ? 11.795  -49.948 -4.849  1.00 30.29  ? 502 ALA B CB  1 
ATOM   2928 N  N   . PHE B 1 176 ? 13.978  -49.821 -7.165  1.00 28.02  ? 503 PHE B N   1 
ATOM   2929 C  CA  . PHE B 1 176 ? 14.950  -50.495 -8.014  1.00 26.63  ? 503 PHE B CA  1 
ATOM   2930 C  C   . PHE B 1 176 ? 16.389  -49.962 -7.831  1.00 25.77  ? 503 PHE B C   1 
ATOM   2931 O  O   . PHE B 1 176 ? 17.372  -50.728 -7.827  1.00 25.35  ? 503 PHE B O   1 
ATOM   2932 C  CB  . PHE B 1 176 ? 14.575  -50.429 -9.496  1.00 26.33  ? 503 PHE B CB  1 
ATOM   2933 C  CG  . PHE B 1 176 ? 15.527  -51.189 -10.336 1.00 25.76  ? 503 PHE B CG  1 
ATOM   2934 C  CD1 . PHE B 1 176 ? 15.483  -52.604 -10.375 1.00 26.86  ? 503 PHE B CD1 1 
ATOM   2935 C  CD2 . PHE B 1 176 ? 16.568  -50.535 -10.967 1.00 24.83  ? 503 PHE B CD2 1 
ATOM   2936 C  CE1 . PHE B 1 176 ? 16.432  -53.325 -11.084 1.00 25.62  ? 503 PHE B CE1 1 
ATOM   2937 C  CE2 . PHE B 1 176 ? 17.524  -51.236 -11.688 1.00 25.09  ? 503 PHE B CE2 1 
ATOM   2938 C  CZ  . PHE B 1 176 ? 17.443  -52.633 -11.751 1.00 24.73  ? 503 PHE B CZ  1 
ATOM   2939 N  N   . SER B 1 177 ? 16.517  -48.646 -7.723  1.00 25.92  ? 504 SER B N   1 
ATOM   2940 C  CA  . SER B 1 177 ? 17.822  -48.020 -7.520  1.00 25.98  ? 504 SER B CA  1 
ATOM   2941 C  C   . SER B 1 177 ? 18.519  -48.588 -6.285  1.00 26.41  ? 504 SER B C   1 
ATOM   2942 O  O   . SER B 1 177 ? 19.726  -48.743 -6.321  1.00 26.84  ? 504 SER B O   1 
ATOM   2943 C  CB  . SER B 1 177 ? 17.710  -46.492 -7.416  1.00 26.59  ? 504 SER B CB  1 
ATOM   2944 O  OG  . SER B 1 177 ? 17.157  -45.961 -8.601  1.00 27.06  ? 504 SER B OG  1 
ATOM   2945 N  N   . CYS B 1 178 ? 17.755  -48.880 -5.225  1.00 27.03  ? 505 CYS B N   1 
ATOM   2946 C  CA  . CYS B 1 178 ? 18.264  -49.462 -3.988  1.00 28.51  ? 505 CYS B CA  1 
ATOM   2947 C  C   . CYS B 1 178 ? 18.684  -50.912 -4.179  1.00 28.45  ? 505 CYS B C   1 
ATOM   2948 O  O   . CYS B 1 178 ? 19.773  -51.304 -3.722  1.00 28.31  ? 505 CYS B O   1 
ATOM   2949 C  CB  . CYS B 1 178 ? 17.226  -49.402 -2.871  1.00 29.87  ? 505 CYS B CB  1 
ATOM   2950 S  SG  . CYS B 1 178 ? 16.898  -47.727 -2.294  1.00 32.27  ? 505 CYS B SG  1 
ATOM   2951 N  N   . ILE B 1 179 ? 17.836  -51.677 -4.861  1.00 28.39  ? 506 ILE B N   1 
ATOM   2952 C  CA  . ILE B 1 179 ? 18.064  -53.097 -5.143  1.00 29.50  ? 506 ILE B CA  1 
ATOM   2953 C  C   . ILE B 1 179 ? 19.343  -53.304 -5.987  1.00 27.97  ? 506 ILE B C   1 
ATOM   2954 O  O   . ILE B 1 179 ? 20.172  -54.176 -5.689  1.00 28.57  ? 506 ILE B O   1 
ATOM   2955 C  CB  . ILE B 1 179 ? 16.821  -53.692 -5.868  1.00 30.45  ? 506 ILE B CB  1 
ATOM   2956 C  CG1 . ILE B 1 179 ? 15.622  -53.805 -4.931  1.00 33.07  ? 506 ILE B CG1 1 
ATOM   2957 C  CG2 . ILE B 1 179 ? 17.111  -55.040 -6.491  1.00 30.97  ? 506 ILE B CG2 1 
ATOM   2958 C  CD1 . ILE B 1 179 ? 15.792  -54.856 -3.850  1.00 37.08  ? 506 ILE B CD1 1 
ATOM   2959 N  N   . ALA B 1 180 ? 19.459  -52.518 -7.057  1.00 26.55  ? 507 ALA B N   1 
ATOM   2960 C  CA  . ALA B 1 180 ? 20.672  -52.472 -7.885  1.00 25.29  ? 507 ALA B CA  1 
ATOM   2961 C  C   . ALA B 1 180 ? 21.916  -52.224 -7.037  1.00 25.05  ? 507 ALA B C   1 
ATOM   2962 O  O   . ALA B 1 180 ? 22.898  -52.950 -7.151  1.00 25.73  ? 507 ALA B O   1 
ATOM   2963 C  CB  . ALA B 1 180 ? 20.545  -51.429 -8.995  1.00 23.17  ? 507 ALA B CB  1 
ATOM   2964 N  N   . ALA B 1 181 ? 21.869  -51.200 -6.184  1.00 25.25  ? 508 ALA B N   1 
ATOM   2965 C  CA  . ALA B 1 181 ? 23.005  -50.876 -5.296  1.00 26.19  ? 508 ALA B CA  1 
ATOM   2966 C  C   . ALA B 1 181 ? 23.342  -52.069 -4.401  1.00 27.88  ? 508 ALA B C   1 
ATOM   2967 O  O   . ALA B 1 181 ? 24.533  -52.405 -4.231  1.00 28.37  ? 508 ALA B O   1 
ATOM   2968 C  CB  . ALA B 1 181 ? 22.728  -49.632 -4.489  1.00 25.91  ? 508 ALA B CB  1 
ATOM   2969 N  N   . LEU B 1 182 ? 22.294  -52.738 -3.890  1.00 27.89  ? 509 LEU B N   1 
ATOM   2970 C  CA  . LEU B 1 182 ? 22.480  -53.908 -3.018  1.00 29.51  ? 509 LEU B CA  1 
ATOM   2971 C  C   . LEU B 1 182 ? 23.061  -55.123 -3.725  1.00 28.08  ? 509 LEU B C   1 
ATOM   2972 O  O   . LEU B 1 182 ? 23.635  -55.966 -3.077  1.00 29.82  ? 509 LEU B O   1 
ATOM   2973 C  CB  . LEU B 1 182 ? 21.164  -54.292 -2.316  1.00 30.21  ? 509 LEU B CB  1 
ATOM   2974 C  CG  . LEU B 1 182 ? 20.712  -53.320 -1.238  1.00 32.02  ? 509 LEU B CG  1 
ATOM   2975 C  CD1 . LEU B 1 182 ? 19.311  -53.691 -0.752  1.00 32.53  ? 509 LEU B CD1 1 
ATOM   2976 C  CD2 . LEU B 1 182 ? 21.715  -53.310 -0.078  1.00 33.25  ? 509 LEU B CD2 1 
ATOM   2977 N  N   . ALA B 1 183 ? 22.920  -55.203 -5.039  1.00 26.39  ? 510 ALA B N   1 
ATOM   2978 C  CA  . ALA B 1 183 ? 23.514  -56.305 -5.783  1.00 26.51  ? 510 ALA B CA  1 
ATOM   2979 C  C   . ALA B 1 183 ? 25.027  -56.090 -5.813  1.00 28.17  ? 510 ALA B C   1 
ATOM   2980 O  O   . ALA B 1 183 ? 25.806  -57.037 -5.952  1.00 29.26  ? 510 ALA B O   1 
ATOM   2981 C  CB  . ALA B 1 183 ? 22.962  -56.350 -7.208  1.00 23.81  ? 510 ALA B CB  1 
ATOM   2982 N  N   . MET B 1 184 ? 25.454  -54.835 -5.738  1.00 29.64  ? 511 MET B N   1 
ATOM   2983 C  CA  . MET B 1 184 ? 26.883  -54.600 -5.735  1.00 31.36  ? 511 MET B CA  1 
ATOM   2984 C  C   . MET B 1 184 ? 27.525  -54.387 -4.365  1.00 31.54  ? 511 MET B C   1 
ATOM   2985 O  O   . MET B 1 184 ? 28.600  -54.926 -4.090  1.00 32.30  ? 511 MET B O   1 
ATOM   2986 C  CB  . MET B 1 184 ? 27.284  -53.490 -6.681  1.00 32.63  ? 511 MET B CB  1 
ATOM   2987 C  CG  . MET B 1 184 ? 28.809  -53.436 -6.707  1.00 37.05  ? 511 MET B CG  1 
ATOM   2988 S  SD  . MET B 1 184 ? 29.305  -52.060 -7.618  1.00 43.01  ? 511 MET B SD  1 
ATOM   2989 C  CE  . MET B 1 184 ? 29.323  -53.031 -9.114  1.00 42.29  ? 511 MET B CE  1 
ATOM   2990 N  N   . VAL B 1 185 ? 26.865  -53.615 -3.506  1.00 31.97  ? 512 VAL B N   1 
ATOM   2991 C  CA  . VAL B 1 185 ? 27.391  -53.334 -2.179  1.00 33.76  ? 512 VAL B CA  1 
ATOM   2992 C  C   . VAL B 1 185 ? 26.952  -54.484 -1.280  1.00 35.22  ? 512 VAL B C   1 
ATOM   2993 O  O   . VAL B 1 185 ? 25.874  -54.452 -0.674  1.00 34.44  ? 512 VAL B O   1 
ATOM   2994 C  CB  . VAL B 1 185 ? 26.922  -51.954 -1.651  1.00 34.26  ? 512 VAL B CB  1 
ATOM   2995 C  CG1 . VAL B 1 185 ? 27.589  -51.647 -0.327  1.00 36.99  ? 512 VAL B CG1 1 
ATOM   2996 C  CG2 . VAL B 1 185 ? 27.244  -50.854 -2.670  1.00 32.88  ? 512 VAL B CG2 1 
ATOM   2997 N  N   . THR B 1 186 ? 27.807  -55.497 -1.220  1.00 36.29  ? 513 THR B N   1 
ATOM   2998 C  CA  . THR B 1 186 ? 27.484  -56.763 -0.575  1.00 39.23  ? 513 THR B CA  1 
ATOM   2999 C  C   . THR B 1 186 ? 28.766  -57.484 -0.141  1.00 41.62  ? 513 THR B C   1 
ATOM   3000 O  O   . THR B 1 186 ? 29.811  -57.298 -0.757  1.00 39.79  ? 513 THR B O   1 
ATOM   3001 C  CB  . THR B 1 186 ? 26.632  -57.676 -1.541  1.00 37.87  ? 513 THR B CB  1 
ATOM   3002 O  OG1 . THR B 1 186 ? 26.099  -58.766 -0.788  1.00 39.72  ? 513 THR B OG1 1 
ATOM   3003 C  CG2 . THR B 1 186 ? 27.445  -58.233 -2.736  1.00 35.02  ? 513 THR B CG2 1 
ATOM   3004 N  N   . GLU B 1 187 ? 28.668  -58.318 0.889   1.00 47.46  ? 514 GLU B N   1 
ATOM   3005 C  CA  . GLU B 1 187 ? 29.806  -59.150 1.358   1.00 51.19  ? 514 GLU B CA  1 
ATOM   3006 C  C   . GLU B 1 187 ? 30.476  -59.971 0.238   1.00 49.76  ? 514 GLU B C   1 
ATOM   3007 O  O   . GLU B 1 187 ? 29.797  -60.625 -0.551  1.00 46.50  ? 514 GLU B O   1 
ATOM   3008 C  CB  . GLU B 1 187 ? 29.469  -60.022 2.593   1.00 58.07  ? 514 GLU B CB  1 
ATOM   3009 C  CG  . GLU B 1 187 ? 28.065  -60.621 2.695   1.00 63.13  ? 514 GLU B CG  1 
ATOM   3010 C  CD  . GLU B 1 187 ? 27.055  -59.638 3.286   1.00 65.52  ? 514 GLU B CD  1 
ATOM   3011 O  OE1 . GLU B 1 187 ? 27.223  -59.237 4.462   1.00 71.45  ? 514 GLU B OE1 1 
ATOM   3012 O  OE2 . GLU B 1 187 ? 26.085  -59.270 2.581   1.00 64.78  ? 514 GLU B OE2 1 
ATOM   3013 N  N   . ARG B 1 188 ? 31.797  -59.845 0.131   1.00 50.99  ? 515 ARG B N   1 
ATOM   3014 C  CA  . ARG B 1 188 ? 32.614  -60.655 -0.783  1.00 52.18  ? 515 ARG B CA  1 
ATOM   3015 C  C   . ARG B 1 188 ? 33.795  -61.125 0.019   1.00 54.49  ? 515 ARG B C   1 
ATOM   3016 O  O   . ARG B 1 188 ? 34.235  -60.391 0.893   1.00 56.54  ? 515 ARG B O   1 
ATOM   3017 C  CB  . ARG B 1 188 ? 33.153  -59.833 -1.951  1.00 50.09  ? 515 ARG B CB  1 
ATOM   3018 C  CG  . ARG B 1 188 ? 32.099  -59.219 -2.839  1.00 48.06  ? 515 ARG B CG  1 
ATOM   3019 C  CD  . ARG B 1 188 ? 31.317  -60.292 -3.577  1.00 46.69  ? 515 ARG B CD  1 
ATOM   3020 N  NE  . ARG B 1 188 ? 30.404  -59.654 -4.514  1.00 44.11  ? 515 ARG B NE  1 
ATOM   3021 C  CZ  . ARG B 1 188 ? 29.438  -60.276 -5.155  1.00 43.12  ? 515 ARG B CZ  1 
ATOM   3022 N  NH1 . ARG B 1 188 ? 29.234  -61.566 -4.972  1.00 44.54  ? 515 ARG B NH1 1 
ATOM   3023 N  NH2 . ARG B 1 188 ? 28.672  -59.601 -5.993  1.00 41.66  ? 515 ARG B NH2 1 
ATOM   3024 N  N   . HIS B 1 189 ? 34.330  -62.312 -0.271  1.00 55.06  ? 516 HIS B N   1 
ATOM   3025 C  CA  . HIS B 1 189 ? 35.538  -62.754 0.457   1.00 59.43  ? 516 HIS B CA  1 
ATOM   3026 C  C   . HIS B 1 189 ? 36.744  -61.947 -0.031  1.00 58.61  ? 516 HIS B C   1 
ATOM   3027 O  O   . HIS B 1 189 ? 36.911  -61.698 -1.223  1.00 58.14  ? 516 HIS B O   1 
ATOM   3028 C  CB  . HIS B 1 189 ? 35.778  -64.266 0.356   1.00 61.44  ? 516 HIS B CB  1 
ATOM   3029 C  CG  . HIS B 1 189 ? 36.794  -64.780 1.341   1.00 68.03  ? 516 HIS B CG  1 
ATOM   3030 N  ND1 . HIS B 1 189 ? 37.907  -65.500 0.960   1.00 69.93  ? 516 HIS B ND1 1 
ATOM   3031 C  CD2 . HIS B 1 189 ? 36.886  -64.638 2.686   1.00 70.76  ? 516 HIS B CD2 1 
ATOM   3032 C  CE1 . HIS B 1 189 ? 38.632  -65.796 2.027   1.00 74.11  ? 516 HIS B CE1 1 
ATOM   3033 N  NE2 . HIS B 1 189 ? 38.033  -65.285 3.087   1.00 74.85  ? 516 HIS B NE2 1 
ATOM   3034 N  N   . GLY B 1 190 ? 37.544  -61.494 0.911   1.00 61.41  ? 517 GLY B N   1 
ATOM   3035 C  CA  . GLY B 1 190 ? 38.795  -60.798 0.592   1.00 61.54  ? 517 GLY B CA  1 
ATOM   3036 C  C   . GLY B 1 190 ? 38.729  -59.283 0.529   1.00 59.78  ? 517 GLY B C   1 
ATOM   3037 O  O   . GLY B 1 190 ? 39.616  -58.659 -0.052  1.00 60.00  ? 517 GLY B O   1 
ATOM   3038 N  N   . LEU B 1 191 ? 37.698  -58.678 1.117   1.00 58.16  ? 518 LEU B N   1 
ATOM   3039 C  CA  . LEU B 1 191 ? 37.619  -57.218 1.204   1.00 56.91  ? 518 LEU B CA  1 
ATOM   3040 C  C   . LEU B 1 191 ? 38.585  -56.687 2.276   1.00 60.12  ? 518 LEU B C   1 
ATOM   3041 O  O   . LEU B 1 191 ? 38.686  -57.264 3.364   1.00 62.05  ? 518 LEU B O   1 
ATOM   3042 C  CB  . LEU B 1 191 ? 36.201  -56.787 1.546   1.00 54.17  ? 518 LEU B CB  1 
ATOM   3043 C  CG  . LEU B 1 191 ? 35.112  -56.886 0.475   1.00 51.16  ? 518 LEU B CG  1 
ATOM   3044 C  CD1 . LEU B 1 191 ? 33.769  -56.898 1.177   1.00 50.68  ? 518 LEU B CD1 1 
ATOM   3045 C  CD2 . LEU B 1 191 ? 35.189  -55.739 -0.527  1.00 48.83  ? 518 LEU B CD2 1 
ATOM   3046 N  N   . LYS B 1 192 ? 39.266  -55.584 1.973   1.00 60.68  ? 519 LYS B N   1 
ATOM   3047 C  CA  . LYS B 1 192 ? 40.065  -54.886 2.974   1.00 64.76  ? 519 LYS B CA  1 
ATOM   3048 C  C   . LYS B 1 192 ? 39.226  -54.205 4.058   1.00 65.30  ? 519 LYS B C   1 
ATOM   3049 O  O   . LYS B 1 192 ? 39.616  -54.228 5.219   1.00 67.32  ? 519 LYS B O   1 
ATOM   3050 C  CB  . LYS B 1 192 ? 40.994  -53.871 2.314   1.00 66.53  ? 519 LYS B CB  1 
ATOM   3051 C  CG  . LYS B 1 192 ? 42.212  -54.499 1.680   1.00 69.44  ? 519 LYS B CG  1 
ATOM   3052 C  CD  . LYS B 1 192 ? 42.722  -53.599 0.585   1.00 70.21  ? 519 LYS B CD  1 
ATOM   3053 C  CE  . LYS B 1 192 ? 43.726  -54.370 -0.240  1.00 72.10  ? 519 LYS B CE  1 
ATOM   3054 N  NZ  . LYS B 1 192 ? 44.586  -53.384 -0.931  1.00 74.89  ? 519 LYS B NZ  1 
ATOM   3055 N  N   . GLU B 1 193 ? 38.086  -53.598 3.680   1.00 62.37  ? 520 GLU B N   1 
ATOM   3056 C  CA  . GLU B 1 193 ? 37.186  -52.960 4.638   1.00 62.44  ? 520 GLU B CA  1 
ATOM   3057 C  C   . GLU B 1 193 ? 35.757  -53.548 4.621   1.00 59.96  ? 520 GLU B C   1 
ATOM   3058 O  O   . GLU B 1 193 ? 34.797  -52.835 4.240   1.00 58.43  ? 520 GLU B O   1 
ATOM   3059 C  CB  . GLU B 1 193 ? 37.180  -51.447 4.435   1.00 63.35  ? 520 GLU B CB  1 
ATOM   3060 C  CG  . GLU B 1 193 ? 38.390  -50.893 5.192   1.00 69.78  ? 520 GLU B CG  1 
ATOM   3061 C  CD  . GLU B 1 193 ? 38.856  -49.551 4.713   1.00 71.15  ? 520 GLU B CD  1 
ATOM   3062 O  OE1 . GLU B 1 193 ? 40.074  -49.292 4.817   1.00 74.24  ? 520 GLU B OE1 1 
ATOM   3063 O  OE2 . GLU B 1 193 ? 37.991  -48.770 4.247   1.00 71.89  ? 520 GLU B OE2 1 
ATOM   3064 N  N   . PRO B 1 194 ? 35.600  -54.831 5.047   1.00 59.67  ? 521 PRO B N   1 
ATOM   3065 C  CA  . PRO B 1 194 ? 34.272  -55.446 4.960   1.00 56.76  ? 521 PRO B CA  1 
ATOM   3066 C  C   . PRO B 1 194 ? 33.214  -54.768 5.835   1.00 56.70  ? 521 PRO B C   1 
ATOM   3067 O  O   . PRO B 1 194 ? 32.052  -54.717 5.429   1.00 55.09  ? 521 PRO B O   1 
ATOM   3068 C  CB  . PRO B 1 194 ? 34.516  -56.892 5.383   1.00 58.64  ? 521 PRO B CB  1 
ATOM   3069 C  CG  . PRO B 1 194 ? 35.756  -56.845 6.236   1.00 62.47  ? 521 PRO B CG  1 
ATOM   3070 C  CD  . PRO B 1 194 ? 36.597  -55.776 5.610   1.00 62.22  ? 521 PRO B CD  1 
ATOM   3071 N  N   . LYS B 1 195 ? 33.611  -54.204 6.977   1.00 58.63  ? 522 LYS B N   1 
ATOM   3072 C  CA  . LYS B 1 195 ? 32.667  -53.492 7.855   1.00 59.10  ? 522 LYS B CA  1 
ATOM   3073 C  C   . LYS B 1 195 ? 32.069  -52.244 7.219   1.00 56.41  ? 522 LYS B C   1 
ATOM   3074 O  O   . LYS B 1 195 ? 30.885  -51.941 7.407   1.00 54.73  ? 522 LYS B O   1 
ATOM   3075 C  CB  . LYS B 1 195 ? 33.291  -53.168 9.218   1.00 62.82  ? 522 LYS B CB  1 
ATOM   3076 C  CG  . LYS B 1 195 ? 33.478  -54.406 10.088  1.00 66.15  ? 522 LYS B CG  1 
ATOM   3077 C  CD  . LYS B 1 195 ? 33.408  -54.077 11.578  1.00 70.36  ? 522 LYS B CD  1 
ATOM   3078 C  CE  . LYS B 1 195 ? 33.453  -55.335 12.439  1.00 73.55  ? 522 LYS B CE  1 
ATOM   3079 N  NZ  . LYS B 1 195 ? 33.481  -55.052 13.906  1.00 78.35  ? 522 LYS B NZ  1 
ATOM   3080 N  N   . ARG B 1 196 ? 32.893  -51.534 6.462   1.00 56.40  ? 523 ARG B N   1 
ATOM   3081 C  CA  . ARG B 1 196 ? 32.452  -50.339 5.736   1.00 54.49  ? 523 ARG B CA  1 
ATOM   3082 C  C   . ARG B 1 196 ? 31.466  -50.710 4.602   1.00 49.94  ? 523 ARG B C   1 
ATOM   3083 O  O   . ARG B 1 196 ? 30.421  -50.080 4.431   1.00 47.83  ? 523 ARG B O   1 
ATOM   3084 C  CB  . ARG B 1 196 ? 33.670  -49.595 5.208   1.00 57.51  ? 523 ARG B CB  1 
ATOM   3085 C  CG  . ARG B 1 196 ? 33.361  -48.151 4.865   1.00 58.93  ? 523 ARG B CG  1 
ATOM   3086 C  CD  . ARG B 1 196 ? 34.327  -47.548 3.867   1.00 60.32  ? 523 ARG B CD  1 
ATOM   3087 N  NE  . ARG B 1 196 ? 35.561  -47.065 4.456   1.00 64.43  ? 523 ARG B NE  1 
ATOM   3088 C  CZ  . ARG B 1 196 ? 35.820  -45.785 4.704   1.00 66.56  ? 523 ARG B CZ  1 
ATOM   3089 N  NH1 . ARG B 1 196 ? 34.944  -44.816 4.397   1.00 64.47  ? 523 ARG B NH1 1 
ATOM   3090 N  NH2 . ARG B 1 196 ? 36.990  -45.469 5.242   1.00 69.87  ? 523 ARG B NH2 1 
ATOM   3091 N  N   . VAL B 1 197 ? 31.780  -51.751 3.849   1.00 47.45  ? 524 VAL B N   1 
ATOM   3092 C  CA  . VAL B 1 197 ? 30.838  -52.259 2.852   1.00 44.42  ? 524 VAL B CA  1 
ATOM   3093 C  C   . VAL B 1 197 ? 29.505  -52.631 3.536   1.00 44.52  ? 524 VAL B C   1 
ATOM   3094 O  O   . VAL B 1 197 ? 28.445  -52.244 3.066   1.00 42.13  ? 524 VAL B O   1 
ATOM   3095 C  CB  . VAL B 1 197 ? 31.441  -53.453 2.071   1.00 42.68  ? 524 VAL B CB  1 
ATOM   3096 C  CG1 . VAL B 1 197 ? 30.417  -54.160 1.190   1.00 39.07  ? 524 VAL B CG1 1 
ATOM   3097 C  CG2 . VAL B 1 197 ? 32.643  -52.994 1.272   1.00 42.80  ? 524 VAL B CG2 1 
ATOM   3098 N  N   . GLU B 1 198 ? 29.586  -53.327 4.669   1.00 47.53  ? 525 GLU B N   1 
ATOM   3099 C  CA  . GLU B 1 198 ? 28.403  -53.752 5.387   1.00 48.73  ? 525 GLU B CA  1 
ATOM   3100 C  C   . GLU B 1 198 ? 27.585  -52.587 5.909   1.00 47.79  ? 525 GLU B C   1 
ATOM   3101 O  O   . GLU B 1 198 ? 26.358  -52.656 5.881   1.00 45.71  ? 525 GLU B O   1 
ATOM   3102 C  CB  . GLU B 1 198 ? 28.749  -54.722 6.536   1.00 54.01  ? 525 GLU B CB  1 
ATOM   3103 C  CG  . GLU B 1 198 ? 27.792  -55.925 6.669   1.00 56.93  ? 525 GLU B CG  1 
ATOM   3104 C  CD  . GLU B 1 198 ? 26.376  -55.555 7.133   1.00 58.77  ? 525 GLU B CD  1 
ATOM   3105 O  OE1 . GLU B 1 198 ? 25.401  -56.002 6.441   1.00 59.17  ? 525 GLU B OE1 1 
ATOM   3106 O  OE2 . GLU B 1 198 ? 26.246  -54.798 8.145   1.00 58.82  ? 525 GLU B OE2 1 
ATOM   3107 N  N   . GLU B 1 199 ? 28.243  -51.535 6.400   1.00 49.34  ? 526 GLU B N   1 
ATOM   3108 C  CA  . GLU B 1 199 ? 27.516  -50.343 6.820   1.00 49.72  ? 526 GLU B CA  1 
ATOM   3109 C  C   . GLU B 1 199 ? 26.788  -49.664 5.647   1.00 45.50  ? 526 GLU B C   1 
ATOM   3110 O  O   . GLU B 1 199 ? 25.639  -49.204 5.791   1.00 43.50  ? 526 GLU B O   1 
ATOM   3111 C  CB  . GLU B 1 199 ? 28.429  -49.333 7.517   1.00 54.86  ? 526 GLU B CB  1 
ATOM   3112 C  CG  . GLU B 1 199 ? 27.641  -48.304 8.322   1.00 60.18  ? 526 GLU B CG  1 
ATOM   3113 C  CD  . GLU B 1 199 ? 28.280  -46.915 8.362   1.00 64.07  ? 526 GLU B CD  1 
ATOM   3114 O  OE1 . GLU B 1 199 ? 29.270  -46.710 9.110   1.00 66.07  ? 526 GLU B OE1 1 
ATOM   3115 O  OE2 . GLU B 1 199 ? 27.752  -46.030 7.639   1.00 65.45  ? 526 GLU B OE2 1 
ATOM   3116 N  N   . LEU B 1 200 ? 27.470  -49.585 4.499   1.00 42.37  ? 527 LEU B N   1 
ATOM   3117 C  CA  . LEU B 1 200 ? 26.870  -48.938 3.369   1.00 39.60  ? 527 LEU B CA  1 
ATOM   3118 C  C   . LEU B 1 200 ? 25.672  -49.815 2.896   1.00 38.32  ? 527 LEU B C   1 
ATOM   3119 O  O   . LEU B 1 200 ? 24.609  -49.287 2.560   1.00 35.99  ? 527 LEU B O   1 
ATOM   3120 C  CB  . LEU B 1 200 ? 27.891  -48.665 2.261   1.00 38.66  ? 527 LEU B CB  1 
ATOM   3121 C  CG  . LEU B 1 200 ? 27.319  -48.017 0.970   1.00 37.59  ? 527 LEU B CG  1 
ATOM   3122 C  CD1 . LEU B 1 200 ? 26.536  -46.704 1.220   1.00 36.90  ? 527 LEU B CD1 1 
ATOM   3123 C  CD2 . LEU B 1 200 ? 28.342  -47.866 -0.149  1.00 36.18  ? 527 LEU B CD2 1 
ATOM   3124 N  N   . GLN B 1 201 ? 25.857  -51.142 2.903   1.00 38.20  ? 528 GLN B N   1 
ATOM   3125 C  CA  . GLN B 1 201 ? 24.773  -52.077 2.592   1.00 38.22  ? 528 GLN B CA  1 
ATOM   3126 C  C   . GLN B 1 201 ? 23.552  -51.772 3.461   1.00 38.55  ? 528 GLN B C   1 
ATOM   3127 O  O   . GLN B 1 201 ? 22.448  -51.547 2.944   1.00 36.56  ? 528 GLN B O   1 
ATOM   3128 C  CB  . GLN B 1 201 ? 25.217  -53.525 2.839   1.00 39.40  ? 528 GLN B CB  1 
ATOM   3129 C  CG  . GLN B 1 201 ? 24.271  -54.609 2.313   1.00 39.92  ? 528 GLN B CG  1 
ATOM   3130 C  CD  . GLN B 1 201 ? 24.730  -56.006 2.727   1.00 41.46  ? 528 GLN B CD  1 
ATOM   3131 O  OE1 . GLN B 1 201 ? 24.917  -56.269 3.892   1.00 45.48  ? 528 GLN B OE1 1 
ATOM   3132 N  NE2 . GLN B 1 201 ? 24.939  -56.876 1.764   1.00 40.95  ? 528 GLN B NE2 1 
ATOM   3133 N  N   . ASN B 1 202 ? 23.771  -51.744 4.770   1.00 39.96  ? 529 ASN B N   1 
ATOM   3134 C  CA  . ASN B 1 202 ? 22.706  -51.491 5.712   1.00 42.55  ? 529 ASN B CA  1 
ATOM   3135 C  C   . ASN B 1 202 ? 22.009  -50.113 5.518   1.00 41.67  ? 529 ASN B C   1 
ATOM   3136 O  O   . ASN B 1 202 ? 20.795  -50.005 5.673   1.00 41.81  ? 529 ASN B O   1 
ATOM   3137 C  CB  . ASN B 1 202 ? 23.232  -51.646 7.133   1.00 46.84  ? 529 ASN B CB  1 
ATOM   3138 C  CG  . ASN B 1 202 ? 22.128  -51.691 8.129   1.00 49.59  ? 529 ASN B CG  1 
ATOM   3139 O  OD1 . ASN B 1 202 ? 21.390  -52.674 8.192   1.00 50.60  ? 529 ASN B OD1 1 
ATOM   3140 N  ND2 . ASN B 1 202 ? 21.984  -50.620 8.901   1.00 51.32  ? 529 ASN B ND2 1 
ATOM   3141 N  N   . LYS B 1 203 ? 22.776  -49.080 5.174   1.00 40.72  ? 530 LYS B N   1 
ATOM   3142 C  CA  . LYS B 1 203 ? 22.188  -47.772 4.872   1.00 40.80  ? 530 LYS B CA  1 
ATOM   3143 C  C   . LYS B 1 203 ? 21.234  -47.882 3.671   1.00 37.27  ? 530 LYS B C   1 
ATOM   3144 O  O   . LYS B 1 203 ? 20.130  -47.365 3.677   1.00 37.02  ? 530 LYS B O   1 
ATOM   3145 C  CB  . LYS B 1 203 ? 23.269  -46.750 4.580   1.00 41.64  ? 530 LYS B CB  1 
ATOM   3146 C  CG  . LYS B 1 203 ? 23.775  -45.923 5.751   1.00 45.67  ? 530 LYS B CG  1 
ATOM   3147 C  CD  . LYS B 1 203 ? 25.235  -45.564 5.480   1.00 47.34  ? 530 LYS B CD  1 
ATOM   3148 C  CE  . LYS B 1 203 ? 25.600  -44.122 5.783   1.00 49.97  ? 530 LYS B CE  1 
ATOM   3149 N  NZ  . LYS B 1 203 ? 25.975  -43.950 7.199   1.00 54.45  ? 530 LYS B NZ  1 
ATOM   3150 N  N   . ILE B 1 204 ? 21.674  -48.594 2.652   1.00 36.14  ? 531 ILE B N   1 
ATOM   3151 C  CA  . ILE B 1 204 ? 20.856  -48.799 1.440   1.00 34.67  ? 531 ILE B CA  1 
ATOM   3152 C  C   . ILE B 1 204 ? 19.588  -49.621 1.744   1.00 35.31  ? 531 ILE B C   1 
ATOM   3153 O  O   . ILE B 1 204 ? 18.499  -49.277 1.258   1.00 34.22  ? 531 ILE B O   1 
ATOM   3154 C  CB  . ILE B 1 204 ? 21.692  -49.388 0.272   1.00 33.19  ? 531 ILE B CB  1 
ATOM   3155 C  CG1 . ILE B 1 204 ? 22.899  -48.454 -0.026  1.00 32.72  ? 531 ILE B CG1 1 
ATOM   3156 C  CG2 . ILE B 1 204 ? 20.817  -49.526 -0.962  1.00 31.18  ? 531 ILE B CG2 1 
ATOM   3157 C  CD1 . ILE B 1 204 ? 23.986  -49.080 -0.872  1.00 31.21  ? 531 ILE B CD1 1 
ATOM   3158 N  N   . VAL B 1 205 ? 19.731  -50.678 2.571   1.00 36.63  ? 532 VAL B N   1 
ATOM   3159 C  CA  . VAL B 1 205 ? 18.595  -51.512 2.992   1.00 37.66  ? 532 VAL B CA  1 
ATOM   3160 C  C   . VAL B 1 205 ? 17.534  -50.613 3.657   1.00 38.79  ? 532 VAL B C   1 
ATOM   3161 O  O   . VAL B 1 205 ? 16.343  -50.701 3.328   1.00 38.98  ? 532 VAL B O   1 
ATOM   3162 C  CB  . VAL B 1 205 ? 19.034  -52.702 3.899   1.00 39.67  ? 532 VAL B CB  1 
ATOM   3163 C  CG1 . VAL B 1 205 ? 17.855  -53.349 4.615   1.00 41.35  ? 532 VAL B CG1 1 
ATOM   3164 C  CG2 . VAL B 1 205 ? 19.775  -53.768 3.100   1.00 38.57  ? 532 VAL B CG2 1 
ATOM   3165 N  N   . ASN B 1 206 ? 17.989  -49.727 4.536   1.00 39.72  ? 533 ASN B N   1 
ATOM   3166 C  CA  . ASN B 1 206 ? 17.126  -48.820 5.264   1.00 42.14  ? 533 ASN B CA  1 
ATOM   3167 C  C   . ASN B 1 206 ? 16.397  -47.780 4.414   1.00 41.25  ? 533 ASN B C   1 
ATOM   3168 O  O   . ASN B 1 206 ? 15.258  -47.476 4.713   1.00 41.95  ? 533 ASN B O   1 
ATOM   3169 C  CB  . ASN B 1 206 ? 17.920  -48.171 6.399   1.00 44.64  ? 533 ASN B CB  1 
ATOM   3170 C  CG  . ASN B 1 206 ? 18.423  -49.201 7.392   1.00 47.98  ? 533 ASN B CG  1 
ATOM   3171 O  OD1 . ASN B 1 206 ? 17.687  -50.112 7.709   1.00 50.41  ? 533 ASN B OD1 1 
ATOM   3172 N  ND2 . ASN B 1 206 ? 19.696  -49.130 7.785   1.00 49.12  ? 533 ASN B ND2 1 
ATOM   3173 N  N   . CYS B 1 207 ? 17.064  -47.241 3.382   1.00 39.90  ? 534 CYS B N   1 
ATOM   3174 C  CA  . CYS B 1 207 ? 16.443  -46.413 2.360   1.00 39.93  ? 534 CYS B CA  1 
ATOM   3175 C  C   . CYS B 1 207 ? 15.297  -47.120 1.735   1.00 39.26  ? 534 CYS B C   1 
ATOM   3176 O  O   . CYS B 1 207 ? 14.223  -46.550 1.577   1.00 39.55  ? 534 CYS B O   1 
ATOM   3177 C  CB  . CYS B 1 207 ? 17.391  -46.203 1.189   1.00 39.60  ? 534 CYS B CB  1 
ATOM   3178 S  SG  . CYS B 1 207 ? 18.630  -45.000 1.574   1.00 43.42  ? 534 CYS B SG  1 
ATOM   3179 N  N   . LEU B 1 208 ? 15.579  -48.348 1.299   1.00 38.56  ? 535 LEU B N   1 
ATOM   3180 C  CA  . LEU B 1 208 ? 14.603  -49.177 0.606   1.00 37.93  ? 535 LEU B CA  1 
ATOM   3181 C  C   . LEU B 1 208 ? 13.384  -49.413 1.506   1.00 39.96  ? 535 LEU B C   1 
ATOM   3182 O  O   . LEU B 1 208 ? 12.245  -49.181 1.063   1.00 39.65  ? 535 LEU B O   1 
ATOM   3183 C  CB  . LEU B 1 208 ? 15.237  -50.495 0.152   1.00 35.70  ? 535 LEU B CB  1 
ATOM   3184 C  CG  . LEU B 1 208 ? 14.361  -51.561 -0.529  1.00 35.81  ? 535 LEU B CG  1 
ATOM   3185 C  CD1 . LEU B 1 208 ? 13.610  -51.026 -1.756  1.00 34.15  ? 535 LEU B CD1 1 
ATOM   3186 C  CD2 . LEU B 1 208 ? 15.189  -52.783 -0.860  1.00 33.91  ? 535 LEU B CD2 1 
ATOM   3187 N  N   . LYS B 1 209 ? 13.652  -49.834 2.758   1.00 40.90  ? 536 LYS B N   1 
ATOM   3188 C  CA  . LYS B 1 209 ? 12.611  -50.101 3.755   1.00 43.42  ? 536 LYS B CA  1 
ATOM   3189 C  C   . LYS B 1 209 ? 11.713  -48.876 3.967   1.00 43.88  ? 536 LYS B C   1 
ATOM   3190 O  O   . LYS B 1 209 ? 10.479  -49.001 3.918   1.00 44.13  ? 536 LYS B O   1 
ATOM   3191 C  CB  . LYS B 1 209 ? 13.202  -50.514 5.096   1.00 44.89  ? 536 LYS B CB  1 
ATOM   3192 C  CG  . LYS B 1 209 ? 13.778  -51.913 5.152   1.00 46.11  ? 536 LYS B CG  1 
ATOM   3193 C  CD  . LYS B 1 209 ? 13.964  -52.334 6.624   1.00 49.53  ? 536 LYS B CD  1 
ATOM   3194 C  CE  . LYS B 1 209 ? 14.701  -53.658 6.736   1.00 50.67  ? 536 LYS B CE  1 
ATOM   3195 N  NZ  . LYS B 1 209 ? 14.765  -54.083 8.172   1.00 54.45  ? 536 LYS B NZ  1 
ATOM   3196 N  N   . ASP B 1 210 ? 12.337  -47.712 4.192   1.00 43.49  ? 537 ASP B N   1 
ATOM   3197 C  CA  . ASP B 1 210 ? 11.597  -46.476 4.452   1.00 45.29  ? 537 ASP B CA  1 
ATOM   3198 C  C   . ASP B 1 210 ? 10.814  -46.084 3.209   1.00 43.60  ? 537 ASP B C   1 
ATOM   3199 O  O   . ASP B 1 210 ? 9.676   -45.668 3.320   1.00 43.95  ? 537 ASP B O   1 
ATOM   3200 C  CB  . ASP B 1 210 ? 12.529  -45.337 4.834   1.00 46.67  ? 537 ASP B CB  1 
ATOM   3201 C  CG  . ASP B 1 210 ? 13.147  -45.511 6.193   1.00 50.33  ? 537 ASP B CG  1 
ATOM   3202 O  OD1 . ASP B 1 210 ? 12.597  -46.226 7.075   1.00 54.02  ? 537 ASP B OD1 1 
ATOM   3203 O  OD2 . ASP B 1 210 ? 14.218  -44.904 6.377   1.00 51.28  ? 537 ASP B OD2 1 
ATOM   3204 N  N   . HIS B 1 211 ? 11.429  -46.257 2.033   1.00 41.26  ? 538 HIS B N   1 
ATOM   3205 C  CA  . HIS B 1 211 ? 10.747  -45.987 0.799   1.00 40.93  ? 538 HIS B CA  1 
ATOM   3206 C  C   . HIS B 1 211 ? 9.466   -46.837 0.625   1.00 41.74  ? 538 HIS B C   1 
ATOM   3207 O  O   . HIS B 1 211 ? 8.381   -46.293 0.373   1.00 42.42  ? 538 HIS B O   1 
ATOM   3208 C  CB  . HIS B 1 211 ? 11.647  -46.123 -0.422  1.00 39.07  ? 538 HIS B CB  1 
ATOM   3209 C  CG  . HIS B 1 211 ? 10.949  -45.714 -1.669  1.00 39.50  ? 538 HIS B CG  1 
ATOM   3210 N  ND1 . HIS B 1 211 ? 10.361  -46.631 -2.518  1.00 40.35  ? 538 HIS B ND1 1 
ATOM   3211 C  CD2 . HIS B 1 211 ? 10.612  -44.488 -2.140  1.00 39.54  ? 538 HIS B CD2 1 
ATOM   3212 C  CE1 . HIS B 1 211 ? 9.790   -45.990 -3.518  1.00 39.77  ? 538 HIS B CE1 1 
ATOM   3213 N  NE2 . HIS B 1 211 ? 9.913   -44.691 -3.304  1.00 39.99  ? 538 HIS B NE2 1 
ATOM   3214 N  N   . VAL B 1 212 ? 9.599   -48.152 0.776   1.00 41.03  ? 539 VAL B N   1 
ATOM   3215 C  CA  . VAL B 1 212 ? 8.453   -49.077 0.666   1.00 42.49  ? 539 VAL B CA  1 
ATOM   3216 C  C   . VAL B 1 212 ? 7.315   -48.711 1.648   1.00 45.57  ? 539 VAL B C   1 
ATOM   3217 O  O   . VAL B 1 212 ? 6.138   -48.624 1.246   1.00 47.54  ? 539 VAL B O   1 
ATOM   3218 C  CB  . VAL B 1 212 ? 8.896   -50.559 0.798   1.00 42.14  ? 539 VAL B CB  1 
ATOM   3219 C  CG1 . VAL B 1 212 ? 7.689   -51.503 0.929   1.00 43.88  ? 539 VAL B CG1 1 
ATOM   3220 C  CG2 . VAL B 1 212 ? 9.770   -50.956 -0.382  1.00 39.03  ? 539 VAL B CG2 1 
ATOM   3221 N  N   . THR B 1 213 ? 7.680   -48.463 2.906   1.00 46.81  ? 540 THR B N   1 
ATOM   3222 C  CA  . THR B 1 213 ? 6.740   -48.052 3.946   1.00 50.62  ? 540 THR B CA  1 
ATOM   3223 C  C   . THR B 1 213 ? 6.047   -46.706 3.639   1.00 51.83  ? 540 THR B C   1 
ATOM   3224 O  O   . THR B 1 213 ? 4.825   -46.616 3.729   1.00 52.90  ? 540 THR B O   1 
ATOM   3225 C  CB  . THR B 1 213 ? 7.433   -47.993 5.322   1.00 51.09  ? 540 THR B CB  1 
ATOM   3226 O  OG1 . THR B 1 213 ? 8.043   -49.263 5.580   1.00 50.97  ? 540 THR B OG1 1 
ATOM   3227 C  CG2 . THR B 1 213 ? 6.433   -47.650 6.417   1.00 53.38  ? 540 THR B CG2 1 
ATOM   3228 N  N   . PHE B 1 214 ? 6.833   -45.690 3.264   1.00 51.92  ? 541 PHE B N   1 
ATOM   3229 C  CA  . PHE B 1 214 ? 6.293   -44.391 2.836   1.00 53.75  ? 541 PHE B CA  1 
ATOM   3230 C  C   . PHE B 1 214 ? 5.281   -44.538 1.702   1.00 54.21  ? 541 PHE B C   1 
ATOM   3231 O  O   . PHE B 1 214 ? 4.209   -43.942 1.771   1.00 56.27  ? 541 PHE B O   1 
ATOM   3232 C  CB  . PHE B 1 214 ? 7.406   -43.409 2.421   1.00 52.66  ? 541 PHE B CB  1 
ATOM   3233 C  CG  . PHE B 1 214 ? 6.884   -42.133 1.796   1.00 53.66  ? 541 PHE B CG  1 
ATOM   3234 C  CD1 . PHE B 1 214 ? 6.581   -41.017 2.586   1.00 55.89  ? 541 PHE B CD1 1 
ATOM   3235 C  CD2 . PHE B 1 214 ? 6.665   -42.053 0.401   1.00 53.42  ? 541 PHE B CD2 1 
ATOM   3236 C  CE1 . PHE B 1 214 ? 6.082   -39.848 2.009   1.00 56.44  ? 541 PHE B CE1 1 
ATOM   3237 C  CE2 . PHE B 1 214 ? 6.157   -40.887 -0.183  1.00 53.99  ? 541 PHE B CE2 1 
ATOM   3238 C  CZ  . PHE B 1 214 ? 5.867   -39.778 0.627   1.00 55.72  ? 541 PHE B CZ  1 
ATOM   3239 N  N   . ASN B 1 215 ? 5.626   -45.306 0.663   1.00 54.12  ? 542 ASN B N   1 
ATOM   3240 C  CA  . ASN B 1 215 ? 4.718   -45.540 -0.467  1.00 56.25  ? 542 ASN B CA  1 
ATOM   3241 C  C   . ASN B 1 215 ? 3.480   -46.351 -0.103  1.00 58.45  ? 542 ASN B C   1 
ATOM   3242 O  O   . ASN B 1 215 ? 2.521   -46.395 -0.879  1.00 60.13  ? 542 ASN B O   1 
ATOM   3243 C  CB  . ASN B 1 215 ? 5.428   -46.250 -1.619  1.00 55.53  ? 542 ASN B CB  1 
ATOM   3244 C  CG  . ASN B 1 215 ? 6.248   -45.327 -2.465  1.00 56.58  ? 542 ASN B CG  1 
ATOM   3245 O  OD1 . ASN B 1 215 ? 6.890   -45.788 -3.408  1.00 56.20  ? 542 ASN B OD1 1 
ATOM   3246 N  ND2 . ASN B 1 215 ? 6.263   -44.031 -2.155  1.00 58.49  ? 542 ASN B ND2 1 
ATOM   3247 N  N   . ASN B 1 216 ? 3.501   -46.990 1.060   1.00 58.92  ? 543 ASN B N   1 
ATOM   3248 C  CA  . ASN B 1 216 ? 2.345   -47.702 1.522   1.00 61.39  ? 543 ASN B CA  1 
ATOM   3249 C  C   . ASN B 1 216 ? 1.617   -46.919 2.616   1.00 63.42  ? 543 ASN B C   1 
ATOM   3250 O  O   . ASN B 1 216 ? 0.927   -47.487 3.479   1.00 66.31  ? 543 ASN B O   1 
ATOM   3251 C  CB  . ASN B 1 216 ? 2.752   -49.085 1.987   1.00 61.72  ? 543 ASN B CB  1 
ATOM   3252 C  CG  . ASN B 1 216 ? 1.609   -50.065 1.912   1.00 64.28  ? 543 ASN B CG  1 
ATOM   3253 O  OD1 . ASN B 1 216 ? 1.016   -50.259 0.856   1.00 64.59  ? 543 ASN B OD1 1 
ATOM   3254 N  ND2 . ASN B 1 216 ? 1.296   -50.687 3.027   1.00 66.65  ? 543 ASN B ND2 1 
ATOM   3255 N  N   . GLY B 1 217 ? 1.794   -45.601 2.573   1.00 62.52  ? 544 GLY B N   1 
ATOM   3256 C  CA  . GLY B 1 217 ? 1.098   -44.679 3.462   1.00 64.73  ? 544 GLY B CA  1 
ATOM   3257 C  C   . GLY B 1 217 ? 1.462   -44.848 4.922   1.00 66.00  ? 544 GLY B C   1 
ATOM   3258 O  O   . GLY B 1 217 ? 0.647   -44.561 5.793   1.00 68.75  ? 544 GLY B O   1 
ATOM   3259 N  N   . GLY B 1 218 ? 2.676   -45.315 5.199   1.00 64.47  ? 545 GLY B N   1 
ATOM   3260 C  CA  . GLY B 1 218 ? 3.141   -45.434 6.574   1.00 66.07  ? 545 GLY B CA  1 
ATOM   3261 C  C   . GLY B 1 218 ? 3.026   -46.808 7.212   1.00 67.91  ? 545 GLY B C   1 
ATOM   3262 O  O   . GLY B 1 218 ? 3.447   -46.980 8.347   1.00 69.12  ? 545 GLY B O   1 
ATOM   3263 N  N   . LEU B 1 219 ? 2.439   -47.773 6.509   1.00 68.45  ? 546 LEU B N   1 
ATOM   3264 C  CA  . LEU B 1 219 ? 2.421   -49.174 6.943   1.00 70.96  ? 546 LEU B CA  1 
ATOM   3265 C  C   . LEU B 1 219 ? 3.507   -50.001 6.269   1.00 69.28  ? 546 LEU B C   1 
ATOM   3266 O  O   . LEU B 1 219 ? 3.811   -49.814 5.091   1.00 67.83  ? 546 LEU B O   1 
ATOM   3267 C  CB  . LEU B 1 219 ? 1.069   -49.821 6.638   1.00 73.57  ? 546 LEU B CB  1 
ATOM   3268 C  CG  . LEU B 1 219 ? -0.012  -50.075 7.692   1.00 79.37  ? 546 LEU B CG  1 
ATOM   3269 C  CD1 . LEU B 1 219 ? -1.379  -49.687 7.125   1.00 81.22  ? 546 LEU B CD1 1 
ATOM   3270 C  CD2 . LEU B 1 219 ? -0.018  -51.523 8.206   1.00 80.65  ? 546 LEU B CD2 1 
ATOM   3271 N  N   . ASN B 1 220 ? 4.082   -50.929 7.022   1.00 70.96  ? 547 ASN B N   1 
ATOM   3272 C  CA  . ASN B 1 220 ? 5.138   -51.800 6.510   1.00 68.94  ? 547 ASN B CA  1 
ATOM   3273 C  C   . ASN B 1 220 ? 4.611   -52.808 5.510   1.00 68.32  ? 547 ASN B C   1 
ATOM   3274 O  O   . ASN B 1 220 ? 3.426   -53.158 5.532   1.00 71.18  ? 547 ASN B O   1 
ATOM   3275 C  CB  . ASN B 1 220 ? 5.843   -52.507 7.665   1.00 72.18  ? 547 ASN B CB  1 
ATOM   3276 C  CG  . ASN B 1 220 ? 6.638   -51.543 8.518   1.00 72.63  ? 547 ASN B CG  1 
ATOM   3277 O  OD1 . ASN B 1 220 ? 7.241   -50.596 8.008   1.00 71.40  ? 547 ASN B OD1 1 
ATOM   3278 N  ND2 . ASN B 1 220 ? 6.637   -51.760 9.810   1.00 74.57  ? 547 ASN B ND2 1 
ATOM   3279 N  N   . ARG B 1 221 ? 5.491   -53.244 4.621   1.00 64.44  ? 548 ARG B N   1 
ATOM   3280 C  CA  . ARG B 1 221 ? 5.206   -54.375 3.747   1.00 64.69  ? 548 ARG B CA  1 
ATOM   3281 C  C   . ARG B 1 221 ? 6.370   -55.389 3.829   1.00 63.08  ? 548 ARG B C   1 
ATOM   3282 O  O   . ARG B 1 221 ? 7.131   -55.555 2.859   1.00 59.15  ? 548 ARG B O   1 
ATOM   3283 C  CB  . ARG B 1 221 ? 4.962   -53.923 2.307   1.00 62.82  ? 548 ARG B CB  1 
ATOM   3284 C  CG  . ARG B 1 221 ? 3.808   -52.962 2.107   1.00 64.38  ? 548 ARG B CG  1 
ATOM   3285 C  CD  . ARG B 1 221 ? 3.902   -52.360 0.712   1.00 63.21  ? 548 ARG B CD  1 
ATOM   3286 N  NE  . ARG B 1 221 ? 3.404   -53.280 -0.313  1.00 64.34  ? 548 ARG B NE  1 
ATOM   3287 C  CZ  . ARG B 1 221 ? 3.592   -53.146 -1.626  1.00 63.83  ? 548 ARG B CZ  1 
ATOM   3288 N  NH1 . ARG B 1 221 ? 4.289   -52.126 -2.128  1.00 60.80  ? 548 ARG B NH1 1 
ATOM   3289 N  NH2 . ARG B 1 221 ? 3.079   -54.060 -2.444  1.00 65.10  ? 548 ARG B NH2 1 
ATOM   3290 N  N   . PRO B 1 222 ? 6.510   -56.062 5.006   1.00 65.07  ? 549 PRO B N   1 
ATOM   3291 C  CA  . PRO B 1 222 ? 7.701   -56.893 5.266   1.00 63.66  ? 549 PRO B CA  1 
ATOM   3292 C  C   . PRO B 1 222 ? 7.819   -58.093 4.340   1.00 62.40  ? 549 PRO B C   1 
ATOM   3293 O  O   . PRO B 1 222 ? 8.934   -58.433 3.957   1.00 59.46  ? 549 PRO B O   1 
ATOM   3294 C  CB  . PRO B 1 222 ? 7.526   -57.337 6.725   1.00 68.25  ? 549 PRO B CB  1 
ATOM   3295 C  CG  . PRO B 1 222 ? 6.504   -56.416 7.314   1.00 69.92  ? 549 PRO B CG  1 
ATOM   3296 C  CD  . PRO B 1 222 ? 5.596   -56.055 6.169   1.00 68.49  ? 549 PRO B CD  1 
ATOM   3297 N  N   . ASN B 1 223 ? 6.688   -58.692 3.970   1.00 64.70  ? 550 ASN B N   1 
ATOM   3298 C  CA  . ASN B 1 223 ? 6.634   -59.755 2.976   1.00 64.34  ? 550 ASN B CA  1 
ATOM   3299 C  C   . ASN B 1 223 ? 6.980   -59.257 1.580   1.00 60.49  ? 550 ASN B C   1 
ATOM   3300 O  O   . ASN B 1 223 ? 7.676   -59.959 0.833   1.00 59.62  ? 550 ASN B O   1 
ATOM   3301 C  CB  . ASN B 1 223 ? 5.259   -60.435 2.939   1.00 69.20  ? 550 ASN B CB  1 
ATOM   3302 C  CG  . ASN B 1 223 ? 5.078   -61.472 4.045   1.00 75.67  ? 550 ASN B CG  1 
ATOM   3303 O  OD1 . ASN B 1 223 ? 4.983   -62.679 3.768   1.00 79.44  ? 550 ASN B OD1 1 
ATOM   3304 N  ND2 . ASN B 1 223 ? 5.026   -61.011 5.306   1.00 76.69  ? 550 ASN B ND2 1 
ATOM   3305 N  N   . TYR B 1 224 ? 6.506   -58.057 1.222   1.00 58.55  ? 551 TYR B N   1 
ATOM   3306 C  CA  . TYR B 1 224 ? 6.864   -57.479 -0.084  1.00 55.42  ? 551 TYR B CA  1 
ATOM   3307 C  C   . TYR B 1 224 ? 8.380   -57.213 -0.158  1.00 51.80  ? 551 TYR B C   1 
ATOM   3308 O  O   . TYR B 1 224 ? 9.036   -57.551 -1.165  1.00 49.40  ? 551 TYR B O   1 
ATOM   3309 C  CB  . TYR B 1 224 ? 6.055   -56.213 -0.409  1.00 54.63  ? 551 TYR B CB  1 
ATOM   3310 C  CG  . TYR B 1 224 ? 6.473   -55.560 -1.718  1.00 52.09  ? 551 TYR B CG  1 
ATOM   3311 C  CD1 . TYR B 1 224 ? 6.085   -56.092 -2.964  1.00 51.80  ? 551 TYR B CD1 1 
ATOM   3312 C  CD2 . TYR B 1 224 ? 7.272   -54.422 -1.717  1.00 49.37  ? 551 TYR B CD2 1 
ATOM   3313 C  CE1 . TYR B 1 224 ? 6.471   -55.480 -4.149  1.00 48.91  ? 551 TYR B CE1 1 
ATOM   3314 C  CE2 . TYR B 1 224 ? 7.669   -53.818 -2.896  1.00 47.07  ? 551 TYR B CE2 1 
ATOM   3315 C  CZ  . TYR B 1 224 ? 7.270   -54.339 -4.099  1.00 46.40  ? 551 TYR B CZ  1 
ATOM   3316 O  OH  . TYR B 1 224 ? 7.686   -53.747 -5.282  1.00 44.86  ? 551 TYR B OH  1 
ATOM   3317 N  N   . LEU B 1 225 ? 8.918   -56.614 0.910   1.00 52.14  ? 552 LEU B N   1 
ATOM   3318 C  CA  . LEU B 1 225 ? 10.341  -56.348 0.989   1.00 50.89  ? 552 LEU B CA  1 
ATOM   3319 C  C   . LEU B 1 225 ? 11.154  -57.657 0.873   1.00 51.35  ? 552 LEU B C   1 
ATOM   3320 O  O   . LEU B 1 225 ? 12.154  -57.707 0.139   1.00 48.51  ? 552 LEU B O   1 
ATOM   3321 C  CB  . LEU B 1 225 ? 10.666  -55.588 2.277   1.00 51.60  ? 552 LEU B CB  1 
ATOM   3322 C  CG  . LEU B 1 225 ? 12.143  -55.205 2.437   1.00 50.60  ? 552 LEU B CG  1 
ATOM   3323 C  CD1 . LEU B 1 225 ? 12.440  -53.875 1.770   1.00 48.07  ? 552 LEU B CD1 1 
ATOM   3324 C  CD2 . LEU B 1 225 ? 12.531  -55.177 3.909   1.00 51.82  ? 552 LEU B CD2 1 
ATOM   3325 N  N   . SER B 1 226 ? 10.689  -58.718 1.553   1.00 54.25  ? 553 SER B N   1 
ATOM   3326 C  CA  . SER B 1 226 ? 11.331  -60.023 1.468   1.00 55.37  ? 553 SER B CA  1 
ATOM   3327 C  C   . SER B 1 226 ? 11.357  -60.554 0.050   1.00 53.40  ? 553 SER B C   1 
ATOM   3328 O  O   . SER B 1 226 ? 12.393  -61.046 -0.403  1.00 52.87  ? 553 SER B O   1 
ATOM   3329 C  CB  . SER B 1 226 ? 10.644  -61.034 2.372   1.00 61.02  ? 553 SER B CB  1 
ATOM   3330 O  OG  . SER B 1 226 ? 11.281  -62.302 2.295   1.00 64.82  ? 553 SER B OG  1 
ATOM   3331 N  N   . LYS B 1 227 ? 10.235  -60.450 -0.656  1.00 53.90  ? 554 LYS B N   1 
ATOM   3332 C  CA  . LYS B 1 227 ? 10.165  -60.998 -2.000  1.00 54.31  ? 554 LYS B CA  1 
ATOM   3333 C  C   . LYS B 1 227 ? 11.081  -60.220 -2.946  1.00 51.28  ? 554 LYS B C   1 
ATOM   3334 O  O   . LYS B 1 227 ? 11.783  -60.812 -3.796  1.00 50.28  ? 554 LYS B O   1 
ATOM   3335 C  CB  . LYS B 1 227 ? 8.735   -61.026 -2.494  1.00 59.23  ? 554 LYS B CB  1 
ATOM   3336 C  CG  . LYS B 1 227 ? 8.524   -62.062 -3.584  1.00 63.21  ? 554 LYS B CG  1 
ATOM   3337 C  CD  . LYS B 1 227 ? 7.036   -62.300 -3.872  1.00 68.46  ? 554 LYS B CD  1 
ATOM   3338 C  CE  . LYS B 1 227 ? 6.866   -63.416 -4.907  1.00 71.45  ? 554 LYS B CE  1 
ATOM   3339 N  NZ  . LYS B 1 227 ? 7.764   -63.288 -6.111  1.00 68.33  ? 554 LYS B NZ  1 
ATOM   3340 N  N   . LEU B 1 228 ? 11.116  -58.907 -2.724  1.00 48.84  ? 555 LEU B N   1 
ATOM   3341 C  CA  . LEU B 1 228 ? 11.972  -57.991 -3.435  1.00 45.91  ? 555 LEU B CA  1 
ATOM   3342 C  C   . LEU B 1 228 ? 13.475  -58.339 -3.291  1.00 43.32  ? 555 LEU B C   1 
ATOM   3343 O  O   . LEU B 1 228 ? 14.200  -58.486 -4.308  1.00 40.95  ? 555 LEU B O   1 
ATOM   3344 C  CB  . LEU B 1 228 ? 11.677  -56.579 -2.921  1.00 47.25  ? 555 LEU B CB  1 
ATOM   3345 C  CG  . LEU B 1 228 ? 12.042  -55.374 -3.766  1.00 47.37  ? 555 LEU B CG  1 
ATOM   3346 C  CD1 . LEU B 1 228 ? 11.532  -55.559 -5.185  1.00 46.16  ? 555 LEU B CD1 1 
ATOM   3347 C  CD2 . LEU B 1 228 ? 11.428  -54.136 -3.152  1.00 48.19  ? 555 LEU B CD2 1 
ATOM   3348 N  N   . LEU B 1 229 ? 13.931  -58.465 -2.044  1.00 42.50  ? 556 LEU B N   1 
ATOM   3349 C  CA  . LEU B 1 229 ? 15.318  -58.825 -1.770  1.00 41.72  ? 556 LEU B CA  1 
ATOM   3350 C  C   . LEU B 1 229 ? 15.629  -60.246 -2.201  1.00 42.74  ? 556 LEU B C   1 
ATOM   3351 O  O   . LEU B 1 229 ? 16.788  -60.528 -2.542  1.00 41.68  ? 556 LEU B O   1 
ATOM   3352 C  CB  . LEU B 1 229 ? 15.671  -58.624 -0.289  1.00 43.15  ? 556 LEU B CB  1 
ATOM   3353 C  CG  . LEU B 1 229 ? 15.566  -57.193 0.230   1.00 41.59  ? 556 LEU B CG  1 
ATOM   3354 C  CD1 . LEU B 1 229 ? 15.659  -57.212 1.746   1.00 43.14  ? 556 LEU B CD1 1 
ATOM   3355 C  CD2 . LEU B 1 229 ? 16.621  -56.298 -0.393  1.00 39.21  ? 556 LEU B CD2 1 
ATOM   3356 N  N   . GLY B 1 230 ? 14.604  -61.120 -2.207  1.00 44.41  ? 557 GLY B N   1 
ATOM   3357 C  CA  . GLY B 1 230 ? 14.725  -62.482 -2.773  1.00 44.23  ? 557 GLY B CA  1 
ATOM   3358 C  C   . GLY B 1 230 ? 15.091  -62.581 -4.254  1.00 42.90  ? 557 GLY B C   1 
ATOM   3359 O  O   . GLY B 1 230 ? 15.591  -63.623 -4.713  1.00 43.38  ? 557 GLY B O   1 
ATOM   3360 N  N   . LYS B 1 231 ? 14.872  -61.509 -5.007  1.00 41.79  ? 558 LYS B N   1 
ATOM   3361 C  CA  . LYS B 1 231 ? 15.348  -61.463 -6.395  1.00 41.33  ? 558 LYS B CA  1 
ATOM   3362 C  C   . LYS B 1 231 ? 16.877  -61.432 -6.521  1.00 40.46  ? 558 LYS B C   1 
ATOM   3363 O  O   . LYS B 1 231 ? 17.428  -61.874 -7.535  1.00 42.72  ? 558 LYS B O   1 
ATOM   3364 C  CB  . LYS B 1 231 ? 14.726  -60.288 -7.169  1.00 41.45  ? 558 LYS B CB  1 
ATOM   3365 C  CG  . LYS B 1 231 ? 13.221  -60.463 -7.428  1.00 43.54  ? 558 LYS B CG  1 
ATOM   3366 C  CD  . LYS B 1 231 ? 12.930  -61.439 -8.568  1.00 44.60  ? 558 LYS B CD  1 
ATOM   3367 C  CE  . LYS B 1 231 ? 11.445  -61.793 -8.619  1.00 47.27  ? 558 LYS B CE  1 
ATOM   3368 N  NZ  . LYS B 1 231 ? 10.783  -62.233 -7.354  1.00 50.63  ? 558 LYS B NZ  1 
ATOM   3369 N  N   . LEU B 1 232 ? 17.562  -60.909 -5.505  1.00 39.70  ? 559 LEU B N   1 
ATOM   3370 C  CA  . LEU B 1 232 ? 19.032  -60.821 -5.523  1.00 37.93  ? 559 LEU B CA  1 
ATOM   3371 C  C   . LEU B 1 232 ? 19.783  -62.176 -5.618  1.00 38.97  ? 559 LEU B C   1 
ATOM   3372 O  O   . LEU B 1 232 ? 20.629  -62.295 -6.509  1.00 38.05  ? 559 LEU B O   1 
ATOM   3373 C  CB  . LEU B 1 232 ? 19.545  -59.987 -4.345  1.00 37.86  ? 559 LEU B CB  1 
ATOM   3374 C  CG  . LEU B 1 232 ? 19.475  -58.470 -4.463  1.00 38.73  ? 559 LEU B CG  1 
ATOM   3375 C  CD1 . LEU B 1 232 ? 18.182  -57.965 -5.046  1.00 39.60  ? 559 LEU B CD1 1 
ATOM   3376 C  CD2 . LEU B 1 232 ? 19.704  -57.848 -3.084  1.00 40.54  ? 559 LEU B CD2 1 
ATOM   3377 N  N   . PRO B 1 233 ? 19.477  -63.191 -4.732  1.00 39.48  ? 560 PRO B N   1 
ATOM   3378 C  CA  . PRO B 1 233 ? 20.154  -64.498 -4.857  1.00 40.30  ? 560 PRO B CA  1 
ATOM   3379 C  C   . PRO B 1 233 ? 19.962  -65.154 -6.227  1.00 39.98  ? 560 PRO B C   1 
ATOM   3380 O  O   . PRO B 1 233 ? 20.897  -65.781 -6.716  1.00 41.31  ? 560 PRO B O   1 
ATOM   3381 C  CB  . PRO B 1 233 ? 19.469  -65.361 -3.782  1.00 42.22  ? 560 PRO B CB  1 
ATOM   3382 C  CG  . PRO B 1 233 ? 18.949  -64.401 -2.785  1.00 42.00  ? 560 PRO B CG  1 
ATOM   3383 C  CD  . PRO B 1 233 ? 18.580  -63.166 -3.553  1.00 40.64  ? 560 PRO B CD  1 
ATOM   3384 N  N   . GLU B 1 234 ? 18.785  -64.982 -6.841  1.00 40.00  ? 561 GLU B N   1 
ATOM   3385 C  CA  . GLU B 1 234 ? 18.494  -65.452 -8.197  1.00 40.36  ? 561 GLU B CA  1 
ATOM   3386 C  C   . GLU B 1 234 ? 19.451  -64.877 -9.277  1.00 38.14  ? 561 GLU B C   1 
ATOM   3387 O  O   . GLU B 1 234 ? 19.723  -65.525 -10.278 1.00 36.45  ? 561 GLU B O   1 
ATOM   3388 C  CB  . GLU B 1 234 ? 17.010  -65.173 -8.531  1.00 42.91  ? 561 GLU B CB  1 
ATOM   3389 C  CG  . GLU B 1 234 ? 16.036  -65.840 -7.524  1.00 48.89  ? 561 GLU B CG  1 
ATOM   3390 C  CD  . GLU B 1 234 ? 14.541  -65.577 -7.785  1.00 52.55  ? 561 GLU B CD  1 
ATOM   3391 O  OE1 . GLU B 1 234 ? 13.704  -66.135 -7.004  1.00 57.40  ? 561 GLU B OE1 1 
ATOM   3392 O  OE2 . GLU B 1 234 ? 14.186  -64.806 -8.717  1.00 49.15  ? 561 GLU B OE2 1 
ATOM   3393 N  N   . LEU B 1 235 ? 19.966  -63.668 -9.058  1.00 37.55  ? 562 LEU B N   1 
ATOM   3394 C  CA  . LEU B 1 235 ? 20.973  -63.102 -9.950  1.00 35.34  ? 562 LEU B CA  1 
ATOM   3395 C  C   . LEU B 1 235 ? 22.256  -63.917 -10.002 1.00 35.94  ? 562 LEU B C   1 
ATOM   3396 O  O   . LEU B 1 235 ? 22.948  -63.884 -11.029 1.00 34.24  ? 562 LEU B O   1 
ATOM   3397 C  CB  . LEU B 1 235 ? 21.341  -61.658 -9.587  1.00 33.63  ? 562 LEU B CB  1 
ATOM   3398 C  CG  . LEU B 1 235 ? 20.313  -60.561 -9.791  1.00 33.02  ? 562 LEU B CG  1 
ATOM   3399 C  CD1 . LEU B 1 235 ? 20.883  -59.255 -9.249  1.00 31.34  ? 562 LEU B CD1 1 
ATOM   3400 C  CD2 . LEU B 1 235 ? 19.980  -60.416 -11.249 1.00 32.53  ? 562 LEU B CD2 1 
ATOM   3401 N  N   . ARG B 1 236 ? 22.589  -64.621 -8.925  1.00 36.43  ? 563 ARG B N   1 
ATOM   3402 C  CA  . ARG B 1 236 ? 23.821  -65.418 -8.942  1.00 37.45  ? 563 ARG B CA  1 
ATOM   3403 C  C   . ARG B 1 236 ? 23.800  -66.518 -10.037 1.00 36.44  ? 563 ARG B C   1 
ATOM   3404 O  O   . ARG B 1 236 ? 24.769  -66.664 -10.812 1.00 34.34  ? 563 ARG B O   1 
ATOM   3405 C  CB  . ARG B 1 236 ? 24.131  -66.032 -7.565  1.00 42.29  ? 563 ARG B CB  1 
ATOM   3406 C  CG  . ARG B 1 236 ? 25.608  -66.371 -7.444  1.00 45.19  ? 563 ARG B CG  1 
ATOM   3407 C  CD  . ARG B 1 236 ? 25.942  -67.488 -6.468  1.00 53.02  ? 563 ARG B CD  1 
ATOM   3408 N  NE  . ARG B 1 236 ? 27.333  -67.885 -6.734  1.00 59.88  ? 563 ARG B NE  1 
ATOM   3409 C  CZ  . ARG B 1 236 ? 27.727  -69.066 -7.227  1.00 63.76  ? 563 ARG B CZ  1 
ATOM   3410 N  NH1 . ARG B 1 236 ? 26.841  -70.043 -7.456  1.00 66.17  ? 563 ARG B NH1 1 
ATOM   3411 N  NH2 . ARG B 1 236 ? 29.023  -69.274 -7.468  1.00 64.21  ? 563 ARG B NH2 1 
ATOM   3412 N  N   . THR B 1 237 ? 22.683  -67.251 -10.088 1.00 35.02  ? 564 THR B N   1 
ATOM   3413 C  CA  . THR B 1 237 ? 22.456  -68.266 -11.105 1.00 35.55  ? 564 THR B CA  1 
ATOM   3414 C  C   . THR B 1 237 ? 22.509  -67.688 -12.509 1.00 32.77  ? 564 THR B C   1 
ATOM   3415 O  O   . THR B 1 237 ? 23.159  -68.280 -13.383 1.00 32.55  ? 564 THR B O   1 
ATOM   3416 C  CB  . THR B 1 237 ? 21.092  -68.936 -10.916 1.00 38.13  ? 564 THR B CB  1 
ATOM   3417 O  OG1 . THR B 1 237 ? 20.980  -69.259 -9.530  1.00 42.93  ? 564 THR B OG1 1 
ATOM   3418 C  CG2 . THR B 1 237 ? 21.004  -70.218 -11.745 1.00 39.31  ? 564 THR B CG2 1 
ATOM   3419 N  N   . LEU B 1 238 ? 21.855  -66.539 -12.707 1.00 30.15  ? 565 LEU B N   1 
ATOM   3420 C  CA  . LEU B 1 238 ? 21.887  -65.852 -14.000 1.00 29.95  ? 565 LEU B CA  1 
ATOM   3421 C  C   . LEU B 1 238 ? 23.298  -65.459 -14.420 1.00 28.92  ? 565 LEU B C   1 
ATOM   3422 O  O   . LEU B 1 238 ? 23.644  -65.490 -15.627 1.00 29.06  ? 565 LEU B O   1 
ATOM   3423 C  CB  . LEU B 1 238 ? 20.921  -64.635 -14.041 1.00 29.14  ? 565 LEU B CB  1 
ATOM   3424 C  CG  . LEU B 1 238 ? 19.459  -65.163 -13.953 1.00 31.25  ? 565 LEU B CG  1 
ATOM   3425 C  CD1 . LEU B 1 238 ? 18.529  -64.136 -13.312 1.00 31.78  ? 565 LEU B CD1 1 
ATOM   3426 C  CD2 . LEU B 1 238 ? 18.923  -65.586 -15.301 1.00 31.42  ? 565 LEU B CD2 1 
ATOM   3427 N  N   . CYS B 1 239 ? 24.119  -65.101 -13.427 1.00 28.85  ? 566 CYS B N   1 
ATOM   3428 C  CA  . CYS B 1 239 ? 25.498  -64.748 -13.653 1.00 28.39  ? 566 CYS B CA  1 
ATOM   3429 C  C   . CYS B 1 239 ? 26.295  -65.959 -14.129 1.00 29.32  ? 566 CYS B C   1 
ATOM   3430 O  O   . CYS B 1 239 ? 26.983  -65.886 -15.146 1.00 28.45  ? 566 CYS B O   1 
ATOM   3431 C  CB  . CYS B 1 239 ? 26.118  -64.116 -12.391 1.00 29.56  ? 566 CYS B CB  1 
ATOM   3432 S  SG  . CYS B 1 239 ? 27.899  -63.901 -12.508 1.00 32.52  ? 566 CYS B SG  1 
ATOM   3433 N  N   . THR B 1 240 ? 26.153  -67.065 -13.414 1.00 29.90  ? 567 THR B N   1 
ATOM   3434 C  CA  . THR B 1 240 ? 26.800  -68.325 -13.769 1.00 32.01  ? 567 THR B CA  1 
ATOM   3435 C  C   . THR B 1 240 ? 26.425  -68.760 -15.193 1.00 31.67  ? 567 THR B C   1 
ATOM   3436 O  O   . THR B 1 240 ? 27.317  -69.229 -15.930 1.00 31.57  ? 567 THR B O   1 
ATOM   3437 C  CB  . THR B 1 240 ? 26.450  -69.429 -12.734 1.00 34.29  ? 567 THR B CB  1 
ATOM   3438 O  OG1 . THR B 1 240 ? 26.815  -68.936 -11.444 1.00 36.17  ? 567 THR B OG1 1 
ATOM   3439 C  CG2 . THR B 1 240 ? 27.237  -70.673 -12.947 1.00 36.94  ? 567 THR B CG2 1 
ATOM   3440 N  N   . GLN B 1 241 ? 25.153  -68.579 -15.576 1.00 31.43  ? 568 GLN B N   1 
ATOM   3441 C  CA  . GLN B 1 241 ? 24.764  -68.942 -16.941 1.00 33.13  ? 568 GLN B CA  1 
ATOM   3442 C  C   . GLN B 1 241 ? 25.453  -68.077 -17.981 1.00 30.77  ? 568 GLN B C   1 
ATOM   3443 O  O   . GLN B 1 241 ? 25.866  -68.603 -19.023 1.00 31.12  ? 568 GLN B O   1 
ATOM   3444 C  CB  . GLN B 1 241 ? 23.269  -68.928 -17.187 1.00 33.37  ? 568 GLN B CB  1 
ATOM   3445 C  CG  . GLN B 1 241 ? 22.462  -69.751 -16.239 1.00 37.41  ? 568 GLN B CG  1 
ATOM   3446 C  CD  . GLN B 1 241 ? 20.957  -69.555 -16.442 1.00 39.86  ? 568 GLN B CD  1 
ATOM   3447 O  OE1 . GLN B 1 241 ? 20.184  -69.896 -15.562 1.00 44.72  ? 568 GLN B OE1 1 
ATOM   3448 N  NE2 . GLN B 1 241 ? 20.549  -69.041 -17.588 1.00 40.27  ? 568 GLN B NE2 1 
ATOM   3449 N  N   . GLY B 1 242 ? 25.646  -66.796 -17.655 1.00 30.03  ? 569 GLY B N   1 
ATOM   3450 C  CA  . GLY B 1 242 ? 26.414  -65.914 -18.516 1.00 28.60  ? 569 GLY B CA  1 
ATOM   3451 C  C   . GLY B 1 242 ? 27.882  -66.268 -18.610 1.00 29.05  ? 569 GLY B C   1 
ATOM   3452 O  O   . GLY B 1 242 ? 28.476  -66.237 -19.698 1.00 30.54  ? 569 GLY B O   1 
ATOM   3453 N  N   . LEU B 1 243 ? 28.477  -66.579 -17.474 1.00 28.28  ? 570 LEU B N   1 
ATOM   3454 C  CA  . LEU B 1 243 ? 29.874  -67.007 -17.416 1.00 29.69  ? 570 LEU B CA  1 
ATOM   3455 C  C   . LEU B 1 243 ? 30.108  -68.282 -18.234 1.00 29.59  ? 570 LEU B C   1 
ATOM   3456 O  O   . LEU B 1 243 ? 31.083  -68.367 -18.950 1.00 29.34  ? 570 LEU B O   1 
ATOM   3457 C  CB  . LEU B 1 243 ? 30.268  -67.230 -15.952 1.00 31.87  ? 570 LEU B CB  1 
ATOM   3458 C  CG  . LEU B 1 243 ? 31.682  -66.840 -15.546 1.00 35.43  ? 570 LEU B CG  1 
ATOM   3459 C  CD1 . LEU B 1 243 ? 32.065  -65.450 -16.034 1.00 34.66  ? 570 LEU B CD1 1 
ATOM   3460 C  CD2 . LEU B 1 243 ? 31.852  -66.974 -14.035 1.00 36.34  ? 570 LEU B CD2 1 
ATOM   3461 N  N   . GLN B 1 244 ? 29.190  -69.244 -18.143 1.00 30.25  ? 571 GLN B N   1 
ATOM   3462 C  CA  . GLN B 1 244 ? 29.258  -70.457 -18.973 1.00 32.09  ? 571 GLN B CA  1 
ATOM   3463 C  C   . GLN B 1 244 ? 29.287  -70.172 -20.487 1.00 31.70  ? 571 GLN B C   1 
ATOM   3464 O  O   . GLN B 1 244 ? 30.012  -70.827 -21.239 1.00 32.22  ? 571 GLN B O   1 
ATOM   3465 C  CB  . GLN B 1 244 ? 28.183  -71.469 -18.548 1.00 33.26  ? 571 GLN B CB  1 
ATOM   3466 C  CG  . GLN B 1 244 ? 26.987  -71.657 -19.453 1.00 33.73  ? 571 GLN B CG  1 
ATOM   3467 C  CD  . GLN B 1 244 ? 26.111  -72.771 -19.019 1.00 35.91  ? 571 GLN B CD  1 
ATOM   3468 O  OE1 . GLN B 1 244 ? 26.583  -73.862 -18.631 1.00 37.71  ? 571 GLN B OE1 1 
ATOM   3469 N  NE2 . GLN B 1 244 ? 24.820  -72.546 -19.128 1.00 35.66  ? 571 GLN B NE2 1 
ATOM   3470 N  N   . ARG B 1 245 ? 28.505  -69.189 -20.917 1.00 30.71  ? 572 ARG B N   1 
ATOM   3471 C  CA  . ARG B 1 245 ? 28.495  -68.789 -22.344 1.00 31.24  ? 572 ARG B CA  1 
ATOM   3472 C  C   . ARG B 1 245 ? 29.860  -68.205 -22.773 1.00 30.32  ? 572 ARG B C   1 
ATOM   3473 O  O   . ARG B 1 245 ? 30.413  -68.573 -23.819 1.00 31.73  ? 572 ARG B O   1 
ATOM   3474 C  CB  . ARG B 1 245 ? 27.358  -67.785 -22.577 1.00 30.92  ? 572 ARG B CB  1 
ATOM   3475 C  CG  . ARG B 1 245 ? 27.336  -67.146 -23.944 1.00 31.55  ? 572 ARG B CG  1 
ATOM   3476 C  CD  . ARG B 1 245 ? 26.882  -68.193 -24.934 1.00 34.28  ? 572 ARG B CD  1 
ATOM   3477 N  NE  . ARG B 1 245 ? 26.701  -67.684 -26.289 1.00 36.36  ? 572 ARG B NE  1 
ATOM   3478 C  CZ  . ARG B 1 245 ? 26.861  -68.414 -27.392 1.00 38.72  ? 572 ARG B CZ  1 
ATOM   3479 N  NH1 . ARG B 1 245 ? 27.248  -69.665 -27.299 1.00 39.69  ? 572 ARG B NH1 1 
ATOM   3480 N  NH2 . ARG B 1 245 ? 26.723  -67.870 -28.598 1.00 40.33  ? 572 ARG B NH2 1 
ATOM   3481 N  N   . ILE B 1 246 ? 30.414  -67.320 -21.950 1.00 28.67  ? 573 ILE B N   1 
ATOM   3482 C  CA  . ILE B 1 246 ? 31.723  -66.753 -22.219 1.00 28.51  ? 573 ILE B CA  1 
ATOM   3483 C  C   . ILE B 1 246 ? 32.794  -67.848 -22.243 1.00 28.86  ? 573 ILE B C   1 
ATOM   3484 O  O   . ILE B 1 246 ? 33.669  -67.844 -23.143 1.00 29.46  ? 573 ILE B O   1 
ATOM   3485 C  CB  . ILE B 1 246 ? 32.091  -65.654 -21.178 1.00 28.44  ? 573 ILE B CB  1 
ATOM   3486 C  CG1 . ILE B 1 246 ? 31.116  -64.497 -21.341 1.00 29.49  ? 573 ILE B CG1 1 
ATOM   3487 C  CG2 . ILE B 1 246 ? 33.566  -65.223 -21.324 1.00 28.10  ? 573 ILE B CG2 1 
ATOM   3488 C  CD1 . ILE B 1 246 ? 30.975  -63.602 -20.141 1.00 31.61  ? 573 ILE B CD1 1 
ATOM   3489 N  N   . PHE B 1 247 ? 32.732  -68.750 -21.242 1.00 27.43  ? 574 PHE B N   1 
ATOM   3490 C  CA  . PHE B 1 247 ? 33.602  -69.922 -21.166 1.00 28.29  ? 574 PHE B CA  1 
ATOM   3491 C  C   . PHE B 1 247 ? 33.544  -70.713 -22.468 1.00 28.79  ? 574 PHE B C   1 
ATOM   3492 O  O   . PHE B 1 247 ? 34.583  -71.062 -23.027 1.00 30.03  ? 574 PHE B O   1 
ATOM   3493 C  CB  . PHE B 1 247 ? 33.180  -70.848 -19.970 1.00 28.27  ? 574 PHE B CB  1 
ATOM   3494 C  CG  . PHE B 1 247 ? 33.962  -72.142 -19.880 1.00 29.68  ? 574 PHE B CG  1 
ATOM   3495 C  CD1 . PHE B 1 247 ? 35.196  -72.177 -19.230 1.00 30.47  ? 574 PHE B CD1 1 
ATOM   3496 C  CD2 . PHE B 1 247 ? 33.477  -73.337 -20.451 1.00 30.62  ? 574 PHE B CD2 1 
ATOM   3497 C  CE1 . PHE B 1 247 ? 35.929  -73.378 -19.126 1.00 32.31  ? 574 PHE B CE1 1 
ATOM   3498 C  CE2 . PHE B 1 247 ? 34.194  -74.532 -20.353 1.00 32.12  ? 574 PHE B CE2 1 
ATOM   3499 C  CZ  . PHE B 1 247 ? 35.434  -74.552 -19.706 1.00 33.08  ? 574 PHE B CZ  1 
ATOM   3500 N  N   . TYR B 1 248 ? 32.335  -71.023 -22.918 1.00 28.52  ? 575 TYR B N   1 
ATOM   3501 C  CA  . TYR B 1 248 ? 32.141  -71.775 -24.139 1.00 30.32  ? 575 TYR B CA  1 
ATOM   3502 C  C   . TYR B 1 248 ? 32.812  -71.057 -25.333 1.00 31.14  ? 575 TYR B C   1 
ATOM   3503 O  O   . TYR B 1 248 ? 33.629  -71.678 -26.057 1.00 31.56  ? 575 TYR B O   1 
ATOM   3504 C  CB  . TYR B 1 248 ? 30.654  -72.031 -24.430 1.00 30.61  ? 575 TYR B CB  1 
ATOM   3505 C  CG  . TYR B 1 248 ? 30.484  -72.731 -25.754 1.00 32.80  ? 575 TYR B CG  1 
ATOM   3506 C  CD1 . TYR B 1 248 ? 30.642  -74.122 -25.852 1.00 34.53  ? 575 TYR B CD1 1 
ATOM   3507 C  CD2 . TYR B 1 248 ? 30.264  -71.989 -26.948 1.00 33.41  ? 575 TYR B CD2 1 
ATOM   3508 C  CE1 . TYR B 1 248 ? 30.587  -74.760 -27.062 1.00 36.83  ? 575 TYR B CE1 1 
ATOM   3509 C  CE2 . TYR B 1 248 ? 30.210  -72.629 -28.184 1.00 35.64  ? 575 TYR B CE2 1 
ATOM   3510 C  CZ  . TYR B 1 248 ? 30.347  -74.015 -28.223 1.00 37.41  ? 575 TYR B CZ  1 
ATOM   3511 O  OH  . TYR B 1 248 ? 30.317  -74.692 -29.417 1.00 40.67  ? 575 TYR B OH  1 
ATOM   3512 N  N   . LEU B 1 249 ? 32.466  -69.771 -25.518 1.00 30.83  ? 576 LEU B N   1 
ATOM   3513 C  CA  . LEU B 1 249 ? 32.994  -68.996 -26.649 1.00 32.53  ? 576 LEU B CA  1 
ATOM   3514 C  C   . LEU B 1 249 ? 34.508  -68.919 -26.634 1.00 33.96  ? 576 LEU B C   1 
ATOM   3515 O  O   . LEU B 1 249 ? 35.169  -69.091 -27.692 1.00 36.19  ? 576 LEU B O   1 
ATOM   3516 C  CB  . LEU B 1 249 ? 32.377  -67.593 -26.704 1.00 31.59  ? 576 LEU B CB  1 
ATOM   3517 C  CG  . LEU B 1 249 ? 30.883  -67.595 -26.983 1.00 31.42  ? 576 LEU B CG  1 
ATOM   3518 C  CD1 . LEU B 1 249 ? 30.247  -66.236 -26.688 1.00 30.72  ? 576 LEU B CD1 1 
ATOM   3519 C  CD2 . LEU B 1 249 ? 30.563  -68.100 -28.405 1.00 33.81  ? 576 LEU B CD2 1 
ATOM   3520 N  N   . LYS B 1 250 ? 35.063  -68.707 -25.436 1.00 34.40  ? 577 LYS B N   1 
ATOM   3521 C  CA  . LYS B 1 250 ? 36.532  -68.689 -25.278 1.00 36.51  ? 577 LYS B CA  1 
ATOM   3522 C  C   . LYS B 1 250 ? 37.208  -70.007 -25.644 1.00 38.18  ? 577 LYS B C   1 
ATOM   3523 O  O   . LYS B 1 250 ? 38.228  -70.043 -26.356 1.00 38.81  ? 577 LYS B O   1 
ATOM   3524 C  CB  . LYS B 1 250 ? 36.921  -68.217 -23.860 1.00 36.90  ? 577 LYS B CB  1 
ATOM   3525 C  CG  . LYS B 1 250 ? 38.400  -68.159 -23.565 1.00 38.33  ? 577 LYS B CG  1 
ATOM   3526 C  CD  . LYS B 1 250 ? 38.660  -67.466 -22.233 1.00 38.96  ? 577 LYS B CD  1 
ATOM   3527 C  CE  . LYS B 1 250 ? 40.152  -67.330 -22.029 1.00 40.19  ? 577 LYS B CE  1 
ATOM   3528 N  NZ  . LYS B 1 250 ? 40.636  -66.396 -23.074 1.00 40.51  ? 577 LYS B NZ  1 
ATOM   3529 N  N   . LEU B 1 251 ? 36.625  -71.104 -25.170 1.00 38.86  ? 578 LEU B N   1 
ATOM   3530 C  CA  . LEU B 1 251 ? 37.162  -72.397 -25.494 1.00 40.54  ? 578 LEU B CA  1 
ATOM   3531 C  C   . LEU B 1 251 ? 36.949  -72.778 -26.943 1.00 41.10  ? 578 LEU B C   1 
ATOM   3532 O  O   . LEU B 1 251 ? 37.823  -73.373 -27.560 1.00 42.60  ? 578 LEU B O   1 
ATOM   3533 C  CB  . LEU B 1 251 ? 36.631  -73.450 -24.525 1.00 42.35  ? 578 LEU B CB  1 
ATOM   3534 C  CG  . LEU B 1 251 ? 37.804  -73.618 -23.535 1.00 43.87  ? 578 LEU B CG  1 
ATOM   3535 C  CD1 . LEU B 1 251 ? 37.617  -72.692 -22.304 1.00 43.82  ? 578 LEU B CD1 1 
ATOM   3536 C  CD2 . LEU B 1 251 ? 38.059  -75.042 -23.131 1.00 45.70  ? 578 LEU B CD2 1 
ATOM   3537 N  N   . GLU B 1 252 ? 35.822  -72.393 -27.514 1.00 40.60  ? 579 GLU B N   1 
ATOM   3538 C  CA  . GLU B 1 252 ? 35.574  -72.678 -28.921 1.00 42.59  ? 579 GLU B CA  1 
ATOM   3539 C  C   . GLU B 1 252 ? 36.598  -71.946 -29.774 1.00 44.02  ? 579 GLU B C   1 
ATOM   3540 O  O   . GLU B 1 252 ? 37.157  -72.529 -30.731 1.00 44.88  ? 579 GLU B O   1 
ATOM   3541 C  CB  . GLU B 1 252 ? 34.157  -72.286 -29.293 1.00 41.30  ? 579 GLU B CB  1 
ATOM   3542 C  CG  . GLU B 1 252 ? 33.836  -72.453 -30.763 1.00 42.94  ? 579 GLU B CG  1 
ATOM   3543 C  CD  . GLU B 1 252 ? 32.407  -72.074 -31.061 1.00 42.44  ? 579 GLU B CD  1 
ATOM   3544 O  OE1 . GLU B 1 252 ? 31.671  -72.996 -31.538 1.00 43.79  ? 579 GLU B OE1 1 
ATOM   3545 O  OE2 . GLU B 1 252 ? 32.026  -70.877 -30.805 1.00 40.61  ? 579 GLU B OE2 1 
ATOM   3546 N  N   . ASP B 1 253 ? 36.881  -70.689 -29.410 1.00 43.39  ? 580 ASP B N   1 
ATOM   3547 C  CA  . ASP B 1 253 ? 37.994  -69.967 -29.998 1.00 44.87  ? 580 ASP B CA  1 
ATOM   3548 C  C   . ASP B 1 253 ? 37.809  -69.668 -31.491 1.00 46.79  ? 580 ASP B C   1 
ATOM   3549 O  O   . ASP B 1 253 ? 38.789  -69.593 -32.238 1.00 49.09  ? 580 ASP B O   1 
ATOM   3550 C  CB  . ASP B 1 253 ? 39.297  -70.753 -29.771 1.00 47.22  ? 580 ASP B CB  1 
ATOM   3551 C  CG  . ASP B 1 253 ? 40.532  -69.884 -29.984 1.00 48.91  ? 580 ASP B CG  1 
ATOM   3552 O  OD1 . ASP B 1 253 ? 40.445  -68.649 -29.772 1.00 48.27  ? 580 ASP B OD1 1 
ATOM   3553 O  OD2 . ASP B 1 253 ? 41.569  -70.421 -30.349 1.00 50.81  ? 580 ASP B OD2 1 
ATOM   3554 N  N   . LEU B 1 254 ? 36.560  -69.581 -31.927 1.00 46.64  ? 581 LEU B N   1 
ATOM   3555 C  CA  . LEU B 1 254 ? 36.253  -69.209 -33.284 1.00 48.10  ? 581 LEU B CA  1 
ATOM   3556 C  C   . LEU B 1 254 ? 35.978  -67.706 -33.332 1.00 47.17  ? 581 LEU B C   1 
ATOM   3557 O  O   . LEU B 1 254 ? 36.413  -67.031 -34.258 1.00 48.49  ? 581 LEU B O   1 
ATOM   3558 C  CB  . LEU B 1 254 ? 35.087  -70.067 -33.860 1.00 48.95  ? 581 LEU B CB  1 
ATOM   3559 C  CG  . LEU B 1 254 ? 35.410  -71.507 -34.351 1.00 50.59  ? 581 LEU B CG  1 
ATOM   3560 C  CD1 . LEU B 1 254 ? 34.164  -72.357 -34.589 1.00 50.69  ? 581 LEU B CD1 1 
ATOM   3561 C  CD2 . LEU B 1 254 ? 36.307  -71.546 -35.588 1.00 53.29  ? 581 LEU B CD2 1 
ATOM   3562 N  N   . VAL B 1 255 ? 35.286  -67.172 -32.330 1.00 45.50  ? 582 VAL B N   1 
ATOM   3563 C  CA  . VAL B 1 255 ? 35.146  -65.703 -32.115 1.00 44.67  ? 582 VAL B CA  1 
ATOM   3564 C  C   . VAL B 1 255 ? 35.579  -65.316 -30.683 1.00 42.87  ? 582 VAL B C   1 
ATOM   3565 O  O   . VAL B 1 255 ? 34.761  -65.269 -29.771 1.00 40.66  ? 582 VAL B O   1 
ATOM   3566 C  CB  . VAL B 1 255 ? 33.703  -65.175 -32.369 1.00 44.75  ? 582 VAL B CB  1 
ATOM   3567 C  CG1 . VAL B 1 255 ? 33.709  -63.656 -32.619 1.00 43.37  ? 582 VAL B CG1 1 
ATOM   3568 C  CG2 . VAL B 1 255 ? 33.023  -65.889 -33.537 1.00 46.14  ? 582 VAL B CG2 1 
ATOM   3569 N  N   . PRO B 1 256 ? 36.878  -65.080 -30.484 1.00 44.41  ? 583 PRO B N   1 
ATOM   3570 C  CA  . PRO B 1 256 ? 37.457  -64.957 -29.141 1.00 43.55  ? 583 PRO B CA  1 
ATOM   3571 C  C   . PRO B 1 256 ? 36.987  -63.677 -28.451 1.00 42.02  ? 583 PRO B C   1 
ATOM   3572 O  O   . PRO B 1 256 ? 36.716  -62.709 -29.130 1.00 44.59  ? 583 PRO B O   1 
ATOM   3573 C  CB  . PRO B 1 256 ? 38.977  -64.899 -29.400 1.00 45.28  ? 583 PRO B CB  1 
ATOM   3574 C  CG  . PRO B 1 256 ? 39.180  -65.234 -30.852 1.00 46.99  ? 583 PRO B CG  1 
ATOM   3575 C  CD  . PRO B 1 256 ? 37.893  -64.993 -31.560 1.00 46.42  ? 583 PRO B CD  1 
ATOM   3576 N  N   . PRO B 1 257 ? 36.857  -63.677 -27.115 1.00 40.75  ? 584 PRO B N   1 
ATOM   3577 C  CA  . PRO B 1 257 ? 36.360  -62.439 -26.473 1.00 38.52  ? 584 PRO B CA  1 
ATOM   3578 C  C   . PRO B 1 257 ? 37.407  -61.313 -26.541 1.00 38.60  ? 584 PRO B C   1 
ATOM   3579 O  O   . PRO B 1 257 ? 38.594  -61.592 -26.652 1.00 40.46  ? 584 PRO B O   1 
ATOM   3580 C  CB  . PRO B 1 257 ? 36.116  -62.876 -25.023 1.00 37.65  ? 584 PRO B CB  1 
ATOM   3581 C  CG  . PRO B 1 257 ? 37.061  -64.032 -24.801 1.00 40.06  ? 584 PRO B CG  1 
ATOM   3582 C  CD  . PRO B 1 257 ? 37.072  -64.759 -26.125 1.00 40.94  ? 584 PRO B CD  1 
ATOM   3583 N  N   . PRO B 1 258 ? 36.972  -60.052 -26.507 1.00 36.75  ? 585 PRO B N   1 
ATOM   3584 C  CA  . PRO B 1 258 ? 38.011  -59.022 -26.491 1.00 37.02  ? 585 PRO B CA  1 
ATOM   3585 C  C   . PRO B 1 258 ? 38.721  -58.988 -25.122 1.00 36.61  ? 585 PRO B C   1 
ATOM   3586 O  O   . PRO B 1 258 ? 38.234  -59.535 -24.104 1.00 34.51  ? 585 PRO B O   1 
ATOM   3587 C  CB  . PRO B 1 258 ? 37.214  -57.733 -26.718 1.00 37.07  ? 585 PRO B CB  1 
ATOM   3588 C  CG  . PRO B 1 258 ? 35.845  -58.031 -26.145 1.00 34.72  ? 585 PRO B CG  1 
ATOM   3589 C  CD  . PRO B 1 258 ? 35.610  -59.471 -26.471 1.00 34.54  ? 585 PRO B CD  1 
ATOM   3590 N  N   . ALA B 1 259 ? 39.854  -58.298 -25.114 1.00 37.90  ? 586 ALA B N   1 
ATOM   3591 C  CA  . ALA B 1 259 ? 40.770  -58.224 -23.983 1.00 38.53  ? 586 ALA B CA  1 
ATOM   3592 C  C   . ALA B 1 259 ? 40.095  -57.874 -22.651 1.00 36.27  ? 586 ALA B C   1 
ATOM   3593 O  O   . ALA B 1 259 ? 40.398  -58.488 -21.619 1.00 36.07  ? 586 ALA B O   1 
ATOM   3594 C  CB  . ALA B 1 259 ? 41.938  -57.267 -24.298 1.00 39.87  ? 586 ALA B CB  1 
ATOM   3595 N  N   . ILE B 1 260 ? 39.162  -56.943 -22.665 1.00 34.97  ? 587 ILE B N   1 
ATOM   3596 C  CA  . ILE B 1 260 ? 38.550  -56.519 -21.423 1.00 34.48  ? 587 ILE B CA  1 
ATOM   3597 C  C   . ILE B 1 260 ? 37.618  -57.583 -20.804 1.00 33.04  ? 587 ILE B C   1 
ATOM   3598 O  O   . ILE B 1 260 ? 37.524  -57.723 -19.558 1.00 32.22  ? 587 ILE B O   1 
ATOM   3599 C  CB  . ILE B 1 260 ? 37.874  -55.128 -21.532 1.00 36.06  ? 587 ILE B CB  1 
ATOM   3600 C  CG1 . ILE B 1 260 ? 37.455  -54.605 -20.133 1.00 36.05  ? 587 ILE B CG1 1 
ATOM   3601 C  CG2 . ILE B 1 260 ? 36.667  -55.150 -22.476 1.00 34.90  ? 587 ILE B CG2 1 
ATOM   3602 C  CD1 . ILE B 1 260 ? 38.655  -54.321 -19.231 1.00 38.07  ? 587 ILE B CD1 1 
ATOM   3603 N  N   . ILE B 1 261 ? 36.986  -58.375 -21.662 1.00 32.07  ? 588 ILE B N   1 
ATOM   3604 C  CA  . ILE B 1 261 ? 36.178  -59.541 -21.218 1.00 30.83  ? 588 ILE B CA  1 
ATOM   3605 C  C   . ILE B 1 261 ? 37.101  -60.640 -20.678 1.00 31.51  ? 588 ILE B C   1 
ATOM   3606 O  O   . ILE B 1 261 ? 36.854  -61.165 -19.597 1.00 30.43  ? 588 ILE B O   1 
ATOM   3607 C  CB  . ILE B 1 261 ? 35.232  -60.065 -22.313 1.00 30.22  ? 588 ILE B CB  1 
ATOM   3608 C  CG1 . ILE B 1 261 ? 34.173  -58.982 -22.622 1.00 29.96  ? 588 ILE B CG1 1 
ATOM   3609 C  CG2 . ILE B 1 261 ? 34.653  -61.459 -21.935 1.00 29.53  ? 588 ILE B CG2 1 
ATOM   3610 C  CD1 . ILE B 1 261 ? 33.127  -59.315 -23.695 1.00 30.15  ? 588 ILE B CD1 1 
ATOM   3611 N  N   . ASP B 1 262 ? 38.168  -60.927 -21.417 1.00 32.95  ? 589 ASP B N   1 
ATOM   3612 C  CA  . ASP B 1 262 ? 39.160  -61.902 -21.016 1.00 35.46  ? 589 ASP B CA  1 
ATOM   3613 C  C   . ASP B 1 262 ? 39.733  -61.596 -19.628 1.00 36.13  ? 589 ASP B C   1 
ATOM   3614 O  O   . ASP B 1 262 ? 39.788  -62.465 -18.768 1.00 35.30  ? 589 ASP B O   1 
ATOM   3615 C  CB  . ASP B 1 262 ? 40.347  -61.907 -21.994 1.00 37.96  ? 589 ASP B CB  1 
ATOM   3616 C  CG  . ASP B 1 262 ? 40.385  -63.089 -22.805 1.00 38.75  ? 589 ASP B CG  1 
ATOM   3617 O  OD1 . ASP B 1 262 ? 39.605  -64.019 -22.539 1.00 38.48  ? 589 ASP B OD1 1 
ATOM   3618 O  OD2 . ASP B 1 262 ? 41.220  -63.097 -23.700 1.00 40.68  ? 589 ASP B OD2 1 
ATOM   3619 N  N   . LYS B 1 263 ? 40.156  -60.343 -19.449 1.00 36.37  ? 590 LYS B N   1 
ATOM   3620 C  CA  . LYS B 1 263 ? 40.720  -59.887 -18.196 1.00 38.59  ? 590 LYS B CA  1 
ATOM   3621 C  C   . LYS B 1 263 ? 39.721  -60.044 -17.017 1.00 35.01  ? 590 LYS B C   1 
ATOM   3622 O  O   . LYS B 1 263 ? 40.064  -60.646 -16.014 1.00 34.83  ? 590 LYS B O   1 
ATOM   3623 C  CB  . LYS B 1 263 ? 41.243  -58.439 -18.330 1.00 41.59  ? 590 LYS B CB  1 
ATOM   3624 C  CG  . LYS B 1 263 ? 41.479  -57.702 -17.024 1.00 44.45  ? 590 LYS B CG  1 
ATOM   3625 C  CD  . LYS B 1 263 ? 41.212  -56.199 -17.182 1.00 46.69  ? 590 LYS B CD  1 
ATOM   3626 C  CE  . LYS B 1 263 ? 42.482  -55.393 -17.047 1.00 50.32  ? 590 LYS B CE  1 
ATOM   3627 N  NZ  . LYS B 1 263 ? 43.123  -55.560 -15.710 1.00 53.68  ? 590 LYS B NZ  1 
ATOM   3628 N  N   . LEU B 1 264 ? 38.508  -59.537 -17.172 1.00 32.88  ? 591 LEU B N   1 
ATOM   3629 C  CA  . LEU B 1 264 ? 37.489  -59.659 -16.126 1.00 32.12  ? 591 LEU B CA  1 
ATOM   3630 C  C   . LEU B 1 264 ? 37.136  -61.143 -15.842 1.00 30.90  ? 591 LEU B C   1 
ATOM   3631 O  O   . LEU B 1 264 ? 37.004  -61.540 -14.663 1.00 28.42  ? 591 LEU B O   1 
ATOM   3632 C  CB  . LEU B 1 264 ? 36.223  -58.869 -16.471 1.00 32.13  ? 591 LEU B CB  1 
ATOM   3633 C  CG  . LEU B 1 264 ? 35.668  -58.008 -15.334 1.00 34.31  ? 591 LEU B CG  1 
ATOM   3634 C  CD1 . LEU B 1 264 ? 36.749  -56.973 -14.996 1.00 37.76  ? 591 LEU B CD1 1 
ATOM   3635 C  CD2 . LEU B 1 264 ? 34.359  -57.302 -15.742 1.00 34.35  ? 591 LEU B CD2 1 
ATOM   3636 N  N   . PHE B 1 265 ? 37.031  -61.939 -16.923 1.00 30.37  ? 592 PHE B N   1 
ATOM   3637 C  CA  . PHE B 1 265 ? 36.718  -63.368 -16.815 1.00 30.98  ? 592 PHE B CA  1 
ATOM   3638 C  C   . PHE B 1 265 ? 37.808  -64.057 -15.990 1.00 32.72  ? 592 PHE B C   1 
ATOM   3639 O  O   . PHE B 1 265 ? 37.513  -64.730 -14.994 1.00 32.68  ? 592 PHE B O   1 
ATOM   3640 C  CB  . PHE B 1 265 ? 36.601  -63.991 -18.225 1.00 31.34  ? 592 PHE B CB  1 
ATOM   3641 C  CG  . PHE B 1 265 ? 36.425  -65.474 -18.222 1.00 31.65  ? 592 PHE B CG  1 
ATOM   3642 C  CD1 . PHE B 1 265 ? 35.143  -65.993 -18.113 1.00 30.62  ? 592 PHE B CD1 1 
ATOM   3643 C  CD2 . PHE B 1 265 ? 37.517  -66.351 -18.370 1.00 32.77  ? 592 PHE B CD2 1 
ATOM   3644 C  CE1 . PHE B 1 265 ? 34.937  -67.385 -18.144 1.00 31.00  ? 592 PHE B CE1 1 
ATOM   3645 C  CE2 . PHE B 1 265 ? 37.325  -67.727 -18.346 1.00 33.96  ? 592 PHE B CE2 1 
ATOM   3646 C  CZ  . PHE B 1 265 ? 36.026  -68.234 -18.231 1.00 32.56  ? 592 PHE B CZ  1 
ATOM   3647 N  N   . LEU B 1 266 ? 39.065  -63.890 -16.420 1.00 34.80  ? 593 LEU B N   1 
ATOM   3648 C  CA  . LEU B 1 266 ? 40.214  -64.533 -15.774 1.00 36.91  ? 593 LEU B CA  1 
ATOM   3649 C  C   . LEU B 1 266 ? 40.437  -64.063 -14.321 1.00 38.16  ? 593 LEU B C   1 
ATOM   3650 O  O   . LEU B 1 266 ? 40.740  -64.874 -13.463 1.00 39.21  ? 593 LEU B O   1 
ATOM   3651 C  CB  . LEU B 1 266 ? 41.486  -64.363 -16.619 1.00 38.74  ? 593 LEU B CB  1 
ATOM   3652 C  CG  . LEU B 1 266 ? 41.538  -65.075 -17.985 1.00 39.83  ? 593 LEU B CG  1 
ATOM   3653 C  CD1 . LEU B 1 266 ? 42.769  -64.627 -18.795 1.00 41.67  ? 593 LEU B CD1 1 
ATOM   3654 C  CD2 . LEU B 1 266 ? 41.473  -66.595 -17.877 1.00 39.45  ? 593 LEU B CD2 1 
ATOM   3655 N  N   . ASP B 1 267 ? 40.296  -62.762 -14.058 1.00 37.69  ? 594 ASP B N   1 
ATOM   3656 C  CA  . ASP B 1 267 ? 40.458  -62.193 -12.700 1.00 39.75  ? 594 ASP B CA  1 
ATOM   3657 C  C   . ASP B 1 267 ? 39.445  -62.750 -11.681 1.00 39.11  ? 594 ASP B C   1 
ATOM   3658 O  O   . ASP B 1 267 ? 39.792  -62.972 -10.525 1.00 40.79  ? 594 ASP B O   1 
ATOM   3659 C  CB  . ASP B 1 267 ? 40.333  -60.654 -12.733 1.00 38.99  ? 594 ASP B CB  1 
ATOM   3660 C  CG  . ASP B 1 267 ? 41.612  -59.978 -13.256 1.00 40.83  ? 594 ASP B CG  1 
ATOM   3661 O  OD1 . ASP B 1 267 ? 42.603  -60.640 -13.357 1.00 42.60  ? 594 ASP B OD1 1 
ATOM   3662 O  OD2 . ASP B 1 267 ? 41.656  -58.793 -13.576 1.00 41.59  ? 594 ASP B OD2 1 
ATOM   3663 N  N   . THR B 1 268 ? 38.219  -62.991 -12.130 1.00 36.91  ? 595 THR B N   1 
ATOM   3664 C  CA  . THR B 1 268 ? 37.122  -63.231 -11.197 1.00 36.57  ? 595 THR B CA  1 
ATOM   3665 C  C   . THR B 1 268 ? 36.890  -64.705 -11.069 1.00 37.60  ? 595 THR B C   1 
ATOM   3666 O  O   . THR B 1 268 ? 36.094  -65.110 -10.197 1.00 38.11  ? 595 THR B O   1 
ATOM   3667 C  CB  . THR B 1 268 ? 35.817  -62.520 -11.638 1.00 34.19  ? 595 THR B CB  1 
ATOM   3668 O  OG1 . THR B 1 268 ? 35.497  -62.973 -12.936 1.00 34.22  ? 595 THR B OG1 1 
ATOM   3669 C  CG2 . THR B 1 268 ? 35.992  -60.964 -11.681 1.00 33.36  ? 595 THR B CG2 1 
ATOM   3670 N  N   . LEU B 1 269 ? 37.512  -65.535 -11.915 1.00 38.23  ? 596 LEU B N   1 
ATOM   3671 C  CA  . LEU B 1 269 ? 37.245  -66.992 -11.851 1.00 39.67  ? 596 LEU B CA  1 
ATOM   3672 C  C   . LEU B 1 269 ? 37.675  -67.652 -10.532 1.00 42.43  ? 596 LEU B C   1 
ATOM   3673 O  O   . LEU B 1 269 ? 38.848  -67.548 -10.152 1.00 44.19  ? 596 LEU B O   1 
ATOM   3674 C  CB  . LEU B 1 269 ? 37.881  -67.762 -13.009 1.00 41.21  ? 596 LEU B CB  1 
ATOM   3675 C  CG  . LEU B 1 269 ? 37.096  -68.234 -14.254 1.00 41.45  ? 596 LEU B CG  1 
ATOM   3676 C  CD1 . LEU B 1 269 ? 37.854  -69.419 -14.844 1.00 41.94  ? 596 LEU B CD1 1 
ATOM   3677 C  CD2 . LEU B 1 269 ? 35.667  -68.627 -13.913 1.00 39.58  ? 596 LEU B CD2 1 
ATOM   3678 N  N   . PRO B 1 270 ? 36.739  -68.386 -9.873  1.00 43.53  ? 597 PRO B N   1 
ATOM   3679 C  CA  . PRO B 1 270 ? 36.987  -69.023 -8.579  1.00 45.35  ? 597 PRO B CA  1 
ATOM   3680 C  C   . PRO B 1 270 ? 37.877  -70.223 -8.641  1.00 46.83  ? 597 PRO B C   1 
ATOM   3681 O  O   . PRO B 1 270 ? 38.076  -70.818 -7.598  1.00 50.55  ? 597 PRO B O   1 
ATOM   3682 C  CB  . PRO B 1 270 ? 35.597  -69.480 -8.137  1.00 45.85  ? 597 PRO B CB  1 
ATOM   3683 C  CG  . PRO B 1 270 ? 34.672  -68.605 -8.877  1.00 44.05  ? 597 PRO B CG  1 
ATOM   3684 C  CD  . PRO B 1 270 ? 35.318  -68.484 -10.232 1.00 42.48  ? 597 PRO B CD  1 
ATOM   3685 N  N   . PHE B 1 271 ? 38.428  -70.573 -9.812  1.00 45.70  ? 598 PHE B N   1 
ATOM   3686 C  CA  . PHE B 1 271 ? 39.384  -71.699 -9.893  1.00 48.36  ? 598 PHE B CA  1 
ATOM   3687 C  C   . PHE B 1 271 ? 40.310  -71.532 -11.097 1.00 48.79  ? 598 PHE B C   1 
ATOM   3688 O  O   . PHE B 1 271 ? 41.223  -72.346 -11.314 1.00 51.77  ? 598 PHE B O   1 
ATOM   3689 C  CB  . PHE B 1 271 ? 38.652  -73.072 -9.993  1.00 48.48  ? 598 PHE B CB  1 
ATOM   3690 C  CG  . PHE B 1 271 ? 37.447  -73.052 -10.919 1.00 45.58  ? 598 PHE B CG  1 
ATOM   3691 C  CD1 . PHE B 1 271 ? 37.622  -73.191 -12.311 1.00 44.42  ? 598 PHE B CD1 1 
ATOM   3692 C  CD2 . PHE B 1 271 ? 36.155  -72.885 -10.410 1.00 43.57  ? 598 PHE B CD2 1 
ATOM   3693 C  CE1 . PHE B 1 271 ? 36.524  -73.157 -13.178 1.00 43.13  ? 598 PHE B CE1 1 
ATOM   3694 C  CE2 . PHE B 1 271 ? 35.056  -72.851 -11.268 1.00 42.41  ? 598 PHE B CE2 1 
ATOM   3695 C  CZ  . PHE B 1 271 ? 35.231  -72.987 -12.657 1.00 41.97  ? 598 PHE B CZ  1 
ATOM   3696 O  OXT . PHE B 1 271 ? 40.125  -70.608 -11.894 1.00 46.47  ? 598 PHE B OXT 1 
HETATM 3697 O  O9  . RPG C 2 .   ? 7.034   -12.371 -20.797 1.00 57.74  ? 601 RPG A O9  1 
HETATM 3698 C  C9  . RPG C 2 .   ? 6.625   -13.533 -20.826 1.00 55.94  ? 601 RPG A C9  1 
HETATM 3699 C  C10 . RPG C 2 .   ? 7.137   -14.609 -19.977 1.00 50.58  ? 601 RPG A C10 1 
HETATM 3700 C  C11 . RPG C 2 .   ? 6.876   -15.744 -20.626 1.00 44.99  ? 601 RPG A C11 1 
HETATM 3701 C  C12 . RPG C 2 .   ? 5.635   -15.585 -21.494 1.00 50.52  ? 601 RPG A C12 1 
HETATM 3702 C  C13 . RPG C 2 .   ? 5.904   -16.345 -22.757 1.00 50.56  ? 601 RPG A C13 1 
HETATM 3703 C  C14 . RPG C 2 .   ? 5.346   -17.489 -23.102 1.00 50.65  ? 601 RPG A C14 1 
HETATM 3704 C  C15 . RPG C 2 .   ? 5.842   -18.080 -24.410 1.00 48.38  ? 601 RPG A C15 1 
HETATM 3705 C  C16 . RPG C 2 .   ? 4.849   -17.804 -25.523 1.00 44.00  ? 601 RPG A C16 1 
HETATM 3706 C  C17 . RPG C 2 .   ? 5.235   -18.516 -26.816 1.00 41.28  ? 601 RPG A C17 1 
HETATM 3707 C  C18 . RPG C 2 .   ? 6.690   -18.312 -27.207 1.00 36.65  ? 601 RPG A C18 1 
HETATM 3708 C  C19 . RPG C 2 .   ? 6.823   -17.785 -28.614 1.00 34.98  ? 601 RPG A C19 1 
HETATM 3709 C  C20 . RPG C 2 .   ? 7.915   -18.513 -29.343 1.00 34.01  ? 601 RPG A C20 1 
HETATM 3710 O  O15 . RPG C 2 .   ? 6.086   -19.501 -24.284 1.00 49.28  ? 601 RPG A O15 1 
HETATM 3711 C  C8  . RPG C 2 .   ? 5.589   -14.078 -21.766 1.00 55.06  ? 601 RPG A C8  1 
HETATM 3712 C  C7  . RPG C 2 .   ? 4.231   -13.475 -21.473 1.00 59.91  ? 601 RPG A C7  1 
HETATM 3713 C  C6  . RPG C 2 .   ? 4.048   -12.267 -22.378 1.00 64.41  ? 601 RPG A C6  1 
HETATM 3714 C  C5  . RPG C 2 .   ? 3.569   -11.056 -21.600 1.00 66.94  ? 601 RPG A C5  1 
HETATM 3715 C  C4  . RPG C 2 .   ? 2.121   -10.739 -21.955 1.00 66.23  ? 601 RPG A C4  1 
HETATM 3716 C  C3  . RPG C 2 .   ? 1.651   -9.506  -21.194 1.00 69.15  ? 601 RPG A C3  1 
HETATM 3717 C  C2  . RPG C 2 .   ? 1.270   -9.816  -19.747 1.00 74.24  ? 601 RPG A C2  1 
HETATM 3718 C  C1  . RPG C 2 .   ? -0.229  -9.726  -19.597 1.00 76.46  ? 601 RPG A C1  1 
HETATM 3719 O  O1  . RPG C 2 .   ? -0.885  -10.788 -19.525 1.00 75.17  ? 601 RPG A O1  1 
HETATM 3720 O  O2  . RPG C 2 .   ? -0.755  -8.591  -19.554 1.00 80.20  ? 601 RPG A O2  1 
HETATM 3721 C  C1  . PGE D 3 .   ? 14.524  -38.563 -5.475  1.00 39.30  ? 602 PGE A C1  1 
HETATM 3722 O  O1  . PGE D 3 .   ? 14.907  -38.399 -6.851  1.00 31.97  ? 602 PGE A O1  1 
HETATM 3723 C  C2  . PGE D 3 .   ? 14.024  -39.969 -5.141  1.00 46.44  ? 602 PGE A C2  1 
HETATM 3724 O  O2  . PGE D 3 .   ? 13.943  -40.112 -3.716  1.00 50.89  ? 602 PGE A O2  1 
HETATM 3725 C  C3  . PGE D 3 .   ? 12.901  -41.007 -3.343  1.00 49.90  ? 602 PGE A C3  1 
HETATM 3726 C  C4  . PGE D 3 .   ? 12.112  -40.511 -2.137  1.00 51.37  ? 602 PGE A C4  1 
HETATM 3727 O  O4  . PGE D 3 .   ? 8.851   -39.300 -2.538  1.00 52.99  ? 602 PGE A O4  1 
HETATM 3728 C  C6  . PGE D 3 .   ? 9.243   -39.612 -1.192  1.00 54.04  ? 602 PGE A C6  1 
HETATM 3729 C  C5  . PGE D 3 .   ? 9.909   -40.989 -1.135  1.00 53.47  ? 602 PGE A C5  1 
HETATM 3730 O  O3  . PGE D 3 .   ? 10.848  -41.197 -2.197  1.00 58.79  ? 602 PGE A O3  1 
HETATM 3731 C  C1  . PEG E 4 .   ? -4.893  -41.258 -13.864 1.00 68.96  ? 603 PEG A C1  1 
HETATM 3732 O  O1  . PEG E 4 .   ? -3.473  -41.073 -13.953 1.00 68.05  ? 603 PEG A O1  1 
HETATM 3733 C  C2  . PEG E 4 .   ? -5.569  -39.895 -13.773 1.00 70.18  ? 603 PEG A C2  1 
HETATM 3734 O  O2  . PEG E 4 .   ? -5.390  -39.373 -12.452 1.00 66.76  ? 603 PEG A O2  1 
HETATM 3735 C  C3  . PEG E 4 .   ? -5.079  -37.977 -12.459 1.00 61.14  ? 603 PEG A C3  1 
HETATM 3736 C  C4  . PEG E 4 .   ? -5.324  -37.404 -11.063 1.00 63.49  ? 603 PEG A C4  1 
HETATM 3737 O  O4  . PEG E 4 .   ? -4.187  -36.634 -10.655 1.00 60.52  ? 603 PEG A O4  1 
HETATM 3738 CL CL  . CL  F 5 .   ? 13.231  -29.205 -23.506 1.00 30.44  ? 604 CL  A CL  1 
HETATM 3739 MG MG  . MG  G 6 .   ? 0.515   -5.110  -33.606 1.00 51.28  ? 605 MG  A MG  1 
HETATM 3740 O  O9  . RPG H 2 .   ? 29.905  -67.141 -10.173 1.00 44.88  ? 601 RPG B O9  1 
HETATM 3741 C  C9  . RPG H 2 .   ? 29.710  -65.975 -10.449 1.00 45.35  ? 601 RPG B C9  1 
HETATM 3742 C  C10 . RPG H 2 .   ? 28.369  -65.364 -10.466 1.00 42.11  ? 601 RPG B C10 1 
HETATM 3743 C  C11 . RPG H 2 .   ? 28.508  -64.165 -11.035 1.00 37.89  ? 601 RPG B C11 1 
HETATM 3744 C  C12 . RPG H 2 .   ? 29.970  -63.752 -11.119 1.00 40.84  ? 601 RPG B C12 1 
HETATM 3745 C  C13 . RPG H 2 .   ? 30.339  -63.148 -12.450 1.00 39.04  ? 601 RPG B C13 1 
HETATM 3746 C  C14 . RPG H 2 .   ? 30.957  -61.993 -12.440 1.00 37.01  ? 601 RPG B C14 1 
HETATM 3747 C  C15 . RPG H 2 .   ? 31.335  -61.276 -13.708 1.00 36.00  ? 601 RPG B C15 1 
HETATM 3748 C  C16 . RPG H 2 .   ? 32.819  -61.474 -14.032 1.00 37.88  ? 601 RPG B C16 1 
HETATM 3749 C  C17 . RPG H 2 .   ? 33.255  -60.954 -15.391 1.00 37.85  ? 601 RPG B C17 1 
HETATM 3750 C  C18 . RPG H 2 .   ? 32.798  -61.803 -16.572 1.00 36.60  ? 601 RPG B C18 1 
HETATM 3751 C  C19 . RPG H 2 .   ? 33.144  -61.084 -17.860 1.00 36.56  ? 601 RPG B C19 1 
HETATM 3752 C  C20 . RPG H 2 .   ? 31.949  -60.565 -18.629 1.00 35.06  ? 601 RPG B C20 1 
HETATM 3753 O  O15 . RPG H 2 .   ? 31.095  -59.917 -13.334 1.00 34.85  ? 601 RPG B O15 1 
HETATM 3754 C  C8  . RPG H 2 .   ? 30.789  -65.007 -10.821 1.00 45.57  ? 601 RPG B C8  1 
HETATM 3755 C  C7  . RPG H 2 .   ? 31.572  -64.591 -9.590  1.00 49.45  ? 601 RPG B C7  1 
HETATM 3756 C  C6  . RPG H 2 .   ? 32.902  -65.274 -9.372  1.00 51.55  ? 601 RPG B C6  1 
HETATM 3757 C  C5  . RPG H 2 .   ? 33.286  -65.212 -7.893  1.00 52.29  ? 601 RPG B C5  1 
HETATM 3758 C  C4  . RPG H 2 .   ? 33.164  -63.805 -7.303  1.00 54.06  ? 601 RPG B C4  1 
HETATM 3759 C  C3  . RPG H 2 .   ? 33.193  -63.777 -5.782  1.00 56.81  ? 601 RPG B C3  1 
HETATM 3760 C  C2  . RPG H 2 .   ? 31.801  -64.067 -5.218  1.00 60.56  ? 601 RPG B C2  1 
HETATM 3761 C  C1  . RPG H 2 .   ? 31.711  -63.896 -3.715  1.00 63.38  ? 601 RPG B C1  1 
HETATM 3762 O  O1  . RPG H 2 .   ? 32.768  -63.807 -3.025  1.00 61.37  ? 601 RPG B O1  1 
HETATM 3763 O  O2  . RPG H 2 .   ? 30.550  -63.854 -3.223  1.00 62.45  ? 601 RPG B O2  1 
HETATM 3764 CL CL  . CL  I 5 .   ? 23.724  -52.034 -18.028 1.00 33.83  ? 602 CL  B CL  1 
HETATM 3765 O  O   . HOH J 7 .   ? 28.148  -27.621 -13.567 1.00 45.54  ? 701 HOH A O   1 
HETATM 3766 O  O   . HOH J 7 .   ? 15.179  -36.356 -26.366 1.00 50.20  ? 702 HOH A O   1 
HETATM 3767 O  O   . HOH J 7 .   ? -16.502 -27.462 -15.088 1.00 41.89  ? 703 HOH A O   1 
HETATM 3768 O  O   . HOH J 7 .   ? 17.496  -11.939 -24.549 1.00 36.06  ? 704 HOH A O   1 
HETATM 3769 O  O   . HOH J 7 .   ? 20.402  -29.542 -32.845 1.00 45.37  ? 705 HOH A O   1 
HETATM 3770 O  O   . HOH J 7 .   ? 1.916   -23.765 -10.010 1.00 35.63  ? 706 HOH A O   1 
HETATM 3771 O  O   . HOH J 7 .   ? 18.876  -35.109 -19.880 1.00 40.44  ? 707 HOH A O   1 
HETATM 3772 O  O   . HOH J 7 .   ? 12.550  -44.649 -19.179 1.00 41.07  ? 708 HOH A O   1 
HETATM 3773 O  O   . HOH J 7 .   ? 6.729   -42.416 -20.824 1.00 45.07  ? 709 HOH A O   1 
HETATM 3774 O  O   . HOH J 7 .   ? 4.438   -17.649 -18.669 1.00 36.56  ? 710 HOH A O   1 
HETATM 3775 O  O   . HOH J 7 .   ? 24.808  -19.821 -31.961 1.00 33.36  ? 711 HOH A O   1 
HETATM 3776 O  O   . HOH J 7 .   ? -9.549  -32.514 -9.910  1.00 54.13  ? 712 HOH A O   1 
HETATM 3777 O  O   . HOH J 7 .   ? 19.638  -27.680 -36.665 1.00 45.46  ? 713 HOH A O   1 
HETATM 3778 O  O   . HOH J 7 .   ? 3.830   -40.111 -16.457 1.00 28.11  ? 714 HOH A O   1 
HETATM 3779 O  O   . HOH J 7 .   ? 15.880  -31.158 -17.821 1.00 27.50  ? 715 HOH A O   1 
HETATM 3780 O  O   . HOH J 7 .   ? 9.405   -10.566 -17.244 1.00 45.80  ? 716 HOH A O   1 
HETATM 3781 O  O   . HOH J 7 .   ? 27.413  -43.424 -23.130 1.00 50.19  ? 717 HOH A O   1 
HETATM 3782 O  O   . HOH J 7 .   ? 1.303   -25.001 -30.213 1.00 59.91  ? 718 HOH A O   1 
HETATM 3783 O  O   . HOH J 7 .   ? 13.003  -24.801 -37.075 1.00 41.10  ? 719 HOH A O   1 
HETATM 3784 O  O   . HOH J 7 .   ? 21.731  -35.994 -32.556 1.00 54.84  ? 720 HOH A O   1 
HETATM 3785 O  O   . HOH J 7 .   ? 27.473  -31.941 -30.158 1.00 36.24  ? 721 HOH A O   1 
HETATM 3786 O  O   . HOH J 7 .   ? 35.734  -32.369 -18.290 1.00 60.57  ? 722 HOH A O   1 
HETATM 3787 O  O   . HOH J 7 .   ? 33.829  -27.090 -21.726 1.00 57.56  ? 723 HOH A O   1 
HETATM 3788 O  O   . HOH J 7 .   ? 4.047   -14.100 -17.404 1.00 51.97  ? 724 HOH A O   1 
HETATM 3789 O  O   . HOH J 7 .   ? 9.488   -12.085 -39.749 1.00 34.25  ? 725 HOH A O   1 
HETATM 3790 O  O   . HOH J 7 .   ? -15.256 -27.087 -20.264 1.00 46.98  ? 726 HOH A O   1 
HETATM 3791 O  O   . HOH J 7 .   ? -2.047  -36.251 -19.298 1.00 35.78  ? 727 HOH A O   1 
HETATM 3792 O  O   . HOH J 7 .   ? 17.019  -21.306 -43.020 1.00 52.21  ? 728 HOH A O   1 
HETATM 3793 O  O   . HOH J 7 .   ? 16.707  -35.711 -1.658  1.00 45.59  ? 729 HOH A O   1 
HETATM 3794 O  O   . HOH J 7 .   ? 19.324  -17.182 -11.021 1.00 57.27  ? 730 HOH A O   1 
HETATM 3795 O  O   . HOH J 7 .   ? 16.222  -38.622 -19.698 1.00 27.72  ? 731 HOH A O   1 
HETATM 3796 O  O   . HOH J 7 .   ? 0.949   -22.652 -17.963 1.00 26.78  ? 732 HOH A O   1 
HETATM 3797 O  O   . HOH J 7 .   ? 17.480  -38.035 -7.596  1.00 32.70  ? 733 HOH A O   1 
HETATM 3798 O  O   . HOH J 7 .   ? 34.634  -32.105 -23.080 1.00 48.00  ? 734 HOH A O   1 
HETATM 3799 O  O   . HOH J 7 .   ? 14.905  -32.754 1.811   1.00 47.06  ? 735 HOH A O   1 
HETATM 3800 O  O   . HOH J 7 .   ? 1.888   -6.816  -33.175 1.00 57.18  ? 736 HOH A O   1 
HETATM 3801 O  O   . HOH J 7 .   ? 23.861  -20.063 -6.091  1.00 51.78  ? 737 HOH A O   1 
HETATM 3802 O  O   . HOH J 7 .   ? 0.600   -18.496 -12.992 1.00 45.91  ? 738 HOH A O   1 
HETATM 3803 O  O   . HOH J 7 .   ? 11.933  -11.657 -39.884 1.00 37.89  ? 739 HOH A O   1 
HETATM 3804 O  O   . HOH J 7 .   ? -5.980  -22.156 -25.950 1.00 50.24  ? 740 HOH A O   1 
HETATM 3805 O  O   . HOH J 7 .   ? 17.553  -12.534 -38.095 1.00 34.56  ? 741 HOH A O   1 
HETATM 3806 O  O   . HOH J 7 .   ? 19.545  -28.603 -8.596  1.00 43.94  ? 742 HOH A O   1 
HETATM 3807 O  O   . HOH J 7 .   ? -7.607  -28.001 -4.460  1.00 54.05  ? 743 HOH A O   1 
HETATM 3808 O  O   . HOH J 7 .   ? 26.013  -29.112 -6.392  1.00 53.32  ? 744 HOH A O   1 
HETATM 3809 O  O   . HOH J 7 .   ? -12.850 -27.048 -13.193 1.00 42.73  ? 745 HOH A O   1 
HETATM 3810 O  O   . HOH J 7 .   ? -0.524  -35.246 -3.524  1.00 50.43  ? 746 HOH A O   1 
HETATM 3811 O  O   . HOH J 7 .   ? 7.756   -21.258 -41.692 1.00 47.96  ? 747 HOH A O   1 
HETATM 3812 O  O   . HOH J 7 .   ? 30.503  -27.769 -34.752 1.00 66.10  ? 748 HOH A O   1 
HETATM 3813 O  O   . HOH J 7 .   ? 10.422  -40.881 -7.123  1.00 43.30  ? 749 HOH A O   1 
HETATM 3814 O  O   . HOH J 7 .   ? 28.117  -18.633 -31.480 1.00 53.72  ? 750 HOH A O   1 
HETATM 3815 O  O   . HOH J 7 .   ? 20.454  -39.435 -17.959 1.00 35.66  ? 751 HOH A O   1 
HETATM 3816 O  O   . HOH J 7 .   ? 7.678   -33.817 -14.679 1.00 23.77  ? 752 HOH A O   1 
HETATM 3817 O  O   . HOH J 7 .   ? 8.294   -18.999 -2.520  1.00 59.10  ? 753 HOH A O   1 
HETATM 3818 O  O   . HOH J 7 .   ? -6.915  -39.768 -17.192 1.00 41.35  ? 754 HOH A O   1 
HETATM 3819 O  O   . HOH J 7 .   ? 10.726  -31.907 -17.187 1.00 22.43  ? 755 HOH A O   1 
HETATM 3820 O  O   . HOH J 7 .   ? 21.032  -20.961 -5.533  1.00 58.46  ? 756 HOH A O   1 
HETATM 3821 O  O   . HOH J 7 .   ? 26.195  -11.444 -20.626 1.00 67.72  ? 757 HOH A O   1 
HETATM 3822 O  O   . HOH J 7 .   ? -2.481  -15.811 -17.998 1.00 36.48  ? 758 HOH A O   1 
HETATM 3823 O  O   . HOH J 7 .   ? -3.233  -23.289 -30.250 1.00 50.19  ? 759 HOH A O   1 
HETATM 3824 O  O   . HOH J 7 .   ? 14.385  -25.041 5.089   1.00 40.70  ? 760 HOH A O   1 
HETATM 3825 O  O   . HOH J 7 .   ? -9.267  -33.409 -7.527  1.00 63.99  ? 761 HOH A O   1 
HETATM 3826 O  O   . HOH J 7 .   ? -1.037  -28.932 -25.986 1.00 52.82  ? 762 HOH A O   1 
HETATM 3827 O  O   . HOH J 7 .   ? 21.672  -6.241  -21.227 1.00 39.91  ? 763 HOH A O   1 
HETATM 3828 O  O   . HOH J 7 .   ? 6.601   -47.182 -11.526 1.00 62.75  ? 764 HOH A O   1 
HETATM 3829 O  O   . HOH J 7 .   ? 6.889   -19.428 -21.152 1.00 38.86  ? 765 HOH A O   1 
HETATM 3830 O  O   . HOH J 7 .   ? 21.175  -31.218 -12.337 1.00 61.08  ? 766 HOH A O   1 
HETATM 3831 O  O   . HOH J 7 .   ? 6.068   -37.620 -2.635  1.00 48.20  ? 767 HOH A O   1 
HETATM 3832 O  O   . HOH J 7 .   ? 2.815   -39.757 -5.439  1.00 49.66  ? 768 HOH A O   1 
HETATM 3833 O  O   . HOH J 7 .   ? 15.415  -27.418 -23.140 1.00 25.80  ? 769 HOH A O   1 
HETATM 3834 O  O   . HOH J 7 .   ? 0.108   -15.940 -16.731 1.00 43.36  ? 770 HOH A O   1 
HETATM 3835 O  O   . HOH J 7 .   ? -8.853  -21.995 -22.405 1.00 34.12  ? 771 HOH A O   1 
HETATM 3836 O  O   . HOH J 7 .   ? 22.110  -38.571 -29.193 1.00 58.03  ? 772 HOH A O   1 
HETATM 3837 O  O   . HOH J 7 .   ? 4.949   -33.155 4.332   1.00 59.19  ? 773 HOH A O   1 
HETATM 3838 O  O   . HOH J 7 .   ? 32.447  -35.476 -21.573 1.00 35.09  ? 774 HOH A O   1 
HETATM 3839 O  O   . HOH J 7 .   ? 6.317   -23.774 -38.542 1.00 54.47  ? 775 HOH A O   1 
HETATM 3840 O  O   . HOH J 7 .   ? 25.780  -30.556 -14.289 1.00 50.42  ? 776 HOH A O   1 
HETATM 3841 O  O   . HOH J 7 .   ? 26.680  -25.793 -44.652 1.00 75.11  ? 777 HOH A O   1 
HETATM 3842 O  O   . HOH J 7 .   ? 29.778  -20.645 -17.119 1.00 56.77  ? 778 HOH A O   1 
HETATM 3843 O  O   . HOH J 7 .   ? 8.498   -36.162 -25.109 1.00 37.14  ? 779 HOH A O   1 
HETATM 3844 O  O   . HOH J 7 .   ? -9.459  -36.096 -7.438  1.00 66.78  ? 780 HOH A O   1 
HETATM 3845 O  O   . HOH J 7 .   ? 22.433  -12.360 -35.651 1.00 56.51  ? 781 HOH A O   1 
HETATM 3846 O  O   . HOH J 7 .   ? 16.433  -34.457 9.928   1.00 74.94  ? 782 HOH A O   1 
HETATM 3847 O  O   . HOH J 7 .   ? 24.870  -32.383 -16.747 1.00 67.89  ? 783 HOH A O   1 
HETATM 3848 O  O   . HOH J 7 .   ? 0.171   -2.379  -33.236 1.00 51.24  ? 784 HOH A O   1 
HETATM 3849 O  O   . HOH J 7 .   ? 19.234  -19.154 -5.958  1.00 59.05  ? 785 HOH A O   1 
HETATM 3850 O  O   . HOH J 7 .   ? 12.548  -23.796 -39.631 1.00 35.41  ? 786 HOH A O   1 
HETATM 3851 O  O   . HOH J 7 .   ? 16.441  -28.006 -25.423 1.00 28.69  ? 787 HOH A O   1 
HETATM 3852 O  O   . HOH J 7 .   ? 4.585   -45.834 -7.969  1.00 51.96  ? 788 HOH A O   1 
HETATM 3853 O  O   . HOH J 7 .   ? -1.538  -20.359 -9.213  1.00 62.53  ? 789 HOH A O   1 
HETATM 3854 O  O   . HOH J 7 .   ? -11.431 -26.985 -25.503 1.00 35.89  ? 790 HOH A O   1 
HETATM 3855 O  O   . HOH J 7 .   ? 13.852  -12.704 -11.707 1.00 51.30  ? 791 HOH A O   1 
HETATM 3856 O  O   . HOH J 7 .   ? 11.729  -15.318 -6.475  1.00 61.91  ? 792 HOH A O   1 
HETATM 3857 O  O   . HOH J 7 .   ? -0.584  -13.750 -35.217 1.00 66.20  ? 793 HOH A O   1 
HETATM 3858 O  O   . HOH J 7 .   ? 33.867  -22.838 -20.341 1.00 46.86  ? 794 HOH A O   1 
HETATM 3859 O  O   . HOH J 7 .   ? -2.973  -34.062 -2.321  1.00 47.78  ? 795 HOH A O   1 
HETATM 3860 O  O   . HOH J 7 .   ? 23.970  -10.360 -27.310 1.00 49.28  ? 796 HOH A O   1 
HETATM 3861 O  O   . HOH J 7 .   ? 18.145  -8.687  -21.278 1.00 47.81  ? 797 HOH A O   1 
HETATM 3862 O  O   . HOH J 7 .   ? -1.191  -27.341 -1.032  1.00 54.57  ? 798 HOH A O   1 
HETATM 3863 O  O   . HOH J 7 .   ? -3.824  -8.660  -19.166 1.00 56.40  ? 799 HOH A O   1 
HETATM 3864 O  O   . HOH J 7 .   ? 36.650  -21.349 -23.968 1.00 63.41  ? 800 HOH A O   1 
HETATM 3865 O  O   . HOH J 7 .   ? 7.787   -28.029 10.980  1.00 56.83  ? 801 HOH A O   1 
HETATM 3866 O  O   . HOH J 7 .   ? 5.332   -16.996 -40.446 1.00 60.23  ? 802 HOH A O   1 
HETATM 3867 O  O   . HOH J 7 .   ? 6.024   -19.515 -6.589  1.00 56.45  ? 803 HOH A O   1 
HETATM 3868 O  O   . HOH J 7 .   ? 18.502  -12.781 -45.836 1.00 73.86  ? 804 HOH A O   1 
HETATM 3869 O  O   . HOH J 7 .   ? 7.436   -27.870 -33.603 1.00 59.48  ? 805 HOH A O   1 
HETATM 3870 O  O   . HOH J 7 .   ? 15.966  -31.847 -3.471  1.00 37.20  ? 806 HOH A O   1 
HETATM 3871 O  O   . HOH J 7 .   ? 12.464  -40.686 6.449   1.00 59.57  ? 807 HOH A O   1 
HETATM 3872 O  O   . HOH J 7 .   ? -4.075  -38.261 -17.604 1.00 39.66  ? 808 HOH A O   1 
HETATM 3873 O  O   . HOH J 7 .   ? 15.241  -28.863 8.001   1.00 69.95  ? 809 HOH A O   1 
HETATM 3874 O  O   . HOH J 7 .   ? -7.587  -32.217 -11.338 1.00 47.27  ? 810 HOH A O   1 
HETATM 3875 O  O   . HOH J 7 .   ? -13.647 -24.431 -12.750 1.00 36.21  ? 811 HOH A O   1 
HETATM 3876 O  O   . HOH J 7 .   ? 26.871  -41.435 -26.466 1.00 63.98  ? 812 HOH A O   1 
HETATM 3877 O  O   . HOH J 7 .   ? -6.976  -33.693 -13.339 1.00 52.80  ? 813 HOH A O   1 
HETATM 3878 O  O   . HOH J 7 .   ? 26.568  -26.065 -34.240 1.00 49.10  ? 814 HOH A O   1 
HETATM 3879 O  O   . HOH J 7 .   ? 11.958  -29.502 -35.310 1.00 61.58  ? 815 HOH A O   1 
HETATM 3880 O  O   . HOH J 7 .   ? -3.566  -20.826 -6.920  1.00 57.33  ? 816 HOH A O   1 
HETATM 3881 O  O   . HOH J 7 .   ? 30.437  -23.355 -33.436 1.00 47.81  ? 817 HOH A O   1 
HETATM 3882 O  O   . HOH J 7 .   ? -2.958  -27.823 -30.567 1.00 63.09  ? 818 HOH A O   1 
HETATM 3883 O  O   . HOH J 7 .   ? 17.101  -26.390 4.420   1.00 53.93  ? 819 HOH A O   1 
HETATM 3884 O  O   . HOH J 7 .   ? 19.843  -6.196  -36.721 1.00 50.61  ? 820 HOH A O   1 
HETATM 3885 O  O   . HOH J 7 .   ? 23.850  -22.890 -32.744 1.00 46.69  ? 821 HOH A O   1 
HETATM 3886 O  O   . HOH J 7 .   ? -9.268  -21.700 -8.959  1.00 65.31  ? 822 HOH A O   1 
HETATM 3887 O  O   . HOH J 7 .   ? -0.077  -40.244 -5.094  1.00 48.23  ? 823 HOH A O   1 
HETATM 3888 O  O   . HOH J 7 .   ? 17.663  -29.487 6.677   1.00 69.35  ? 824 HOH A O   1 
HETATM 3889 O  O   . HOH J 7 .   ? 10.175  -7.546  -39.640 1.00 49.40  ? 825 HOH A O   1 
HETATM 3890 O  O   . HOH J 7 .   ? -15.991 -23.070 -26.054 1.00 56.78  ? 826 HOH A O   1 
HETATM 3891 O  O   . HOH J 7 .   ? 22.482  -10.230 -19.949 1.00 63.54  ? 827 HOH A O   1 
HETATM 3892 O  O   . HOH J 7 .   ? 24.486  -12.376 -31.355 1.00 54.61  ? 828 HOH A O   1 
HETATM 3893 O  O   . HOH J 7 .   ? 19.020  -5.884  -22.671 1.00 46.45  ? 829 HOH A O   1 
HETATM 3894 O  O   . HOH J 7 .   ? 5.022   -17.547 -14.354 1.00 59.82  ? 830 HOH A O   1 
HETATM 3895 O  O   . HOH J 7 .   ? 16.067  -30.143 -32.670 1.00 54.57  ? 831 HOH A O   1 
HETATM 3896 O  O   . HOH J 7 .   ? -1.240  -41.050 -11.046 1.00 55.13  ? 832 HOH A O   1 
HETATM 3897 O  O   . HOH J 7 .   ? 16.994  -36.920 -16.548 1.00 39.08  ? 833 HOH A O   1 
HETATM 3898 O  O   . HOH J 7 .   ? -15.111 -20.759 -16.690 1.00 57.72  ? 834 HOH A O   1 
HETATM 3899 O  O   . HOH J 7 .   ? 7.852   -28.744 4.043   1.00 53.94  ? 835 HOH A O   1 
HETATM 3900 O  O   . HOH J 7 .   ? 10.955  -44.502 -17.108 1.00 49.15  ? 836 HOH A O   1 
HETATM 3901 O  O   . HOH J 7 .   ? 36.461  -15.192 -37.914 1.00 60.73  ? 837 HOH A O   1 
HETATM 3902 O  O   . HOH J 7 .   ? 32.897  -18.055 -18.803 1.00 57.92  ? 838 HOH A O   1 
HETATM 3903 O  O   . HOH J 7 .   ? -12.809 -19.789 -22.156 1.00 66.52  ? 839 HOH A O   1 
HETATM 3904 O  O   . HOH J 7 .   ? -0.532  -18.212 -24.835 1.00 57.09  ? 840 HOH A O   1 
HETATM 3905 O  O   . HOH J 7 .   ? 8.081   -37.795 6.498   1.00 55.66  ? 841 HOH A O   1 
HETATM 3906 O  O   . HOH J 7 .   ? 28.129  -33.867 -19.358 1.00 49.50  ? 842 HOH A O   1 
HETATM 3907 O  O   . HOH J 7 .   ? -4.463  -19.995 -26.230 1.00 57.57  ? 843 HOH A O   1 
HETATM 3908 O  O   . HOH J 7 .   ? -2.582  -11.987 -25.128 1.00 50.69  ? 844 HOH A O   1 
HETATM 3909 O  O   . HOH J 7 .   ? 4.572   -20.197 -13.198 1.00 45.27  ? 845 HOH A O   1 
HETATM 3910 O  O   . HOH J 7 .   ? -8.956  -25.441 -29.023 1.00 58.69  ? 846 HOH A O   1 
HETATM 3911 O  O   . HOH J 7 .   ? 12.069  -17.065 -2.356  1.00 52.24  ? 847 HOH A O   1 
HETATM 3912 O  O   . HOH J 7 .   ? 25.782  -29.187 -38.351 1.00 65.23  ? 848 HOH A O   1 
HETATM 3913 O  O   . HOH J 7 .   ? 1.506   -21.986 -37.694 1.00 67.61  ? 849 HOH A O   1 
HETATM 3914 O  O   . HOH J 7 .   ? 24.139  -11.951 -18.549 1.00 49.56  ? 850 HOH A O   1 
HETATM 3915 O  O   . HOH J 7 .   ? 21.789  -35.441 -19.208 1.00 52.57  ? 851 HOH A O   1 
HETATM 3916 O  O   . HOH J 7 .   ? 25.501  -11.409 -29.306 1.00 51.89  ? 852 HOH A O   1 
HETATM 3917 O  O   . HOH J 7 .   ? -0.275  -40.693 -18.610 1.00 61.66  ? 853 HOH A O   1 
HETATM 3918 O  O   . HOH J 7 .   ? 3.209   -28.795 5.391   1.00 66.00  ? 854 HOH A O   1 
HETATM 3919 O  O   . HOH J 7 .   ? 14.461  -12.458 -9.110  1.00 71.04  ? 855 HOH A O   1 
HETATM 3920 O  O   . HOH J 7 .   ? 3.293   -23.099 -7.326  1.00 56.79  ? 856 HOH A O   1 
HETATM 3921 O  O   . HOH J 7 .   ? -11.390 -26.180 -28.525 1.00 64.34  ? 857 HOH A O   1 
HETATM 3922 O  O   . HOH J 7 .   ? 11.584  -12.102 -9.847  1.00 69.82  ? 858 HOH A O   1 
HETATM 3923 O  O   . HOH J 7 .   ? 26.159  -30.217 -8.997  1.00 61.62  ? 859 HOH A O   1 
HETATM 3924 O  O   . HOH J 7 .   ? 7.473   -42.801 -24.067 1.00 59.58  ? 860 HOH A O   1 
HETATM 3925 O  O   . HOH J 7 .   ? 38.577  -25.693 -22.886 1.00 59.73  ? 861 HOH A O   1 
HETATM 3926 O  O   . HOH J 7 .   ? 10.719  -15.457 -4.031  1.00 79.26  ? 862 HOH A O   1 
HETATM 3927 O  O   . HOH J 7 .   ? 15.443  -41.995 2.871   1.00 54.29  ? 863 HOH A O   1 
HETATM 3928 O  O   . HOH J 7 .   ? 29.359  -38.486 -23.729 1.00 51.20  ? 864 HOH A O   1 
HETATM 3929 O  O   . HOH J 7 .   ? 25.750  -23.043 -1.446  1.00 61.18  ? 865 HOH A O   1 
HETATM 3930 O  O   . HOH J 7 .   ? 5.400   -43.999 -23.271 1.00 49.41  ? 866 HOH A O   1 
HETATM 3931 O  O   . HOH J 7 .   ? 29.923  -24.340 -46.097 1.00 58.01  ? 867 HOH A O   1 
HETATM 3932 O  O   . HOH J 7 .   ? 31.338  -33.582 -8.935  1.00 57.85  ? 868 HOH A O   1 
HETATM 3933 O  O   . HOH J 7 .   ? 32.116  -31.102 -8.083  1.00 78.16  ? 869 HOH A O   1 
HETATM 3934 O  O   . HOH K 7 .   ? 25.755  -59.604 -6.266  1.00 39.14  ? 701 HOH B O   1 
HETATM 3935 O  O   . HOH K 7 .   ? 24.205  -40.029 -7.370  1.00 51.38  ? 702 HOH B O   1 
HETATM 3936 O  O   . HOH K 7 .   ? 25.127  -75.977 -18.645 1.00 32.70  ? 703 HOH B O   1 
HETATM 3937 O  O   . HOH K 7 .   ? 36.579  -51.304 -12.400 1.00 53.56  ? 704 HOH B O   1 
HETATM 3938 O  O   . HOH K 7 .   ? 19.812  -45.227 5.112   1.00 55.50  ? 705 HOH B O   1 
HETATM 3939 O  O   . HOH K 7 .   ? 2.152   -56.059 -28.561 1.00 66.45  ? 706 HOH B O   1 
HETATM 3940 O  O   . HOH K 7 .   ? 23.650  -56.635 -0.538  1.00 42.56  ? 707 HOH B O   1 
HETATM 3941 O  O   . HOH K 7 .   ? 40.218  -55.966 -1.336  1.00 47.20  ? 708 HOH B O   1 
HETATM 3942 O  O   . HOH K 7 .   ? 41.160  -65.003 -9.546  1.00 81.53  ? 709 HOH B O   1 
HETATM 3943 O  O   . HOH K 7 .   ? 42.432  -54.134 -7.926  1.00 54.57  ? 710 HOH B O   1 
HETATM 3944 O  O   . HOH K 7 .   ? 6.471   -56.797 -20.570 1.00 49.96  ? 711 HOH B O   1 
HETATM 3945 O  O   . HOH K 7 .   ? 40.253  -63.603 -26.189 1.00 38.59  ? 712 HOH B O   1 
HETATM 3946 O  O   . HOH K 7 .   ? 18.328  -51.815 -32.280 1.00 37.24  ? 713 HOH B O   1 
HETATM 3947 O  O   . HOH K 7 .   ? 29.919  -56.978 -5.391  1.00 27.04  ? 714 HOH B O   1 
HETATM 3948 O  O   . HOH K 7 .   ? 32.738  -75.397 -31.929 1.00 53.71  ? 715 HOH B O   1 
HETATM 3949 O  O   . HOH K 7 .   ? 0.066   -49.351 -1.462  1.00 66.19  ? 716 HOH B O   1 
HETATM 3950 O  O   . HOH K 7 .   ? 20.561  -44.106 -28.082 1.00 50.02  ? 717 HOH B O   1 
HETATM 3951 O  O   . HOH K 7 .   ? 31.140  -43.032 -4.824  1.00 32.44  ? 718 HOH B O   1 
HETATM 3952 O  O   . HOH K 7 .   ? 38.025  -43.663 -4.944  1.00 61.11  ? 719 HOH B O   1 
HETATM 3953 O  O   . HOH K 7 .   ? 44.043  -71.297 -29.810 1.00 83.82  ? 720 HOH B O   1 
HETATM 3954 O  O   . HOH K 7 .   ? 28.733  -62.549 -7.799  1.00 45.94  ? 721 HOH B O   1 
HETATM 3955 O  O   . HOH K 7 .   ? 6.576   -42.819 -4.530  1.00 43.72  ? 722 HOH B O   1 
HETATM 3956 O  O   . HOH K 7 .   ? 39.112  -67.818 -27.571 1.00 42.07  ? 723 HOH B O   1 
HETATM 3957 O  O   . HOH K 7 .   ? 6.948   -65.555 -15.402 1.00 62.23  ? 724 HOH B O   1 
HETATM 3958 O  O   . HOH K 7 .   ? 32.028  -62.877 -39.979 1.00 58.87  ? 725 HOH B O   1 
HETATM 3959 O  O   . HOH K 7 .   ? 40.365  -66.507 -25.772 1.00 47.04  ? 726 HOH B O   1 
HETATM 3960 O  O   . HOH K 7 .   ? 21.972  -54.175 -19.010 1.00 22.99  ? 727 HOH B O   1 
HETATM 3961 O  O   . HOH K 7 .   ? 34.227  -68.901 -30.232 1.00 39.55  ? 728 HOH B O   1 
HETATM 3962 O  O   . HOH K 7 .   ? 43.585  -71.034 -11.610 1.00 45.69  ? 729 HOH B O   1 
HETATM 3963 O  O   . HOH K 7 .   ? 17.696  -69.245 -14.657 1.00 52.90  ? 730 HOH B O   1 
HETATM 3964 O  O   . HOH K 7 .   ? 15.674  -70.097 -16.702 1.00 73.41  ? 731 HOH B O   1 
HETATM 3965 O  O   . HOH K 7 .   ? 25.736  -52.904 -30.237 1.00 55.86  ? 732 HOH B O   1 
HETATM 3966 O  O   . HOH K 7 .   ? 21.015  -47.075 -8.418  1.00 27.04  ? 733 HOH B O   1 
HETATM 3967 O  O   . HOH K 7 .   ? 14.497  -47.599 8.566   1.00 58.67  ? 734 HOH B O   1 
HETATM 3968 O  O   . HOH K 7 .   ? 27.299  -61.412 -1.502  1.00 37.54  ? 735 HOH B O   1 
HETATM 3969 O  O   . HOH K 7 .   ? 14.824  -46.844 -15.592 1.00 39.57  ? 736 HOH B O   1 
HETATM 3970 O  O   . HOH K 7 .   ? 15.781  -72.023 -23.415 1.00 55.64  ? 737 HOH B O   1 
HETATM 3971 O  O   . HOH K 7 .   ? 35.164  -50.585 -20.014 1.00 61.95  ? 738 HOH B O   1 
HETATM 3972 O  O   . HOH K 7 .   ? 21.567  -41.987 -18.939 1.00 31.62  ? 739 HOH B O   1 
HETATM 3973 O  O   . HOH K 7 .   ? 9.956   -48.781 7.569   1.00 55.38  ? 740 HOH B O   1 
HETATM 3974 O  O   . HOH K 7 .   ? 29.724  -48.883 10.827  1.00 73.22  ? 741 HOH B O   1 
HETATM 3975 O  O   . HOH K 7 .   ? 20.843  -49.257 -11.868 1.00 25.47  ? 742 HOH B O   1 
HETATM 3976 O  O   . HOH K 7 .   ? 19.730  -33.609 -15.059 1.00 35.29  ? 743 HOH B O   1 
HETATM 3977 O  O   . HOH K 7 .   ? 16.261  -51.915 -37.783 1.00 52.72  ? 744 HOH B O   1 
HETATM 3978 O  O   . HOH K 7 .   ? 32.959  -51.012 -25.341 1.00 41.85  ? 745 HOH B O   1 
HETATM 3979 O  O   . HOH K 7 .   ? 43.605  -56.625 -13.143 1.00 47.30  ? 746 HOH B O   1 
HETATM 3980 O  O   . HOH K 7 .   ? 15.900  -45.853 -33.637 1.00 55.65  ? 747 HOH B O   1 
HETATM 3981 O  O   . HOH K 7 .   ? 27.518  -44.371 -16.048 1.00 35.62  ? 748 HOH B O   1 
HETATM 3982 O  O   . HOH K 7 .   ? 26.144  -62.953 -5.449  1.00 40.52  ? 749 HOH B O   1 
HETATM 3983 O  O   . HOH K 7 .   ? 17.222  -42.878 -17.567 1.00 34.99  ? 750 HOH B O   1 
HETATM 3984 O  O   . HOH K 7 .   ? 15.169  -67.243 -15.071 1.00 50.49  ? 751 HOH B O   1 
HETATM 3985 O  O   . HOH K 7 .   ? 11.287  -43.952 -28.871 1.00 71.18  ? 752 HOH B O   1 
HETATM 3986 O  O   . HOH K 7 .   ? 42.113  -68.901 -10.732 1.00 50.12  ? 753 HOH B O   1 
HETATM 3987 O  O   . HOH K 7 .   ? 8.011   -53.416 -19.874 1.00 40.50  ? 754 HOH B O   1 
HETATM 3988 O  O   . HOH K 7 .   ? 17.664  -50.582 -15.746 1.00 23.89  ? 755 HOH B O   1 
HETATM 3989 O  O   . HOH K 7 .   ? 16.075  -71.306 -19.101 1.00 77.20  ? 756 HOH B O   1 
HETATM 3990 O  O   . HOH K 7 .   ? 28.529  -64.897 -5.004  1.00 63.15  ? 757 HOH B O   1 
HETATM 3991 O  O   . HOH K 7 .   ? 2.594   -55.973 0.414   1.00 62.54  ? 758 HOH B O   1 
HETATM 3992 O  O   . HOH K 7 .   ? 15.938  -47.363 -18.665 1.00 39.41  ? 759 HOH B O   1 
HETATM 3993 O  O   . HOH K 7 .   ? 18.849  -60.741 -0.481  1.00 48.19  ? 760 HOH B O   1 
HETATM 3994 O  O   . HOH K 7 .   ? 36.582  -42.632 -12.747 1.00 62.49  ? 761 HOH B O   1 
HETATM 3995 O  O   . HOH K 7 .   ? 33.849  -55.470 -27.306 1.00 38.02  ? 762 HOH B O   1 
HETATM 3996 O  O   . HOH K 7 .   ? 5.836   -55.848 -30.252 1.00 65.26  ? 763 HOH B O   1 
HETATM 3997 O  O   . HOH K 7 .   ? 4.243   -52.598 -5.051  1.00 58.29  ? 764 HOH B O   1 
HETATM 3998 O  O   . HOH K 7 .   ? 13.041  -65.691 -12.142 1.00 57.90  ? 765 HOH B O   1 
HETATM 3999 O  O   . HOH K 7 .   ? 36.180  -60.018 -30.281 1.00 55.81  ? 766 HOH B O   1 
HETATM 4000 O  O   . HOH K 7 .   ? 40.926  -70.848 -25.381 1.00 50.15  ? 767 HOH B O   1 
HETATM 4001 O  O   . HOH K 7 .   ? 43.155  -47.319 -2.656  1.00 48.26  ? 768 HOH B O   1 
HETATM 4002 O  O   . HOH K 7 .   ? 19.173  -60.187 -36.492 1.00 45.81  ? 769 HOH B O   1 
HETATM 4003 O  O   . HOH K 7 .   ? 23.087  -53.364 -21.363 1.00 37.57  ? 770 HOH B O   1 
HETATM 4004 O  O   . HOH K 7 .   ? 34.874  -60.112 3.809   1.00 56.73  ? 771 HOH B O   1 
HETATM 4005 O  O   . HOH K 7 .   ? 23.817  -69.590 -22.996 1.00 42.48  ? 772 HOH B O   1 
HETATM 4006 O  O   . HOH K 7 .   ? 39.097  -54.953 -24.935 1.00 43.94  ? 773 HOH B O   1 
HETATM 4007 O  O   . HOH K 7 .   ? 10.475  -43.226 -8.067  1.00 52.27  ? 774 HOH B O   1 
HETATM 4008 O  O   . HOH K 7 .   ? 9.976   -52.055 -15.188 1.00 52.30  ? 775 HOH B O   1 
HETATM 4009 O  O   . HOH K 7 .   ? 35.869  -61.576 -8.028  1.00 54.42  ? 776 HOH B O   1 
HETATM 4010 O  O   . HOH K 7 .   ? 22.855  -70.095 -29.946 1.00 60.12  ? 777 HOH B O   1 
HETATM 4011 O  O   . HOH K 7 .   ? 27.531  -69.935 -30.699 1.00 64.12  ? 778 HOH B O   1 
HETATM 4012 O  O   . HOH K 7 .   ? 23.649  -60.548 -29.744 1.00 41.87  ? 779 HOH B O   1 
HETATM 4013 O  O   . HOH K 7 .   ? 30.569  -41.533 -12.470 1.00 51.65  ? 780 HOH B O   1 
HETATM 4014 O  O   . HOH K 7 .   ? 30.569  -57.109 4.197   1.00 52.97  ? 781 HOH B O   1 
HETATM 4015 O  O   . HOH K 7 .   ? 23.835  -48.472 -32.622 1.00 61.80  ? 782 HOH B O   1 
HETATM 4016 O  O   . HOH K 7 .   ? 4.934   -49.205 -8.027  1.00 60.00  ? 783 HOH B O   1 
HETATM 4017 O  O   . HOH K 7 .   ? 40.556  -71.743 -33.619 1.00 71.50  ? 784 HOH B O   1 
HETATM 4018 O  O   . HOH K 7 .   ? 18.047  -69.443 -8.521  1.00 63.67  ? 785 HOH B O   1 
HETATM 4019 O  O   . HOH K 7 .   ? 40.004  -44.842 -2.512  1.00 65.40  ? 786 HOH B O   1 
HETATM 4020 O  O   . HOH K 7 .   ? 31.678  -40.961 -2.092  1.00 64.74  ? 787 HOH B O   1 
HETATM 4021 O  O   . HOH K 7 .   ? 20.126  -40.036 3.548   1.00 37.79  ? 788 HOH B O   1 
HETATM 4022 O  O   . HOH K 7 .   ? 37.367  -60.060 4.043   1.00 67.15  ? 789 HOH B O   1 
HETATM 4023 O  O   . HOH K 7 .   ? 13.199  -43.221 -30.303 1.00 50.70  ? 790 HOH B O   1 
HETATM 4024 O  O   . HOH K 7 .   ? 11.591  -72.163 -17.495 1.00 71.57  ? 791 HOH B O   1 
HETATM 4025 O  O   . HOH K 7 .   ? 29.380  -47.522 -23.368 1.00 59.49  ? 792 HOH B O   1 
HETATM 4026 O  O   . HOH K 7 .   ? 19.448  -35.816 -8.338  1.00 37.41  ? 793 HOH B O   1 
HETATM 4027 O  O   . HOH K 7 .   ? 33.668  -57.390 -30.830 1.00 57.01  ? 794 HOH B O   1 
HETATM 4028 O  O   . HOH K 7 .   ? 7.925   -50.085 -5.467  1.00 45.72  ? 795 HOH B O   1 
HETATM 4029 O  O   . HOH K 7 .   ? 8.132   -52.400 -32.555 1.00 64.42  ? 796 HOH B O   1 
HETATM 4030 O  O   . HOH K 7 .   ? 6.077   -57.251 -17.901 1.00 54.30  ? 797 HOH B O   1 
HETATM 4031 O  O   . HOH K 7 .   ? 3.664   -57.180 2.538   1.00 49.07  ? 798 HOH B O   1 
HETATM 4032 O  O   . HOH K 7 .   ? 17.861  -41.698 1.971   1.00 40.93  ? 799 HOH B O   1 
HETATM 4033 O  O   . HOH K 7 .   ? 32.401  -59.567 3.475   1.00 62.24  ? 800 HOH B O   1 
HETATM 4034 O  O   . HOH K 7 .   ? 43.628  -66.989 -21.831 1.00 61.03  ? 801 HOH B O   1 
HETATM 4035 O  O   . HOH K 7 .   ? 36.557  -53.064 7.960   1.00 44.22  ? 802 HOH B O   1 
HETATM 4036 O  O   . HOH K 7 .   ? 26.373  -46.574 -27.532 1.00 67.21  ? 803 HOH B O   1 
HETATM 4037 O  O   . HOH K 7 .   ? 11.737  -54.985 9.262   1.00 50.89  ? 804 HOH B O   1 
HETATM 4038 O  O   . HOH K 7 .   ? 17.760  -40.334 -18.548 1.00 31.46  ? 805 HOH B O   1 
HETATM 4039 O  O   . HOH K 7 .   ? 43.514  -50.377 -2.130  1.00 49.30  ? 806 HOH B O   1 
HETATM 4040 O  O   . HOH K 7 .   ? 17.070  -76.895 -22.576 1.00 67.90  ? 807 HOH B O   1 
HETATM 4041 O  O   . HOH K 7 .   ? 40.817  -60.094 -28.756 1.00 70.07  ? 808 HOH B O   1 
HETATM 4042 O  O   . HOH K 7 .   ? 8.840   -52.331 4.313   1.00 52.09  ? 809 HOH B O   1 
HETATM 4043 O  O   . HOH K 7 .   ? 22.658  -45.331 -29.320 1.00 52.59  ? 810 HOH B O   1 
HETATM 4044 O  O   . HOH K 7 .   ? 35.973  -49.848 -10.313 1.00 59.94  ? 811 HOH B O   1 
HETATM 4045 O  O   . HOH K 7 .   ? 11.594  -67.359 -22.202 1.00 56.89  ? 812 HOH B O   1 
HETATM 4046 O  O   . HOH K 7 .   ? 39.492  -65.696 -7.266  1.00 61.01  ? 813 HOH B O   1 
HETATM 4047 O  O   . HOH K 7 .   ? 34.556  -45.301 -15.011 1.00 62.70  ? 814 HOH B O   1 
HETATM 4048 O  O   . HOH K 7 .   ? 19.041  -34.194 3.614   1.00 62.84  ? 815 HOH B O   1 
HETATM 4049 O  O   . HOH K 7 .   ? 41.596  -56.828 -9.678  1.00 60.69  ? 816 HOH B O   1 
HETATM 4050 O  O   . HOH K 7 .   ? 22.922  -59.523 -31.725 1.00 33.47  ? 817 HOH B O   1 
HETATM 4051 O  O   . HOH K 7 .   ? 6.329   -44.061 6.402   1.00 56.91  ? 818 HOH B O   1 
HETATM 4052 O  O   . HOH K 7 .   ? 29.393  -55.932 -37.428 1.00 70.30  ? 819 HOH B O   1 
HETATM 4053 O  O   . HOH K 7 .   ? -2.232  -49.199 3.299   1.00 62.44  ? 820 HOH B O   1 
HETATM 4054 O  O   . HOH K 7 .   ? 5.793   -58.523 -30.240 1.00 56.82  ? 821 HOH B O   1 
HETATM 4055 O  O   . HOH K 7 .   ? 24.166  -39.542 0.558   1.00 57.29  ? 822 HOH B O   1 
HETATM 4056 O  O   . HOH K 7 .   ? 44.590  -50.373 -4.466  1.00 65.68  ? 823 HOH B O   1 
HETATM 4057 O  O   . HOH K 7 .   ? 14.743  -61.171 2.916   1.00 48.66  ? 824 HOH B O   1 
HETATM 4058 O  O   . HOH K 7 .   ? 36.481  -63.740 -36.000 1.00 51.55  ? 825 HOH B O   1 
HETATM 4059 O  O   . HOH K 7 .   ? 15.520  -44.275 -15.562 1.00 34.83  ? 826 HOH B O   1 
HETATM 4060 O  O   . HOH K 7 .   ? 8.156   -52.125 -13.420 1.00 52.98  ? 827 HOH B O   1 
HETATM 4061 O  O   . HOH K 7 .   ? 9.326   -50.747 -24.515 1.00 45.92  ? 828 HOH B O   1 
HETATM 4062 O  O   . HOH K 7 .   ? 20.280  -43.987 -34.225 1.00 57.37  ? 829 HOH B O   1 
HETATM 4063 O  O   . HOH K 7 .   ? 13.633  -47.004 -21.540 1.00 48.10  ? 830 HOH B O   1 
HETATM 4064 O  O   . HOH K 7 .   ? -1.490  -42.441 3.354   1.00 60.05  ? 831 HOH B O   1 
HETATM 4065 O  O   . HOH K 7 .   ? 41.895  -67.003 -33.010 1.00 59.59  ? 832 HOH B O   1 
HETATM 4066 O  O   . HOH K 7 .   ? 34.310  -37.840 1.898   1.00 61.99  ? 833 HOH B O   1 
HETATM 4067 O  O   . HOH K 7 .   ? 26.017  -63.592 -40.140 1.00 59.09  ? 834 HOH B O   1 
HETATM 4068 O  O   . HOH K 7 .   ? 12.278  -48.691 -16.844 1.00 58.65  ? 835 HOH B O   1 
HETATM 4069 O  O   . HOH K 7 .   ? 23.353  -63.364 -3.012  1.00 64.64  ? 836 HOH B O   1 
HETATM 4070 O  O   . HOH K 7 .   ? 18.394  -43.381 6.000   1.00 60.22  ? 837 HOH B O   1 
HETATM 4071 O  O   . HOH K 7 .   ? -2.964  -48.758 -0.881  1.00 62.57  ? 838 HOH B O   1 
HETATM 4072 O  O   . HOH K 7 .   ? 4.591   -59.187 -5.557  1.00 68.48  ? 839 HOH B O   1 
HETATM 4073 O  O   . HOH K 7 .   ? 23.861  -37.263 -6.245  1.00 50.73  ? 840 HOH B O   1 
HETATM 4074 O  O   . HOH K 7 .   ? 37.650  -42.546 -7.380  1.00 74.16  ? 841 HOH B O   1 
HETATM 4075 O  O   . HOH K 7 .   ? 26.104  -41.667 2.545   1.00 64.75  ? 842 HOH B O   1 
HETATM 4076 O  O   . HOH K 7 .   ? 4.727   -59.959 -3.035  1.00 64.94  ? 843 HOH B O   1 
HETATM 4077 O  O   . HOH K 7 .   ? 44.163  -65.743 -31.314 0.50 93.71  ? 844 HOH B O   1 
HETATM 4078 O  O   . HOH K 7 .   ? 25.157  -37.118 -3.898  1.00 54.67  ? 845 HOH B O   1 
HETATM 4079 O  O   . HOH K 7 .   ? 33.798  -69.349 -38.169 1.00 74.09  ? 846 HOH B O   1 
HETATM 4080 O  O   . HOH K 7 .   ? -0.424  -48.957 -4.807  1.00 63.70  ? 847 HOH B O   1 
HETATM 4081 O  O   . HOH K 7 .   ? 35.300  -71.551 -39.096 1.00 64.01  ? 848 HOH B O   1 
HETATM 4082 O  O   . HOH K 7 .   ? 36.241  -74.194 -38.156 1.00 66.26  ? 849 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 35  ? 0.6106 0.6187 0.8344 -0.0437 0.0078  0.1044  362 VAL A N   
2    C CA  . VAL A 35  ? 0.5831 0.5900 0.7807 -0.0321 0.0084  0.0893  362 VAL A CA  
3    C C   . VAL A 35  ? 0.5826 0.6141 0.7774 -0.0237 0.0192  0.0915  362 VAL A C   
4    O O   . VAL A 35  ? 0.5826 0.6293 0.7951 -0.0270 0.0209  0.0946  362 VAL A O   
5    C CB  . VAL A 35  ? 0.5811 0.5762 0.7736 -0.0360 -0.0033 0.0731  362 VAL A CB  
6    C CG1 . VAL A 35  ? 0.5740 0.5661 0.7431 -0.0253 -0.0030 0.0593  362 VAL A CG1 
7    C CG2 . VAL A 35  ? 0.6000 0.5674 0.7948 -0.0466 -0.0137 0.0713  362 VAL A CG2 
8    N N   . SER A 36  ? 0.5460 0.5802 0.7187 -0.0132 0.0261  0.0907  363 SER A N   
9    C CA  . SER A 36  ? 0.5094 0.5591 0.6700 -0.0047 0.0356  0.0888  363 SER A CA  
10   C C   . SER A 36  ? 0.4822 0.5339 0.6388 -0.0031 0.0301  0.0731  363 SER A C   
11   O O   . SER A 36  ? 0.4666 0.5070 0.6218 -0.0063 0.0191  0.0625  363 SER A O   
12   C CB  . SER A 36  ? 0.5370 0.5836 0.6700 0.0036  0.0391  0.0895  363 SER A CB  
13   O OG  . SER A 36  ? 0.5087 0.5464 0.6273 0.0061  0.0293  0.0762  363 SER A OG  
14   N N   . LEU A 37  ? 0.4552 0.5192 0.6083 0.0027  0.0390  0.0720  364 LEU A N   
15   C CA  . LEU A 37  ? 0.4242 0.4898 0.5747 0.0047  0.0349  0.0588  364 LEU A CA  
16   C C   . LEU A 37  ? 0.4161 0.4702 0.5433 0.0077  0.0266  0.0449  364 LEU A C   
17   O O   . LEU A 37  ? 0.3845 0.4334 0.5144 0.0050  0.0174  0.0350  364 LEU A O   
18   C CB  . LEU A 37  ? 0.4346 0.5123 0.5845 0.0122  0.0482  0.0608  364 LEU A CB  
19   C CG  . LEU A 37  ? 0.4223 0.5000 0.5675 0.0160  0.0459  0.0481  364 LEU A CG  
20   C CD1 . LEU A 37  ? 0.3968 0.4770 0.5662 0.0080  0.0341  0.0458  364 LEU A CD1 
21   C CD2 . LEU A 37  ? 0.4261 0.5112 0.5671 0.0258  0.0623  0.0506  364 LEU A CD2 
22   N N   . ILE A 38  ? 0.4175 0.4685 0.5224 0.0130  0.0294  0.0457  365 ILE A N   
23   C CA  . ILE A 38  ? 0.3973 0.4409 0.4844 0.0151  0.0209  0.0359  365 ILE A CA  
24   C C   . ILE A 38  ? 0.3838 0.4185 0.4801 0.0114  0.0115  0.0341  365 ILE A C   
25   O O   . ILE A 38  ? 0.3843 0.4152 0.4779 0.0118  0.0050  0.0243  365 ILE A O   
26   C CB  . ILE A 38  ? 0.4415 0.4842 0.5022 0.0201  0.0231  0.0386  365 ILE A CB  
27   C CG1 . ILE A 38  ? 0.4391 0.4778 0.4847 0.0211  0.0134  0.0278  365 ILE A CG1 
28   C CG2 . ILE A 38  ? 0.4468 0.4879 0.5072 0.0198  0.0239  0.0519  365 ILE A CG2 
29   C CD1 . ILE A 38  ? 0.4751 0.5113 0.4903 0.0244  0.0145  0.0263  365 ILE A CD1 
30   N N   . SER A 39  ? 0.3865 0.4162 0.4939 0.0080  0.0121  0.0437  366 SER A N   
31   C CA  . SER A 39  ? 0.3628 0.3786 0.4776 0.0049  0.0054  0.0417  366 SER A CA  
32   C C   . SER A 39  ? 0.3383 0.3489 0.4609 0.0001  0.0001  0.0320  366 SER A C   
33   O O   . SER A 39  ? 0.3361 0.3357 0.4538 0.0011  -0.0046 0.0241  366 SER A O   
34   C CB  . SER A 39  ? 0.4034 0.4114 0.5296 0.0005  0.0073  0.0537  366 SER A CB  
35   O OG  . SER A 39  ? 0.4574 0.4631 0.5759 0.0054  0.0093  0.0623  366 SER A OG  
36   N N   . ALA A 40  ? 0.3088 0.3273 0.4438 -0.0048 0.0012  0.0341  367 ALA A N   
37   C CA  . ALA A 40  ? 0.3000 0.3152 0.4415 -0.0100 -0.0055 0.0263  367 ALA A CA  
38   C C   . ALA A 40  ? 0.2799 0.2982 0.4097 -0.0047 -0.0070 0.0149  367 ALA A C   
39   O O   . ALA A 40  ? 0.2817 0.2902 0.4078 -0.0067 -0.0133 0.0067  367 ALA A O   
40   C CB  . ALA A 40  ? 0.2885 0.3156 0.4507 -0.0163 -0.0049 0.0342  367 ALA A CB  
41   N N   . LEU A 41  ? 0.2692 0.2984 0.3911 0.0016  -0.0011 0.0145  368 LEU A N   
42   C CA  . LEU A 41  ? 0.2553 0.2858 0.3667 0.0057  -0.0028 0.0045  368 LEU A CA  
43   C C   . LEU A 41  ? 0.2590 0.2810 0.3609 0.0079  -0.0073 -0.0001 368 LEU A C   
44   O O   . LEU A 41  ? 0.2437 0.2627 0.3430 0.0083  -0.0109 -0.0078 368 LEU A O   
45   C CB  . LEU A 41  ? 0.2661 0.3051 0.3673 0.0110  0.0040  0.0046  368 LEU A CB  
46   C CG  . LEU A 41  ? 0.2690 0.3176 0.3817 0.0118  0.0120  0.0097  368 LEU A CG  
47   C CD1 . LEU A 41  ? 0.2800 0.3311 0.3764 0.0189  0.0220  0.0097  368 LEU A CD1 
48   C CD2 . LEU A 41  ? 0.2523 0.3034 0.3776 0.0098  0.0080  0.0050  368 LEU A CD2 
49   N N   . VAL A 42  ? 0.2592 0.2783 0.3579 0.0098  -0.0064 0.0061  369 VAL A N   
50   C CA  . VAL A 42  ? 0.2724 0.2859 0.3674 0.0133  -0.0093 0.0049  369 VAL A CA  
51   C C   . VAL A 42  ? 0.2817 0.2806 0.3804 0.0118  -0.0109 0.0007  369 VAL A C   
52   O O   . VAL A 42  ? 0.2786 0.2741 0.3744 0.0148  -0.0118 -0.0046 369 VAL A O   
53   C CB  . VAL A 42  ? 0.2796 0.2946 0.3720 0.0166  -0.0083 0.0149  369 VAL A CB  
54   C CG1 . VAL A 42  ? 0.2867 0.2959 0.3825 0.0211  -0.0101 0.0166  369 VAL A CG1 
55   C CG2 . VAL A 42  ? 0.2839 0.3101 0.3639 0.0182  -0.0090 0.0161  369 VAL A CG2 
56   N N   . ARG A 43  ? 0.3009 0.2899 0.4045 0.0066  -0.0111 0.0032  370 ARG A N   
57   C CA  . ARG A 43  ? 0.3314 0.3004 0.4321 0.0040  -0.0136 -0.0018 370 ARG A CA  
58   C C   . ARG A 43  ? 0.3116 0.2804 0.4076 0.0019  -0.0172 -0.0110 370 ARG A C   
59   O O   . ARG A 43  ? 0.3043 0.2596 0.3908 0.0045  -0.0169 -0.0170 370 ARG A O   
60   C CB  . ARG A 43  ? 0.3914 0.3482 0.4979 -0.0040 -0.0161 0.0026  370 ARG A CB  
61   C CG  . ARG A 43  ? 0.5030 0.4584 0.6158 -0.0035 -0.0124 0.0138  370 ARG A CG  
62   C CD  . ARG A 43  ? 0.5633 0.5066 0.6712 0.0044  -0.0083 0.0169  370 ARG A CD  
63   N NE  . ARG A 43  ? 0.6393 0.5840 0.7539 0.0053  -0.0051 0.0299  370 ARG A NE  
64   C CZ  . ARG A 43  ? 0.5945 0.5584 0.7101 0.0094  -0.0024 0.0385  370 ARG A CZ  
65   N NH1 . ARG A 43  ? 0.6321 0.6140 0.7422 0.0123  -0.0031 0.0343  370 ARG A NH1 
66   N NH2 . ARG A 43  ? 0.4692 0.4321 0.5887 0.0101  0.0004  0.0511  370 ARG A NH2 
67   N N   . ALA A 44  ? 0.2778 0.2612 0.3801 -0.0013 -0.0191 -0.0111 371 ALA A N   
68   C CA  . ALA A 44  ? 0.2877 0.2724 0.3875 -0.0031 -0.0229 -0.0177 371 ALA A CA  
69   C C   . ALA A 44  ? 0.2744 0.2604 0.3659 0.0036  -0.0203 -0.0230 371 ALA A C   
70   O O   . ALA A 44  ? 0.2766 0.2531 0.3601 0.0038  -0.0218 -0.0285 371 ALA A O   
71   C CB  . ALA A 44  ? 0.2722 0.2749 0.3835 -0.0050 -0.0228 -0.0146 371 ALA A CB  
72   N N   . HIS A 45  ? 0.2608 0.2582 0.3539 0.0083  -0.0170 -0.0201 372 HIS A N   
73   C CA  . HIS A 45  ? 0.2691 0.2702 0.3591 0.0132  -0.0161 -0.0226 372 HIS A CA  
74   C C   . HIS A 45  ? 0.2790 0.2686 0.3666 0.0176  -0.0131 -0.0221 372 HIS A C   
75   O O   . HIS A 45  ? 0.2837 0.2685 0.3674 0.0198  -0.0114 -0.0261 372 HIS A O   
76   C CB  . HIS A 45  ? 0.2565 0.2703 0.3471 0.0153  -0.0161 -0.0189 372 HIS A CB  
77   C CG  . HIS A 45  ? 0.2563 0.2753 0.3479 0.0182  -0.0175 -0.0192 372 HIS A CG  
78   N ND1 . HIS A 45  ? 0.2449 0.2674 0.3362 0.0171  -0.0193 -0.0241 372 HIS A ND1 
79   C CD2 . HIS A 45  ? 0.2606 0.2826 0.3573 0.0220  -0.0175 -0.0132 372 HIS A CD2 
80   C CE1 . HIS A 45  ? 0.2532 0.2814 0.3496 0.0189  -0.0208 -0.0212 372 HIS A CE1 
81   N NE2 . HIS A 45  ? 0.2552 0.2845 0.3562 0.0223  -0.0198 -0.0141 372 HIS A NE2 
82   N N   . VAL A 46  ? 0.2944 0.2780 0.3838 0.0197  -0.0109 -0.0165 373 VAL A N   
83   C CA  . VAL A 46  ? 0.3054 0.2769 0.3939 0.0265  -0.0055 -0.0145 373 VAL A CA  
84   C C   . VAL A 46  ? 0.3328 0.2816 0.4084 0.0259  -0.0032 -0.0220 373 VAL A C   
85   O O   . VAL A 46  ? 0.3294 0.2705 0.4002 0.0325  0.0030  -0.0238 373 VAL A O   
86   C CB  . VAL A 46  ? 0.3056 0.2736 0.3992 0.0292  -0.0035 -0.0059 373 VAL A CB  
87   C CG1 . VAL A 46  ? 0.3117 0.2629 0.4047 0.0375  0.0038  -0.0037 373 VAL A CG1 
88   C CG2 . VAL A 46  ? 0.2770 0.2665 0.3786 0.0305  -0.0065 0.0017  373 VAL A CG2 
89   N N   . ASP A 47  ? 0.3366 0.2749 0.4059 0.0178  -0.0085 -0.0258 374 ASP A N   
90   C CA  . ASP A 47  ? 0.3709 0.2842 0.4228 0.0151  -0.0094 -0.0333 374 ASP A CA  
91   C C   . ASP A 47  ? 0.3843 0.3013 0.4286 0.0132  -0.0122 -0.0391 374 ASP A C   
92   O O   . ASP A 47  ? 0.4312 0.3275 0.4571 0.0102  -0.0145 -0.0453 374 ASP A O   
93   C CB  . ASP A 47  ? 0.3941 0.2936 0.4436 0.0052  -0.0167 -0.0335 374 ASP A CB  
94   C CG  . ASP A 47  ? 0.4304 0.3160 0.4822 0.0074  -0.0127 -0.0284 374 ASP A CG  
95   O OD1 . ASP A 47  ? 0.4525 0.3315 0.5024 0.0180  -0.0036 -0.0266 374 ASP A OD1 
96   O OD2 . ASP A 47  ? 0.4262 0.3069 0.4832 -0.0010 -0.0184 -0.0251 374 ASP A OD2 
97   N N   . SER A 48  ? 0.3439 0.2843 0.3995 0.0147  -0.0125 -0.0372 375 SER A N   
98   C CA  . SER A 48  ? 0.3504 0.2933 0.3997 0.0140  -0.0139 -0.0414 375 SER A CA  
99   C C   . SER A 48  ? 0.3351 0.2892 0.3902 0.0215  -0.0069 -0.0391 375 SER A C   
100  O O   . SER A 48  ? 0.3419 0.3040 0.3978 0.0209  -0.0079 -0.0403 375 SER A O   
101  C CB  . SER A 48  ? 0.3183 0.2768 0.3771 0.0075  -0.0215 -0.0408 375 SER A CB  
102  O OG  . SER A 48  ? 0.2972 0.2750 0.3703 0.0093  -0.0201 -0.0368 375 SER A OG  
103  N N   . ASN A 49  ? 0.3325 0.2882 0.3944 0.0282  -0.0004 -0.0343 376 ASN A N   
104  C CA  . ASN A 49  ? 0.3197 0.2893 0.3932 0.0345  0.0050  -0.0292 376 ASN A CA  
105  C C   . ASN A 49  ? 0.3365 0.2926 0.4064 0.0441  0.0165  -0.0264 376 ASN A C   
106  O O   . ASN A 49  ? 0.3512 0.2903 0.4138 0.0465  0.0194  -0.0269 376 ASN A O   
107  C CB  . ASN A 49  ? 0.2925 0.2832 0.3831 0.0332  0.0002  -0.0231 376 ASN A CB  
108  C CG  . ASN A 49  ? 0.3072 0.3097 0.3993 0.0264  -0.0074 -0.0264 376 ASN A CG  
109  O OD1 . ASN A 49  ? 0.3006 0.3106 0.3972 0.0260  -0.0077 -0.0263 376 ASN A OD1 
110  N ND2 . ASN A 49  ? 0.2868 0.2896 0.3759 0.0217  -0.0121 -0.0286 376 ASN A ND2 
111  N N   . PRO A 50  ? 0.3420 0.3046 0.4180 0.0502  0.0244  -0.0224 377 PRO A N   
112  C CA  . PRO A 50  ? 0.3550 0.3053 0.4298 0.0621  0.0387  -0.0179 377 PRO A CA  
113  C C   . PRO A 50  ? 0.3527 0.3157 0.4497 0.0672  0.0397  -0.0075 377 PRO A C   
114  O O   . PRO A 50  ? 0.3571 0.3421 0.4706 0.0616  0.0294  -0.0027 377 PRO A O   
115  C CB  . PRO A 50  ? 0.3485 0.3106 0.4322 0.0670  0.0470  -0.0125 377 PRO A CB  
116  C CG  . PRO A 50  ? 0.3311 0.3196 0.4329 0.0577  0.0344  -0.0101 377 PRO A CG  
117  C CD  . PRO A 50  ? 0.3100 0.2918 0.3976 0.0477  0.0221  -0.0197 377 PRO A CD  
118  N N   . ALA A 51  ? 0.3693 0.3156 0.4633 0.0777  0.0516  -0.0044 378 ALA A N   
119  C CA  . ALA A 51  ? 0.3778 0.3331 0.4920 0.0838  0.0532  0.0066  378 ALA A CA  
120  C C   . ALA A 51  ? 0.3622 0.3409 0.5050 0.0933  0.0615  0.0211  378 ALA A C   
121  O O   . ALA A 51  ? 0.3515 0.3241 0.4922 0.1018  0.0755  0.0223  378 ALA A O   
122  C CB  . ALA A 51  ? 0.3921 0.3140 0.4895 0.0915  0.0633  0.0036  378 ALA A CB  
123  N N   . MET A 52  ? 0.3613 0.3672 0.5308 0.0913  0.0523  0.0329  379 MET A N   
124  C CA  . MET A 52  ? 0.3905 0.4217 0.5936 0.0992  0.0573  0.0502  379 MET A CA  
125  C C   . MET A 52  ? 0.3974 0.4141 0.6063 0.1174  0.0791  0.0579  379 MET A C   
126  O O   . MET A 52  ? 0.3779 0.4099 0.6096 0.1260  0.0896  0.0697  379 MET A O   
127  C CB  . MET A 52  ? 0.4241 0.4794 0.6483 0.0940  0.0419  0.0617  379 MET A CB  
128  C CG  . MET A 52  ? 0.4946 0.5782 0.7578 0.1013  0.0436  0.0827  379 MET A CG  
129  S SD  . MET A 52  ? 0.6127 0.7260 0.8919 0.0872  0.0281  0.0854  379 MET A SD  
130  C CE  . MET A 52  ? 0.5331 0.6644 0.8187 0.0766  0.0042  0.0928  379 MET A CE  
131  N N   . THR A 53  ? 0.4097 0.3951 0.5974 0.1233  0.0865  0.0512  380 THR A N   
132  C CA  . THR A 53  ? 0.4417 0.4066 0.6300 0.1416  0.1085  0.0569  380 THR A CA  
133  C C   . THR A 53  ? 0.4688 0.4048 0.6279 0.1484  0.1257  0.0457  380 THR A C   
134  O O   . THR A 53  ? 0.4960 0.4122 0.6515 0.1654  0.1475  0.0497  380 THR A O   
135  C CB  . THR A 53  ? 0.4577 0.3973 0.6359 0.1456  0.1095  0.0557  380 THR A CB  
136  O OG1 . THR A 53  ? 0.4725 0.3835 0.6141 0.1335  0.1008  0.0370  380 THR A OG1 
137  C CG2 . THR A 53  ? 0.4258 0.3953 0.6352 0.1430  0.0963  0.0715  380 THR A CG2 
138  N N   . SER A 54  ? 0.4643 0.3946 0.5993 0.1362  0.1172  0.0318  381 SER A N   
139  C CA  . SER A 54  ? 0.5173 0.4244 0.6246 0.1422  0.1327  0.0236  381 SER A CA  
140  C C   . SER A 54  ? 0.5018 0.4297 0.6112 0.1325  0.1256  0.0219  381 SER A C   
141  O O   . SER A 54  ? 0.5284 0.4386 0.6059 0.1238  0.1200  0.0080  381 SER A O   
142  C CB  . SER A 54  ? 0.5623 0.4211 0.6218 0.1403  0.1344  0.0055  381 SER A CB  
143  O OG  . SER A 54  ? 0.5310 0.3909 0.5809 0.1225  0.1121  -0.0042 381 SER A OG  
144  N N   . LEU A 55  ? 0.4498 0.4163 0.5992 0.1332  0.1244  0.0376  382 LEU A N   
145  C CA  . LEU A 55  ? 0.4200 0.4079 0.5786 0.1256  0.1201  0.0399  382 LEU A CA  
146  C C   . LEU A 55  ? 0.4545 0.4313 0.6044 0.1389  0.1440  0.0439  382 LEU A C   
147  O O   . LEU A 55  ? 0.4787 0.4466 0.6346 0.1559  0.1645  0.0523  382 LEU A O   
148  C CB  . LEU A 55  ? 0.3705 0.4016 0.5756 0.1196  0.1078  0.0559  382 LEU A CB  
149  C CG  . LEU A 55  ? 0.3297 0.3698 0.5344 0.1041  0.0830  0.0495  382 LEU A CG  
150  C CD1 . LEU A 55  ? 0.2913 0.3686 0.5339 0.0967  0.0692  0.0636  382 LEU A CD1 
151  C CD2 . LEU A 55  ? 0.3031 0.3251 0.4738 0.0920  0.0722  0.0310  382 LEU A CD2 
152  N N   . ASP A 56  ? 0.4493 0.4269 0.5862 0.1325  0.1431  0.0395  383 ASP A N   
153  C CA  . ASP A 56  ? 0.4806 0.4478 0.6063 0.1449  0.1666  0.0442  383 ASP A CA  
154  C C   . ASP A 56  ? 0.4466 0.4535 0.6155 0.1435  0.1690  0.0626  383 ASP A C   
155  O O   . ASP A 56  ? 0.4199 0.4406 0.5925 0.1295  0.1544  0.0605  383 ASP A O   
156  C CB  . ASP A 56  ? 0.5206 0.4540 0.5938 0.1388  0.1640  0.0261  383 ASP A CB  
157  C CG  . ASP A 56  ? 0.5639 0.4819 0.6145 0.1500  0.1872  0.0290  383 ASP A CG  
158  O OD1 . ASP A 56  ? 0.5735 0.5028 0.6465 0.1651  0.2098  0.0445  383 ASP A OD1 
159  O OD2 . ASP A 56  ? 0.6059 0.5010 0.6160 0.1432  0.1820  0.0165  383 ASP A OD2 
160  N N   . TYR A 57  ? 0.4606 0.4848 0.6638 0.1581  0.1873  0.0814  384 TYR A N   
161  C CA  . TYR A 57  ? 0.4481 0.5103 0.6976 0.1588  0.1932  0.1028  384 TYR A CA  
162  C C   . TYR A 57  ? 0.4665 0.5193 0.7028 0.1701  0.2191  0.1084  384 TYR A C   
163  O O   . TYR A 57  ? 0.4835 0.5683 0.7602 0.1705  0.2256  0.1278  384 TYR A O   
164  C CB  . TYR A 57  ? 0.4419 0.5341 0.7438 0.1685  0.1987  0.1246  384 TYR A CB  
165  C CG  . TYR A 57  ? 0.4214 0.5422 0.7539 0.1520  0.1685  0.1282  384 TYR A CG  
166  C CD1 . TYR A 57  ? 0.4102 0.5689 0.7834 0.1384  0.1535  0.1420  384 TYR A CD1 
167  C CD2 . TYR A 57  ? 0.4109 0.5202 0.7314 0.1496  0.1551  0.1190  384 TYR A CD2 
168  C CE1 . TYR A 57  ? 0.4009 0.5815 0.7956 0.1227  0.1252  0.1443  384 TYR A CE1 
169  C CE2 . TYR A 57  ? 0.4115 0.5445 0.7540 0.1347  0.1280  0.1220  384 TYR A CE2 
170  C CZ  . TYR A 57  ? 0.4067 0.5751 0.7857 0.1218  0.1135  0.1349  384 TYR A CZ  
171  O OH  . TYR A 57  ? 0.4444 0.6325 0.8396 0.1064  0.0861  0.1371  384 TYR A OH  
172  N N   . SER A 58  ? 0.4941 0.5035 0.6738 0.1775  0.2324  0.0921  385 SER A N   
173  C CA  . SER A 58  ? 0.5385 0.5324 0.6968 0.1916  0.2615  0.0974  385 SER A CA  
174  C C   . SER A 58  ? 0.5276 0.5399 0.6935 0.1811  0.2578  0.1039  385 SER A C   
175  O O   . SER A 58  ? 0.5694 0.5764 0.7262 0.1924  0.2822  0.1129  385 SER A O   
176  C CB  . SER A 58  ? 0.5780 0.5160 0.6655 0.1990  0.2721  0.0762  385 SER A CB  
177  O OG  . SER A 58  ? 0.5608 0.4837 0.6127 0.1808  0.2483  0.0581  385 SER A OG  
178  N N   . ARG A 59  ? 0.4885 0.5197 0.6687 0.1604  0.2286  0.0995  386 ARG A N   
179  C CA  . ARG A 59  ? 0.4874 0.5334 0.6752 0.1493  0.2229  0.1051  386 ARG A CA  
180  C C   . ARG A 59  ? 0.4292 0.5203 0.6782 0.1363  0.2064  0.1215  386 ARG A C   
181  O O   . ARG A 59  ? 0.4087 0.5135 0.6705 0.1264  0.2015  0.1283  386 ARG A O   
182  C CB  . ARG A 59  ? 0.5222 0.5418 0.6625 0.1358  0.2038  0.0836  386 ARG A CB  
183  C CG  . ARG A 59  ? 0.6202 0.5980 0.7005 0.1471  0.2225  0.0732  386 ARG A CG  
184  C CD  . ARG A 59  ? 0.6624 0.6218 0.7034 0.1355  0.2091  0.0611  386 ARG A CD  
185  N NE  . ARG A 59  ? 0.6725 0.6137 0.6882 0.1249  0.1858  0.0415  386 ARG A NE  
186  C CZ  . ARG A 59  ? 0.6765 0.6237 0.6923 0.1086  0.1610  0.0338  386 ARG A CZ  
187  N NH1 . ARG A 59  ? 0.6615 0.6293 0.6984 0.1002  0.1547  0.0426  386 ARG A NH1 
188  N NH2 . ARG A 59  ? 0.6568 0.5881 0.6520 0.1012  0.1432  0.0180  386 ARG A NH2 
189  N N   . PHE A 60  ? 0.3893 0.5013 0.6742 0.1355  0.1967  0.1279  387 PHE A N   
190  C CA  . PHE A 60  ? 0.3417 0.4916 0.6772 0.1199  0.1746  0.1400  387 PHE A CA  
191  C C   . PHE A 60  ? 0.3607 0.5442 0.7468 0.1233  0.1886  0.1673  387 PHE A C   
192  O O   . PHE A 60  ? 0.3671 0.5541 0.7656 0.1423  0.2165  0.1816  387 PHE A O   
193  C CB  . PHE A 60  ? 0.3051 0.4652 0.6589 0.1187  0.1603  0.1399  387 PHE A CB  
194  C CG  . PHE A 60  ? 0.2682 0.4655 0.6715 0.1035  0.1375  0.1536  387 PHE A CG  
195  C CD1 . PHE A 60  ? 0.2436 0.4404 0.6384 0.0830  0.1092  0.1414  387 PHE A CD1 
196  C CD2 . PHE A 60  ? 0.2574 0.4901 0.7171 0.1096  0.1439  0.1800  387 PHE A CD2 
197  C CE1 . PHE A 60  ? 0.2243 0.4503 0.6587 0.0678  0.0869  0.1529  387 PHE A CE1 
198  C CE2 . PHE A 60  ? 0.2358 0.5015 0.7391 0.0932  0.1194  0.1930  387 PHE A CE2 
199  C CZ  . PHE A 60  ? 0.2275 0.4876 0.7149 0.0717  0.0901  0.1782  387 PHE A CZ  
200  N N   . GLN A 61  ? 0.3645 0.5714 0.7805 0.1052  0.1699  0.1750  388 GLN A N   
201  C CA  . GLN A 61  ? 0.4110 0.6547 0.8840 0.1042  0.1779  0.2033  388 GLN A CA  
202  C C   . GLN A 61  ? 0.4021 0.6739 0.9155 0.0817  0.1458  0.2102  388 GLN A C   
203  O O   . GLN A 61  ? 0.4087 0.6714 0.9071 0.0645  0.1260  0.1984  388 GLN A O   
204  C CB  . GLN A 61  ? 0.4335 0.6708 0.8956 0.1053  0.1945  0.2087  388 GLN A CB  
205  C CG  . GLN A 61  ? 0.4934 0.6998 0.9092 0.1260  0.2262  0.2025  388 GLN A CG  
206  C CD  . GLN A 61  ? 0.5314 0.7358 0.9406 0.1253  0.2405  0.2113  388 GLN A CD  
207  O OE1 . GLN A 61  ? 0.5628 0.7990 1.0215 0.1187  0.2416  0.2339  388 GLN A OE1 
208  N NE2 . GLN A 61  ? 0.5605 0.7277 0.9090 0.1313  0.2505  0.1947  388 GLN A NE2 
209  N N   . ALA A 62  ? 0.4239 0.7286 0.9884 0.0820  0.1408  0.2301  389 ALA A N   
210  C CA  . ALA A 62  ? 0.4411 0.7719 1.0433 0.0599  0.1082  0.2380  389 ALA A CA  
211  C C   . ALA A 62  ? 0.4746 0.8227 1.1076 0.0430  0.1002  0.2515  389 ALA A C   
212  O O   . ALA A 62  ? 0.5186 0.8763 1.1678 0.0209  0.0703  0.2513  389 ALA A O   
213  C CB  . ALA A 62  ? 0.4511 0.8148 1.1027 0.0658  0.1063  0.2597  389 ALA A CB  
214  N N   . ASN A 63  ? 0.4902 0.8381 1.1261 0.0532  0.1273  0.2620  390 ASN A N   
215  C CA  . ASN A 63  ? 0.4892 0.8549 1.1586 0.0400  0.1253  0.2791  390 ASN A CA  
216  C C   . ASN A 63  ? 0.5053 0.8519 1.1461 0.0527  0.1554  0.2785  390 ASN A C   
217  O O   . ASN A 63  ? 0.5024 0.8698 1.1764 0.0641  0.1817  0.3033  390 ASN A O   
218  C CB  . ASN A 63  ? 0.4875 0.9015 1.2335 0.0394  0.1283  0.3147  390 ASN A CB  
219  C CG  . ASN A 63  ? 0.5012 0.9375 1.2899 0.0123  0.1008  0.3281  390 ASN A CG  
220  O OD1 . ASN A 63  ? 0.5436 0.9577 1.3038 -0.0064 0.0771  0.3092  390 ASN A OD1 
221  N ND2 . ASN A 63  ? 0.5015 0.9815 1.3604 0.0096  0.1032  0.3617  390 ASN A ND2 
222  N N   . PRO A 64  ? 0.5076 0.8158 1.0878 0.0508  0.1518  0.2520  391 PRO A N   
223  C CA  . PRO A 64  ? 0.5443 0.8308 1.0886 0.0653  0.1805  0.2502  391 PRO A CA  
224  C C   . PRO A 64  ? 0.5789 0.8804 1.1517 0.0586  0.1899  0.2713  391 PRO A C   
225  O O   . PRO A 64  ? 0.5454 0.8658 1.1569 0.0377  0.1677  0.2810  391 PRO A O   
226  C CB  . PRO A 64  ? 0.5110 0.7568 0.9900 0.0610  0.1667  0.2180  391 PRO A CB  
227  C CG  . PRO A 64  ? 0.4905 0.7414 0.9829 0.0384  0.1312  0.2092  391 PRO A CG  
228  C CD  . PRO A 64  ? 0.5016 0.7855 1.0453 0.0353  0.1220  0.2250  391 PRO A CD  
229  N N   . ASP A 65  ? 0.6524 0.9427 1.2033 0.0759  0.2224  0.2782  392 ASP A N   
230  C CA  . ASP A 65  ? 0.7038 1.0023 1.2710 0.0715  0.2344  0.2966  392 ASP A CA  
231  C C   . ASP A 65  ? 0.7295 0.9925 1.2416 0.0645  0.2261  0.2767  392 ASP A C   
232  O O   . ASP A 65  ? 0.7551 1.0220 1.2835 0.0473  0.2118  0.2822  392 ASP A O   
233  C CB  . ASP A 65  ? 0.7675 1.0751 1.3429 0.0949  0.2767  0.3187  392 ASP A CB  
234  C CG  . ASP A 65  ? 0.7948 1.1266 1.4127 0.0889  0.2892  0.3478  392 ASP A CG  
235  O OD1 . ASP A 65  ? 0.8055 1.1217 1.4029 0.0769  0.2806  0.3430  392 ASP A OD1 
236  O OD2 . ASP A 65  ? 0.8190 1.1868 1.4942 0.0966  0.3080  0.3774  392 ASP A OD2 
237  N N   . ASP A 71  ? 0.8888 0.9729 1.1521 0.0120  0.1224  0.1655  398 ASP A N   
238  C CA  . ASP A 71  ? 0.9225 0.9909 1.1607 0.0144  0.1296  0.1723  398 ASP A CA  
239  C C   . ASP A 71  ? 0.9193 0.9706 1.1061 0.0297  0.1455  0.1681  398 ASP A C   
240  O O   . ASP A 71  ? 0.9673 0.9999 1.1212 0.0306  0.1427  0.1661  398 ASP A O   
241  C CB  . ASP A 71  ? 0.9690 1.0522 1.2427 0.0094  0.1413  0.1978  398 ASP A CB  
242  C CG  . ASP A 71  ? 0.9907 1.0625 1.2713 -0.0028 0.1270  0.2006  398 ASP A CG  
243  O OD1 . ASP A 71  ? 1.0271 1.1083 1.3485 -0.0174 0.1139  0.2054  398 ASP A OD1 
244  O OD2 . ASP A 71  ? 1.0022 1.0543 1.2467 0.0017  0.1282  0.1981  398 ASP A OD2 
245  N N   . ASP A 72  ? 0.8398 0.8959 1.0190 0.0415  0.1615  0.1676  399 ASP A N   
246  C CA  . ASP A 72  ? 0.7711 0.8049 0.8952 0.0556  0.1750  0.1598  399 ASP A CA  
247  C C   . ASP A 72  ? 0.6976 0.7090 0.7833 0.0519  0.1540  0.1384  399 ASP A C   
248  O O   . ASP A 72  ? 0.6338 0.6484 0.7330 0.0442  0.1340  0.1244  399 ASP A O   
249  C CB  . ASP A 72  ? 0.7770 0.8147 0.8987 0.0682  0.1914  0.1572  399 ASP A CB  
250  C CG  . ASP A 72  ? 0.8435 0.8887 0.9696 0.0815  0.2240  0.1781  399 ASP A CG  
251  O OD1 . ASP A 72  ? 0.8766 0.9131 0.9832 0.0840  0.2358  0.1899  399 ASP A OD1 
252  O OD2 . ASP A 72  ? 0.8126 0.8722 0.9616 0.0905  0.2389  0.1839  399 ASP A OD2 
253  N N   . THR A 73  ? 0.6681 0.6572 0.7054 0.0578  0.1593  0.1375  400 THR A N   
254  C CA  . THR A 73  ? 0.6577 0.6242 0.6516 0.0570  0.1434  0.1199  400 THR A CA  
255  C C   . THR A 73  ? 0.6429 0.6030 0.6227 0.0618  0.1416  0.1026  400 THR A C   
256  O O   . THR A 73  ? 0.6314 0.5823 0.5971 0.0569  0.1224  0.0868  400 THR A O   
257  C CB  . THR A 73  ? 0.6955 0.6387 0.6364 0.0630  0.1515  0.1252  400 THR A CB  
258  O OG1 . THR A 73  ? 0.7444 0.6721 0.6476 0.0757  0.1722  0.1232  400 THR A OG1 
259  C CG2 . THR A 73  ? 0.6932 0.6437 0.6487 0.0614  0.1610  0.1464  400 THR A CG2 
260  N N   . GLN A 74  ? 0.6424 0.6083 0.6295 0.0718  0.1626  0.1077  401 GLN A N   
261  C CA  . GLN A 74  ? 0.6401 0.6009 0.6198 0.0777  0.1646  0.0949  401 GLN A CA  
262  C C   . GLN A 74  ? 0.5542 0.5321 0.5714 0.0681  0.1443  0.0858  401 GLN A C   
263  O O   . GLN A 74  ? 0.5329 0.4990 0.5316 0.0672  0.1327  0.0697  401 GLN A O   
264  C CB  . GLN A 74  ? 0.7099 0.6782 0.7010 0.0915  0.1935  0.1070  401 GLN A CB  
265  C CG  . GLN A 74  ? 0.8376 0.7809 0.7782 0.1045  0.2174  0.1122  401 GLN A CG  
266  C CD  . GLN A 74  ? 0.9340 0.8545 0.8400 0.1187  0.2334  0.1019  401 GLN A CD  
267  O OE1 . GLN A 74  ? 0.9929 0.8989 0.8813 0.1157  0.2181  0.0833  401 GLN A OE1 
268  N NE2 . GLN A 74  ? 0.9587 0.8752 0.8561 0.1347  0.2656  0.1147  401 GLN A NE2 
269  N N   . HIS A 75  ? 0.5023 0.5061 0.5698 0.0607  0.1404  0.0966  402 HIS A N   
270  C CA  . HIS A 75  ? 0.4667 0.4852 0.5672 0.0509  0.1209  0.0886  402 HIS A CA  
271  C C   . HIS A 75  ? 0.4336 0.4401 0.5180 0.0420  0.0982  0.0742  402 HIS A C   
272  O O   . HIS A 75  ? 0.4219 0.4281 0.5078 0.0389  0.0854  0.0613  402 HIS A O   
273  C CB  . HIS A 75  ? 0.4482 0.4931 0.6016 0.0427  0.1190  0.1033  402 HIS A CB  
274  C CG  . HIS A 75  ? 0.4741 0.5380 0.6557 0.0502  0.1375  0.1180  402 HIS A CG  
275  N ND1 . HIS A 75  ? 0.5110 0.5829 0.7027 0.0565  0.1590  0.1376  402 HIS A ND1 
276  C CD2 . HIS A 75  ? 0.4668 0.5447 0.6706 0.0536  0.1387  0.1179  402 HIS A CD2 
277  C CE1 . HIS A 75  ? 0.4981 0.5895 0.7200 0.0638  0.1733  0.1494  402 HIS A CE1 
278  N NE2 . HIS A 75  ? 0.4792 0.5744 0.7088 0.0621  0.1607  0.1378  402 HIS A NE2 
279  N N   . ILE A 76  ? 0.4253 0.4219 0.4940 0.0392  0.0951  0.0780  403 ILE A N   
280  C CA  . ILE A 76  ? 0.4181 0.4044 0.4740 0.0326  0.0756  0.0674  403 ILE A CA  
281  C C   . ILE A 76  ? 0.4274 0.3967 0.4449 0.0367  0.0708  0.0534  403 ILE A C   
282  O O   . ILE A 76  ? 0.4053 0.3742 0.4254 0.0324  0.0560  0.0414  403 ILE A O   
283  C CB  . ILE A 76  ? 0.4204 0.4013 0.4720 0.0295  0.0737  0.0775  403 ILE A CB  
284  C CG1 . ILE A 76  ? 0.4169 0.4135 0.5108 0.0229  0.0757  0.0903  403 ILE A CG1 
285  C CG2 . ILE A 76  ? 0.4104 0.3821 0.4514 0.0247  0.0547  0.0681  403 ILE A CG2 
286  C CD1 . ILE A 76  ? 0.4400 0.4318 0.5336 0.0207  0.0787  0.1046  403 ILE A CD1 
287  N N   . GLN A 77  ? 0.4681 0.4219 0.4495 0.0450  0.0842  0.0554  404 GLN A N   
288  C CA  . GLN A 77  ? 0.4940 0.4270 0.4348 0.0476  0.0794  0.0426  404 GLN A CA  
289  C C   . GLN A 77  ? 0.4747 0.4115 0.4270 0.0482  0.0762  0.0311  404 GLN A C   
290  O O   . GLN A 77  ? 0.4516 0.3810 0.3931 0.0437  0.0611  0.0193  404 GLN A O   
291  C CB  . GLN A 77  ? 0.5572 0.4689 0.4539 0.0569  0.0969  0.0464  404 GLN A CB  
292  C CG  . GLN A 77  ? 0.6004 0.4850 0.4498 0.0574  0.0890  0.0320  404 GLN A CG  
293  C CD  . GLN A 77  ? 0.6097 0.4894 0.4478 0.0472  0.0642  0.0272  404 GLN A CD  
294  O OE1 . GLN A 77  ? 0.6185 0.5000 0.4538 0.0443  0.0596  0.0367  404 GLN A OE1 
295  N NE2 . GLN A 77  ? 0.5940 0.4687 0.4284 0.0420  0.0486  0.0144  404 GLN A NE2 
296  N N   . GLN A 78  ? 0.4676 0.4180 0.4457 0.0532  0.0897  0.0365  405 GLN A N   
297  C CA  . GLN A 78  ? 0.4587 0.4146 0.4511 0.0543  0.0873  0.0283  405 GLN A CA  
298  C C   . GLN A 78  ? 0.4080 0.3778 0.4274 0.0441  0.0672  0.0219  405 GLN A C   
299  O O   . GLN A 78  ? 0.4051 0.3705 0.4194 0.0425  0.0582  0.0111  405 GLN A O   
300  C CB  . GLN A 78  ? 0.4813 0.4519 0.4997 0.0624  0.1058  0.0389  405 GLN A CB  
301  C CG  . GLN A 78  ? 0.5685 0.5205 0.5538 0.0753  0.1288  0.0433  405 GLN A CG  
302  C CD  . GLN A 78  ? 0.5989 0.5676 0.6129 0.0854  0.1515  0.0586  405 GLN A CD  
303  O OE1 . GLN A 78  ? 0.6091 0.6056 0.6710 0.0817  0.1483  0.0670  405 GLN A OE1 
304  N NE2 . GLN A 78  ? 0.6321 0.5834 0.6161 0.0983  0.1748  0.0636  405 GLN A NE2 
305  N N   . PHE A 79  ? 0.3672 0.3509 0.4127 0.0374  0.0612  0.0288  406 PHE A N   
306  C CA  . PHE A 79  ? 0.3393 0.3306 0.4037 0.0288  0.0441  0.0225  406 PHE A CA  
307  C C   . PHE A 79  ? 0.3430 0.3202 0.3821 0.0267  0.0315  0.0117  406 PHE A C   
308  O O   . PHE A 79  ? 0.3361 0.3149 0.3792 0.0241  0.0221  0.0028  406 PHE A O   
309  C CB  . PHE A 79  ? 0.3152 0.3153 0.4033 0.0225  0.0409  0.0315  406 PHE A CB  
310  C CG  . PHE A 79  ? 0.2973 0.2972 0.3953 0.0152  0.0250  0.0242  406 PHE A CG  
311  C CD1 . PHE A 79  ? 0.2779 0.2860 0.3946 0.0107  0.0169  0.0175  406 PHE A CD1 
312  C CD2 . PHE A 79  ? 0.2990 0.2893 0.3857 0.0137  0.0185  0.0241  406 PHE A CD2 
313  C CE1 . PHE A 79  ? 0.2678 0.2719 0.3887 0.0058  0.0051  0.0105  406 PHE A CE1 
314  C CE2 . PHE A 79  ? 0.2864 0.2751 0.3820 0.0095  0.0068  0.0180  406 PHE A CE2 
315  C CZ  . PHE A 79  ? 0.2734 0.2678 0.3846 0.0059  0.0012  0.0106  406 PHE A CZ  
316  N N   . TYR A 80  ? 0.3688 0.3332 0.3825 0.0277  0.0314  0.0143  407 TYR A N   
317  C CA  . TYR A 80  ? 0.3999 0.3529 0.3917 0.0249  0.0182  0.0069  407 TYR A CA  
318  C C   . TYR A 80  ? 0.4071 0.3487 0.3776 0.0266  0.0172  -0.0030 407 TYR A C   
319  O O   . TYR A 80  ? 0.3954 0.3372 0.3680 0.0222  0.0046  -0.0100 407 TYR A O   
320  C CB  . TYR A 80  ? 0.4340 0.3751 0.4001 0.0249  0.0164  0.0132  407 TYR A CB  
321  C CG  . TYR A 80  ? 0.4551 0.4035 0.4388 0.0227  0.0148  0.0236  407 TYR A CG  
322  C CD1 . TYR A 80  ? 0.4329 0.3929 0.4484 0.0185  0.0069  0.0230  407 TYR A CD1 
323  C CD2 . TYR A 80  ? 0.4885 0.4287 0.4529 0.0252  0.0218  0.0341  407 TYR A CD2 
324  C CE1 . TYR A 80  ? 0.4576 0.4197 0.4876 0.0167  0.0060  0.0325  407 TYR A CE1 
325  C CE2 . TYR A 80  ? 0.5142 0.4593 0.4944 0.0231  0.0207  0.0448  407 TYR A CE2 
326  C CZ  . TYR A 80  ? 0.4886 0.4441 0.5025 0.0188  0.0128  0.0440  407 TYR A CZ  
327  O OH  . TYR A 80  ? 0.5152 0.4710 0.5419 0.0172  0.0126  0.0552  407 TYR A OH  
328  N N   . ASP A 81  ? 0.4273 0.3578 0.3783 0.0334  0.0314  -0.0028 408 ASP A N   
329  C CA  . ASP A 81  ? 0.4448 0.3607 0.3759 0.0360  0.0329  -0.0121 408 ASP A CA  
330  C C   . ASP A 81  ? 0.4248 0.3548 0.3847 0.0341  0.0283  -0.0169 408 ASP A C   
331  O O   . ASP A 81  ? 0.4445 0.3668 0.3959 0.0309  0.0192  -0.0249 408 ASP A O   
332  C CB  . ASP A 81  ? 0.4766 0.3787 0.3870 0.0463  0.0533  -0.0098 408 ASP A CB  
333  C CG  . ASP A 81  ? 0.5297 0.4122 0.4018 0.0493  0.0598  -0.0061 408 ASP A CG  
334  O OD1 . ASP A 81  ? 0.5315 0.4090 0.3889 0.0425  0.0459  -0.0058 408 ASP A OD1 
335  O OD2 . ASP A 81  ? 0.5768 0.4499 0.4343 0.0595  0.0803  -0.0018 408 ASP A OD2 
336  N N   . LEU A 82  ? 0.3971 0.3475 0.3906 0.0349  0.0330  -0.0111 409 LEU A N   
337  C CA  . LEU A 82  ? 0.3865 0.3492 0.4035 0.0328  0.0276  -0.0150 409 LEU A CA  
338  C C   . LEU A 82  ? 0.3786 0.3453 0.4018 0.0252  0.0115  -0.0206 409 LEU A C   
339  O O   . LEU A 82  ? 0.3415 0.3086 0.3675 0.0236  0.0060  -0.0264 409 LEU A O   
340  C CB  . LEU A 82  ? 0.3675 0.3506 0.4176 0.0335  0.0330  -0.0070 409 LEU A CB  
341  C CG  . LEU A 82  ? 0.4042 0.3897 0.4588 0.0425  0.0506  0.0012  409 LEU A CG  
342  C CD1 . LEU A 82  ? 0.3831 0.3917 0.4748 0.0402  0.0527  0.0125  409 LEU A CD1 
343  C CD2 . LEU A 82  ? 0.3980 0.3767 0.4466 0.0491  0.0566  -0.0026 409 LEU A CD2 
344  N N   . LEU A 83  ? 0.3607 0.3300 0.3872 0.0215  0.0054  -0.0176 410 LEU A N   
345  C CA  . LEU A 83  ? 0.3676 0.3401 0.4006 0.0165  -0.0071 -0.0213 410 LEU A CA  
346  C C   . LEU A 83  ? 0.3874 0.3480 0.3991 0.0144  -0.0149 -0.0259 410 LEU A C   
347  O O   . LEU A 83  ? 0.3921 0.3566 0.4117 0.0115  -0.0221 -0.0299 410 LEU A O   
348  C CB  . LEU A 83  ? 0.3570 0.3334 0.3993 0.0144  -0.0111 -0.0159 410 LEU A CB  
349  C CG  . LEU A 83  ? 0.3516 0.3375 0.4176 0.0132  -0.0083 -0.0124 410 LEU A CG  
350  C CD1 . LEU A 83  ? 0.3490 0.3325 0.4186 0.0119  -0.0115 -0.0066 410 LEU A CD1 
351  C CD2 . LEU A 83  ? 0.3403 0.3337 0.4226 0.0110  -0.0123 -0.0183 410 LEU A CD2 
352  N N   . THR A 84  ? 0.3967 0.3424 0.3812 0.0152  -0.0140 -0.0246 411 THR A N   
353  C CA  . THR A 84  ? 0.4228 0.3553 0.3857 0.0104  -0.0254 -0.0285 411 THR A CA  
354  C C   . THR A 84  ? 0.4404 0.3626 0.3939 0.0105  -0.0239 -0.0361 411 THR A C   
355  O O   . THR A 84  ? 0.4448 0.3660 0.4001 0.0047  -0.0349 -0.0391 411 THR A O   
356  C CB  . THR A 84  ? 0.4378 0.3527 0.3671 0.0096  -0.0279 -0.0256 411 THR A CB  
357  O OG1 . THR A 84  ? 0.4676 0.3679 0.3740 0.0162  -0.0128 -0.0268 411 THR A OG1 
358  C CG2 . THR A 84  ? 0.4206 0.3447 0.3591 0.0094  -0.0304 -0.0165 411 THR A CG2 
359  N N   . GLY A 85  ? 0.4515 0.3670 0.3982 0.0173  -0.0096 -0.0376 412 GLY A N   
360  C CA  . GLY A 85  ? 0.4713 0.3774 0.4136 0.0193  -0.0058 -0.0436 412 GLY A CA  
361  C C   . GLY A 85  ? 0.4497 0.3743 0.4224 0.0162  -0.0117 -0.0441 412 GLY A C   
362  O O   . GLY A 85  ? 0.4710 0.3894 0.4412 0.0123  -0.0181 -0.0482 412 GLY A O   
363  N N   . SER A 86  ? 0.4251 0.3706 0.4245 0.0171  -0.0101 -0.0399 413 SER A N   
364  C CA  . SER A 86  ? 0.4292 0.3897 0.4519 0.0147  -0.0149 -0.0406 413 SER A CA  
365  C C   . SER A 86  ? 0.4470 0.4109 0.4744 0.0084  -0.0268 -0.0415 413 SER A C   
366  O O   . SER A 86  ? 0.4226 0.3912 0.4597 0.0065  -0.0297 -0.0430 413 SER A O   
367  C CB  . SER A 86  ? 0.4456 0.4223 0.4896 0.0163  -0.0112 -0.0368 413 SER A CB  
368  O OG  . SER A 86  ? 0.5607 0.5481 0.6200 0.0132  -0.0175 -0.0381 413 SER A OG  
369  N N   . MET A 87  ? 0.4519 0.4144 0.4742 0.0057  -0.0332 -0.0389 414 MET A N   
370  C CA  . MET A 87  ? 0.4755 0.4429 0.5051 0.0002  -0.0447 -0.0368 414 MET A CA  
371  C C   . MET A 87  ? 0.4682 0.4259 0.4886 -0.0051 -0.0515 -0.0396 414 MET A C   
372  O O   . MET A 87  ? 0.3984 0.3657 0.4355 -0.0084 -0.0564 -0.0378 414 MET A O   
373  C CB  . MET A 87  ? 0.5142 0.4781 0.5346 -0.0021 -0.0520 -0.0320 414 MET A CB  
374  C CG  . MET A 87  ? 0.5443 0.5198 0.5814 0.0010  -0.0497 -0.0269 414 MET A CG  
375  S SD  . MET A 87  ? 0.6489 0.6240 0.6818 -0.0016 -0.0606 -0.0183 414 MET A SD  
376  C CE  . MET A 87  ? 0.5438 0.5243 0.5855 -0.0087 -0.0746 -0.0163 414 MET A CE  
377  N N   . GLU A 88  ? 0.5095 0.4462 0.5022 -0.0059 -0.0512 -0.0436 415 GLU A N   
378  C CA  . GLU A 88  ? 0.5481 0.4690 0.5272 -0.0123 -0.0587 -0.0472 415 GLU A CA  
379  C C   . GLU A 88  ? 0.4966 0.4208 0.4893 -0.0106 -0.0530 -0.0493 415 GLU A C   
380  O O   . GLU A 88  ? 0.4850 0.4109 0.4871 -0.0172 -0.0609 -0.0480 415 GLU A O   
381  C CB  . GLU A 88  ? 0.6247 0.5158 0.5642 -0.0123 -0.0576 -0.0527 415 GLU A CB  
382  C CG  . GLU A 88  ? 0.7511 0.6225 0.6719 -0.0234 -0.0730 -0.0556 415 GLU A CG  
383  C CD  . GLU A 88  ? 0.7989 0.6818 0.7287 -0.0332 -0.0915 -0.0485 415 GLU A CD  
384  O OE1 . GLU A 88  ? 0.8885 0.7632 0.8143 -0.0446 -0.1073 -0.0479 415 GLU A OE1 
385  O OE2 . GLU A 88  ? 0.8494 0.7502 0.7930 -0.0301 -0.0912 -0.0421 415 GLU A OE2 
386  N N   . ILE A 89  ? 0.4583 0.3851 0.4541 -0.0021 -0.0398 -0.0506 416 ILE A N   
387  C CA  . ILE A 89  ? 0.4340 0.3644 0.4417 0.0005  -0.0341 -0.0510 416 ILE A CA  
388  C C   . ILE A 89  ? 0.3754 0.3284 0.4100 -0.0015 -0.0374 -0.0468 416 ILE A C   
389  O O   . ILE A 89  ? 0.3710 0.3250 0.4133 -0.0046 -0.0396 -0.0457 416 ILE A O   
390  C CB  . ILE A 89  ? 0.4621 0.3910 0.4678 0.0100  -0.0203 -0.0511 416 ILE A CB  
391  C CG1 . ILE A 89  ? 0.5318 0.4328 0.5086 0.0131  -0.0148 -0.0555 416 ILE A CG1 
392  C CG2 . ILE A 89  ? 0.4417 0.3801 0.4644 0.0130  -0.0162 -0.0489 416 ILE A CG2 
393  C CD1 . ILE A 89  ? 0.6166 0.5156 0.5872 0.0227  -0.0010 -0.0537 416 ILE A CD1 
394  N N   . ILE A 90  ? 0.3351 0.3037 0.3822 0.0000  -0.0372 -0.0443 417 ILE A N   
395  C CA  . ILE A 90  ? 0.3129 0.2990 0.3809 -0.0004 -0.0380 -0.0411 417 ILE A CA  
396  C C   . ILE A 90  ? 0.3182 0.3084 0.3953 -0.0067 -0.0466 -0.0370 417 ILE A C   
397  O O   . ILE A 90  ? 0.2989 0.2995 0.3910 -0.0071 -0.0453 -0.0336 417 ILE A O   
398  C CB  . ILE A 90  ? 0.2818 0.2782 0.3580 0.0032  -0.0350 -0.0402 417 ILE A CB  
399  C CG1 . ILE A 90  ? 0.2716 0.2676 0.3450 0.0075  -0.0280 -0.0421 417 ILE A CG1 
400  C CG2 . ILE A 90  ? 0.2457 0.2547 0.3381 0.0040  -0.0342 -0.0378 417 ILE A CG2 
401  C CD1 . ILE A 90  ? 0.2684 0.2705 0.3482 0.0091  -0.0263 -0.0415 417 ILE A CD1 
402  N N   . ARG A 91  ? 0.3555 0.3377 0.4234 -0.0118 -0.0555 -0.0361 418 ARG A N   
403  C CA  . ARG A 91  ? 0.3820 0.3684 0.4601 -0.0197 -0.0666 -0.0305 418 ARG A CA  
404  C C   . ARG A 91  ? 0.3653 0.3430 0.4420 -0.0251 -0.0688 -0.0312 418 ARG A C   
405  O O   . ARG A 91  ? 0.3580 0.3479 0.4553 -0.0290 -0.0716 -0.0246 418 ARG A O   
406  C CB  . ARG A 91  ? 0.4348 0.4118 0.4986 -0.0253 -0.0784 -0.0292 418 ARG A CB  
407  C CG  . ARG A 91  ? 0.5238 0.5098 0.6040 -0.0348 -0.0929 -0.0205 418 ARG A CG  
408  C CD  . ARG A 91  ? 0.6069 0.5799 0.6670 -0.0425 -0.1081 -0.0193 418 ARG A CD  
409  N NE  . ARG A 91  ? 0.6701 0.6469 0.7254 -0.0365 -0.1057 -0.0175 418 ARG A NE  
410  C CZ  . ARG A 91  ? 0.6747 0.6723 0.7556 -0.0333 -0.1067 -0.0082 418 ARG A CZ  
411  N NH1 . ARG A 91  ? 0.6784 0.6970 0.7932 -0.0344 -0.1087 0.0008  418 ARG A NH1 
412  N NH2 . ARG A 91  ? 0.7038 0.7003 0.7769 -0.0280 -0.1042 -0.0069 418 ARG A NH2 
413  N N   . GLY A 92  ? 0.3644 0.3211 0.4183 -0.0244 -0.0659 -0.0381 419 GLY A N   
414  C CA  . GLY A 92  ? 0.3668 0.3112 0.4180 -0.0284 -0.0667 -0.0391 419 GLY A CA  
415  C C   . GLY A 92  ? 0.3501 0.3107 0.4216 -0.0235 -0.0574 -0.0351 419 GLY A C   
416  O O   . GLY A 92  ? 0.3443 0.3078 0.4283 -0.0286 -0.0599 -0.0301 419 GLY A O   
417  N N   . TRP A 93  ? 0.3008 0.2714 0.3746 -0.0143 -0.0474 -0.0366 420 TRP A N   
418  C CA  . TRP A 93  ? 0.2806 0.2659 0.3687 -0.0098 -0.0400 -0.0330 420 TRP A CA  
419  C C   . TRP A 93  ? 0.2586 0.2611 0.3673 -0.0128 -0.0417 -0.0258 420 TRP A C   
420  O O   . TRP A 93  ? 0.2471 0.2547 0.3656 -0.0140 -0.0391 -0.0206 420 TRP A O   
421  C CB  . TRP A 93  ? 0.2528 0.2456 0.3392 -0.0020 -0.0328 -0.0356 420 TRP A CB  
422  C CG  . TRP A 93  ? 0.2339 0.2408 0.3304 0.0012  -0.0276 -0.0326 420 TRP A CG  
423  C CD1 . TRP A 93  ? 0.2355 0.2436 0.3319 0.0035  -0.0236 -0.0303 420 TRP A CD1 
424  C CD2 . TRP A 93  ? 0.2189 0.2374 0.3231 0.0033  -0.0255 -0.0316 420 TRP A CD2 
425  N NE1 . TRP A 93  ? 0.2350 0.2541 0.3352 0.0061  -0.0198 -0.0284 420 TRP A NE1 
426  C CE2 . TRP A 93  ? 0.2204 0.2446 0.3246 0.0066  -0.0199 -0.0300 420 TRP A CE2 
427  C CE3 . TRP A 93  ? 0.2146 0.2374 0.3242 0.0035  -0.0272 -0.0316 420 TRP A CE3 
428  C CZ2 . TRP A 93  ? 0.2194 0.2503 0.3249 0.0102  -0.0150 -0.0300 420 TRP A CZ2 
429  C CZ3 . TRP A 93  ? 0.2148 0.2456 0.3303 0.0080  -0.0217 -0.0308 420 TRP A CZ3 
430  C CH2 . TRP A 93  ? 0.2218 0.2550 0.3333 0.0113  -0.0151 -0.0308 420 TRP A CH2 
431  N N   . ALA A 94  ? 0.2463 0.2575 0.3622 -0.0131 -0.0451 -0.0241 421 ALA A N   
432  C CA  . ALA A 94  ? 0.2457 0.2747 0.3839 -0.0131 -0.0441 -0.0159 421 ALA A CA  
433  C C   . ALA A 94  ? 0.2629 0.2953 0.4164 -0.0221 -0.0511 -0.0075 421 ALA A C   
434  O O   . ALA A 94  ? 0.2410 0.2869 0.4126 -0.0210 -0.0450 0.0004  421 ALA A O   
435  C CB  . ALA A 94  ? 0.2409 0.2762 0.3846 -0.0115 -0.0473 -0.0146 421 ALA A CB  
436  N N   . GLU A 95  ? 0.2881 0.3062 0.4318 -0.0311 -0.0634 -0.0094 422 GLU A N   
437  C CA  . GLU A 95  ? 0.3385 0.3547 0.4937 -0.0425 -0.0733 -0.0023 422 GLU A CA  
438  C C   . GLU A 95  ? 0.3424 0.3524 0.4983 -0.0435 -0.0675 -0.0010 422 GLU A C   
439  O O   . GLU A 95  ? 0.3298 0.3449 0.5040 -0.0519 -0.0724 0.0081  422 GLU A O   
440  C CB  . GLU A 95  ? 0.4022 0.3989 0.5394 -0.0527 -0.0894 -0.0064 422 GLU A CB  
441  C CG  . GLU A 95  ? 0.4487 0.4595 0.5968 -0.0541 -0.0979 -0.0008 422 GLU A CG  
442  C CD  . GLU A 95  ? 0.5165 0.5070 0.6389 -0.0622 -0.1132 -0.0058 422 GLU A CD  
443  O OE1 . GLU A 95  ? 0.5889 0.5522 0.6848 -0.0681 -0.1182 -0.0138 422 GLU A OE1 
444  O OE2 . GLU A 95  ? 0.5364 0.5363 0.6633 -0.0623 -0.1201 -0.0014 422 GLU A OE2 
445  N N   . LYS A 96  ? 0.3364 0.3381 0.4760 -0.0350 -0.0572 -0.0081 423 LYS A N   
446  C CA  . LYS A 96  ? 0.3434 0.3407 0.4838 -0.0340 -0.0507 -0.0055 423 LYS A CA  
447  C C   . LYS A 96  ? 0.3144 0.3329 0.4702 -0.0271 -0.0389 0.0020  423 LYS A C   
448  O O   . LYS A 96  ? 0.3026 0.3199 0.4598 -0.0261 -0.0332 0.0064  423 LYS A O   
449  C CB  . LYS A 96  ? 0.3738 0.3506 0.4902 -0.0287 -0.0468 -0.0145 423 LYS A CB  
450  C CG  . LYS A 96  ? 0.4426 0.3913 0.5389 -0.0347 -0.0552 -0.0216 423 LYS A CG  
451  C CD  . LYS A 96  ? 0.5038 0.4357 0.5790 -0.0255 -0.0470 -0.0294 423 LYS A CD  
452  C CE  . LYS A 96  ? 0.5498 0.4539 0.5978 -0.0270 -0.0511 -0.0387 423 LYS A CE  
453  N NZ  . LYS A 96  ? 0.5427 0.4507 0.5798 -0.0184 -0.0453 -0.0438 423 LYS A NZ  
454  N N   . ILE A 97  ? 0.2836 0.3189 0.4485 -0.0218 -0.0345 0.0036  424 ILE A N   
455  C CA  . ILE A 97  ? 0.2722 0.3237 0.4467 -0.0144 -0.0217 0.0099  424 ILE A CA  
456  C C   . ILE A 97  ? 0.2671 0.3331 0.4694 -0.0198 -0.0211 0.0241  424 ILE A C   
457  O O   . ILE A 97  ? 0.2555 0.3307 0.4759 -0.0246 -0.0280 0.0294  424 ILE A O   
458  C CB  . ILE A 97  ? 0.2811 0.3403 0.4526 -0.0057 -0.0156 0.0057  424 ILE A CB  
459  C CG1 . ILE A 97  ? 0.2899 0.3370 0.4376 -0.0014 -0.0158 -0.0059 424 ILE A CG1 
460  C CG2 . ILE A 97  ? 0.2639 0.3356 0.4423 0.0021  -0.0014 0.0121  424 ILE A CG2 
461  C CD1 . ILE A 97  ? 0.3194 0.3687 0.4656 0.0027  -0.0156 -0.0107 424 ILE A CD1 
462  N N   . PRO A 98  ? 0.2652 0.3347 0.4730 -0.0196 -0.0134 0.0323  425 PRO A N   
463  C CA  . PRO A 98  ? 0.2641 0.3494 0.5025 -0.0254 -0.0120 0.0483  425 PRO A CA  
464  C C   . PRO A 98  ? 0.2555 0.3622 0.5146 -0.0190 -0.0041 0.0557  425 PRO A C   
465  O O   . PRO A 98  ? 0.2663 0.3748 0.5126 -0.0072 0.0078  0.0506  425 PRO A O   
466  C CB  . PRO A 98  ? 0.2741 0.3599 0.5092 -0.0221 -0.0002 0.0552  425 PRO A CB  
467  C CG  . PRO A 98  ? 0.2681 0.3337 0.4734 -0.0198 -0.0029 0.0432  425 PRO A CG  
468  C CD  . PRO A 98  ? 0.2612 0.3219 0.4498 -0.0145 -0.0061 0.0296  425 PRO A CD  
469  N N   . GLY A 99  ? 0.2509 0.3720 0.5415 -0.0270 -0.0117 0.0676  426 GLY A N   
470  C CA  . GLY A 99  ? 0.2410 0.3840 0.5571 -0.0203 -0.0045 0.0772  426 GLY A CA  
471  C C   . GLY A 99  ? 0.2433 0.3844 0.5563 -0.0197 -0.0149 0.0700  426 GLY A C   
472  O O   . GLY A 99  ? 0.2465 0.4067 0.5888 -0.0186 -0.0156 0.0815  426 GLY A O   
473  N N   . PHE A 100 ? 0.2353 0.3553 0.5154 -0.0198 -0.0220 0.0531  427 PHE A N   
474  C CA  . PHE A 100 ? 0.2368 0.3544 0.5117 -0.0180 -0.0297 0.0469  427 PHE A CA  
475  C C   . PHE A 100 ? 0.2433 0.3671 0.5378 -0.0307 -0.0490 0.0553  427 PHE A C   
476  O O   . PHE A 100 ? 0.2397 0.3773 0.5529 -0.0283 -0.0521 0.0625  427 PHE A O   
477  C CB  . PHE A 100 ? 0.2205 0.3156 0.4585 -0.0158 -0.0323 0.0293  427 PHE A CB  
478  C CG  . PHE A 100 ? 0.2135 0.3055 0.4448 -0.0133 -0.0382 0.0238  427 PHE A CG  
479  C CD1 . PHE A 100 ? 0.2043 0.3001 0.4342 -0.0014 -0.0266 0.0213  427 PHE A CD1 
480  C CD2 . PHE A 100 ? 0.2153 0.2980 0.4392 -0.0230 -0.0552 0.0215  427 PHE A CD2 
481  C CE1 . PHE A 100 ? 0.1996 0.2919 0.4249 0.0005  -0.0318 0.0178  427 PHE A CE1 
482  C CE2 . PHE A 100 ? 0.2154 0.2954 0.4321 -0.0204 -0.0600 0.0181  427 PHE A CE2 
483  C CZ  . PHE A 100 ? 0.2028 0.2883 0.4217 -0.0087 -0.0482 0.0166  427 PHE A CZ  
484  N N   . ALA A 101 ? 0.2652 0.3764 0.5536 -0.0444 -0.0628 0.0543  428 ALA A N   
485  C CA  . ALA A 101 ? 0.2847 0.3974 0.5872 -0.0598 -0.0845 0.0619  428 ALA A CA  
486  C C   . ALA A 101 ? 0.2768 0.4194 0.6272 -0.0644 -0.0859 0.0837  428 ALA A C   
487  O O   . ALA A 101 ? 0.2886 0.4391 0.6575 -0.0763 -0.1048 0.0932  428 ALA A O   
488  C CB  . ALA A 101 ? 0.3105 0.3960 0.5892 -0.0732 -0.0981 0.0536  428 ALA A CB  
489  N N   . ASP A 102 ? 0.2745 0.4347 0.6454 -0.0547 -0.0659 0.0930  429 ASP A N   
490  C CA  . ASP A 102 ? 0.2714 0.4638 0.6927 -0.0561 -0.0626 0.1165  429 ASP A CA  
491  C C   . ASP A 102 ? 0.2614 0.4753 0.7056 -0.0442 -0.0558 0.1250  429 ASP A C   
492  O O   . ASP A 102 ? 0.2537 0.4970 0.7447 -0.0455 -0.0559 0.1466  429 ASP A O   
493  C CB  . ASP A 102 ? 0.2811 0.4838 0.7150 -0.0491 -0.0410 0.1251  429 ASP A CB  
494  C CG  . ASP A 102 ? 0.3221 0.5064 0.7413 -0.0609 -0.0470 0.1214  429 ASP A CG  
495  O OD1 . ASP A 102 ? 0.3259 0.4932 0.7362 -0.0776 -0.0697 0.1167  429 ASP A OD1 
496  O OD2 . ASP A 102 ? 0.3161 0.5013 0.7309 -0.0528 -0.0281 0.1235  429 ASP A OD2 
497  N N   . LEU A 103 ? 0.2572 0.4575 0.6720 -0.0322 -0.0491 0.1098  430 LEU A N   
498  C CA  . LEU A 103 ? 0.2469 0.4632 0.6809 -0.0197 -0.0415 0.1171  430 LEU A CA  
499  C C   . LEU A 103 ? 0.2395 0.4631 0.6890 -0.0306 -0.0657 0.1247  430 LEU A C   
500  O O   . LEU A 103 ? 0.2449 0.4503 0.6709 -0.0452 -0.0865 0.1157  430 LEU A O   
501  C CB  . LEU A 103 ? 0.2374 0.4337 0.6339 -0.0048 -0.0274 0.0983  430 LEU A CB  
502  C CG  . LEU A 103 ? 0.2452 0.4313 0.6200 0.0053  -0.0059 0.0896  430 LEU A CG  
503  C CD1 . LEU A 103 ? 0.2325 0.3950 0.5671 0.0132  -0.0019 0.0696  430 LEU A CD1 
504  C CD2 . LEU A 103 ? 0.2459 0.4531 0.6506 0.0188  0.0170  0.1052  430 LEU A CD2 
505  N N   . PRO A 104 ? 0.2414 0.4892 0.7272 -0.0228 -0.0628 0.1410  431 PRO A N   
506  C CA  . PRO A 104 ? 0.2516 0.5048 0.7472 -0.0327 -0.0878 0.1481  431 PRO A CA  
507  C C   . PRO A 104 ? 0.2590 0.4814 0.7044 -0.0346 -0.0976 0.1268  431 PRO A C   
508  O O   . PRO A 104 ? 0.2563 0.4600 0.6696 -0.0228 -0.0811 0.1097  431 PRO A O   
509  C CB  . PRO A 104 ? 0.2466 0.5261 0.7821 -0.0170 -0.0753 0.1656  431 PRO A CB  
510  C CG  . PRO A 104 ? 0.2429 0.5388 0.8042 -0.0042 -0.0478 0.1752  431 PRO A CG  
511  C CD  . PRO A 104 ? 0.2300 0.5000 0.7484 -0.0044 -0.0369 0.1548  431 PRO A CD  
512  N N   . LYS A 105 ? 0.2834 0.4999 0.7205 -0.0497 -0.1244 0.1281  432 LYS A N   
513  C CA  . LYS A 105 ? 0.3068 0.4933 0.6945 -0.0516 -0.1329 0.1092  432 LYS A CA  
514  C C   . LYS A 105 ? 0.2935 0.4773 0.6724 -0.0337 -0.1173 0.1038  432 LYS A C   
515  O O   . LYS A 105 ? 0.2836 0.4432 0.6232 -0.0283 -0.1090 0.0851  432 LYS A O   
516  C CB  . LYS A 105 ? 0.3588 0.5389 0.7375 -0.0700 -0.1640 0.1136  432 LYS A CB  
517  C CG  . LYS A 105 ? 0.4125 0.5608 0.7380 -0.0718 -0.1719 0.0957  432 LYS A CG  
518  C CD  . LYS A 105 ? 0.4392 0.5582 0.7237 -0.0718 -0.1622 0.0745  432 LYS A CD  
519  C CE  . LYS A 105 ? 0.4800 0.5691 0.7145 -0.0714 -0.1658 0.0583  432 LYS A CE  
520  N NZ  . LYS A 105 ? 0.5095 0.5735 0.7112 -0.0701 -0.1549 0.0405  432 LYS A NZ  
521  N N   . ALA A 106 ? 0.2716 0.4798 0.6889 -0.0249 -0.1133 0.1213  433 ALA A N   
522  C CA  . ALA A 106 ? 0.2588 0.4642 0.6734 -0.0075 -0.0976 0.1187  433 ALA A CA  
523  C C   . ALA A 106 ? 0.2413 0.4331 0.6373 0.0066  -0.0707 0.1036  433 ALA A C   
524  O O   . ALA A 106 ? 0.2449 0.4182 0.6143 0.0147  -0.0627 0.0907  433 ALA A O   
525  C CB  . ALA A 106 ? 0.2462 0.4815 0.7112 0.0007  -0.0958 0.1426  433 ALA A CB  
526  N N   . ASP A 107 ? 0.2286 0.4288 0.6374 0.0084  -0.0581 0.1059  434 ASP A N   
527  C CA  . ASP A 107 ? 0.2265 0.4131 0.6145 0.0202  -0.0347 0.0925  434 ASP A CA  
528  C C   . ASP A 107 ? 0.2263 0.3859 0.5681 0.0132  -0.0397 0.0713  434 ASP A C   
529  O O   . ASP A 107 ? 0.2299 0.3716 0.5447 0.0215  -0.0286 0.0572  434 ASP A O   
530  C CB  . ASP A 107 ? 0.2246 0.4277 0.6371 0.0233  -0.0205 0.1027  434 ASP A CB  
531  C CG  . ASP A 107 ? 0.2254 0.4509 0.6780 0.0381  -0.0034 0.1206  434 ASP A CG  
532  O OD1 . ASP A 107 ? 0.2193 0.4478 0.6832 0.0459  -0.0036 0.1258  434 ASP A OD1 
533  O OD2 . ASP A 107 ? 0.2371 0.4767 0.7101 0.0431  0.0122  0.1304  434 ASP A OD2 
534  N N   . GLN A 108 ? 0.2286 0.3844 0.5624 -0.0019 -0.0566 0.0699  435 GLN A N   
535  C CA  . GLN A 108 ? 0.2400 0.3705 0.5327 -0.0081 -0.0620 0.0520  435 GLN A CA  
536  C C   . GLN A 108 ? 0.2405 0.3553 0.5079 -0.0048 -0.0651 0.0421  435 GLN A C   
537  O O   . GLN A 108 ? 0.2324 0.3310 0.4735 0.0001  -0.0560 0.0283  435 GLN A O   
538  C CB  . GLN A 108 ? 0.2486 0.3739 0.5364 -0.0246 -0.0807 0.0531  435 GLN A CB  
539  C CG  . GLN A 108 ? 0.2557 0.3913 0.5630 -0.0294 -0.0772 0.0607  435 GLN A CG  
540  C CD  . GLN A 108 ? 0.2812 0.4075 0.5830 -0.0471 -0.0973 0.0616  435 GLN A CD  
541  O OE1 . GLN A 108 ? 0.3136 0.4564 0.6466 -0.0567 -0.1068 0.0768  435 GLN A OE1 
542  N NE2 . GLN A 108 ? 0.2860 0.3856 0.5495 -0.0518 -0.1044 0.0466  435 GLN A NE2 
543  N N   . ASP A 109 ? 0.2475 0.3682 0.5247 -0.0081 -0.0782 0.0508  436 ASP A N   
544  C CA  . ASP A 109 ? 0.2554 0.3635 0.5125 -0.0049 -0.0810 0.0451  436 ASP A CA  
545  C C   . ASP A 109 ? 0.2494 0.3554 0.5085 0.0097  -0.0625 0.0414  436 ASP A C   
546  O O   . ASP A 109 ? 0.2458 0.3346 0.4791 0.0123  -0.0582 0.0295  436 ASP A O   
547  C CB  . ASP A 109 ? 0.2657 0.3830 0.5359 -0.0103 -0.0987 0.0587  436 ASP A CB  
548  C CG  . ASP A 109 ? 0.2934 0.4047 0.5504 -0.0268 -0.1205 0.0597  436 ASP A CG  
549  O OD1 . ASP A 109 ? 0.3204 0.4143 0.5510 -0.0328 -0.1209 0.0473  436 ASP A OD1 
550  O OD2 . ASP A 109 ? 0.3127 0.4355 0.5857 -0.0341 -0.1380 0.0735  436 ASP A OD2 
551  N N   . LEU A 110 ? 0.2484 0.3704 0.5380 0.0192  -0.0515 0.0520  437 LEU A N   
552  C CA  . LEU A 110 ? 0.2580 0.3720 0.5447 0.0334  -0.0331 0.0468  437 LEU A CA  
553  C C   . LEU A 110 ? 0.2563 0.3522 0.5128 0.0350  -0.0221 0.0294  437 LEU A C   
554  O O   . LEU A 110 ? 0.2533 0.3323 0.4895 0.0389  -0.0173 0.0190  437 LEU A O   
555  C CB  . LEU A 110 ? 0.2557 0.3867 0.5771 0.0453  -0.0195 0.0606  437 LEU A CB  
556  C CG  . LEU A 110 ? 0.2720 0.3898 0.5876 0.0614  0.0016  0.0548  437 LEU A CG  
557  C CD1 . LEU A 110 ? 0.2771 0.3787 0.5804 0.0649  -0.0008 0.0504  437 LEU A CD1 
558  C CD2 . LEU A 110 ? 0.2761 0.4138 0.6302 0.0735  0.0157  0.0719  437 LEU A CD2 
559  N N   . LEU A 111 ? 0.2390 0.3394 0.4951 0.0314  -0.0193 0.0282  438 LEU A N   
560  C CA  . LEU A 111 ? 0.2481 0.3344 0.4784 0.0327  -0.0105 0.0146  438 LEU A CA  
561  C C   . LEU A 111 ? 0.2565 0.3269 0.4587 0.0255  -0.0197 0.0027  438 LEU A C   
562  O O   . LEU A 111 ? 0.2549 0.3117 0.4380 0.0289  -0.0138 -0.0075 438 LEU A O   
563  C CB  . LEU A 111 ? 0.2411 0.3362 0.4778 0.0301  -0.0063 0.0181  438 LEU A CB  
564  C CG  . LEU A 111 ? 0.2556 0.3649 0.5159 0.0394  0.0089  0.0291  438 LEU A CG  
565  C CD1 . LEU A 111 ? 0.2626 0.3802 0.5278 0.0340  0.0106  0.0336  438 LEU A CD1 
566  C CD2 . LEU A 111 ? 0.2574 0.3540 0.5035 0.0532  0.0276  0.0222  438 LEU A CD2 
567  N N   . PHE A 112 ? 0.2662 0.3377 0.4664 0.0158  -0.0339 0.0048  439 PHE A N   
568  C CA  . PHE A 112 ? 0.2914 0.3481 0.4660 0.0103  -0.0404 -0.0046 439 PHE A CA  
569  C C   . PHE A 112 ? 0.3054 0.3534 0.4706 0.0138  -0.0399 -0.0078 439 PHE A C   
570  O O   . PHE A 112 ? 0.2853 0.3221 0.4332 0.0146  -0.0361 -0.0165 439 PHE A O   
571  C CB  . PHE A 112 ? 0.3070 0.3622 0.4773 -0.0001 -0.0550 -0.0016 439 PHE A CB  
572  C CG  . PHE A 112 ? 0.3244 0.3629 0.4675 -0.0034 -0.0596 -0.0097 439 PHE A CG  
573  C CD1 . PHE A 112 ? 0.3529 0.3805 0.4782 -0.0032 -0.0541 -0.0189 439 PHE A CD1 
574  C CD2 . PHE A 112 ? 0.3428 0.3768 0.4783 -0.0057 -0.0681 -0.0068 439 PHE A CD2 
575  C CE1 . PHE A 112 ? 0.3727 0.3858 0.4752 -0.0043 -0.0553 -0.0248 439 PHE A CE1 
576  C CE2 . PHE A 112 ? 0.3847 0.4025 0.4933 -0.0073 -0.0693 -0.0134 439 PHE A CE2 
577  C CZ  . PHE A 112 ? 0.3789 0.3865 0.4720 -0.0062 -0.0621 -0.0222 439 PHE A CZ  
578  N N   . GLU A 113 ? 0.3024 0.3567 0.4816 0.0153  -0.0446 0.0011  440 GLU A N   
579  C CA  . GLU A 113 ? 0.3244 0.3707 0.4968 0.0181  -0.0450 0.0007  440 GLU A CA  
580  C C   . GLU A 113 ? 0.3156 0.3539 0.4867 0.0262  -0.0323 -0.0051 440 GLU A C   
581  O O   . GLU A 113 ? 0.3130 0.3395 0.4698 0.0257  -0.0314 -0.0109 440 GLU A O   
582  C CB  . GLU A 113 ? 0.3322 0.3878 0.5216 0.0183  -0.0537 0.0138  440 GLU A CB  
583  C CG  . GLU A 113 ? 0.3660 0.4205 0.5433 0.0076  -0.0697 0.0166  440 GLU A CG  
584  C CD  . GLU A 113 ? 0.3862 0.4531 0.5816 0.0050  -0.0827 0.0316  440 GLU A CD  
585  O OE1 . GLU A 113 ? 0.3917 0.4674 0.6091 0.0129  -0.0785 0.0408  440 GLU A OE1 
586  O OE2 . GLU A 113 ? 0.4328 0.4986 0.6187 -0.0052 -0.0979 0.0344  440 GLU A OE2 
587  N N   . SER A 114 ? 0.2950 0.3381 0.4794 0.0333  -0.0225 -0.0033 441 SER A N   
588  C CA  . SER A 114 ? 0.3005 0.3307 0.4782 0.0409  -0.0104 -0.0104 441 SER A CA  
589  C C   . SER A 114 ? 0.2856 0.3042 0.4400 0.0368  -0.0088 -0.0230 441 SER A C   
590  O O   . SER A 114 ? 0.2851 0.2890 0.4282 0.0388  -0.0046 -0.0300 441 SER A O   
591  C CB  . SER A 114 ? 0.2979 0.3330 0.4896 0.0505  0.0021  -0.0064 441 SER A CB  
592  O OG  . SER A 114 ? 0.3367 0.3865 0.5557 0.0548  0.0009  0.0077  441 SER A OG  
593  N N   . ALA A 115 ? 0.2627 0.2877 0.4119 0.0311  -0.0128 -0.0246 442 ALA A N   
594  C CA  . ALA A 115 ? 0.2667 0.2847 0.3984 0.0281  -0.0115 -0.0336 442 ALA A CA  
595  C C   . ALA A 115 ? 0.2432 0.2580 0.3648 0.0214  -0.0190 -0.0364 442 ALA A C   
596  O O   . ALA A 115 ? 0.2404 0.2510 0.3516 0.0191  -0.0189 -0.0418 442 ALA A O   
597  C CB  . ALA A 115 ? 0.2498 0.2761 0.3834 0.0277  -0.0088 -0.0321 442 ALA A CB  
598  N N   . PHE A 116 ? 0.2419 0.2592 0.3667 0.0189  -0.0252 -0.0316 443 PHE A N   
599  C CA  . PHE A 116 ? 0.2617 0.2754 0.3751 0.0142  -0.0297 -0.0331 443 PHE A CA  
600  C C   . PHE A 116 ? 0.2749 0.2823 0.3809 0.0135  -0.0270 -0.0375 443 PHE A C   
601  O O   . PHE A 116 ? 0.2798 0.2873 0.3797 0.0117  -0.0265 -0.0401 443 PHE A O   
602  C CB  . PHE A 116 ? 0.2754 0.2884 0.3865 0.0117  -0.0365 -0.0277 443 PHE A CB  
603  C CG  . PHE A 116 ? 0.3120 0.3171 0.4078 0.0096  -0.0367 -0.0295 443 PHE A CG  
604  C CD1 . PHE A 116 ? 0.3100 0.3114 0.3948 0.0078  -0.0356 -0.0332 443 PHE A CD1 
605  C CD2 . PHE A 116 ? 0.3243 0.3251 0.4178 0.0105  -0.0359 -0.0264 443 PHE A CD2 
606  C CE1 . PHE A 116 ? 0.3298 0.3243 0.4022 0.0082  -0.0322 -0.0338 443 PHE A CE1 
607  C CE2 . PHE A 116 ? 0.3327 0.3273 0.4132 0.0097  -0.0334 -0.0263 443 PHE A CE2 
608  C CZ  . PHE A 116 ? 0.3246 0.3164 0.3950 0.0091  -0.0307 -0.0300 443 PHE A CZ  
609  N N   . LEU A 117 ? 0.2795 0.2816 0.3883 0.0149  -0.0256 -0.0372 444 LEU A N   
610  C CA  . LEU A 117 ? 0.2907 0.2877 0.3965 0.0124  -0.0249 -0.0393 444 LEU A CA  
611  C C   . LEU A 117 ? 0.2941 0.2895 0.3965 0.0110  -0.0241 -0.0452 444 LEU A C   
612  O O   . LEU A 117 ? 0.2922 0.2894 0.3935 0.0074  -0.0257 -0.0456 444 LEU A O   
613  C CB  . LEU A 117 ? 0.3067 0.2958 0.4171 0.0132  -0.0244 -0.0369 444 LEU A CB  
614  C CG  . LEU A 117 ? 0.3313 0.3204 0.4418 0.0126  -0.0258 -0.0295 444 LEU A CG  
615  C CD1 . LEU A 117 ? 0.3282 0.3084 0.4450 0.0137  -0.0249 -0.0259 444 LEU A CD1 
616  C CD2 . LEU A 117 ? 0.3262 0.3179 0.4313 0.0095  -0.0247 -0.0281 444 LEU A CD2 
617  N N   . GLU A 118 ? 0.2948 0.2873 0.3955 0.0142  -0.0214 -0.0485 445 GLU A N   
618  C CA  . GLU A 118 ? 0.3301 0.3198 0.4218 0.0131  -0.0211 -0.0539 445 GLU A CA  
619  C C   . GLU A 118 ? 0.3280 0.3276 0.4185 0.0111  -0.0230 -0.0523 445 GLU A C   
620  O O   . GLU A 118 ? 0.3380 0.3382 0.4248 0.0075  -0.0264 -0.0535 445 GLU A O   
621  C CB  . GLU A 118 ? 0.3492 0.3336 0.4367 0.0188  -0.0148 -0.0565 445 GLU A CB  
622  C CG  . GLU A 118 ? 0.4230 0.3936 0.5106 0.0221  -0.0115 -0.0583 445 GLU A CG  
623  C CD  . GLU A 118 ? 0.4604 0.4201 0.5397 0.0293  -0.0025 -0.0622 445 GLU A CD  
624  O OE1 . GLU A 118 ? 0.5292 0.4792 0.6125 0.0348  0.0026  -0.0616 445 GLU A OE1 
625  O OE2 . GLU A 118 ? 0.5270 0.4867 0.5948 0.0302  0.0002  -0.0652 445 GLU A OE2 
626  N N   . LEU A 119 ? 0.3078 0.3145 0.4028 0.0127  -0.0221 -0.0487 446 LEU A N   
627  C CA  . LEU A 119 ? 0.2995 0.3117 0.3928 0.0115  -0.0230 -0.0473 446 LEU A CA  
628  C C   . LEU A 119 ? 0.2903 0.3033 0.3841 0.0096  -0.0245 -0.0455 446 LEU A C   
629  O O   . LEU A 119 ? 0.2688 0.2851 0.3623 0.0091  -0.0247 -0.0445 446 LEU A O   
630  C CB  . LEU A 119 ? 0.3030 0.3187 0.4001 0.0121  -0.0228 -0.0442 446 LEU A CB  
631  C CG  . LEU A 119 ? 0.3393 0.3593 0.4393 0.0140  -0.0195 -0.0430 446 LEU A CG  
632  C CD1 . LEU A 119 ? 0.3613 0.3820 0.4544 0.0137  -0.0181 -0.0438 446 LEU A CD1 
633  C CD2 . LEU A 119 ? 0.3808 0.3992 0.4823 0.0181  -0.0145 -0.0440 446 LEU A CD2 
634  N N   . PHE A 120 ? 0.2818 0.2922 0.3770 0.0095  -0.0244 -0.0436 447 PHE A N   
635  C CA  . PHE A 120 ? 0.2771 0.2882 0.3730 0.0091  -0.0227 -0.0404 447 PHE A CA  
636  C C   . PHE A 120 ? 0.2737 0.2894 0.3767 0.0066  -0.0242 -0.0394 447 PHE A C   
637  O O   . PHE A 120 ? 0.2972 0.3185 0.4045 0.0072  -0.0228 -0.0358 447 PHE A O   
638  C CB  . PHE A 120 ? 0.2864 0.2934 0.3815 0.0092  -0.0219 -0.0376 447 PHE A CB  
639  C CG  . PHE A 120 ? 0.2921 0.3003 0.3894 0.0094  -0.0177 -0.0327 447 PHE A CG  
640  C CD1 . PHE A 120 ? 0.2803 0.2859 0.3694 0.0127  -0.0124 -0.0307 447 PHE A CD1 
641  C CD2 . PHE A 120 ? 0.2925 0.3030 0.4002 0.0065  -0.0181 -0.0295 447 PHE A CD2 
642  C CE1 . PHE A 120 ? 0.2936 0.3012 0.3859 0.0149  -0.0053 -0.0245 447 PHE A CE1 
643  C CE2 . PHE A 120 ? 0.2868 0.3014 0.4010 0.0069  -0.0129 -0.0223 447 PHE A CE2 
644  C CZ  . PHE A 120 ? 0.2779 0.2922 0.3850 0.0119  -0.0053 -0.0194 447 PHE A CZ  
645  N N   . VAL A 121 ? 0.2692 0.2813 0.3729 0.0037  -0.0276 -0.0423 448 VAL A N   
646  C CA  . VAL A 121 ? 0.2672 0.2809 0.3757 -0.0013 -0.0325 -0.0416 448 VAL A CA  
647  C C   . VAL A 121 ? 0.2664 0.2844 0.3707 -0.0021 -0.0360 -0.0427 448 VAL A C   
648  O O   . VAL A 121 ? 0.2486 0.2750 0.3613 -0.0050 -0.0399 -0.0377 448 VAL A O   
649  C CB  . VAL A 121 ? 0.2768 0.2788 0.3820 -0.0047 -0.0357 -0.0459 448 VAL A CB  
650  C CG1 . VAL A 121 ? 0.2902 0.2898 0.3954 -0.0123 -0.0440 -0.0468 448 VAL A CG1 
651  C CG2 . VAL A 121 ? 0.2697 0.2687 0.3820 -0.0046 -0.0330 -0.0419 448 VAL A CG2 
652  N N   . LEU A 122 ? 0.2575 0.2711 0.3508 0.0006  -0.0344 -0.0475 449 LEU A N   
653  C CA  . LEU A 122 ? 0.2658 0.2818 0.3519 0.0002  -0.0370 -0.0479 449 LEU A CA  
654  C C   . LEU A 122 ? 0.2441 0.2708 0.3387 0.0021  -0.0362 -0.0413 449 LEU A C   
655  O O   . LEU A 122 ? 0.2414 0.2745 0.3391 -0.0003 -0.0415 -0.0372 449 LEU A O   
656  C CB  . LEU A 122 ? 0.2607 0.2712 0.3355 0.0041  -0.0323 -0.0520 449 LEU A CB  
657  C CG  . LEU A 122 ? 0.2672 0.2789 0.3311 0.0041  -0.0338 -0.0516 449 LEU A CG  
658  C CD1 . LEU A 122 ? 0.2796 0.2834 0.3293 -0.0010 -0.0415 -0.0551 449 LEU A CD1 
659  C CD2 . LEU A 122 ? 0.2788 0.2880 0.3359 0.0090  -0.0261 -0.0528 449 LEU A CD2 
660  N N   . ARG A 123 ? 0.2449 0.2720 0.3428 0.0062  -0.0302 -0.0398 450 ARG A N   
661  C CA  . ARG A 123 ? 0.2454 0.2768 0.3478 0.0095  -0.0271 -0.0349 450 ARG A CA  
662  C C   . ARG A 123 ? 0.2470 0.2853 0.3620 0.0102  -0.0259 -0.0284 450 ARG A C   
663  O O   . ARG A 123 ? 0.2424 0.2870 0.3650 0.0129  -0.0247 -0.0222 450 ARG A O   
664  C CB  . ARG A 123 ? 0.2531 0.2771 0.3502 0.0124  -0.0222 -0.0368 450 ARG A CB  
665  C CG  . ARG A 123 ? 0.2530 0.2746 0.3444 0.0120  -0.0227 -0.0392 450 ARG A CG  
666  C CD  . ARG A 123 ? 0.2546 0.2701 0.3434 0.0117  -0.0219 -0.0409 450 ARG A CD  
667  N NE  . ARG A 123 ? 0.2521 0.2599 0.3364 0.0129  -0.0199 -0.0402 450 ARG A NE  
668  C CZ  . ARG A 123 ? 0.2518 0.2523 0.3317 0.0133  -0.0189 -0.0396 450 ARG A CZ  
669  N NH1 . ARG A 123 ? 0.2462 0.2489 0.3291 0.0121  -0.0199 -0.0379 450 ARG A NH1 
670  N NH2 . ARG A 123 ? 0.2489 0.2373 0.3195 0.0151  -0.0161 -0.0406 450 ARG A NH2 
671  N N   . LEU A 124 ? 0.2436 0.2812 0.3628 0.0083  -0.0253 -0.0282 451 LEU A N   
672  C CA  . LEU A 124 ? 0.2430 0.2895 0.3779 0.0084  -0.0232 -0.0200 451 LEU A CA  
673  C C   . LEU A 124 ? 0.2406 0.2982 0.3878 0.0029  -0.0323 -0.0148 451 LEU A C   
674  O O   . LEU A 124 ? 0.2567 0.3267 0.4204 0.0049  -0.0312 -0.0050 451 LEU A O   
675  C CB  . LEU A 124 ? 0.2411 0.2842 0.3781 0.0063  -0.0212 -0.0198 451 LEU A CB  
676  C CG  . LEU A 124 ? 0.2418 0.2952 0.3974 0.0064  -0.0168 -0.0092 451 LEU A CG  
677  C CD1 . LEU A 124 ? 0.2407 0.2972 0.3996 0.0156  -0.0049 -0.0028 451 LEU A CD1 
678  C CD2 . LEU A 124 ? 0.2285 0.2762 0.3833 0.0041  -0.0145 -0.0088 451 LEU A CD2 
679  N N   . ALA A 125 ? 0.2482 0.3003 0.3864 -0.0037 -0.0414 -0.0209 452 ALA A N   
680  C CA  . ALA A 125 ? 0.2576 0.3157 0.4005 -0.0114 -0.0536 -0.0177 452 ALA A CA  
681  C C   . ALA A 125 ? 0.2585 0.3244 0.4010 -0.0091 -0.0566 -0.0131 452 ALA A C   
682  O O   . ALA A 125 ? 0.2549 0.3333 0.4114 -0.0132 -0.0651 -0.0040 452 ALA A O   
683  C CB  . ALA A 125 ? 0.2616 0.3043 0.3858 -0.0180 -0.0612 -0.0278 452 ALA A CB  
684  N N   . TYR A 126 ? 0.2530 0.3121 0.3814 -0.0032 -0.0506 -0.0179 453 TYR A N   
685  C CA  . TYR A 126 ? 0.2682 0.3328 0.3951 -0.0006 -0.0527 -0.0129 453 TYR A CA  
686  C C   . TYR A 126 ? 0.2621 0.3388 0.4100 0.0055  -0.0473 -0.0014 453 TYR A C   
687  O O   . TYR A 126 ? 0.2642 0.3516 0.4214 0.0054  -0.0531 0.0078  453 TYR A O   
688  C CB  . TYR A 126 ? 0.2502 0.3044 0.3595 0.0034  -0.0467 -0.0194 453 TYR A CB  
689  C CG  . TYR A 126 ? 0.2559 0.3133 0.3598 0.0048  -0.0496 -0.0144 453 TYR A CG  
690  C CD1 . TYR A 126 ? 0.2693 0.3276 0.3616 -0.0008 -0.0605 -0.0134 453 TYR A CD1 
691  C CD2 . TYR A 126 ? 0.2445 0.3014 0.3520 0.0113  -0.0420 -0.0104 453 TYR A CD2 
692  C CE1 . TYR A 126 ? 0.2791 0.3401 0.3643 0.0006  -0.0632 -0.0073 453 TYR A CE1 
693  C CE2 . TYR A 126 ? 0.2480 0.3071 0.3512 0.0127  -0.0442 -0.0043 453 TYR A CE2 
694  C CZ  . TYR A 126 ? 0.2684 0.3309 0.3609 0.0077  -0.0546 -0.0022 453 TYR A CZ  
695  O OH  . TYR A 126 ? 0.2800 0.3449 0.3662 0.0090  -0.0573 0.0051  453 TYR A OH  
696  N N   . ARG A 127 ? 0.2669 0.3403 0.4201 0.0115  -0.0358 -0.0017 454 ARG A N   
697  C CA  . ARG A 127 ? 0.2780 0.3553 0.4447 0.0207  -0.0252 0.0066  454 ARG A CA  
698  C C   . ARG A 127 ? 0.2679 0.3627 0.4614 0.0206  -0.0256 0.0192  454 ARG A C   
699  O O   . ARG A 127 ? 0.2822 0.3852 0.4923 0.0284  -0.0185 0.0299  454 ARG A O   
700  C CB  . ARG A 127 ? 0.2981 0.3609 0.4534 0.0252  -0.0138 -0.0004 454 ARG A CB  
701  C CG  . ARG A 127 ? 0.3406 0.3928 0.4912 0.0346  -0.0019 0.0006  454 ARG A CG  
702  C CD  . ARG A 127 ? 0.3624 0.3947 0.4896 0.0343  0.0013  -0.0106 454 ARG A CD  
703  N NE  . ARG A 127 ? 0.3655 0.3975 0.4905 0.0317  0.0021  -0.0131 454 ARG A NE  
704  C CZ  . ARG A 127 ? 0.3551 0.3786 0.4666 0.0274  -0.0010 -0.0209 454 ARG A CZ  
705  N NH1 . ARG A 127 ? 0.3410 0.3550 0.4393 0.0247  -0.0051 -0.0278 454 ARG A NH1 
706  N NH2 . ARG A 127 ? 0.3525 0.3791 0.4677 0.0258  0.0001  -0.0194 454 ARG A NH2 
707  N N   . SER A 128 ? 0.2548 0.3543 0.4540 0.0124  -0.0323 0.0187  455 SER A N   
708  C CA  . SER A 128 ? 0.2570 0.3730 0.4845 0.0115  -0.0309 0.0315  455 SER A CA  
709  C C   . SER A 128 ? 0.2567 0.3938 0.5088 0.0060  -0.0439 0.0453  455 SER A C   
710  O O   . SER A 128 ? 0.2492 0.3859 0.4915 0.0020  -0.0555 0.0436  455 SER A O   
711  C CB  . SER A 128 ? 0.2655 0.3768 0.4909 0.0040  -0.0331 0.0268  455 SER A CB  
712  O OG  . SER A 128 ? 0.2735 0.3690 0.4811 0.0103  -0.0203 0.0184  455 SER A OG  
713  N N   . ASN A 129 ? 0.2642 0.4206 0.5489 0.0058  -0.0420 0.0604  456 ASN A N   
714  C CA  . ASN A 129 ? 0.2788 0.4590 0.5931 -0.0012 -0.0568 0.0766  456 ASN A CA  
715  C C   . ASN A 129 ? 0.2837 0.4714 0.6133 -0.0151 -0.0682 0.0804  456 ASN A C   
716  O O   . ASN A 129 ? 0.2883 0.4926 0.6497 -0.0132 -0.0601 0.0945  456 ASN A O   
717  C CB  . ASN A 129 ? 0.2719 0.4725 0.6195 0.0115  -0.0447 0.0958  456 ASN A CB  
718  C CG  . ASN A 129 ? 0.2996 0.5266 0.6786 0.0048  -0.0623 0.1143  456 ASN A CG  
719  O OD1 . ASN A 129 ? 0.3160 0.5486 0.6964 -0.0118 -0.0849 0.1148  456 ASN A OD1 
720  N ND2 . ASN A 129 ? 0.2859 0.5285 0.6905 0.0176  -0.0525 0.1304  456 ASN A ND2 
721  N N   . PRO A 130 ? 0.3006 0.4742 0.6069 -0.0288 -0.0856 0.0681  457 PRO A N   
722  C CA  . PRO A 130 ? 0.3221 0.4948 0.6369 -0.0435 -0.0974 0.0685  457 PRO A CA  
723  C C   . PRO A 130 ? 0.3404 0.5412 0.6980 -0.0536 -0.1111 0.0898  457 PRO A C   
724  O O   . PRO A 130 ? 0.3558 0.5646 0.7374 -0.0592 -0.1093 0.0980  457 PRO A O   
725  C CB  . PRO A 130 ? 0.3337 0.4817 0.6097 -0.0538 -0.1127 0.0505  457 PRO A CB  
726  C CG  . PRO A 130 ? 0.3204 0.4672 0.5785 -0.0478 -0.1149 0.0478  457 PRO A CG  
727  C CD  . PRO A 130 ? 0.2940 0.4492 0.5636 -0.0307 -0.0940 0.0535  457 PRO A CD  
728  N N   . VAL A 131 ? 0.3401 0.5569 0.7094 -0.0556 -0.1241 0.1005  458 VAL A N   
729  C CA  . VAL A 131 ? 0.3508 0.5990 0.7661 -0.0653 -0.1394 0.1243  458 VAL A CA  
730  C C   . VAL A 131 ? 0.3383 0.6125 0.8009 -0.0545 -0.1192 0.1444  458 VAL A C   
731  O O   . VAL A 131 ? 0.3333 0.6299 0.8362 -0.0646 -0.1275 0.1622  458 VAL A O   
732  C CB  . VAL A 131 ? 0.3558 0.6189 0.7765 -0.0645 -0.1531 0.1347  458 VAL A CB  
733  C CG1 . VAL A 131 ? 0.3567 0.6570 0.8320 -0.0722 -0.1671 0.1630  458 VAL A CG1 
734  C CG2 . VAL A 131 ? 0.3709 0.6104 0.7459 -0.0770 -0.1750 0.1184  458 VAL A CG2 
735  N N   . GLU A 132 ? 0.3332 0.6029 0.7897 -0.0342 -0.0924 0.1419  459 GLU A N   
736  C CA  . GLU A 132 ? 0.3156 0.6048 0.8094 -0.0212 -0.0692 0.1595  459 GLU A CA  
737  C C   . GLU A 132 ? 0.2826 0.5550 0.7620 -0.0190 -0.0526 0.1499  459 GLU A C   
738  O O   . GLU A 132 ? 0.2744 0.5582 0.7771 -0.0081 -0.0314 0.1626  459 GLU A O   
739  C CB  . GLU A 132 ? 0.3219 0.6143 0.8184 0.0000  -0.0490 0.1649  459 GLU A CB  
740  C CG  . GLU A 132 ? 0.3512 0.6632 0.8676 -0.0008 -0.0643 0.1786  459 GLU A CG  
741  C CD  . GLU A 132 ? 0.3711 0.6968 0.9130 0.0209  -0.0419 0.1949  459 GLU A CD  
742  O OE1 . GLU A 132 ? 0.3655 0.6682 0.8794 0.0368  -0.0207 0.1827  459 GLU A OE1 
743  O OE2 . GLU A 132 ? 0.4477 0.8076 1.0405 0.0223  -0.0454 0.2215  459 GLU A OE2 
744  N N   . GLY A 133 ? 0.2697 0.5149 0.7105 -0.0284 -0.0617 0.1285  460 GLY A N   
745  C CA  . GLY A 133 ? 0.2574 0.4839 0.6797 -0.0258 -0.0474 0.1184  460 GLY A CA  
746  C C   . GLY A 133 ? 0.2441 0.4566 0.6436 -0.0061 -0.0216 0.1110  460 GLY A C   
747  O O   . GLY A 133 ? 0.2460 0.4529 0.6430 0.0000  -0.0045 0.1122  460 GLY A O   
748  N N   . LYS A 134 ? 0.2309 0.4359 0.6118 0.0027  -0.0198 0.1036  461 LYS A N   
749  C CA  . LYS A 134 ? 0.2277 0.4165 0.5857 0.0199  0.0021  0.0965  461 LYS A CA  
750  C C   . LYS A 134 ? 0.2207 0.3802 0.5330 0.0182  -0.0014 0.0732  461 LYS A C   
751  O O   . LYS A 134 ? 0.2100 0.3636 0.5076 0.0137  -0.0144 0.0647  461 LYS A O   
752  C CB  . LYS A 134 ? 0.2330 0.4314 0.6043 0.0326  0.0100  0.1062  461 LYS A CB  
753  C CG  . LYS A 134 ? 0.2492 0.4757 0.6669 0.0405  0.0221  0.1310  461 LYS A CG  
754  C CD  . LYS A 134 ? 0.2578 0.4911 0.6882 0.0552  0.0317  0.1407  461 LYS A CD  
755  C CE  . LYS A 134 ? 0.2916 0.5605 0.7783 0.0600  0.0382  0.1694  461 LYS A CE  
756  N NZ  . LYS A 134 ? 0.3101 0.5789 0.8049 0.0802  0.0568  0.1781  461 LYS A NZ  
757  N N   . LEU A 135 ? 0.2171 0.3601 0.5092 0.0220  0.0103  0.0654  462 LEU A N   
758  C CA  . LEU A 135 ? 0.2253 0.3429 0.4785 0.0219  0.0090  0.0463  462 LEU A CA  
759  C C   . LEU A 135 ? 0.2377 0.3420 0.4727 0.0354  0.0240  0.0424  462 LEU A C   
760  O O   . LEU A 135 ? 0.2524 0.3571 0.4928 0.0466  0.0421  0.0508  462 LEU A O   
761  C CB  . LEU A 135 ? 0.2208 0.3280 0.4629 0.0177  0.0112  0.0416  462 LEU A CB  
762  C CG  . LEU A 135 ? 0.2273 0.3356 0.4753 0.0031  -0.0049 0.0392  462 LEU A CG  
763  C CD1 . LEU A 135 ? 0.2160 0.3141 0.4464 -0.0046 -0.0211 0.0258  462 LEU A CD1 
764  C CD2 . LEU A 135 ? 0.2345 0.3644 0.5197 -0.0048 -0.0103 0.0556  462 LEU A CD2 
765  N N   . ILE A 136 ? 0.2411 0.3320 0.4539 0.0349  0.0176  0.0304  463 ILE A N   
766  C CA  . ILE A 136 ? 0.2610 0.3355 0.4549 0.0458  0.0295  0.0258  463 ILE A CA  
767  C C   . ILE A 136 ? 0.2674 0.3206 0.4293 0.0420  0.0258  0.0104  463 ILE A C   
768  O O   . ILE A 136 ? 0.2649 0.3166 0.4198 0.0344  0.0130  0.0027  463 ILE A O   
769  C CB  . ILE A 136 ? 0.2550 0.3350 0.4576 0.0490  0.0259  0.0295  463 ILE A CB  
770  C CG1 . ILE A 136 ? 0.2640 0.3695 0.5038 0.0519  0.0273  0.0478  463 ILE A CG1 
771  C CG2 . ILE A 136 ? 0.2719 0.3303 0.4537 0.0595  0.0379  0.0240  463 ILE A CG2 
772  C CD1 . ILE A 136 ? 0.2764 0.3908 0.5288 0.0551  0.0222  0.0549  463 ILE A CD1 
773  N N   . PHE A 137 ? 0.2885 0.3260 0.4316 0.0474  0.0370  0.0073  464 PHE A N   
774  C CA  . PHE A 137 ? 0.3150 0.3337 0.4296 0.0433  0.0320  -0.0050 464 PHE A CA  
775  C C   . PHE A 137 ? 0.3346 0.3355 0.4289 0.0457  0.0316  -0.0132 464 PHE A C   
776  O O   . PHE A 137 ? 0.3300 0.3285 0.4283 0.0528  0.0387  -0.0097 464 PHE A O   
777  C CB  . PHE A 137 ? 0.3137 0.3239 0.4155 0.0455  0.0405  -0.0037 464 PHE A CB  
778  C CG  . PHE A 137 ? 0.3101 0.3374 0.4335 0.0399  0.0374  0.0039  464 PHE A CG  
779  C CD1 . PHE A 137 ? 0.2872 0.3160 0.4108 0.0304  0.0244  -0.0011 464 PHE A CD1 
780  C CD2 . PHE A 137 ? 0.2981 0.3407 0.4457 0.0440  0.0473  0.0173  464 PHE A CD2 
781  C CE1 . PHE A 137 ? 0.2883 0.3288 0.4311 0.0244  0.0207  0.0053  464 PHE A CE1 
782  C CE2 . PHE A 137 ? 0.2892 0.3471 0.4593 0.0367  0.0426  0.0253  464 PHE A CE2 
783  C CZ  . PHE A 137 ? 0.2870 0.3418 0.4529 0.0265  0.0288  0.0184  464 PHE A CZ  
784  N N   . CYS A 138 ? 0.3676 0.3564 0.4430 0.0399  0.0234  -0.0224 465 CYS A N   
785  C CA  . CYS A 138 ? 0.3855 0.3600 0.4465 0.0389  0.0194  -0.0292 465 CYS A CA  
786  C C   . CYS A 138 ? 0.3964 0.3478 0.4367 0.0464  0.0303  -0.0312 465 CYS A C   
787  O O   . CYS A 138 ? 0.4370 0.3763 0.4705 0.0471  0.0295  -0.0344 465 CYS A O   
788  C CB  . CYS A 138 ? 0.4135 0.3825 0.4630 0.0305  0.0080  -0.0362 465 CYS A CB  
789  S SG  . CYS A 138 ? 0.5527 0.5041 0.5760 0.0302  0.0100  -0.0391 465 CYS A SG  
790  N N   . ASN A 139 ? 0.3881 0.3304 0.4158 0.0520  0.0411  -0.0296 466 ASN A N   
791  C CA  . ASN A 139 ? 0.4263 0.3425 0.4301 0.0613  0.0546  -0.0319 466 ASN A CA  
792  C C   . ASN A 139 ? 0.4213 0.3452 0.4451 0.0734  0.0699  -0.0223 466 ASN A C   
793  O O   . ASN A 139 ? 0.4646 0.3662 0.4702 0.0842  0.0854  -0.0228 466 ASN A O   
794  C CB  . ASN A 139 ? 0.4620 0.3619 0.4383 0.0638  0.0622  -0.0336 466 ASN A CB  
795  C CG  . ASN A 139 ? 0.4669 0.3885 0.4643 0.0681  0.0716  -0.0225 466 ASN A CG  
796  O OD1 . ASN A 139 ? 0.4114 0.3613 0.4446 0.0659  0.0680  -0.0145 466 ASN A OD1 
797  N ND2 . ASN A 139 ? 0.5116 0.4183 0.4851 0.0735  0.0834  -0.0214 466 ASN A ND2 
798  N N   . GLY A 140 ? 0.3768 0.3307 0.4366 0.0721  0.0657  -0.0131 467 GLY A N   
799  C CA  . GLY A 140 ? 0.3712 0.3366 0.4555 0.0830  0.0778  -0.0012 467 GLY A CA  
800  C C   . GLY A 140 ? 0.3673 0.3486 0.4708 0.0906  0.0918  0.0113  467 GLY A C   
801  O O   . GLY A 140 ? 0.3574 0.3528 0.4874 0.0999  0.1021  0.0242  467 GLY A O   
802  N N   . VAL A 141 ? 0.3585 0.3389 0.4512 0.0864  0.0921  0.0095  468 VAL A N   
803  C CA  . VAL A 141 ? 0.3532 0.3491 0.4644 0.0920  0.1054  0.0226  468 VAL A CA  
804  C C   . VAL A 141 ? 0.3139 0.3460 0.4694 0.0840  0.0938  0.0343  468 VAL A C   
805  O O   . VAL A 141 ? 0.2820 0.3214 0.4399 0.0708  0.0750  0.0283  468 VAL A O   
806  C CB  . VAL A 141 ? 0.3653 0.3477 0.4497 0.0897  0.1091  0.0182  468 VAL A CB  
807  C CG1 . VAL A 141 ? 0.3638 0.3679 0.4747 0.0927  0.1203  0.0341  468 VAL A CG1 
808  C CG2 . VAL A 141 ? 0.4019 0.3467 0.4407 0.0994  0.1232  0.0093  468 VAL A CG2 
809  N N   . VAL A 142 ? 0.2976 0.3504 0.4870 0.0922  0.1053  0.0513  469 VAL A N   
810  C CA  . VAL A 142 ? 0.2708 0.3575 0.5031 0.0836  0.0933  0.0644  469 VAL A CA  
811  C C   . VAL A 142 ? 0.2711 0.3722 0.5218 0.0826  0.1018  0.0766  469 VAL A C   
812  O O   . VAL A 142 ? 0.2828 0.3824 0.5365 0.0959  0.1249  0.0867  469 VAL A O   
813  C CB  . VAL A 142 ? 0.2687 0.3751 0.5353 0.0911  0.0964  0.0791  469 VAL A CB  
814  C CG1 . VAL A 142 ? 0.2398 0.3818 0.5508 0.0796  0.0803  0.0939  469 VAL A CG1 
815  C CG2 . VAL A 142 ? 0.2676 0.3579 0.5158 0.0934  0.0905  0.0689  469 VAL A CG2 
816  N N   . LEU A 143 ? 0.2493 0.3618 0.5103 0.0673  0.0843  0.0756  470 LEU A N   
817  C CA  . LEU A 143 ? 0.2515 0.3768 0.5310 0.0630  0.0884  0.0868  470 LEU A CA  
818  C C   . LEU A 143 ? 0.2306 0.3826 0.5487 0.0482  0.0686  0.0962  470 LEU A C   
819  O O   . LEU A 143 ? 0.2091 0.3592 0.5214 0.0379  0.0483  0.0862  470 LEU A O   
820  C CB  . LEU A 143 ? 0.2595 0.3634 0.5047 0.0574  0.0855  0.0738  470 LEU A CB  
821  C CG  . LEU A 143 ? 0.2910 0.3665 0.4936 0.0688  0.1022  0.0652  470 LEU A CG  
822  C CD1 . LEU A 143 ? 0.2920 0.3503 0.4651 0.0608  0.0937  0.0541  470 LEU A CD1 
823  C CD2 . LEU A 143 ? 0.2983 0.3744 0.5045 0.0839  0.1294  0.0790  470 LEU A CD2 
824  N N   . HIS A 144 ? 0.2269 0.4017 0.5820 0.0466  0.0744  0.1154  471 HIS A N   
825  C CA  . HIS A 144 ? 0.2232 0.4193 0.6118 0.0296  0.0534  0.1240  471 HIS A CA  
826  C C   . HIS A 144 ? 0.2192 0.4002 0.5889 0.0154  0.0396  0.1119  471 HIS A C   
827  O O   . HIS A 144 ? 0.2233 0.3877 0.5696 0.0195  0.0509  0.1066  471 HIS A O   
828  C CB  . HIS A 144 ? 0.2283 0.4556 0.6679 0.0306  0.0631  0.1509  471 HIS A CB  
829  C CG  . HIS A 144 ? 0.2226 0.4752 0.7024 0.0132  0.0390  0.1626  471 HIS A CG  
830  N ND1 . HIS A 144 ? 0.2240 0.4777 0.7133 -0.0050 0.0226  0.1633  471 HIS A ND1 
831  C CD2 . HIS A 144 ? 0.2258 0.5023 0.7381 0.0105  0.0272  0.1749  471 HIS A CD2 
832  C CE1 . HIS A 144 ? 0.2294 0.5045 0.7526 -0.0195 0.0006  0.1741  471 HIS A CE1 
833  N NE2 . HIS A 144 ? 0.2263 0.5173 0.7649 -0.0105 0.0024  0.1821  471 HIS A NE2 
834  N N   . ARG A 145 ? 0.2216 0.4072 0.6008 -0.0006 0.0153  0.1085  472 ARG A N   
835  C CA  . ARG A 145 ? 0.2455 0.4178 0.6141 -0.0149 0.0014  0.1000  472 ARG A CA  
836  C C   . ARG A 145 ? 0.2545 0.4306 0.6387 -0.0164 0.0127  0.1123  472 ARG A C   
837  O O   . ARG A 145 ? 0.2717 0.4279 0.6324 -0.0184 0.0139  0.1031  472 ARG A O   
838  C CB  . ARG A 145 ? 0.2652 0.4447 0.6491 -0.0322 -0.0246 0.1001  472 ARG A CB  
839  C CG  . ARG A 145 ? 0.3106 0.4688 0.6768 -0.0461 -0.0388 0.0878  472 ARG A CG  
840  C CD  . ARG A 145 ? 0.3490 0.5099 0.7274 -0.0648 -0.0648 0.0884  472 ARG A CD  
841  N NE  . ARG A 145 ? 0.3802 0.5677 0.8055 -0.0745 -0.0706 0.1107  472 ARG A NE  
842  C CZ  . ARG A 145 ? 0.4059 0.5970 0.8541 -0.0830 -0.0692 0.1219  472 ARG A CZ  
843  N NH1 . ARG A 145 ? 0.4278 0.5961 0.8543 -0.0818 -0.0613 0.1128  472 ARG A NH1 
844  N NH2 . ARG A 145 ? 0.4082 0.6275 0.9043 -0.0927 -0.0758 0.1446  472 ARG A NH2 
845  N N   . LEU A 146 ? 0.2493 0.4517 0.6744 -0.0146 0.0218  0.1347  473 LEU A N   
846  C CA  . LEU A 146 ? 0.2581 0.4680 0.7029 -0.0154 0.0347  0.1502  473 LEU A CA  
847  C C   . LEU A 146 ? 0.2661 0.4598 0.6798 0.0013  0.0604  0.1470  473 LEU A C   
848  O O   . LEU A 146 ? 0.2633 0.4516 0.6751 0.0000  0.0689  0.1530  473 LEU A O   
849  C CB  . LEU A 146 ? 0.2630 0.5090 0.7642 -0.0167 0.0394  0.1777  473 LEU A CB  
850  C CG  . LEU A 146 ? 0.2707 0.5345 0.8115 -0.0385 0.0144  0.1889  473 LEU A CG  
851  C CD1 . LEU A 146 ? 0.2663 0.5700 0.8664 -0.0360 0.0234  0.2195  473 LEU A CD1 
852  C CD2 . LEU A 146 ? 0.2835 0.5313 0.8188 -0.0538 0.0046  0.1853  473 LEU A CD2 
853  N N   . GLN A 147 ? 0.2527 0.4363 0.6399 0.0165  0.0720  0.1377  474 GLN A N   
854  C CA  . GLN A 147 ? 0.2767 0.4372 0.6231 0.0300  0.0914  0.1298  474 GLN A CA  
855  C C   . GLN A 147 ? 0.2907 0.4240 0.5965 0.0238  0.0788  0.1093  474 GLN A C   
856  O O   . GLN A 147 ? 0.3260 0.4428 0.6043 0.0293  0.0896  0.1067  474 GLN A O   
857  C CB  . GLN A 147 ? 0.2721 0.4258 0.6006 0.0467  0.1062  0.1253  474 GLN A CB  
858  C CG  . GLN A 147 ? 0.2654 0.4416 0.6285 0.0589  0.1268  0.1468  474 GLN A CG  
859  C CD  . GLN A 147 ? 0.2703 0.4330 0.6107 0.0756  0.1404  0.1395  474 GLN A CD  
860  O OE1 . GLN A 147 ? 0.2516 0.4163 0.5951 0.0738  0.1273  0.1324  474 GLN A OE1 
861  N NE2 . GLN A 147 ? 0.2902 0.4352 0.6032 0.0917  0.1666  0.1404  474 GLN A NE2 
862  N N   . CYS A 148 ? 0.2853 0.4140 0.5872 0.0132  0.0569  0.0962  475 CYS A N   
863  C CA  . CYS A 148 ? 0.2952 0.3996 0.5618 0.0090  0.0459  0.0776  475 CYS A CA  
864  C C   . CYS A 148 ? 0.3009 0.3997 0.5726 -0.0020 0.0378  0.0795  475 CYS A C   
865  O O   . CYS A 148 ? 0.3025 0.3824 0.5481 -0.0027 0.0338  0.0688  475 CYS A O   
866  C CB  . CYS A 148 ? 0.2844 0.3855 0.5438 0.0045  0.0294  0.0637  475 CYS A CB  
867  S SG  . CYS A 148 ? 0.3002 0.3999 0.5452 0.0189  0.0405  0.0596  475 CYS A SG  
868  N N   . VAL A 149 ? 0.3158 0.4319 0.6243 -0.0110 0.0345  0.0945  476 VAL A N   
869  C CA  . VAL A 149 ? 0.3130 0.4242 0.6333 -0.0242 0.0244  0.0980  476 VAL A CA  
870  C C   . VAL A 149 ? 0.3186 0.4159 0.6203 -0.0191 0.0367  0.1009  476 VAL A C   
871  O O   . VAL A 149 ? 0.3161 0.3956 0.6036 -0.0247 0.0278  0.0930  476 VAL A O   
872  C CB  . VAL A 149 ? 0.3278 0.4633 0.6956 -0.0353 0.0192  0.1168  476 VAL A CB  
873  C CG1 . VAL A 149 ? 0.3417 0.4786 0.7288 -0.0422 0.0240  0.1319  476 VAL A CG1 
874  C CG2 . VAL A 149 ? 0.3287 0.4627 0.7033 -0.0496 -0.0057 0.1076  476 VAL A CG2 
875  N N   . ARG A 150 ? 0.3292 0.4320 0.6266 -0.0071 0.0575  0.1115  477 ARG A N   
876  C CA  . ARG A 150 ? 0.3610 0.4498 0.6361 -0.0020 0.0689  0.1153  477 ARG A CA  
877  C C   . ARG A 150 ? 0.3613 0.4256 0.5922 0.0025  0.0638  0.0974  477 ARG A C   
878  O O   . ARG A 150 ? 0.3556 0.4070 0.5734 0.0007  0.0624  0.0983  477 ARG A O   
879  C CB  . ARG A 150 ? 0.4123 0.5106 0.6898 0.0099  0.0941  0.1318  477 ARG A CB  
880  C CG  . ARG A 150 ? 0.4612 0.5827 0.7871 0.0022  0.0990  0.1553  477 ARG A CG  
881  C CD  . ARG A 150 ? 0.4982 0.6371 0.8396 0.0146  0.1253  0.1748  477 ARG A CD  
882  N NE  . ARG A 150 ? 0.5871 0.7110 0.8960 0.0255  0.1456  0.1802  477 ARG A NE  
883  C CZ  . ARG A 150 ? 0.6308 0.7626 0.9418 0.0387  0.1734  0.1973  477 ARG A CZ  
884  N NH1 . ARG A 150 ? 0.6458 0.8038 0.9961 0.0440  0.1860  0.2127  477 ARG A NH1 
885  N NH2 . ARG A 150 ? 0.6462 0.7592 0.9186 0.0475  0.1892  0.1999  477 ARG A NH2 
886  N N   . GLY A 151 ? 0.3353 0.3945 0.5467 0.0078  0.0600  0.0828  478 GLY A N   
887  C CA  . GLY A 151 ? 0.3429 0.3821 0.5178 0.0109  0.0534  0.0675  478 GLY A CA  
888  C C   . GLY A 151 ? 0.3244 0.3574 0.5028 0.0018  0.0342  0.0556  478 GLY A C   
889  O O   . GLY A 151 ? 0.3219 0.3416 0.4862 0.0004  0.0284  0.0514  478 GLY A O   
890  N N   . PHE A 152 ? 0.3042 0.3467 0.5016 -0.0037 0.0254  0.0516  479 PHE A N   
891  C CA  . PHE A 152 ? 0.2985 0.3337 0.4948 -0.0107 0.0094  0.0390  479 PHE A CA  
892  C C   . PHE A 152 ? 0.3113 0.3424 0.5256 -0.0221 0.0000  0.0423  479 PHE A C   
893  O O   . PHE A 152 ? 0.3054 0.3235 0.5127 -0.0266 -0.0109 0.0314  479 PHE A O   
894  C CB  . PHE A 152 ? 0.2921 0.3372 0.4955 -0.0116 0.0037  0.0334  479 PHE A CB  
895  C CG  . PHE A 152 ? 0.2989 0.3411 0.4807 -0.0022 0.0084  0.0251  479 PHE A CG  
896  C CD1 . PHE A 152 ? 0.2986 0.3323 0.4655 -0.0026 -0.0006 0.0116  479 PHE A CD1 
897  C CD2 . PHE A 152 ? 0.2955 0.3418 0.4718 0.0072  0.0228  0.0313  479 PHE A CD2 
898  C CE1 . PHE A 152 ? 0.3063 0.3372 0.4558 0.0045  0.0027  0.0052  479 PHE A CE1 
899  C CE2 . PHE A 152 ? 0.3038 0.3430 0.4587 0.0147  0.0262  0.0231  479 PHE A CE2 
900  C CZ  . PHE A 152 ? 0.3023 0.3344 0.4451 0.0125  0.0152  0.0103  479 PHE A CZ  
901  N N   . GLY A 153 ? 0.3198 0.3607 0.5578 -0.0268 0.0048  0.0576  480 GLY A N   
902  C CA  . GLY A 153 ? 0.3293 0.3658 0.5880 -0.0402 -0.0058 0.0617  480 GLY A CA  
903  C C   . GLY A 153 ? 0.3328 0.3705 0.5994 -0.0497 -0.0216 0.0533  480 GLY A C   
904  O O   . GLY A 153 ? 0.3327 0.3846 0.6021 -0.0464 -0.0215 0.0522  480 GLY A O   
905  N N   . GLU A 154 ? 0.3452 0.3643 0.6096 -0.0599 -0.0345 0.0460  481 GLU A N   
906  C CA  . GLU A 154 ? 0.3875 0.4011 0.6523 -0.0706 -0.0512 0.0370  481 GLU A CA  
907  C C   . GLU A 154 ? 0.3616 0.3721 0.6022 -0.0634 -0.0536 0.0219  481 GLU A C   
908  O O   . GLU A 154 ? 0.3760 0.3905 0.6177 -0.0695 -0.0646 0.0180  481 GLU A O   
909  C CB  . GLU A 154 ? 0.4502 0.4351 0.7073 -0.0807 -0.0621 0.0293  481 GLU A CB  
910  C CG  . GLU A 154 ? 0.5304 0.5147 0.8147 -0.0957 -0.0690 0.0423  481 GLU A CG  
911  C CD  . GLU A 154 ? 0.6259 0.5752 0.8978 -0.1020 -0.0750 0.0344  481 GLU A CD  
912  O OE1 . GLU A 154 ? 0.6752 0.6217 0.9649 -0.1067 -0.0713 0.0472  481 GLU A OE1 
913  O OE2 . GLU A 154 ? 0.6381 0.5616 0.8826 -0.1013 -0.0817 0.0165  481 GLU A OE2 
914  N N   . TRP A 155 ? 0.3351 0.3375 0.5540 -0.0514 -0.0445 0.0143  482 TRP A N   
915  C CA  . TRP A 155 ? 0.3189 0.3182 0.5162 -0.0441 -0.0451 0.0014  482 TRP A CA  
916  C C   . TRP A 155 ? 0.3172 0.3365 0.5218 -0.0429 -0.0460 0.0042  482 TRP A C   
917  O O   . TRP A 155 ? 0.3280 0.3441 0.5210 -0.0441 -0.0535 -0.0048 482 TRP A O   
918  C CB  . TRP A 155 ? 0.2995 0.2943 0.4807 -0.0321 -0.0347 -0.0014 482 TRP A CB  
919  C CG  . TRP A 155 ? 0.2813 0.2719 0.4432 -0.0254 -0.0350 -0.0133 482 TRP A CG  
920  C CD1 . TRP A 155 ? 0.2849 0.2652 0.4356 -0.0277 -0.0421 -0.0242 482 TRP A CD1 
921  C CD2 . TRP A 155 ? 0.2655 0.2603 0.4159 -0.0157 -0.0278 -0.0146 482 TRP A CD2 
922  N NE1 . TRP A 155 ? 0.2817 0.2629 0.4187 -0.0193 -0.0382 -0.0306 482 TRP A NE1 
923  C CE2 . TRP A 155 ? 0.2596 0.2495 0.3973 -0.0128 -0.0307 -0.0249 482 TRP A CE2 
924  C CE3 . TRP A 155 ? 0.2589 0.2591 0.4063 -0.0097 -0.0195 -0.0078 482 TRP A CE3 
925  C CZ2 . TRP A 155 ? 0.2617 0.2543 0.3889 -0.0054 -0.0268 -0.0276 482 TRP A CZ2 
926  C CZ3 . TRP A 155 ? 0.2541 0.2539 0.3867 -0.0030 -0.0171 -0.0120 482 TRP A CZ3 
927  C CH2 . TRP A 155 ? 0.2592 0.2561 0.3840 -0.0015 -0.0214 -0.0215 482 TRP A CH2 
928  N N   . ILE A 156 ? 0.2923 0.3313 0.5165 -0.0404 -0.0380 0.0179  483 ILE A N   
929  C CA  . ILE A 156 ? 0.2749 0.3326 0.5089 -0.0376 -0.0373 0.0224  483 ILE A CA  
930  C C   . ILE A 156 ? 0.2918 0.3553 0.5390 -0.0498 -0.0540 0.0237  483 ILE A C   
931  O O   . ILE A 156 ? 0.2743 0.3428 0.5154 -0.0483 -0.0590 0.0196  483 ILE A O   
932  C CB  . ILE A 156 ? 0.2669 0.3426 0.5174 -0.0292 -0.0217 0.0370  483 ILE A CB  
933  C CG1 . ILE A 156 ? 0.2562 0.3432 0.5058 -0.0208 -0.0174 0.0370  483 ILE A CG1 
934  C CG2 . ILE A 156 ? 0.2678 0.3596 0.5531 -0.0370 -0.0217 0.0547  483 ILE A CG2 
935  C CD1 . ILE A 156 ? 0.2539 0.3269 0.4725 -0.0119 -0.0135 0.0233  483 ILE A CD1 
936  N N   . ASP A 157 ? 0.3229 0.3833 0.5857 -0.0627 -0.0636 0.0291  484 ASP A N   
937  C CA  . ASP A 157 ? 0.3481 0.4085 0.6189 -0.0777 -0.0834 0.0292  484 ASP A CA  
938  C C   . ASP A 157 ? 0.3514 0.3888 0.5874 -0.0793 -0.0935 0.0104  484 ASP A C   
939  O O   . ASP A 157 ? 0.3532 0.3954 0.5858 -0.0841 -0.1051 0.0090  484 ASP A O   
940  C CB  . ASP A 157 ? 0.3875 0.4422 0.6774 -0.0925 -0.0924 0.0369  484 ASP A CB  
941  C CG  . ASP A 157 ? 0.4024 0.4848 0.7334 -0.0932 -0.0839 0.0594  484 ASP A CG  
942  O OD1 . ASP A 157 ? 0.3918 0.4984 0.7378 -0.0837 -0.0738 0.0694  484 ASP A OD1 
943  O OD2 . ASP A 157 ? 0.4551 0.5347 0.8046 -0.1031 -0.0863 0.0684  484 ASP A OD2 
944  N N   . SER A 158 ? 0.3490 0.3621 0.5597 -0.0743 -0.0880 -0.0024 485 SER A N   
945  C CA  . SER A 158 ? 0.3681 0.3599 0.5453 -0.0720 -0.0921 -0.0193 485 SER A CA  
946  C C   . SER A 158 ? 0.3338 0.3386 0.5018 -0.0617 -0.0866 -0.0216 485 SER A C   
947  O O   . SER A 158 ? 0.3453 0.3441 0.4958 -0.0639 -0.0947 -0.0287 485 SER A O   
948  C CB  . SER A 158 ? 0.3679 0.3363 0.5265 -0.0652 -0.0833 -0.0291 485 SER A CB  
949  O OG  . SER A 158 ? 0.3981 0.3510 0.5640 -0.0748 -0.0887 -0.0271 485 SER A OG  
950  N N   . ILE A 159 ? 0.3068 0.3271 0.4847 -0.0508 -0.0729 -0.0152 486 ILE A N   
951  C CA  . ILE A 159 ? 0.2957 0.3267 0.4670 -0.0413 -0.0671 -0.0163 486 ILE A CA  
952  C C   . ILE A 159 ? 0.3118 0.3596 0.4959 -0.0463 -0.0767 -0.0087 486 ILE A C   
953  O O   . ILE A 159 ? 0.3342 0.3804 0.5031 -0.0444 -0.0806 -0.0140 486 ILE A O   
954  C CB  . ILE A 159 ? 0.2695 0.3085 0.4454 -0.0299 -0.0516 -0.0116 486 ILE A CB  
955  C CG1 . ILE A 159 ? 0.2731 0.2951 0.4314 -0.0250 -0.0455 -0.0202 486 ILE A CG1 
956  C CG2 . ILE A 159 ? 0.2370 0.2869 0.4107 -0.0218 -0.0464 -0.0103 486 ILE A CG2 
957  C CD1 . ILE A 159 ? 0.2608 0.2858 0.4199 -0.0169 -0.0336 -0.0154 486 ILE A CD1 
958  N N   . VAL A 160 ? 0.3219 0.3863 0.5350 -0.0526 -0.0806 0.0050  487 VAL A N   
959  C CA  . VAL A 160 ? 0.3321 0.4172 0.5648 -0.0568 -0.0897 0.0163  487 VAL A CA  
960  C C   . VAL A 160 ? 0.3696 0.4437 0.5864 -0.0696 -0.1105 0.0097  487 VAL A C   
961  O O   . VAL A 160 ? 0.3699 0.4521 0.5829 -0.0696 -0.1179 0.0118  487 VAL A O   
962  C CB  . VAL A 160 ? 0.3348 0.4425 0.6076 -0.0607 -0.0882 0.0352  487 VAL A CB  
963  C CG1 . VAL A 160 ? 0.3290 0.4596 0.6278 -0.0685 -0.1026 0.0493  487 VAL A CG1 
964  C CG2 . VAL A 160 ? 0.3236 0.4414 0.6065 -0.0458 -0.0660 0.0422  487 VAL A CG2 
965  N N   . GLU A 161 ? 0.3994 0.4525 0.6042 -0.0801 -0.1193 0.0017  488 GLU A N   
966  C CA  . GLU A 161 ? 0.4510 0.4840 0.6309 -0.0925 -0.1381 -0.0078 488 GLU A CA  
967  C C   . GLU A 161 ? 0.4335 0.4518 0.5764 -0.0839 -0.1341 -0.0215 488 GLU A C   
968  O O   . GLU A 161 ? 0.4558 0.4741 0.5851 -0.0887 -0.1464 -0.0221 488 GLU A O   
969  C CB  . GLU A 161 ? 0.5155 0.5224 0.6863 -0.1025 -0.1435 -0.0155 488 GLU A CB  
970  C CG  . GLU A 161 ? 0.6512 0.6233 0.7815 -0.1111 -0.1566 -0.0321 488 GLU A CG  
971  C CD  . GLU A 161 ? 0.7717 0.7388 0.9054 -0.1321 -0.1823 -0.0280 488 GLU A CD  
972  O OE1 . GLU A 161 ? 0.8115 0.7765 0.9673 -0.1433 -0.1885 -0.0216 488 GLU A OE1 
973  O OE2 . GLU A 161 ? 0.8571 0.8214 0.9711 -0.1384 -0.1974 -0.0304 488 GLU A OE2 
974  N N   . PHE A 162 ? 0.3984 0.4056 0.5267 -0.0715 -0.1172 -0.0307 489 PHE A N   
975  C CA  . PHE A 162 ? 0.3850 0.3818 0.4843 -0.0620 -0.1102 -0.0410 489 PHE A CA  
976  C C   . PHE A 162 ? 0.3551 0.3738 0.4628 -0.0560 -0.1084 -0.0328 489 PHE A C   
977  O O   . PHE A 162 ? 0.3597 0.3723 0.4448 -0.0551 -0.1123 -0.0374 489 PHE A O   
978  C CB  . PHE A 162 ? 0.3772 0.3651 0.4701 -0.0503 -0.0929 -0.0478 489 PHE A CB  
979  C CG  . PHE A 162 ? 0.3821 0.3614 0.4504 -0.0409 -0.0848 -0.0564 489 PHE A CG  
980  C CD1 . PHE A 162 ? 0.4200 0.3744 0.4561 -0.0425 -0.0877 -0.0680 489 PHE A CD1 
981  C CD2 . PHE A 162 ? 0.3520 0.3461 0.4281 -0.0307 -0.0738 -0.0524 489 PHE A CD2 
982  C CE1 . PHE A 162 ? 0.4330 0.3822 0.4496 -0.0329 -0.0778 -0.0734 489 PHE A CE1 
983  C CE2 . PHE A 162 ? 0.3638 0.3524 0.4218 -0.0231 -0.0665 -0.0579 489 PHE A CE2 
984  C CZ  . PHE A 162 ? 0.3890 0.3570 0.4190 -0.0238 -0.0677 -0.0675 489 PHE A CZ  
985  N N   . SER A 163 ? 0.3118 0.3534 0.4497 -0.0508 -0.1010 -0.0207 490 SER A N   
986  C CA  . SER A 163 ? 0.3126 0.3742 0.4628 -0.0444 -0.0985 -0.0110 490 SER A CA  
987  C C   . SER A 163 ? 0.3285 0.3975 0.4790 -0.0540 -0.1170 -0.0046 490 SER A C   
988  O O   . SER A 163 ? 0.3237 0.3934 0.4598 -0.0506 -0.1189 -0.0049 490 SER A O   
989  C CB  . SER A 163 ? 0.2810 0.3623 0.4634 -0.0382 -0.0878 0.0016  490 SER A CB  
990  O OG  . SER A 163 ? 0.2763 0.3729 0.4698 -0.0301 -0.0828 0.0105  490 SER A OG  
991  N N   . SER A 164 ? 0.3510 0.4248 0.5175 -0.0669 -0.1313 0.0018  491 SER A N   
992  C CA  . SER A 164 ? 0.3872 0.4675 0.5553 -0.0795 -0.1532 0.0089  491 SER A CA  
993  C C   . SER A 164 ? 0.4053 0.4605 0.5279 -0.0836 -0.1626 -0.0049 491 SER A C   
994  O O   . SER A 164 ? 0.3994 0.4611 0.5129 -0.0834 -0.1702 -0.0004 491 SER A O   
995  C CB  . SER A 164 ? 0.4312 0.5145 0.6208 -0.0952 -0.1678 0.0156  491 SER A CB  
996  O OG  . SER A 164 ? 0.4405 0.5542 0.6769 -0.0922 -0.1617 0.0344  491 SER A OG  
997  N N   . ASN A 165 ? 0.4338 0.4595 0.5271 -0.0858 -0.1600 -0.0212 492 ASN A N   
998  C CA  . ASN A 165 ? 0.4938 0.4913 0.5392 -0.0866 -0.1635 -0.0359 492 ASN A CA  
999  C C   . ASN A 165 ? 0.4818 0.4820 0.5119 -0.0722 -0.1489 -0.0381 492 ASN A C   
1000 O O   . ASN A 165 ? 0.5166 0.5079 0.5173 -0.0736 -0.1558 -0.0407 492 ASN A O   
1001 C CB  . ASN A 165 ? 0.5365 0.5004 0.5561 -0.0888 -0.1596 -0.0522 492 ASN A CB  
1002 C CG  . ASN A 165 ? 0.5821 0.5370 0.6108 -0.1059 -0.1772 -0.0510 492 ASN A CG  
1003 O OD1 . ASN A 165 ? 0.6205 0.5593 0.6504 -0.1066 -0.1713 -0.0574 492 ASN A OD1 
1004 N ND2 . ASN A 165 ? 0.6106 0.5768 0.6485 -0.1202 -0.1995 -0.0411 492 ASN A ND2 
1005 N N   . LEU A 166 ? 0.4368 0.4490 0.4863 -0.0595 -0.1303 -0.0358 493 LEU A N   
1006 C CA  . LEU A 166 ? 0.4456 0.4603 0.4848 -0.0471 -0.1165 -0.0370 493 LEU A CA  
1007 C C   . LEU A 166 ? 0.4489 0.4831 0.4979 -0.0466 -0.1236 -0.0241 493 LEU A C   
1008 O O   . LEU A 166 ? 0.4697 0.4983 0.4951 -0.0438 -0.1236 -0.0253 493 LEU A O   
1009 C CB  . LEU A 166 ? 0.4071 0.4286 0.4651 -0.0362 -0.0983 -0.0371 493 LEU A CB  
1010 C CG  . LEU A 166 ? 0.4182 0.4386 0.4678 -0.0247 -0.0833 -0.0398 493 LEU A CG  
1011 C CD1 . LEU A 166 ? 0.4141 0.4128 0.4330 -0.0220 -0.0772 -0.0519 493 LEU A CD1 
1012 C CD2 . LEU A 166 ? 0.3706 0.4004 0.4436 -0.0177 -0.0712 -0.0368 493 LEU A CD2 
1013 N N   . GLN A 167 ? 0.4347 0.4916 0.5192 -0.0489 -0.1287 -0.0104 494 GLN A N   
1014 C CA  . GLN A 167 ? 0.4328 0.5106 0.5341 -0.0466 -0.1337 0.0044  494 GLN A CA  
1015 C C   . GLN A 167 ? 0.4618 0.5387 0.5468 -0.0577 -0.1555 0.0089  494 GLN A C   
1016 O O   . GLN A 167 ? 0.4652 0.5498 0.5456 -0.0541 -0.1583 0.0168  494 GLN A O   
1017 C CB  . GLN A 167 ? 0.4161 0.5182 0.5620 -0.0427 -0.1287 0.0188  494 GLN A CB  
1018 C CG  . GLN A 167 ? 0.3991 0.4989 0.5500 -0.0288 -0.1061 0.0147  494 GLN A CG  
1019 C CD  . GLN A 167 ? 0.3938 0.5121 0.5810 -0.0216 -0.0960 0.0273  494 GLN A CD  
1020 O OE1 . GLN A 167 ? 0.4131 0.5260 0.6027 -0.0141 -0.0806 0.0227  494 GLN A OE1 
1021 N NE2 . GLN A 167 ? 0.3871 0.5270 0.6023 -0.0234 -0.1042 0.0441  494 GLN A NE2 
1022 N N   . ASN A 168 ? 0.4815 0.5457 0.5537 -0.0716 -0.1715 0.0032  495 ASN A N   
1023 C CA  . ASN A 168 ? 0.5232 0.5772 0.5666 -0.0842 -0.1940 0.0031  495 ASN A CA  
1024 C C   . ASN A 168 ? 0.5307 0.5632 0.5262 -0.0789 -0.1892 -0.0070 495 ASN A C   
1025 O O   . ASN A 168 ? 0.5516 0.5801 0.5230 -0.0859 -0.2056 -0.0031 495 ASN A O   
1026 C CB  . ASN A 168 ? 0.5812 0.6153 0.6110 -0.1000 -0.2096 -0.0059 495 ASN A CB  
1027 C CG  . ASN A 168 ? 0.6039 0.6619 0.6777 -0.1122 -0.2261 0.0099  495 ASN A CG  
1028 O OD1 . ASN A 168 ? 0.6396 0.6848 0.7130 -0.1251 -0.2370 0.0049  495 ASN A OD1 
1029 N ND2 . ASN A 168 ? 0.5931 0.6858 0.7071 -0.1078 -0.2273 0.0303  495 ASN A ND2 
1030 N N   . MET A 169 ? 0.5090 0.5289 0.4915 -0.0667 -0.1669 -0.0182 496 MET A N   
1031 C CA  . MET A 169 ? 0.5352 0.5376 0.4773 -0.0602 -0.1587 -0.0255 496 MET A CA  
1032 C C   . MET A 169 ? 0.5074 0.5277 0.4592 -0.0507 -0.1517 -0.0132 496 MET A C   
1033 O O   . MET A 169 ? 0.5296 0.5374 0.4482 -0.0465 -0.1467 -0.0161 496 MET A O   
1034 C CB  . MET A 169 ? 0.5464 0.5284 0.4720 -0.0518 -0.1388 -0.0408 496 MET A CB  
1035 C CG  . MET A 169 ? 0.5967 0.5526 0.5017 -0.0602 -0.1450 -0.0545 496 MET A CG  
1036 S SD  . MET A 169 ? 0.6419 0.5749 0.5249 -0.0467 -0.1191 -0.0694 496 MET A SD  
1037 C CE  . MET A 169 ? 0.6816 0.5992 0.5171 -0.0404 -0.1126 -0.0719 496 MET A CE  
1038 N N   . ASN A 170 ? 0.4628 0.5101 0.4585 -0.0467 -0.1501 0.0008  497 ASN A N   
1039 C CA  . ASN A 170 ? 0.4418 0.5050 0.4511 -0.0375 -0.1438 0.0138  497 ASN A CA  
1040 C C   . ASN A 170 ? 0.4179 0.4694 0.4100 -0.0268 -0.1237 0.0066  497 ASN A C   
1041 O O   . ASN A 170 ? 0.4324 0.4784 0.4010 -0.0242 -0.1224 0.0095  497 ASN A O   
1042 C CB  . ASN A 170 ? 0.4814 0.5510 0.4787 -0.0440 -0.1630 0.0261  497 ASN A CB  
1043 C CG  . ASN A 170 ? 0.5159 0.6035 0.5405 -0.0550 -0.1843 0.0379  497 ASN A CG  
1044 O OD1 . ASN A 170 ? 0.5695 0.6499 0.5718 -0.0684 -0.2063 0.0379  497 ASN A OD1 
1045 N ND2 . ASN A 170 ? 0.4809 0.5910 0.5533 -0.0500 -0.1780 0.0483  497 ASN A ND2 
1046 N N   . ILE A 171 ? 0.3838 0.4320 0.3882 -0.0212 -0.1085 -0.0016 498 ILE A N   
1047 C CA  . ILE A 171 ? 0.3738 0.4129 0.3676 -0.0126 -0.0907 -0.0076 498 ILE A CA  
1048 C C   . ILE A 171 ? 0.3507 0.4037 0.3719 -0.0049 -0.0823 0.0029  498 ILE A C   
1049 O O   . ILE A 171 ? 0.3343 0.3968 0.3842 -0.0027 -0.0795 0.0057  498 ILE A O   
1050 C CB  . ILE A 171 ? 0.3591 0.3874 0.3530 -0.0114 -0.0810 -0.0207 498 ILE A CB  
1051 C CG1 . ILE A 171 ? 0.3852 0.3960 0.3529 -0.0193 -0.0903 -0.0312 498 ILE A CG1 
1052 C CG2 . ILE A 171 ? 0.3366 0.3596 0.3272 -0.0030 -0.0634 -0.0245 498 ILE A CG2 
1053 C CD1 . ILE A 171 ? 0.3825 0.3861 0.3597 -0.0195 -0.0845 -0.0407 498 ILE A CD1 
1054 N N   . ASP A 172 ? 0.3621 0.4142 0.3729 -0.0006 -0.0776 0.0090  499 ASP A N   
1055 C CA  . ASP A 172 ? 0.3462 0.4068 0.3802 0.0062  -0.0699 0.0190  499 ASP A CA  
1056 C C   . ASP A 172 ? 0.3283 0.3831 0.3726 0.0107  -0.0552 0.0115  499 ASP A C   
1057 O O   . ASP A 172 ? 0.3347 0.3812 0.3683 0.0094  -0.0505 0.0006  499 ASP A O   
1058 C CB  . ASP A 172 ? 0.3563 0.4175 0.3784 0.0086  -0.0704 0.0300  499 ASP A CB  
1059 C CG  . ASP A 172 ? 0.3817 0.4308 0.3777 0.0102  -0.0601 0.0249  499 ASP A CG  
1060 O OD1 . ASP A 172 ? 0.4206 0.4673 0.3954 0.0103  -0.0624 0.0322  499 ASP A OD1 
1061 O OD2 . ASP A 172 ? 0.3692 0.4114 0.3641 0.0116  -0.0496 0.0152  499 ASP A OD2 
1062 N N   . ILE A 173 ? 0.3138 0.3713 0.3778 0.0159  -0.0488 0.0177  500 ILE A N   
1063 C CA  . ILE A 173 ? 0.3027 0.3532 0.3756 0.0186  -0.0380 0.0114  500 ILE A CA  
1064 C C   . ILE A 173 ? 0.2976 0.3406 0.3572 0.0180  -0.0308 0.0065  500 ILE A C   
1065 O O   . ILE A 173 ? 0.2904 0.3294 0.3516 0.0171  -0.0263 -0.0016 500 ILE A O   
1066 C CB  . ILE A 173 ? 0.2991 0.3483 0.3903 0.0242  -0.0330 0.0187  500 ILE A CB  
1067 C CG1 . ILE A 173 ? 0.2908 0.3482 0.3988 0.0263  -0.0362 0.0220  500 ILE A CG1 
1068 C CG2 . ILE A 173 ? 0.2862 0.3234 0.3798 0.0249  -0.0240 0.0117  500 ILE A CG2 
1069 C CD1 . ILE A 173 ? 0.3029 0.3607 0.4280 0.0339  -0.0316 0.0328  500 ILE A CD1 
1070 N N   . SER A 174 ? 0.3063 0.3490 0.3539 0.0185  -0.0296 0.0133  501 SER A N   
1071 C CA  . SER A 174 ? 0.3162 0.3545 0.3548 0.0189  -0.0205 0.0120  501 SER A CA  
1072 C C   . SER A 174 ? 0.3205 0.3551 0.3427 0.0178  -0.0189 0.0021  501 SER A C   
1073 O O   . SER A 174 ? 0.3199 0.3528 0.3474 0.0186  -0.0113 -0.0023 501 SER A O   
1074 C CB  . SER A 174 ? 0.3402 0.3787 0.3686 0.0204  -0.0178 0.0233  501 SER A CB  
1075 O OG  . SER A 174 ? 0.3539 0.3925 0.3993 0.0221  -0.0173 0.0325  501 SER A OG  
1076 N N   . ALA A 175 ? 0.3211 0.3535 0.3243 0.0157  -0.0269 -0.0008 502 ALA A N   
1077 C CA  . ALA A 175 ? 0.3280 0.3514 0.3123 0.0148  -0.0255 -0.0115 502 ALA A CA  
1078 C C   . ALA A 175 ? 0.3144 0.3377 0.3151 0.0138  -0.0253 -0.0200 502 ALA A C   
1079 O O   . ALA A 175 ? 0.3117 0.3292 0.3088 0.0160  -0.0174 -0.0265 502 ALA A O   
1080 C CB  . ALA A 175 ? 0.3428 0.3595 0.3003 0.0106  -0.0369 -0.0137 502 ALA A CB  
1081 N N   . PHE A 176 ? 0.2830 0.3130 0.3025 0.0116  -0.0327 -0.0184 503 PHE A N   
1082 C CA  . PHE A 176 ? 0.2713 0.3009 0.3046 0.0108  -0.0321 -0.0249 503 PHE A CA  
1083 C C   . PHE A 176 ? 0.2658 0.2951 0.3110 0.0138  -0.0225 -0.0258 503 PHE A C   
1084 O O   . PHE A 176 ? 0.2556 0.2818 0.3034 0.0140  -0.0196 -0.0319 503 PHE A O   
1085 C CB  . PHE A 176 ? 0.2569 0.2941 0.3084 0.0093  -0.0387 -0.0210 503 PHE A CB  
1086 C CG  . PHE A 176 ? 0.2536 0.2896 0.3160 0.0088  -0.0371 -0.0267 503 PHE A CG  
1087 C CD1 . PHE A 176 ? 0.2600 0.2917 0.3164 0.0048  -0.0419 -0.0329 503 PHE A CD1 
1088 C CD2 . PHE A 176 ? 0.2386 0.2742 0.3131 0.0116  -0.0309 -0.0265 503 PHE A CD2 
1089 C CE1 . PHE A 176 ? 0.2600 0.2900 0.3261 0.0046  -0.0396 -0.0369 503 PHE A CE1 
1090 C CE2 . PHE A 176 ? 0.2343 0.2674 0.3147 0.0111  -0.0295 -0.0312 503 PHE A CE2 
1091 C CZ  . PHE A 176 ? 0.2367 0.2684 0.3145 0.0081  -0.0333 -0.0356 503 PHE A CZ  
1092 N N   . SER A 177 ? 0.2594 0.2916 0.3129 0.0152  -0.0190 -0.0189 504 SER A N   
1093 C CA  . SER A 177 ? 0.2627 0.2943 0.3281 0.0156  -0.0131 -0.0184 504 SER A CA  
1094 C C   . SER A 177 ? 0.2641 0.2958 0.3253 0.0171  -0.0060 -0.0201 504 SER A C   
1095 O O   . SER A 177 ? 0.2554 0.2883 0.3280 0.0167  -0.0039 -0.0217 504 SER A O   
1096 C CB  . SER A 177 ? 0.2595 0.2909 0.3322 0.0156  -0.0112 -0.0101 504 SER A CB  
1097 O OG  . SER A 177 ? 0.2910 0.3204 0.3691 0.0163  -0.0154 -0.0083 504 SER A OG  
1098 N N   . CYS A 178 ? 0.2788 0.3089 0.3230 0.0194  -0.0020 -0.0188 505 CYS A N   
1099 C CA  . CYS A 178 ? 0.2932 0.3215 0.3305 0.0234  0.0081  -0.0199 505 CYS A CA  
1100 C C   . CYS A 178 ? 0.2904 0.3121 0.3226 0.0247  0.0078  -0.0294 505 CYS A C   
1101 O O   . CYS A 178 ? 0.2816 0.3049 0.3240 0.0280  0.0151  -0.0296 505 CYS A O   
1102 C CB  . CYS A 178 ? 0.3135 0.3372 0.3263 0.0264  0.0134  -0.0169 505 CYS A CB  
1103 S SG  . CYS A 178 ? 0.3320 0.3630 0.3509 0.0262  0.0173  -0.0026 505 CYS A SG  
1104 N N   . ILE A 179 ? 0.2984 0.3132 0.3174 0.0218  -0.0009 -0.0357 506 ILE A N   
1105 C CA  . ILE A 179 ? 0.3168 0.3220 0.3288 0.0215  -0.0029 -0.0449 506 ILE A CA  
1106 C C   . ILE A 179 ? 0.2841 0.2946 0.3192 0.0210  -0.0037 -0.0456 506 ILE A C   
1107 O O   . ILE A 179 ? 0.2818 0.2877 0.3192 0.0242  0.0013  -0.0489 506 ILE A O   
1108 C CB  . ILE A 179 ? 0.3391 0.3383 0.3373 0.0156  -0.0154 -0.0488 506 ILE A CB  
1109 C CG1 . ILE A 179 ? 0.3814 0.3705 0.3488 0.0155  -0.0162 -0.0498 506 ILE A CG1 
1110 C CG2 . ILE A 179 ? 0.3631 0.3533 0.3606 0.0130  -0.0198 -0.0567 506 ILE A CG2 
1111 C CD1 . ILE A 179 ? 0.4350 0.4056 0.3773 0.0200  -0.0071 -0.0579 506 ILE A CD1 
1112 N N   . ALA A 180 ? 0.2598 0.2781 0.3098 0.0176  -0.0097 -0.0420 507 ALA A N   
1113 C CA  . ALA A 180 ? 0.2455 0.2672 0.3125 0.0167  -0.0110 -0.0419 507 ALA A CA  
1114 C C   . ALA A 180 ? 0.2440 0.2700 0.3223 0.0194  -0.0043 -0.0382 507 ALA A C   
1115 O O   . ALA A 180 ? 0.2416 0.2672 0.3275 0.0207  -0.0035 -0.0395 507 ALA A O   
1116 C CB  . ALA A 180 ? 0.2253 0.2507 0.3005 0.0141  -0.0157 -0.0384 507 ALA A CB  
1117 N N   . ALA A 181 ? 0.2419 0.2732 0.3238 0.0201  0.0000  -0.0319 508 ALA A N   
1118 C CA  . ALA A 181 ? 0.2539 0.2929 0.3518 0.0219  0.0061  -0.0254 508 ALA A CA  
1119 C C   . ALA A 181 ? 0.2629 0.3000 0.3584 0.0287  0.0154  -0.0270 508 ALA A C   
1120 O O   . ALA A 181 ? 0.2543 0.2971 0.3666 0.0305  0.0174  -0.0235 508 ALA A O   
1121 C CB  . ALA A 181 ? 0.2421 0.2869 0.3444 0.0212  0.0106  -0.0169 508 ALA A CB  
1122 N N   . LEU A 182 ? 0.2895 0.3164 0.3621 0.0324  0.0204  -0.0323 509 LEU A N   
1123 C CA  . LEU A 182 ? 0.3164 0.3345 0.3794 0.0402  0.0310  -0.0358 509 LEU A CA  
1124 C C   . LEU A 182 ? 0.3209 0.3313 0.3864 0.0405  0.0271  -0.0422 509 LEU A C   
1125 O O   . LEU A 182 ? 0.3418 0.3468 0.4088 0.0478  0.0367  -0.0426 509 LEU A O   
1126 C CB  . LEU A 182 ? 0.3406 0.3440 0.3708 0.0429  0.0358  -0.0413 509 LEU A CB  
1127 C CG  . LEU A 182 ? 0.3601 0.3699 0.3862 0.0460  0.0454  -0.0328 509 LEU A CG  
1128 C CD1 . LEU A 182 ? 0.3798 0.3733 0.3673 0.0471  0.0469  -0.0383 509 LEU A CD1 
1129 C CD2 . LEU A 182 ? 0.3581 0.3763 0.4011 0.0548  0.0624  -0.0241 509 LEU A CD2 
1130 N N   . ALA A 183 ? 0.3015 0.3113 0.3688 0.0336  0.0148  -0.0458 510 ALA A N   
1131 C CA  . ALA A 183 ? 0.3170 0.3207 0.3890 0.0334  0.0112  -0.0498 510 ALA A CA  
1132 C C   . ALA A 183 ? 0.3072 0.3228 0.4042 0.0352  0.0122  -0.0421 510 ALA A C   
1133 O O   . ALA A 183 ? 0.2939 0.3059 0.3980 0.0386  0.0138  -0.0420 510 ALA A O   
1134 C CB  . ALA A 183 ? 0.3012 0.3029 0.3700 0.0259  -0.0005 -0.0535 510 ALA A CB  
1135 N N   . MET A 184 ? 0.3009 0.3298 0.4115 0.0322  0.0100  -0.0348 511 MET A N   
1136 C CA  . MET A 184 ? 0.3045 0.3451 0.4388 0.0321  0.0082  -0.0262 511 MET A CA  
1137 C C   . MET A 184 ? 0.3045 0.3565 0.4567 0.0381  0.0188  -0.0164 511 MET A C   
1138 O O   . MET A 184 ? 0.3196 0.3782 0.4902 0.0423  0.0212  -0.0101 511 MET A O   
1139 C CB  . MET A 184 ? 0.3132 0.3585 0.4526 0.0235  -0.0031 -0.0240 511 MET A CB  
1140 C CG  . MET A 184 ? 0.3285 0.3837 0.4890 0.0216  -0.0085 -0.0155 511 MET A CG  
1141 S SD  . MET A 184 ? 0.3657 0.4213 0.5270 0.0107  -0.0221 -0.0133 511 MET A SD  
1142 C CE  . MET A 184 ? 0.3352 0.3949 0.4996 0.0083  -0.0180 -0.0095 511 MET A CE  
1143 N N   . VAL A 185 ? 0.2916 0.3472 0.4404 0.0391  0.0256  -0.0135 512 VAL A N   
1144 C CA  . VAL A 185 ? 0.2963 0.3642 0.4632 0.0452  0.0379  -0.0023 512 VAL A CA  
1145 C C   . VAL A 185 ? 0.3244 0.3808 0.4762 0.0573  0.0543  -0.0065 512 VAL A C   
1146 O O   . VAL A 185 ? 0.3470 0.3934 0.4748 0.0608  0.0631  -0.0108 512 VAL A O   
1147 C CB  . VAL A 185 ? 0.2887 0.3647 0.4586 0.0409  0.0394  0.0043  512 VAL A CB  
1148 C CG1 . VAL A 185 ? 0.2923 0.3848 0.4874 0.0470  0.0532  0.0191  512 VAL A CG1 
1149 C CG2 . VAL A 185 ? 0.2614 0.3408 0.4392 0.0287  0.0228  0.0055  512 VAL A CG2 
1150 N N   . THR A 186 ? 0.3267 0.3823 0.4904 0.0639  0.0583  -0.0049 513 THR A N   
1151 C CA  . THR A 186 ? 0.3794 0.4167 0.5250 0.0756  0.0730  -0.0115 513 THR A CA  
1152 C C   . THR A 186 ? 0.3927 0.4385 0.5673 0.0853  0.0814  -0.0015 513 THR A C   
1153 O O   . THR A 186 ? 0.3706 0.4318 0.5721 0.0800  0.0695  0.0064  513 THR A O   
1154 C CB  . THR A 186 ? 0.3867 0.4000 0.5012 0.0714  0.0642  -0.0276 513 THR A CB  
1155 O OG1 . THR A 186 ? 0.4237 0.4136 0.5128 0.0811  0.0777  -0.0358 513 THR A OG1 
1156 C CG2 . THR A 186 ? 0.3829 0.3972 0.5106 0.0666  0.0514  -0.0284 513 THR A CG2 
1157 N N   . GLU A 187 ? 0.4363 0.4706 0.6036 0.0997  0.1016  -0.0016 514 GLU A N   
1158 C CA  . GLU A 187 ? 0.4759 0.5153 0.6702 0.1117  0.1121  0.0080  514 GLU A CA  
1159 C C   . GLU A 187 ? 0.4512 0.4849 0.6520 0.1077  0.0980  0.0047  514 GLU A C   
1160 O O   . GLU A 187 ? 0.4604 0.4709 0.6321 0.1031  0.0908  -0.0099 514 GLU A O   
1161 C CB  . GLU A 187 ? 0.5395 0.5581 0.7157 0.1299  0.1387  0.0050  514 GLU A CB  
1162 C CG  . GLU A 187 ? 0.6193 0.6501 0.8335 0.1448  0.1533  0.0205  514 GLU A CG  
1163 C CD  . GLU A 187 ? 0.6487 0.7181 0.9105 0.1474  0.1596  0.0439  514 GLU A CD  
1164 O OE1 . GLU A 187 ? 0.6558 0.7454 0.9273 0.1339  0.1470  0.0490  514 GLU A OE1 
1165 O OE2 . GLU A 187 ? 0.6798 0.7588 0.9709 0.1631  0.1778  0.0580  514 GLU A OE2 
1166 N N   . ARG A 188 ? 0.4172 0.4742 0.6577 0.1078  0.0921  0.0203  515 ARG A N   
1167 C CA  . ARG A 188 ? 0.4072 0.4615 0.6578 0.1061  0.0808  0.0215  515 ARG A CA  
1168 C C   . ARG A 188 ? 0.4226 0.4927 0.7119 0.1194  0.0921  0.0395  515 ARG A C   
1169 O O   . ARG A 188 ? 0.4169 0.5106 0.7341 0.1231  0.0997  0.0540  515 ARG A O   
1170 C CB  . ARG A 188 ? 0.3591 0.4295 0.6198 0.0901  0.0571  0.0251  515 ARG A CB  
1171 C CG  . ARG A 188 ? 0.3618 0.4201 0.5904 0.0775  0.0456  0.0102  515 ARG A CG  
1172 C CD  . ARG A 188 ? 0.3596 0.3904 0.5574 0.0775  0.0452  -0.0052 515 ARG A CD  
1173 N NE  . ARG A 188 ? 0.3458 0.3719 0.5220 0.0654  0.0333  -0.0150 515 ARG A NE  
1174 C CZ  . ARG A 188 ? 0.3604 0.3668 0.5103 0.0618  0.0304  -0.0277 515 ARG A CZ  
1175 N NH1 . ARG A 188 ? 0.3838 0.3692 0.5216 0.0684  0.0382  -0.0341 515 ARG A NH1 
1176 N NH2 . ARG A 188 ? 0.3332 0.3401 0.4701 0.0517  0.0200  -0.0333 515 ARG A NH2 
1177 N N   . HIS A 189 ? 0.4449 0.5035 0.7391 0.1267  0.0936  0.0405  516 HIS A N   
1178 C CA  . HIS A 189 ? 0.4804 0.5551 0.8151 0.1413  0.1053  0.0598  516 HIS A CA  
1179 C C   . HIS A 189 ? 0.4436 0.5544 0.8197 0.1316  0.0860  0.0794  516 HIS A C   
1180 O O   . HIS A 189 ? 0.4199 0.5314 0.7876 0.1169  0.0634  0.0758  516 HIS A O   
1181 C CB  . HIS A 189 ? 0.5167 0.5667 0.8467 0.1546  0.1156  0.0571  516 HIS A CB  
1182 C CG  . HIS A 189 ? 0.5759 0.6375 0.9431 0.1749  0.1366  0.0755  516 HIS A CG  
1183 N ND1 . HIS A 189 ? 0.5971 0.6677 0.9977 0.1827  0.1344  0.0913  516 HIS A ND1 
1184 C CD2 . HIS A 189 ? 0.5845 0.6523 0.9633 0.1898  0.1614  0.0829  516 HIS A CD2 
1185 C CE1 . HIS A 189 ? 0.5992 0.6815 1.0325 0.2020  0.1570  0.1077  516 HIS A CE1 
1186 N NE2 . HIS A 189 ? 0.6055 0.6864 1.0261 0.2069  0.1745  0.1030  516 HIS A NE2 
1187 N N   . GLY A 190 ? 0.4161 0.5561 0.8347 0.1388  0.0945  0.1002  517 GLY A N   
1188 C CA  . GLY A 190 ? 0.4032 0.5778 0.8638 0.1286  0.0742  0.1209  517 GLY A CA  
1189 C C   . GLY A 190 ? 0.3767 0.5702 0.8415 0.1103  0.0574  0.1233  517 GLY A C   
1190 O O   . GLY A 190 ? 0.4126 0.6248 0.8965 0.0964  0.0336  0.1340  517 GLY A O   
1191 N N   . LEU A 191 ? 0.3328 0.5198 0.7785 0.1101  0.0694  0.1141  518 LEU A N   
1192 C CA  . LEU A 191 ? 0.2797 0.4846 0.7345 0.0949  0.0576  0.1190  518 LEU A CA  
1193 C C   . LEU A 191 ? 0.2703 0.5127 0.7823 0.0977  0.0618  0.1468  518 LEU A C   
1194 O O   . LEU A 191 ? 0.2555 0.5062 0.7899 0.1157  0.0862  0.1579  518 LEU A O   
1195 C CB  . LEU A 191 ? 0.2713 0.4584 0.6901 0.0953  0.0705  0.1032  518 LEU A CB  
1196 C CG  . LEU A 191 ? 0.2679 0.4240 0.6345 0.0873  0.0613  0.0781  518 LEU A CG  
1197 C CD1 . LEU A 191 ? 0.2791 0.4170 0.6141 0.0949  0.0807  0.0659  518 LEU A CD1 
1198 C CD2 . LEU A 191 ? 0.2399 0.4002 0.6003 0.0674  0.0363  0.0751  518 LEU A CD2 
1199 N N   . LYS A 192 ? 0.2532 0.5165 0.7873 0.0796  0.0381  0.1578  519 LYS A N   
1200 C CA  . LYS A 192 ? 0.2638 0.5644 0.8537 0.0775  0.0382  0.1848  519 LYS A CA  
1201 C C   . LYS A 192 ? 0.2625 0.5681 0.8544 0.0808  0.0582  0.1869  519 LYS A C   
1202 O O   . LYS A 192 ? 0.2626 0.5947 0.8984 0.0908  0.0751  0.2086  519 LYS A O   
1203 C CB  . LYS A 192 ? 0.2657 0.5826 0.8742 0.0542  0.0035  0.1947  519 LYS A CB  
1204 C CG  . LYS A 192 ? 0.2733 0.5989 0.9006 0.0545  -0.0127 0.2054  519 LYS A CG  
1205 C CD  . LYS A 192 ? 0.2843 0.6038 0.8943 0.0317  -0.0484 0.2009  519 LYS A CD  
1206 C CE  . LYS A 192 ? 0.3015 0.6100 0.8988 0.0375  -0.0559 0.1982  519 LYS A CE  
1207 N NZ  . LYS A 192 ? 0.3152 0.6357 0.9240 0.0184  -0.0905 0.2103  519 LYS A NZ  
1208 N N   . GLU A 193 ? 0.2478 0.5293 0.7942 0.0733  0.0572  0.1662  520 GLU A N   
1209 C CA  . GLU A 193 ? 0.2507 0.5342 0.7934 0.0767  0.0763  0.1678  520 GLU A CA  
1210 C C   . GLU A 193 ? 0.2640 0.5134 0.7515 0.0888  0.0964  0.1444  520 GLU A C   
1211 O O   . GLU A 193 ? 0.2358 0.4694 0.6897 0.0798  0.0915  0.1306  520 GLU A O   
1212 C CB  . GLU A 193 ? 0.2486 0.5375 0.7925 0.0547  0.0556  0.1690  520 GLU A CB  
1213 C CG  . GLU A 193 ? 0.2442 0.5606 0.8340 0.0375  0.0302  0.1892  520 GLU A CG  
1214 C CD  . GLU A 193 ? 0.2473 0.6017 0.8984 0.0421  0.0421  0.2193  520 GLU A CD  
1215 O OE1 . GLU A 193 ? 0.2387 0.6193 0.9345 0.0311  0.0217  0.2390  520 GLU A OE1 
1216 O OE2 . GLU A 193 ? 0.2573 0.6158 0.9120 0.0563  0.0711  0.2243  520 GLU A OE2 
1217 N N   . PRO A 194 ? 0.2839 0.5212 0.7626 0.1091  0.1187  0.1410  521 PRO A N   
1218 C CA  . PRO A 194 ? 0.3018 0.5033 0.7246 0.1177  0.1330  0.1177  521 PRO A CA  
1219 C C   . PRO A 194 ? 0.3191 0.5161 0.7224 0.1209  0.1506  0.1163  521 PRO A C   
1220 O O   . PRO A 194 ? 0.3254 0.4960 0.6804 0.1175  0.1490  0.0967  521 PRO A O   
1221 C CB  . PRO A 194 ? 0.3205 0.5105 0.7442 0.1385  0.1533  0.1178  521 PRO A CB  
1222 C CG  . PRO A 194 ? 0.3152 0.5416 0.8013 0.1469  0.1625  0.1468  521 PRO A CG  
1223 C CD  . PRO A 194 ? 0.2905 0.5441 0.8090 0.1249  0.1314  0.1583  521 PRO A CD  
1224 N N   . LYS A 195 ? 0.3385 0.5627 0.7806 0.1262  0.1658  0.1386  522 LYS A N   
1225 C CA  . LYS A 195 ? 0.3683 0.5901 0.7937 0.1293  0.1837  0.1403  522 LYS A CA  
1226 C C   . LYS A 195 ? 0.3469 0.5660 0.7554 0.1089  0.1623  0.1332  522 LYS A C   
1227 O O   . LYS A 195 ? 0.3481 0.5482 0.7163 0.1096  0.1700  0.1221  522 LYS A O   
1228 C CB  . LYS A 195 ? 0.3864 0.6406 0.8616 0.1395  0.2061  0.1687  522 LYS A CB  
1229 C CG  . LYS A 195 ? 0.4563 0.7106 0.9449 0.1644  0.2356  0.1770  522 LYS A CG  
1230 C CD  . LYS A 195 ? 0.5075 0.7174 0.9333 0.1801  0.2537  0.1525  522 LYS A CD  
1231 C CE  . LYS A 195 ? 0.5385 0.7461 0.9812 0.2049  0.2814  0.1611  522 LYS A CE  
1232 N NZ  . LYS A 195 ? 0.5596 0.8011 1.0544 0.2190  0.3084  0.1912  522 LYS A NZ  
1233 N N   . ARG A 196 ? 0.3291 0.5649 0.7665 0.0912  0.1355  0.1396  523 ARG A N   
1234 C CA  . ARG A 196 ? 0.3327 0.5626 0.7552 0.0720  0.1142  0.1325  523 ARG A CA  
1235 C C   . ARG A 196 ? 0.3163 0.5130 0.6842 0.0689  0.1037  0.1056  523 ARG A C   
1236 O O   . ARG A 196 ? 0.3173 0.5003 0.6557 0.0638  0.1021  0.0965  523 ARG A O   
1237 C CB  . ARG A 196 ? 0.3524 0.6039 0.8161 0.0547  0.0884  0.1454  523 ARG A CB  
1238 C CG  . ARG A 196 ? 0.3927 0.6412 0.8518 0.0352  0.0692  0.1440  523 ARG A CG  
1239 C CD  . ARG A 196 ? 0.4481 0.7213 0.9472 0.0289  0.0739  0.1669  523 ARG A CD  
1240 N NE  . ARG A 196 ? 0.4960 0.7574 0.9825 0.0095  0.0524  0.1608  523 ARG A NE  
1241 C CZ  . ARG A 196 ? 0.5310 0.8032 1.0468 -0.0092 0.0290  0.1712  523 ARG A CZ  
1242 N NH1 . ARG A 196 ? 0.5472 0.8466 1.1103 -0.0125 0.0219  0.1901  523 ARG A NH1 
1243 N NH2 . ARG A 196 ? 0.5692 0.8236 1.0664 -0.0248 0.0124  0.1631  523 ARG A NH2 
1244 N N   . VAL A 197 ? 0.3105 0.4956 0.6674 0.0722  0.0970  0.0947  524 VAL A N   
1245 C CA  . VAL A 197 ? 0.3121 0.4676 0.6214 0.0706  0.0897  0.0714  524 VAL A CA  
1246 C C   . VAL A 197 ? 0.3393 0.4752 0.6101 0.0816  0.1096  0.0617  524 VAL A C   
1247 O O   . VAL A 197 ? 0.3367 0.4569 0.5747 0.0753  0.1030  0.0495  524 VAL A O   
1248 C CB  . VAL A 197 ? 0.3026 0.4498 0.6102 0.0741  0.0829  0.0643  524 VAL A CB  
1249 C CG1 . VAL A 197 ? 0.2888 0.4057 0.5495 0.0741  0.0790  0.0419  524 VAL A CG1 
1250 C CG2 . VAL A 197 ? 0.2777 0.4407 0.6140 0.0611  0.0599  0.0725  524 VAL A CG2 
1251 N N   . GLU A 198 ? 0.3689 0.5058 0.6442 0.0981  0.1341  0.0684  525 GLU A N   
1252 C CA  . GLU A 198 ? 0.4064 0.5211 0.6403 0.1090  0.1536  0.0592  525 GLU A CA  
1253 C C   . GLU A 198 ? 0.4164 0.5356 0.6404 0.1040  0.1572  0.0643  525 GLU A C   
1254 O O   . GLU A 198 ? 0.4487 0.5457 0.6281 0.1043  0.1590  0.0515  525 GLU A O   
1255 C CB  . GLU A 198 ? 0.4565 0.5682 0.6953 0.1295  0.1819  0.0657  525 GLU A CB  
1256 C CG  . GLU A 198 ? 0.5193 0.6032 0.7064 0.1396  0.2011  0.0547  525 GLU A CG  
1257 C CD  . GLU A 198 ? 0.5962 0.6645 0.7719 0.1614  0.2308  0.0553  525 GLU A CD  
1258 O OE1 . GLU A 198 ? 0.6031 0.6934 0.8155 0.1733  0.2517  0.0753  525 GLU A OE1 
1259 O OE2 . GLU A 198 ? 0.6578 0.6898 0.7859 0.1666  0.2336  0.0357  525 GLU A OE2 
1260 N N   . GLU A 199 ? 0.3979 0.5452 0.6632 0.0988  0.1576  0.0841  526 GLU A N   
1261 C CA  . GLU A 199 ? 0.3955 0.5473 0.6547 0.0926  0.1596  0.0908  526 GLU A CA  
1262 C C   . GLU A 199 ? 0.3726 0.5115 0.6083 0.0771  0.1355  0.0774  526 GLU A C   
1263 O O   . GLU A 199 ? 0.3680 0.4945 0.5725 0.0759  0.1379  0.0728  526 GLU A O   
1264 C CB  . GLU A 199 ? 0.4080 0.5925 0.7207 0.0881  0.1631  0.1160  526 GLU A CB  
1265 C CG  . GLU A 199 ? 0.4841 0.6812 0.8145 0.1064  0.1947  0.1323  526 GLU A CG  
1266 C CD  . GLU A 199 ? 0.4931 0.7286 0.8913 0.1041  0.1972  0.1598  526 GLU A CD  
1267 O OE1 . GLU A 199 ? 0.5484 0.7983 0.9694 0.1204  0.2243  0.1760  526 GLU A OE1 
1268 O OE2 . GLU A 199 ? 0.4912 0.7425 0.9211 0.0862  0.1726  0.1665  526 GLU A OE2 
1269 N N   . LEU A 200 ? 0.3287 0.4704 0.5791 0.0659  0.1131  0.0726  527 LEU A N   
1270 C CA  . LEU A 200 ? 0.3085 0.4377 0.5388 0.0534  0.0932  0.0610  527 LEU A CA  
1271 C C   . LEU A 200 ? 0.3141 0.4177 0.4970 0.0584  0.0940  0.0421  527 LEU A C   
1272 O O   . LEU A 200 ? 0.3140 0.4071 0.4721 0.0537  0.0883  0.0363  527 LEU A O   
1273 C CB  . LEU A 200 ? 0.2861 0.4213 0.5386 0.0413  0.0709  0.0600  527 LEU A CB  
1274 C CG  . LEU A 200 ? 0.2723 0.3922 0.5031 0.0301  0.0521  0.0476  527 LEU A CG  
1275 C CD1 . LEU A 200 ? 0.2700 0.3887 0.4968 0.0237  0.0512  0.0527  527 LEU A CD1 
1276 C CD2 . LEU A 200 ? 0.2683 0.3912 0.5162 0.0200  0.0331  0.0468  527 LEU A CD2 
1277 N N   . GLN A 201 ? 0.3203 0.4141 0.4927 0.0676  0.1003  0.0339  528 GLN A N   
1278 C CA  . GLN A 201 ? 0.3459 0.4139 0.4742 0.0715  0.1009  0.0167  528 GLN A CA  
1279 C C   . GLN A 201 ? 0.3702 0.4281 0.4668 0.0761  0.1131  0.0167  528 GLN A C   
1280 O O   . GLN A 201 ? 0.3722 0.4179 0.4405 0.0702  0.1030  0.0083  528 GLN A O   
1281 C CB  . GLN A 201 ? 0.3621 0.4193 0.4858 0.0826  0.1111  0.0110  528 GLN A CB  
1282 C CG  . GLN A 201 ? 0.3907 0.4193 0.4727 0.0833  0.1065  -0.0076 528 GLN A CG  
1283 C CD  . GLN A 201 ? 0.4196 0.4332 0.4957 0.0951  0.1190  -0.0127 528 GLN A CD  
1284 O OE1 . GLN A 201 ? 0.4735 0.4841 0.5477 0.1084  0.1406  -0.0072 528 GLN A OE1 
1285 N NE2 . GLN A 201 ? 0.4244 0.4277 0.4982 0.0913  0.1071  -0.0221 528 GLN A NE2 
1286 N N   . ASN A 202 ? 0.3947 0.4591 0.4978 0.0869  0.1350  0.0279  529 ASN A N   
1287 C CA  . ASN A 202 ? 0.4411 0.4954 0.5120 0.0929  0.1497  0.0299  529 ASN A CA  
1288 C C   . ASN A 202 ? 0.4375 0.4993 0.5077 0.0825  0.1398  0.0363  529 ASN A C   
1289 O O   . ASN A 202 ? 0.4548 0.5010 0.4858 0.0828  0.1401  0.0310  529 ASN A O   
1290 C CB  . ASN A 202 ? 0.4788 0.5417 0.5629 0.1077  0.1779  0.0437  529 ASN A CB  
1291 C CG  . ASN A 202 ? 0.5301 0.5774 0.6041 0.1215  0.1918  0.0357  529 ASN A CG  
1292 O OD1 . ASN A 202 ? 0.5560 0.5809 0.6038 0.1197  0.1809  0.0179  529 ASN A OD1 
1293 N ND2 . ASN A 202 ? 0.5516 0.6113 0.6500 0.1352  0.2160  0.0501  529 ASN A ND2 
1294 N N   . LYS A 203 ? 0.4085 0.4919 0.5199 0.0731  0.1301  0.0479  530 LYS A N   
1295 C CA  . LYS A 203 ? 0.4117 0.4991 0.5242 0.0630  0.1200  0.0538  530 LYS A CA  
1296 C C   . LYS A 203 ? 0.3958 0.4664 0.4794 0.0562  0.1014  0.0385  530 LYS A C   
1297 O O   . LYS A 203 ? 0.4027 0.4658 0.4623 0.0544  0.0991  0.0389  530 LYS A O   
1298 C CB  . LYS A 203 ? 0.3998 0.5073 0.5588 0.0524  0.1099  0.0660  530 LYS A CB  
1299 C CG  . LYS A 203 ? 0.4407 0.5678 0.6305 0.0537  0.1244  0.0873  530 LYS A CG  
1300 C CD  . LYS A 203 ? 0.4524 0.5973 0.6891 0.0423  0.1107  0.0963  530 LYS A CD  
1301 C CE  . LYS A 203 ? 0.4792 0.6435 0.7509 0.0375  0.1178  0.1186  530 LYS A CE  
1302 N NZ  . LYS A 203 ? 0.5216 0.7076 0.8268 0.0463  0.1349  0.1335  530 LYS A NZ  
1303 N N   . ILE A 204 ? 0.3673 0.4334 0.4546 0.0529  0.0886  0.0268  531 ILE A N   
1304 C CA  . ILE A 204 ? 0.3478 0.4012 0.4141 0.0467  0.0716  0.0142  531 ILE A CA  
1305 C C   . ILE A 204 ? 0.3738 0.4085 0.3962 0.0517  0.0749  0.0047  531 ILE A C   
1306 O O   . ILE A 204 ? 0.3760 0.4044 0.3795 0.0470  0.0648  0.0023  531 ILE A O   
1307 C CB  . ILE A 204 ? 0.3323 0.3857 0.4134 0.0423  0.0589  0.0057  531 ILE A CB  
1308 C CG1 . ILE A 204 ? 0.2987 0.3673 0.4171 0.0356  0.0529  0.0148  531 ILE A CG1 
1309 C CG2 . ILE A 204 ? 0.3148 0.3573 0.3773 0.0366  0.0436  -0.0050 531 ILE A CG2 
1310 C CD1 . ILE A 204 ? 0.2879 0.3576 0.4204 0.0334  0.0440  0.0090  531 ILE A CD1 
1311 N N   . VAL A 205 ? 0.3919 0.4167 0.3980 0.0610  0.0888  0.0004  532 VAL A N   
1312 C CA  . VAL A 205 ? 0.4381 0.4398 0.3971 0.0652  0.0920  -0.0096 532 VAL A CA  
1313 C C   . VAL A 205 ? 0.4746 0.4749 0.4107 0.0654  0.0963  -0.0016 532 VAL A C   
1314 O O   . VAL A 205 ? 0.4753 0.4632 0.3799 0.0608  0.0847  -0.0073 532 VAL A O   
1315 C CB  . VAL A 205 ? 0.4626 0.4497 0.4069 0.0770  0.1096  -0.0155 532 VAL A CB  
1316 C CG1 . VAL A 205 ? 0.5105 0.4693 0.3991 0.0816  0.1156  -0.0249 532 VAL A CG1 
1317 C CG2 . VAL A 205 ? 0.4427 0.4255 0.4010 0.0754  0.1012  -0.0254 532 VAL A CG2 
1318 N N   . ASN A 206 ? 0.4915 0.5062 0.4465 0.0699  0.1115  0.0134  533 ASN A N   
1319 C CA  . ASN A 206 ? 0.5412 0.5562 0.4781 0.0708  0.1179  0.0241  533 ASN A CA  
1320 C C   . ASN A 206 ? 0.5337 0.5548 0.4764 0.0601  0.0991  0.0284  533 ASN A C   
1321 O O   . ASN A 206 ? 0.5477 0.5604 0.4595 0.0597  0.0971  0.0311  533 ASN A O   
1322 C CB  . ASN A 206 ? 0.5587 0.5899 0.5212 0.0777  0.1395  0.0412  533 ASN A CB  
1323 C CG  . ASN A 206 ? 0.6173 0.6390 0.5640 0.0920  0.1633  0.0394  533 ASN A CG  
1324 O OD1 . ASN A 206 ? 0.6633 0.6597 0.5667 0.0976  0.1662  0.0250  533 ASN A OD1 
1325 N ND2 . ASN A 206 ? 0.6226 0.6637 0.6046 0.0982  0.1816  0.0554  533 ASN A ND2 
1326 N N   . CYS A 207 ? 0.5084 0.5424 0.4887 0.0522  0.0863  0.0295  534 CYS A N   
1327 C CA  . CYS A 207 ? 0.4939 0.5298 0.4799 0.0437  0.0688  0.0308  534 CYS A CA  
1328 C C   . CYS A 207 ? 0.4785 0.5012 0.4329 0.0418  0.0557  0.0201  534 CYS A C   
1329 O O   . CYS A 207 ? 0.4958 0.5167 0.4368 0.0390  0.0478  0.0250  534 CYS A O   
1330 C CB  . CYS A 207 ? 0.5112 0.5546 0.5314 0.0372  0.0570  0.0270  534 CYS A CB  
1331 S SG  . CYS A 207 ? 0.6481 0.7059 0.7079 0.0327  0.0606  0.0417  534 CYS A SG  
1332 N N   . LEU A 208 ? 0.4548 0.4697 0.4029 0.0421  0.0517  0.0066  535 LEU A N   
1333 C CA  . LEU A 208 ? 0.4548 0.4577 0.3781 0.0380  0.0369  -0.0040 535 LEU A CA  
1334 C C   . LEU A 208 ? 0.4808 0.4690 0.3587 0.0402  0.0388  -0.0040 535 LEU A C   
1335 O O   . LEU A 208 ? 0.4742 0.4607 0.3380 0.0348  0.0243  -0.0020 535 LEU A O   
1336 C CB  . LEU A 208 ? 0.4359 0.4312 0.3610 0.0382  0.0348  -0.0173 535 LEU A CB  
1337 C CG  . LEU A 208 ? 0.4515 0.4335 0.3545 0.0326  0.0194  -0.0285 535 LEU A CG  
1338 C CD1 . LEU A 208 ? 0.4191 0.4118 0.3372 0.0249  0.0018  -0.0242 535 LEU A CD1 
1339 C CD2 . LEU A 208 ? 0.4335 0.4089 0.3449 0.0332  0.0199  -0.0394 535 LEU A CD2 
1340 N N   . LYS A 209 ? 0.5103 0.4882 0.3664 0.0485  0.0571  -0.0048 536 LYS A N   
1341 C CA  . LYS A 209 ? 0.5654 0.5247 0.3708 0.0520  0.0623  -0.0054 536 LYS A CA  
1342 C C   . LYS A 209 ? 0.5715 0.5389 0.3710 0.0496  0.0583  0.0090  536 LYS A C   
1343 O O   . LYS A 209 ? 0.5911 0.5478 0.3567 0.0451  0.0448  0.0078  536 LYS A O   
1344 C CB  . LYS A 209 ? 0.6059 0.5551 0.3945 0.0641  0.0882  -0.0053 536 LYS A CB  
1345 C CG  . LYS A 209 ? 0.6286 0.5590 0.4038 0.0685  0.0933  -0.0211 536 LYS A CG  
1346 C CD  . LYS A 209 ? 0.6724 0.5894 0.4243 0.0830  0.1220  -0.0197 536 LYS A CD  
1347 C CE  . LYS A 209 ? 0.6886 0.5870 0.4336 0.0898  0.1304  -0.0336 536 LYS A CE  
1348 N NZ  . LYS A 209 ? 0.7490 0.6286 0.4636 0.1058  0.1599  -0.0333 536 LYS A NZ  
1349 N N   . ASP A 210 ? 0.5491 0.5349 0.3826 0.0516  0.0682  0.0233  537 ASP A N   
1350 C CA  . ASP A 210 ? 0.5687 0.5620 0.4013 0.0499  0.0665  0.0390  537 ASP A CA  
1351 C C   . ASP A 210 ? 0.5561 0.5544 0.3986 0.0414  0.0431  0.0397  537 ASP A C   
1352 O O   . ASP A 210 ? 0.5726 0.5676 0.3919 0.0395  0.0346  0.0471  537 ASP A O   
1353 C CB  . ASP A 210 ? 0.5539 0.5645 0.4258 0.0520  0.0805  0.0539  537 ASP A CB  
1354 C CG  . ASP A 210 ? 0.6111 0.6204 0.4746 0.0616  0.1063  0.0593  537 ASP A CG  
1355 O OD1 . ASP A 210 ? 0.6555 0.6473 0.4727 0.0685  0.1164  0.0547  537 ASP A OD1 
1356 O OD2 . ASP A 210 ? 0.6083 0.6337 0.5122 0.0624  0.1168  0.0689  537 ASP A OD2 
1357 N N   . HIS A 211 ? 0.5112 0.5173 0.3871 0.0371  0.0334  0.0328  538 HIS A N   
1358 C CA  . HIS A 211 ? 0.5028 0.5144 0.3917 0.0308  0.0140  0.0336  538 HIS A CA  
1359 C C   . HIS A 211 ? 0.5295 0.5307 0.3828 0.0268  -0.0017 0.0279  538 HIS A C   
1360 O O   . HIS A 211 ? 0.5460 0.5509 0.3936 0.0239  -0.0140 0.0376  538 HIS A O   
1361 C CB  . HIS A 211 ? 0.4595 0.4785 0.3850 0.0280  0.0089  0.0263  538 HIS A CB  
1362 C CG  . HIS A 211 ? 0.4479 0.4728 0.3880 0.0236  -0.0074 0.0284  538 HIS A CG  
1363 N ND1 . HIS A 211 ? 0.4575 0.4803 0.3917 0.0196  -0.0210 0.0199  538 HIS A ND1 
1364 C CD2 . HIS A 211 ? 0.4355 0.4677 0.3960 0.0234  -0.0114 0.0397  538 HIS A CD2 
1365 C CE1 . HIS A 211 ? 0.4536 0.4852 0.4066 0.0176  -0.0319 0.0271  538 HIS A CE1 
1366 N NE2 . HIS A 211 ? 0.4425 0.4787 0.4110 0.0206  -0.0257 0.0384  538 HIS A NE2 
1367 N N   . VAL A 212 ? 0.5461 0.5336 0.3767 0.0263  -0.0022 0.0135  539 VAL A N   
1368 C CA  . VAL A 212 ? 0.5853 0.5592 0.3802 0.0202  -0.0192 0.0065  539 VAL A CA  
1369 C C   . VAL A 212 ? 0.6309 0.5949 0.3827 0.0205  -0.0211 0.0146  539 VAL A C   
1370 O O   . VAL A 212 ? 0.6520 0.6176 0.3924 0.0137  -0.0409 0.0201  539 VAL A O   
1371 C CB  . VAL A 212 ? 0.5908 0.5461 0.3665 0.0197  -0.0172 -0.0114 539 VAL A CB  
1372 C CG1 . VAL A 212 ? 0.6239 0.5594 0.3554 0.0119  -0.0350 -0.0191 539 VAL A CG1 
1373 C CG2 . VAL A 212 ? 0.5440 0.5109 0.3620 0.0171  -0.0216 -0.0170 539 VAL A CG2 
1374 N N   . THR A 213 ? 0.6615 0.6170 0.3915 0.0286  -0.0004 0.0172  540 THR A N   
1375 C CA  . THR A 213 ? 0.7074 0.6518 0.3924 0.0308  0.0023  0.0260  540 THR A CA  
1376 C C   . THR A 213 ? 0.7058 0.6682 0.4099 0.0287  -0.0062 0.0456  540 THR A C   
1377 O O   . THR A 213 ? 0.7344 0.6919 0.4089 0.0240  -0.0220 0.0519  540 THR A O   
1378 C CB  . THR A 213 ? 0.7242 0.6591 0.3905 0.0419  0.0312  0.0270  540 THR A CB  
1379 O OG1 . THR A 213 ? 0.7325 0.6495 0.3824 0.0454  0.0399  0.0096  540 THR A OG1 
1380 C CG2 . THR A 213 ? 0.7763 0.6972 0.3905 0.0449  0.0359  0.0359  540 THR A CG2 
1381 N N   . PHE A 214 ? 0.6774 0.6588 0.4301 0.0315  0.0026  0.0552  541 PHE A N   
1382 C CA  . PHE A 214 ? 0.6764 0.6724 0.4525 0.0302  -0.0045 0.0732  541 PHE A CA  
1383 C C   . PHE A 214 ? 0.6795 0.6820 0.4631 0.0231  -0.0303 0.0748  541 PHE A C   
1384 O O   . PHE A 214 ? 0.6805 0.6862 0.4528 0.0215  -0.0414 0.0889  541 PHE A O   
1385 C CB  . PHE A 214 ? 0.6494 0.6597 0.4768 0.0327  0.0068  0.0794  541 PHE A CB  
1386 C CG  . PHE A 214 ? 0.6588 0.6800 0.5128 0.0315  -0.0011 0.0957  541 PHE A CG  
1387 C CD1 . PHE A 214 ? 0.6708 0.6931 0.5205 0.0346  0.0079  0.1135  541 PHE A CD1 
1388 C CD2 . PHE A 214 ? 0.6343 0.6636 0.5180 0.0282  -0.0165 0.0943  541 PHE A CD2 
1389 C CE1 . PHE A 214 ? 0.6755 0.7049 0.5496 0.0343  0.0011  0.1290  541 PHE A CE1 
1390 C CE2 . PHE A 214 ? 0.6431 0.6798 0.5505 0.0292  -0.0218 0.1097  541 PHE A CE2 
1391 C CZ  . PHE A 214 ? 0.6553 0.6911 0.5577 0.0321  -0.0135 0.1267  541 PHE A CZ  
1392 N N   . ASN A 215 ? 0.6612 0.6671 0.4663 0.0191  -0.0395 0.0626  542 ASN A N   
1393 C CA  . ASN A 215 ? 0.6719 0.6868 0.4902 0.0125  -0.0626 0.0654  542 ASN A CA  
1394 C C   . ASN A 215 ? 0.7275 0.7314 0.5017 0.0053  -0.0813 0.0632  542 ASN A C   
1395 O O   . ASN A 215 ? 0.7571 0.7709 0.5411 -0.0009 -0.1025 0.0701  542 ASN A O   
1396 C CB  . ASN A 215 ? 0.6380 0.6604 0.4930 0.0106  -0.0652 0.0550  542 ASN A CB  
1397 C CG  . ASN A 215 ? 0.6316 0.6661 0.5314 0.0157  -0.0550 0.0617  542 ASN A CG  
1398 O OD1 . ASN A 215 ? 0.6082 0.6542 0.5347 0.0162  -0.0628 0.0727  542 ASN A OD1 
1399 N ND2 . ASN A 215 ? 0.6530 0.6833 0.5592 0.0198  -0.0368 0.0568  542 ASN A ND2 
1400 N N   . ASN A 216 ? 0.7597 0.7422 0.4849 0.0062  -0.0735 0.0541  543 ASN A N   
1401 C CA  . ASN A 216 ? 0.8051 0.7709 0.4787 -0.0012 -0.0912 0.0514  543 ASN A CA  
1402 C C   . ASN A 216 ? 0.8503 0.8095 0.4854 0.0021  -0.0876 0.0655  543 ASN A C   
1403 O O   . ASN A 216 ? 0.8932 0.8293 0.4684 -0.0008 -0.0929 0.0608  543 ASN A O   
1404 C CB  . ASN A 216 ? 0.8324 0.7722 0.4695 -0.0029 -0.0866 0.0298  543 ASN A CB  
1405 C CG  . ASN A 216 ? 0.8879 0.8112 0.4851 -0.0153 -0.1131 0.0234  543 ASN A CG  
1406 O OD1 . ASN A 216 ? 0.8759 0.8143 0.5009 -0.0249 -0.1363 0.0277  543 ASN A OD1 
1407 N ND2 . ASN A 216 ? 0.9623 0.8536 0.4934 -0.0155 -0.1101 0.0138  543 ASN A ND2 
1408 N N   . GLY A 217 ? 0.8276 0.8046 0.4951 0.0084  -0.0781 0.0828  544 GLY A N   
1409 C CA  . GLY A 217 ? 0.8713 0.8461 0.5113 0.0119  -0.0746 0.1003  544 GLY A CA  
1410 C C   . GLY A 217 ? 0.9128 0.8662 0.5043 0.0188  -0.0515 0.0956  544 GLY A C   
1411 O O   . GLY A 217 ? 0.9601 0.9024 0.5059 0.0196  -0.0524 0.1052  544 GLY A O   
1412 N N   . GLY A 218 ? 0.9064 0.8545 0.5084 0.0244  -0.0302 0.0819  545 GLY A N   
1413 C CA  . GLY A 218 ? 0.9564 0.8880 0.5227 0.0336  -0.0034 0.0798  545 GLY A CA  
1414 C C   . GLY A 218 ? 1.0189 0.9199 0.5284 0.0341  -0.0002 0.0602  545 GLY A C   
1415 O O   . GLY A 218 ? 1.0527 0.9394 0.5349 0.0439  0.0256  0.0577  545 GLY A O   
1416 N N   . LEU A 219 ? 1.0467 0.9369 0.5394 0.0238  -0.0252 0.0470  546 LEU A N   
1417 C CA  . LEU A 219 ? 1.1072 0.9639 0.5478 0.0232  -0.0232 0.0256  546 LEU A CA  
1418 C C   . LEU A 219 ? 1.0674 0.9262 0.5445 0.0230  -0.0196 0.0092  546 LEU A C   
1419 O O   . LEU A 219 ? 1.0180 0.9007 0.5502 0.0172  -0.0327 0.0111  546 LEU A O   
1420 C CB  . LEU A 219 ? 1.2034 1.0364 0.5850 0.0112  -0.0516 0.0202  546 LEU A CB  
1421 C CG  . LEU A 219 ? 1.2269 1.0732 0.6176 -0.0037 -0.0890 0.0290  546 LEU A CG  
1422 C CD1 . LEU A 219 ? 1.2777 1.0992 0.6364 -0.0167 -0.1125 0.0099  546 LEU A CD1 
1423 C CD2 . LEU A 219 ? 1.2597 1.1015 0.6065 -0.0039 -0.0955 0.0464  546 LEU A CD2 
1424 N N   . ASN A 220 ? 1.0769 0.9093 0.5218 0.0304  -0.0004 -0.0061 547 ASN A N   
1425 C CA  . ASN A 220 ? 1.0295 0.8604 0.5040 0.0321  0.0060  -0.0211 547 ASN A CA  
1426 C C   . ASN A 220 ? 1.0002 0.8211 0.4705 0.0182  -0.0225 -0.0343 547 ASN A C   
1427 O O   . ASN A 220 ? 1.0364 0.8395 0.4622 0.0078  -0.0449 -0.0370 547 ASN A O   
1428 C CB  . ASN A 220 ? 1.0815 0.8852 0.5208 0.0455  0.0359  -0.0319 547 ASN A CB  
1429 C CG  . ASN A 220 ? 1.0886 0.9100 0.5509 0.0594  0.0664  -0.0169 547 ASN A CG  
1430 O OD1 . ASN A 220 ? 1.0248 0.8804 0.5485 0.0593  0.0679  -0.0039 547 ASN A OD1 
1431 N ND2 . ASN A 220 ? 1.1482 0.9455 0.5602 0.0711  0.0907  -0.0175 547 ASN A ND2 
1432 N N   . ARG A 221 ? 0.9116 0.7454 0.4302 0.0172  -0.0226 -0.0411 548 ARG A N   
1433 C CA  . ARG A 221 ? 0.9033 0.7257 0.4212 0.0053  -0.0446 -0.0545 548 ARG A CA  
1434 C C   . ARG A 221 ? 0.8777 0.6852 0.4031 0.0123  -0.0272 -0.0698 548 ARG A C   
1435 O O   . ARG A 221 ? 0.8123 0.6387 0.3888 0.0103  -0.0301 -0.0708 548 ARG A O   
1436 C CB  . ARG A 221 ? 0.8646 0.7206 0.4386 -0.0047 -0.0669 -0.0443 548 ARG A CB  
1437 C CG  . ARG A 221 ? 0.8819 0.7548 0.4554 -0.0110 -0.0852 -0.0271 548 ARG A CG  
1438 C CD  . ARG A 221 ? 0.8456 0.7534 0.4841 -0.0156 -0.0979 -0.0163 548 ARG A CD  
1439 N NE  . ARG A 221 ? 0.8652 0.7727 0.5123 -0.0291 -0.1233 -0.0216 548 ARG A NE  
1440 C CZ  . ARG A 221 ? 0.8120 0.7455 0.5136 -0.0331 -0.1327 -0.0155 548 ARG A CZ  
1441 N NH1 . ARG A 221 ? 0.7625 0.7212 0.5115 -0.0246 -0.1196 -0.0057 548 ARG A NH1 
1442 N NH2 . ARG A 221 ? 0.8263 0.7589 0.5338 -0.0458 -0.1549 -0.0190 548 ARG A NH2 
1443 N N   . PRO A 222 ? 0.9137 0.6859 0.3870 0.0215  -0.0080 -0.0812 549 PRO A N   
1444 C CA  . PRO A 222 ? 0.8951 0.6545 0.3790 0.0318  0.0132  -0.0928 549 PRO A CA  
1445 C C   . PRO A 222 ? 0.8758 0.6222 0.3682 0.0215  -0.0042 -0.1068 549 PRO A C   
1446 O O   . PRO A 222 ? 0.8298 0.5858 0.3621 0.0268  0.0061  -0.1095 549 PRO A O   
1447 C CB  . PRO A 222 ? 0.9620 0.6825 0.3805 0.0439  0.0362  -0.1008 549 PRO A CB  
1448 C CG  . PRO A 222 ? 1.0221 0.7246 0.3829 0.0350  0.0188  -0.0996 549 PRO A CG  
1449 C CD  . PRO A 222 ? 0.9723 0.7139 0.3739 0.0240  -0.0039 -0.0829 549 PRO A CD  
1450 N N   . ASN A 223 ? 0.9097 0.6348 0.3654 0.0062  -0.0314 -0.1144 550 ASN A N   
1451 C CA  . ASN A 223 ? 0.9051 0.6215 0.3742 -0.0067 -0.0521 -0.1249 550 ASN A CA  
1452 C C   . ASN A 223 ? 0.8437 0.6046 0.3847 -0.0135 -0.0654 -0.1127 550 ASN A C   
1453 O O   . ASN A 223 ? 0.8074 0.5716 0.3806 -0.0160 -0.0672 -0.1180 550 ASN A O   
1454 C CB  . ASN A 223 ? 0.9588 0.6427 0.3736 -0.0236 -0.0804 -0.1341 550 ASN A CB  
1455 C CG  . ASN A 223 ? 1.0396 0.6653 0.3792 -0.0192 -0.0695 -0.1537 550 ASN A CG  
1456 O OD1 . ASN A 223 ? 1.0924 0.6855 0.3793 -0.0333 -0.0923 -0.1627 550 ASN A OD1 
1457 N ND2 . ASN A 223 ? 1.0396 0.6510 0.3727 0.0000  -0.0354 -0.1597 550 ASN A ND2 
1458 N N   . TYR A 224 ? 0.8288 0.6222 0.3941 -0.0157 -0.0733 -0.0961 551 TYR A N   
1459 C CA  . TYR A 224 ? 0.7681 0.6016 0.4003 -0.0194 -0.0815 -0.0846 551 TYR A CA  
1460 C C   . TYR A 224 ? 0.7313 0.5811 0.4058 -0.0066 -0.0575 -0.0834 551 TYR A C   
1461 O O   . TYR A 224 ? 0.6969 0.5606 0.4122 -0.0091 -0.0607 -0.0840 551 TYR A O   
1462 C CB  . TYR A 224 ? 0.7545 0.6163 0.4035 -0.0229 -0.0936 -0.0668 551 TYR A CB  
1463 C CG  . TYR A 224 ? 0.7084 0.6068 0.4224 -0.0248 -0.0993 -0.0557 551 TYR A CG  
1464 C CD1 . TYR A 224 ? 0.6952 0.6020 0.4323 -0.0371 -0.1209 -0.0551 551 TYR A CD1 
1465 C CD2 . TYR A 224 ? 0.6716 0.5940 0.4226 -0.0144 -0.0825 -0.0456 551 TYR A CD2 
1466 C CE1 . TYR A 224 ? 0.6488 0.5865 0.4418 -0.0371 -0.1232 -0.0450 551 TYR A CE1 
1467 C CE2 . TYR A 224 ? 0.6334 0.5834 0.4368 -0.0155 -0.0866 -0.0371 551 TYR A CE2 
1468 C CZ  . TYR A 224 ? 0.6226 0.5800 0.4458 -0.0258 -0.1057 -0.0368 551 TYR A CZ  
1469 O OH  . TYR A 224 ? 0.5714 0.5541 0.4433 -0.0250 -0.1065 -0.0281 551 TYR A OH  
1470 N N   . LEU A 225 ? 0.7399 0.5889 0.4051 0.0065  -0.0340 -0.0803 552 LEU A N   
1471 C CA  . LEU A 225 ? 0.7077 0.5706 0.4100 0.0180  -0.0121 -0.0782 552 LEU A CA  
1472 C C   . LEU A 225 ? 0.7076 0.5515 0.4105 0.0200  -0.0066 -0.0920 552 LEU A C   
1473 O O   . LEU A 225 ? 0.6363 0.4972 0.3826 0.0215  -0.0037 -0.0902 552 LEU A O   
1474 C CB  . LEU A 225 ? 0.7280 0.5914 0.4176 0.0309  0.0119  -0.0713 552 LEU A CB  
1475 C CG  . LEU A 225 ? 0.7076 0.5899 0.4407 0.0413  0.0324  -0.0657 552 LEU A CG  
1476 C CD1 . LEU A 225 ? 0.6822 0.5984 0.4619 0.0389  0.0286  -0.0512 552 LEU A CD1 
1477 C CD2 . LEU A 225 ? 0.7614 0.6317 0.4730 0.0556  0.0599  -0.0644 552 LEU A CD2 
1478 N N   . SER A 226 ? 0.7791 0.5852 0.4313 0.0196  -0.0062 -0.1055 553 SER A N   
1479 C CA  . SER A 226 ? 0.7961 0.5786 0.4447 0.0206  -0.0028 -0.1189 553 SER A CA  
1480 C C   . SER A 226 ? 0.7669 0.5609 0.4489 0.0076  -0.0241 -0.1198 553 SER A C   
1481 O O   . SER A 226 ? 0.7437 0.5426 0.4565 0.0110  -0.0176 -0.1215 553 SER A O   
1482 C CB  . SER A 226 ? 0.8657 0.6003 0.4487 0.0207  -0.0013 -0.1343 553 SER A CB  
1483 O OG  . SER A 226 ? 0.9203 0.6431 0.4843 0.0382  0.0280  -0.1346 553 SER A OG  
1484 N N   . LYS A 227 ? 0.7829 0.5831 0.4613 -0.0069 -0.0491 -0.1167 554 LYS A N   
1485 C CA  . LYS A 227 ? 0.7834 0.5958 0.4949 -0.0196 -0.0689 -0.1155 554 LYS A CA  
1486 C C   . LYS A 227 ? 0.7084 0.5595 0.4791 -0.0149 -0.0626 -0.1037 554 LYS A C   
1487 O O   . LYS A 227 ? 0.7036 0.5612 0.5044 -0.0173 -0.0645 -0.1045 554 LYS A O   
1488 C CB  . LYS A 227 ? 0.8234 0.6379 0.5219 -0.0358 -0.0968 -0.1114 554 LYS A CB  
1489 C CG  . LYS A 227 ? 0.8504 0.6635 0.5681 -0.0505 -0.1171 -0.1137 554 LYS A CG  
1490 C CD  . LYS A 227 ? 0.8992 0.7102 0.6003 -0.0681 -0.1468 -0.1099 554 LYS A CD  
1491 C CE  . LYS A 227 ? 0.9041 0.7329 0.6485 -0.0818 -0.1657 -0.1035 554 LYS A CE  
1492 N NZ  . LYS A 227 ? 0.9221 0.7612 0.6671 -0.0992 -0.1958 -0.0938 554 LYS A NZ  
1493 N N   . LEU A 228 ? 0.6746 0.5482 0.4582 -0.0084 -0.0547 -0.0927 555 LEU A N   
1494 C CA  . LEU A 228 ? 0.6164 0.5213 0.4479 -0.0033 -0.0474 -0.0823 555 LEU A CA  
1495 C C   . LEU A 228 ? 0.5835 0.4878 0.4344 0.0060  -0.0299 -0.0860 555 LEU A C   
1496 O O   . LEU A 228 ? 0.5521 0.4702 0.4375 0.0043  -0.0325 -0.0837 555 LEU A O   
1497 C CB  . LEU A 228 ? 0.6227 0.5427 0.4541 0.0017  -0.0413 -0.0716 555 LEU A CB  
1498 C CG  . LEU A 228 ? 0.6146 0.5640 0.4865 0.0033  -0.0406 -0.0591 555 LEU A CG  
1499 C CD1 . LEU A 228 ? 0.6260 0.5895 0.5246 -0.0054 -0.0575 -0.0552 555 LEU A CD1 
1500 C CD2 . LEU A 228 ? 0.6214 0.5773 0.4813 0.0062  -0.0378 -0.0492 555 LEU A CD2 
1501 N N   . LEU A 229 ? 0.5751 0.4636 0.4041 0.0163  -0.0121 -0.0903 556 LEU A N   
1502 C CA  . LEU A 229 ? 0.5823 0.4701 0.4299 0.0260  0.0043  -0.0921 556 LEU A CA  
1503 C C   . LEU A 229 ? 0.5998 0.4678 0.4441 0.0225  -0.0007 -0.1023 556 LEU A C   
1504 O O   . LEU A 229 ? 0.6072 0.4818 0.4789 0.0270  0.0058  -0.1010 556 LEU A O   
1505 C CB  . LEU A 229 ? 0.5957 0.4730 0.4236 0.0393  0.0268  -0.0919 556 LEU A CB  
1506 C CG  . LEU A 229 ? 0.5909 0.4904 0.4295 0.0431  0.0342  -0.0791 556 LEU A CG  
1507 C CD1 . LEU A 229 ? 0.6244 0.5106 0.4363 0.0555  0.0563  -0.0782 556 LEU A CD1 
1508 C CD2 . LEU A 229 ? 0.5397 0.4696 0.4283 0.0439  0.0358  -0.0684 556 LEU A CD2 
1509 N N   . GLY A 230 ? 0.6283 0.4710 0.4386 0.0138  -0.0136 -0.1117 557 GLY A N   
1510 C CA  . GLY A 230 ? 0.6501 0.4720 0.4568 0.0068  -0.0228 -0.1210 557 GLY A CA  
1511 C C   . GLY A 230 ? 0.6125 0.4569 0.4612 -0.0015 -0.0353 -0.1147 557 GLY A C   
1512 O O   . GLY A 230 ? 0.6127 0.4444 0.4680 -0.0047 -0.0382 -0.1195 557 GLY A O   
1513 N N   . LYS A 231 ? 0.5761 0.4523 0.4523 -0.0045 -0.0416 -0.1034 558 LYS A N   
1514 C CA  . LYS A 231 ? 0.5494 0.4475 0.4653 -0.0090 -0.0482 -0.0964 558 LYS A CA  
1515 C C   . LYS A 231 ? 0.5353 0.4410 0.4762 0.0001  -0.0343 -0.0943 558 LYS A C   
1516 O O   . LYS A 231 ? 0.5212 0.4338 0.4851 -0.0031 -0.0383 -0.0917 558 LYS A O   
1517 C CB  . LYS A 231 ? 0.5279 0.4540 0.4641 -0.0126 -0.0561 -0.0852 558 LYS A CB  
1518 C CG  . LYS A 231 ? 0.5418 0.4664 0.4658 -0.0246 -0.0752 -0.0836 558 LYS A CG  
1519 C CD  . LYS A 231 ? 0.5265 0.4549 0.4718 -0.0351 -0.0883 -0.0816 558 LYS A CD  
1520 C CE  . LYS A 231 ? 0.5471 0.4670 0.4775 -0.0496 -0.1097 -0.0817 558 LYS A CE  
1521 N NZ  . LYS A 231 ? 0.5927 0.4750 0.4811 -0.0517 -0.1100 -0.0964 558 LYS A NZ  
1522 N N   . LEU A 232 ? 0.5319 0.4372 0.4690 0.0114  -0.0184 -0.0939 559 LEU A N   
1523 C CA  . LEU A 232 ? 0.5318 0.4459 0.4937 0.0198  -0.0068 -0.0900 559 LEU A CA  
1524 C C   . LEU A 232 ? 0.5455 0.4408 0.5081 0.0213  -0.0044 -0.0956 559 LEU A C   
1525 O O   . LEU A 232 ? 0.5191 0.4260 0.5076 0.0202  -0.0068 -0.0906 559 LEU A O   
1526 C CB  . LEU A 232 ? 0.5286 0.4492 0.4909 0.0308  0.0090  -0.0857 559 LEU A CB  
1527 C CG  . LEU A 232 ? 0.5327 0.4755 0.5052 0.0292  0.0070  -0.0772 559 LEU A CG  
1528 C CD1 . LEU A 232 ? 0.5397 0.4866 0.5096 0.0388  0.0229  -0.0722 559 LEU A CD1 
1529 C CD2 . LEU A 232 ? 0.4963 0.4600 0.5010 0.0257  0.0009  -0.0702 559 LEU A CD2 
1530 N N   . PRO A 233 ? 0.5955 0.4597 0.5277 0.0239  0.0002  -0.1057 560 PRO A N   
1531 C CA  . PRO A 233 ? 0.6231 0.4651 0.5549 0.0248  0.0017  -0.1112 560 PRO A CA  
1532 C C   . PRO A 233 ? 0.6226 0.4673 0.5687 0.0119  -0.0146 -0.1101 560 PRO A C   
1533 O O   . PRO A 233 ? 0.6352 0.4785 0.5994 0.0134  -0.0127 -0.1076 560 PRO A O   
1534 C CB  . PRO A 233 ? 0.6730 0.4762 0.5606 0.0268  0.0062  -0.1242 560 PRO A CB  
1535 C CG  . PRO A 233 ? 0.6802 0.4891 0.5509 0.0340  0.0161  -0.1228 560 PRO A CG  
1536 C CD  . PRO A 233 ? 0.6317 0.4758 0.5252 0.0272  0.0059  -0.1127 560 PRO A CD  
1537 N N   . GLU A 234 ? 0.6201 0.4709 0.5609 -0.0001 -0.0299 -0.1099 561 GLU A N   
1538 C CA  . GLU A 234 ? 0.5913 0.4510 0.5515 -0.0126 -0.0449 -0.1055 561 GLU A CA  
1539 C C   . GLU A 234 ? 0.5540 0.4425 0.5512 -0.0098 -0.0419 -0.0942 561 GLU A C   
1540 O O   . GLU A 234 ? 0.5510 0.4422 0.5658 -0.0155 -0.0472 -0.0901 561 GLU A O   
1541 C CB  . GLU A 234 ? 0.6187 0.4842 0.5694 -0.0245 -0.0611 -0.1046 561 GLU A CB  
1542 C CG  . GLU A 234 ? 0.6987 0.5319 0.6062 -0.0294 -0.0673 -0.1163 561 GLU A CG  
1543 C CD  . GLU A 234 ? 0.7386 0.5779 0.6364 -0.0427 -0.0867 -0.1137 561 GLU A CD  
1544 O OE1 . GLU A 234 ? 0.8069 0.6185 0.6650 -0.0483 -0.0944 -0.1231 561 GLU A OE1 
1545 O OE2 . GLU A 234 ? 0.6991 0.5690 0.6273 -0.0476 -0.0947 -0.1020 561 GLU A OE2 
1546 N N   . LEU A 235 ? 0.5068 0.4150 0.5140 -0.0015 -0.0334 -0.0889 562 LEU A N   
1547 C CA  . LEU A 235 ? 0.4793 0.4088 0.5139 0.0014  -0.0304 -0.0799 562 LEU A CA  
1548 C C   . LEU A 235 ? 0.4722 0.3935 0.5164 0.0065  -0.0241 -0.0789 562 LEU A C   
1549 O O   . LEU A 235 ? 0.4711 0.4041 0.5338 0.0057  -0.0252 -0.0719 562 LEU A O   
1550 C CB  . LEU A 235 ? 0.4306 0.3783 0.4715 0.0080  -0.0238 -0.0752 562 LEU A CB  
1551 C CG  . LEU A 235 ? 0.4012 0.3626 0.4409 0.0041  -0.0294 -0.0722 562 LEU A CG  
1552 C CD1 . LEU A 235 ? 0.3609 0.3349 0.4057 0.0107  -0.0217 -0.0680 562 LEU A CD1 
1553 C CD2 . LEU A 235 ? 0.3692 0.3432 0.4248 -0.0025 -0.0376 -0.0663 562 LEU A CD2 
1554 N N   . ARG A 236 ? 0.4970 0.3976 0.5277 0.0128  -0.0164 -0.0850 563 ARG A N   
1555 C CA  . ARG A 236 ? 0.5134 0.4057 0.5551 0.0192  -0.0097 -0.0825 563 ARG A CA  
1556 C C   . ARG A 236 ? 0.4932 0.3763 0.5415 0.0109  -0.0177 -0.0814 563 ARG A C   
1557 O O   . ARG A 236 ? 0.4779 0.3700 0.5451 0.0126  -0.0169 -0.0733 563 ARG A O   
1558 C CB  . ARG A 236 ? 0.5778 0.4472 0.6038 0.0296  0.0026  -0.0887 563 ARG A CB  
1559 C CG  . ARG A 236 ? 0.6375 0.5098 0.6837 0.0401  0.0120  -0.0812 563 ARG A CG  
1560 C CD  . ARG A 236 ? 0.7239 0.5667 0.7574 0.0505  0.0245  -0.0869 563 ARG A CD  
1561 N NE  . ARG A 236 ? 0.7735 0.6220 0.8326 0.0590  0.0303  -0.0766 563 ARG A NE  
1562 C CZ  . ARG A 236 ? 0.8073 0.6371 0.8701 0.0590  0.0294  -0.0761 563 ARG A CZ  
1563 N NH1 . ARG A 236 ? 0.7948 0.5960 0.8371 0.0503  0.0233  -0.0862 563 ARG A NH1 
1564 N NH2 . ARG A 236 ? 0.8099 0.6487 0.8975 0.0675  0.0342  -0.0643 563 ARG A NH2 
1565 N N   . THR A 237 ? 0.4951 0.3607 0.5280 0.0011  -0.0265 -0.0885 564 THR A N   
1566 C CA  . THR A 237 ? 0.5043 0.3623 0.5456 -0.0093 -0.0358 -0.0862 564 THR A CA  
1567 C C   . THR A 237 ? 0.4452 0.3321 0.5114 -0.0137 -0.0401 -0.0746 564 THR A C   
1568 O O   . THR A 237 ? 0.4197 0.3079 0.5010 -0.0150 -0.0397 -0.0677 564 THR A O   
1569 C CB  . THR A 237 ? 0.5439 0.3827 0.5657 -0.0218 -0.0480 -0.0943 564 THR A CB  
1570 O OG1 . THR A 237 ? 0.6518 0.4618 0.6428 -0.0160 -0.0420 -0.1064 564 THR A OG1 
1571 C CG2 . THR A 237 ? 0.5529 0.3777 0.5839 -0.0330 -0.0568 -0.0921 564 THR A CG2 
1572 N N   . LEU A 238 ? 0.4152 0.3231 0.4837 -0.0150 -0.0427 -0.0721 565 LEU A N   
1573 C CA  . LEU A 238 ? 0.3874 0.3204 0.4761 -0.0170 -0.0441 -0.0617 565 LEU A CA  
1574 C C   . LEU A 238 ? 0.3678 0.3102 0.4665 -0.0085 -0.0358 -0.0555 565 LEU A C   
1575 O O   . LEU A 238 ? 0.3519 0.3045 0.4633 -0.0099 -0.0355 -0.0472 565 LEU A O   
1576 C CB  . LEU A 238 ? 0.3598 0.3094 0.4470 -0.0186 -0.0477 -0.0609 565 LEU A CB  
1577 C CG  . LEU A 238 ? 0.3881 0.3318 0.4700 -0.0298 -0.0598 -0.0630 565 LEU A CG  
1578 C CD1 . LEU A 238 ? 0.3786 0.3283 0.4479 -0.0296 -0.0632 -0.0658 565 LEU A CD1 
1579 C CD2 . LEU A 238 ? 0.3718 0.3291 0.4772 -0.0383 -0.0660 -0.0525 565 LEU A CD2 
1580 N N   . CYS A 239 ? 0.3645 0.3031 0.4571 0.0002  -0.0292 -0.0586 566 CYS A N   
1581 C CA  . CYS A 239 ? 0.3682 0.3148 0.4701 0.0072  -0.0242 -0.0521 566 CYS A CA  
1582 C C   . CYS A 239 ? 0.3524 0.2883 0.4616 0.0074  -0.0234 -0.0475 566 CYS A C   
1583 O O   . CYS A 239 ? 0.3278 0.2724 0.4455 0.0071  -0.0238 -0.0390 566 CYS A O   
1584 C CB  . CYS A 239 ? 0.3772 0.3253 0.4762 0.0158  -0.0180 -0.0541 566 CYS A CB  
1585 S SG  . CYS A 239 ? 0.3961 0.3514 0.5097 0.0236  -0.0143 -0.0446 566 CYS A SG  
1586 N N   . THR A 240 ? 0.3559 0.2702 0.4588 0.0075  -0.0223 -0.0532 567 THR A N   
1587 C CA  . THR A 240 ? 0.3842 0.2836 0.4935 0.0073  -0.0215 -0.0492 567 THR A CA  
1588 C C   . THR A 240 ? 0.3696 0.2742 0.4882 -0.0025 -0.0274 -0.0424 567 THR A C   
1589 O O   . THR A 240 ? 0.3577 0.2626 0.4861 -0.0017 -0.0260 -0.0334 567 THR A O   
1590 C CB  . THR A 240 ? 0.4119 0.2805 0.5078 0.0083  -0.0193 -0.0590 567 THR A CB  
1591 O OG1 . THR A 240 ? 0.4228 0.2888 0.5106 0.0190  -0.0109 -0.0638 567 THR A OG1 
1592 C CG2 . THR A 240 ? 0.4287 0.2802 0.5327 0.0110  -0.0163 -0.0539 567 THR A CG2 
1593 N N   . GLN A 241 ? 0.3588 0.2687 0.4758 -0.0115 -0.0337 -0.0450 568 GLN A N   
1594 C CA  . GLN A 241 ? 0.3605 0.2795 0.4914 -0.0201 -0.0376 -0.0360 568 GLN A CA  
1595 C C   . GLN A 241 ? 0.3305 0.2708 0.4689 -0.0154 -0.0325 -0.0262 568 GLN A C   
1596 O O   . GLN A 241 ? 0.3094 0.2536 0.4577 -0.0180 -0.0309 -0.0166 568 GLN A O   
1597 C CB  . GLN A 241 ? 0.3901 0.3133 0.5225 -0.0306 -0.0462 -0.0383 568 GLN A CB  
1598 C CG  . GLN A 241 ? 0.4663 0.3639 0.5855 -0.0377 -0.0538 -0.0486 568 GLN A CG  
1599 C CD  . GLN A 241 ? 0.5209 0.4242 0.6418 -0.0499 -0.0658 -0.0492 568 GLN A CD  
1600 O OE1 . GLN A 241 ? 0.5509 0.4760 0.6921 -0.0551 -0.0684 -0.0383 568 GLN A OE1 
1601 N NE2 . GLN A 241 ? 0.5810 0.4637 0.6805 -0.0546 -0.0732 -0.0608 568 GLN A NE2 
1602 N N   . GLY A 242 ? 0.3097 0.2618 0.4412 -0.0090 -0.0299 -0.0288 569 GLY A N   
1603 C CA  . GLY A 242 ? 0.3070 0.2726 0.4386 -0.0044 -0.0257 -0.0216 569 GLY A CA  
1604 C C   . GLY A 242 ? 0.3250 0.2852 0.4566 0.0004  -0.0234 -0.0154 569 GLY A C   
1605 O O   . GLY A 242 ? 0.3429 0.3077 0.4749 0.0005  -0.0209 -0.0064 569 GLY A O   
1606 N N   . LEU A 243 ? 0.3147 0.2651 0.4455 0.0049  -0.0234 -0.0189 570 LEU A N   
1607 C CA  . LEU A 243 ? 0.3308 0.2760 0.4656 0.0097  -0.0222 -0.0112 570 LEU A CA  
1608 C C   . LEU A 243 ? 0.3243 0.2599 0.4658 0.0056  -0.0216 -0.0034 570 LEU A C   
1609 O O   . LEU A 243 ? 0.3191 0.2575 0.4615 0.0073  -0.0206 0.0071  570 LEU A O   
1610 C CB  . LEU A 243 ? 0.3608 0.2966 0.4979 0.0166  -0.0202 -0.0153 570 LEU A CB  
1611 C CG  . LEU A 243 ? 0.3789 0.3266 0.5159 0.0228  -0.0198 -0.0161 570 LEU A CG  
1612 C CD1 . LEU A 243 ? 0.4183 0.3553 0.5612 0.0310  -0.0146 -0.0178 570 LEU A CD1 
1613 C CD2 . LEU A 243 ? 0.3790 0.3400 0.5175 0.0242  -0.0238 -0.0060 570 LEU A CD2 
1614 N N   . GLN A 244 ? 0.3231 0.2469 0.4682 -0.0008 -0.0230 -0.0080 571 GLN A N   
1615 C CA  . GLN A 244 ? 0.3376 0.2517 0.4922 -0.0072 -0.0233 -0.0003 571 GLN A CA  
1616 C C   . GLN A 244 ? 0.3198 0.2502 0.4791 -0.0105 -0.0208 0.0111  571 GLN A C   
1617 O O   . GLN A 244 ? 0.3088 0.2365 0.4738 -0.0112 -0.0180 0.0227  571 GLN A O   
1618 C CB  . GLN A 244 ? 0.3622 0.2617 0.5183 -0.0165 -0.0284 -0.0086 571 GLN A CB  
1619 C CG  . GLN A 244 ? 0.4049 0.2958 0.5740 -0.0264 -0.0308 -0.0002 571 GLN A CG  
1620 C CD  . GLN A 244 ? 0.4301 0.3067 0.5996 -0.0383 -0.0394 -0.0083 571 GLN A CD  
1621 O OE1 . GLN A 244 ? 0.4752 0.3626 0.6422 -0.0428 -0.0443 -0.0137 571 GLN A OE1 
1622 N NE2 . GLN A 244 ? 0.4525 0.3042 0.6250 -0.0443 -0.0425 -0.0081 571 GLN A NE2 
1623 N N   . ARG A 245 ? 0.3069 0.2533 0.4632 -0.0114 -0.0203 0.0086  572 ARG A N   
1624 C CA  . ARG A 245 ? 0.2952 0.2555 0.4539 -0.0121 -0.0148 0.0189  572 ARG A CA  
1625 C C   . ARG A 245 ? 0.2889 0.2510 0.4340 -0.0046 -0.0105 0.0256  572 ARG A C   
1626 O O   . ARG A 245 ? 0.3013 0.2645 0.4464 -0.0045 -0.0051 0.0375  572 ARG A O   
1627 C CB  . ARG A 245 ? 0.2907 0.2654 0.4494 -0.0130 -0.0141 0.0147  572 ARG A CB  
1628 C CG  . ARG A 245 ? 0.2950 0.2823 0.4551 -0.0110 -0.0050 0.0255  572 ARG A CG  
1629 C CD  . ARG A 245 ? 0.3138 0.3035 0.4945 -0.0179 -0.0023 0.0381  572 ARG A CD  
1630 N NE  . ARG A 245 ? 0.3204 0.3220 0.5036 -0.0144 0.0096  0.0506  572 ARG A NE  
1631 C CZ  . ARG A 245 ? 0.3518 0.3592 0.5544 -0.0190 0.0150  0.0649  572 ARG A CZ  
1632 N NH1 . ARG A 245 ? 0.3667 0.3673 0.5879 -0.0292 0.0072  0.0678  572 ARG A NH1 
1633 N NH2 . ARG A 245 ? 0.3658 0.3846 0.5700 -0.0138 0.0290  0.0769  572 ARG A NH2 
1634 N N   . ILE A 246 ? 0.2748 0.2370 0.4079 0.0008  -0.0136 0.0191  573 ILE A N   
1635 C CA  . ILE A 246 ? 0.2811 0.2437 0.4000 0.0060  -0.0135 0.0255  573 ILE A CA  
1636 C C   . ILE A 246 ? 0.2857 0.2392 0.4099 0.0070  -0.0141 0.0358  573 ILE A C   
1637 O O   . ILE A 246 ? 0.2983 0.2517 0.4122 0.0086  -0.0118 0.0465  573 ILE A O   
1638 C CB  . ILE A 246 ? 0.2788 0.2446 0.3893 0.0099  -0.0192 0.0178  573 ILE A CB  
1639 C CG1 . ILE A 246 ? 0.2735 0.2468 0.3767 0.0090  -0.0177 0.0097  573 ILE A CG1 
1640 C CG2 . ILE A 246 ? 0.2890 0.2543 0.3861 0.0130  -0.0230 0.0256  573 ILE A CG2 
1641 C CD1 . ILE A 246 ? 0.2633 0.2400 0.3656 0.0107  -0.0227 0.0006  573 ILE A CD1 
1642 N N   . PHE A 247 ? 0.2733 0.2168 0.4108 0.0068  -0.0166 0.0326  574 PHE A N   
1643 C CA  . PHE A 247 ? 0.2867 0.2182 0.4325 0.0081  -0.0164 0.0423  574 PHE A CA  
1644 C C   . PHE A 247 ? 0.2971 0.2272 0.4470 0.0030  -0.0116 0.0539  574 PHE A C   
1645 O O   . PHE A 247 ? 0.3017 0.2293 0.4479 0.0053  -0.0099 0.0673  574 PHE A O   
1646 C CB  . PHE A 247 ? 0.2904 0.2061 0.4478 0.0083  -0.0175 0.0342  574 PHE A CB  
1647 C CG  . PHE A 247 ? 0.3060 0.2048 0.4732 0.0099  -0.0163 0.0436  574 PHE A CG  
1648 C CD1 . PHE A 247 ? 0.3110 0.2075 0.4808 0.0189  -0.0171 0.0513  574 PHE A CD1 
1649 C CD2 . PHE A 247 ? 0.3158 0.2012 0.4919 0.0020  -0.0151 0.0463  574 PHE A CD2 
1650 C CE1 . PHE A 247 ? 0.3300 0.2092 0.5102 0.0214  -0.0152 0.0611  574 PHE A CE1 
1651 C CE2 . PHE A 247 ? 0.3284 0.1951 0.5137 0.0032  -0.0138 0.0552  574 PHE A CE2 
1652 C CZ  . PHE A 247 ? 0.3375 0.2004 0.5241 0.0136  -0.0132 0.0623  574 PHE A CZ  
1653 N N   . TYR A 248 ? 0.2977 0.2300 0.4566 -0.0041 -0.0096 0.0506  575 TYR A N   
1654 C CA  . TYR A 248 ? 0.3143 0.2484 0.4828 -0.0097 -0.0041 0.0632  575 TYR A CA  
1655 C C   . TYR A 248 ? 0.3219 0.2671 0.4752 -0.0053 0.0034  0.0739  575 TYR A C   
1656 O O   . TYR A 248 ? 0.3280 0.2699 0.4800 -0.0046 0.0084  0.0886  575 TYR A O   
1657 C CB  . TYR A 248 ? 0.3229 0.2622 0.5067 -0.0188 -0.0051 0.0588  575 TYR A CB  
1658 C CG  . TYR A 248 ? 0.3420 0.2871 0.5414 -0.0250 0.0011  0.0745  575 TYR A CG  
1659 C CD1 . TYR A 248 ? 0.3553 0.2866 0.5710 -0.0322 -0.0010 0.0823  575 TYR A CD1 
1660 C CD2 . TYR A 248 ? 0.3468 0.3100 0.5449 -0.0227 0.0107  0.0827  575 TYR A CD2 
1661 C CE1 . TYR A 248 ? 0.3749 0.3130 0.6089 -0.0388 0.0049  0.0989  575 TYR A CE1 
1662 C CE2 . TYR A 248 ? 0.3632 0.3339 0.5790 -0.0274 0.0190  0.0998  575 TYR A CE2 
1663 C CZ  . TYR A 248 ? 0.3757 0.3349 0.6108 -0.0361 0.0154  0.1084  575 TYR A CZ  
1664 O OH  . TYR A 248 ? 0.3971 0.3639 0.6531 -0.0418 0.0232  0.1270  575 TYR A OH  
1665 N N   . LEU A 249 ? 0.3153 0.2709 0.4545 -0.0019 0.0049  0.0665  576 LEU A N   
1666 C CA  . LEU A 249 ? 0.3366 0.2973 0.4542 0.0029  0.0129  0.0737  576 LEU A CA  
1667 C C   . LEU A 249 ? 0.3622 0.3151 0.4594 0.0077  0.0097  0.0803  576 LEU A C   
1668 O O   . LEU A 249 ? 0.3835 0.3344 0.4655 0.0099  0.0171  0.0926  576 LEU A O   
1669 C CB  . LEU A 249 ? 0.3270 0.2950 0.4311 0.0059  0.0142  0.0627  576 LEU A CB  
1670 C CG  . LEU A 249 ? 0.3125 0.2914 0.4363 0.0022  0.0189  0.0603  576 LEU A CG  
1671 C CD1 . LEU A 249 ? 0.3065 0.2897 0.4165 0.0061  0.0185  0.0488  576 LEU A CD1 
1672 C CD2 . LEU A 249 ? 0.3200 0.3057 0.4517 0.0022  0.0323  0.0753  576 LEU A CD2 
1673 N N   . LYS A 250 ? 0.3604 0.3092 0.4574 0.0094  -0.0008 0.0742  577 LYS A N   
1674 C CA  . LYS A 250 ? 0.3951 0.3387 0.4779 0.0132  -0.0068 0.0830  577 LYS A CA  
1675 C C   . LYS A 250 ? 0.4131 0.3492 0.5051 0.0129  -0.0038 0.0988  577 LYS A C   
1676 O O   . LYS A 250 ? 0.4260 0.3590 0.4995 0.0152  -0.0030 0.1116  577 LYS A O   
1677 C CB  . LYS A 250 ? 0.3919 0.3366 0.4803 0.0157  -0.0181 0.0753  577 LYS A CB  
1678 C CG  . LYS A 250 ? 0.4209 0.3642 0.4983 0.0191  -0.0269 0.0859  577 LYS A CG  
1679 C CD  . LYS A 250 ? 0.4091 0.3581 0.4976 0.0217  -0.0368 0.0798  577 LYS A CD  
1680 C CE  . LYS A 250 ? 0.4416 0.3921 0.5256 0.0244  -0.0475 0.0935  577 LYS A CE  
1681 N NZ  . LYS A 250 ? 0.4586 0.4099 0.5090 0.0212  -0.0539 0.0949  577 LYS A NZ  
1682 N N   . LEU A 251 ? 0.4130 0.3438 0.5311 0.0094  -0.0026 0.0983  578 LEU A N   
1683 C CA  . LEU A 251 ? 0.4551 0.3766 0.5846 0.0079  0.0007  0.1136  578 LEU A CA  
1684 C C   . LEU A 251 ? 0.4723 0.3982 0.5974 0.0049  0.0122  0.1261  578 LEU A C   
1685 O O   . LEU A 251 ? 0.4987 0.4200 0.6177 0.0063  0.0162  0.1424  578 LEU A O   
1686 C CB  . LEU A 251 ? 0.4727 0.3832 0.6284 0.0036  -0.0011 0.1078  578 LEU A CB  
1687 C CG  . LEU A 251 ? 0.5236 0.4164 0.6951 0.0044  -0.0033 0.1143  578 LEU A CG  
1688 C CD1 . LEU A 251 ? 0.5277 0.4175 0.6933 0.0134  -0.0080 0.1230  578 LEU A CD1 
1689 C CD2 . LEU A 251 ? 0.5101 0.3945 0.6924 0.0019  -0.0068 0.0966  578 LEU A CD2 
1690 N N   . GLU A 252 ? 0.4789 0.4146 0.6074 0.0017  0.0186  0.1199  579 GLU A N   
1691 C CA  . GLU A 252 ? 0.5113 0.4538 0.6391 0.0005  0.0321  0.1331  579 GLU A CA  
1692 C C   . GLU A 252 ? 0.5380 0.4791 0.6283 0.0082  0.0378  0.1405  579 GLU A C   
1693 O O   . GLU A 252 ? 0.5535 0.4924 0.6360 0.0095  0.0477  0.1573  579 GLU A O   
1694 C CB  . GLU A 252 ? 0.5015 0.4570 0.6430 -0.0028 0.0375  0.1261  579 GLU A CB  
1695 C CG  . GLU A 252 ? 0.5462 0.5114 0.6903 -0.0020 0.0542  0.1417  579 GLU A CG  
1696 C CD  . GLU A 252 ? 0.5561 0.5370 0.7173 -0.0039 0.0602  0.1376  579 GLU A CD  
1697 O OE1 . GLU A 252 ? 0.5893 0.5796 0.7821 -0.0108 0.0655  0.1496  579 GLU A OE1 
1698 O OE2 . GLU A 252 ? 0.5277 0.5119 0.6734 0.0008  0.0589  0.1240  579 GLU A OE2 
1699 N N   . ASP A 253 ? 0.5435 0.4840 0.6094 0.0123  0.0308  0.1281  580 ASP A N   
1700 C CA  . ASP A 253 ? 0.5875 0.5212 0.6134 0.0177  0.0304  0.1329  580 ASP A CA  
1701 C C   . ASP A 253 ? 0.6086 0.5419 0.6102 0.0217  0.0478  0.1398  580 ASP A C   
1702 O O   . ASP A 253 ? 0.6388 0.5627 0.6067 0.0255  0.0516  0.1496  580 ASP A O   
1703 C CB  . ASP A 253 ? 0.6208 0.5464 0.6436 0.0183  0.0238  0.1477  580 ASP A CB  
1704 C CG  . ASP A 253 ? 0.6608 0.5791 0.6425 0.0220  0.0158  0.1506  580 ASP A CG  
1705 O OD1 . ASP A 253 ? 0.6610 0.5796 0.6243 0.0225  0.0086  0.1367  580 ASP A OD1 
1706 O OD2 . ASP A 253 ? 0.6935 0.6049 0.6614 0.0235  0.0157  0.1673  580 ASP A OD2 
1707 N N   . LEU A 254 ? 0.6025 0.5454 0.6201 0.0214  0.0589  0.1354  581 LEU A N   
1708 C CA  . LEU A 254 ? 0.6245 0.5673 0.6204 0.0276  0.0777  0.1406  581 LEU A CA  
1709 C C   . LEU A 254 ? 0.6299 0.5622 0.5846 0.0326  0.0744  0.1255  581 LEU A C   
1710 O O   . LEU A 254 ? 0.6598 0.5780 0.5711 0.0383  0.0818  0.1292  581 LEU A O   
1711 C CB  . LEU A 254 ? 0.6258 0.5849 0.6594 0.0256  0.0888  0.1424  581 LEU A CB  
1712 C CG  . LEU A 254 ? 0.6822 0.6480 0.7200 0.0300  0.1123  0.1605  581 LEU A CG  
1713 C CD1 . LEU A 254 ? 0.6957 0.6643 0.7579 0.0244  0.1150  0.1803  581 LEU A CD1 
1714 C CD2 . LEU A 254 ? 0.6547 0.6378 0.7225 0.0304  0.1210  0.1575  581 LEU A CD2 
1715 N N   . VAL A 255 ? 0.5848 0.5216 0.5515 0.0300  0.0627  0.1089  582 VAL A N   
1716 C CA  . VAL A 255 ? 0.5897 0.5159 0.5234 0.0320  0.0546  0.0943  582 VAL A CA  
1717 C C   . VAL A 255 ? 0.5598 0.4895 0.5093 0.0262  0.0331  0.0857  582 VAL A C   
1718 O O   . VAL A 255 ? 0.5226 0.4632 0.5041 0.0231  0.0289  0.0778  582 VAL A O   
1719 C CB  . VAL A 255 ? 0.5805 0.5096 0.5147 0.0358  0.0644  0.0834  582 VAL A CB  
1720 C CG1 . VAL A 255 ? 0.5936 0.5046 0.4838 0.0382  0.0589  0.0706  582 VAL A CG1 
1721 C CG2 . VAL A 255 ? 0.5902 0.5244 0.5300 0.0420  0.0881  0.0945  582 VAL A CG2 
1722 N N   . PRO A 256 ? 0.5748 0.4953 0.5012 0.0251  0.0197  0.0880  583 PRO A N   
1723 C CA  . PRO A 256 ? 0.5579 0.4824 0.4978 0.0212  0.0006  0.0819  583 PRO A CA  
1724 C C   . PRO A 256 ? 0.5395 0.4661 0.4789 0.0199  -0.0049 0.0653  583 PRO A C   
1725 O O   . PRO A 256 ? 0.5416 0.4596 0.4544 0.0220  0.0016  0.0588  583 PRO A O   
1726 C CB  . PRO A 256 ? 0.5970 0.5108 0.5043 0.0206  -0.0113 0.0898  583 PRO A CB  
1727 C CG  . PRO A 256 ? 0.6493 0.5523 0.5272 0.0242  0.0024  0.1018  583 PRO A CG  
1728 C CD  . PRO A 256 ? 0.6360 0.5452 0.5323 0.0273  0.0233  0.1026  583 PRO A CD  
1729 N N   . PRO A 257 ? 0.5134 0.4501 0.4817 0.0173  -0.0154 0.0588  584 PRO A N   
1730 C CA  . PRO A 257 ? 0.5000 0.4388 0.4675 0.0159  -0.0198 0.0446  584 PRO A CA  
1731 C C   . PRO A 257 ? 0.5217 0.4498 0.4553 0.0136  -0.0320 0.0417  584 PRO A C   
1732 O O   . PRO A 257 ? 0.5481 0.4722 0.4690 0.0120  -0.0423 0.0508  584 PRO A O   
1733 C CB  . PRO A 257 ? 0.4490 0.3996 0.4521 0.0144  -0.0271 0.0410  584 PRO A CB  
1734 C CG  . PRO A 257 ? 0.4573 0.4082 0.4721 0.0151  -0.0312 0.0529  584 PRO A CG  
1735 C CD  . PRO A 257 ? 0.4902 0.4343 0.4912 0.0164  -0.0214 0.0638  584 PRO A CD  
1736 N N   . PRO A 258 ? 0.5229 0.4450 0.4413 0.0127  -0.0316 0.0301  585 PRO A N   
1737 C CA  . PRO A 258 ? 0.5629 0.4718 0.4485 0.0082  -0.0459 0.0274  585 PRO A CA  
1738 C C   . PRO A 258 ? 0.5536 0.4755 0.4636 0.0030  -0.0646 0.0292  585 PRO A C   
1739 O O   . PRO A 258 ? 0.5014 0.4398 0.4502 0.0045  -0.0629 0.0286  585 PRO A O   
1740 C CB  . PRO A 258 ? 0.5548 0.4524 0.4223 0.0089  -0.0393 0.0145  585 PRO A CB  
1741 C CG  . PRO A 258 ? 0.5126 0.4268 0.4182 0.0119  -0.0294 0.0101  585 PRO A CG  
1742 C CD  . PRO A 258 ? 0.4963 0.4221 0.4262 0.0149  -0.0212 0.0200  585 PRO A CD  
1743 N N   . ALA A 259 ? 0.5746 0.4884 0.4613 -0.0030 -0.0817 0.0319  586 ALA A N   
1744 C CA  . ALA A 259 ? 0.5582 0.4867 0.4696 -0.0075 -0.1001 0.0399  586 ALA A CA  
1745 C C   . ALA A 259 ? 0.5199 0.4660 0.4713 -0.0075 -0.1005 0.0341  586 ALA A C   
1746 O O   . ALA A 259 ? 0.4809 0.4436 0.4676 -0.0048 -0.1025 0.0415  586 ALA A O   
1747 C CB  . ALA A 259 ? 0.6111 0.5273 0.4891 -0.0163 -0.1206 0.0428  586 ALA A CB  
1748 N N   . ILE A 260 ? 0.4995 0.4403 0.4442 -0.0092 -0.0963 0.0216  587 ILE A N   
1749 C CA  . ILE A 260 ? 0.4907 0.4467 0.4686 -0.0096 -0.0965 0.0169  587 ILE A CA  
1750 C C   . ILE A 260 ? 0.4439 0.4125 0.4538 -0.0021 -0.0821 0.0160  587 ILE A C   
1751 O O   . ILE A 260 ? 0.4077 0.3909 0.4488 -0.0005 -0.0838 0.0182  587 ILE A O   
1752 C CB  . ILE A 260 ? 0.5241 0.4699 0.4866 -0.0137 -0.0964 0.0049  587 ILE A CB  
1753 C CG1 . ILE A 260 ? 0.5166 0.4791 0.5128 -0.0152 -0.0992 0.0031  587 ILE A CG1 
1754 C CG2 . ILE A 260 ? 0.5345 0.4680 0.4795 -0.0081 -0.0787 -0.0039 587 ILE A CG2 
1755 C CD1 . ILE A 260 ? 0.5649 0.5410 0.5809 -0.0212 -0.1168 0.0136  587 ILE A CD1 
1756 N N   . ILE A 261 ? 0.4368 0.3986 0.4379 0.0022  -0.0684 0.0141  588 ILE A N   
1757 C CA  . ILE A 261 ? 0.3985 0.3684 0.4256 0.0070  -0.0572 0.0135  588 ILE A CA  
1758 C C   . ILE A 261 ? 0.3746 0.3496 0.4196 0.0095  -0.0603 0.0244  588 ILE A C   
1759 O O   . ILE A 261 ? 0.3430 0.3255 0.4139 0.0124  -0.0582 0.0241  588 ILE A O   
1760 C CB  . ILE A 261 ? 0.4129 0.3763 0.4302 0.0095  -0.0431 0.0108  588 ILE A CB  
1761 C CG1 . ILE A 261 ? 0.4273 0.3862 0.4319 0.0091  -0.0382 0.0009  588 ILE A CG1 
1762 C CG2 . ILE A 261 ? 0.3765 0.3465 0.4205 0.0117  -0.0355 0.0116  588 ILE A CG2 
1763 C CD1 . ILE A 261 ? 0.4397 0.4073 0.4625 0.0080  -0.0407 -0.0066 588 ILE A CD1 
1764 N N   . ASP A 262 ? 0.3980 0.3667 0.4261 0.0089  -0.0649 0.0341  589 ASP A N   
1765 C CA  . ASP A 262 ? 0.4061 0.3781 0.4491 0.0116  -0.0685 0.0469  589 ASP A CA  
1766 C C   . ASP A 262 ? 0.3915 0.3762 0.4608 0.0127  -0.0782 0.0514  589 ASP A C   
1767 O O   . ASP A 262 ? 0.3688 0.3580 0.4644 0.0181  -0.0738 0.0555  589 ASP A O   
1768 C CB  . ASP A 262 ? 0.4354 0.3986 0.4497 0.0096  -0.0754 0.0572  589 ASP A CB  
1769 C CG  . ASP A 262 ? 0.4458 0.4077 0.4699 0.0135  -0.0721 0.0707  589 ASP A CG  
1770 O OD1 . ASP A 262 ? 0.4482 0.4096 0.4913 0.0168  -0.0606 0.0699  589 ASP A OD1 
1771 O OD2 . ASP A 262 ? 0.4723 0.4321 0.4835 0.0125  -0.0822 0.0827  589 ASP A OD2 
1772 N N   . LYS A 263 ? 0.4161 0.4054 0.4784 0.0076  -0.0908 0.0511  590 LYS A N   
1773 C CA  . LYS A 263 ? 0.4303 0.4352 0.5206 0.0078  -0.1004 0.0581  590 LYS A CA  
1774 C C   . LYS A 263 ? 0.3862 0.3992 0.5044 0.0132  -0.0891 0.0506  590 LYS A C   
1775 O O   . LYS A 263 ? 0.3692 0.3901 0.5156 0.0201  -0.0856 0.0577  590 LYS A O   
1776 C CB  . LYS A 263 ? 0.4927 0.4998 0.5692 -0.0014 -0.1178 0.0593  590 LYS A CB  
1777 C CG  . LYS A 263 ? 0.5431 0.5710 0.6560 -0.0016 -0.1276 0.0694  590 LYS A CG  
1778 C CD  . LYS A 263 ? 0.6103 0.6438 0.7176 -0.0120 -0.1511 0.0798  590 LYS A CD  
1779 C CE  . LYS A 263 ? 0.6642 0.6981 0.7671 -0.0213 -0.1584 0.0713  590 LYS A CE  
1780 N NZ  . LYS A 263 ? 0.6690 0.7182 0.8070 -0.0165 -0.1470 0.0677  590 LYS A NZ  
1781 N N   . LEU A 264 ? 0.3546 0.3635 0.4632 0.0110  -0.0823 0.0369  591 LEU A N   
1782 C CA  . LEU A 264 ? 0.3483 0.3624 0.4772 0.0157  -0.0715 0.0293  591 LEU A CA  
1783 C C   . LEU A 264 ? 0.3284 0.3357 0.4672 0.0226  -0.0595 0.0282  591 LEU A C   
1784 O O   . LEU A 264 ? 0.3350 0.3454 0.4942 0.0288  -0.0533 0.0284  591 LEU A O   
1785 C CB  . LEU A 264 ? 0.3541 0.3642 0.4689 0.0120  -0.0671 0.0162  591 LEU A CB  
1786 C CG  . LEU A 264 ? 0.4185 0.4333 0.5285 0.0054  -0.0774 0.0156  591 LEU A CG  
1787 C CD1 . LEU A 264 ? 0.4302 0.4395 0.5282 0.0033  -0.0711 0.0033  591 LEU A CD1 
1788 C CD2 . LEU A 264 ? 0.4036 0.4353 0.5437 0.0069  -0.0819 0.0240  591 LEU A CD2 
1789 N N   . PHE A 265 ? 0.3127 0.3091 0.4363 0.0213  -0.0563 0.0279  592 PHE A N   
1790 C CA  . PHE A 265 ? 0.3046 0.2918 0.4363 0.0252  -0.0471 0.0277  592 PHE A CA  
1791 C C   . PHE A 265 ? 0.3090 0.2971 0.4607 0.0318  -0.0482 0.0390  592 PHE A C   
1792 O O   . PHE A 265 ? 0.2875 0.2710 0.4547 0.0377  -0.0406 0.0361  592 PHE A O   
1793 C CB  . PHE A 265 ? 0.2985 0.2768 0.4135 0.0217  -0.0442 0.0293  592 PHE A CB  
1794 C CG  . PHE A 265 ? 0.3018 0.2701 0.4272 0.0236  -0.0373 0.0316  592 PHE A CG  
1795 C CD1 . PHE A 265 ? 0.2867 0.2487 0.4190 0.0227  -0.0306 0.0216  592 PHE A CD1 
1796 C CD2 . PHE A 265 ? 0.3094 0.2729 0.4375 0.0256  -0.0388 0.0445  592 PHE A CD2 
1797 C CE1 . PHE A 265 ? 0.2901 0.2394 0.4311 0.0227  -0.0263 0.0235  592 PHE A CE1 
1798 C CE2 . PHE A 265 ? 0.3160 0.2673 0.4544 0.0266  -0.0327 0.0472  592 PHE A CE2 
1799 C CZ  . PHE A 265 ? 0.3030 0.2466 0.4477 0.0245  -0.0269 0.0361  592 PHE A CZ  
1800 N N   . LEU A 266 ? 0.3216 0.3140 0.4707 0.0311  -0.0576 0.0520  593 LEU A N   
1801 C CA  . LEU A 266 ? 0.3355 0.3304 0.5052 0.0378  -0.0599 0.0663  593 LEU A CA  
1802 C C   . LEU A 266 ? 0.3362 0.3435 0.5333 0.0445  -0.0591 0.0692  593 LEU A C   
1803 O O   . LEU A 266 ? 0.3356 0.3387 0.5533 0.0539  -0.0512 0.0743  593 LEU A O   
1804 C CB  . LEU A 266 ? 0.3484 0.3468 0.5074 0.0347  -0.0728 0.0812  593 LEU A CB  
1805 C CG  . LEU A 266 ? 0.3739 0.3587 0.5090 0.0313  -0.0700 0.0833  593 LEU A CG  
1806 C CD1 . LEU A 266 ? 0.3915 0.3779 0.5070 0.0275  -0.0832 0.0967  593 LEU A CD1 
1807 C CD2 . LEU A 266 ? 0.3752 0.3477 0.5231 0.0364  -0.0594 0.0868  593 LEU A CD2 
1808 N N   . ASP A 267 ? 0.3367 0.3577 0.5344 0.0402  -0.0657 0.0667  594 ASP A N   
1809 C CA  . ASP A 267 ? 0.3573 0.3933 0.5832 0.0459  -0.0638 0.0712  594 ASP A CA  
1810 C C   . ASP A 267 ? 0.3566 0.3840 0.5907 0.0542  -0.0462 0.0602  594 ASP A C   
1811 O O   . ASP A 267 ? 0.3321 0.3650 0.5905 0.0642  -0.0386 0.0665  594 ASP A O   
1812 C CB  . ASP A 267 ? 0.3644 0.4145 0.5874 0.0373  -0.0745 0.0698  594 ASP A CB  
1813 C CG  . ASP A 267 ? 0.4048 0.4653 0.6264 0.0299  -0.0944 0.0839  594 ASP A CG  
1814 O OD1 . ASP A 267 ? 0.4220 0.4829 0.6491 0.0328  -0.1000 0.0973  594 ASP A OD1 
1815 O OD2 . ASP A 267 ? 0.4429 0.5090 0.6554 0.0202  -0.1052 0.0812  594 ASP A OD2 
1816 N N   . THR A 268 ? 0.3751 0.3890 0.5874 0.0500  -0.0401 0.0443  595 THR A N   
1817 C CA  . THR A 268 ? 0.4165 0.4164 0.6263 0.0551  -0.0261 0.0318  595 THR A CA  
1818 C C   . THR A 268 ? 0.4346 0.4152 0.6496 0.0631  -0.0168 0.0328  595 THR A C   
1819 O O   . THR A 268 ? 0.4675 0.4373 0.6861 0.0708  -0.0052 0.0268  595 THR A O   
1820 C CB  . THR A 268 ? 0.4652 0.4569 0.6504 0.0461  -0.0265 0.0178  595 THR A CB  
1821 O OG1 . THR A 268 ? 0.4811 0.4860 0.6604 0.0401  -0.0326 0.0152  595 THR A OG1 
1822 C CG2 . THR A 268 ? 0.5088 0.4844 0.6859 0.0480  -0.0162 0.0045  595 THR A CG2 
1823 N N   . LEU A 269 ? 0.4454 0.4198 0.6588 0.0614  -0.0217 0.0408  596 LEU A N   
1824 C CA  . LEU A 269 ? 0.4709 0.4247 0.6896 0.0680  -0.0140 0.0430  596 LEU A CA  
1825 C C   . LEU A 269 ? 0.5100 0.4631 0.7530 0.0822  -0.0056 0.0522  596 LEU A C   
1826 O O   . LEU A 269 ? 0.5113 0.4845 0.7748 0.0865  -0.0115 0.0682  596 LEU A O   
1827 C CB  . LEU A 269 ? 0.4583 0.4074 0.6720 0.0631  -0.0209 0.0526  596 LEU A CB  
1828 C CG  . LEU A 269 ? 0.4591 0.4044 0.6504 0.0512  -0.0244 0.0445  596 LEU A CG  
1829 C CD1 . LEU A 269 ? 0.4635 0.3989 0.6521 0.0487  -0.0260 0.0547  596 LEU A CD1 
1830 C CD2 . LEU A 269 ? 0.4392 0.3729 0.6196 0.0468  -0.0183 0.0272  596 LEU A CD2 
1831 N N   . PRO A 270 ? 0.5207 0.4490 0.7613 0.0900  0.0080  0.0433  597 PRO A N   
1832 C CA  . PRO A 270 ? 0.5157 0.4363 0.7766 0.1061  0.0205  0.0509  597 PRO A CA  
1833 C C   . PRO A 270 ? 0.5124 0.4278 0.7901 0.1122  0.0187  0.0674  597 PRO A C   
1834 O O   . PRO A 270 ? 0.5266 0.4288 0.8195 0.1265  0.0309  0.0730  597 PRO A O   
1835 C CB  . PRO A 270 ? 0.5462 0.4326 0.7871 0.1094  0.0339  0.0327  597 PRO A CB  
1836 C CG  . PRO A 270 ? 0.5617 0.4495 0.7782 0.0957  0.0277  0.0173  597 PRO A CG  
1837 C CD  . PRO A 270 ? 0.5329 0.4382 0.7491 0.0836  0.0124  0.0245  597 PRO A CD  
1838 N N   . PHE A 271 ? 0.4952 0.4175 0.7681 0.1024  0.0053  0.0754  598 PHE A N   
1839 C CA  . PHE A 271 ? 0.4968 0.4125 0.7830 0.1073  0.0028  0.0926  598 PHE A CA  
1840 C C   . PHE A 271 ? 0.4804 0.4165 0.7625 0.0973  -0.0141 0.1055  598 PHE A C   
1841 O O   . PHE A 271 ? 0.4803 0.4155 0.7713 0.1000  -0.0188 0.1222  598 PHE A O   
1842 C CB  . PHE A 271 ? 0.4977 0.3770 0.7710 0.1060  0.0103  0.0845  598 PHE A CB  
1843 C CG  . PHE A 271 ? 0.4650 0.3341 0.7113 0.0912  0.0074  0.0667  598 PHE A CG  
1844 C CD1 . PHE A 271 ? 0.4530 0.3328 0.6876 0.0783  -0.0035 0.0702  598 PHE A CD1 
1845 C CD2 . PHE A 271 ? 0.4634 0.3126 0.6954 0.0907  0.0160  0.0473  598 PHE A CD2 
1846 C CE1 . PHE A 271 ? 0.4286 0.3028 0.6436 0.0658  -0.0051 0.0558  598 PHE A CE1 
1847 C CE2 . PHE A 271 ? 0.4397 0.2834 0.6504 0.0766  0.0114  0.0328  598 PHE A CE2 
1848 C CZ  . PHE A 271 ? 0.4288 0.2861 0.6342 0.0646  0.0013  0.0380  598 PHE A CZ  
1849 O OXT . PHE A 271 ? 0.4679 0.4189 0.7347 0.0867  -0.0229 0.0993  598 PHE A OXT 
1850 N N   . PRO B 33  ? 0.8631 0.5763 0.9905 0.0566  -0.0419 -0.2042 360 PRO B N   
1851 C CA  . PRO B 33  ? 0.8654 0.6088 0.9566 0.0722  -0.0575 -0.2072 360 PRO B CA  
1852 C C   . PRO B 33  ? 0.8283 0.6068 0.9083 0.0748  -0.0552 -0.1783 360 PRO B C   
1853 O O   . PRO B 33  ? 0.8240 0.6028 0.8932 0.0828  -0.0398 -0.1542 360 PRO B O   
1854 C CB  . PRO B 33  ? 0.8886 0.6111 0.9464 0.0928  -0.0500 -0.2110 360 PRO B CB  
1855 C CG  . PRO B 33  ? 0.9159 0.6004 0.9891 0.0909  -0.0296 -0.2020 360 PRO B CG  
1856 C CD  . PRO B 33  ? 0.9027 0.5810 1.0156 0.0686  -0.0224 -0.1931 360 PRO B CD  
1857 N N   . PRO B 34  ? 0.8065 0.6139 0.8896 0.0689  -0.0716 -0.1822 361 PRO B N   
1858 C CA  . PRO B 34  ? 0.7668 0.6020 0.8533 0.0642  -0.0691 -0.1576 361 PRO B CA  
1859 C C   . PRO B 34  ? 0.7171 0.5669 0.7741 0.0776  -0.0575 -0.1318 361 PRO B C   
1860 O O   . PRO B 34  ? 0.7373 0.5900 0.7624 0.0929  -0.0574 -0.1341 361 PRO B O   
1861 C CB  . PRO B 34  ? 0.7678 0.6262 0.8515 0.0627  -0.0918 -0.1720 361 PRO B CB  
1862 C CG  . PRO B 34  ? 0.8079 0.6558 0.8630 0.0763  -0.1044 -0.1965 361 PRO B CG  
1863 C CD  . PRO B 34  ? 0.8300 0.6455 0.9030 0.0723  -0.0951 -0.2102 361 PRO B CD  
1864 N N   . VAL B 35  ? 0.6568 0.5161 0.7274 0.0709  -0.0473 -0.1090 362 VAL B N   
1865 C CA  . VAL B 35  ? 0.6106 0.4917 0.6640 0.0786  -0.0399 -0.0866 362 VAL B CA  
1866 C C   . VAL B 35  ? 0.5852 0.4901 0.6179 0.0815  -0.0517 -0.0883 362 VAL B C   
1867 O O   . VAL B 35  ? 0.5588 0.4676 0.5973 0.0751  -0.0666 -0.1009 362 VAL B O   
1868 C CB  . VAL B 35  ? 0.5946 0.4768 0.6699 0.0691  -0.0297 -0.0667 362 VAL B CB  
1869 C CG1 . VAL B 35  ? 0.5486 0.4595 0.6209 0.0662  -0.0307 -0.0497 362 VAL B CG1 
1870 C CG2 . VAL B 35  ? 0.5868 0.4498 0.6594 0.0786  -0.0150 -0.0563 362 VAL B CG2 
1871 N N   . SER B 36  ? 0.5548 0.4739 0.5631 0.0925  -0.0442 -0.0768 363 SER B N   
1872 C CA  . SER B 36  ? 0.5311 0.4687 0.5169 0.0953  -0.0485 -0.0713 363 SER B CA  
1873 C C   . SER B 36  ? 0.4963 0.4488 0.4985 0.0827  -0.0527 -0.0587 363 SER B C   
1874 O O   . SER B 36  ? 0.4614 0.4150 0.4901 0.0731  -0.0475 -0.0491 363 SER B O   
1875 C CB  . SER B 36  ? 0.5186 0.4684 0.4852 0.1060  -0.0334 -0.0590 363 SER B CB  
1876 O OG  . SER B 36  ? 0.4939 0.4587 0.4817 0.0997  -0.0239 -0.0406 363 SER B OG  
1877 N N   . LEU B 37  ? 0.4826 0.4436 0.4656 0.0846  -0.0610 -0.0582 364 LEU B N   
1878 C CA  . LEU B 37  ? 0.4565 0.4301 0.4516 0.0749  -0.0644 -0.0464 364 LEU B CA  
1879 C C   . LEU B 37  ? 0.4196 0.4061 0.4274 0.0688  -0.0494 -0.0255 364 LEU B C   
1880 O O   . LEU B 37  ? 0.3917 0.3823 0.4242 0.0583  -0.0498 -0.0188 364 LEU B O   
1881 C CB  . LEU B 37  ? 0.4749 0.4510 0.4385 0.0822  -0.0738 -0.0468 364 LEU B CB  
1882 C CG  . LEU B 37  ? 0.4550 0.4411 0.4250 0.0752  -0.0767 -0.0340 364 LEU B CG  
1883 C CD1 . LEU B 37  ? 0.4360 0.4256 0.4430 0.0643  -0.0880 -0.0412 364 LEU B CD1 
1884 C CD2 . LEU B 37  ? 0.4887 0.4696 0.4182 0.0871  -0.0845 -0.0339 364 LEU B CD2 
1885 N N   . ILE B 38  ? 0.4162 0.4101 0.4081 0.0759  -0.0366 -0.0171 365 ILE B N   
1886 C CA  . ILE B 38  ? 0.4002 0.4103 0.4066 0.0711  -0.0246 -0.0010 365 ILE B CA  
1887 C C   . ILE B 38  ? 0.3787 0.3862 0.4105 0.0684  -0.0222 0.0010  365 ILE B C   
1888 O O   . ILE B 38  ? 0.3634 0.3793 0.4110 0.0611  -0.0205 0.0113  365 ILE B O   
1889 C CB  . ILE B 38  ? 0.4117 0.4342 0.4030 0.0783  -0.0101 0.0050  365 ILE B CB  
1890 C CG1 . ILE B 38  ? 0.3905 0.4336 0.4007 0.0702  -0.0015 0.0190  365 ILE B CG1 
1891 C CG2 . ILE B 38  ? 0.4223 0.4414 0.4097 0.0905  -0.0032 -0.0029 365 ILE B CG2 
1892 C CD1 . ILE B 38  ? 0.4000 0.4590 0.4046 0.0730  0.0145  0.0245  365 ILE B CD1 
1893 N N   . SER B 39  ? 0.3905 0.3823 0.4225 0.0752  -0.0221 -0.0089 366 SER B N   
1894 C CA  . SER B 39  ? 0.3894 0.3690 0.4391 0.0746  -0.0189 -0.0068 366 SER B CA  
1895 C C   . SER B 39  ? 0.3694 0.3406 0.4370 0.0617  -0.0237 -0.0056 366 SER B C   
1896 O O   . SER B 39  ? 0.3554 0.3246 0.4341 0.0588  -0.0184 0.0046  366 SER B O   
1897 C CB  . SER B 39  ? 0.4202 0.3775 0.4650 0.0836  -0.0175 -0.0195 366 SER B CB  
1898 O OG  . SER B 39  ? 0.4281 0.3933 0.4633 0.0974  -0.0090 -0.0170 366 SER B OG  
1899 N N   . ALA B 40  ? 0.3767 0.3433 0.4465 0.0554  -0.0338 -0.0172 367 ALA B N   
1900 C CA  . ALA B 40  ? 0.3656 0.3292 0.4578 0.0426  -0.0377 -0.0180 367 ALA B CA  
1901 C C   . ALA B 40  ? 0.3384 0.3197 0.4333 0.0371  -0.0364 -0.0031 367 ALA B C   
1902 O O   . ALA B 40  ? 0.3312 0.3098 0.4424 0.0296  -0.0321 0.0032  367 ALA B O   
1903 C CB  . ALA B 40  ? 0.3683 0.3287 0.4667 0.0389  -0.0515 -0.0368 367 ALA B CB  
1904 N N   . LEU B 41  ? 0.3305 0.3270 0.4082 0.0410  -0.0382 0.0021  368 LEU B N   
1905 C CA  . LEU B 41  ? 0.3020 0.3130 0.3816 0.0356  -0.0362 0.0149  368 LEU B CA  
1906 C C   . LEU B 41  ? 0.2905 0.3070 0.3764 0.0362  -0.0269 0.0264  368 LEU B C   
1907 O O   . LEU B 41  ? 0.2738 0.2945 0.3686 0.0300  -0.0258 0.0339  368 LEU B O   
1908 C CB  . LEU B 41  ? 0.3089 0.3297 0.3677 0.0390  -0.0374 0.0179  368 LEU B CB  
1909 C CG  . LEU B 41  ? 0.3325 0.3470 0.3770 0.0421  -0.0495 0.0080  368 LEU B CG  
1910 C CD1 . LEU B 41  ? 0.3467 0.3633 0.3607 0.0489  -0.0462 0.0133  368 LEU B CD1 
1911 C CD2 . LEU B 41  ? 0.3152 0.3306 0.3776 0.0345  -0.0587 0.0062  368 LEU B CD2 
1912 N N   . VAL B 42  ? 0.3027 0.3190 0.3830 0.0456  -0.0212 0.0264  369 VAL B N   
1913 C CA  . VAL B 42  ? 0.2978 0.3203 0.3829 0.0503  -0.0155 0.0353  369 VAL B CA  
1914 C C   . VAL B 42  ? 0.3019 0.3049 0.3942 0.0485  -0.0133 0.0385  369 VAL B C   
1915 O O   . VAL B 42  ? 0.2829 0.2899 0.3773 0.0474  -0.0117 0.0473  369 VAL B O   
1916 C CB  . VAL B 42  ? 0.3093 0.3388 0.3889 0.0637  -0.0107 0.0337  369 VAL B CB  
1917 C CG1 . VAL B 42  ? 0.3014 0.3326 0.3857 0.0728  -0.0083 0.0405  369 VAL B CG1 
1918 C CG2 . VAL B 42  ? 0.3016 0.3541 0.3778 0.0632  -0.0078 0.0341  369 VAL B CG2 
1919 N N   . ARG B 43  ? 0.3218 0.3024 0.4170 0.0476  -0.0124 0.0304  370 ARG B N   
1920 C CA  . ARG B 43  ? 0.3540 0.3114 0.4566 0.0445  -0.0058 0.0334  370 ARG B CA  
1921 C C   . ARG B 43  ? 0.3280 0.2895 0.4419 0.0323  -0.0058 0.0376  370 ARG B C   
1922 O O   . ARG B 43  ? 0.3215 0.2730 0.4344 0.0321  0.0017  0.0470  370 ARG B O   
1923 C CB  . ARG B 43  ? 0.4076 0.3400 0.5163 0.0433  -0.0036 0.0213  370 ARG B CB  
1924 C CG  . ARG B 43  ? 0.4802 0.3853 0.6032 0.0349  0.0063  0.0215  370 ARG B CG  
1925 C CD  . ARG B 43  ? 0.5364 0.4200 0.6464 0.0442  0.0189  0.0361  370 ARG B CD  
1926 N NE  . ARG B 43  ? 0.6045 0.4631 0.7042 0.0560  0.0244  0.0338  370 ARG B NE  
1927 C CZ  . ARG B 43  ? 0.6506 0.4844 0.7336 0.0691  0.0345  0.0459  370 ARG B CZ  
1928 N NH1 . ARG B 43  ? 0.6245 0.4547 0.6958 0.0729  0.0403  0.0615  370 ARG B NH1 
1929 N NH2 . ARG B 43  ? 0.6815 0.4914 0.7561 0.0806  0.0386  0.0418  370 ARG B NH2 
1930 N N   . ALA B 44  ? 0.3054 0.2803 0.4269 0.0244  -0.0142 0.0304  371 ALA B N   
1931 C CA  . ALA B 44  ? 0.2935 0.2742 0.4276 0.0144  -0.0153 0.0322  371 ALA B CA  
1932 C C   . ALA B 44  ? 0.2762 0.2682 0.4008 0.0163  -0.0127 0.0453  371 ALA B C   
1933 O O   . ALA B 44  ? 0.2684 0.2550 0.3974 0.0124  -0.0069 0.0511  371 ALA B O   
1934 C CB  . ALA B 44  ? 0.2910 0.2850 0.4293 0.0106  -0.0276 0.0225  371 ALA B CB  
1935 N N   . HIS B 45  ? 0.2666 0.2743 0.3792 0.0223  -0.0163 0.0483  372 HIS B N   
1936 C CA  . HIS B 45  ? 0.2562 0.2771 0.3636 0.0240  -0.0157 0.0569  372 HIS B CA  
1937 C C   . HIS B 45  ? 0.2628 0.2730 0.3630 0.0323  -0.0101 0.0640  372 HIS B C   
1938 O O   . HIS B 45  ? 0.2505 0.2580 0.3474 0.0310  -0.0079 0.0698  372 HIS B O   
1939 C CB  . HIS B 45  ? 0.2567 0.2978 0.3594 0.0274  -0.0185 0.0565  372 HIS B CB  
1940 C CG  . HIS B 45  ? 0.2669 0.3243 0.3704 0.0281  -0.0192 0.0616  372 HIS B CG  
1941 N ND1 . HIS B 45  ? 0.2505 0.3152 0.3574 0.0192  -0.0211 0.0635  372 HIS B ND1 
1942 C CD2 . HIS B 45  ? 0.2708 0.3385 0.3734 0.0375  -0.0197 0.0634  372 HIS B CD2 
1943 C CE1 . HIS B 45  ? 0.2625 0.3417 0.3714 0.0214  -0.0227 0.0650  372 HIS B CE1 
1944 N NE2 . HIS B 45  ? 0.2730 0.3558 0.3799 0.0330  -0.0229 0.0647  372 HIS B NE2 
1945 N N   . VAL B 46  ? 0.2743 0.2755 0.3682 0.0429  -0.0077 0.0635  373 VAL B N   
1946 C CA  . VAL B 46  ? 0.2921 0.2795 0.3732 0.0555  -0.0032 0.0711  373 VAL B CA  
1947 C C   . VAL B 46  ? 0.3135 0.2721 0.3905 0.0517  0.0070  0.0771  373 VAL B C   
1948 O O   . VAL B 46  ? 0.3178 0.2686 0.3795 0.0587  0.0102  0.0859  373 VAL B O   
1949 C CB  . VAL B 46  ? 0.3078 0.2875 0.3832 0.0690  -0.0020 0.0688  373 VAL B CB  
1950 C CG1 . VAL B 46  ? 0.3363 0.2920 0.3938 0.0847  0.0034  0.0778  373 VAL B CG1 
1951 C CG2 . VAL B 46  ? 0.2929 0.3038 0.3729 0.0742  -0.0089 0.0644  373 VAL B CG2 
1952 N N   . ASP B 47  ? 0.3165 0.2603 0.4075 0.0409  0.0126  0.0712  374 ASP B N   
1953 C CA  . ASP B 47  ? 0.3582 0.2760 0.4522 0.0349  0.0261  0.0755  374 ASP B CA  
1954 C C   . ASP B 47  ? 0.3459 0.2741 0.4480 0.0247  0.0273  0.0772  374 ASP B C   
1955 O O   . ASP B 47  ? 0.3746 0.2842 0.4823 0.0187  0.0408  0.0801  374 ASP B O   
1956 C CB  . ASP B 47  ? 0.3703 0.2700 0.4835 0.0261  0.0322  0.0656  374 ASP B CB  
1957 C CG  . ASP B 47  ? 0.4059 0.2820 0.5074 0.0373  0.0370  0.0661  374 ASP B CG  
1958 O OD1 . ASP B 47  ? 0.4182 0.2867 0.4957 0.0534  0.0384  0.0764  374 ASP B OD1 
1959 O OD2 . ASP B 47  ? 0.4280 0.2925 0.5449 0.0308  0.0387  0.0549  374 ASP B OD2 
1960 N N   . SER B 48  ? 0.3154 0.2712 0.4187 0.0228  0.0153  0.0752  375 SER B N   
1961 C CA  . SER B 48  ? 0.3087 0.2724 0.4169 0.0153  0.0161  0.0766  375 SER B CA  
1962 C C   . SER B 48  ? 0.3124 0.2889 0.4024 0.0224  0.0102  0.0824  375 SER B C   
1963 O O   . SER B 48  ? 0.3020 0.2892 0.3953 0.0166  0.0074  0.0816  375 SER B O   
1964 C CB  . SER B 48  ? 0.2805 0.2617 0.4101 0.0047  0.0073  0.0668  375 SER B CB  
1965 O OG  . SER B 48  ? 0.2478 0.2475 0.3721 0.0073  -0.0044 0.0641  375 SER B OG  
1966 N N   . ASN B 49  ? 0.3337 0.3109 0.4070 0.0352  0.0067  0.0861  376 ASN B N   
1967 C CA  . ASN B 49  ? 0.3380 0.3327 0.3991 0.0426  -0.0024 0.0875  376 ASN B CA  
1968 C C   . ASN B 49  ? 0.3725 0.3511 0.4073 0.0599  0.0000  0.0950  376 ASN B C   
1969 O O   . ASN B 49  ? 0.3850 0.3423 0.4117 0.0678  0.0071  0.0993  376 ASN B O   
1970 C CB  . ASN B 49  ? 0.3109 0.3338 0.3835 0.0420  -0.0135 0.0809  376 ASN B CB  
1971 C CG  . ASN B 49  ? 0.3099 0.3470 0.3978 0.0277  -0.0166 0.0760  376 ASN B CG  
1972 O OD1 . ASN B 49  ? 0.3192 0.3661 0.4076 0.0233  -0.0202 0.0751  376 ASN B OD1 
1973 N ND2 . ASN B 49  ? 0.2955 0.3314 0.3938 0.0217  -0.0157 0.0723  376 ASN B ND2 
1974 N N   . PRO B 50  ? 0.3947 0.3808 0.4134 0.0674  -0.0065 0.0960  377 PRO B N   
1975 C CA  . PRO B 50  ? 0.4435 0.4133 0.4312 0.0883  -0.0069 0.1030  377 PRO B CA  
1976 C C   . PRO B 50  ? 0.4382 0.4266 0.4289 0.1021  -0.0192 0.0991  377 PRO B C   
1977 O O   . PRO B 50  ? 0.4043 0.4213 0.4213 0.0939  -0.0266 0.0906  377 PRO B O   
1978 C CB  . PRO B 50  ? 0.4631 0.4405 0.4347 0.0917  -0.0137 0.1013  377 PRO B CB  
1979 C CG  . PRO B 50  ? 0.4233 0.4355 0.4252 0.0759  -0.0247 0.0898  377 PRO B CG  
1980 C CD  . PRO B 50  ? 0.3895 0.3977 0.4153 0.0593  -0.0152 0.0898  377 PRO B CD  
1981 N N   . ALA B 51  ? 0.4757 0.4473 0.4384 0.1244  -0.0206 0.1055  378 ALA B N   
1982 C CA  . ALA B 51  ? 0.4890 0.4836 0.4557 0.1412  -0.0351 0.1002  378 ALA B CA  
1983 C C   . ALA B 51  ? 0.5206 0.5273 0.4651 0.1607  -0.0510 0.0978  378 ALA B C   
1984 O O   . ALA B 51  ? 0.5244 0.5151 0.4443 0.1622  -0.0488 0.1019  378 ALA B O   
1985 C CB  . ALA B 51  ? 0.5081 0.4750 0.4640 0.1547  -0.0264 0.1073  378 ALA B CB  
1986 N N   . MET B 52  ? 0.5577 0.5930 0.5108 0.1770  -0.0673 0.0899  379 MET B N   
1987 C CA  . MET B 52  ? 0.6251 0.6719 0.5555 0.2010  -0.0861 0.0857  379 MET B CA  
1988 C C   . MET B 52  ? 0.6746 0.6729 0.5489 0.2234  -0.0794 0.1010  379 MET B C   
1989 O O   . MET B 52  ? 0.7177 0.7148 0.5633 0.2368  -0.0903 0.0994  379 MET B O   
1990 C CB  . MET B 52  ? 0.6705 0.7542 0.6217 0.2189  -0.1037 0.0748  379 MET B CB  
1991 C CG  . MET B 52  ? 0.6751 0.8135 0.6805 0.1996  -0.1123 0.0570  379 MET B CG  
1992 S SD  . MET B 52  ? 0.7230 0.8962 0.7483 0.1826  -0.1262 0.0409  379 MET B SD  
1993 C CE  . MET B 52  ? 0.7132 0.9085 0.7211 0.2178  -0.1553 0.0296  379 MET B CE  
1994 N N   . THR B 53  ? 0.6907 0.6460 0.5479 0.2263  -0.0598 0.1156  380 THR B N   
1995 C CA  . THR B 53  ? 0.7420 0.6431 0.5436 0.2468  -0.0473 0.1329  380 THR B CA  
1996 C C   . THR B 53  ? 0.7466 0.6201 0.5305 0.2311  -0.0291 0.1407  380 THR B C   
1997 O O   . THR B 53  ? 0.7946 0.6289 0.5294 0.2482  -0.0199 0.1533  380 THR B O   
1998 C CB  . THR B 53  ? 0.7663 0.6263 0.5584 0.2541  -0.0294 0.1454  380 THR B CB  
1999 O OG1 . THR B 53  ? 0.7414 0.5996 0.5710 0.2230  -0.0125 0.1434  380 THR B OG1 
2000 C CG2 . THR B 53  ? 0.7566 0.6382 0.5587 0.2748  -0.0457 0.1392  380 THR B CG2 
2001 N N   . SER B 54  ? 0.6923 0.5858 0.5149 0.2003  -0.0234 0.1332  381 SER B N   
2002 C CA  . SER B 54  ? 0.7151 0.5857 0.5270 0.1858  -0.0055 0.1391  381 SER B CA  
2003 C C   . SER B 54  ? 0.6925 0.5910 0.5049 0.1814  -0.0198 0.1284  381 SER B C   
2004 O O   . SER B 54  ? 0.7095 0.5970 0.5228 0.1661  -0.0060 0.1302  381 SER B O   
2005 C CB  . SER B 54  ? 0.6588 0.5253 0.5102 0.1564  0.0127  0.1388  381 SER B CB  
2006 O OG  . SER B 54  ? 0.5832 0.4919 0.4783 0.1406  -0.0008 0.1252  381 SER B OG  
2007 N N   . LEU B 55  ? 0.6884 0.6225 0.5033 0.1940  -0.0463 0.1158  382 LEU B N   
2008 C CA  . LEU B 55  ? 0.6577 0.6187 0.4769 0.1880  -0.0610 0.1023  382 LEU B CA  
2009 C C   . LEU B 55  ? 0.7043 0.6352 0.4683 0.2059  -0.0583 0.1083  382 LEU B C   
2010 O O   . LEU B 55  ? 0.7461 0.6528 0.4636 0.2346  -0.0614 0.1166  382 LEU B O   
2011 C CB  . LEU B 55  ? 0.6284 0.6398 0.4769 0.1909  -0.0886 0.0835  382 LEU B CB  
2012 C CG  . LEU B 55  ? 0.5845 0.6307 0.4899 0.1688  -0.0899 0.0749  382 LEU B CG  
2013 C CD1 . LEU B 55  ? 0.5630 0.6581 0.5014 0.1626  -0.1116 0.0542  382 LEU B CD1 
2014 C CD2 . LEU B 55  ? 0.5476 0.5838 0.4765 0.1401  -0.0704 0.0794  382 LEU B CD2 
2015 N N   . ASP B 56  ? 0.6800 0.6089 0.4472 0.1894  -0.0502 0.1049  383 ASP B N   
2016 C CA  . ASP B 56  ? 0.7297 0.6245 0.4446 0.2026  -0.0400 0.1121  383 ASP B CA  
2017 C C   . ASP B 56  ? 0.7232 0.6461 0.4372 0.2028  -0.0621 0.0931  383 ASP B C   
2018 O O   . ASP B 56  ? 0.6862 0.6288 0.4357 0.1788  -0.0614 0.0829  383 ASP B O   
2019 C CB  . ASP B 56  ? 0.7267 0.5910 0.4475 0.1832  -0.0069 0.1244  383 ASP B CB  
2020 C CG  . ASP B 56  ? 0.7650 0.5949 0.4368 0.1932  0.0092  0.1315  383 ASP B CG  
2021 O OD1 . ASP B 56  ? 0.8004 0.6225 0.4240 0.2168  -0.0033 0.1289  383 ASP B OD1 
2022 O OD2 . ASP B 56  ? 0.7693 0.5803 0.4525 0.1769  0.0360  0.1389  383 ASP B OD2 
2023 N N   . TYR B 57  ? 0.7629 0.6868 0.4363 0.2312  -0.0828 0.0875  384 TYR B N   
2024 C CA  . TYR B 57  ? 0.7843 0.7322 0.4497 0.2363  -0.1070 0.0667  384 TYR B CA  
2025 C C   . TYR B 57  ? 0.8292 0.7407 0.4378 0.2474  -0.0954 0.0712  384 TYR B C   
2026 O O   . TYR B 57  ? 0.8254 0.7506 0.4170 0.2560  -0.1159 0.0535  384 TYR B O   
2027 C CB  . TYR B 57  ? 0.8211 0.7965 0.4758 0.2633  -0.1413 0.0528  384 TYR B CB  
2028 C CG  . TYR B 57  ? 0.7931 0.8187 0.5141 0.2492  -0.1576 0.0392  384 TYR B CG  
2029 C CD1 . TYR B 57  ? 0.7489 0.8186 0.5217 0.2268  -0.1728 0.0162  384 TYR B CD1 
2030 C CD2 . TYR B 57  ? 0.7977 0.8237 0.5307 0.2572  -0.1541 0.0500  384 TYR B CD2 
2031 C CE1 . TYR B 57  ? 0.7136 0.8267 0.5474 0.2125  -0.1823 0.0052  384 TYR B CE1 
2032 C CE2 . TYR B 57  ? 0.7564 0.8278 0.5499 0.2443  -0.1654 0.0379  384 TYR B CE2 
2033 C CZ  . TYR B 57  ? 0.7179 0.8328 0.5612 0.2218  -0.1784 0.0161  384 TYR B CZ  
2034 O OH  . TYR B 57  ? 0.7007 0.8584 0.6030 0.2084  -0.1854 0.0050  384 TYR B OH  
2035 N N   . SER B 58  ? 0.8604 0.7264 0.4410 0.2469  -0.0619 0.0930  385 SER B N   
2036 C CA  . SER B 58  ? 0.9491 0.7746 0.4678 0.2614  -0.0455 0.1003  385 SER B CA  
2037 C C   . SER B 58  ? 0.9402 0.7783 0.4753 0.2427  -0.0443 0.0853  385 SER B C   
2038 O O   . SER B 58  ? 0.9807 0.7916 0.4654 0.2561  -0.0353 0.0865  385 SER B O   
2039 C CB  . SER B 58  ? 0.9649 0.7395 0.4583 0.2619  -0.0050 0.1270  385 SER B CB  
2040 O OG  . SER B 58  ? 0.9005 0.6833 0.4513 0.2280  0.0164  0.1288  385 SER B OG  
2041 N N   . ARG B 59  ? 0.9053 0.7812 0.5071 0.2137  -0.0522 0.0720  386 ARG B N   
2042 C CA  . ARG B 59  ? 0.9157 0.8035 0.5341 0.1976  -0.0543 0.0563  386 ARG B CA  
2043 C C   . ARG B 59  ? 0.8820 0.8134 0.5339 0.1903  -0.0879 0.0301  386 ARG B C   
2044 O O   . ARG B 59  ? 0.8893 0.8273 0.5489 0.1803  -0.0924 0.0151  386 ARG B O   
2045 C CB  . ARG B 59  ? 0.8962 0.7795 0.5569 0.1699  -0.0273 0.0644  386 ARG B CB  
2046 C CG  . ARG B 59  ? 1.0082 0.8487 0.6330 0.1761  0.0069  0.0824  386 ARG B CG  
2047 C CD  . ARG B 59  ? 1.0437 0.8786 0.7116 0.1547  0.0341  0.0959  386 ARG B CD  
2048 N NE  . ARG B 59  ? 1.1792 0.9709 0.8085 0.1652  0.0673  0.1147  386 ARG B NE  
2049 C CZ  . ARG B 59  ? 1.2226 0.9989 0.8664 0.1526  0.0980  0.1212  386 ARG B CZ  
2050 N NH1 . ARG B 59  ? 1.1731 0.9736 0.8690 0.1304  0.0985  0.1109  386 ARG B NH1 
2051 N NH2 . ARG B 59  ? 1.3025 1.0377 0.9086 0.1633  0.1298  0.1384  386 ARG B NH2 
2052 N N   . PHE B 60  ? 0.8575 0.8170 0.5289 0.1962  -0.1100 0.0241  387 PHE B N   
2053 C CA  . PHE B 60  ? 0.8267 0.8324 0.5445 0.1847  -0.1383 -0.0004 387 PHE B CA  
2054 C C   . PHE B 60  ? 0.8789 0.8925 0.5654 0.2018  -0.1643 -0.0230 387 PHE B C   
2055 O O   . PHE B 60  ? 0.9459 0.9394 0.5726 0.2325  -0.1716 -0.0198 387 PHE B O   
2056 C CB  . PHE B 60  ? 0.7789 0.8131 0.5267 0.1887  -0.1519 -0.0002 387 PHE B CB  
2057 C CG  . PHE B 60  ? 0.7414 0.8251 0.5401 0.1775  -0.1785 -0.0259 387 PHE B CG  
2058 C CD1 . PHE B 60  ? 0.6832 0.7886 0.5419 0.1453  -0.1720 -0.0321 387 PHE B CD1 
2059 C CD2 . PHE B 60  ? 0.7781 0.8868 0.5659 0.2000  -0.2095 -0.0441 387 PHE B CD2 
2060 C CE1 . PHE B 60  ? 0.6598 0.8088 0.5689 0.1328  -0.1916 -0.0547 387 PHE B CE1 
2061 C CE2 . PHE B 60  ? 0.7530 0.9115 0.5966 0.1878  -0.2328 -0.0702 387 PHE B CE2 
2062 C CZ  . PHE B 60  ? 0.6987 0.8762 0.6037 0.1528  -0.2219 -0.0751 387 PHE B CZ  
2063 N N   . GLN B 61  ? 0.8879 0.9288 0.6139 0.1824  -0.1783 -0.0464 388 GLN B N   
2064 C CA  . GLN B 61  ? 0.9553 1.0121 0.6649 0.1947  -0.2079 -0.0746 388 GLN B CA  
2065 C C   . GLN B 61  ? 0.9472 1.0515 0.7264 0.1719  -0.2284 -0.1004 388 GLN B C   
2066 O O   . GLN B 61  ? 0.9186 1.0266 0.7398 0.1426  -0.2165 -0.1041 388 GLN B O   
2067 C CB  . GLN B 61  ? 0.9693 0.9956 0.6428 0.1942  -0.1974 -0.0792 388 GLN B CB  
2068 C CG  . GLN B 61  ? 1.0397 1.0648 0.6646 0.2194  -0.2241 -0.1019 388 GLN B CG  
2069 C CD  . GLN B 61  ? 1.0692 1.0648 0.6634 0.2163  -0.2117 -0.1082 388 GLN B CD  
2070 O OE1 . GLN B 61  ? 1.0691 1.0325 0.6502 0.2093  -0.1788 -0.0868 388 GLN B OE1 
2071 N NE2 . GLN B 61  ? 1.0948 1.1032 0.6818 0.2208  -0.2382 -0.1394 388 GLN B NE2 
2072 N N   . ALA B 62  ? 1.0375 1.1772 0.8288 0.1862  -0.2582 -0.1183 389 ALA B N   
2073 C CA  . ALA B 62  ? 1.0590 1.2483 0.9219 0.1651  -0.2770 -0.1445 389 ALA B CA  
2074 C C   . ALA B 62  ? 1.1036 1.3004 0.9857 0.1475  -0.2878 -0.1732 389 ALA B C   
2075 O O   . ALA B 62  ? 1.1067 1.3347 1.0547 0.1203  -0.2917 -0.1906 389 ALA B O   
2076 C CB  . ALA B 62  ? 1.0662 1.2942 0.9375 0.1884  -0.3077 -0.1588 389 ALA B CB  
2077 N N   . ASN B 63  ? 1.1569 1.3226 0.9822 0.1619  -0.2901 -0.1782 390 ASN B N   
2078 C CA  . ASN B 63  ? 1.1699 1.3456 1.0073 0.1524  -0.3089 -0.2122 390 ASN B CA  
2079 C C   . ASN B 63  ? 1.2042 1.3373 0.9960 0.1527  -0.2959 -0.2128 390 ASN B C   
2080 O O   . ASN B 63  ? 1.2660 1.3979 1.0276 0.1667  -0.3185 -0.2390 390 ASN B O   
2081 C CB  . ASN B 63  ? 1.2104 1.4213 1.0410 0.1767  -0.3508 -0.2429 390 ASN B CB  
2082 C CG  . ASN B 63  ? 1.2628 1.4578 1.0224 0.2193  -0.3594 -0.2266 390 ASN B CG  
2083 O OD1 . ASN B 63  ? 1.2491 1.4146 0.9806 0.2261  -0.3329 -0.1917 390 ASN B OD1 
2084 N ND2 . ASN B 63  ? 1.3050 1.5164 1.0330 0.2487  -0.3961 -0.2522 390 ASN B ND2 
2085 N N   . PRO B 64  ? 1.1994 1.3001 0.9901 0.1369  -0.2610 -0.1874 391 PRO B N   
2086 C CA  . PRO B 64  ? 1.2311 1.2912 0.9736 0.1424  -0.2476 -0.1873 391 PRO B CA  
2087 C C   . PRO B 64  ? 1.2452 1.3083 1.0122 0.1244  -0.2582 -0.2182 391 PRO B C   
2088 O O   . PRO B 64  ? 1.2799 1.3316 1.0031 0.1417  -0.2743 -0.2389 391 PRO B O   
2089 C CB  . PRO B 64  ? 1.1983 1.2310 0.9455 0.1294  -0.2096 -0.1544 391 PRO B CB  
2090 C CG  . PRO B 64  ? 1.1275 1.1880 0.9407 0.1058  -0.2054 -0.1464 391 PRO B CG  
2091 C CD  . PRO B 64  ? 1.1344 1.2357 0.9697 0.1132  -0.2345 -0.1627 391 PRO B CD  
2092 N N   . ASP B 72  ? 1.0732 0.8814 0.7525 0.1137  0.0210  -0.0762 399 ASP B N   
2093 C CA  . ASP B 72  ? 1.0262 0.8560 0.7320 0.1048  0.0138  -0.0611 399 ASP B CA  
2094 C C   . ASP B 72  ? 0.9648 0.8018 0.7155 0.0930  0.0350  -0.0413 399 ASP B C   
2095 O O   . ASP B 72  ? 0.8912 0.7476 0.6840 0.0781  0.0268  -0.0344 399 ASP B O   
2096 C CB  . ASP B 72  ? 1.0369 0.8885 0.7677 0.0921  -0.0177 -0.0756 399 ASP B CB  
2097 C CG  . ASP B 72  ? 1.0359 0.8890 0.8070 0.0741  -0.0241 -0.0892 399 ASP B CG  
2098 O OD1 . ASP B 72  ? 1.0923 0.9273 0.8628 0.0755  -0.0094 -0.0923 399 ASP B OD1 
2099 O OD2 . ASP B 72  ? 0.9928 0.8635 0.7957 0.0591  -0.0429 -0.0969 399 ASP B OD2 
2100 N N   . THR B 73  ? 0.9510 0.7723 0.6907 0.1013  0.0629  -0.0337 400 THR B N   
2101 C CA  . THR B 73  ? 0.8847 0.7124 0.6603 0.0947  0.0861  -0.0161 400 THR B CA  
2102 C C   . THR B 73  ? 0.8542 0.6890 0.6280 0.0943  0.0882  0.0011  400 THR B C   
2103 O O   . THR B 73  ? 0.7864 0.6341 0.6013 0.0834  0.0965  0.0127  400 THR B O   
2104 C CB  . THR B 73  ? 0.9118 0.7221 0.6742 0.1052  0.1179  -0.0138 400 THR B CB  
2105 O OG1 . THR B 73  ? 0.9726 0.7643 0.6844 0.1206  0.1351  -0.0043 400 THR B OG1 
2106 C CG2 . THR B 73  ? 0.9370 0.7339 0.6833 0.1115  0.1150  -0.0325 400 THR B CG2 
2107 N N   . GLN B 74  ? 0.8738 0.6991 0.5988 0.1078  0.0793  0.0012  401 GLN B N   
2108 C CA  . GLN B 74  ? 0.8602 0.6876 0.5755 0.1112  0.0788  0.0162  401 GLN B CA  
2109 C C   . GLN B 74  ? 0.7786 0.6335 0.5397 0.0950  0.0568  0.0164  401 GLN B C   
2110 O O   . GLN B 74  ? 0.7176 0.5793 0.5024 0.0885  0.0646  0.0305  401 GLN B O   
2111 C CB  . GLN B 74  ? 0.9436 0.7556 0.5936 0.1328  0.0677  0.0139  401 GLN B CB  
2112 C CG  . GLN B 74  ? 1.0815 0.8659 0.6714 0.1528  0.0780  0.0066  401 GLN B CG  
2113 C CD  . GLN B 74  ? 1.1549 0.9119 0.7206 0.1618  0.1186  0.0244  401 GLN B CD  
2114 O OE1 . GLN B 74  ? 1.2108 0.9574 0.7662 0.1658  0.1337  0.0434  401 GLN B OE1 
2115 N NE2 . GLN B 74  ? 1.1805 0.9243 0.7379 0.1651  0.1385  0.0180  401 GLN B NE2 
2116 N N   . HIS B 75  ? 0.7360 0.6053 0.5092 0.0883  0.0309  0.0000  402 HIS B N   
2117 C CA  . HIS B 75  ? 0.6859 0.5801 0.5015 0.0727  0.0126  -0.0008 402 HIS B CA  
2118 C C   . HIS B 75  ? 0.6168 0.5192 0.4822 0.0566  0.0235  0.0068  402 HIS B C   
2119 O O   . HIS B 75  ? 0.5778 0.4947 0.4706 0.0479  0.0200  0.0155  402 HIS B O   
2120 C CB  . HIS B 75  ? 0.7156 0.6214 0.5349 0.0678  -0.0136 -0.0211 402 HIS B CB  
2121 C CG  . HIS B 75  ? 0.7630 0.6709 0.5429 0.0833  -0.0320 -0.0305 402 HIS B CG  
2122 N ND1 . HIS B 75  ? 0.8184 0.7101 0.5527 0.0988  -0.0365 -0.0441 402 HIS B ND1 
2123 C CD2 . HIS B 75  ? 0.7591 0.6832 0.5362 0.0884  -0.0477 -0.0286 402 HIS B CD2 
2124 C CE1 . HIS B 75  ? 0.8496 0.7481 0.5537 0.1135  -0.0561 -0.0507 402 HIS B CE1 
2125 N NE2 . HIS B 75  ? 0.8264 0.7454 0.5576 0.1076  -0.0631 -0.0413 402 HIS B NE2 
2126 N N   . ILE B 76  ? 0.5915 0.4843 0.4661 0.0551  0.0365  0.0033  403 ILE B N   
2127 C CA  . ILE B 76  ? 0.5484 0.4485 0.4672 0.0445  0.0463  0.0096  403 ILE B CA  
2128 C C   . ILE B 76  ? 0.5539 0.4565 0.4839 0.0453  0.0645  0.0251  403 ILE B C   
2129 O O   . ILE B 76  ? 0.5198 0.4365 0.4830 0.0359  0.0613  0.0314  403 ILE B O   
2130 C CB  . ILE B 76  ? 0.5463 0.4358 0.4715 0.0463  0.0551  0.0009  403 ILE B CB  
2131 C CG1 . ILE B 76  ? 0.5452 0.4300 0.4641 0.0424  0.0361  -0.0151 403 ILE B CG1 
2132 C CG2 . ILE B 76  ? 0.5099 0.4087 0.4798 0.0398  0.0645  0.0070  403 ILE B CG2 
2133 C CD1 . ILE B 76  ? 0.5570 0.4249 0.4709 0.0474  0.0436  -0.0265 403 ILE B CD1 
2134 N N   . GLN B 77  ? 0.5897 0.4763 0.4890 0.0568  0.0839  0.0306  404 GLN B N   
2135 C CA  . GLN B 77  ? 0.5874 0.4711 0.4967 0.0566  0.1059  0.0446  404 GLN B CA  
2136 C C   . GLN B 77  ? 0.5557 0.4481 0.4698 0.0524  0.0941  0.0531  404 GLN B C   
2137 O O   . GLN B 77  ? 0.5227 0.4248 0.4720 0.0432  0.1000  0.0600  404 GLN B O   
2138 C CB  . GLN B 77  ? 0.6549 0.5127 0.5183 0.0715  0.1302  0.0499  404 GLN B CB  
2139 C CG  . GLN B 77  ? 0.6919 0.5423 0.5730 0.0708  0.1644  0.0560  404 GLN B CG  
2140 C CD  . GLN B 77  ? 0.7580 0.5865 0.5985 0.0850  0.1832  0.0515  404 GLN B CD  
2141 O OE1 . GLN B 77  ? 0.8057 0.6136 0.5869 0.0999  0.1798  0.0513  404 GLN B OE1 
2142 N NE2 . GLN B 77  ? 0.7533 0.5868 0.6251 0.0821  0.2023  0.0469  404 GLN B NE2 
2143 N N   . GLN B 78  ? 0.5653 0.4560 0.4464 0.0597  0.0758  0.0504  405 GLN B N   
2144 C CA  . GLN B 78  ? 0.5630 0.4635 0.4486 0.0579  0.0633  0.0568  405 GLN B CA  
2145 C C   . GLN B 78  ? 0.4973 0.4217 0.4304 0.0418  0.0486  0.0537  405 GLN B C   
2146 O O   . GLN B 78  ? 0.4669 0.3986 0.4208 0.0363  0.0497  0.0614  405 GLN B O   
2147 C CB  . GLN B 78  ? 0.6153 0.5134 0.4594 0.0712  0.0447  0.0519  405 GLN B CB  
2148 C CG  . GLN B 78  ? 0.6572 0.5633 0.5042 0.0729  0.0358  0.0601  405 GLN B CG  
2149 C CD  . GLN B 78  ? 0.7503 0.6428 0.5451 0.0942  0.0292  0.0628  405 GLN B CD  
2150 O OE1 . GLN B 78  ? 0.7943 0.6829 0.5553 0.1060  0.0176  0.0520  405 GLN B OE1 
2151 N NE2 . GLN B 78  ? 0.7757 0.6590 0.5617 0.1009  0.0360  0.0765  405 GLN B NE2 
2152 N N   . PHE B 79  ? 0.4744 0.4072 0.4216 0.0352  0.0368  0.0426  406 PHE B N   
2153 C CA  . PHE B 79  ? 0.4359 0.3849 0.4218 0.0218  0.0265  0.0407  406 PHE B CA  
2154 C C   . PHE B 79  ? 0.3998 0.3519 0.4171 0.0167  0.0400  0.0481  406 PHE B C   
2155 O O   . PHE B 79  ? 0.3585 0.3217 0.3965 0.0104  0.0345  0.0525  406 PHE B O   
2156 C CB  . PHE B 79  ? 0.4481 0.3961 0.4385 0.0174  0.0171  0.0285  406 PHE B CB  
2157 C CG  . PHE B 79  ? 0.4347 0.3900 0.4594 0.0067  0.0130  0.0288  406 PHE B CG  
2158 C CD1 . PHE B 79  ? 0.4256 0.3928 0.4648 -0.0018 0.0007  0.0301  406 PHE B CD1 
2159 C CD2 . PHE B 79  ? 0.4243 0.3732 0.4640 0.0073  0.0218  0.0276  406 PHE B CD2 
2160 C CE1 . PHE B 79  ? 0.4218 0.3909 0.4843 -0.0091 -0.0022 0.0318  406 PHE B CE1 
2161 C CE2 . PHE B 79  ? 0.4166 0.3688 0.4813 0.0013  0.0160  0.0282  406 PHE B CE2 
2162 C CZ  . PHE B 79  ? 0.4113 0.3715 0.4843 -0.0067 0.0041  0.0309  406 PHE B CZ  
2163 N N   . TYR B 80  ? 0.3990 0.3426 0.4204 0.0200  0.0577  0.0481  407 TYR B N   
2164 C CA  . TYR B 80  ? 0.3632 0.3134 0.4197 0.0153  0.0707  0.0522  407 TYR B CA  
2165 C C   . TYR B 80  ? 0.3732 0.3222 0.4320 0.0139  0.0792  0.0616  407 TYR B C   
2166 O O   . TYR B 80  ? 0.3461 0.3072 0.4368 0.0065  0.0760  0.0625  407 TYR B O   
2167 C CB  . TYR B 80  ? 0.3687 0.3122 0.4317 0.0197  0.0909  0.0492  407 TYR B CB  
2168 C CG  . TYR B 80  ? 0.3683 0.3123 0.4379 0.0216  0.0851  0.0394  407 TYR B CG  
2169 C CD1 . TYR B 80  ? 0.3355 0.2883 0.4229 0.0166  0.0654  0.0352  407 TYR B CD1 
2170 C CD2 . TYR B 80  ? 0.3928 0.3248 0.4484 0.0297  0.1012  0.0350  407 TYR B CD2 
2171 C CE1 . TYR B 80  ? 0.3439 0.2914 0.4353 0.0198  0.0622  0.0273  407 TYR B CE1 
2172 C CE2 . TYR B 80  ? 0.4008 0.3306 0.4629 0.0330  0.0974  0.0254  407 TYR B CE2 
2173 C CZ  . TYR B 80  ? 0.3719 0.3083 0.4512 0.0280  0.0774  0.0218  407 TYR B CZ  
2174 O OH  . TYR B 80  ? 0.3929 0.3216 0.4753 0.0327  0.0755  0.0134  407 TYR B OH  
2175 N N   . ASP B 81  ? 0.4116 0.3432 0.4341 0.0224  0.0901  0.0680  408 ASP B N   
2176 C CA  . ASP B 81  ? 0.4207 0.3437 0.4384 0.0230  0.0996  0.0782  408 ASP B CA  
2177 C C   . ASP B 81  ? 0.3869 0.3231 0.4137 0.0188  0.0794  0.0787  408 ASP B C   
2178 O O   . ASP B 81  ? 0.3550 0.2939 0.4043 0.0130  0.0835  0.0822  408 ASP B O   
2179 C CB  . ASP B 81  ? 0.4889 0.3866 0.4557 0.0370  0.1117  0.0859  408 ASP B CB  
2180 C CG  . ASP B 81  ? 0.5492 0.4295 0.5065 0.0411  0.1398  0.0878  408 ASP B CG  
2181 O OD1 . ASP B 81  ? 0.5440 0.4350 0.5424 0.0320  0.1515  0.0832  408 ASP B OD1 
2182 O OD2 . ASP B 81  ? 0.6281 0.4844 0.5364 0.0550  0.1508  0.0935  408 ASP B OD2 
2183 N N   . LEU B 82  ? 0.3774 0.3229 0.3908 0.0207  0.0583  0.0736  409 LEU B N   
2184 C CA  . LEU B 82  ? 0.3663 0.3259 0.3903 0.0167  0.0417  0.0737  409 LEU B CA  
2185 C C   . LEU B 82  ? 0.3402 0.3143 0.4032 0.0055  0.0371  0.0708  409 LEU B C   
2186 O O   . LEU B 82  ? 0.3488 0.3286 0.4242 0.0025  0.0335  0.0734  409 LEU B O   
2187 C CB  . LEU B 82  ? 0.3683 0.3376 0.3762 0.0195  0.0221  0.0670  409 LEU B CB  
2188 C CG  . LEU B 82  ? 0.4047 0.3644 0.3716 0.0338  0.0186  0.0668  409 LEU B CG  
2189 C CD1 . LEU B 82  ? 0.3993 0.3725 0.3620 0.0330  -0.0009 0.0541  409 LEU B CD1 
2190 C CD2 . LEU B 82  ? 0.4109 0.3654 0.3628 0.0430  0.0192  0.0757  409 LEU B CD2 
2191 N N   . LEU B 83  ? 0.3314 0.3100 0.4110 0.0015  0.0365  0.0649  410 LEU B N   
2192 C CA  . LEU B 83  ? 0.3056 0.2959 0.4175 -0.0052 0.0309  0.0620  410 LEU B CA  
2193 C C   . LEU B 83  ? 0.3059 0.2971 0.4424 -0.0077 0.0432  0.0633  410 LEU B C   
2194 O O   . LEU B 83  ? 0.2909 0.2911 0.4460 -0.0117 0.0358  0.0620  410 LEU B O   
2195 C CB  . LEU B 83  ? 0.3029 0.2948 0.4255 -0.0056 0.0280  0.0558  410 LEU B CB  
2196 C CG  . LEU B 83  ? 0.3114 0.3013 0.4206 -0.0066 0.0155  0.0521  410 LEU B CG  
2197 C CD1 . LEU B 83  ? 0.3124 0.2974 0.4307 -0.0046 0.0169  0.0469  410 LEU B CD1 
2198 C CD2 . LEU B 83  ? 0.2881 0.2856 0.4010 -0.0117 0.0023  0.0537  410 LEU B CD2 
2199 N N   . THR B 84  ? 0.3178 0.2995 0.4554 -0.0059 0.0626  0.0646  411 THR B N   
2200 C CA  . THR B 84  ? 0.3312 0.3154 0.5015 -0.0112 0.0766  0.0633  411 THR B CA  
2201 C C   . THR B 84  ? 0.3469 0.3218 0.5106 -0.0129 0.0807  0.0695  411 THR B C   
2202 O O   . THR B 84  ? 0.3249 0.3076 0.5186 -0.0194 0.0792  0.0651  411 THR B O   
2203 C CB  . THR B 84  ? 0.3486 0.3258 0.5291 -0.0106 0.1010  0.0626  411 THR B CB  
2204 O OG1 . THR B 84  ? 0.3927 0.3467 0.5312 -0.0036 0.1157  0.0719  411 THR B OG1 
2205 C CG2 . THR B 84  ? 0.3301 0.3170 0.5210 -0.0075 0.0968  0.0550  411 THR B CG2 
2206 N N   . GLY B 85  ? 0.3764 0.3343 0.5004 -0.0056 0.0844  0.0784  412 GLY B N   
2207 C CA  . GLY B 85  ? 0.4144 0.3613 0.5258 -0.0036 0.0851  0.0850  412 GLY B CA  
2208 C C   . GLY B 85  ? 0.4011 0.3650 0.5276 -0.0075 0.0643  0.0802  412 GLY B C   
2209 O O   . GLY B 85  ? 0.4122 0.3753 0.5566 -0.0120 0.0658  0.0788  412 GLY B O   
2210 N N   . SER B 86  ? 0.4077 0.3859 0.5281 -0.0065 0.0465  0.0767  413 SER B N   
2211 C CA  . SER B 86  ? 0.4110 0.4035 0.5414 -0.0094 0.0295  0.0731  413 SER B CA  
2212 C C   . SER B 86  ? 0.3900 0.3932 0.5541 -0.0160 0.0252  0.0654  413 SER B C   
2213 O O   . SER B 86  ? 0.3769 0.3852 0.5476 -0.0173 0.0168  0.0629  413 SER B O   
2214 C CB  . SER B 86  ? 0.4412 0.4431 0.5575 -0.0079 0.0159  0.0717  413 SER B CB  
2215 O OG  . SER B 86  ? 0.5282 0.5421 0.6580 -0.0121 0.0038  0.0679  413 SER B OG  
2216 N N   . MET B 87  ? 0.3926 0.4002 0.5775 -0.0186 0.0300  0.0603  414 MET B N   
2217 C CA  . MET B 87  ? 0.3856 0.4061 0.6058 -0.0225 0.0245  0.0504  414 MET B CA  
2218 C C   . MET B 87  ? 0.3598 0.3777 0.5992 -0.0273 0.0303  0.0467  414 MET B C   
2219 O O   . MET B 87  ? 0.3283 0.3553 0.5813 -0.0284 0.0172  0.0391  414 MET B O   
2220 C CB  . MET B 87  ? 0.3736 0.3999 0.6181 -0.0232 0.0329  0.0448  414 MET B CB  
2221 C CG  . MET B 87  ? 0.4183 0.4508 0.6571 -0.0182 0.0213  0.0431  414 MET B CG  
2222 S SD  . MET B 87  ? 0.4399 0.4810 0.7124 -0.0169 0.0331  0.0349  414 MET B SD  
2223 C CE  . MET B 87  ? 0.3992 0.4325 0.6419 -0.0100 0.0249  0.0387  414 MET B CE  
2224 N N   . GLU B 88  ? 0.3724 0.3749 0.6105 -0.0296 0.0508  0.0518  415 GLU B N   
2225 C CA  . GLU B 88  ? 0.3959 0.3904 0.6542 -0.0358 0.0606  0.0483  415 GLU B CA  
2226 C C   . GLU B 88  ? 0.3768 0.3644 0.6149 -0.0326 0.0503  0.0511  415 GLU B C   
2227 O O   . GLU B 88  ? 0.3623 0.3532 0.6207 -0.0368 0.0444  0.0418  415 GLU B O   
2228 C CB  . GLU B 88  ? 0.4828 0.4555 0.7370 -0.0378 0.0888  0.0562  415 GLU B CB  
2229 C CG  . GLU B 88  ? 0.5753 0.5379 0.8621 -0.0480 0.1054  0.0506  415 GLU B CG  
2230 C CD  . GLU B 88  ? 0.6558 0.6424 1.0006 -0.0582 0.1044  0.0328  415 GLU B CD  
2231 O OE1 . GLU B 88  ? 0.7289 0.7078 1.1068 -0.0689 0.1211  0.0263  415 GLU B OE1 
2232 O OE2 . GLU B 88  ? 0.6522 0.6643 1.0117 -0.0553 0.0875  0.0245  415 GLU B OE2 
2233 N N   . ILE B 89  ? 0.3448 0.3245 0.5448 -0.0245 0.0474  0.0619  416 ILE B N   
2234 C CA  . ILE B 89  ? 0.3495 0.3248 0.5306 -0.0193 0.0390  0.0649  416 ILE B CA  
2235 C C   . ILE B 89  ? 0.3107 0.3048 0.4995 -0.0198 0.0190  0.0566  416 ILE B C   
2236 O O   . ILE B 89  ? 0.2998 0.2920 0.4930 -0.0198 0.0144  0.0517  416 ILE B O   
2237 C CB  . ILE B 89  ? 0.3598 0.3257 0.5030 -0.0091 0.0409  0.0766  416 ILE B CB  
2238 C CG1 . ILE B 89  ? 0.4040 0.3420 0.5346 -0.0060 0.0623  0.0852  416 ILE B CG1 
2239 C CG2 . ILE B 89  ? 0.3515 0.3233 0.4792 -0.0025 0.0279  0.0776  416 ILE B CG2 
2240 C CD1 . ILE B 89  ? 0.4537 0.3822 0.5494 0.0041  0.0671  0.0947  416 ILE B CD1 
2241 N N   . ILE B 90  ? 0.2808 0.2895 0.4704 -0.0198 0.0087  0.0545  417 ILE B N   
2242 C CA  . ILE B 90  ? 0.2663 0.2877 0.4567 -0.0184 -0.0080 0.0486  417 ILE B CA  
2243 C C   . ILE B 90  ? 0.2829 0.3102 0.5007 -0.0213 -0.0143 0.0357  417 ILE B C   
2244 O O   . ILE B 90  ? 0.2715 0.3026 0.4854 -0.0184 -0.0261 0.0298  417 ILE B O   
2245 C CB  . ILE B 90  ? 0.2615 0.2906 0.4419 -0.0168 -0.0151 0.0514  417 ILE B CB  
2246 C CG1 . ILE B 90  ? 0.2751 0.3014 0.4307 -0.0145 -0.0122 0.0603  417 ILE B CG1 
2247 C CG2 . ILE B 90  ? 0.2528 0.2891 0.4300 -0.0139 -0.0296 0.0470  417 ILE B CG2 
2248 C CD1 . ILE B 90  ? 0.2827 0.3129 0.4298 -0.0151 -0.0168 0.0620  417 ILE B CD1 
2249 N N   . ARG B 91  ? 0.2820 0.3112 0.5284 -0.0266 -0.0063 0.0299  418 ARG B N   
2250 C CA  . ARG B 91  ? 0.3117 0.3500 0.5927 -0.0304 -0.0123 0.0142  418 ARG B CA  
2251 C C   . ARG B 91  ? 0.2900 0.3169 0.5741 -0.0336 -0.0087 0.0098  418 ARG B C   
2252 O O   . ARG B 91  ? 0.2844 0.3180 0.5780 -0.0325 -0.0228 -0.0030 418 ARG B O   
2253 C CB  . ARG B 91  ? 0.3496 0.3941 0.6669 -0.0368 0.0000  0.0085  418 ARG B CB  
2254 C CG  . ARG B 91  ? 0.4173 0.4781 0.7800 -0.0413 -0.0078 -0.0111 418 ARG B CG  
2255 C CD  . ARG B 91  ? 0.4888 0.5578 0.8909 -0.0482 0.0087  -0.0159 418 ARG B CD  
2256 N NE  . ARG B 91  ? 0.5159 0.6017 0.9234 -0.0408 -0.0007 -0.0177 418 ARG B NE  
2257 C CZ  . ARG B 91  ? 0.5756 0.6568 0.9716 -0.0387 0.0119  -0.0073 418 ARG B CZ  
2258 N NH1 . ARG B 91  ? 0.6024 0.6628 0.9766 -0.0424 0.0344  0.0065  418 ARG B NH1 
2259 N NH2 . ARG B 91  ? 0.5791 0.6746 0.9820 -0.0306 0.0011  -0.0111 418 ARG B NH2 
2260 N N   . GLY B 92  ? 0.2756 0.2831 0.5477 -0.0356 0.0091  0.0201  419 GLY B N   
2261 C CA  . GLY B 92  ? 0.2896 0.2804 0.5601 -0.0370 0.0143  0.0178  419 GLY B CA  
2262 C C   . GLY B 92  ? 0.2808 0.2739 0.5249 -0.0285 -0.0007 0.0179  419 GLY B C   
2263 O O   . GLY B 92  ? 0.2854 0.2755 0.5369 -0.0288 -0.0073 0.0065  419 GLY B O   
2264 N N   . TRP B 93  ? 0.2658 0.2650 0.4811 -0.0213 -0.0057 0.0290  420 TRP B N   
2265 C CA  . TRP B 93  ? 0.2742 0.2790 0.4668 -0.0139 -0.0175 0.0295  420 TRP B CA  
2266 C C   . TRP B 93  ? 0.2736 0.2892 0.4740 -0.0127 -0.0337 0.0158  420 TRP B C   
2267 O O   . TRP B 93  ? 0.2860 0.2982 0.4787 -0.0087 -0.0397 0.0088  420 TRP B O   
2268 C CB  . TRP B 93  ? 0.2595 0.2721 0.4291 -0.0095 -0.0189 0.0413  420 TRP B CB  
2269 C CG  . TRP B 93  ? 0.2584 0.2799 0.4107 -0.0043 -0.0286 0.0410  420 TRP B CG  
2270 C CD1 . TRP B 93  ? 0.2646 0.2853 0.4018 0.0016  -0.0277 0.0432  420 TRP B CD1 
2271 C CD2 . TRP B 93  ? 0.2533 0.2839 0.3997 -0.0033 -0.0383 0.0394  420 TRP B CD2 
2272 N NE1 . TRP B 93  ? 0.2449 0.2746 0.3688 0.0046  -0.0341 0.0428  420 TRP B NE1 
2273 C CE2 . TRP B 93  ? 0.2557 0.2889 0.3823 0.0020  -0.0405 0.0412  420 TRP B CE2 
2274 C CE3 . TRP B 93  ? 0.2472 0.2822 0.4021 -0.0049 -0.0444 0.0369  420 TRP B CE3 
2275 C CZ2 . TRP B 93  ? 0.2693 0.3056 0.3805 0.0049  -0.0464 0.0423  420 TRP B CZ2 
2276 C CZ3 . TRP B 93  ? 0.2629 0.3003 0.4018 -0.0002 -0.0531 0.0375  420 TRP B CZ3 
2277 C CH2 . TRP B 93  ? 0.2729 0.3091 0.3882 0.0042  -0.0530 0.0412  420 TRP B CH2 
2278 N N   . ALA B 94  ? 0.2660 0.2933 0.4798 -0.0143 -0.0410 0.0115  421 ALA B N   
2279 C CA  . ALA B 94  ? 0.2885 0.3261 0.5044 -0.0092 -0.0593 -0.0006 421 ALA B CA  
2280 C C   . ALA B 94  ? 0.3079 0.3452 0.5466 -0.0114 -0.0662 -0.0194 421 ALA B C   
2281 O O   . ALA B 94  ? 0.3113 0.3493 0.5360 -0.0041 -0.0799 -0.0288 421 ALA B O   
2282 C CB  . ALA B 94  ? 0.2786 0.3277 0.5083 -0.0087 -0.0652 -0.0020 421 ALA B CB  
2283 N N   . GLU B 95  ? 0.3257 0.3595 0.5976 -0.0216 -0.0547 -0.0248 422 GLU B N   
2284 C CA  . GLU B 95  ? 0.3665 0.3985 0.6683 -0.0273 -0.0582 -0.0445 422 GLU B CA  
2285 C C   . GLU B 95  ? 0.3895 0.4033 0.6710 -0.0248 -0.0552 -0.0451 422 GLU B C   
2286 O O   . GLU B 95  ? 0.3995 0.4115 0.6962 -0.0263 -0.0640 -0.0641 422 GLU B O   
2287 C CB  . GLU B 95  ? 0.3867 0.4168 0.7309 -0.0407 -0.0412 -0.0485 422 GLU B CB  
2288 C CG  . GLU B 95  ? 0.4255 0.4769 0.7972 -0.0425 -0.0447 -0.0523 422 GLU B CG  
2289 C CD  . GLU B 95  ? 0.4553 0.5039 0.8675 -0.0561 -0.0217 -0.0535 422 GLU B CD  
2290 O OE1 . GLU B 95  ? 0.5149 0.5415 0.9318 -0.0645 -0.0023 -0.0503 422 GLU B OE1 
2291 O OE2 . GLU B 95  ? 0.4661 0.5324 0.9048 -0.0577 -0.0210 -0.0572 422 GLU B OE2 
2292 N N   . LYS B 96  ? 0.3753 0.3777 0.6234 -0.0195 -0.0451 -0.0268 423 LYS B N   
2293 C CA  . LYS B 96  ? 0.4056 0.3928 0.6330 -0.0140 -0.0428 -0.0267 423 LYS B CA  
2294 C C   . LYS B 96  ? 0.4068 0.4020 0.6032 -0.0021 -0.0576 -0.0293 423 LYS B C   
2295 O O   . LYS B 96  ? 0.4284 0.4132 0.6061 0.0042  -0.0560 -0.0305 423 LYS B O   
2296 C CB  . LYS B 96  ? 0.4250 0.3969 0.6356 -0.0121 -0.0248 -0.0080 423 LYS B CB  
2297 C CG  . LYS B 96  ? 0.4724 0.4251 0.7031 -0.0208 -0.0058 -0.0043 423 LYS B CG  
2298 C CD  . LYS B 96  ? 0.5042 0.4434 0.7084 -0.0139 0.0081  0.0161  423 LYS B CD  
2299 C CE  . LYS B 96  ? 0.5520 0.4596 0.7612 -0.0171 0.0292  0.0218  423 LYS B CE  
2300 N NZ  . LYS B 96  ? 0.6244 0.5119 0.8053 -0.0042 0.0335  0.0300  423 LYS B NZ  
2301 N N   . ILE B 97  ? 0.3775 0.3882 0.5659 0.0018  -0.0702 -0.0294 424 ILE B N   
2302 C CA  . ILE B 97  ? 0.3678 0.3816 0.5224 0.0138  -0.0819 -0.0309 424 ILE B CA  
2303 C C   . ILE B 97  ? 0.3740 0.3873 0.5346 0.0179  -0.0987 -0.0542 424 ILE B C   
2304 O O   . ILE B 97  ? 0.3729 0.3962 0.5593 0.0150  -0.1106 -0.0673 424 ILE B O   
2305 C CB  . ILE B 97  ? 0.3600 0.3838 0.4987 0.0180  -0.0870 -0.0206 424 ILE B CB  
2306 C CG1 . ILE B 97  ? 0.3467 0.3710 0.4776 0.0142  -0.0719 -0.0008 424 ILE B CG1 
2307 C CG2 . ILE B 97  ? 0.3817 0.4037 0.4838 0.0312  -0.0979 -0.0230 424 ILE B CG2 
2308 C CD1 . ILE B 97  ? 0.3521 0.3833 0.4824 0.0133  -0.0742 0.0071  424 ILE B CD1 
2309 N N   . PRO B 98  ? 0.3710 0.3740 0.5097 0.0255  -0.1005 -0.0613 425 PRO B N   
2310 C CA  . PRO B 98  ? 0.3934 0.3949 0.5373 0.0297  -0.1182 -0.0866 425 PRO B CA  
2311 C C   . PRO B 98  ? 0.3989 0.4131 0.5304 0.0397  -0.1395 -0.0944 425 PRO B C   
2312 O O   . PRO B 98  ? 0.3863 0.4013 0.4825 0.0491  -0.1389 -0.0788 425 PRO B O   
2313 C CB  . PRO B 98  ? 0.4199 0.4074 0.5304 0.0397  -0.1148 -0.0888 425 PRO B CB  
2314 C CG  . PRO B 98  ? 0.4023 0.3836 0.5098 0.0360  -0.0927 -0.0680 425 PRO B CG  
2315 C CD  . PRO B 98  ? 0.3725 0.3665 0.4841 0.0311  -0.0874 -0.0493 425 PRO B CD  
2316 N N   . GLY B 99  ? 0.4023 0.4260 0.5646 0.0377  -0.1575 -0.1180 426 GLY B N   
2317 C CA  . GLY B 99  ? 0.4164 0.4536 0.5697 0.0500  -0.1808 -0.1273 426 GLY B CA  
2318 C C   . GLY B 99  ? 0.4004 0.4536 0.5811 0.0450  -0.1810 -0.1192 426 GLY B C   
2319 O O   . GLY B 99  ? 0.4213 0.4893 0.6127 0.0536  -0.2029 -0.1335 426 GLY B O   
2320 N N   . PHE B 100 ? 0.3712 0.4222 0.5637 0.0332  -0.1587 -0.0984 427 PHE B N   
2321 C CA  . PHE B 100 ? 0.3609 0.4250 0.5754 0.0297  -0.1574 -0.0906 427 PHE B CA  
2322 C C   . PHE B 100 ? 0.3574 0.4399 0.6311 0.0207  -0.1652 -0.1123 427 PHE B C   
2323 O O   . PHE B 100 ? 0.3425 0.4418 0.6322 0.0269  -0.1795 -0.1194 427 PHE B O   
2324 C CB  . PHE B 100 ? 0.3463 0.4031 0.5579 0.0198  -0.1323 -0.0658 427 PHE B CB  
2325 C CG  . PHE B 100 ? 0.3325 0.3996 0.5610 0.0175  -0.1296 -0.0575 427 PHE B CG  
2326 C CD1 . PHE B 100 ? 0.3410 0.4060 0.5376 0.0280  -0.1341 -0.0444 427 PHE B CD1 
2327 C CD2 . PHE B 100 ? 0.3153 0.3910 0.5901 0.0047  -0.1197 -0.0620 427 PHE B CD2 
2328 C CE1 . PHE B 100 ? 0.3388 0.4104 0.5492 0.0266  -0.1308 -0.0368 427 PHE B CE1 
2329 C CE2 . PHE B 100 ? 0.3140 0.3986 0.6028 0.0038  -0.1158 -0.0549 427 PHE B CE2 
2330 C CZ  . PHE B 100 ? 0.3192 0.4022 0.5762 0.0152  -0.1227 -0.0430 427 PHE B CZ  
2331 N N   . ALA B 101 ? 0.3713 0.4494 0.6786 0.0062  -0.1542 -0.1225 428 ALA B N   
2332 C CA  . ALA B 101 ? 0.3872 0.4818 0.7574 -0.0055 -0.1585 -0.1465 428 ALA B CA  
2333 C C   . ALA B 101 ? 0.4125 0.5244 0.7957 0.0045  -0.1904 -0.1774 428 ALA B C   
2334 O O   . ALA B 101 ? 0.4156 0.5498 0.8547 -0.0023 -0.1992 -0.1994 428 ALA B O   
2335 C CB  . ALA B 101 ? 0.3930 0.4715 0.7924 -0.0241 -0.1350 -0.1483 428 ALA B CB  
2336 N N   . ASP B 102 ? 0.4388 0.5415 0.7706 0.0219  -0.2076 -0.1796 429 ASP B N   
2337 C CA  . ASP B 102 ? 0.4830 0.6006 0.8148 0.0370  -0.2419 -0.2085 429 ASP B CA  
2338 C C   . ASP B 102 ? 0.4882 0.6243 0.8108 0.0548  -0.2631 -0.2080 429 ASP B C   
2339 O O   . ASP B 102 ? 0.5041 0.6579 0.8362 0.0684  -0.2939 -0.2341 429 ASP B O   
2340 C CB  . ASP B 102 ? 0.5337 0.6313 0.8077 0.0516  -0.2520 -0.2124 429 ASP B CB  
2341 C CG  . ASP B 102 ? 0.5558 0.6350 0.8405 0.0375  -0.2363 -0.2191 429 ASP B CG  
2342 O OD1 . ASP B 102 ? 0.5459 0.6307 0.8905 0.0176  -0.2268 -0.2322 429 ASP B OD1 
2343 O OD2 . ASP B 102 ? 0.5793 0.6372 0.8130 0.0468  -0.2319 -0.2113 429 ASP B OD2 
2344 N N   . LEU B 103 ? 0.4637 0.5943 0.7661 0.0565  -0.2480 -0.1795 430 LEU B N   
2345 C CA  . LEU B 103 ? 0.4873 0.6298 0.7774 0.0747  -0.2656 -0.1763 430 LEU B CA  
2346 C C   . LEU B 103 ? 0.4824 0.6571 0.8459 0.0666  -0.2720 -0.1948 430 LEU B C   
2347 O O   . LEU B 103 ? 0.4736 0.6545 0.8885 0.0437  -0.2509 -0.1974 430 LEU B O   
2348 C CB  . LEU B 103 ? 0.4632 0.5870 0.7108 0.0774  -0.2459 -0.1415 430 LEU B CB  
2349 C CG  . LEU B 103 ? 0.4714 0.5664 0.6545 0.0825  -0.2341 -0.1219 430 LEU B CG  
2350 C CD1 . LEU B 103 ? 0.4426 0.5234 0.6038 0.0766  -0.2094 -0.0908 430 LEU B CD1 
2351 C CD2 . LEU B 103 ? 0.5216 0.6067 0.6494 0.1082  -0.2574 -0.1273 430 LEU B CD2 
2352 N N   . PRO B 104 ? 0.4939 0.6883 0.8621 0.0864  -0.2992 -0.2068 431 PRO B N   
2353 C CA  . PRO B 104 ? 0.4817 0.7098 0.9227 0.0797  -0.3023 -0.2224 431 PRO B CA  
2354 C C   . PRO B 104 ? 0.4518 0.6744 0.9126 0.0614  -0.2672 -0.1983 431 PRO B C   
2355 O O   . PRO B 104 ? 0.4412 0.6372 0.8512 0.0626  -0.2495 -0.1684 431 PRO B O   
2356 C CB  . PRO B 104 ? 0.5024 0.7420 0.9209 0.1099  -0.3331 -0.2267 431 PRO B CB  
2357 C CG  . PRO B 104 ? 0.5360 0.7569 0.8888 0.1310  -0.3559 -0.2308 431 PRO B CG  
2358 C CD  . PRO B 104 ? 0.5322 0.7186 0.8405 0.1172  -0.3275 -0.2072 431 PRO B CD  
2359 N N   . LYS B 105 ? 0.4388 0.6864 0.9727 0.0450  -0.2566 -0.2122 432 LYS B N   
2360 C CA  . LYS B 105 ? 0.4171 0.6576 0.9677 0.0283  -0.2217 -0.1907 432 LYS B CA  
2361 C C   . LYS B 105 ? 0.4067 0.6388 0.9191 0.0434  -0.2201 -0.1673 432 LYS B C   
2362 O O   . LYS B 105 ? 0.4064 0.6148 0.8875 0.0360  -0.1948 -0.1402 432 LYS B O   
2363 C CB  . LYS B 105 ? 0.4229 0.6928 1.0604 0.0100  -0.2094 -0.2112 432 LYS B CB  
2364 C CG  . LYS B 105 ? 0.4295 0.6897 1.0814 -0.0063 -0.1711 -0.1900 432 LYS B CG  
2365 C CD  . LYS B 105 ? 0.4372 0.6595 1.0471 -0.0198 -0.1441 -0.1663 432 LYS B CD  
2366 C CE  . LYS B 105 ? 0.4358 0.6443 1.0454 -0.0311 -0.1094 -0.1438 432 LYS B CE  
2367 N NZ  . LYS B 105 ? 0.4275 0.6013 0.9932 -0.0393 -0.0905 -0.1240 432 LYS B NZ  
2368 N N   . ALA B 106 ? 0.4022 0.6530 0.9175 0.0655  -0.2482 -0.1791 433 ALA B N   
2369 C CA  . ALA B 106 ? 0.3977 0.6379 0.8757 0.0836  -0.2510 -0.1601 433 ALA B CA  
2370 C C   . ALA B 106 ? 0.3980 0.5980 0.7942 0.0900  -0.2439 -0.1316 433 ALA B C   
2371 O O   . ALA B 106 ? 0.3963 0.5780 0.7660 0.0901  -0.2276 -0.1088 433 ALA B O   
2372 C CB  . ALA B 106 ? 0.4157 0.6799 0.9049 0.1106  -0.2870 -0.1800 433 ALA B CB  
2373 N N   . ASP B 107 ? 0.4143 0.6014 0.7737 0.0948  -0.2553 -0.1350 434 ASP B N   
2374 C CA  . ASP B 107 ? 0.4335 0.5857 0.7208 0.1001  -0.2472 -0.1110 434 ASP B CA  
2375 C C   . ASP B 107 ? 0.4038 0.5404 0.6889 0.0767  -0.2137 -0.0916 434 ASP B C   
2376 O O   . ASP B 107 ? 0.4005 0.5155 0.6477 0.0763  -0.1985 -0.0678 434 ASP B O   
2377 C CB  . ASP B 107 ? 0.4592 0.6037 0.7106 0.1122  -0.2670 -0.1224 434 ASP B CB  
2378 C CG  . ASP B 107 ? 0.5039 0.6495 0.7239 0.1432  -0.2995 -0.1316 434 ASP B CG  
2379 O OD1 . ASP B 107 ? 0.5119 0.6654 0.7420 0.1556  -0.3076 -0.1297 434 ASP B OD1 
2380 O OD2 . ASP B 107 ? 0.5377 0.6746 0.7196 0.1573  -0.3174 -0.1409 434 ASP B OD2 
2381 N N   . GLN B 108 ? 0.3856 0.5326 0.7126 0.0578  -0.2027 -0.1028 435 GLN B N   
2382 C CA  . GLN B 108 ? 0.3631 0.4964 0.6913 0.0381  -0.1724 -0.0861 435 GLN B CA  
2383 C C   . GLN B 108 ? 0.3498 0.4811 0.6840 0.0335  -0.1546 -0.0695 435 GLN B C   
2384 O O   . GLN B 108 ? 0.3297 0.4413 0.6297 0.0294  -0.1381 -0.0482 435 GLN B O   
2385 C CB  . GLN B 108 ? 0.3415 0.4839 0.7172 0.0205  -0.1627 -0.1014 435 GLN B CB  
2386 C CG  . GLN B 108 ? 0.3533 0.4910 0.7188 0.0220  -0.1751 -0.1159 435 GLN B CG  
2387 C CD  . GLN B 108 ? 0.3457 0.4893 0.7629 0.0034  -0.1642 -0.1323 435 GLN B CD  
2388 O OE1 . GLN B 108 ? 0.3774 0.5358 0.8257 0.0036  -0.1821 -0.1593 435 GLN B OE1 
2389 N NE2 . GLN B 108 ? 0.3153 0.4461 0.7425 -0.0123 -0.1347 -0.1172 435 GLN B NE2 
2390 N N   . ASP B 109 ? 0.3338 0.4867 0.7129 0.0349  -0.1586 -0.0813 436 ASP B N   
2391 C CA  . ASP B 109 ? 0.3163 0.4684 0.7026 0.0332  -0.1435 -0.0690 436 ASP B CA  
2392 C C   . ASP B 109 ? 0.3342 0.4674 0.6688 0.0483  -0.1498 -0.0520 436 ASP B C   
2393 O O   . ASP B 109 ? 0.3259 0.4430 0.6402 0.0426  -0.1321 -0.0343 436 ASP B O   
2394 C CB  . ASP B 109 ? 0.3204 0.5023 0.7665 0.0352  -0.1485 -0.0874 436 ASP B CB  
2395 C CG  . ASP B 109 ? 0.3108 0.5093 0.8150 0.0165  -0.1343 -0.1027 436 ASP B CG  
2396 O OD1 . ASP B 109 ? 0.3214 0.5031 0.8161 0.0015  -0.1153 -0.0944 436 ASP B OD1 
2397 O OD2 . ASP B 109 ? 0.3194 0.5474 0.8806 0.0168  -0.1414 -0.1239 436 ASP B OD2 
2398 N N   . LEU B 110 ? 0.3571 0.4904 0.6698 0.0679  -0.1746 -0.0579 437 LEU B N   
2399 C CA  . LEU B 110 ? 0.3862 0.4947 0.6456 0.0822  -0.1775 -0.0399 437 LEU B CA  
2400 C C   . LEU B 110 ? 0.3812 0.4629 0.5949 0.0726  -0.1601 -0.0196 437 LEU B C   
2401 O O   . LEU B 110 ? 0.3800 0.4440 0.5720 0.0699  -0.1464 -0.0028 437 LEU B O   
2402 C CB  . LEU B 110 ? 0.4302 0.5374 0.6644 0.1077  -0.2063 -0.0480 437 LEU B CB  
2403 C CG  . LEU B 110 ? 0.4721 0.5465 0.6450 0.1247  -0.2081 -0.0283 437 LEU B CG  
2404 C CD1 . LEU B 110 ? 0.4734 0.5391 0.6510 0.1265  -0.1976 -0.0174 437 LEU B CD1 
2405 C CD2 . LEU B 110 ? 0.5210 0.5946 0.6694 0.1526  -0.2378 -0.0384 437 LEU B CD2 
2406 N N   . LEU B 111 ? 0.3702 0.4505 0.5731 0.0676  -0.1611 -0.0231 438 LEU B N   
2407 C CA  . LEU B 111 ? 0.3607 0.4208 0.5261 0.0597  -0.1453 -0.0065 438 LEU B CA  
2408 C C   . LEU B 111 ? 0.3305 0.3894 0.5109 0.0419  -0.1222 0.0037  438 LEU B C   
2409 O O   . LEU B 111 ? 0.3149 0.3584 0.4689 0.0388  -0.1104 0.0194  438 LEU B O   
2410 C CB  . LEU B 111 ? 0.3548 0.4147 0.5084 0.0596  -0.1507 -0.0142 438 LEU B CB  
2411 C CG  . LEU B 111 ? 0.4040 0.4575 0.5235 0.0796  -0.1722 -0.0215 438 LEU B CG  
2412 C CD1 . LEU B 111 ? 0.4055 0.4601 0.5196 0.0769  -0.1750 -0.0319 438 LEU B CD1 
2413 C CD2 . LEU B 111 ? 0.4347 0.4618 0.4982 0.0920  -0.1688 -0.0025 438 LEU B CD2 
2414 N N   . PHE B 112 ? 0.3142 0.3883 0.5362 0.0311  -0.1158 -0.0058 439 PHE B N   
2415 C CA  . PHE B 112 ? 0.3098 0.3807 0.5418 0.0169  -0.0943 0.0033  439 PHE B CA  
2416 C C   . PHE B 112 ? 0.3159 0.3819 0.5449 0.0180  -0.0871 0.0122  439 PHE B C   
2417 O O   . PHE B 112 ? 0.3320 0.3860 0.5408 0.0122  -0.0746 0.0249  439 PHE B O   
2418 C CB  . PHE B 112 ? 0.2954 0.3788 0.5706 0.0065  -0.0862 -0.0080 439 PHE B CB  
2419 C CG  . PHE B 112 ? 0.2871 0.3645 0.5683 -0.0037 -0.0641 0.0017  439 PHE B CG  
2420 C CD1 . PHE B 112 ? 0.2736 0.3372 0.5296 -0.0093 -0.0520 0.0138  439 PHE B CD1 
2421 C CD2 . PHE B 112 ? 0.2846 0.3698 0.5935 -0.0057 -0.0557 -0.0011 439 PHE B CD2 
2422 C CE1 . PHE B 112 ? 0.2721 0.3284 0.5264 -0.0154 -0.0341 0.0226  439 PHE B CE1 
2423 C CE2 . PHE B 112 ? 0.2924 0.3686 0.5984 -0.0129 -0.0347 0.0083  439 PHE B CE2 
2424 C CZ  . PHE B 112 ? 0.2720 0.3328 0.5485 -0.0171 -0.0251 0.0203  439 PHE B CZ  
2425 N N   . GLU B 113 ? 0.3239 0.4002 0.5752 0.0258  -0.0957 0.0036  440 GLU B N   
2426 C CA  . GLU B 113 ? 0.3449 0.4165 0.5973 0.0280  -0.0887 0.0095  440 GLU B CA  
2427 C C   . GLU B 113 ? 0.3406 0.3903 0.5508 0.0344  -0.0903 0.0230  440 GLU B C   
2428 O O   . GLU B 113 ? 0.3526 0.3911 0.5528 0.0286  -0.0776 0.0318  440 GLU B O   
2429 C CB  . GLU B 113 ? 0.3817 0.4719 0.6712 0.0370  -0.0982 -0.0043 440 GLU B CB  
2430 C CG  . GLU B 113 ? 0.4119 0.5211 0.7491 0.0254  -0.0857 -0.0151 440 GLU B CG  
2431 C CD  . GLU B 113 ? 0.4743 0.6097 0.8597 0.0331  -0.0961 -0.0335 440 GLU B CD  
2432 O OE1 . GLU B 113 ? 0.5181 0.6558 0.8976 0.0501  -0.1129 -0.0362 440 GLU B OE1 
2433 O OE2 . GLU B 113 ? 0.4871 0.6408 0.9182 0.0228  -0.0876 -0.0460 440 GLU B OE2 
2434 N N   . SER B 114 ? 0.3497 0.3912 0.5339 0.0459  -0.1046 0.0241  441 SER B N   
2435 C CA  . SER B 114 ? 0.3793 0.3952 0.5214 0.0512  -0.1027 0.0382  441 SER B CA  
2436 C C   . SER B 114 ? 0.3804 0.3857 0.5029 0.0371  -0.0870 0.0494  441 SER B C   
2437 O O   . SER B 114 ? 0.3986 0.3851 0.4991 0.0351  -0.0789 0.0599  441 SER B O   
2438 C CB  . SER B 114 ? 0.4143 0.4207 0.5271 0.0679  -0.1190 0.0379  441 SER B CB  
2439 O OG  . SER B 114 ? 0.4461 0.4657 0.5777 0.0835  -0.1378 0.0251  441 SER B OG  
2440 N N   . ALA B 115 ? 0.3534 0.3707 0.4854 0.0282  -0.0832 0.0461  442 ALA B N   
2441 C CA  . ALA B 115 ? 0.3354 0.3473 0.4504 0.0181  -0.0715 0.0545  442 ALA B CA  
2442 C C   . ALA B 115 ? 0.3037 0.3224 0.4350 0.0062  -0.0594 0.0554  442 ALA B C   
2443 O O   . ALA B 115 ? 0.3043 0.3206 0.4243 -0.0008 -0.0511 0.0614  442 ALA B O   
2444 C CB  . ALA B 115 ? 0.3268 0.3442 0.4352 0.0198  -0.0762 0.0505  442 ALA B CB  
2445 N N   . PHE B 116 ? 0.2847 0.3122 0.4420 0.0051  -0.0579 0.0490  443 PHE B N   
2446 C CA  . PHE B 116 ? 0.2816 0.3127 0.4488 -0.0034 -0.0456 0.0500  443 PHE B CA  
2447 C C   . PHE B 116 ? 0.2910 0.3140 0.4403 -0.0086 -0.0380 0.0575  443 PHE B C   
2448 O O   . PHE B 116 ? 0.2803 0.3058 0.4235 -0.0133 -0.0329 0.0601  443 PHE B O   
2449 C CB  . PHE B 116 ? 0.2779 0.3159 0.4724 -0.0037 -0.0403 0.0436  443 PHE B CB  
2450 C CG  . PHE B 116 ? 0.2742 0.3079 0.4656 -0.0095 -0.0259 0.0477  443 PHE B CG  
2451 C CD1 . PHE B 116 ? 0.2659 0.2987 0.4526 -0.0138 -0.0182 0.0507  443 PHE B CD1 
2452 C CD2 . PHE B 116 ? 0.2752 0.3028 0.4631 -0.0083 -0.0205 0.0486  443 PHE B CD2 
2453 C CE1 . PHE B 116 ? 0.2641 0.2902 0.4400 -0.0154 -0.0068 0.0550  443 PHE B CE1 
2454 C CE2 . PHE B 116 ? 0.2614 0.2833 0.4395 -0.0112 -0.0088 0.0515  443 PHE B CE2 
2455 C CZ  . PHE B 116 ? 0.2660 0.2871 0.4364 -0.0141 -0.0025 0.0550  443 PHE B CZ  
2456 N N   . LEU B 117 ? 0.3017 0.3150 0.4436 -0.0070 -0.0384 0.0595  444 LEU B N   
2457 C CA  . LEU B 117 ? 0.3124 0.3184 0.4425 -0.0131 -0.0321 0.0627  444 LEU B CA  
2458 C C   . LEU B 117 ? 0.3020 0.3063 0.4177 -0.0179 -0.0318 0.0674  444 LEU B C   
2459 O O   . LEU B 117 ? 0.2956 0.3044 0.4091 -0.0242 -0.0279 0.0672  444 LEU B O   
2460 C CB  . LEU B 117 ? 0.3254 0.3186 0.4539 -0.0100 -0.0318 0.0619  444 LEU B CB  
2461 C CG  . LEU B 117 ? 0.3461 0.3342 0.4731 -0.0137 -0.0251 0.0590  444 LEU B CG  
2462 C CD1 . LEU B 117 ? 0.3120 0.3101 0.4440 -0.0152 -0.0190 0.0564  444 LEU B CD1 
2463 C CD2 . LEU B 117 ? 0.3522 0.3288 0.4831 -0.0068 -0.0252 0.0564  444 LEU B CD2 
2464 N N   . GLU B 118 ? 0.3236 0.3223 0.4297 -0.0138 -0.0358 0.0706  445 GLU B N   
2465 C CA  . GLU B 118 ? 0.3411 0.3399 0.4352 -0.0179 -0.0322 0.0750  445 GLU B CA  
2466 C C   . GLU B 118 ? 0.3235 0.3394 0.4250 -0.0206 -0.0309 0.0727  445 GLU B C   
2467 O O   . GLU B 118 ? 0.3128 0.3356 0.4148 -0.0267 -0.0261 0.0732  445 GLU B O   
2468 C CB  . GLU B 118 ? 0.3749 0.3625 0.4514 -0.0100 -0.0356 0.0792  445 GLU B CB  
2469 C CG  . GLU B 118 ? 0.4232 0.3891 0.4867 -0.0050 -0.0361 0.0836  445 GLU B CG  
2470 C CD  . GLU B 118 ? 0.5010 0.4494 0.5366 0.0045  -0.0373 0.0904  445 GLU B CD  
2471 O OE1 . GLU B 118 ? 0.5816 0.5111 0.6032 0.0154  -0.0423 0.0935  445 GLU B OE1 
2472 O OE2 . GLU B 118 ? 0.5022 0.4531 0.5264 0.0030  -0.0324 0.0933  445 GLU B OE2 
2473 N N   . LEU B 119 ? 0.3223 0.3447 0.4325 -0.0158 -0.0352 0.0689  446 LEU B N   
2474 C CA  . LEU B 119 ? 0.3095 0.3424 0.4245 -0.0164 -0.0333 0.0674  446 LEU B CA  
2475 C C   . LEU B 119 ? 0.2887 0.3261 0.4076 -0.0196 -0.0287 0.0672  446 LEU B C   
2476 O O   . LEU B 119 ? 0.2897 0.3350 0.4064 -0.0198 -0.0271 0.0677  446 LEU B O   
2477 C CB  . LEU B 119 ? 0.3156 0.3502 0.4407 -0.0119 -0.0374 0.0623  446 LEU B CB  
2478 C CG  . LEU B 119 ? 0.3387 0.3730 0.4569 -0.0067 -0.0437 0.0593  446 LEU B CG  
2479 C CD1 . LEU B 119 ? 0.3670 0.4052 0.4752 -0.0068 -0.0394 0.0616  446 LEU B CD1 
2480 C CD2 . LEU B 119 ? 0.3671 0.3934 0.4705 -0.0017 -0.0493 0.0612  446 LEU B CD2 
2481 N N   . PHE B 120 ? 0.2718 0.3043 0.3952 -0.0200 -0.0270 0.0659  447 PHE B N   
2482 C CA  . PHE B 120 ? 0.2606 0.2940 0.3806 -0.0206 -0.0232 0.0654  447 PHE B CA  
2483 C C   . PHE B 120 ? 0.2635 0.3030 0.3777 -0.0249 -0.0251 0.0644  447 PHE B C   
2484 O O   . PHE B 120 ? 0.2668 0.3146 0.3777 -0.0229 -0.0261 0.0631  447 PHE B O   
2485 C CB  . PHE B 120 ? 0.2716 0.2969 0.3943 -0.0201 -0.0200 0.0635  447 PHE B CB  
2486 C CG  . PHE B 120 ? 0.2882 0.3112 0.4003 -0.0192 -0.0168 0.0619  447 PHE B CG  
2487 C CD1 . PHE B 120 ? 0.2960 0.3166 0.4010 -0.0140 -0.0107 0.0638  447 PHE B CD1 
2488 C CD2 . PHE B 120 ? 0.2799 0.3000 0.3864 -0.0226 -0.0194 0.0581  447 PHE B CD2 
2489 C CE1 . PHE B 120 ? 0.3101 0.3262 0.3978 -0.0099 -0.0091 0.0622  447 PHE B CE1 
2490 C CE2 . PHE B 120 ? 0.2856 0.3038 0.3799 -0.0202 -0.0189 0.0541  447 PHE B CE2 
2491 C CZ  . PHE B 120 ? 0.3013 0.3179 0.3840 -0.0127 -0.0146 0.0562  447 PHE B CZ  
2492 N N   . VAL B 121 ? 0.2551 0.2901 0.3692 -0.0300 -0.0255 0.0646  448 VAL B N   
2493 C CA  . VAL B 121 ? 0.2591 0.2996 0.3748 -0.0372 -0.0250 0.0618  448 VAL B CA  
2494 C C   . VAL B 121 ? 0.2545 0.3097 0.3744 -0.0381 -0.0241 0.0625  448 VAL B C   
2495 O O   . VAL B 121 ? 0.2546 0.3251 0.3820 -0.0404 -0.0257 0.0574  448 VAL B O   
2496 C CB  . VAL B 121 ? 0.2633 0.2878 0.3769 -0.0431 -0.0218 0.0632  448 VAL B CB  
2497 C CG1 . VAL B 121 ? 0.2677 0.2972 0.3886 -0.0537 -0.0178 0.0597  448 VAL B CG1 
2498 C CG2 . VAL B 121 ? 0.2648 0.2761 0.3760 -0.0413 -0.0226 0.0605  448 VAL B CG2 
2499 N N   . LEU B 122 ? 0.2605 0.3124 0.3763 -0.0350 -0.0224 0.0673  449 LEU B N   
2500 C CA  . LEU B 122 ? 0.2720 0.3360 0.3900 -0.0347 -0.0194 0.0680  449 LEU B CA  
2501 C C   . LEU B 122 ? 0.2633 0.3427 0.3865 -0.0288 -0.0229 0.0648  449 LEU B C   
2502 O O   . LEU B 122 ? 0.2810 0.3777 0.4135 -0.0298 -0.0223 0.0612  449 LEU B O   
2503 C CB  . LEU B 122 ? 0.2836 0.3383 0.3904 -0.0295 -0.0183 0.0724  449 LEU B CB  
2504 C CG  . LEU B 122 ? 0.3022 0.3670 0.4077 -0.0277 -0.0132 0.0728  449 LEU B CG  
2505 C CD1 . LEU B 122 ? 0.3071 0.3761 0.4170 -0.0365 -0.0024 0.0741  449 LEU B CD1 
2506 C CD2 . LEU B 122 ? 0.3031 0.3567 0.3931 -0.0196 -0.0155 0.0746  449 LEU B CD2 
2507 N N   . ARG B 123 ? 0.2502 0.3224 0.3685 -0.0220 -0.0258 0.0659  450 ARG B N   
2508 C CA  . ARG B 123 ? 0.2307 0.3087 0.3476 -0.0140 -0.0274 0.0653  450 ARG B CA  
2509 C C   . ARG B 123 ? 0.2334 0.3198 0.3497 -0.0119 -0.0312 0.0618  450 ARG B C   
2510 O O   . ARG B 123 ? 0.2245 0.3227 0.3407 -0.0042 -0.0346 0.0599  450 ARG B O   
2511 C CB  . ARG B 123 ? 0.2299 0.2932 0.3428 -0.0095 -0.0257 0.0678  450 ARG B CB  
2512 C CG  . ARG B 123 ? 0.2318 0.2905 0.3465 -0.0086 -0.0253 0.0676  450 ARG B CG  
2513 C CD  . ARG B 123 ? 0.2221 0.2684 0.3421 -0.0088 -0.0245 0.0663  450 ARG B CD  
2514 N NE  . ARG B 123 ? 0.2371 0.2754 0.3568 -0.0059 -0.0188 0.0681  450 ARG B NE  
2515 C CZ  . ARG B 123 ? 0.2388 0.2689 0.3581 -0.0015 -0.0146 0.0687  450 ARG B CZ  
2516 N NH1 . ARG B 123 ? 0.2451 0.2760 0.3664 0.0005  -0.0171 0.0654  450 ARG B NH1 
2517 N NH2 . ARG B 123 ? 0.2284 0.2460 0.3429 0.0013  -0.0065 0.0725  450 ARG B NH2 
2518 N N   . LEU B 124 ? 0.2196 0.2994 0.3337 -0.0167 -0.0320 0.0599  451 LEU B N   
2519 C CA  . LEU B 124 ? 0.2234 0.3103 0.3342 -0.0145 -0.0378 0.0538  451 LEU B CA  
2520 C C   . LEU B 124 ? 0.2231 0.3324 0.3500 -0.0197 -0.0422 0.0460  451 LEU B C   
2521 O O   . LEU B 124 ? 0.2295 0.3547 0.3579 -0.0126 -0.0501 0.0397  451 LEU B O   
2522 C CB  . LEU B 124 ? 0.2303 0.3040 0.3358 -0.0192 -0.0368 0.0516  451 LEU B CB  
2523 C CG  . LEU B 124 ? 0.2357 0.3129 0.3340 -0.0170 -0.0436 0.0429  451 LEU B CG  
2524 C CD1 . LEU B 124 ? 0.2425 0.3177 0.3210 -0.0018 -0.0461 0.0453  451 LEU B CD1 
2525 C CD2 . LEU B 124 ? 0.2347 0.2954 0.3279 -0.0218 -0.0403 0.0407  451 LEU B CD2 
2526 N N   . ALA B 125 ? 0.2186 0.3285 0.3577 -0.0313 -0.0366 0.0460  452 ALA B N   
2527 C CA  . ALA B 125 ? 0.2169 0.3475 0.3773 -0.0396 -0.0359 0.0385  452 ALA B CA  
2528 C C   . ALA B 125 ? 0.2115 0.3640 0.3819 -0.0325 -0.0367 0.0373  452 ALA B C   
2529 O O   . ALA B 125 ? 0.2240 0.4022 0.4146 -0.0334 -0.0413 0.0272  452 ALA B O   
2530 C CB  . ALA B 125 ? 0.2086 0.3276 0.3742 -0.0525 -0.0249 0.0422  452 ALA B CB  
2531 N N   . TYR B 126 ? 0.2202 0.3639 0.3792 -0.0249 -0.0327 0.0457  453 TYR B N   
2532 C CA  . TYR B 126 ? 0.2249 0.3858 0.3912 -0.0164 -0.0323 0.0447  453 TYR B CA  
2533 C C   . TYR B 126 ? 0.2445 0.4168 0.4078 -0.0017 -0.0436 0.0405  453 TYR B C   
2534 O O   . TYR B 126 ? 0.2570 0.4538 0.4359 0.0041  -0.0473 0.0340  453 TYR B O   
2535 C CB  . TYR B 126 ? 0.2295 0.3735 0.3815 -0.0115 -0.0263 0.0530  453 TYR B CB  
2536 C CG  . TYR B 126 ? 0.2367 0.3941 0.3942 -0.0032 -0.0235 0.0519  453 TYR B CG  
2537 C CD1 . TYR B 126 ? 0.2387 0.4156 0.4140 -0.0088 -0.0154 0.0481  453 TYR B CD1 
2538 C CD2 . TYR B 126 ? 0.2437 0.3926 0.3895 0.0103  -0.0267 0.0544  453 TYR B CD2 
2539 C CE1 . TYR B 126 ? 0.2418 0.4322 0.4229 0.0003  -0.0115 0.0461  453 TYR B CE1 
2540 C CE2 . TYR B 126 ? 0.2482 0.4074 0.3983 0.0196  -0.0239 0.0526  453 TYR B CE2 
2541 C CZ  . TYR B 126 ? 0.2465 0.4277 0.4141 0.0153  -0.0170 0.0481  453 TYR B CZ  
2542 O OH  . TYR B 126 ? 0.2574 0.4490 0.4293 0.0257  -0.0129 0.0457  453 TYR B OH  
2543 N N   . ARG B 127 ? 0.2570 0.4104 0.3993 0.0050  -0.0479 0.0444  454 ARG B N   
2544 C CA  . ARG B 127 ? 0.2868 0.4379 0.4129 0.0224  -0.0558 0.0450  454 ARG B CA  
2545 C C   . ARG B 127 ? 0.2822 0.4512 0.4116 0.0264  -0.0686 0.0342  454 ARG B C   
2546 O O   . ARG B 127 ? 0.2926 0.4686 0.4118 0.0436  -0.0784 0.0317  454 ARG B O   
2547 C CB  . ARG B 127 ? 0.3197 0.4391 0.4216 0.0243  -0.0504 0.0539  454 ARG B CB  
2548 C CG  . ARG B 127 ? 0.3767 0.4774 0.4556 0.0405  -0.0488 0.0613  454 ARG B CG  
2549 C CD  . ARG B 127 ? 0.3735 0.4464 0.4452 0.0352  -0.0365 0.0698  454 ARG B CD  
2550 N NE  . ARG B 127 ? 0.3689 0.4356 0.4386 0.0267  -0.0349 0.0687  454 ARG B NE  
2551 C CZ  . ARG B 127 ? 0.3327 0.3883 0.4087 0.0163  -0.0279 0.0706  454 ARG B CZ  
2552 N NH1 . ARG B 127 ? 0.3231 0.3708 0.4080 0.0120  -0.0219 0.0733  454 ARG B NH1 
2553 N NH2 . ARG B 127 ? 0.3093 0.3626 0.3824 0.0116  -0.0284 0.0679  454 ARG B NH2 
2554 N N   . SER B 128 ? 0.2691 0.4423 0.4095 0.0122  -0.0695 0.0272  455 SER B N   
2555 C CA  . SER B 128 ? 0.2786 0.4633 0.4180 0.0154  -0.0829 0.0147  455 SER B CA  
2556 C C   . SER B 128 ? 0.2806 0.5047 0.4514 0.0159  -0.0944 -0.0012 455 SER B C   
2557 O O   . SER B 128 ? 0.2602 0.5028 0.4556 0.0121  -0.0887 -0.0017 455 SER B O   
2558 C CB  . SER B 128 ? 0.2821 0.4531 0.4219 0.0000  -0.0791 0.0117  455 SER B CB  
2559 O OG  . SER B 128 ? 0.2832 0.4227 0.3965 0.0024  -0.0709 0.0235  455 SER B OG  
2560 N N   . ASN B 129 ? 0.2915 0.5294 0.4622 0.0214  -0.1105 -0.0157 456 ASN B N   
2561 C CA  . ASN B 129 ? 0.3053 0.5855 0.5126 0.0212  -0.1241 -0.0353 456 ASN B CA  
2562 C C   . ASN B 129 ? 0.3121 0.5992 0.5405 0.0022  -0.1273 -0.0512 456 ASN B C   
2563 O O   . ASN B 129 ? 0.3232 0.6112 0.5376 0.0099  -0.1436 -0.0634 456 ASN B O   
2564 C CB  . ASN B 129 ? 0.3221 0.6179 0.5136 0.0488  -0.1453 -0.0426 456 ASN B CB  
2565 C CG  . ASN B 129 ? 0.3260 0.6727 0.5636 0.0509  -0.1600 -0.0638 456 ASN B CG  
2566 O OD1 . ASN B 129 ? 0.3157 0.6872 0.5990 0.0291  -0.1558 -0.0774 456 ASN B OD1 
2567 N ND2 . ASN B 129 ? 0.3386 0.7005 0.5653 0.0779  -0.1767 -0.0673 456 ASN B ND2 
2568 N N   . PRO B 130 ? 0.3124 0.6002 0.5707 -0.0217 -0.1109 -0.0508 457 PRO B N   
2569 C CA  . PRO B 130 ? 0.3273 0.6116 0.6039 -0.0424 -0.1088 -0.0631 457 PRO B CA  
2570 C C   . PRO B 130 ? 0.3499 0.6715 0.6609 -0.0448 -0.1276 -0.0909 457 PRO B C   
2571 O O   . PRO B 130 ? 0.3702 0.6838 0.6757 -0.0495 -0.1369 -0.1038 457 PRO B O   
2572 C CB  . PRO B 130 ? 0.3116 0.5884 0.6109 -0.0635 -0.0849 -0.0538 457 PRO B CB  
2573 C CG  . PRO B 130 ? 0.3071 0.6007 0.6140 -0.0545 -0.0792 -0.0456 457 PRO B CG  
2574 C CD  . PRO B 130 ? 0.2966 0.5825 0.5671 -0.0293 -0.0917 -0.0374 457 PRO B CD  
2575 N N   . VAL B 131 ? 0.3544 0.7175 0.7008 -0.0400 -0.1344 -0.1017 458 VAL B N   
2576 C CA  . VAL B 131 ? 0.3688 0.7766 0.7560 -0.0399 -0.1551 -0.1312 458 VAL B CA  
2577 C C   . VAL B 131 ? 0.4002 0.8063 0.7526 -0.0178 -0.1834 -0.1430 458 VAL B C   
2578 O O   . VAL B 131 ? 0.3988 0.8252 0.7726 -0.0226 -0.2010 -0.1690 458 VAL B O   
2579 C CB  . VAL B 131 ? 0.3665 0.8201 0.7928 -0.0312 -0.1585 -0.1380 458 VAL B CB  
2580 C CG1 . VAL B 131 ? 0.3672 0.8719 0.8337 -0.0242 -0.1862 -0.1704 458 VAL B CG1 
2581 C CG2 . VAL B 131 ? 0.3624 0.8222 0.8283 -0.0550 -0.1295 -0.1315 458 VAL B CG2 
2582 N N   . GLU B 132 ? 0.4094 0.7899 0.7072 0.0069  -0.1871 -0.1246 459 GLU B N   
2583 C CA  . GLU B 132 ? 0.4482 0.8201 0.7026 0.0309  -0.2104 -0.1322 459 GLU B CA  
2584 C C   . GLU B 132 ? 0.4469 0.7725 0.6578 0.0261  -0.2018 -0.1227 459 GLU B C   
2585 O O   . GLU B 132 ? 0.4864 0.7980 0.6550 0.0450  -0.2167 -0.1273 459 GLU B O   
2586 C CB  . GLU B 132 ? 0.4912 0.8610 0.7097 0.0635  -0.2193 -0.1193 459 GLU B CB  
2587 C CG  . GLU B 132 ? 0.5157 0.9347 0.7789 0.0717  -0.2307 -0.1319 459 GLU B CG  
2588 C CD  . GLU B 132 ? 0.5609 0.9835 0.7898 0.1091  -0.2489 -0.1279 459 GLU B CD  
2589 O OE1 . GLU B 132 ? 0.5977 0.9802 0.7751 0.1250  -0.2385 -0.1031 459 GLU B OE1 
2590 O OE2 . GLU B 132 ? 0.5979 1.0649 0.8555 0.1227  -0.2730 -0.1503 459 GLU B OE2 
2591 N N   . GLY B 133 ? 0.3964 0.6980 0.6162 0.0028  -0.1776 -0.1098 460 GLY B N   
2592 C CA  . GLY B 133 ? 0.3931 0.6517 0.5759 -0.0011 -0.1670 -0.0993 460 GLY B CA  
2593 C C   . GLY B 133 ? 0.3909 0.6183 0.5202 0.0201  -0.1610 -0.0767 460 GLY B C   
2594 O O   . GLY B 133 ? 0.4078 0.6063 0.4990 0.0269  -0.1597 -0.0736 460 GLY B O   
2595 N N   . LYS B 134 ? 0.3619 0.5935 0.4897 0.0299  -0.1552 -0.0616 461 LYS B N   
2596 C CA  . LYS B 134 ? 0.3640 0.5651 0.4460 0.0485  -0.1471 -0.0405 461 LYS B CA  
2597 C C   . LYS B 134 ? 0.3404 0.5183 0.4250 0.0354  -0.1235 -0.0204 461 LYS B C   
2598 O O   . LYS B 134 ? 0.3237 0.5146 0.4349 0.0276  -0.1164 -0.0156 461 LYS B O   
2599 C CB  . LYS B 134 ? 0.3770 0.5929 0.4488 0.0726  -0.1586 -0.0383 461 LYS B CB  
2600 C CG  . LYS B 134 ? 0.4079 0.6399 0.4606 0.0951  -0.1852 -0.0559 461 LYS B CG  
2601 C CD  . LYS B 134 ? 0.4200 0.6651 0.4647 0.1201  -0.1951 -0.0515 461 LYS B CD  
2602 C CE  . LYS B 134 ? 0.4724 0.7142 0.4719 0.1524  -0.2178 -0.0588 461 LYS B CE  
2603 N NZ  . LYS B 134 ? 0.4836 0.7700 0.5117 0.1562  -0.2473 -0.0895 461 LYS B NZ  
2604 N N   . LEU B 135 ? 0.3399 0.4852 0.3983 0.0334  -0.1120 -0.0109 462 LEU B N   
2605 C CA  . LEU B 135 ? 0.3312 0.4541 0.3889 0.0249  -0.0923 0.0065  462 LEU B CA  
2606 C C   . LEU B 135 ? 0.3521 0.4562 0.3800 0.0423  -0.0857 0.0216  462 LEU B C   
2607 O O   . LEU B 135 ? 0.3850 0.4744 0.3775 0.0591  -0.0890 0.0229  462 LEU B O   
2608 C CB  . LEU B 135 ? 0.3347 0.4361 0.3870 0.0137  -0.0833 0.0068  462 LEU B CB  
2609 C CG  . LEU B 135 ? 0.3362 0.4561 0.4245 -0.0049 -0.0872 -0.0057 462 LEU B CG  
2610 C CD1 . LEU B 135 ? 0.3589 0.4810 0.4472 -0.0090 -0.0976 -0.0240 462 LEU B CD1 
2611 C CD2 . LEU B 135 ? 0.2964 0.4109 0.4063 -0.0207 -0.0734 0.0033  462 LEU B CD2 
2612 N N   . ILE B 136 ? 0.3362 0.4386 0.3766 0.0387  -0.0760 0.0323  463 ILE B N   
2613 C CA  . ILE B 136 ? 0.3568 0.4414 0.3754 0.0530  -0.0689 0.0454  463 ILE B CA  
2614 C C   . ILE B 136 ? 0.3360 0.4003 0.3600 0.0421  -0.0516 0.0562  463 ILE B C   
2615 O O   . ILE B 136 ? 0.3233 0.3958 0.3717 0.0299  -0.0483 0.0566  463 ILE B O   
2616 C CB  . ILE B 136 ? 0.3431 0.4463 0.3707 0.0638  -0.0767 0.0448  463 ILE B CB  
2617 C CG1 . ILE B 136 ? 0.3672 0.4959 0.3940 0.0763  -0.0971 0.0306  463 ILE B CG1 
2618 C CG2 . ILE B 136 ? 0.3616 0.4389 0.3628 0.0794  -0.0679 0.0586  463 ILE B CG2 
2619 C CD1 . ILE B 136 ? 0.3558 0.5096 0.3982 0.0880  -0.1065 0.0269  463 ILE B CD1 
2620 N N   . PHE B 137 ? 0.3718 0.4097 0.3729 0.0471  -0.0403 0.0640  464 PHE B N   
2621 C CA  . PHE B 137 ? 0.3736 0.3943 0.3842 0.0369  -0.0241 0.0716  464 PHE B CA  
2622 C C   . PHE B 137 ? 0.3962 0.4040 0.4068 0.0411  -0.0144 0.0810  464 PHE B C   
2623 O O   . PHE B 137 ? 0.4061 0.4122 0.4017 0.0547  -0.0185 0.0840  464 PHE B O   
2624 C CB  . PHE B 137 ? 0.3745 0.3773 0.3683 0.0376  -0.0149 0.0723  464 PHE B CB  
2625 C CG  . PHE B 137 ? 0.3655 0.3805 0.3650 0.0309  -0.0249 0.0608  464 PHE B CG  
2626 C CD1 . PHE B 137 ? 0.3391 0.3592 0.3640 0.0161  -0.0231 0.0578  464 PHE B CD1 
2627 C CD2 . PHE B 137 ? 0.3782 0.3995 0.3584 0.0399  -0.0376 0.0519  464 PHE B CD2 
2628 C CE1 . PHE B 137 ? 0.3378 0.3648 0.3688 0.0091  -0.0307 0.0476  464 PHE B CE1 
2629 C CE2 . PHE B 137 ? 0.3782 0.4097 0.3677 0.0317  -0.0468 0.0391  464 PHE B CE2 
2630 C CZ  . PHE B 137 ? 0.3552 0.3877 0.3701 0.0156  -0.0420 0.0376  464 PHE B CZ  
2631 N N   . CYS B 138 ? 0.3884 0.3882 0.4175 0.0304  -0.0035 0.0838  465 CYS B N   
2632 C CA  . CYS B 138 ? 0.4274 0.4190 0.4647 0.0309  0.0027  0.0885  465 CYS B CA  
2633 C C   . CYS B 138 ? 0.4595 0.4237 0.4723 0.0429  0.0152  0.0978  465 CYS B C   
2634 O O   . CYS B 138 ? 0.4587 0.4139 0.4712 0.0477  0.0182  0.1015  465 CYS B O   
2635 C CB  . CYS B 138 ? 0.4220 0.4138 0.4868 0.0176  0.0084  0.0860  465 CYS B CB  
2636 S SG  . CYS B 138 ? 0.5294 0.5041 0.5996 0.0120  0.0253  0.0879  465 CYS B SG  
2637 N N   . ASN B 139 ? 0.4867 0.4346 0.4759 0.0490  0.0236  0.1021  466 ASN B N   
2638 C CA  . ASN B 139 ? 0.5510 0.4672 0.5073 0.0635  0.0374  0.1133  466 ASN B CA  
2639 C C   . ASN B 139 ? 0.5724 0.4891 0.4944 0.0846  0.0236  0.1151  466 ASN B C   
2640 O O   . ASN B 139 ? 0.5831 0.4699 0.4674 0.1015  0.0333  0.1256  466 ASN B O   
2641 C CB  . ASN B 139 ? 0.5971 0.4913 0.5375 0.0630  0.0563  0.1182  466 ASN B CB  
2642 C CG  . ASN B 139 ? 0.6356 0.5412 0.5591 0.0672  0.0459  0.1120  466 ASN B CG  
2643 O OD1 . ASN B 139 ? 0.6189 0.5519 0.5526 0.0652  0.0249  0.1020  466 ASN B OD1 
2644 N ND2 . ASN B 139 ? 0.6788 0.5618 0.5766 0.0727  0.0622  0.1170  466 ASN B ND2 
2645 N N   . GLY B 140 ? 0.5236 0.4731 0.4575 0.0849  0.0018  0.1046  467 GLY B N   
2646 C CA  . GLY B 140 ? 0.5167 0.4741 0.4250 0.1058  -0.0148 0.1025  467 GLY B CA  
2647 C C   . GLY B 140 ? 0.5057 0.4657 0.3871 0.1152  -0.0244 0.0968  467 GLY B C   
2648 O O   . GLY B 140 ? 0.5344 0.5039 0.3955 0.1337  -0.0414 0.0922  467 GLY B O   
2649 N N   . VAL B 141 ? 0.4885 0.4407 0.3694 0.1043  -0.0148 0.0956  468 VAL B N   
2650 C CA  . VAL B 141 ? 0.4980 0.4531 0.3554 0.1110  -0.0242 0.0871  468 VAL B CA  
2651 C C   . VAL B 141 ? 0.4598 0.4534 0.3432 0.1043  -0.0481 0.0693  468 VAL B C   
2652 O O   . VAL B 141 ? 0.4196 0.4327 0.3426 0.0851  -0.0493 0.0639  468 VAL B O   
2653 C CB  . VAL B 141 ? 0.5067 0.4430 0.3597 0.1010  -0.0055 0.0895  468 VAL B CB  
2654 C CG1 . VAL B 141 ? 0.5109 0.4551 0.3483 0.1038  -0.0175 0.0764  468 VAL B CG1 
2655 C CG2 . VAL B 141 ? 0.5531 0.4488 0.3694 0.1128  0.0188  0.1056  468 VAL B CG2 
2656 N N   . VAL B 142 ? 0.4846 0.4877 0.3445 0.1214  -0.0669 0.0601  469 VAL B N   
2657 C CA  . VAL B 142 ? 0.4654 0.5061 0.3520 0.1154  -0.0899 0.0402  469 VAL B CA  
2658 C C   . VAL B 142 ? 0.4781 0.5146 0.3475 0.1146  -0.0954 0.0284  469 VAL B C   
2659 O O   . VAL B 142 ? 0.5184 0.5340 0.3411 0.1339  -0.0965 0.0300  469 VAL B O   
2660 C CB  . VAL B 142 ? 0.4780 0.5414 0.3602 0.1356  -0.1122 0.0326  469 VAL B CB  
2661 C CG1 . VAL B 142 ? 0.4524 0.5587 0.3740 0.1252  -0.1334 0.0099  469 VAL B CG1 
2662 C CG2 . VAL B 142 ? 0.4657 0.5279 0.3590 0.1398  -0.1052 0.0448  469 VAL B CG2 
2663 N N   . LEU B 143 ? 0.4579 0.5124 0.3635 0.0931  -0.0986 0.0164  470 LEU B N   
2664 C CA  . LEU B 143 ? 0.4740 0.5267 0.3714 0.0891  -0.1051 0.0017  470 LEU B CA  
2665 C C   . LEU B 143 ? 0.4623 0.5497 0.4006 0.0751  -0.1235 -0.0192 470 LEU B C   
2666 O O   . LEU B 143 ? 0.4504 0.5568 0.4305 0.0590  -0.1209 -0.0183 470 LEU B O   
2667 C CB  . LEU B 143 ? 0.4517 0.4822 0.3540 0.0740  -0.0837 0.0094  470 LEU B CB  
2668 C CG  . LEU B 143 ? 0.4781 0.4745 0.3484 0.0831  -0.0606 0.0278  470 LEU B CG  
2669 C CD1 . LEU B 143 ? 0.4562 0.4409 0.3470 0.0662  -0.0417 0.0327  470 LEU B CD1 
2670 C CD2 . LEU B 143 ? 0.5295 0.5056 0.3444 0.1056  -0.0632 0.0253  470 LEU B CD2 
2671 N N   . HIS B 144 ? 0.4848 0.5796 0.4113 0.0809  -0.1409 -0.0388 471 HIS B N   
2672 C CA  . HIS B 144 ? 0.4869 0.6126 0.4566 0.0645  -0.1563 -0.0614 471 HIS B CA  
2673 C C   . HIS B 144 ? 0.4818 0.5962 0.4771 0.0391  -0.1417 -0.0621 471 HIS B C   
2674 O O   . HIS B 144 ? 0.4771 0.5615 0.4477 0.0394  -0.1277 -0.0539 471 HIS B O   
2675 C CB  . HIS B 144 ? 0.5245 0.6618 0.4755 0.0783  -0.1817 -0.0860 471 HIS B CB  
2676 C CG  . HIS B 144 ? 0.5177 0.6954 0.5204 0.0639  -0.2007 -0.1120 471 HIS B CG  
2677 N ND1 . HIS B 144 ? 0.5042 0.6842 0.5384 0.0401  -0.1994 -0.1282 471 HIS B ND1 
2678 C CD2 . HIS B 144 ? 0.5177 0.7353 0.5501 0.0693  -0.2196 -0.1250 471 HIS B CD2 
2679 C CE1 . HIS B 144 ? 0.5089 0.7276 0.5908 0.0297  -0.2155 -0.1504 471 HIS B CE1 
2680 N NE2 . HIS B 144 ? 0.5116 0.7563 0.5953 0.0472  -0.2284 -0.1495 471 HIS B NE2 
2681 N N   . ARG B 145 ? 0.4748 0.6124 0.5189 0.0184  -0.1441 -0.0721 472 ARG B N   
2682 C CA  . ARG B 145 ? 0.4889 0.6153 0.5577 -0.0048 -0.1327 -0.0754 472 ARG B CA  
2683 C C   . ARG B 145 ? 0.5102 0.6150 0.5553 -0.0033 -0.1360 -0.0881 472 ARG B C   
2684 O O   . ARG B 145 ? 0.4904 0.5686 0.5297 -0.0109 -0.1205 -0.0800 472 ARG B O   
2685 C CB  . ARG B 145 ? 0.5048 0.6602 0.6259 -0.0247 -0.1373 -0.0895 472 ARG B CB  
2686 C CG  . ARG B 145 ? 0.5296 0.6672 0.6735 -0.0482 -0.1214 -0.0881 472 ARG B CG  
2687 C CD  . ARG B 145 ? 0.5438 0.7050 0.7389 -0.0699 -0.1217 -0.1029 472 ARG B CD  
2688 N NE  . ARG B 145 ? 0.5807 0.7648 0.7941 -0.0724 -0.1419 -0.1326 472 ARG B NE  
2689 C CZ  . ARG B 145 ? 0.6321 0.8002 0.8415 -0.0792 -0.1471 -0.1502 472 ARG B CZ  
2690 N NH1 . ARG B 145 ? 0.6689 0.7970 0.8543 -0.0823 -0.1331 -0.1399 472 ARG B NH1 
2691 N NH2 . ARG B 145 ? 0.6255 0.8184 0.8542 -0.0808 -0.1681 -0.1800 472 ARG B NH2 
2692 N N   . LEU B 146 ? 0.5367 0.6531 0.5659 0.0091  -0.1570 -0.1086 473 LEU B N   
2693 C CA  . LEU B 146 ? 0.5781 0.6748 0.5804 0.0134  -0.1624 -0.1237 473 LEU B CA  
2694 C C   . LEU B 146 ? 0.6018 0.6636 0.5517 0.0305  -0.1479 -0.1066 473 LEU B C   
2695 O O   . LEU B 146 ? 0.6141 0.6518 0.5472 0.0290  -0.1414 -0.1124 473 LEU B O   
2696 C CB  . LEU B 146 ? 0.6227 0.7430 0.6211 0.0238  -0.1913 -0.1522 473 LEU B CB  
2697 C CG  . LEU B 146 ? 0.6399 0.7780 0.6858 0.0009  -0.2026 -0.1812 473 LEU B CG  
2698 C CD1 . LEU B 146 ? 0.6013 0.7472 0.7036 -0.0281 -0.1862 -0.1750 473 LEU B CD1 
2699 C CD2 . LEU B 146 ? 0.6638 0.8396 0.7213 0.0108  -0.2344 -0.2103 473 LEU B CD2 
2700 N N   . GLN B 147 ? 0.5860 0.6441 0.5129 0.0459  -0.1406 -0.0860 474 GLN B N   
2701 C CA  . GLN B 147 ? 0.5962 0.6217 0.4828 0.0581  -0.1206 -0.0674 474 GLN B CA  
2702 C C   . GLN B 147 ? 0.5633 0.5751 0.4748 0.0410  -0.0975 -0.0520 474 GLN B C   
2703 O O   . GLN B 147 ? 0.5771 0.5641 0.4690 0.0444  -0.0816 -0.0454 474 GLN B O   
2704 C CB  . GLN B 147 ? 0.5995 0.6212 0.4566 0.0779  -0.1171 -0.0499 474 GLN B CB  
2705 C CG  . GLN B 147 ? 0.6427 0.6685 0.4584 0.1033  -0.1376 -0.0605 474 GLN B CG  
2706 C CD  . GLN B 147 ? 0.6636 0.6791 0.4514 0.1219  -0.1297 -0.0390 474 GLN B CD  
2707 O OE1 . GLN B 147 ? 0.6404 0.6764 0.4562 0.1190  -0.1343 -0.0332 474 GLN B OE1 
2708 N NE2 . GLN B 147 ? 0.6846 0.6654 0.4181 0.1403  -0.1143 -0.0259 474 GLN B NE2 
2709 N N   . CYS B 148 ? 0.5312 0.5599 0.4854 0.0244  -0.0960 -0.0468 475 CYS B N   
2710 C CA  . CYS B 148 ? 0.4897 0.5076 0.4654 0.0115  -0.0774 -0.0317 475 CYS B CA  
2711 C C   . CYS B 148 ? 0.4936 0.4983 0.4835 -0.0018 -0.0731 -0.0403 475 CYS B C   
2712 O O   . CYS B 148 ? 0.4812 0.4699 0.4748 -0.0048 -0.0582 -0.0295 475 CYS B O   
2713 C CB  . CYS B 148 ? 0.4478 0.4849 0.4557 0.0017  -0.0772 -0.0231 475 CYS B CB  
2714 S SG  . CYS B 148 ? 0.4728 0.5162 0.4641 0.0180  -0.0758 -0.0076 475 CYS B SG  
2715 N N   . VAL B 149 ? 0.5160 0.5269 0.5139 -0.0084 -0.0867 -0.0611 476 VAL B N   
2716 C CA  . VAL B 149 ? 0.5438 0.5386 0.5532 -0.0208 -0.0839 -0.0725 476 VAL B CA  
2717 C C   . VAL B 149 ? 0.5700 0.5365 0.5524 -0.0113 -0.0715 -0.0688 476 VAL B C   
2718 O O   . VAL B 149 ? 0.5591 0.5084 0.5537 -0.0188 -0.0597 -0.0636 476 VAL B O   
2719 C CB  . VAL B 149 ? 0.5639 0.5725 0.5855 -0.0279 -0.1029 -0.0993 476 VAL B CB  
2720 C CG1 . VAL B 149 ? 0.6173 0.6036 0.6213 -0.0266 -0.1055 -0.1174 476 VAL B CG1 
2721 C CG2 . VAL B 149 ? 0.5448 0.5676 0.6127 -0.0499 -0.1022 -0.1022 476 VAL B CG2 
2722 N N   . ARG B 150 ? 0.6223 0.5831 0.5663 0.0070  -0.0726 -0.0700 477 ARG B N   
2723 C CA  . ARG B 150 ? 0.6459 0.5811 0.5624 0.0176  -0.0584 -0.0677 477 ARG B CA  
2724 C C   . ARG B 150 ? 0.5902 0.5173 0.5174 0.0175  -0.0373 -0.0464 477 ARG B C   
2725 O O   . ARG B 150 ? 0.5960 0.5059 0.5229 0.0185  -0.0252 -0.0463 477 ARG B O   
2726 C CB  . ARG B 150 ? 0.7300 0.6595 0.5979 0.0386  -0.0628 -0.0730 477 ARG B CB  
2727 C CG  . ARG B 150 ? 0.8141 0.7473 0.6655 0.0425  -0.0851 -0.0995 477 ARG B CG  
2728 C CD  . ARG B 150 ? 0.8947 0.8288 0.6973 0.0663  -0.0943 -0.1008 477 ARG B CD  
2729 N NE  . ARG B 150 ? 0.9894 0.9010 0.7450 0.0821  -0.0955 -0.1158 477 ARG B NE  
2730 C CZ  . ARG B 150 ? 1.0618 0.9669 0.7632 0.1062  -0.1051 -0.1214 477 ARG B CZ  
2731 N NH1 . ARG B 150 ? 1.0578 0.9764 0.7442 0.1191  -0.1149 -0.1126 477 ARG B NH1 
2732 N NH2 . ARG B 150 ? 1.1476 1.0298 0.8054 0.1199  -0.1049 -0.1362 477 ARG B NH2 
2733 N N   . GLY B 151 ? 0.5416 0.4822 0.4807 0.0166  -0.0338 -0.0304 478 GLY B N   
2734 C CA  . GLY B 151 ? 0.5126 0.4493 0.4656 0.0163  -0.0163 -0.0131 478 GLY B CA  
2735 C C   . GLY B 151 ? 0.4962 0.4386 0.4864 0.0019  -0.0170 -0.0085 478 GLY B C   
2736 O O   . GLY B 151 ? 0.4870 0.4203 0.4904 0.0010  -0.0068 -0.0037 478 GLY B O   
2737 N N   . PHE B 152 ? 0.4701 0.4275 0.4761 -0.0077 -0.0289 -0.0105 479 PHE B N   
2738 C CA  . PHE B 152 ? 0.4495 0.4116 0.4846 -0.0199 -0.0285 -0.0036 479 PHE B CA  
2739 C C   . PHE B 152 ? 0.4455 0.3939 0.4916 -0.0304 -0.0305 -0.0132 479 PHE B C   
2740 O O   . PHE B 152 ? 0.4373 0.3799 0.4999 -0.0375 -0.0267 -0.0060 479 PHE B O   
2741 C CB  . PHE B 152 ? 0.4294 0.4135 0.4757 -0.0251 -0.0373 -0.0015 479 PHE B CB  
2742 C CG  . PHE B 152 ? 0.4290 0.4224 0.4708 -0.0171 -0.0334 0.0111  479 PHE B CG  
2743 C CD1 . PHE B 152 ? 0.4073 0.4073 0.4673 -0.0220 -0.0299 0.0220  479 PHE B CD1 
2744 C CD2 . PHE B 152 ? 0.4545 0.4471 0.4708 -0.0038 -0.0328 0.0120  479 PHE B CD2 
2745 C CE1 . PHE B 152 ? 0.4153 0.4216 0.4726 -0.0155 -0.0262 0.0318  479 PHE B CE1 
2746 C CE2 . PHE B 152 ? 0.4413 0.4371 0.4533 0.0028  -0.0269 0.0242  479 PHE B CE2 
2747 C CZ  . PHE B 152 ? 0.4144 0.4175 0.4494 -0.0039 -0.0238 0.0332  479 PHE B CZ  
2748 N N   . GLY B 153 ? 0.4618 0.4037 0.4970 -0.0309 -0.0370 -0.0297 480 GLY B N   
2749 C CA  . GLY B 153 ? 0.4798 0.4088 0.5284 -0.0437 -0.0394 -0.0409 480 GLY B CA  
2750 C C   . GLY B 153 ? 0.4700 0.4165 0.5427 -0.0583 -0.0455 -0.0430 480 GLY B C   
2751 O O   . GLY B 153 ? 0.4287 0.3995 0.5057 -0.0566 -0.0506 -0.0385 480 GLY B O   
2752 N N   . GLU B 154 ? 0.4840 0.4163 0.5733 -0.0728 -0.0430 -0.0501 481 GLU B N   
2753 C CA  . GLU B 154 ? 0.4907 0.4360 0.6075 -0.0897 -0.0441 -0.0538 481 GLU B CA  
2754 C C   . GLU B 154 ? 0.4529 0.4083 0.5796 -0.0916 -0.0366 -0.0346 481 GLU B C   
2755 O O   . GLU B 154 ? 0.4463 0.4212 0.5938 -0.1018 -0.0375 -0.0370 481 GLU B O   
2756 C CB  . GLU B 154 ? 0.5584 0.4782 0.6892 -0.1055 -0.0381 -0.0644 481 GLU B CB  
2757 C CG  . GLU B 154 ? 0.6338 0.5578 0.7693 -0.1112 -0.0504 -0.0919 481 GLU B CG  
2758 C CD  . GLU B 154 ? 0.7019 0.5965 0.8534 -0.1286 -0.0431 -0.1041 481 GLU B CD  
2759 O OE1 . GLU B 154 ? 0.7484 0.6251 0.8883 -0.1261 -0.0482 -0.1211 481 GLU B OE1 
2760 O OE2 . GLU B 154 ? 0.7449 0.6313 0.9188 -0.1443 -0.0305 -0.0965 481 GLU B OE2 
2761 N N   . TRP B 155 ? 0.4249 0.3694 0.5381 -0.0808 -0.0299 -0.0174 482 TRP B N   
2762 C CA  . TRP B 155 ? 0.3995 0.3567 0.5153 -0.0771 -0.0265 -0.0011 482 TRP B CA  
2763 C C   . TRP B 155 ? 0.3901 0.3801 0.5138 -0.0769 -0.0342 -0.0040 482 TRP B C   
2764 O O   . TRP B 155 ? 0.3925 0.3942 0.5285 -0.0820 -0.0307 0.0031  482 TRP B O   
2765 C CB  . TRP B 155 ? 0.3670 0.3162 0.4679 -0.0622 -0.0236 0.0104  482 TRP B CB  
2766 C CG  . TRP B 155 ? 0.3443 0.3029 0.4475 -0.0577 -0.0213 0.0247  482 TRP B CG  
2767 C CD1 . TRP B 155 ? 0.3383 0.2968 0.4483 -0.0640 -0.0175 0.0328  482 TRP B CD1 
2768 C CD2 . TRP B 155 ? 0.3195 0.2872 0.4177 -0.0461 -0.0216 0.0317  482 TRP B CD2 
2769 N NE1 . TRP B 155 ? 0.3167 0.2839 0.4242 -0.0557 -0.0179 0.0430  482 TRP B NE1 
2770 C CE2 . TRP B 155 ? 0.3103 0.2840 0.4137 -0.0460 -0.0206 0.0419  482 TRP B CE2 
2771 C CE3 . TRP B 155 ? 0.3069 0.2762 0.3969 -0.0365 -0.0207 0.0299  482 TRP B CE3 
2772 C CZ2 . TRP B 155 ? 0.2991 0.2814 0.4033 -0.0376 -0.0208 0.0483  482 TRP B CZ2 
2773 C CZ3 . TRP B 155 ? 0.2978 0.2751 0.3902 -0.0294 -0.0180 0.0377  482 TRP B CZ3 
2774 C CH2 . TRP B 155 ? 0.2912 0.2755 0.3925 -0.0305 -0.0191 0.0458  482 TRP B CH2 
2775 N N   . ILE B 156 ? 0.3932 0.3965 0.5075 -0.0691 -0.0444 -0.0145 483 ILE B N   
2776 C CA  . ILE B 156 ? 0.3734 0.4058 0.4924 -0.0649 -0.0532 -0.0171 483 ILE B CA  
2777 C C   . ILE B 156 ? 0.3613 0.4138 0.5102 -0.0794 -0.0565 -0.0280 483 ILE B C   
2778 O O   . ILE B 156 ? 0.3442 0.4179 0.5053 -0.0792 -0.0568 -0.0234 483 ILE B O   
2779 C CB  . ILE B 156 ? 0.3957 0.4346 0.4910 -0.0494 -0.0635 -0.0240 483 ILE B CB  
2780 C CG1 . ILE B 156 ? 0.3808 0.4419 0.4737 -0.0393 -0.0689 -0.0180 483 ILE B CG1 
2781 C CG2 . ILE B 156 ? 0.4127 0.4556 0.5082 -0.0521 -0.0759 -0.0463 483 ILE B CG2 
2782 C CD1 . ILE B 156 ? 0.3688 0.4224 0.4556 -0.0338 -0.0579 0.0013  483 ILE B CD1 
2783 N N   . ASP B 157 ? 0.3727 0.4172 0.5357 -0.0927 -0.0567 -0.0424 484 ASP B N   
2784 C CA  . ASP B 157 ? 0.3766 0.4372 0.5750 -0.1105 -0.0551 -0.0534 484 ASP B CA  
2785 C C   . ASP B 157 ? 0.3602 0.4150 0.5705 -0.1194 -0.0380 -0.0369 484 ASP B C   
2786 O O   . ASP B 157 ? 0.3453 0.4257 0.5802 -0.1260 -0.0363 -0.0394 484 ASP B O   
2787 C CB  . ASP B 157 ? 0.4114 0.4570 0.6230 -0.1249 -0.0554 -0.0720 484 ASP B CB  
2788 C CG  . ASP B 157 ? 0.4390 0.4973 0.6432 -0.1173 -0.0753 -0.0945 484 ASP B CG  
2789 O OD1 . ASP B 157 ? 0.4298 0.5118 0.6217 -0.1016 -0.0891 -0.0965 484 ASP B OD1 
2790 O OD2 . ASP B 157 ? 0.4918 0.5333 0.7004 -0.1264 -0.0771 -0.1111 484 ASP B OD2 
2791 N N   . SER B 158 ? 0.3649 0.3873 0.5567 -0.1176 -0.0260 -0.0206 485 SER B N   
2792 C CA  . SER B 158 ? 0.3733 0.3878 0.5657 -0.1207 -0.0115 -0.0032 485 SER B CA  
2793 C C   . SER B 158 ? 0.3353 0.3745 0.5242 -0.1096 -0.0153 0.0056  485 SER B C   
2794 O O   . SER B 158 ? 0.3267 0.3773 0.5283 -0.1149 -0.0069 0.0105  485 SER B O   
2795 C CB  . SER B 158 ? 0.4018 0.3786 0.5697 -0.1147 -0.0030 0.0117  485 SER B CB  
2796 O OG  . SER B 158 ? 0.4630 0.4127 0.6338 -0.1248 0.0026  0.0044  485 SER B OG  
2797 N N   . ILE B 159 ? 0.3186 0.3636 0.4897 -0.0942 -0.0259 0.0074  486 ILE B N   
2798 C CA  . ILE B 159 ? 0.3011 0.3653 0.4677 -0.0830 -0.0296 0.0148  486 ILE B CA  
2799 C C   . ILE B 159 ? 0.2937 0.3919 0.4831 -0.0858 -0.0354 0.0044  486 ILE B C   
2800 O O   . ILE B 159 ? 0.2948 0.4063 0.4916 -0.0845 -0.0305 0.0107  486 ILE B O   
2801 C CB  . ILE B 159 ? 0.2988 0.3582 0.4428 -0.0674 -0.0367 0.0182  486 ILE B CB  
2802 C CG1 . ILE B 159 ? 0.2989 0.3316 0.4284 -0.0636 -0.0299 0.0290  486 ILE B CG1 
2803 C CG2 . ILE B 159 ? 0.2763 0.3537 0.4168 -0.0563 -0.0406 0.0234  486 ILE B CG2 
2804 C CD1 . ILE B 159 ? 0.2975 0.3228 0.4104 -0.0520 -0.0329 0.0289  486 ILE B CD1 
2805 N N   . VAL B 160 ? 0.2977 0.4107 0.4992 -0.0887 -0.0461 -0.0129 487 VAL B N   
2806 C CA  . VAL B 160 ? 0.3103 0.4600 0.5367 -0.0886 -0.0557 -0.0263 487 VAL B CA  
2807 C C   . VAL B 160 ? 0.3177 0.4805 0.5790 -0.1059 -0.0427 -0.0290 487 VAL B C   
2808 O O   . VAL B 160 ? 0.2998 0.4906 0.5800 -0.1037 -0.0425 -0.0304 487 VAL B O   
2809 C CB  . VAL B 160 ? 0.3182 0.4801 0.5476 -0.0861 -0.0734 -0.0474 487 VAL B CB  
2810 C CG1 . VAL B 160 ? 0.3205 0.5240 0.5864 -0.0895 -0.0846 -0.0665 487 VAL B CG1 
2811 C CG2 . VAL B 160 ? 0.3246 0.4768 0.5152 -0.0650 -0.0840 -0.0427 487 VAL B CG2 
2812 N N   . GLU B 161 ? 0.3448 0.4847 0.6136 -0.1225 -0.0300 -0.0292 488 GLU B N   
2813 C CA  . GLU B 161 ? 0.3531 0.4954 0.6508 -0.1408 -0.0114 -0.0290 488 GLU B CA  
2814 C C   . GLU B 161 ? 0.3233 0.4609 0.6076 -0.1346 0.0021  -0.0093 488 GLU B C   
2815 O O   . GLU B 161 ? 0.3089 0.4702 0.6174 -0.1394 0.0105  -0.0112 488 GLU B O   
2816 C CB  . GLU B 161 ? 0.4068 0.5134 0.7038 -0.1564 0.0009  -0.0293 488 GLU B CB  
2817 C CG  . GLU B 161 ? 0.4745 0.5629 0.7830 -0.1724 0.0270  -0.0196 488 GLU B CG  
2818 C CD  . GLU B 161 ? 0.5535 0.6094 0.8697 -0.1898 0.0376  -0.0261 488 GLU B CD  
2819 O OE1 . GLU B 161 ? 0.6033 0.6328 0.8948 -0.1833 0.0288  -0.0261 488 GLU B OE1 
2820 O OE2 . GLU B 161 ? 0.5584 0.6140 0.9062 -0.2102 0.0561  -0.0316 488 GLU B OE2 
2821 N N   . PHE B 162 ? 0.3072 0.4162 0.5545 -0.1231 0.0034  0.0076  489 PHE B N   
2822 C CA  . PHE B 162 ? 0.2994 0.4026 0.5295 -0.1147 0.0122  0.0239  489 PHE B CA  
2823 C C   . PHE B 162 ? 0.2871 0.4233 0.5244 -0.1028 0.0032  0.0212  489 PHE B C   
2824 O O   . PHE B 162 ? 0.2762 0.4214 0.5181 -0.1021 0.0135  0.0266  489 PHE B O   
2825 C CB  . PHE B 162 ? 0.3053 0.3771 0.4991 -0.1029 0.0097  0.0376  489 PHE B CB  
2826 C CG  . PHE B 162 ? 0.2993 0.3642 0.4739 -0.0933 0.0155  0.0515  489 PHE B CG  
2827 C CD1 . PHE B 162 ? 0.3204 0.3668 0.4867 -0.0986 0.0328  0.0612  489 PHE B CD1 
2828 C CD2 . PHE B 162 ? 0.2721 0.3459 0.4349 -0.0787 0.0048  0.0543  489 PHE B CD2 
2829 C CE1 . PHE B 162 ? 0.3283 0.3674 0.4723 -0.0877 0.0365  0.0723  489 PHE B CE1 
2830 C CE2 . PHE B 162 ? 0.2815 0.3488 0.4274 -0.0699 0.0085  0.0640  489 PHE B CE2 
2831 C CZ  . PHE B 162 ? 0.3065 0.3578 0.4421 -0.0735 0.0228  0.0722  489 PHE B CZ  
2832 N N   . SER B 163 ? 0.2784 0.4283 0.5122 -0.0920 -0.0147 0.0135  490 SER B N   
2833 C CA  . SER B 163 ? 0.2721 0.4502 0.5113 -0.0789 -0.0247 0.0098  490 SER B CA  
2834 C C   . SER B 163 ? 0.2862 0.4996 0.5640 -0.0863 -0.0210 -0.0017 490 SER B C   
2835 O O   . SER B 163 ? 0.2849 0.5134 0.5684 -0.0798 -0.0160 0.0021  490 SER B O   
2836 C CB  . SER B 163 ? 0.2692 0.4520 0.4961 -0.0666 -0.0434 0.0023  490 SER B CB  
2837 O OG  . SER B 163 ? 0.2723 0.4763 0.4980 -0.0505 -0.0530 0.0009  490 SER B OG  
2838 N N   . SER B 164 ? 0.2963 0.5223 0.6027 -0.1004 -0.0226 -0.0171 491 SER B N   
2839 C CA  . SER B 164 ? 0.3222 0.5842 0.6753 -0.1114 -0.0181 -0.0321 491 SER B CA  
2840 C C   . SER B 164 ? 0.3396 0.5964 0.7014 -0.1210 0.0074  -0.0210 491 SER B C   
2841 O O   . SER B 164 ? 0.3297 0.6157 0.7126 -0.1167 0.0118  -0.0239 491 SER B O   
2842 C CB  . SER B 164 ? 0.3272 0.5930 0.7077 -0.1292 -0.0210 -0.0501 491 SER B CB  
2843 O OG  . SER B 164 ? 0.3729 0.6831 0.8030 -0.1358 -0.0252 -0.0705 491 SER B OG  
2844 N N   . ASN B 165 ? 0.3682 0.5864 0.7104 -0.1316 0.0246  -0.0080 492 ASN B N   
2845 C CA  . ASN B 165 ? 0.3826 0.5871 0.7204 -0.1376 0.0505  0.0053  492 ASN B CA  
2846 C C   . ASN B 165 ? 0.3612 0.5658 0.6723 -0.1191 0.0501  0.0179  492 ASN B C   
2847 O O   . ASN B 165 ? 0.3547 0.5716 0.6763 -0.1197 0.0661  0.0205  492 ASN B O   
2848 C CB  . ASN B 165 ? 0.4380 0.5953 0.7514 -0.1480 0.0669  0.0181  492 ASN B CB  
2849 C CG  . ASN B 165 ? 0.4854 0.6387 0.8288 -0.1691 0.0723  0.0050  492 ASN B CG  
2850 O OD1 . ASN B 165 ? 0.5446 0.6614 0.8674 -0.1732 0.0738  0.0101  492 ASN B OD1 
2851 N ND2 . ASN B 165 ? 0.4775 0.6689 0.8716 -0.1819 0.0742  -0.0137 492 ASN B ND2 
2852 N N   . LEU B 166 ? 0.3346 0.5263 0.6139 -0.1031 0.0330  0.0240  493 LEU B N   
2853 C CA  . LEU B 166 ? 0.3415 0.5299 0.5961 -0.0865 0.0313  0.0339  493 LEU B CA  
2854 C C   . LEU B 166 ? 0.3396 0.5667 0.6185 -0.0775 0.0261  0.0246  493 LEU B C   
2855 O O   . LEU B 166 ? 0.3342 0.5673 0.6113 -0.0718 0.0365  0.0288  493 LEU B O   
2856 C CB  . LEU B 166 ? 0.3163 0.4826 0.5384 -0.0742 0.0159  0.0405  493 LEU B CB  
2857 C CG  . LEU B 166 ? 0.3136 0.4654 0.5069 -0.0598 0.0142  0.0508  493 LEU B CG  
2858 C CD1 . LEU B 166 ? 0.3144 0.4390 0.4847 -0.0619 0.0278  0.0620  493 LEU B CD1 
2859 C CD2 . LEU B 166 ? 0.3029 0.4417 0.4789 -0.0510 -0.0007 0.0524  493 LEU B CD2 
2860 N N   . GLN B 167 ? 0.3602 0.6130 0.6604 -0.0747 0.0093  0.0111  494 GLN B N   
2861 C CA  . GLN B 167 ? 0.3815 0.6714 0.7039 -0.0624 0.0000  0.0011  494 GLN B CA  
2862 C C   . GLN B 167 ? 0.3948 0.7187 0.7614 -0.0721 0.0143  -0.0089 494 GLN B C   
2863 O O   . GLN B 167 ? 0.4036 0.7503 0.7813 -0.0604 0.0159  -0.0111 494 GLN B O   
2864 C CB  . GLN B 167 ? 0.3708 0.6747 0.6951 -0.0521 -0.0244 -0.0098 494 GLN B CB  
2865 C CG  . GLN B 167 ? 0.3768 0.6500 0.6562 -0.0365 -0.0333 0.0030  494 GLN B CG  
2866 C CD  . GLN B 167 ? 0.3735 0.6507 0.6413 -0.0227 -0.0539 -0.0031 494 GLN B CD  
2867 O OE1 . GLN B 167 ? 0.4092 0.6578 0.6445 -0.0170 -0.0576 0.0055  494 GLN B OE1 
2868 N NE2 . GLN B 167 ? 0.3929 0.7048 0.6856 -0.0159 -0.0669 -0.0183 494 GLN B NE2 
2869 N N   . ASN B 168 ? 0.4013 0.7254 0.7925 -0.0936 0.0277  -0.0143 495 ASN B N   
2870 C CA  . ASN B 168 ? 0.4038 0.7534 0.8373 -0.1073 0.0497  -0.0213 495 ASN B CA  
2871 C C   . ASN B 168 ? 0.4153 0.7512 0.8290 -0.1026 0.0728  -0.0065 495 ASN B C   
2872 O O   . ASN B 168 ? 0.4329 0.7948 0.8792 -0.1075 0.0908  -0.0121 495 ASN B O   
2873 C CB  . ASN B 168 ? 0.4313 0.7701 0.8870 -0.1331 0.0645  -0.0262 495 ASN B CB  
2874 C CG  . ASN B 168 ? 0.4407 0.8132 0.9410 -0.1414 0.0461  -0.0505 495 ASN B CG  
2875 O OD1 . ASN B 168 ? 0.4612 0.8229 0.9789 -0.1616 0.0528  -0.0576 495 ASN B OD1 
2876 N ND2 . ASN B 168 ? 0.4302 0.8426 0.9483 -0.1245 0.0222  -0.0645 495 ASN B ND2 
2877 N N   . MET B 169 ? 0.3993 0.6950 0.7604 -0.0928 0.0726  0.0108  496 MET B N   
2878 C CA  . MET B 169 ? 0.4085 0.6885 0.7434 -0.0852 0.0904  0.0233  496 MET B CA  
2879 C C   . MET B 169 ? 0.3744 0.6733 0.7052 -0.0641 0.0811  0.0211  496 MET B C   
2880 O O   . MET B 169 ? 0.3710 0.6614 0.6843 -0.0573 0.0961  0.0279  496 MET B O   
2881 C CB  . MET B 169 ? 0.4494 0.6796 0.7318 -0.0833 0.0931  0.0403  496 MET B CB  
2882 C CG  . MET B 169 ? 0.5129 0.7180 0.7947 -0.1022 0.1086  0.0453  496 MET B CG  
2883 S SD  . MET B 169 ? 0.6290 0.7783 0.8479 -0.0952 0.1170  0.0661  496 MET B SD  
2884 C CE  . MET B 169 ? 0.6135 0.7681 0.8264 -0.0908 0.1448  0.0710  496 MET B CE  
2885 N N   . ASN B 170 ? 0.3428 0.6634 0.6858 -0.0525 0.0569  0.0117  497 ASN B N   
2886 C CA  . ASN B 170 ? 0.3356 0.6731 0.6771 -0.0310 0.0472  0.0087  497 ASN B CA  
2887 C C   . ASN B 170 ? 0.3335 0.6362 0.6282 -0.0186 0.0501  0.0220  497 ASN B C   
2888 O O   . ASN B 170 ? 0.3334 0.6383 0.6231 -0.0110 0.0631  0.0235  497 ASN B O   
2889 C CB  . ASN B 170 ? 0.3525 0.7336 0.7392 -0.0302 0.0593  -0.0032 497 ASN B CB  
2890 C CG  . ASN B 170 ? 0.3643 0.7867 0.8040 -0.0399 0.0506  -0.0212 497 ASN B CG  
2891 O OD1 . ASN B 170 ? 0.4067 0.8525 0.8876 -0.0567 0.0691  -0.0295 497 ASN B OD1 
2892 N ND2 . ASN B 170 ? 0.3586 0.7894 0.7973 -0.0296 0.0229  -0.0282 497 ASN B ND2 
2893 N N   . ILE B 171 ? 0.3158 0.5867 0.5779 -0.0173 0.0382  0.0300  498 ILE B N   
2894 C CA  . ILE B 171 ? 0.3072 0.5445 0.5289 -0.0091 0.0392  0.0401  498 ILE B CA  
2895 C C   . ILE B 171 ? 0.2822 0.5198 0.4957 0.0090  0.0240  0.0380  498 ILE B C   
2896 O O   . ILE B 171 ? 0.2602 0.4966 0.4734 0.0125  0.0088  0.0369  498 ILE B O   
2897 C CB  . ILE B 171 ? 0.3176 0.5222 0.5140 -0.0178 0.0354  0.0484  498 ILE B CB  
2898 C CG1 . ILE B 171 ? 0.3420 0.5425 0.5465 -0.0353 0.0509  0.0510  498 ILE B CG1 
2899 C CG2 . ILE B 171 ? 0.3246 0.4985 0.4839 -0.0092 0.0339  0.0557  498 ILE B CG2 
2900 C CD1 . ILE B 171 ? 0.3541 0.5303 0.5452 -0.0437 0.0437  0.0557  498 ILE B CD1 
2901 N N   . ASP B 172 ? 0.2899 0.5259 0.4942 0.0213  0.0296  0.0377  499 ASP B N   
2902 C CA  . ASP B 172 ? 0.2924 0.5215 0.4863 0.0389  0.0175  0.0366  499 ASP B CA  
2903 C C   . ASP B 172 ? 0.2856 0.4777 0.4486 0.0388  0.0096  0.0434  499 ASP B C   
2904 O O   . ASP B 172 ? 0.2795 0.4539 0.4283 0.0281  0.0126  0.0481  499 ASP B O   
2905 C CB  . ASP B 172 ? 0.3142 0.5526 0.5102 0.0532  0.0257  0.0321  499 ASP B CB  
2906 C CG  . ASP B 172 ? 0.3496 0.5637 0.5175 0.0532  0.0376  0.0354  499 ASP B CG  
2907 O OD1 . ASP B 172 ? 0.3708 0.5925 0.5394 0.0638  0.0471  0.0310  499 ASP B OD1 
2908 O OD2 . ASP B 172 ? 0.3691 0.5562 0.5124 0.0454  0.0363  0.0411  499 ASP B OD2 
2909 N N   . ILE B 173 ? 0.2822 0.4629 0.4368 0.0513  0.0002  0.0435  500 ILE B N   
2910 C CA  . ILE B 173 ? 0.2958 0.4444 0.4291 0.0506  -0.0056 0.0481  500 ILE B CA  
2911 C C   . ILE B 173 ? 0.2795 0.4076 0.3949 0.0471  -0.0007 0.0482  500 ILE B C   
2912 O O   . ILE B 173 ? 0.2534 0.3653 0.3597 0.0388  -0.0042 0.0509  500 ILE B O   
2913 C CB  . ILE B 173 ? 0.3282 0.4642 0.4554 0.0648  -0.0123 0.0491  500 ILE B CB  
2914 C CG1 . ILE B 173 ? 0.3513 0.5000 0.4861 0.0666  -0.0207 0.0506  500 ILE B CG1 
2915 C CG2 . ILE B 173 ? 0.3207 0.4229 0.4312 0.0619  -0.0136 0.0524  500 ILE B CG2 
2916 C CD1 . ILE B 173 ? 0.3798 0.5225 0.5073 0.0857  -0.0267 0.0519  500 ILE B CD1 
2917 N N   . SER B 174 ? 0.2871 0.4177 0.3975 0.0547  0.0066  0.0440  501 SER B N   
2918 C CA  . SER B 174 ? 0.3059 0.4171 0.3946 0.0548  0.0094  0.0419  501 SER B CA  
2919 C C   . SER B 174 ? 0.3127 0.4221 0.3921 0.0437  0.0138  0.0462  501 SER B C   
2920 O O   . SER B 174 ? 0.3307 0.4205 0.3939 0.0408  0.0073  0.0466  501 SER B O   
2921 C CB  . SER B 174 ? 0.3245 0.4382 0.4064 0.0672  0.0176  0.0357  501 SER B CB  
2922 O OG  . SER B 174 ? 0.3175 0.4254 0.4035 0.0793  0.0133  0.0319  501 SER B OG  
2923 N N   . ALA B 175 ? 0.3034 0.4324 0.3950 0.0376  0.0245  0.0490  502 ALA B N   
2924 C CA  . ALA B 175 ? 0.3111 0.4330 0.3923 0.0270  0.0314  0.0550  502 ALA B CA  
2925 C C   . ALA B 175 ? 0.3023 0.4139 0.3851 0.0180  0.0203  0.0590  502 ALA B C   
2926 O O   . ALA B 175 ? 0.3151 0.4072 0.3780 0.0155  0.0182  0.0627  502 ALA B O   
2927 C CB  . ALA B 175 ? 0.3027 0.4460 0.4020 0.0198  0.0481  0.0565  502 ALA B CB  
2928 N N   . PHE B 176 ? 0.2788 0.4028 0.3829 0.0155  0.0129  0.0578  503 PHE B N   
2929 C CA  . PHE B 176 ? 0.2641 0.3783 0.3691 0.0082  0.0040  0.0607  503 PHE B CA  
2930 C C   . PHE B 176 ? 0.2659 0.3576 0.3555 0.0120  -0.0052 0.0603  503 PHE B C   
2931 O O   . PHE B 176 ? 0.2667 0.3462 0.3501 0.0070  -0.0094 0.0627  503 PHE B O   
2932 C CB  . PHE B 176 ? 0.2490 0.3779 0.3733 0.0075  -0.0023 0.0589  503 PHE B CB  
2933 C CG  . PHE B 176 ? 0.2459 0.3641 0.3687 0.0005  -0.0088 0.0616  503 PHE B CG  
2934 C CD1 . PHE B 176 ? 0.2582 0.3769 0.3852 -0.0107 -0.0052 0.0633  503 PHE B CD1 
2935 C CD2 . PHE B 176 ? 0.2411 0.3447 0.3575 0.0047  -0.0159 0.0623  503 PHE B CD2 
2936 C CE1 . PHE B 176 ? 0.2475 0.3542 0.3715 -0.0157 -0.0107 0.0651  503 PHE B CE1 
2937 C CE2 . PHE B 176 ? 0.2481 0.3417 0.3635 -0.0010 -0.0196 0.0643  503 PHE B CE2 
2938 C CZ  . PHE B 176 ? 0.2416 0.3376 0.3603 -0.0103 -0.0179 0.0654  503 PHE B CZ  
2939 N N   . SER B 177 ? 0.2702 0.3570 0.3573 0.0209  -0.0083 0.0558  504 SER B N   
2940 C CA  . SER B 177 ? 0.2797 0.3477 0.3596 0.0229  -0.0162 0.0521  504 SER B CA  
2941 C C   . SER B 177 ? 0.2947 0.3518 0.3567 0.0230  -0.0190 0.0504  504 SER B C   
2942 O O   . SER B 177 ? 0.3033 0.3508 0.3658 0.0210  -0.0276 0.0479  504 SER B O   
2943 C CB  . SER B 177 ? 0.2898 0.3510 0.3694 0.0319  -0.0168 0.0462  504 SER B CB  
2944 O OG  . SER B 177 ? 0.2901 0.3568 0.3810 0.0351  -0.0153 0.0490  504 SER B OG  
2945 N N   . CYS B 178 ? 0.3073 0.3662 0.3533 0.0267  -0.0113 0.0516  505 CYS B N   
2946 C CA  . CYS B 178 ? 0.3395 0.3847 0.3591 0.0306  -0.0129 0.0518  505 CYS B CA  
2947 C C   . CYS B 178 ? 0.3414 0.3816 0.3578 0.0237  -0.0127 0.0598  505 CYS B C   
2948 O O   . CYS B 178 ? 0.3485 0.3755 0.3514 0.0273  -0.0228 0.0584  505 CYS B O   
2949 C CB  . CYS B 178 ? 0.3634 0.4087 0.3626 0.0371  0.0000  0.0528  505 CYS B CB  
2950 S SG  . CYS B 178 ? 0.3960 0.4404 0.3897 0.0492  -0.0011 0.0413  505 CYS B SG  
2951 N N   . ILE B 179 ? 0.3323 0.3833 0.3629 0.0147  -0.0025 0.0664  506 ILE B N   
2952 C CA  . ILE B 179 ? 0.3488 0.3933 0.3787 0.0068  0.0001  0.0737  506 ILE B CA  
2953 C C   . ILE B 179 ? 0.3276 0.3673 0.3675 0.0047  -0.0134 0.0718  506 ILE B C   
2954 O O   . ILE B 179 ? 0.3440 0.3695 0.3718 0.0060  -0.0178 0.0748  506 ILE B O   
2955 C CB  . ILE B 179 ? 0.3480 0.4093 0.3996 -0.0040 0.0124  0.0766  506 ILE B CB  
2956 C CG1 . ILE B 179 ? 0.3820 0.4476 0.4269 -0.0040 0.0300  0.0791  506 ILE B CG1 
2957 C CG2 . ILE B 179 ? 0.3549 0.4093 0.4124 -0.0139 0.0132  0.0812  506 ILE B CG2 
2958 C CD1 . ILE B 179 ? 0.4508 0.4922 0.4659 -0.0038 0.0409  0.0879  506 ILE B CD1 
2959 N N   . ALA B 180 ? 0.2991 0.3495 0.3601 0.0028  -0.0182 0.0674  507 ALA B N   
2960 C CA  . ALA B 180 ? 0.2806 0.3271 0.3531 0.0012  -0.0275 0.0648  507 ALA B CA  
2961 C C   . ALA B 180 ? 0.2840 0.3198 0.3479 0.0079  -0.0380 0.0592  507 ALA B C   
2962 O O   . ALA B 180 ? 0.2938 0.3240 0.3596 0.0078  -0.0442 0.0591  507 ALA B O   
2963 C CB  . ALA B 180 ? 0.2456 0.2998 0.3348 0.0007  -0.0278 0.0620  507 ALA B CB  
2964 N N   . ALA B 181 ? 0.2899 0.3239 0.3456 0.0148  -0.0410 0.0527  508 ALA B N   
2965 C CA  . ALA B 181 ? 0.3065 0.3330 0.3554 0.0222  -0.0541 0.0433  508 ALA B CA  
2966 C C   . ALA B 181 ? 0.3397 0.3558 0.3637 0.0287  -0.0585 0.0475  508 ALA B C   
2967 O O   . ALA B 181 ? 0.3458 0.3591 0.3730 0.0332  -0.0714 0.0421  508 ALA B O   
2968 C CB  . ALA B 181 ? 0.3064 0.3309 0.3470 0.0289  -0.0562 0.0342  508 ALA B CB  
2969 N N   . LEU B 182 ? 0.3494 0.3595 0.3507 0.0295  -0.0465 0.0574  509 LEU B N   
2970 C CA  . LEU B 182 ? 0.3859 0.3788 0.3565 0.0367  -0.0463 0.0647  509 LEU B CA  
2971 C C   . LEU B 182 ? 0.3666 0.3543 0.3460 0.0320  -0.0476 0.0709  509 LEU B C   
2972 O O   . LEU B 182 ? 0.4016 0.3730 0.3580 0.0413  -0.0530 0.0746  509 LEU B O   
2973 C CB  . LEU B 182 ? 0.4057 0.3907 0.3515 0.0367  -0.0277 0.0745  509 LEU B CB  
2974 C CG  . LEU B 182 ? 0.4365 0.4196 0.3602 0.0468  -0.0262 0.0689  509 LEU B CG  
2975 C CD1 . LEU B 182 ? 0.4492 0.4290 0.3574 0.0441  -0.0027 0.0787  509 LEU B CD1 
2976 C CD2 . LEU B 182 ? 0.4692 0.4354 0.3585 0.0640  -0.0423 0.0631  509 LEU B CD2 
2977 N N   . ALA B 183 ? 0.3311 0.3309 0.3404 0.0199  -0.0433 0.0716  510 ALA B N   
2978 C CA  . ALA B 183 ? 0.3314 0.3260 0.3496 0.0160  -0.0445 0.0755  510 ALA B CA  
2979 C C   . ALA B 183 ? 0.3480 0.3449 0.3774 0.0236  -0.0611 0.0664  510 ALA B C   
2980 O O   . ALA B 183 ? 0.3646 0.3536 0.3935 0.0274  -0.0662 0.0681  510 ALA B O   
2981 C CB  . ALA B 183 ? 0.2844 0.2915 0.3285 0.0028  -0.0366 0.0764  510 ALA B CB  
2982 N N   . MET B 184 ? 0.3579 0.3663 0.4018 0.0252  -0.0690 0.0556  511 MET B N   
2983 C CA  . MET B 184 ? 0.3716 0.3861 0.4339 0.0306  -0.0839 0.0443  511 MET B CA  
2984 C C   . MET B 184 ? 0.3812 0.3917 0.4253 0.0458  -0.1006 0.0351  511 MET B C   
2985 O O   . MET B 184 ? 0.3897 0.4004 0.4369 0.0553  -0.1145 0.0295  511 MET B O   
2986 C CB  . MET B 184 ? 0.3712 0.3997 0.4687 0.0217  -0.0822 0.0358  511 MET B CB  
2987 C CG  . MET B 184 ? 0.4155 0.4527 0.5392 0.0254  -0.0951 0.0232  511 MET B CG  
2988 S SD  . MET B 184 ? 0.4742 0.5224 0.6374 0.0144  -0.0891 0.0133  511 MET B SD  
2989 C CE  . MET B 184 ? 0.4623 0.5098 0.6346 0.0071  -0.0755 0.0247  511 MET B CE  
2990 N N   . VAL B 185 ? 0.3946 0.4016 0.4185 0.0498  -0.1002 0.0324  512 VAL B N   
2991 C CA  . VAL B 185 ? 0.4266 0.4285 0.4274 0.0659  -0.1172 0.0219  512 VAL B CA  
2992 C C   . VAL B 185 ? 0.4686 0.4484 0.4212 0.0783  -0.1141 0.0353  512 VAL B C   
2993 O O   . VAL B 185 ? 0.4730 0.4408 0.3945 0.0799  -0.1012 0.0438  512 VAL B O   
2994 C CB  . VAL B 185 ? 0.4328 0.4379 0.4308 0.0660  -0.1177 0.0115  512 VAL B CB  
2995 C CG1 . VAL B 185 ? 0.4765 0.4773 0.4514 0.0835  -0.1386 -0.0032 512 VAL B CG1 
2996 C CG2 . VAL B 185 ? 0.3950 0.4151 0.4390 0.0522  -0.1153 0.0019  512 VAL B CG2 
2997 N N   . THR B 186 ? 0.4860 0.4591 0.4334 0.0875  -0.1242 0.0374  513 THR B N   
2998 C CA  . THR B 186 ? 0.5472 0.4932 0.4499 0.0987  -0.1183 0.0531  513 THR B CA  
2999 C C   . THR B 186 ? 0.5826 0.5227 0.4759 0.1181  -0.1400 0.0480  513 THR B C   
3000 O O   . THR B 186 ? 0.5387 0.4998 0.4731 0.1165  -0.1537 0.0353  513 THR B O   
3001 C CB  . THR B 186 ? 0.5299 0.4681 0.4407 0.0822  -0.0949 0.0698  513 THR B CB  
3002 O OG1 . THR B 186 ? 0.5790 0.4861 0.4440 0.0906  -0.0837 0.0858  513 THR B OG1 
3003 C CG2 . THR B 186 ? 0.4780 0.4264 0.4259 0.0751  -0.0987 0.0677  513 THR B CG2 
3004 N N   . GLU B 187 ? 0.6842 0.5950 0.5238 0.1371  -0.1416 0.0585  514 GLU B N   
3005 C CA  . GLU B 187 ? 0.7407 0.6410 0.5632 0.1602  -0.1626 0.0562  514 GLU B CA  
3006 C C   . GLU B 187 ? 0.7074 0.6151 0.5678 0.1535  -0.1622 0.0582  514 GLU B C   
3007 O O   . GLU B 187 ? 0.6677 0.5647 0.5340 0.1377  -0.1401 0.0723  514 GLU B O   
3008 C CB  . GLU B 187 ? 0.8663 0.7247 0.6152 0.1833  -0.1597 0.0719  514 GLU B CB  
3009 C CG  . GLU B 187 ? 0.9519 0.7796 0.6669 0.1722  -0.1259 0.0952  514 GLU B CG  
3010 C CD  . GLU B 187 ? 0.9868 0.8174 0.6850 0.1666  -0.1138 0.0938  514 GLU B CD  
3011 O OE1 . GLU B 187 ? 1.0804 0.8998 0.7344 0.1879  -0.1263 0.0885  514 GLU B OE1 
3012 O OE2 . GLU B 187 ? 0.9633 0.8071 0.6907 0.1426  -0.0927 0.0972  514 GLU B OE2 
3013 N N   . ARG B 188 ? 0.7057 0.6352 0.5965 0.1645  -0.1865 0.0411  515 ARG B N   
3014 C CA  . ARG B 188 ? 0.7073 0.6439 0.6312 0.1638  -0.1887 0.0408  515 ARG B CA  
3015 C C   . ARG B 188 ? 0.7415 0.6770 0.6516 0.1941  -0.2172 0.0314  515 ARG B C   
3016 O O   . ARG B 188 ? 0.7654 0.7137 0.6691 0.2080  -0.2393 0.0156  515 ARG B O   
3017 C CB  . ARG B 188 ? 0.6452 0.6200 0.6377 0.1442  -0.1881 0.0253  515 ARG B CB  
3018 C CG  . ARG B 188 ? 0.6123 0.5919 0.6215 0.1171  -0.1638 0.0319  515 ARG B CG  
3019 C CD  . ARG B 188 ? 0.6065 0.5644 0.6029 0.1068  -0.1417 0.0509  515 ARG B CD  
3020 N NE  . ARG B 188 ? 0.5635 0.5316 0.5808 0.0831  -0.1228 0.0537  515 ARG B NE  
3021 C CZ  . ARG B 188 ? 0.5580 0.5127 0.5676 0.0702  -0.1033 0.0669  515 ARG B CZ  
3022 N NH1 . ARG B 188 ? 0.5939 0.5215 0.5766 0.0758  -0.0970 0.0791  515 ARG B NH1 
3023 N NH2 . ARG B 188 ? 0.5285 0.4962 0.5580 0.0522  -0.0904 0.0668  515 ARG B NH2 
3024 N N   . HIS B 189 ? 0.7546 0.6761 0.6611 0.2058  -0.2188 0.0389  516 HIS B N   
3025 C CA  . HIS B 189 ? 0.8122 0.7363 0.7093 0.2383  -0.2494 0.0280  516 HIS B CA  
3026 C C   . HIS B 189 ? 0.7605 0.7364 0.7299 0.2352  -0.2696 -0.0002 516 HIS B C   
3027 O O   . HIS B 189 ? 0.7284 0.7276 0.7530 0.2125  -0.2560 -0.0048 516 HIS B O   
3028 C CB  . HIS B 189 ? 0.8580 0.7486 0.7275 0.2552  -0.2456 0.0444  516 HIS B CB  
3029 C CG  . HIS B 189 ? 0.9535 0.8368 0.7944 0.2949  -0.2772 0.0375  516 HIS B CG  
3030 N ND1 . HIS B 189 ? 0.9646 0.8589 0.8334 0.3119  -0.2922 0.0299  516 HIS B ND1 
3031 C CD2 . HIS B 189 ? 1.0113 0.8792 0.7979 0.3231  -0.2982 0.0354  516 HIS B CD2 
3032 C CE1 . HIS B 189 ? 1.0316 0.9184 0.8657 0.3496  -0.3225 0.0236  516 HIS B CE1 
3033 N NE2 . HIS B 189 ? 1.0642 0.9339 0.8457 0.3574  -0.3271 0.0269  516 HIS B NE2 
3034 N N   . GLY B 190 ? 0.7905 0.7838 0.7587 0.2577  -0.3012 -0.0199 517 GLY B N   
3035 C CA  . GLY B 190 ? 0.7511 0.7952 0.7918 0.2570  -0.3228 -0.0500 517 GLY B CA  
3036 C C   . GLY B 190 ? 0.7050 0.7798 0.7864 0.2357  -0.3238 -0.0698 517 GLY B C   
3037 O O   . GLY B 190 ? 0.6707 0.7860 0.8231 0.2248  -0.3303 -0.0920 517 GLY B O   
3038 N N   . LEU B 191 ? 0.7053 0.7602 0.7442 0.2295  -0.3156 -0.0623 518 LEU B N   
3039 C CA  . LEU B 191 ? 0.6710 0.7497 0.7416 0.2128  -0.3184 -0.0818 518 LEU B CA  
3040 C C   . LEU B 191 ? 0.7015 0.8031 0.7797 0.2354  -0.3575 -0.1121 518 LEU B C   
3041 O O   . LEU B 191 ? 0.7513 0.8339 0.7724 0.2666  -0.3789 -0.1105 518 LEU B O   
3042 C CB  . LEU B 191 ? 0.6624 0.7122 0.6833 0.2024  -0.2981 -0.0651 518 LEU B CB  
3043 C CG  . LEU B 191 ? 0.6277 0.6638 0.6522 0.1751  -0.2611 -0.0422 518 LEU B CG  
3044 C CD1 . LEU B 191 ? 0.6539 0.6571 0.6146 0.1767  -0.2463 -0.0241 518 LEU B CD1 
3045 C CD2 . LEU B 191 ? 0.5683 0.6317 0.6553 0.1474  -0.2492 -0.0541 518 LEU B CD2 
3046 N N   . LYS B 192 ? 0.6730 0.8131 0.8194 0.2201  -0.3661 -0.1399 519 LYS B N   
3047 C CA  . LYS B 192 ? 0.7121 0.8765 0.8718 0.2368  -0.4027 -0.1731 519 LYS B CA  
3048 C C   . LYS B 192 ? 0.7469 0.8878 0.8463 0.2440  -0.4087 -0.1744 519 LYS B C   
3049 O O   . LYS B 192 ? 0.7843 0.9246 0.8489 0.2727  -0.4412 -0.1904 519 LYS B O   
3050 C CB  . LYS B 192 ? 0.6875 0.8978 0.9425 0.2145  -0.4062 -0.2035 519 LYS B CB  
3051 C CG  . LYS B 192 ? 0.6924 0.9362 1.0098 0.2190  -0.4147 -0.2147 519 LYS B CG  
3052 C CD  . LYS B 192 ? 0.6615 0.9378 1.0683 0.1857  -0.3957 -0.2301 519 LYS B CD  
3053 C CE  . LYS B 192 ? 0.6578 0.9612 1.1202 0.1877  -0.3933 -0.2335 519 LYS B CE  
3054 N NZ  . LYS B 192 ? 0.6477 0.9922 1.2056 0.1623  -0.3856 -0.2604 519 LYS B NZ  
3055 N N   . GLU B 193 ? 0.7205 0.8424 0.8066 0.2201  -0.3780 -0.1586 520 GLU B N   
3056 C CA  . GLU B 193 ? 0.7483 0.8466 0.7773 0.2260  -0.3784 -0.1579 520 GLU B CA  
3057 C C   . GLU B 193 ? 0.7528 0.8093 0.7160 0.2231  -0.3466 -0.1213 520 GLU B C   
3058 O O   . GLU B 193 ? 0.7352 0.7841 0.7006 0.2014  -0.3215 -0.1128 520 GLU B O   
3059 C CB  . GLU B 193 ? 0.7374 0.8548 0.8148 0.2029  -0.3758 -0.1808 520 GLU B CB  
3060 C CG  . GLU B 193 ? 0.7978 0.9459 0.9076 0.2176  -0.4164 -0.2211 520 GLU B CG  
3061 C CD  . GLU B 193 ? 0.7801 0.9563 0.9668 0.1912  -0.4153 -0.2491 520 GLU B CD  
3062 O OE1 . GLU B 193 ? 0.7876 0.9999 1.0330 0.1941  -0.4418 -0.2814 520 GLU B OE1 
3063 O OE2 . GLU B 193 ? 0.7940 0.9551 0.9823 0.1683  -0.3874 -0.2389 520 GLU B OE2 
3064 N N   . PRO B 194 ? 0.7774 0.8063 0.6834 0.2454  -0.3471 -0.1001 521 PRO B N   
3065 C CA  . PRO B 194 ? 0.7706 0.7618 0.6239 0.2392  -0.3139 -0.0665 521 PRO B CA  
3066 C C   . PRO B 194 ? 0.7946 0.7642 0.5953 0.2417  -0.3046 -0.0632 521 PRO B C   
3067 O O   . PRO B 194 ? 0.7825 0.7374 0.5731 0.2235  -0.2729 -0.0435 521 PRO B O   
3068 C CB  . PRO B 194 ? 0.8201 0.7840 0.6239 0.2654  -0.3198 -0.0491 521 PRO B CB  
3069 C CG  . PRO B 194 ? 0.8641 0.8441 0.6651 0.2959  -0.3624 -0.0747 521 PRO B CG  
3070 C CD  . PRO B 194 ? 0.8156 0.8448 0.7035 0.2771  -0.3763 -0.1058 521 PRO B CD  
3071 N N   . LYS B 195 ? 0.8284 0.7989 0.6001 0.2637  -0.3322 -0.0844 522 LYS B N   
3072 C CA  . LYS B 195 ? 0.8582 0.8085 0.5788 0.2682  -0.3242 -0.0842 522 LYS B CA  
3073 C C   . LYS B 195 ? 0.8032 0.7700 0.5700 0.2385  -0.3064 -0.0921 522 LYS B C   
3074 O O   . LYS B 195 ? 0.7989 0.7468 0.5338 0.2319  -0.2817 -0.0784 522 LYS B O   
3075 C CB  . LYS B 195 ? 0.9213 0.8681 0.5974 0.3009  -0.3607 -0.1081 522 LYS B CB  
3076 C CG  . LYS B 195 ? 0.9996 0.9138 0.5997 0.3364  -0.3717 -0.0926 522 LYS B CG  
3077 C CD  . LYS B 195 ? 1.0864 0.9784 0.6085 0.3693  -0.3925 -0.1045 522 LYS B CD  
3078 C CE  . LYS B 195 ? 1.1701 1.0199 0.6044 0.4063  -0.3975 -0.0834 522 LYS B CE  
3079 N NZ  . LYS B 195 ? 1.2667 1.0928 0.6174 0.4431  -0.4205 -0.0958 522 LYS B NZ  
3080 N N   . ARG B 196 ? 0.7665 0.7676 0.6086 0.2214  -0.3175 -0.1138 523 ARG B N   
3081 C CA  . ARG B 196 ? 0.7220 0.7363 0.6117 0.1935  -0.3004 -0.1209 523 ARG B CA  
3082 C C   . ARG B 196 ? 0.6632 0.6696 0.5647 0.1707  -0.2631 -0.0916 523 ARG B C   
3083 O O   . ARG B 196 ? 0.6414 0.6394 0.5363 0.1583  -0.2414 -0.0837 523 ARG B O   
3084 C CB  . ARG B 196 ? 0.7230 0.7721 0.6898 0.1816  -0.3193 -0.1503 523 ARG B CB  
3085 C CG  . ARG B 196 ? 0.7264 0.7822 0.7302 0.1601  -0.3089 -0.1647 523 ARG B CG  
3086 C CD  . ARG B 196 ? 0.7061 0.7909 0.7947 0.1382  -0.3102 -0.1824 523 ARG B CD  
3087 N NE  . ARG B 196 ? 0.7383 0.8473 0.8621 0.1460  -0.3438 -0.2191 523 ARG B NE  
3088 C CZ  . ARG B 196 ? 0.7522 0.8688 0.9077 0.1365  -0.3522 -0.2473 523 ARG B CZ  
3089 N NH1 . ARG B 196 ? 0.7318 0.8313 0.8864 0.1199  -0.3286 -0.2417 523 ARG B NH1 
3090 N NH2 . ARG B 196 ? 0.7734 0.9157 0.9654 0.1440  -0.3851 -0.2830 523 ARG B NH2 
3091 N N   . VAL B 197 ? 0.6253 0.6346 0.5430 0.1669  -0.2570 -0.0768 524 VAL B N   
3092 C CA  . VAL B 197 ? 0.5884 0.5887 0.5106 0.1485  -0.2249 -0.0503 524 VAL B CA  
3093 C C   . VAL B 197 ? 0.6206 0.5915 0.4794 0.1553  -0.2055 -0.0297 524 VAL B C   
3094 O O   . VAL B 197 ? 0.5894 0.5580 0.4533 0.1394  -0.1816 -0.0192 524 VAL B O   
3095 C CB  . VAL B 197 ? 0.5585 0.5625 0.5004 0.1473  -0.2237 -0.0393 524 VAL B CB  
3096 C CG1 . VAL B 197 ? 0.5190 0.5097 0.4556 0.1318  -0.1933 -0.0130 524 VAL B CG1 
3097 C CG2 . VAL B 197 ? 0.5266 0.5621 0.5374 0.1372  -0.2360 -0.0590 524 VAL B CG2 
3098 N N   . GLU B 198 ? 0.6857 0.6345 0.4855 0.1802  -0.2160 -0.0252 525 GLU B N   
3099 C CA  . GLU B 198 ? 0.7318 0.6499 0.4696 0.1876  -0.1948 -0.0052 525 GLU B CA  
3100 C C   . GLU B 198 ? 0.7248 0.6422 0.4487 0.1852  -0.1868 -0.0133 525 GLU B C   
3101 O O   . GLU B 198 ? 0.7085 0.6139 0.4143 0.1769  -0.1586 0.0033  525 GLU B O   
3102 C CB  . GLU B 198 ? 0.8311 0.7197 0.5012 0.2181  -0.2072 0.0019  525 GLU B CB  
3103 C CG  . GLU B 198 ? 0.8954 0.7488 0.5185 0.2193  -0.1772 0.0332  525 GLU B CG  
3104 C CD  . GLU B 198 ? 0.9350 0.7726 0.5252 0.2132  -0.1476 0.0447  525 GLU B CD  
3105 O OE1 . GLU B 198 ? 0.9359 0.7703 0.5420 0.1926  -0.1168 0.0630  525 GLU B OE1 
3106 O OE2 . GLU B 198 ? 0.9503 0.7814 0.5031 0.2286  -0.1557 0.0333  525 GLU B OE2 
3107 N N   . GLU B 199 ? 0.7366 0.6672 0.4708 0.1926  -0.2111 -0.0401 526 GLU B N   
3108 C CA  . GLU B 199 ? 0.7445 0.6741 0.4703 0.1898  -0.2039 -0.0503 526 GLU B CA  
3109 C C   . GLU B 199 ? 0.6688 0.6136 0.4463 0.1621  -0.1807 -0.0451 526 GLU B C   
3110 O O   . GLU B 199 ? 0.6513 0.5885 0.4127 0.1580  -0.1595 -0.0378 526 GLU B O   
3111 C CB  . GLU B 199 ? 0.8040 0.7442 0.5359 0.2015  -0.2360 -0.0834 526 GLU B CB  
3112 C CG  . GLU B 199 ? 0.8861 0.8146 0.5856 0.2075  -0.2300 -0.0932 526 GLU B CG  
3113 C CD  . GLU B 199 ? 0.9163 0.8618 0.6560 0.2021  -0.2507 -0.1266 526 GLU B CD  
3114 O OE1 . GLU B 199 ? 0.9424 0.8930 0.6747 0.2186  -0.2836 -0.1521 526 GLU B OE1 
3115 O OE2 . GLU B 199 ? 0.9185 0.8711 0.6971 0.1819  -0.2335 -0.1274 526 GLU B OE2 
3116 N N   . LEU B 200 ? 0.6019 0.5678 0.4399 0.1451  -0.1849 -0.0494 527 LEU B N   
3117 C CA  . LEU B 200 ? 0.5487 0.5259 0.4300 0.1224  -0.1652 -0.0445 527 LEU B CA  
3118 C C   . LEU B 200 ? 0.5406 0.5090 0.4062 0.1149  -0.1369 -0.0168 527 LEU B C   
3119 O O   . LEU B 200 ? 0.5088 0.4787 0.3800 0.1056  -0.1176 -0.0105 527 LEU B O   
3120 C CB  . LEU B 200 ? 0.5089 0.5069 0.4530 0.1073  -0.1734 -0.0545 527 LEU B CB  
3121 C CG  . LEU B 200 ? 0.4793 0.4849 0.4638 0.0858  -0.1523 -0.0474 527 LEU B CG  
3122 C CD1 . LEU B 200 ? 0.4737 0.4737 0.4545 0.0838  -0.1443 -0.0550 527 LEU B CD1 
3123 C CD2 . LEU B 200 ? 0.4375 0.4591 0.4779 0.0718  -0.1559 -0.0542 527 LEU B CD2 
3124 N N   . GLN B 201 ? 0.5482 0.5075 0.3956 0.1198  -0.1356 -0.0022 528 GLN B N   
3125 C CA  . GLN B 201 ? 0.5572 0.5059 0.3890 0.1127  -0.1096 0.0214  528 GLN B CA  
3126 C C   . GLN B 201 ? 0.5790 0.5145 0.3712 0.1187  -0.0918 0.0274  528 GLN B C   
3127 O O   . GLN B 201 ? 0.5461 0.4889 0.3540 0.1058  -0.0702 0.0355  528 GLN B O   
3128 C CB  . GLN B 201 ? 0.5868 0.5182 0.3918 0.1224  -0.1122 0.0343  528 GLN B CB  
3129 C CG  . GLN B 201 ? 0.5985 0.5191 0.3992 0.1108  -0.0858 0.0568  528 GLN B CG  
3130 C CD  . GLN B 201 ? 0.6379 0.5331 0.4042 0.1233  -0.0877 0.0695  528 GLN B CD  
3131 O OE1 . GLN B 201 ? 0.7136 0.5860 0.4282 0.1441  -0.0939 0.0714  528 GLN B OE1 
3132 N NE2 . GLN B 201 ? 0.6222 0.5190 0.4143 0.1123  -0.0830 0.0776  528 GLN B NE2 
3133 N N   . ASN B 202 ? 0.6197 0.5372 0.3613 0.1397  -0.1016 0.0221  529 ASN B N   
3134 C CA  . ASN B 202 ? 0.6723 0.5744 0.3698 0.1484  -0.0837 0.0272  529 ASN B CA  
3135 C C   . ASN B 202 ? 0.6478 0.5656 0.3699 0.1404  -0.0767 0.0156  529 ASN B C   
3136 O O   . ASN B 202 ? 0.6537 0.5694 0.3654 0.1374  -0.0519 0.0248  529 ASN B O   
3137 C CB  . ASN B 202 ? 0.7558 0.6339 0.3897 0.1758  -0.0993 0.0212  529 ASN B CB  
3138 C CG  . ASN B 202 ? 0.8166 0.6723 0.3953 0.1864  -0.0753 0.0316  529 ASN B CG  
3139 O OD1 . ASN B 202 ? 0.8422 0.6810 0.3991 0.1834  -0.0491 0.0538  529 ASN B OD1 
3140 N ND2 . ASN B 202 ? 0.8460 0.7003 0.4033 0.1980  -0.0818 0.0151  529 ASN B ND2 
3141 N N   . LYS B 203 ? 0.6193 0.5519 0.3757 0.1373  -0.0971 -0.0046 530 LYS B N   
3142 C CA  . LYS B 203 ? 0.6084 0.5517 0.3901 0.1298  -0.0904 -0.0149 530 LYS B CA  
3143 C C   . LYS B 203 ? 0.5464 0.5040 0.3656 0.1111  -0.0677 0.0000  530 LYS B C   
3144 O O   . LYS B 203 ? 0.5420 0.5031 0.3615 0.1096  -0.0500 0.0030  530 LYS B O   
3145 C CB  . LYS B 203 ? 0.6039 0.5571 0.4210 0.1265  -0.1139 -0.0380 530 LYS B CB  
3146 C CG  . LYS B 203 ? 0.6672 0.6109 0.4569 0.1431  -0.1338 -0.0617 530 LYS B CG  
3147 C CD  . LYS B 203 ? 0.6718 0.6272 0.4995 0.1395  -0.1616 -0.0830 530 LYS B CD  
3148 C CE  . LYS B 203 ? 0.6991 0.6550 0.5443 0.1394  -0.1748 -0.1107 530 LYS B CE  
3149 N NZ  . LYS B 203 ? 0.7752 0.7198 0.5738 0.1617  -0.1963 -0.1302 530 LYS B NZ  
3150 N N   . ILE B 204 ? 0.5188 0.4855 0.3687 0.0988  -0.0694 0.0083  531 ILE B N   
3151 C CA  . ILE B 204 ? 0.4840 0.4649 0.3681 0.0825  -0.0518 0.0209  531 ILE B CA  
3152 C C   . ILE B 204 ? 0.5003 0.4777 0.3635 0.0817  -0.0276 0.0373  531 ILE B C   
3153 O O   . ILE B 204 ? 0.4755 0.4662 0.3582 0.0746  -0.0116 0.0410  531 ILE B O   
3154 C CB  . ILE B 204 ? 0.4510 0.4405 0.3696 0.0707  -0.0597 0.0243  531 ILE B CB  
3155 C CG1 . ILE B 204 ? 0.4343 0.4289 0.3799 0.0697  -0.0791 0.0068  531 ILE B CG1 
3156 C CG2 . ILE B 204 ? 0.4109 0.4141 0.3595 0.0565  -0.0439 0.0348  531 ILE B CG2 
3157 C CD1 . ILE B 204 ? 0.4038 0.4049 0.3771 0.0623  -0.0886 0.0073  531 ILE B CD1 
3158 N N   . VAL B 205 ? 0.5362 0.4950 0.3604 0.0899  -0.0245 0.0464  532 VAL B N   
3159 C CA  . VAL B 205 ? 0.5595 0.5098 0.3616 0.0884  0.0019  0.0621  532 VAL B CA  
3160 C C   . VAL B 205 ? 0.5767 0.5306 0.3664 0.0946  0.0173  0.0577  532 VAL B C   
3161 O O   . VAL B 205 ? 0.5681 0.5355 0.3771 0.0853  0.0396  0.0644  532 VAL B O   
3162 C CB  . VAL B 205 ? 0.6112 0.5320 0.3640 0.0998  0.0033  0.0731  532 VAL B CB  
3163 C CG1 . VAL B 205 ? 0.6480 0.5534 0.3696 0.1007  0.0347  0.0881  532 VAL B CG1 
3164 C CG2 . VAL B 205 ? 0.5920 0.5106 0.3627 0.0918  -0.0046 0.0805  532 VAL B CG2 
3165 N N   . ASN B 206 ? 0.6009 0.5451 0.3629 0.1101  0.0040  0.0441  533 ASN B N   
3166 C CA  . ASN B 206 ? 0.6374 0.5814 0.3821 0.1192  0.0164  0.0375  533 ASN B CA  
3167 C C   . ASN B 206 ? 0.6026 0.5711 0.3936 0.1103  0.0218  0.0308  533 ASN B C   
3168 O O   . ASN B 206 ? 0.6099 0.5850 0.3988 0.1126  0.0426  0.0327  533 ASN B O   
3169 C CB  . ASN B 206 ? 0.6898 0.6150 0.3911 0.1392  -0.0028 0.0219  533 ASN B CB  
3170 C CG  . ASN B 206 ? 0.7601 0.6582 0.4045 0.1538  -0.0056 0.0301  533 ASN B CG  
3171 O OD1 . ASN B 206 ? 0.8029 0.6890 0.4235 0.1534  0.0192  0.0480  533 ASN B OD1 
3172 N ND2 . ASN B 206 ? 0.7835 0.6722 0.4103 0.1658  -0.0355 0.0176  533 ASN B ND2 
3173 N N   . CYS B 207 ? 0.5684 0.5486 0.3988 0.1016  0.0042  0.0233  534 CYS B N   
3174 C CA  . CYS B 207 ? 0.5480 0.5480 0.4212 0.0936  0.0085  0.0205  534 CYS B CA  
3175 C C   . CYS B 207 ? 0.5260 0.5442 0.4213 0.0835  0.0289  0.0338  534 CYS B C   
3176 O O   . CYS B 207 ? 0.5193 0.5526 0.4307 0.0849  0.0419  0.0324  534 CYS B O   
3177 C CB  . CYS B 207 ? 0.5302 0.5357 0.4385 0.0833  -0.0086 0.0172  534 CYS B CB  
3178 S SG  . CYS B 207 ? 0.5841 0.5760 0.4895 0.0903  -0.0315 -0.0032 534 CYS B SG  
3179 N N   . LEU B 208 ? 0.5154 0.5334 0.4161 0.0732  0.0298  0.0449  535 LEU B N   
3180 C CA  . LEU B 208 ? 0.4929 0.5285 0.4198 0.0607  0.0468  0.0554  535 LEU B CA  
3181 C C   . LEU B 208 ? 0.5228 0.5606 0.4346 0.0641  0.0729  0.0600  535 LEU B C   
3182 O O   . LEU B 208 ? 0.5002 0.5628 0.4435 0.0596  0.0864  0.0591  535 LEU B O   
3183 C CB  . LEU B 208 ? 0.4666 0.4944 0.3951 0.0504  0.0430  0.0650  535 LEU B CB  
3184 C CG  . LEU B 208 ? 0.4548 0.4965 0.4092 0.0354  0.0594  0.0743  535 LEU B CG  
3185 C CD1 . LEU B 208 ? 0.4081 0.4805 0.4087 0.0281  0.0581  0.0690  535 LEU B CD1 
3186 C CD2 . LEU B 208 ? 0.4376 0.4641 0.3866 0.0281  0.0534  0.0822  535 LEU B CD2 
3187 N N   . LYS B 209 ? 0.5595 0.5716 0.4230 0.0738  0.0797  0.0641  536 LYS B N   
3188 C CA  . LYS B 209 ? 0.6008 0.6080 0.4408 0.0785  0.1083  0.0700  536 LYS B CA  
3189 C C   . LYS B 209 ? 0.5967 0.6217 0.4486 0.0868  0.1166  0.0593  536 LYS B C   
3190 O O   . LYS B 209 ? 0.5852 0.6307 0.4608 0.0816  0.1407  0.0619  536 LYS B O   
3191 C CB  . LYS B 209 ? 0.6533 0.6240 0.4283 0.0933  0.1103  0.0748  536 LYS B CB  
3192 C CG  . LYS B 209 ? 0.6831 0.6311 0.4375 0.0885  0.1116  0.0891  536 LYS B CG  
3193 C CD  . LYS B 209 ? 0.7630 0.6731 0.4456 0.1067  0.1223  0.0966  536 LYS B CD  
3194 C CE  . LYS B 209 ? 0.7965 0.6776 0.4511 0.1069  0.1197  0.1107  536 LYS B CE  
3195 N NZ  . LYS B 209 ? 0.8833 0.7236 0.4616 0.1273  0.1328  0.1203  536 LYS B NZ  
3196 N N   . ASP B 210 ? 0.5985 0.6162 0.4375 0.0994  0.0971  0.0462  537 ASP B N   
3197 C CA  . ASP B 210 ? 0.6156 0.6442 0.4608 0.1100  0.1033  0.0350  537 ASP B CA  
3198 C C   . ASP B 210 ? 0.5638 0.6256 0.4668 0.1011  0.1046  0.0333  537 ASP B C   
3199 O O   . ASP B 210 ? 0.5563 0.6373 0.4760 0.1054  0.1219  0.0304  537 ASP B O   
3200 C CB  . ASP B 210 ? 0.6464 0.6571 0.4698 0.1230  0.0801  0.0197  537 ASP B CB  
3201 C CG  . ASP B 210 ? 0.7230 0.7035 0.4856 0.1373  0.0769  0.0167  537 ASP B CG  
3202 O OD1 . ASP B 210 ? 0.7850 0.7549 0.5126 0.1426  0.0991  0.0263  537 ASP B OD1 
3203 O OD2 . ASP B 210 ? 0.7441 0.7105 0.4936 0.1439  0.0518  0.0038  537 ASP B OD2 
3204 N N   . HIS B 211 ? 0.5224 0.5909 0.4541 0.0902  0.0865  0.0349  538 HIS B N   
3205 C CA  . HIS B 211 ? 0.4927 0.5899 0.4726 0.0839  0.0853  0.0341  538 HIS B CA  
3206 C C   . HIS B 211 ? 0.4842 0.6091 0.4925 0.0748  0.1078  0.0401  538 HIS B C   
3207 O O   . HIS B 211 ? 0.4742 0.6257 0.5117 0.0794  0.1167  0.0346  538 HIS B O   
3208 C CB  . HIS B 211 ? 0.4629 0.5592 0.4622 0.0746  0.0644  0.0358  538 HIS B CB  
3209 C CG  . HIS B 211 ? 0.4462 0.5683 0.4864 0.0729  0.0614  0.0342  538 HIS B CG  
3210 N ND1 . HIS B 211 ? 0.4390 0.5843 0.5095 0.0611  0.0656  0.0393  538 HIS B ND1 
3211 C CD2 . HIS B 211 ? 0.4402 0.5682 0.4938 0.0837  0.0557  0.0273  538 HIS B CD2 
3212 C CE1 . HIS B 211 ? 0.4154 0.5809 0.5147 0.0658  0.0590  0.0352  538 HIS B CE1 
3213 N NE2 . HIS B 211 ? 0.4255 0.5798 0.5139 0.0801  0.0539  0.0291  538 HIS B NE2 
3214 N N   . VAL B 212 ? 0.4797 0.5979 0.4813 0.0624  0.1170  0.0501  539 VAL B N   
3215 C CA  . VAL B 212 ? 0.4805 0.6219 0.5117 0.0501  0.1406  0.0548  539 VAL B CA  
3216 C C   . VAL B 212 ? 0.5169 0.6691 0.5454 0.0583  0.1678  0.0518  539 VAL B C   
3217 O O   . VAL B 212 ? 0.5146 0.7030 0.5884 0.0547  0.1803  0.0465  539 VAL B O   
3218 C CB  . VAL B 212 ? 0.4873 0.6095 0.5044 0.0360  0.1481  0.0669  539 VAL B CB  
3219 C CG1 . VAL B 212 ? 0.4940 0.6341 0.5388 0.0221  0.1783  0.0710  539 VAL B CG1 
3220 C CG2 . VAL B 212 ? 0.4430 0.5641 0.4758 0.0268  0.1242  0.0679  539 VAL B CG2 
3221 N N   . THR B 213 ? 0.5599 0.6824 0.5362 0.0709  0.1756  0.0536  540 THR B N   
3222 C CA  . THR B 213 ? 0.6112 0.7375 0.5744 0.0816  0.2023  0.0508  540 THR B CA  
3223 C C   . THR B 213 ? 0.6078 0.7611 0.6001 0.0942  0.1977  0.0369  540 THR B C   
3224 O O   . THR B 213 ? 0.6009 0.7839 0.6252 0.0946  0.2199  0.0331  540 THR B O   
3225 C CB  . THR B 213 ? 0.6552 0.7391 0.5468 0.0961  0.2064  0.0542  540 THR B CB  
3226 O OG1 . THR B 213 ? 0.6721 0.7294 0.5352 0.0872  0.2104  0.0682  540 THR B OG1 
3227 C CG2 . THR B 213 ? 0.6899 0.7750 0.5630 0.1077  0.2380  0.0521  540 THR B CG2 
3228 N N   . PHE B 214 ? 0.6156 0.7579 0.5991 0.1042  0.1699  0.0292  541 PHE B N   
3229 C CA  . PHE B 214 ? 0.6240 0.7852 0.6330 0.1173  0.1628  0.0172  541 PHE B CA  
3230 C C   . PHE B 214 ? 0.5945 0.7996 0.6656 0.1103  0.1646  0.0155  541 PHE B C   
3231 O O   . PHE B 214 ? 0.6031 0.8348 0.7000 0.1204  0.1766  0.0077  541 PHE B O   
3232 C CB  . PHE B 214 ? 0.6229 0.7610 0.6167 0.1248  0.1331  0.0110  541 PHE B CB  
3233 C CG  . PHE B 214 ? 0.6219 0.7742 0.6424 0.1377  0.1255  0.0012  541 PHE B CG  
3234 C CD1 . PHE B 214 ? 0.6602 0.8019 0.6613 0.1563  0.1314  -0.0093 541 PHE B CD1 
3235 C CD2 . PHE B 214 ? 0.5977 0.7721 0.6597 0.1333  0.1125  0.0026  541 PHE B CD2 
3236 C CE1 . PHE B 214 ? 0.6564 0.8075 0.6804 0.1701  0.1251  -0.0175 541 PHE B CE1 
3237 C CE2 . PHE B 214 ? 0.5953 0.7791 0.6770 0.1485  0.1056  -0.0047 541 PHE B CE2 
3238 C CZ  . PHE B 214 ? 0.6273 0.7987 0.6907 0.1669  0.1122  -0.0144 541 PHE B CZ  
3239 N N   . ASN B 215 ? 0.5828 0.7962 0.6773 0.0949  0.1514  0.0210  542 ASN B N   
3240 C CA  . ASN B 215 ? 0.5766 0.8320 0.7283 0.0885  0.1492  0.0173  542 ASN B CA  
3241 C C   . ASN B 215 ? 0.5823 0.8702 0.7682 0.0789  0.1778  0.0163  542 ASN B C   
3242 O O   . ASN B 215 ? 0.5718 0.9018 0.8109 0.0768  0.1774  0.0086  542 ASN B O   
3243 C CB  . ASN B 215 ? 0.5645 0.8177 0.7277 0.0744  0.1291  0.0225  542 ASN B CB  
3244 C CG  . ASN B 215 ? 0.5858 0.8239 0.7399 0.0838  0.1023  0.0208  542 ASN B CG  
3245 O OD1 . ASN B 215 ? 0.5808 0.8144 0.7400 0.0746  0.0866  0.0248  542 ASN B OD1 
3246 N ND2 . ASN B 215 ? 0.6184 0.8457 0.7580 0.1018  0.0983  0.0149  542 ASN B ND2 
3247 N N   . ASN B 216 ? 0.6049 0.8729 0.7606 0.0736  0.2027  0.0235  543 ASN B N   
3248 C CA  . ASN B 216 ? 0.6175 0.9114 0.8035 0.0638  0.2356  0.0232  543 ASN B CA  
3249 C C   . ASN B 216 ? 0.6463 0.9439 0.8195 0.0805  0.2596  0.0178  543 ASN B C   
3250 O O   . ASN B 216 ? 0.6816 0.9827 0.8550 0.0749  0.2946  0.0213  543 ASN B O   
3251 C CB  . ASN B 216 ? 0.6381 0.9056 0.8012 0.0453  0.2524  0.0367  543 ASN B CB  
3252 C CG  . ASN B 216 ? 0.6425 0.9421 0.8574 0.0264  0.2815  0.0355  543 ASN B CG  
3253 O OD1 . ASN B 216 ? 0.6128 0.9529 0.8882 0.0167  0.2718  0.0259  543 ASN B OD1 
3254 N ND2 . ASN B 216 ? 0.6869 0.9676 0.8780 0.0213  0.3176  0.0444  543 ASN B ND2 
3255 N N   . GLY B 217 ? 0.6403 0.9341 0.8008 0.1014  0.2422  0.0095  544 GLY B N   
3256 C CA  . GLY B 217 ? 0.6697 0.9687 0.8209 0.1207  0.2606  0.0015  544 GLY B CA  
3257 C C   . GLY B 217 ? 0.7206 0.9794 0.8075 0.1260  0.2828  0.0082  544 GLY B C   
3258 O O   . GLY B 217 ? 0.7542 1.0209 0.8370 0.1360  0.3113  0.0041  544 GLY B O   
3259 N N   . GLY B 218 ? 0.7325 0.9487 0.7681 0.1212  0.2698  0.0179  545 GLY B N   
3260 C CA  . GLY B 218 ? 0.7901 0.9642 0.7558 0.1305  0.2850  0.0235  545 GLY B CA  
3261 C C   . GLY B 218 ? 0.8258 0.9839 0.7704 0.1168  0.3142  0.0388  545 GLY B C   
3262 O O   . GLY B 218 ? 0.8760 0.9949 0.7551 0.1266  0.3262  0.0452  545 GLY B O   
3263 N N   . LEU B 219 ? 0.8058 0.9915 0.8032 0.0952  0.3262  0.0440  546 LEU B N   
3264 C CA  . LEU B 219 ? 0.8497 1.0153 0.8310 0.0788  0.3527  0.0597  546 LEU B CA  
3265 C C   . LEU B 219 ? 0.8387 0.9829 0.8106 0.0658  0.3270  0.0688  546 LEU B C   
3266 O O   . LEU B 219 ? 0.8003 0.9656 0.8113 0.0593  0.2972  0.0624  546 LEU B O   
3267 C CB  . LEU B 219 ? 0.8458 1.0538 0.8956 0.0603  0.3857  0.0581  546 LEU B CB  
3268 C CG  . LEU B 219 ? 0.9185 1.1304 0.9667 0.0603  0.4367  0.0612  546 LEU B CG  
3269 C CD1 . LEU B 219 ? 0.8912 1.1682 1.0266 0.0551  0.4498  0.0452  546 LEU B CD1 
3270 C CD2 . LEU B 219 ? 0.9522 1.1328 0.9792 0.0419  0.4705  0.0795  546 LEU B CD2 
3271 N N   . ASN B 220 ? 0.8926 0.9931 0.8101 0.0637  0.3397  0.0841  547 ASN B N   
3272 C CA  . ASN B 220 ? 0.8798 0.9560 0.7834 0.0535  0.3182  0.0935  547 ASN B CA  
3273 C C   . ASN B 220 ? 0.8425 0.9443 0.8088 0.0273  0.3261  0.0958  547 ASN B C   
3274 O O   . ASN B 220 ? 0.8554 0.9839 0.8651 0.0148  0.3577  0.0941  547 ASN B O   
3275 C CB  . ASN B 220 ? 0.9661 0.9863 0.7901 0.0626  0.3303  0.1093  547 ASN B CB  
3276 C CG  . ASN B 220 ? 1.0020 0.9955 0.7618 0.0893  0.3110  0.1037  547 ASN B CG  
3277 O OD1 . ASN B 220 ? 0.9788 0.9843 0.7497 0.0968  0.2764  0.0905  547 ASN B OD1 
3278 N ND2 . ASN B 220 ? 1.0617 1.0176 0.7538 0.1041  0.3336  0.1126  547 ASN B ND2 
3279 N N   . ARG B 221 ? 0.7930 0.8886 0.7668 0.0191  0.2972  0.0974  548 ARG B N   
3280 C CA  . ARG B 221 ? 0.7763 0.8848 0.7967 -0.0051 0.3026  0.1003  548 ARG B CA  
3281 C C   . ARG B 221 ? 0.7863 0.8483 0.7619 -0.0081 0.2931  0.1145  548 ARG B C   
3282 O O   . ARG B 221 ? 0.7307 0.7956 0.7209 -0.0130 0.2634  0.1117  548 ARG B O   
3283 C CB  . ARG B 221 ? 0.7152 0.8703 0.8010 -0.0124 0.2758  0.0852  548 ARG B CB  
3284 C CG  . ARG B 221 ? 0.7031 0.9062 0.8369 -0.0072 0.2816  0.0704  548 ARG B CG  
3285 C CD  . ARG B 221 ? 0.6626 0.8992 0.8397 -0.0063 0.2465  0.0577  548 ARG B CD  
3286 N NE  . ARG B 221 ? 0.6491 0.9132 0.8822 -0.0274 0.2457  0.0526  548 ARG B NE  
3287 C CZ  . ARG B 221 ? 0.6250 0.9108 0.8894 -0.0297 0.2160  0.0439  548 ARG B CZ  
3288 N NH1 . ARG B 221 ? 0.5941 0.8757 0.8404 -0.0132 0.1862  0.0412  548 ARG B NH1 
3289 N NH2 . ARG B 221 ? 0.6170 0.9265 0.9299 -0.0489 0.2172  0.0375  548 ARG B NH2 
3290 N N   . PRO B 222 ? 0.8456 0.8629 0.7636 -0.0030 0.3194  0.1302  549 PRO B N   
3291 C CA  . PRO B 222 ? 0.8622 0.8305 0.7259 0.0017  0.3080  0.1441  549 PRO B CA  
3292 C C   . PRO B 222 ? 0.8353 0.8016 0.7338 -0.0203 0.3071  0.1485  549 PRO B C   
3293 O O   . PRO B 222 ? 0.8114 0.7576 0.6902 -0.0164 0.2806  0.1516  549 PRO B O   
3294 C CB  . PRO B 222 ? 0.9577 0.8807 0.7546 0.0129  0.3426  0.1601  549 PRO B CB  
3295 C CG  . PRO B 222 ? 0.9678 0.9151 0.7734 0.0198  0.3645  0.1523  549 PRO B CG  
3296 C CD  . PRO B 222 ? 0.8996 0.9073 0.7954 0.0014  0.3613  0.1364  549 PRO B CD  
3297 N N   . ASN B 223 ? 0.8388 0.8278 0.7914 -0.0429 0.3350  0.1464  550 ASN B N   
3298 C CA  . ASN B 223 ? 0.8180 0.8120 0.8145 -0.0662 0.3337  0.1455  550 ASN B CA  
3299 C C   . ASN B 223 ? 0.7408 0.7735 0.7838 -0.0694 0.2938  0.1294  550 ASN B C   
3300 O O   . ASN B 223 ? 0.7326 0.7528 0.7796 -0.0769 0.2765  0.1307  550 ASN B O   
3301 C CB  . ASN B 223 ? 0.8549 0.8687 0.9057 -0.0907 0.3735  0.1431  550 ASN B CB  
3302 C CG  . ASN B 223 ? 0.9691 0.9301 0.9757 -0.0954 0.4172  0.1635  550 ASN B CG  
3303 O OD1 . ASN B 223 ? 1.0189 0.9585 1.0406 -0.1153 0.4339  0.1698  550 ASN B OD1 
3304 N ND2 . ASN B 223 ? 1.0098 0.9458 0.9583 -0.0762 0.4372  0.1741  550 ASN B ND2 
3305 N N   . TYR B 224 ? 0.6911 0.7676 0.7657 -0.0623 0.2803  0.1147  551 TYR B N   
3306 C CA  . TYR B 224 ? 0.6292 0.7373 0.7389 -0.0617 0.2432  0.1012  551 TYR B CA  
3307 C C   . TYR B 224 ? 0.6092 0.6872 0.6716 -0.0467 0.2123  0.1064  551 TYR B C   
3308 O O   . TYR B 224 ? 0.5739 0.6529 0.6500 -0.0524 0.1898  0.1036  551 TYR B O   
3309 C CB  . TYR B 224 ? 0.5909 0.7464 0.7384 -0.0538 0.2358  0.0860  551 TYR B CB  
3310 C CG  . TYR B 224 ? 0.5421 0.7222 0.7149 -0.0496 0.1989  0.0747  551 TYR B CG  
3311 C CD1 . TYR B 224 ? 0.5119 0.7202 0.7358 -0.0646 0.1888  0.0649  551 TYR B CD1 
3312 C CD2 . TYR B 224 ? 0.5198 0.6923 0.6636 -0.0304 0.1750  0.0733  551 TYR B CD2 
3313 C CE1 . TYR B 224 ? 0.4645 0.6907 0.7031 -0.0580 0.1568  0.0561  551 TYR B CE1 
3314 C CE2 . TYR B 224 ? 0.4789 0.6681 0.6414 -0.0262 0.1456  0.0651  551 TYR B CE2 
3315 C CZ  . TYR B 224 ? 0.4471 0.6619 0.6536 -0.0388 0.1371  0.0576  551 TYR B CZ  
3316 O OH  . TYR B 224 ? 0.4201 0.6469 0.6374 -0.0325 0.1093  0.0511  551 TYR B OH  
3317 N N   . LEU B 225 ? 0.6399 0.6925 0.6484 -0.0275 0.2118  0.1123  552 LEU B N   
3318 C CA  . LEU B 225 ? 0.6468 0.6731 0.6136 -0.0130 0.1838  0.1150  552 LEU B CA  
3319 C C   . LEU B 225 ? 0.6708 0.6631 0.6171 -0.0194 0.1820  0.1263  552 LEU B C   
3320 O O   . LEU B 225 ? 0.6347 0.6244 0.5837 -0.0180 0.1555  0.1235  552 LEU B O   
3321 C CB  . LEU B 225 ? 0.6811 0.6858 0.5934 0.0084  0.1854  0.1172  552 LEU B CB  
3322 C CG  . LEU B 225 ? 0.6886 0.6710 0.5628 0.0242  0.1543  0.1157  552 LEU B CG  
3323 C CD1 . LEU B 225 ? 0.6393 0.6482 0.5389 0.0298  0.1286  0.1008  552 LEU B CD1 
3324 C CD2 . LEU B 225 ? 0.7389 0.6847 0.5453 0.0437  0.1611  0.1224  552 LEU B CD2 
3325 N N   . SER B 226 ? 0.7223 0.6881 0.6507 -0.0267 0.2124  0.1389  553 SER B N   
3326 C CA  . SER B 226 ? 0.7550 0.6845 0.6640 -0.0325 0.2146  0.1505  553 SER B CA  
3327 C C   . SER B 226 ? 0.7056 0.6562 0.6670 -0.0509 0.2016  0.1425  553 SER B C   
3328 O O   . SER B 226 ? 0.7091 0.6415 0.6582 -0.0481 0.1823  0.1449  553 SER B O   
3329 C CB  . SER B 226 ? 0.8455 0.7418 0.7310 -0.0395 0.2549  0.1657  553 SER B CB  
3330 O OG  . SER B 226 ? 0.9145 0.7701 0.7781 -0.0435 0.2575  0.1777  553 SER B OG  
3331 N N   . LYS B 227 ? 0.6795 0.6694 0.6989 -0.0680 0.2110  0.1315  554 LYS B N   
3332 C CA  . LYS B 227 ? 0.6622 0.6720 0.7292 -0.0847 0.1988  0.1219  554 LYS B CA  
3333 C C   . LYS B 227 ? 0.6168 0.6431 0.6886 -0.0745 0.1616  0.1130  554 LYS B C   
3334 O O   . LYS B 227 ? 0.6048 0.6231 0.6823 -0.0791 0.1460  0.1116  554 LYS B O   
3335 C CB  . LYS B 227 ? 0.6902 0.7414 0.8189 -0.1031 0.2147  0.1095  554 LYS B CB  
3336 C CG  . LYS B 227 ? 0.7242 0.7827 0.8948 -0.1239 0.2122  0.1014  554 LYS B CG  
3337 C CD  . LYS B 227 ? 0.7566 0.8539 0.9906 -0.1443 0.2325  0.0880  554 LYS B CD  
3338 C CE  . LYS B 227 ? 0.7801 0.8807 1.0540 -0.1658 0.2293  0.0777  554 LYS B CE  
3339 N NZ  . LYS B 227 ? 0.7398 0.8451 1.0112 -0.1589 0.1923  0.0703  554 LYS B NZ  
3340 N N   . LEU B 228 ? 0.5817 0.6263 0.6474 -0.0599 0.1500  0.1079  555 LEU B N   
3341 C CA  . LEU B 228 ? 0.5408 0.5967 0.6068 -0.0489 0.1196  0.1008  555 LEU B CA  
3342 C C   . LEU B 228 ? 0.5318 0.5541 0.5600 -0.0396 0.1033  0.1079  555 LEU B C   
3343 O O   . LEU B 228 ? 0.4963 0.5218 0.5376 -0.0418 0.0846  0.1038  555 LEU B O   
3344 C CB  . LEU B 228 ? 0.5542 0.6265 0.6143 -0.0347 0.1167  0.0957  555 LEU B CB  
3345 C CG  . LEU B 228 ? 0.5438 0.6370 0.6189 -0.0262 0.0921  0.0857  555 LEU B CG  
3346 C CD1 . LEU B 228 ? 0.5039 0.6259 0.6238 -0.0370 0.0840  0.0774  555 LEU B CD1 
3347 C CD2 . LEU B 228 ? 0.5501 0.6576 0.6230 -0.0143 0.0965  0.0806  555 LEU B CD2 
3348 N N   . LEU B 229 ? 0.5473 0.5386 0.5287 -0.0276 0.1101  0.1175  556 LEU B N   
3349 C CA  . LEU B 229 ? 0.5592 0.5206 0.5051 -0.0159 0.0940  0.1230  556 LEU B CA  
3350 C C   . LEU B 229 ? 0.5793 0.5187 0.5260 -0.0256 0.0987  0.1302  556 LEU B C   
3351 O O   . LEU B 229 ? 0.5730 0.5001 0.5104 -0.0190 0.0801  0.1303  556 LEU B O   
3352 C CB  . LEU B 229 ? 0.6049 0.5382 0.4961 0.0024  0.0981  0.1301  556 LEU B CB  
3353 C CG  . LEU B 229 ? 0.5823 0.5316 0.4662 0.0148  0.0904  0.1211  556 LEU B CG  
3354 C CD1 . LEU B 229 ? 0.6314 0.5502 0.4573 0.0320  0.1000  0.1284  556 LEU B CD1 
3355 C CD2 . LEU B 229 ? 0.5430 0.5062 0.4405 0.0213  0.0602  0.1095  556 LEU B CD2 
3356 N N   . GLY B 230 ? 0.5969 0.5321 0.5584 -0.0415 0.1241  0.1349  557 GLY B N   
3357 C CA  . GLY B 230 ? 0.5980 0.5135 0.5689 -0.0545 0.1306  0.1392  557 GLY B CA  
3358 C C   . GLY B 230 ? 0.5615 0.4984 0.5701 -0.0632 0.1106  0.1278  557 GLY B C   
3359 O O   . GLY B 230 ? 0.5751 0.4907 0.5825 -0.0682 0.1091  0.1304  557 GLY B O   
3360 N N   . LYS B 231 ? 0.5247 0.5001 0.5629 -0.0631 0.0957  0.1155  558 LYS B N   
3361 C CA  . LYS B 231 ? 0.5046 0.4968 0.5687 -0.0668 0.0758  0.1056  558 LYS B CA  
3362 C C   . LYS B 231 ? 0.5072 0.4816 0.5482 -0.0535 0.0565  0.1082  558 LYS B C   
3363 O O   . LYS B 231 ? 0.5316 0.5062 0.5855 -0.0570 0.0462  0.1037  558 LYS B O   
3364 C CB  . LYS B 231 ? 0.4820 0.5152 0.5776 -0.0672 0.0658  0.0935  558 LYS B CB  
3365 C CG  . LYS B 231 ? 0.4872 0.5471 0.6198 -0.0816 0.0802  0.0860  558 LYS B CG  
3366 C CD  . LYS B 231 ? 0.4885 0.5550 0.6510 -0.0969 0.0778  0.0773  558 LYS B CD  
3367 C CE  . LYS B 231 ? 0.5006 0.5921 0.7034 -0.1131 0.0943  0.0684  558 LYS B CE  
3368 N NZ  . LYS B 231 ? 0.5499 0.6271 0.7467 -0.1202 0.1236  0.0773  558 LYS B NZ  
3369 N N   . LEU B 232 ? 0.5129 0.4737 0.5216 -0.0377 0.0514  0.1135  559 LEU B N   
3370 C CA  . LEU B 232 ? 0.4999 0.4488 0.4924 -0.0243 0.0321  0.1133  559 LEU B CA  
3371 C C   . LEU B 232 ? 0.5276 0.4466 0.5063 -0.0232 0.0320  0.1198  559 LEU B C   
3372 O O   . LEU B 232 ? 0.5095 0.4335 0.5025 -0.0222 0.0185  0.1143  559 LEU B O   
3373 C CB  . LEU B 232 ? 0.5111 0.4537 0.4737 -0.0072 0.0247  0.1144  559 LEU B CB  
3374 C CG  . LEU B 232 ? 0.5085 0.4777 0.4853 -0.0034 0.0148  0.1045  559 LEU B CG  
3375 C CD1 . LEU B 232 ? 0.5015 0.4963 0.5067 -0.0150 0.0253  0.1005  559 LEU B CD1 
3376 C CD2 . LEU B 232 ? 0.5467 0.5045 0.4890 0.0121  0.0121  0.1051  559 LEU B CD2 
3377 N N   . PRO B 233 ? 0.5546 0.4405 0.5048 -0.0225 0.0488  0.1319  560 PRO B N   
3378 C CA  . PRO B 233 ? 0.5805 0.4338 0.5166 -0.0202 0.0496  0.1385  560 PRO B CA  
3379 C C   . PRO B 233 ? 0.5618 0.4237 0.5332 -0.0367 0.0504  0.1311  560 PRO B C   
3380 O O   . PRO B 233 ? 0.5838 0.4323 0.5533 -0.0314 0.0407  0.1303  560 PRO B O   
3381 C CB  . PRO B 233 ? 0.6280 0.4445 0.5314 -0.0211 0.0745  0.1532  560 PRO B CB  
3382 C CG  . PRO B 233 ? 0.6282 0.4538 0.5137 -0.0141 0.0800  0.1552  560 PRO B CG  
3383 C CD  . PRO B 233 ? 0.5819 0.4546 0.5076 -0.0216 0.0691  0.1408  560 PRO B CD  
3384 N N   . GLU B 234 ? 0.5435 0.4290 0.5470 -0.0548 0.0603  0.1241  561 GLU B N   
3385 C CA  . GLU B 234 ? 0.5322 0.4313 0.5698 -0.0696 0.0580  0.1133  561 GLU B CA  
3386 C C   . GLU B 234 ? 0.4936 0.4120 0.5436 -0.0624 0.0359  0.1039  561 GLU B C   
3387 O O   . GLU B 234 ? 0.4690 0.3843 0.5315 -0.0676 0.0318  0.0977  561 GLU B O   
3388 C CB  . GLU B 234 ? 0.5439 0.4717 0.6147 -0.0868 0.0691  0.1051  561 GLU B CB  
3389 C CG  . GLU B 234 ? 0.6282 0.5366 0.6927 -0.0970 0.0963  0.1137  561 GLU B CG  
3390 C CD  . GLU B 234 ? 0.6499 0.5918 0.7550 -0.1143 0.1087  0.1035  561 GLU B CD  
3391 O OE1 . GLU B 234 ? 0.7156 0.6434 0.8216 -0.1251 0.1347  0.1097  561 GLU B OE1 
3392 O OE2 . GLU B 234 ? 0.5836 0.5649 0.7190 -0.1161 0.0938  0.0898  561 GLU B OE2 
3393 N N   . LEU B 235 ? 0.4816 0.4174 0.5274 -0.0505 0.0236  0.1027  562 LEU B N   
3394 C CA  . LEU B 235 ? 0.4458 0.3953 0.5016 -0.0436 0.0071  0.0956  562 LEU B CA  
3395 C C   . LEU B 235 ? 0.4649 0.3917 0.5087 -0.0343 0.0006  0.0981  562 LEU B C   
3396 O O   . LEU B 235 ? 0.4361 0.3710 0.4936 -0.0332 -0.0074 0.0913  562 LEU B O   
3397 C CB  . LEU B 235 ? 0.4184 0.3862 0.4732 -0.0337 -0.0025 0.0935  562 LEU B CB  
3398 C CG  . LEU B 235 ? 0.3970 0.3910 0.4665 -0.0385 -0.0004 0.0890  562 LEU B CG  
3399 C CD1 . LEU B 235 ? 0.3750 0.3772 0.4385 -0.0272 -0.0093 0.0875  562 LEU B CD1 
3400 C CD2 . LEU B 235 ? 0.3771 0.3892 0.4694 -0.0455 -0.0041 0.0809  562 LEU B CD2 
3401 N N   . ARG B 236 ? 0.4896 0.3878 0.5065 -0.0258 0.0044  0.1077  563 ARG B N   
3402 C CA  . ARG B 236 ? 0.5132 0.3903 0.5191 -0.0136 -0.0033 0.1096  563 ARG B CA  
3403 C C   . ARG B 236 ? 0.5001 0.3655 0.5187 -0.0231 0.0017  0.1058  563 ARG B C   
3404 O O   . ARG B 236 ? 0.4690 0.3380 0.4977 -0.0171 -0.0073 0.0997  563 ARG B O   
3405 C CB  . ARG B 236 ? 0.5983 0.4421 0.5664 0.0007  -0.0008 0.1216  563 ARG B CB  
3406 C CG  . ARG B 236 ? 0.6412 0.4751 0.6007 0.0201  -0.0166 0.1206  563 ARG B CG  
3407 C CD  . ARG B 236 ? 0.7677 0.5585 0.6880 0.0355  -0.0134 0.1331  563 ARG B CD  
3408 N NE  . ARG B 236 ? 0.8541 0.6425 0.7785 0.0526  -0.0297 0.1283  563 ARG B NE  
3409 C CZ  . ARG B 236 ? 0.9121 0.6755 0.8347 0.0554  -0.0261 0.1305  563 ARG B CZ  
3410 N NH1 . ARG B 236 ? 0.9554 0.6892 0.8696 0.0415  -0.0066 0.1377  563 ARG B NH1 
3411 N NH2 . ARG B 236 ? 0.9133 0.6814 0.8448 0.0725  -0.0418 0.1241  563 ARG B NH2 
3412 N N   . THR B 237 ? 0.4860 0.3384 0.5061 -0.0382 0.0172  0.1079  564 THR B N   
3413 C CA  . THR B 237 ? 0.4918 0.3333 0.5255 -0.0498 0.0224  0.1014  564 THR B CA  
3414 C C   . THR B 237 ? 0.4376 0.3103 0.4972 -0.0548 0.0124  0.0874  564 THR B C   
3415 O O   . THR B 237 ? 0.4361 0.3008 0.4995 -0.0526 0.0083  0.0813  564 THR B O   
3416 C CB  . THR B 237 ? 0.5261 0.3563 0.5662 -0.0686 0.0410  0.1025  564 THR B CB  
3417 O OG1 . THR B 237 ? 0.6064 0.4074 0.6173 -0.0627 0.0533  0.1177  564 THR B OG1 
3418 C CG2 . THR B 237 ? 0.5455 0.3533 0.5948 -0.0792 0.0468  0.0957  564 THR B CG2 
3419 N N   . LEU B 238 ? 0.3890 0.2940 0.4625 -0.0593 0.0093  0.0830  565 LEU B N   
3420 C CA  . LEU B 238 ? 0.3718 0.3034 0.4625 -0.0607 0.0002  0.0719  565 LEU B CA  
3421 C C   . LEU B 238 ? 0.3592 0.2926 0.4469 -0.0471 -0.0091 0.0711  565 LEU B C   
3422 O O   . LEU B 238 ? 0.3566 0.2961 0.4514 -0.0468 -0.0125 0.0630  565 LEU B O   
3423 C CB  . LEU B 238 ? 0.3472 0.3098 0.4500 -0.0647 -0.0013 0.0689  565 LEU B CB  
3424 C CG  . LEU B 238 ? 0.3678 0.3350 0.4845 -0.0805 0.0084  0.0647  565 LEU B CG  
3425 C CD1 . LEU B 238 ? 0.3643 0.3547 0.4883 -0.0816 0.0114  0.0665  565 LEU B CD1 
3426 C CD2 . LEU B 238 ? 0.3603 0.3387 0.4946 -0.0894 0.0038  0.0502  565 LEU B CD2 
3427 N N   . CYS B 239 ? 0.3633 0.2919 0.4408 -0.0354 -0.0129 0.0783  566 CYS B N   
3428 C CA  . CYS B 239 ? 0.3548 0.2878 0.4362 -0.0231 -0.0211 0.0760  566 CYS B CA  
3429 C C   . CYS B 239 ? 0.3741 0.2866 0.4532 -0.0182 -0.0206 0.0741  566 CYS B C   
3430 O O   . CYS B 239 ? 0.3568 0.2770 0.4469 -0.0155 -0.0221 0.0672  566 CYS B O   
3431 C CB  . CYS B 239 ? 0.3715 0.3064 0.4452 -0.0114 -0.0280 0.0809  566 CYS B CB  
3432 S SG  . CYS B 239 ? 0.4025 0.3442 0.4889 0.0036  -0.0389 0.0753  566 CYS B SG  
3433 N N   . THR B 240 ? 0.3963 0.2805 0.4593 -0.0167 -0.0162 0.0806  567 THR B N   
3434 C CA  . THR B 240 ? 0.4333 0.2918 0.4911 -0.0112 -0.0145 0.0796  567 THR B CA  
3435 C C   . THR B 240 ? 0.4245 0.2849 0.4937 -0.0222 -0.0102 0.0690  567 THR B C   
3436 O O   . THR B 240 ? 0.4239 0.2786 0.4968 -0.0147 -0.0118 0.0632  567 THR B O   
3437 C CB  . THR B 240 ? 0.4827 0.3035 0.5166 -0.0095 -0.0070 0.0903  567 THR B CB  
3438 O OG1 . THR B 240 ? 0.5123 0.3320 0.5298 0.0036  -0.0128 0.0992  567 THR B OG1 
3439 C CG2 . THR B 240 ? 0.5293 0.3195 0.5547 0.0002  -0.0062 0.0905  567 THR B CG2 
3440 N N   . GLN B 241 ? 0.4162 0.2863 0.4915 -0.0380 -0.0057 0.0650  568 GLN B N   
3441 C CA  . GLN B 241 ? 0.4336 0.3075 0.5174 -0.0466 -0.0051 0.0523  568 GLN B CA  
3442 C C   . GLN B 241 ? 0.3944 0.2905 0.4841 -0.0391 -0.0108 0.0459  568 GLN B C   
3443 O O   . GLN B 241 ? 0.4016 0.2907 0.4901 -0.0368 -0.0103 0.0373  568 GLN B O   
3444 C CB  . GLN B 241 ? 0.4300 0.3144 0.5234 -0.0635 -0.0021 0.0460  568 GLN B CB  
3445 C CG  . GLN B 241 ? 0.4888 0.3518 0.5806 -0.0743 0.0084  0.0516  568 GLN B CG  
3446 C CD  . GLN B 241 ? 0.5068 0.3898 0.6175 -0.0917 0.0116  0.0434  568 GLN B CD  
3447 O OE1 . GLN B 241 ? 0.5706 0.4441 0.6843 -0.1016 0.0229  0.0489  568 GLN B OE1 
3448 N NE2 . GLN B 241 ? 0.4992 0.4088 0.6220 -0.0942 0.0022  0.0299  568 GLN B NE2 
3449 N N   . GLY B 242 ? 0.3760 0.2945 0.4702 -0.0347 -0.0144 0.0505  569 GLY B N   
3450 C CA  . GLY B 242 ? 0.3508 0.2856 0.4502 -0.0275 -0.0159 0.0469  569 GLY B CA  
3451 C C   . GLY B 242 ? 0.3576 0.2849 0.4611 -0.0156 -0.0150 0.0463  569 GLY B C   
3452 O O   . GLY B 242 ? 0.3750 0.3048 0.4806 -0.0116 -0.0111 0.0402  569 GLY B O   
3453 N N   . LEU B 243 ? 0.3504 0.2694 0.4546 -0.0084 -0.0183 0.0523  570 LEU B N   
3454 C CA  . LEU B 243 ? 0.3672 0.2814 0.4792 0.0051  -0.0198 0.0505  570 LEU B CA  
3455 C C   . LEU B 243 ? 0.3752 0.2678 0.4812 0.0074  -0.0148 0.0448  570 LEU B C   
3456 O O   . LEU B 243 ? 0.3674 0.2643 0.4832 0.0155  -0.0118 0.0389  570 LEU B O   
3457 C CB  . LEU B 243 ? 0.3992 0.3051 0.5064 0.0149  -0.0275 0.0577  570 LEU B CB  
3458 C CG  . LEU B 243 ? 0.4334 0.3541 0.5587 0.0299  -0.0351 0.0545  570 LEU B CG  
3459 C CD1 . LEU B 243 ? 0.4058 0.3568 0.5542 0.0259  -0.0336 0.0490  570 LEU B CD1 
3460 C CD2 . LEU B 243 ? 0.4518 0.3640 0.5647 0.0410  -0.0460 0.0610  570 LEU B CD2 
3461 N N   . GLN B 244 ? 0.3960 0.2654 0.4877 -0.0006 -0.0125 0.0457  571 GLN B N   
3462 C CA  . GLN B 244 ? 0.4294 0.2753 0.5146 -0.0007 -0.0077 0.0380  571 GLN B CA  
3463 C C   . GLN B 244 ? 0.4197 0.2776 0.5069 -0.0030 -0.0042 0.0265  571 GLN B C   
3464 O O   . GLN B 244 ? 0.4306 0.2773 0.5163 0.0048  -0.0002 0.0193  571 GLN B O   
3465 C CB  . GLN B 244 ? 0.4574 0.2754 0.5308 -0.0121 -0.0042 0.0399  571 GLN B CB  
3466 C CG  . GLN B 244 ? 0.4626 0.2823 0.5366 -0.0287 -0.0018 0.0292  571 GLN B CG  
3467 C CD  . GLN B 244 ? 0.5014 0.2917 0.5709 -0.0408 0.0041  0.0292  571 GLN B CD  
3468 O OE1 . GLN B 244 ? 0.5390 0.2946 0.5991 -0.0349 0.0089  0.0327  571 GLN B OE1 
3469 N NE2 . GLN B 244 ? 0.4915 0.2940 0.5692 -0.0576 0.0048  0.0242  571 GLN B NE2 
3470 N N   . ARG B 245 ? 0.4001 0.2790 0.4876 -0.0115 -0.0055 0.0251  572 ARG B N   
3471 C CA  . ARG B 245 ? 0.4056 0.2939 0.4872 -0.0107 -0.0025 0.0159  572 ARG B CA  
3472 C C   . ARG B 245 ? 0.3879 0.2866 0.4774 0.0016  0.0041  0.0167  572 ARG B C   
3473 O O   . ARG B 245 ? 0.4102 0.3020 0.4932 0.0080  0.0110  0.0090  572 ARG B O   
3474 C CB  . ARG B 245 ? 0.3962 0.3040 0.4746 -0.0192 -0.0067 0.0160  572 ARG B CB  
3475 C CG  . ARG B 245 ? 0.4055 0.3221 0.4711 -0.0147 -0.0045 0.0096  572 ARG B CG  
3476 C CD  . ARG B 245 ? 0.4499 0.3513 0.5013 -0.0165 -0.0066 -0.0045 572 ARG B CD  
3477 N NE  . ARG B 245 ? 0.4815 0.3879 0.5120 -0.0101 -0.0065 -0.0120 572 ARG B NE  
3478 C CZ  . ARG B 245 ? 0.5224 0.4142 0.5345 -0.0047 -0.0051 -0.0247 572 ARG B CZ  
3479 N NH1 . ARG B 245 ? 0.5403 0.4117 0.5560 -0.0057 -0.0030 -0.0314 572 ARG B NH1 
3480 N NH2 . ARG B 245 ? 0.5505 0.4449 0.5368 0.0040  -0.0047 -0.0301 572 ARG B NH2 
3481 N N   . ILE B 246 ? 0.3563 0.2713 0.4616 0.0047  0.0031  0.0247  573 ILE B N   
3482 C CA  . ILE B 246 ? 0.3444 0.2721 0.4665 0.0140  0.0104  0.0240  573 ILE B CA  
3483 C C   . ILE B 246 ? 0.3501 0.2659 0.4805 0.0253  0.0130  0.0191  573 ILE B C   
3484 O O   . ILE B 246 ? 0.3543 0.2735 0.4913 0.0325  0.0241  0.0132  573 ILE B O   
3485 C CB  . ILE B 246 ? 0.3302 0.2780 0.4724 0.0140  0.0061  0.0304  573 ILE B CB  
3486 C CG1 . ILE B 246 ? 0.3429 0.3009 0.4765 0.0051  0.0061  0.0345  573 ILE B CG1 
3487 C CG2 . ILE B 246 ? 0.3116 0.2744 0.4815 0.0226  0.0135  0.0267  573 ILE B CG2 
3488 C CD1 . ILE B 246 ? 0.3616 0.3328 0.5066 0.0025  -0.0012 0.0403  573 ILE B CD1 
3489 N N   . PHE B 247 ? 0.3376 0.2382 0.4664 0.0283  0.0044  0.0222  574 PHE B N   
3490 C CA  . PHE B 247 ? 0.3530 0.2365 0.4851 0.0411  0.0049  0.0184  574 PHE B CA  
3491 C C   . PHE B 247 ? 0.3697 0.2361 0.4880 0.0416  0.0140  0.0087  574 PHE B C   
3492 O O   . PHE B 247 ? 0.3821 0.2487 0.5100 0.0534  0.0214  0.0023  574 PHE B O   
3493 C CB  . PHE B 247 ? 0.3653 0.2240 0.4848 0.0429  -0.0041 0.0256  574 PHE B CB  
3494 C CG  . PHE B 247 ? 0.3923 0.2260 0.5094 0.0580  -0.0039 0.0229  574 PHE B CG  
3495 C CD1 . PHE B 247 ? 0.3930 0.2364 0.5280 0.0765  -0.0101 0.0234  574 PHE B CD1 
3496 C CD2 . PHE B 247 ? 0.4214 0.2218 0.5200 0.0548  0.0013  0.0182  574 PHE B CD2 
3497 C CE1 . PHE B 247 ? 0.4253 0.2448 0.5574 0.0939  -0.0110 0.0211  574 PHE B CE1 
3498 C CE2 . PHE B 247 ? 0.4508 0.2239 0.5456 0.0701  0.0022  0.0161  574 PHE B CE2 
3499 C CZ  . PHE B 247 ? 0.4546 0.2371 0.5652 0.0909  -0.0038 0.0183  574 PHE B CZ  
3500 N N   . TYR B 248 ? 0.3779 0.2304 0.4752 0.0295  0.0130  0.0060  575 TYR B N   
3501 C CA  . TYR B 248 ? 0.4120 0.2472 0.4928 0.0294  0.0188  -0.0058 575 TYR B CA  
3502 C C   . TYR B 248 ? 0.4173 0.2682 0.4974 0.0361  0.0298  -0.0111 575 TYR B C   
3503 O O   . TYR B 248 ? 0.4266 0.2674 0.5049 0.0470  0.0389  -0.0192 575 TYR B O   
3504 C CB  . TYR B 248 ? 0.4246 0.2498 0.4884 0.0140  0.0132  -0.0107 575 TYR B CB  
3505 C CG  . TYR B 248 ? 0.4637 0.2731 0.5094 0.0152  0.0166  -0.0263 575 TYR B CG  
3506 C CD1 . TYR B 248 ? 0.4980 0.2757 0.5380 0.0178  0.0182  -0.0346 575 TYR B CD1 
3507 C CD2 . TYR B 248 ? 0.4719 0.2950 0.5025 0.0164  0.0190  -0.0330 575 TYR B CD2 
3508 C CE1 . TYR B 248 ? 0.5382 0.3004 0.5608 0.0205  0.0210  -0.0509 575 TYR B CE1 
3509 C CE2 . TYR B 248 ? 0.5127 0.3200 0.5215 0.0209  0.0216  -0.0485 575 TYR B CE2 
3510 C CZ  . TYR B 248 ? 0.5456 0.3237 0.5519 0.0220  0.0219  -0.0585 575 TYR B CZ  
3511 O OH  . TYR B 248 ? 0.6002 0.3607 0.5841 0.0270  0.0239  -0.0760 575 TYR B OH  
3512 N N   . LEU B 249 ? 0.4063 0.2788 0.4863 0.0305  0.0310  -0.0061 576 LEU B N   
3513 C CA  . LEU B 249 ? 0.4265 0.3089 0.5003 0.0362  0.0447  -0.0085 576 LEU B CA  
3514 C C   . LEU B 249 ? 0.4329 0.3250 0.5324 0.0475  0.0574  -0.0087 576 LEU B C   
3515 O O   . LEU B 249 ? 0.4652 0.3523 0.5575 0.0561  0.0726  -0.0153 576 LEU B O   
3516 C CB  . LEU B 249 ? 0.4104 0.3100 0.4797 0.0294  0.0443  -0.0009 576 LEU B CB  
3517 C CG  . LEU B 249 ? 0.4179 0.3127 0.4629 0.0208  0.0326  -0.0037 576 LEU B CG  
3518 C CD1 . LEU B 249 ? 0.4030 0.3155 0.4487 0.0154  0.0293  0.0053  576 LEU B CD1 
3519 C CD2 . LEU B 249 ? 0.4640 0.3437 0.4768 0.0261  0.0354  -0.0159 576 LEU B CD2 
3520 N N   . LYS B 250 ? 0.4237 0.3299 0.5534 0.0486  0.0510  -0.0029 577 LYS B N   
3521 C CA  . LYS B 250 ? 0.4342 0.3552 0.5976 0.0599  0.0596  -0.0059 577 LYS B CA  
3522 C C   . LYS B 250 ? 0.4610 0.3654 0.6240 0.0730  0.0636  -0.0147 577 LYS B C   
3523 O O   . LYS B 250 ? 0.4618 0.3735 0.6393 0.0826  0.0795  -0.0213 577 LYS B O   
3524 C CB  . LYS B 250 ? 0.4224 0.3631 0.6166 0.0602  0.0470  -0.0006 577 LYS B CB  
3525 C CG  . LYS B 250 ? 0.4192 0.3816 0.6555 0.0721  0.0512  -0.0064 577 LYS B CG  
3526 C CD  . LYS B 250 ? 0.4107 0.3951 0.6742 0.0714  0.0363  -0.0034 577 LYS B CD  
3527 C CE  . LYS B 250 ? 0.4008 0.4129 0.7131 0.0828  0.0394  -0.0130 577 LYS B CE  
3528 N NZ  . LYS B 250 ? 0.3933 0.4213 0.7245 0.0754  0.0635  -0.0165 577 LYS B NZ  
3529 N N   . LEU B 251 ? 0.4834 0.3632 0.6297 0.0735  0.0511  -0.0150 578 LEU B N   
3530 C CA  . LEU B 251 ? 0.5134 0.3712 0.6555 0.0862  0.0543  -0.0233 578 LEU B CA  
3531 C C   . LEU B 251 ? 0.5349 0.3763 0.6504 0.0867  0.0671  -0.0336 578 LEU B C   
3532 O O   . LEU B 251 ? 0.5544 0.3898 0.6742 0.0999  0.0784  -0.0422 578 LEU B O   
3533 C CB  . LEU B 251 ? 0.5491 0.3797 0.6801 0.0866  0.0397  -0.0196 578 LEU B CB  
3534 C CG  . LEU B 251 ? 0.5547 0.3969 0.7152 0.1035  0.0336  -0.0169 578 LEU B CG  
3535 C CD1 . LEU B 251 ? 0.5424 0.4060 0.7162 0.0983  0.0208  -0.0064 578 LEU B CD1 
3536 C CD2 . LEU B 251 ? 0.5922 0.4008 0.7431 0.1176  0.0286  -0.0183 578 LEU B CD2 
3537 N N   . GLU B 252 ? 0.5396 0.3756 0.6273 0.0742  0.0651  -0.0338 579 GLU B N   
3538 C CA  . GLU B 252 ? 0.5801 0.4010 0.6369 0.0766  0.0747  -0.0450 579 GLU B CA  
3539 C C   . GLU B 252 ? 0.5908 0.4277 0.6539 0.0861  0.0959  -0.0458 579 GLU B C   
3540 O O   . GLU B 252 ? 0.6104 0.4342 0.6605 0.0974  0.1095  -0.0560 579 GLU B O   
3541 C CB  . GLU B 252 ? 0.5744 0.3918 0.6030 0.0633  0.0650  -0.0457 579 GLU B CB  
3542 C CG  . GLU B 252 ? 0.6121 0.4157 0.6036 0.0678  0.0714  -0.0583 579 GLU B CG  
3543 C CD  . GLU B 252 ? 0.6135 0.4178 0.5810 0.0567  0.0574  -0.0610 579 GLU B CD  
3544 O OE1 . GLU B 252 ? 0.6437 0.4283 0.5916 0.0537  0.0480  -0.0759 579 GLU B OE1 
3545 O OE2 . GLU B 252 ? 0.5823 0.4073 0.5533 0.0513  0.0554  -0.0499 579 GLU B OE2 
3546 N N   . ASP B 253 ? 0.5670 0.4304 0.6512 0.0816  0.1007  -0.0355 580 ASP B N   
3547 C CA  . ASP B 253 ? 0.5744 0.4544 0.6761 0.0886  0.1240  -0.0350 580 ASP B CA  
3548 C C   . ASP B 253 ? 0.6168 0.4831 0.6778 0.0926  0.1423  -0.0385 580 ASP B C   
3549 O O   . ASP B 253 ? 0.6435 0.5119 0.7098 0.1023  0.1663  -0.0421 580 ASP B O   
3550 C CB  . ASP B 253 ? 0.5908 0.4766 0.7267 0.1023  0.1314  -0.0423 580 ASP B CB  
3551 C CG  . ASP B 253 ? 0.5902 0.5038 0.7643 0.1062  0.1541  -0.0416 580 ASP B CG  
3552 O OD1 . ASP B 253 ? 0.5720 0.5032 0.7585 0.0959  0.1583  -0.0332 580 ASP B OD1 
3553 O OD2 . ASP B 253 ? 0.6062 0.5239 0.8002 0.1189  0.1686  -0.0502 580 ASP B OD2 
3554 N N   . LEU B 254 ? 0.6336 0.4852 0.6533 0.0868  0.1308  -0.0388 581 LEU B N   
3555 C CA  . LEU B 254 ? 0.6720 0.5095 0.6457 0.0929  0.1437  -0.0415 581 LEU B CA  
3556 C C   . LEU B 254 ? 0.6579 0.5074 0.6267 0.0872  0.1505  -0.0277 581 LEU B C   
3557 O O   . LEU B 254 ? 0.6833 0.5272 0.6317 0.0944  0.1740  -0.0238 581 LEU B O   
3558 C CB  . LEU B 254 ? 0.7050 0.5194 0.6354 0.0931  0.1254  -0.0540 581 LEU B CB  
3559 C CG  . LEU B 254 ? 0.7371 0.5289 0.6560 0.1024  0.1263  -0.0708 581 LEU B CG  
3560 C CD1 . LEU B 254 ? 0.7544 0.5270 0.6446 0.0970  0.1035  -0.0847 581 LEU B CD1 
3561 C CD2 . LEU B 254 ? 0.7833 0.5638 0.6777 0.1188  0.1529  -0.0768 581 LEU B CD2 
3562 N N   . VAL B 255 ? 0.6264 0.4898 0.6126 0.0752  0.1324  -0.0197 582 VAL B N   
3563 C CA  . VAL B 255 ? 0.6097 0.4857 0.6016 0.0692  0.1385  -0.0060 582 VAL B CA  
3564 C C   . VAL B 255 ? 0.5611 0.4612 0.6066 0.0594  0.1313  0.0000  582 VAL B C   
3565 O O   . VAL B 255 ? 0.5288 0.4353 0.5807 0.0509  0.1101  0.0030  582 VAL B O   
3566 C CB  . VAL B 255 ? 0.6255 0.4952 0.5794 0.0661  0.1221  -0.0028 582 VAL B CB  
3567 C CG1 . VAL B 255 ? 0.6103 0.4821 0.5553 0.0662  0.1364  0.0109  582 VAL B CG1 
3568 C CG2 . VAL B 255 ? 0.6672 0.5156 0.5701 0.0756  0.1163  -0.0145 582 VAL B CG2 
3569 N N   . PRO B 256 ? 0.5628 0.4769 0.6474 0.0614  0.1489  0.0003  583 PRO B N   
3570 C CA  . PRO B 256 ? 0.5266 0.4644 0.6634 0.0559  0.1391  0.0011  583 PRO B CA  
3571 C C   . PRO B 256 ? 0.4997 0.4496 0.6470 0.0450  0.1331  0.0109  583 PRO B C   
3572 O O   . PRO B 256 ? 0.5415 0.4843 0.6681 0.0431  0.1469  0.0177  583 PRO B O   
3573 C CB  . PRO B 256 ? 0.5307 0.4828 0.7068 0.0620  0.1628  -0.0039 583 PRO B CB  
3574 C CG  . PRO B 256 ? 0.5708 0.5028 0.7118 0.0715  0.1859  -0.0073 583 PRO B CG  
3575 C CD  . PRO B 256 ? 0.5911 0.4998 0.6728 0.0705  0.1796  -0.0023 583 PRO B CD  
3576 N N   . PRO B 257 ? 0.4697 0.4344 0.6442 0.0395  0.1129  0.0117  584 PRO B N   
3577 C CA  . PRO B 257 ? 0.4360 0.4102 0.6174 0.0298  0.1074  0.0197  584 PRO B CA  
3578 C C   . PRO B 257 ? 0.4200 0.4091 0.6375 0.0263  0.1281  0.0205  584 PRO B C   
3579 O O   . PRO B 257 ? 0.4282 0.4294 0.6798 0.0304  0.1407  0.0132  584 PRO B O   
3580 C CB  . PRO B 257 ? 0.4154 0.3999 0.6153 0.0275  0.0823  0.0187  584 PRO B CB  
3581 C CG  . PRO B 257 ? 0.4376 0.4254 0.6588 0.0370  0.0801  0.0103  584 PRO B CG  
3582 C CD  . PRO B 257 ? 0.4644 0.4333 0.6576 0.0434  0.0942  0.0064  584 PRO B CD  
3583 N N   . PRO B 258 ? 0.3988 0.3864 0.6110 0.0188  0.1330  0.0284  585 PRO B N   
3584 C CA  . PRO B 258 ? 0.3845 0.3847 0.6371 0.0131  0.1538  0.0274  585 PRO B CA  
3585 C C   . PRO B 258 ? 0.3513 0.3804 0.6593 0.0092  0.1379  0.0184  585 PRO B C   
3586 O O   . PRO B 258 ? 0.3235 0.3583 0.6294 0.0110  0.1106  0.0167  585 PRO B O   
3587 C CB  . PRO B 258 ? 0.3985 0.3842 0.6258 0.0070  0.1602  0.0387  585 PRO B CB  
3588 C CG  . PRO B 258 ? 0.3806 0.3618 0.5766 0.0075  0.1317  0.0422  585 PRO B CG  
3589 C CD  . PRO B 258 ? 0.3872 0.3628 0.5624 0.0153  0.1216  0.0371  585 PRO B CD  
3590 N N   . ALA B 259 ? 0.3458 0.3919 0.7022 0.0041  0.1558  0.0121  586 ALA B N   
3591 C CA  . ALA B 259 ? 0.3232 0.4011 0.7395 0.0021  0.1428  -0.0007 586 ALA B CA  
3592 C C   . ALA B 259 ? 0.2929 0.3772 0.7080 -0.0011 0.1132  -0.0005 586 ALA B C   
3593 O O   . ALA B 259 ? 0.2778 0.3793 0.7131 0.0054  0.0893  -0.0089 586 ALA B O   
3594 C CB  . ALA B 259 ? 0.3167 0.4110 0.7871 -0.0069 0.1703  -0.0081 586 ALA B CB  
3595 N N   . ILE B 260 ? 0.2908 0.3594 0.6782 -0.0088 0.1143  0.0092  587 ILE B N   
3596 C CA  . ILE B 260 ? 0.2828 0.3573 0.6697 -0.0117 0.0896  0.0087  587 ILE B CA  
3597 C C   . ILE B 260 ? 0.2791 0.3462 0.6299 -0.0036 0.0641  0.0130  587 ILE B C   
3598 O O   . ILE B 260 ? 0.2625 0.3400 0.6214 -0.0010 0.0411  0.0087  587 ILE B O   
3599 C CB  . ILE B 260 ? 0.3122 0.3728 0.6851 -0.0215 0.0988  0.0166  587 ILE B CB  
3600 C CG1 . ILE B 260 ? 0.3059 0.3764 0.6872 -0.0243 0.0744  0.0124  587 ILE B CG1 
3601 C CG2 . ILE B 260 ? 0.3264 0.3590 0.6405 -0.0187 0.1058  0.0316  587 ILE B CG2 
3602 C CD1 . ILE B 260 ? 0.3023 0.4013 0.7429 -0.0269 0.0664  -0.0049 587 ILE B CD1 
3603 N N   . ILE B 261 ? 0.2863 0.3345 0.5978 0.0006  0.0688  0.0202  588 ILE B N   
3604 C CA  . ILE B 261 ? 0.2836 0.3223 0.5652 0.0066  0.0493  0.0230  588 ILE B CA  
3605 C C   . ILE B 261 ? 0.2811 0.3299 0.5859 0.0166  0.0393  0.0145  588 ILE B C   
3606 O O   . ILE B 261 ? 0.2689 0.3181 0.5691 0.0213  0.0190  0.0143  588 ILE B O   
3607 C CB  . ILE B 261 ? 0.2981 0.3147 0.5351 0.0075  0.0559  0.0296  588 ILE B CB  
3608 C CG1 . ILE B 261 ? 0.3062 0.3142 0.5178 0.0012  0.0592  0.0381  588 ILE B CG1 
3609 C CG2 . ILE B 261 ? 0.2996 0.3060 0.5161 0.0123  0.0398  0.0292  588 ILE B CG2 
3610 C CD1 . ILE B 261 ? 0.3294 0.3192 0.4967 0.0035  0.0619  0.0427  588 ILE B CD1 
3611 N N   . ASP B 262 ? 0.2890 0.3450 0.6178 0.0210  0.0547  0.0077  589 ASP B N   
3612 C CA  . ASP B 262 ? 0.3080 0.3758 0.6634 0.0329  0.0468  -0.0016 589 ASP B CA  
3613 C C   . ASP B 262 ? 0.2972 0.3882 0.6873 0.0367  0.0262  -0.0095 589 ASP B C   
3614 O O   . ASP B 262 ? 0.2892 0.3784 0.6735 0.0484  0.0062  -0.0109 589 ASP B O   
3615 C CB  . ASP B 262 ? 0.3247 0.4044 0.7129 0.0356  0.0703  -0.0097 589 ASP B CB  
3616 C CG  . ASP B 262 ? 0.3478 0.4108 0.7136 0.0450  0.0774  -0.0098 589 ASP B CG  
3617 O OD1 . ASP B 262 ? 0.3627 0.4058 0.6933 0.0496  0.0624  -0.0053 589 ASP B OD1 
3618 O OD2 . ASP B 262 ? 0.3637 0.4330 0.7488 0.0475  0.0996  -0.0152 589 ASP B OD2 
3619 N N   . LYS B 263 ? 0.2827 0.3927 0.7064 0.0274  0.0319  -0.0149 590 LYS B N   
3620 C CA  . LYS B 263 ? 0.2910 0.4252 0.7498 0.0301  0.0120  -0.0259 590 LYS B CA  
3621 C C   . LYS B 263 ? 0.2625 0.3838 0.6837 0.0338  -0.0130 -0.0189 590 LYS B C   
3622 O O   . LYS B 263 ? 0.2568 0.3848 0.6817 0.0472  -0.0349 -0.0242 590 LYS B O   
3623 C CB  . LYS B 263 ? 0.3090 0.4613 0.8099 0.0161  0.0258  -0.0338 590 LYS B CB  
3624 C CG  . LYS B 263 ? 0.3295 0.5018 0.8574 0.0152  0.0037  -0.0453 590 LYS B CG  
3625 C CD  . LYS B 263 ? 0.3551 0.5251 0.8938 -0.0024 0.0179  -0.0449 590 LYS B CD  
3626 C CE  . LYS B 263 ? 0.3669 0.5680 0.9768 -0.0099 0.0243  -0.0649 590 LYS B CE  
3627 N NZ  . LYS B 263 ? 0.3891 0.6192 1.0314 0.0005  -0.0081 -0.0838 590 LYS B NZ  
3628 N N   . LEU B 264 ? 0.2543 0.3565 0.6385 0.0237  -0.0085 -0.0069 591 LEU B N   
3629 C CA  . LEU B 264 ? 0.2606 0.3502 0.6094 0.0259  -0.0273 0.0002  591 LEU B CA  
3630 C C   . LEU B 264 ? 0.2620 0.3329 0.5791 0.0376  -0.0374 0.0066  591 LEU B C   
3631 O O   . LEU B 264 ? 0.2364 0.3034 0.5397 0.0472  -0.0563 0.0075  591 LEU B O   
3632 C CB  . LEU B 264 ? 0.2756 0.3505 0.5945 0.0136  -0.0185 0.0111  591 LEU B CB  
3633 C CG  . LEU B 264 ? 0.3044 0.3823 0.6169 0.0110  -0.0320 0.0109  591 LEU B CG  
3634 C CD1 . LEU B 264 ? 0.3248 0.4256 0.6842 0.0082  -0.0331 -0.0035 591 LEU B CD1 
3635 C CD2 . LEU B 264 ? 0.3194 0.3831 0.6024 0.0012  -0.0230 0.0216  591 LEU B CD2 
3636 N N   . PHE B 265 ? 0.2640 0.3211 0.5685 0.0374  -0.0239 0.0106  592 PHE B N   
3637 C CA  . PHE B 265 ? 0.2885 0.3235 0.5651 0.0466  -0.0298 0.0157  592 PHE B CA  
3638 C C   . PHE B 265 ? 0.3011 0.3447 0.5972 0.0647  -0.0450 0.0081  592 PHE B C   
3639 O O   . PHE B 265 ? 0.3138 0.3420 0.5858 0.0747  -0.0601 0.0132  592 PHE B O   
3640 C CB  . PHE B 265 ? 0.3011 0.3226 0.5668 0.0437  -0.0122 0.0168  592 PHE B CB  
3641 C CG  . PHE B 265 ? 0.3208 0.3181 0.5636 0.0526  -0.0163 0.0192  592 PHE B CG  
3642 C CD1 . PHE B 265 ? 0.3281 0.3010 0.5341 0.0458  -0.0185 0.0277  592 PHE B CD1 
3643 C CD2 . PHE B 265 ? 0.3289 0.3271 0.5890 0.0672  -0.0164 0.0121  592 PHE B CD2 
3644 C CE1 . PHE B 265 ? 0.3488 0.2945 0.5343 0.0518  -0.0197 0.0294  592 PHE B CE1 
3645 C CE2 . PHE B 265 ? 0.3612 0.3314 0.5976 0.0759  -0.0194 0.0147  592 PHE B CE2 
3646 C CZ  . PHE B 265 ? 0.3654 0.3076 0.5639 0.0671  -0.0204 0.0236  592 PHE B CZ  
3647 N N   . LEU B 266 ? 0.3051 0.3724 0.6444 0.0698  -0.0399 -0.0038 593 LEU B N   
3648 C CA  . LEU B 266 ? 0.3186 0.3998 0.6838 0.0895  -0.0550 -0.0140 593 LEU B CA  
3649 C C   . LEU B 266 ? 0.3273 0.4229 0.6996 0.0983  -0.0799 -0.0192 593 LEU B C   
3650 O O   . LEU B 266 ? 0.3470 0.4354 0.7072 0.1178  -0.0986 -0.0196 593 LEU B O   
3651 C CB  . LEU B 266 ? 0.3151 0.4241 0.7325 0.0914  -0.0414 -0.0277 593 LEU B CB  
3652 C CG  . LEU B 266 ? 0.3367 0.4308 0.7457 0.0903  -0.0187 -0.0253 593 LEU B CG  
3653 C CD1 . LEU B 266 ? 0.3316 0.4562 0.7954 0.0894  -0.0002 -0.0387 593 LEU B CD1 
3654 C CD2 . LEU B 266 ? 0.3500 0.4179 0.7309 0.1070  -0.0265 -0.0214 593 LEU B CD2 
3655 N N   . ASP B 267 ? 0.3099 0.4231 0.6989 0.0854  -0.0802 -0.0236 594 ASP B N   
3656 C CA  . ASP B 267 ? 0.3299 0.4566 0.7237 0.0928  -0.1042 -0.0310 594 ASP B CA  
3657 C C   . ASP B 267 ? 0.3515 0.4474 0.6868 0.1012  -0.1181 -0.0171 594 ASP B C   
3658 O O   . ASP B 267 ? 0.3750 0.4729 0.7017 0.1191  -0.1411 -0.0216 594 ASP B O   
3659 C CB  . ASP B 267 ? 0.3061 0.4508 0.7244 0.0746  -0.0980 -0.0376 594 ASP B CB  
3660 C CG  . ASP B 267 ? 0.2948 0.4753 0.7811 0.0693  -0.0898 -0.0563 594 ASP B CG  
3661 O OD1 . ASP B 267 ? 0.3017 0.4988 0.8181 0.0822  -0.0943 -0.0662 594 ASP B OD1 
3662 O OD2 . ASP B 267 ? 0.2919 0.4837 0.8045 0.0526  -0.0773 -0.0616 594 ASP B OD2 
3663 N N   . THR B 268 ? 0.3463 0.4140 0.6420 0.0892  -0.1036 -0.0010 595 THR B N   
3664 C CA  . THR B 268 ? 0.3672 0.4087 0.6134 0.0912  -0.1108 0.0117  595 THR B CA  
3665 C C   . THR B 268 ? 0.4024 0.4119 0.6141 0.1033  -0.1113 0.0225  595 THR B C   
3666 O O   . THR B 268 ? 0.4317 0.4151 0.6009 0.1078  -0.1158 0.0340  595 THR B O   
3667 C CB  . THR B 268 ? 0.3460 0.3789 0.5739 0.0702  -0.0956 0.0211  595 THR B CB  
3668 O OG1 . THR B 268 ? 0.3496 0.3733 0.5769 0.0601  -0.0772 0.0259  595 THR B OG1 
3669 C CG2 . THR B 268 ? 0.3169 0.3757 0.5750 0.0589  -0.0944 0.0115  595 THR B CG2 
3670 N N   . LEU B 269 ? 0.4063 0.4134 0.6328 0.1083  -0.1042 0.0198  596 LEU B N   
3671 C CA  . LEU B 269 ? 0.4483 0.4186 0.6403 0.1191  -0.1026 0.0302  596 LEU B CA  
3672 C C   . LEU B 269 ? 0.4963 0.4512 0.6646 0.1448  -0.1229 0.0330  596 LEU B C   
3673 O O   . LEU B 269 ? 0.5015 0.4800 0.6972 0.1630  -0.1396 0.0206  596 LEU B O   
3674 C CB  . LEU B 269 ? 0.4617 0.4308 0.6732 0.1217  -0.0914 0.0250  596 LEU B CB  
3675 C CG  . LEU B 269 ? 0.4757 0.4252 0.6739 0.1053  -0.0705 0.0301  596 LEU B CG  
3676 C CD1 . LEU B 269 ? 0.4846 0.4207 0.6881 0.1193  -0.0667 0.0260  596 LEU B CD1 
3677 C CD2 . LEU B 269 ? 0.4772 0.3941 0.6325 0.0944  -0.0659 0.0438  596 LEU B CD2 
3678 N N   . PRO B 270 ? 0.5407 0.4548 0.6581 0.1473  -0.1204 0.0491  597 PRO B N   
3679 C CA  . PRO B 270 ? 0.5840 0.4738 0.6652 0.1730  -0.1369 0.0558  597 PRO B CA  
3680 C C   . PRO B 270 ? 0.6094 0.4817 0.6881 0.1969  -0.1432 0.0552  597 PRO B C   
3681 O O   . PRO B 270 ? 0.6769 0.5238 0.7199 0.2212  -0.1566 0.0623  597 PRO B O   
3682 C CB  . PRO B 270 ? 0.6214 0.4688 0.6516 0.1628  -0.1228 0.0747  597 PRO B CB  
3683 C CG  . PRO B 270 ? 0.5870 0.4524 0.6341 0.1332  -0.1076 0.0734  597 PRO B CG  
3684 C CD  . PRO B 270 ? 0.5438 0.4347 0.6353 0.1251  -0.1017 0.0612  597 PRO B CD  
3685 N N   . PHE B 271 ? 0.5797 0.4637 0.6927 0.1929  -0.1340 0.0468  598 PHE B N   
3686 C CA  . PHE B 271 ? 0.6173 0.4874 0.7327 0.2185  -0.1407 0.0441  598 PHE B CA  
3687 C C   . PHE B 271 ? 0.5921 0.4982 0.7634 0.2149  -0.1343 0.0274  598 PHE B C   
3688 O O   . PHE B 271 ? 0.6262 0.5300 0.8108 0.2359  -0.1388 0.0215  598 PHE B O   
3689 C CB  . PHE B 271 ? 0.6543 0.4648 0.7228 0.2198  -0.1262 0.0607  598 PHE B CB  
3690 C CG  . PHE B 271 ? 0.6240 0.4210 0.6866 0.1872  -0.1019 0.0662  598 PHE B CG  
3691 C CD1 . PHE B 271 ? 0.5955 0.4044 0.6876 0.1747  -0.0882 0.0566  598 PHE B CD1 
3692 C CD2 . PHE B 271 ? 0.6173 0.3919 0.6460 0.1706  -0.0932 0.0794  598 PHE B CD2 
3693 C CE1 . PHE B 271 ? 0.5847 0.3835 0.6703 0.1473  -0.0696 0.0591  598 PHE B CE1 
3694 C CE2 . PHE B 271 ? 0.6047 0.3727 0.6337 0.1421  -0.0738 0.0814  598 PHE B CE2 
3695 C CZ  . PHE B 271 ? 0.5860 0.3661 0.6425 0.1309  -0.0636 0.0708  598 PHE B CZ  
3696 O OXT . PHE B 271 ? 0.5431 0.4779 0.7444 0.1917  -0.1223 0.0207  598 PHE B OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   328 ?   ?   ?   A . n 
A 1 2   VAL 2   329 ?   ?   ?   A . n 
A 1 3   LYS 3   330 ?   ?   ?   A . n 
A 1 4   GLU 4   331 ?   ?   ?   A . n 
A 1 5   VAL 5   332 ?   ?   ?   A . n 
A 1 6   VAL 6   333 ?   ?   ?   A . n 
A 1 7   ARG 7   334 ?   ?   ?   A . n 
A 1 8   THR 8   335 ?   ?   ?   A . n 
A 1 9   ASP 9   336 ?   ?   ?   A . n 
A 1 10  SER 10  337 ?   ?   ?   A . n 
A 1 11  LEU 11  338 ?   ?   ?   A . n 
A 1 12  LYS 12  339 ?   ?   ?   A . n 
A 1 13  GLY 13  340 ?   ?   ?   A . n 
A 1 14  ARG 14  341 ?   ?   ?   A . n 
A 1 15  ARG 15  342 ?   ?   ?   A . n 
A 1 16  GLY 16  343 ?   ?   ?   A . n 
A 1 17  ARG 17  344 ?   ?   ?   A . n 
A 1 18  LEU 18  345 ?   ?   ?   A . n 
A 1 19  PRO 19  346 ?   ?   ?   A . n 
A 1 20  SER 20  347 ?   ?   ?   A . n 
A 1 21  LYS 21  348 ?   ?   ?   A . n 
A 1 22  PRO 22  349 ?   ?   ?   A . n 
A 1 23  LYS 23  350 ?   ?   ?   A . n 
A 1 24  SER 24  351 ?   ?   ?   A . n 
A 1 25  PRO 25  352 ?   ?   ?   A . n 
A 1 26  GLN 26  353 ?   ?   ?   A . n 
A 1 27  GLU 27  354 ?   ?   ?   A . n 
A 1 28  PRO 28  355 ?   ?   ?   A . n 
A 1 29  SER 29  356 ?   ?   ?   A . n 
A 1 30  PRO 30  357 ?   ?   ?   A . n 
A 1 31  PRO 31  358 ?   ?   ?   A . n 
A 1 32  SER 32  359 ?   ?   ?   A . n 
A 1 33  PRO 33  360 ?   ?   ?   A . n 
A 1 34  PRO 34  361 ?   ?   ?   A . n 
A 1 35  VAL 35  362 362 VAL VAL A . n 
A 1 36  SER 36  363 363 SER SER A . n 
A 1 37  LEU 37  364 364 LEU LEU A . n 
A 1 38  ILE 38  365 365 ILE ILE A . n 
A 1 39  SER 39  366 366 SER SER A . n 
A 1 40  ALA 40  367 367 ALA ALA A . n 
A 1 41  LEU 41  368 368 LEU LEU A . n 
A 1 42  VAL 42  369 369 VAL VAL A . n 
A 1 43  ARG 43  370 370 ARG ARG A . n 
A 1 44  ALA 44  371 371 ALA ALA A . n 
A 1 45  HIS 45  372 372 HIS HIS A . n 
A 1 46  VAL 46  373 373 VAL VAL A . n 
A 1 47  ASP 47  374 374 ASP ASP A . n 
A 1 48  SER 48  375 375 SER SER A . n 
A 1 49  ASN 49  376 376 ASN ASN A . n 
A 1 50  PRO 50  377 377 PRO PRO A . n 
A 1 51  ALA 51  378 378 ALA ALA A . n 
A 1 52  MET 52  379 379 MET MET A . n 
A 1 53  THR 53  380 380 THR THR A . n 
A 1 54  SER 54  381 381 SER SER A . n 
A 1 55  LEU 55  382 382 LEU LEU A . n 
A 1 56  ASP 56  383 383 ASP ASP A . n 
A 1 57  TYR 57  384 384 TYR TYR A . n 
A 1 58  SER 58  385 385 SER SER A . n 
A 1 59  ARG 59  386 386 ARG ARG A . n 
A 1 60  PHE 60  387 387 PHE PHE A . n 
A 1 61  GLN 61  388 388 GLN GLN A . n 
A 1 62  ALA 62  389 389 ALA ALA A . n 
A 1 63  ASN 63  390 390 ASN ASN A . n 
A 1 64  PRO 64  391 391 PRO PRO A . n 
A 1 65  ASP 65  392 392 ASP ASP A . n 
A 1 66  TYR 66  393 ?   ?   ?   A . n 
A 1 67  GLN 67  394 ?   ?   ?   A . n 
A 1 68  MET 68  395 ?   ?   ?   A . n 
A 1 69  SER 69  396 ?   ?   ?   A . n 
A 1 70  GLY 70  397 ?   ?   ?   A . n 
A 1 71  ASP 71  398 398 ASP ASP A . n 
A 1 72  ASP 72  399 399 ASP ASP A . n 
A 1 73  THR 73  400 400 THR THR A . n 
A 1 74  GLN 74  401 401 GLN GLN A . n 
A 1 75  HIS 75  402 402 HIS HIS A . n 
A 1 76  ILE 76  403 403 ILE ILE A . n 
A 1 77  GLN 77  404 404 GLN GLN A . n 
A 1 78  GLN 78  405 405 GLN GLN A . n 
A 1 79  PHE 79  406 406 PHE PHE A . n 
A 1 80  TYR 80  407 407 TYR TYR A . n 
A 1 81  ASP 81  408 408 ASP ASP A . n 
A 1 82  LEU 82  409 409 LEU LEU A . n 
A 1 83  LEU 83  410 410 LEU LEU A . n 
A 1 84  THR 84  411 411 THR THR A . n 
A 1 85  GLY 85  412 412 GLY GLY A . n 
A 1 86  SER 86  413 413 SER SER A . n 
A 1 87  MET 87  414 414 MET MET A . n 
A 1 88  GLU 88  415 415 GLU GLU A . n 
A 1 89  ILE 89  416 416 ILE ILE A . n 
A 1 90  ILE 90  417 417 ILE ILE A . n 
A 1 91  ARG 91  418 418 ARG ARG A . n 
A 1 92  GLY 92  419 419 GLY GLY A . n 
A 1 93  TRP 93  420 420 TRP TRP A . n 
A 1 94  ALA 94  421 421 ALA ALA A . n 
A 1 95  GLU 95  422 422 GLU GLU A . n 
A 1 96  LYS 96  423 423 LYS LYS A . n 
A 1 97  ILE 97  424 424 ILE ILE A . n 
A 1 98  PRO 98  425 425 PRO PRO A . n 
A 1 99  GLY 99  426 426 GLY GLY A . n 
A 1 100 PHE 100 427 427 PHE PHE A . n 
A 1 101 ALA 101 428 428 ALA ALA A . n 
A 1 102 ASP 102 429 429 ASP ASP A . n 
A 1 103 LEU 103 430 430 LEU LEU A . n 
A 1 104 PRO 104 431 431 PRO PRO A . n 
A 1 105 LYS 105 432 432 LYS LYS A . n 
A 1 106 ALA 106 433 433 ALA ALA A . n 
A 1 107 ASP 107 434 434 ASP ASP A . n 
A 1 108 GLN 108 435 435 GLN GLN A . n 
A 1 109 ASP 109 436 436 ASP ASP A . n 
A 1 110 LEU 110 437 437 LEU LEU A . n 
A 1 111 LEU 111 438 438 LEU LEU A . n 
A 1 112 PHE 112 439 439 PHE PHE A . n 
A 1 113 GLU 113 440 440 GLU GLU A . n 
A 1 114 SER 114 441 441 SER SER A . n 
A 1 115 ALA 115 442 442 ALA ALA A . n 
A 1 116 PHE 116 443 443 PHE PHE A . n 
A 1 117 LEU 117 444 444 LEU LEU A . n 
A 1 118 GLU 118 445 445 GLU GLU A . n 
A 1 119 LEU 119 446 446 LEU LEU A . n 
A 1 120 PHE 120 447 447 PHE PHE A . n 
A 1 121 VAL 121 448 448 VAL VAL A . n 
A 1 122 LEU 122 449 449 LEU LEU A . n 
A 1 123 ARG 123 450 450 ARG ARG A . n 
A 1 124 LEU 124 451 451 LEU LEU A . n 
A 1 125 ALA 125 452 452 ALA ALA A . n 
A 1 126 TYR 126 453 453 TYR TYR A . n 
A 1 127 ARG 127 454 454 ARG ARG A . n 
A 1 128 SER 128 455 455 SER SER A . n 
A 1 129 ASN 129 456 456 ASN ASN A . n 
A 1 130 PRO 130 457 457 PRO PRO A . n 
A 1 131 VAL 131 458 458 VAL VAL A . n 
A 1 132 GLU 132 459 459 GLU GLU A . n 
A 1 133 GLY 133 460 460 GLY GLY A . n 
A 1 134 LYS 134 461 461 LYS LYS A . n 
A 1 135 LEU 135 462 462 LEU LEU A . n 
A 1 136 ILE 136 463 463 ILE ILE A . n 
A 1 137 PHE 137 464 464 PHE PHE A . n 
A 1 138 CYS 138 465 465 CYS CYS A . n 
A 1 139 ASN 139 466 466 ASN ASN A . n 
A 1 140 GLY 140 467 467 GLY GLY A . n 
A 1 141 VAL 141 468 468 VAL VAL A . n 
A 1 142 VAL 142 469 469 VAL VAL A . n 
A 1 143 LEU 143 470 470 LEU LEU A . n 
A 1 144 HIS 144 471 471 HIS HIS A . n 
A 1 145 ARG 145 472 472 ARG ARG A . n 
A 1 146 LEU 146 473 473 LEU LEU A . n 
A 1 147 GLN 147 474 474 GLN GLN A . n 
A 1 148 CYS 148 475 475 CYS CYS A . n 
A 1 149 VAL 149 476 476 VAL VAL A . n 
A 1 150 ARG 150 477 477 ARG ARG A . n 
A 1 151 GLY 151 478 478 GLY GLY A . n 
A 1 152 PHE 152 479 479 PHE PHE A . n 
A 1 153 GLY 153 480 480 GLY GLY A . n 
A 1 154 GLU 154 481 481 GLU GLU A . n 
A 1 155 TRP 155 482 482 TRP TRP A . n 
A 1 156 ILE 156 483 483 ILE ILE A . n 
A 1 157 ASP 157 484 484 ASP ASP A . n 
A 1 158 SER 158 485 485 SER SER A . n 
A 1 159 ILE 159 486 486 ILE ILE A . n 
A 1 160 VAL 160 487 487 VAL VAL A . n 
A 1 161 GLU 161 488 488 GLU GLU A . n 
A 1 162 PHE 162 489 489 PHE PHE A . n 
A 1 163 SER 163 490 490 SER SER A . n 
A 1 164 SER 164 491 491 SER SER A . n 
A 1 165 ASN 165 492 492 ASN ASN A . n 
A 1 166 LEU 166 493 493 LEU LEU A . n 
A 1 167 GLN 167 494 494 GLN GLN A . n 
A 1 168 ASN 168 495 495 ASN ASN A . n 
A 1 169 MET 169 496 496 MET MET A . n 
A 1 170 ASN 170 497 497 ASN ASN A . n 
A 1 171 ILE 171 498 498 ILE ILE A . n 
A 1 172 ASP 172 499 499 ASP ASP A . n 
A 1 173 ILE 173 500 500 ILE ILE A . n 
A 1 174 SER 174 501 501 SER SER A . n 
A 1 175 ALA 175 502 502 ALA ALA A . n 
A 1 176 PHE 176 503 503 PHE PHE A . n 
A 1 177 SER 177 504 504 SER SER A . n 
A 1 178 CYS 178 505 505 CYS CYS A . n 
A 1 179 ILE 179 506 506 ILE ILE A . n 
A 1 180 ALA 180 507 507 ALA ALA A . n 
A 1 181 ALA 181 508 508 ALA ALA A . n 
A 1 182 LEU 182 509 509 LEU LEU A . n 
A 1 183 ALA 183 510 510 ALA ALA A . n 
A 1 184 MET 184 511 511 MET MET A . n 
A 1 185 VAL 185 512 512 VAL VAL A . n 
A 1 186 THR 186 513 513 THR THR A . n 
A 1 187 GLU 187 514 514 GLU GLU A . n 
A 1 188 ARG 188 515 515 ARG ARG A . n 
A 1 189 HIS 189 516 516 HIS HIS A . n 
A 1 190 GLY 190 517 517 GLY GLY A . n 
A 1 191 LEU 191 518 518 LEU LEU A . n 
A 1 192 LYS 192 519 519 LYS LYS A . n 
A 1 193 GLU 193 520 520 GLU GLU A . n 
A 1 194 PRO 194 521 521 PRO PRO A . n 
A 1 195 LYS 195 522 522 LYS LYS A . n 
A 1 196 ARG 196 523 523 ARG ARG A . n 
A 1 197 VAL 197 524 524 VAL VAL A . n 
A 1 198 GLU 198 525 525 GLU GLU A . n 
A 1 199 GLU 199 526 526 GLU GLU A . n 
A 1 200 LEU 200 527 527 LEU LEU A . n 
A 1 201 GLN 201 528 528 GLN GLN A . n 
A 1 202 ASN 202 529 529 ASN ASN A . n 
A 1 203 LYS 203 530 530 LYS LYS A . n 
A 1 204 ILE 204 531 531 ILE ILE A . n 
A 1 205 VAL 205 532 532 VAL VAL A . n 
A 1 206 ASN 206 533 533 ASN ASN A . n 
A 1 207 CYS 207 534 534 CYS CYS A . n 
A 1 208 LEU 208 535 535 LEU LEU A . n 
A 1 209 LYS 209 536 536 LYS LYS A . n 
A 1 210 ASP 210 537 537 ASP ASP A . n 
A 1 211 HIS 211 538 538 HIS HIS A . n 
A 1 212 VAL 212 539 539 VAL VAL A . n 
A 1 213 THR 213 540 540 THR THR A . n 
A 1 214 PHE 214 541 541 PHE PHE A . n 
A 1 215 ASN 215 542 542 ASN ASN A . n 
A 1 216 ASN 216 543 543 ASN ASN A . n 
A 1 217 GLY 217 544 544 GLY GLY A . n 
A 1 218 GLY 218 545 545 GLY GLY A . n 
A 1 219 LEU 219 546 546 LEU LEU A . n 
A 1 220 ASN 220 547 547 ASN ASN A . n 
A 1 221 ARG 221 548 548 ARG ARG A . n 
A 1 222 PRO 222 549 549 PRO PRO A . n 
A 1 223 ASN 223 550 550 ASN ASN A . n 
A 1 224 TYR 224 551 551 TYR TYR A . n 
A 1 225 LEU 225 552 552 LEU LEU A . n 
A 1 226 SER 226 553 553 SER SER A . n 
A 1 227 LYS 227 554 554 LYS LYS A . n 
A 1 228 LEU 228 555 555 LEU LEU A . n 
A 1 229 LEU 229 556 556 LEU LEU A . n 
A 1 230 GLY 230 557 557 GLY GLY A . n 
A 1 231 LYS 231 558 558 LYS LYS A . n 
A 1 232 LEU 232 559 559 LEU LEU A . n 
A 1 233 PRO 233 560 560 PRO PRO A . n 
A 1 234 GLU 234 561 561 GLU GLU A . n 
A 1 235 LEU 235 562 562 LEU LEU A . n 
A 1 236 ARG 236 563 563 ARG ARG A . n 
A 1 237 THR 237 564 564 THR THR A . n 
A 1 238 LEU 238 565 565 LEU LEU A . n 
A 1 239 CYS 239 566 566 CYS CYS A . n 
A 1 240 THR 240 567 567 THR THR A . n 
A 1 241 GLN 241 568 568 GLN GLN A . n 
A 1 242 GLY 242 569 569 GLY GLY A . n 
A 1 243 LEU 243 570 570 LEU LEU A . n 
A 1 244 GLN 244 571 571 GLN GLN A . n 
A 1 245 ARG 245 572 572 ARG ARG A . n 
A 1 246 ILE 246 573 573 ILE ILE A . n 
A 1 247 PHE 247 574 574 PHE PHE A . n 
A 1 248 TYR 248 575 575 TYR TYR A . n 
A 1 249 LEU 249 576 576 LEU LEU A . n 
A 1 250 LYS 250 577 577 LYS LYS A . n 
A 1 251 LEU 251 578 578 LEU LEU A . n 
A 1 252 GLU 252 579 579 GLU GLU A . n 
A 1 253 ASP 253 580 580 ASP ASP A . n 
A 1 254 LEU 254 581 581 LEU LEU A . n 
A 1 255 VAL 255 582 582 VAL VAL A . n 
A 1 256 PRO 256 583 583 PRO PRO A . n 
A 1 257 PRO 257 584 584 PRO PRO A . n 
A 1 258 PRO 258 585 585 PRO PRO A . n 
A 1 259 ALA 259 586 586 ALA ALA A . n 
A 1 260 ILE 260 587 587 ILE ILE A . n 
A 1 261 ILE 261 588 588 ILE ILE A . n 
A 1 262 ASP 262 589 589 ASP ASP A . n 
A 1 263 LYS 263 590 590 LYS LYS A . n 
A 1 264 LEU 264 591 591 LEU LEU A . n 
A 1 265 PHE 265 592 592 PHE PHE A . n 
A 1 266 LEU 266 593 593 LEU LEU A . n 
A 1 267 ASP 267 594 594 ASP ASP A . n 
A 1 268 THR 268 595 595 THR THR A . n 
A 1 269 LEU 269 596 596 LEU LEU A . n 
A 1 270 PRO 270 597 597 PRO PRO A . n 
A 1 271 PHE 271 598 598 PHE PHE A . n 
B 1 1   MET 1   328 ?   ?   ?   B . n 
B 1 2   VAL 2   329 ?   ?   ?   B . n 
B 1 3   LYS 3   330 ?   ?   ?   B . n 
B 1 4   GLU 4   331 ?   ?   ?   B . n 
B 1 5   VAL 5   332 ?   ?   ?   B . n 
B 1 6   VAL 6   333 ?   ?   ?   B . n 
B 1 7   ARG 7   334 ?   ?   ?   B . n 
B 1 8   THR 8   335 ?   ?   ?   B . n 
B 1 9   ASP 9   336 ?   ?   ?   B . n 
B 1 10  SER 10  337 ?   ?   ?   B . n 
B 1 11  LEU 11  338 ?   ?   ?   B . n 
B 1 12  LYS 12  339 ?   ?   ?   B . n 
B 1 13  GLY 13  340 ?   ?   ?   B . n 
B 1 14  ARG 14  341 ?   ?   ?   B . n 
B 1 15  ARG 15  342 ?   ?   ?   B . n 
B 1 16  GLY 16  343 ?   ?   ?   B . n 
B 1 17  ARG 17  344 ?   ?   ?   B . n 
B 1 18  LEU 18  345 ?   ?   ?   B . n 
B 1 19  PRO 19  346 ?   ?   ?   B . n 
B 1 20  SER 20  347 ?   ?   ?   B . n 
B 1 21  LYS 21  348 ?   ?   ?   B . n 
B 1 22  PRO 22  349 ?   ?   ?   B . n 
B 1 23  LYS 23  350 ?   ?   ?   B . n 
B 1 24  SER 24  351 ?   ?   ?   B . n 
B 1 25  PRO 25  352 ?   ?   ?   B . n 
B 1 26  GLN 26  353 ?   ?   ?   B . n 
B 1 27  GLU 27  354 ?   ?   ?   B . n 
B 1 28  PRO 28  355 ?   ?   ?   B . n 
B 1 29  SER 29  356 ?   ?   ?   B . n 
B 1 30  PRO 30  357 ?   ?   ?   B . n 
B 1 31  PRO 31  358 ?   ?   ?   B . n 
B 1 32  SER 32  359 ?   ?   ?   B . n 
B 1 33  PRO 33  360 360 PRO PRO B . n 
B 1 34  PRO 34  361 361 PRO PRO B . n 
B 1 35  VAL 35  362 362 VAL VAL B . n 
B 1 36  SER 36  363 363 SER SER B . n 
B 1 37  LEU 37  364 364 LEU LEU B . n 
B 1 38  ILE 38  365 365 ILE ILE B . n 
B 1 39  SER 39  366 366 SER SER B . n 
B 1 40  ALA 40  367 367 ALA ALA B . n 
B 1 41  LEU 41  368 368 LEU LEU B . n 
B 1 42  VAL 42  369 369 VAL VAL B . n 
B 1 43  ARG 43  370 370 ARG ARG B . n 
B 1 44  ALA 44  371 371 ALA ALA B . n 
B 1 45  HIS 45  372 372 HIS HIS B . n 
B 1 46  VAL 46  373 373 VAL VAL B . n 
B 1 47  ASP 47  374 374 ASP ASP B . n 
B 1 48  SER 48  375 375 SER SER B . n 
B 1 49  ASN 49  376 376 ASN ASN B . n 
B 1 50  PRO 50  377 377 PRO PRO B . n 
B 1 51  ALA 51  378 378 ALA ALA B . n 
B 1 52  MET 52  379 379 MET MET B . n 
B 1 53  THR 53  380 380 THR THR B . n 
B 1 54  SER 54  381 381 SER SER B . n 
B 1 55  LEU 55  382 382 LEU LEU B . n 
B 1 56  ASP 56  383 383 ASP ASP B . n 
B 1 57  TYR 57  384 384 TYR TYR B . n 
B 1 58  SER 58  385 385 SER SER B . n 
B 1 59  ARG 59  386 386 ARG ARG B . n 
B 1 60  PHE 60  387 387 PHE PHE B . n 
B 1 61  GLN 61  388 388 GLN GLN B . n 
B 1 62  ALA 62  389 389 ALA ALA B . n 
B 1 63  ASN 63  390 390 ASN ASN B . n 
B 1 64  PRO 64  391 391 PRO PRO B . n 
B 1 65  ASP 65  392 ?   ?   ?   B . n 
B 1 66  TYR 66  393 ?   ?   ?   B . n 
B 1 67  GLN 67  394 ?   ?   ?   B . n 
B 1 68  MET 68  395 ?   ?   ?   B . n 
B 1 69  SER 69  396 ?   ?   ?   B . n 
B 1 70  GLY 70  397 ?   ?   ?   B . n 
B 1 71  ASP 71  398 ?   ?   ?   B . n 
B 1 72  ASP 72  399 399 ASP ASP B . n 
B 1 73  THR 73  400 400 THR THR B . n 
B 1 74  GLN 74  401 401 GLN GLN B . n 
B 1 75  HIS 75  402 402 HIS HIS B . n 
B 1 76  ILE 76  403 403 ILE ILE B . n 
B 1 77  GLN 77  404 404 GLN GLN B . n 
B 1 78  GLN 78  405 405 GLN GLN B . n 
B 1 79  PHE 79  406 406 PHE PHE B . n 
B 1 80  TYR 80  407 407 TYR TYR B . n 
B 1 81  ASP 81  408 408 ASP ASP B . n 
B 1 82  LEU 82  409 409 LEU LEU B . n 
B 1 83  LEU 83  410 410 LEU LEU B . n 
B 1 84  THR 84  411 411 THR THR B . n 
B 1 85  GLY 85  412 412 GLY GLY B . n 
B 1 86  SER 86  413 413 SER SER B . n 
B 1 87  MET 87  414 414 MET MET B . n 
B 1 88  GLU 88  415 415 GLU GLU B . n 
B 1 89  ILE 89  416 416 ILE ILE B . n 
B 1 90  ILE 90  417 417 ILE ILE B . n 
B 1 91  ARG 91  418 418 ARG ARG B . n 
B 1 92  GLY 92  419 419 GLY GLY B . n 
B 1 93  TRP 93  420 420 TRP TRP B . n 
B 1 94  ALA 94  421 421 ALA ALA B . n 
B 1 95  GLU 95  422 422 GLU GLU B . n 
B 1 96  LYS 96  423 423 LYS LYS B . n 
B 1 97  ILE 97  424 424 ILE ILE B . n 
B 1 98  PRO 98  425 425 PRO PRO B . n 
B 1 99  GLY 99  426 426 GLY GLY B . n 
B 1 100 PHE 100 427 427 PHE PHE B . n 
B 1 101 ALA 101 428 428 ALA ALA B . n 
B 1 102 ASP 102 429 429 ASP ASP B . n 
B 1 103 LEU 103 430 430 LEU LEU B . n 
B 1 104 PRO 104 431 431 PRO PRO B . n 
B 1 105 LYS 105 432 432 LYS LYS B . n 
B 1 106 ALA 106 433 433 ALA ALA B . n 
B 1 107 ASP 107 434 434 ASP ASP B . n 
B 1 108 GLN 108 435 435 GLN GLN B . n 
B 1 109 ASP 109 436 436 ASP ASP B . n 
B 1 110 LEU 110 437 437 LEU LEU B . n 
B 1 111 LEU 111 438 438 LEU LEU B . n 
B 1 112 PHE 112 439 439 PHE PHE B . n 
B 1 113 GLU 113 440 440 GLU GLU B . n 
B 1 114 SER 114 441 441 SER SER B . n 
B 1 115 ALA 115 442 442 ALA ALA B . n 
B 1 116 PHE 116 443 443 PHE PHE B . n 
B 1 117 LEU 117 444 444 LEU LEU B . n 
B 1 118 GLU 118 445 445 GLU GLU B . n 
B 1 119 LEU 119 446 446 LEU LEU B . n 
B 1 120 PHE 120 447 447 PHE PHE B . n 
B 1 121 VAL 121 448 448 VAL VAL B . n 
B 1 122 LEU 122 449 449 LEU LEU B . n 
B 1 123 ARG 123 450 450 ARG ARG B . n 
B 1 124 LEU 124 451 451 LEU LEU B . n 
B 1 125 ALA 125 452 452 ALA ALA B . n 
B 1 126 TYR 126 453 453 TYR TYR B . n 
B 1 127 ARG 127 454 454 ARG ARG B . n 
B 1 128 SER 128 455 455 SER SER B . n 
B 1 129 ASN 129 456 456 ASN ASN B . n 
B 1 130 PRO 130 457 457 PRO PRO B . n 
B 1 131 VAL 131 458 458 VAL VAL B . n 
B 1 132 GLU 132 459 459 GLU GLU B . n 
B 1 133 GLY 133 460 460 GLY GLY B . n 
B 1 134 LYS 134 461 461 LYS LYS B . n 
B 1 135 LEU 135 462 462 LEU LEU B . n 
B 1 136 ILE 136 463 463 ILE ILE B . n 
B 1 137 PHE 137 464 464 PHE PHE B . n 
B 1 138 CYS 138 465 465 CYS CYS B . n 
B 1 139 ASN 139 466 466 ASN ASN B . n 
B 1 140 GLY 140 467 467 GLY GLY B . n 
B 1 141 VAL 141 468 468 VAL VAL B . n 
B 1 142 VAL 142 469 469 VAL VAL B . n 
B 1 143 LEU 143 470 470 LEU LEU B . n 
B 1 144 HIS 144 471 471 HIS HIS B . n 
B 1 145 ARG 145 472 472 ARG ARG B . n 
B 1 146 LEU 146 473 473 LEU LEU B . n 
B 1 147 GLN 147 474 474 GLN GLN B . n 
B 1 148 CYS 148 475 475 CYS CYS B . n 
B 1 149 VAL 149 476 476 VAL VAL B . n 
B 1 150 ARG 150 477 477 ARG ARG B . n 
B 1 151 GLY 151 478 478 GLY GLY B . n 
B 1 152 PHE 152 479 479 PHE PHE B . n 
B 1 153 GLY 153 480 480 GLY GLY B . n 
B 1 154 GLU 154 481 481 GLU GLU B . n 
B 1 155 TRP 155 482 482 TRP TRP B . n 
B 1 156 ILE 156 483 483 ILE ILE B . n 
B 1 157 ASP 157 484 484 ASP ASP B . n 
B 1 158 SER 158 485 485 SER SER B . n 
B 1 159 ILE 159 486 486 ILE ILE B . n 
B 1 160 VAL 160 487 487 VAL VAL B . n 
B 1 161 GLU 161 488 488 GLU GLU B . n 
B 1 162 PHE 162 489 489 PHE PHE B . n 
B 1 163 SER 163 490 490 SER SER B . n 
B 1 164 SER 164 491 491 SER SER B . n 
B 1 165 ASN 165 492 492 ASN ASN B . n 
B 1 166 LEU 166 493 493 LEU LEU B . n 
B 1 167 GLN 167 494 494 GLN GLN B . n 
B 1 168 ASN 168 495 495 ASN ASN B . n 
B 1 169 MET 169 496 496 MET MET B . n 
B 1 170 ASN 170 497 497 ASN ASN B . n 
B 1 171 ILE 171 498 498 ILE ILE B . n 
B 1 172 ASP 172 499 499 ASP ASP B . n 
B 1 173 ILE 173 500 500 ILE ILE B . n 
B 1 174 SER 174 501 501 SER SER B . n 
B 1 175 ALA 175 502 502 ALA ALA B . n 
B 1 176 PHE 176 503 503 PHE PHE B . n 
B 1 177 SER 177 504 504 SER SER B . n 
B 1 178 CYS 178 505 505 CYS CYS B . n 
B 1 179 ILE 179 506 506 ILE ILE B . n 
B 1 180 ALA 180 507 507 ALA ALA B . n 
B 1 181 ALA 181 508 508 ALA ALA B . n 
B 1 182 LEU 182 509 509 LEU LEU B . n 
B 1 183 ALA 183 510 510 ALA ALA B . n 
B 1 184 MET 184 511 511 MET MET B . n 
B 1 185 VAL 185 512 512 VAL VAL B . n 
B 1 186 THR 186 513 513 THR THR B . n 
B 1 187 GLU 187 514 514 GLU GLU B . n 
B 1 188 ARG 188 515 515 ARG ARG B . n 
B 1 189 HIS 189 516 516 HIS HIS B . n 
B 1 190 GLY 190 517 517 GLY GLY B . n 
B 1 191 LEU 191 518 518 LEU LEU B . n 
B 1 192 LYS 192 519 519 LYS LYS B . n 
B 1 193 GLU 193 520 520 GLU GLU B . n 
B 1 194 PRO 194 521 521 PRO PRO B . n 
B 1 195 LYS 195 522 522 LYS LYS B . n 
B 1 196 ARG 196 523 523 ARG ARG B . n 
B 1 197 VAL 197 524 524 VAL VAL B . n 
B 1 198 GLU 198 525 525 GLU GLU B . n 
B 1 199 GLU 199 526 526 GLU GLU B . n 
B 1 200 LEU 200 527 527 LEU LEU B . n 
B 1 201 GLN 201 528 528 GLN GLN B . n 
B 1 202 ASN 202 529 529 ASN ASN B . n 
B 1 203 LYS 203 530 530 LYS LYS B . n 
B 1 204 ILE 204 531 531 ILE ILE B . n 
B 1 205 VAL 205 532 532 VAL VAL B . n 
B 1 206 ASN 206 533 533 ASN ASN B . n 
B 1 207 CYS 207 534 534 CYS CYS B . n 
B 1 208 LEU 208 535 535 LEU LEU B . n 
B 1 209 LYS 209 536 536 LYS LYS B . n 
B 1 210 ASP 210 537 537 ASP ASP B . n 
B 1 211 HIS 211 538 538 HIS HIS B . n 
B 1 212 VAL 212 539 539 VAL VAL B . n 
B 1 213 THR 213 540 540 THR THR B . n 
B 1 214 PHE 214 541 541 PHE PHE B . n 
B 1 215 ASN 215 542 542 ASN ASN B . n 
B 1 216 ASN 216 543 543 ASN ASN B . n 
B 1 217 GLY 217 544 544 GLY GLY B . n 
B 1 218 GLY 218 545 545 GLY GLY B . n 
B 1 219 LEU 219 546 546 LEU LEU B . n 
B 1 220 ASN 220 547 547 ASN ASN B . n 
B 1 221 ARG 221 548 548 ARG ARG B . n 
B 1 222 PRO 222 549 549 PRO PRO B . n 
B 1 223 ASN 223 550 550 ASN ASN B . n 
B 1 224 TYR 224 551 551 TYR TYR B . n 
B 1 225 LEU 225 552 552 LEU LEU B . n 
B 1 226 SER 226 553 553 SER SER B . n 
B 1 227 LYS 227 554 554 LYS LYS B . n 
B 1 228 LEU 228 555 555 LEU LEU B . n 
B 1 229 LEU 229 556 556 LEU LEU B . n 
B 1 230 GLY 230 557 557 GLY GLY B . n 
B 1 231 LYS 231 558 558 LYS LYS B . n 
B 1 232 LEU 232 559 559 LEU LEU B . n 
B 1 233 PRO 233 560 560 PRO PRO B . n 
B 1 234 GLU 234 561 561 GLU GLU B . n 
B 1 235 LEU 235 562 562 LEU LEU B . n 
B 1 236 ARG 236 563 563 ARG ARG B . n 
B 1 237 THR 237 564 564 THR THR B . n 
B 1 238 LEU 238 565 565 LEU LEU B . n 
B 1 239 CYS 239 566 566 CYS CYS B . n 
B 1 240 THR 240 567 567 THR THR B . n 
B 1 241 GLN 241 568 568 GLN GLN B . n 
B 1 242 GLY 242 569 569 GLY GLY B . n 
B 1 243 LEU 243 570 570 LEU LEU B . n 
B 1 244 GLN 244 571 571 GLN GLN B . n 
B 1 245 ARG 245 572 572 ARG ARG B . n 
B 1 246 ILE 246 573 573 ILE ILE B . n 
B 1 247 PHE 247 574 574 PHE PHE B . n 
B 1 248 TYR 248 575 575 TYR TYR B . n 
B 1 249 LEU 249 576 576 LEU LEU B . n 
B 1 250 LYS 250 577 577 LYS LYS B . n 
B 1 251 LEU 251 578 578 LEU LEU B . n 
B 1 252 GLU 252 579 579 GLU GLU B . n 
B 1 253 ASP 253 580 580 ASP ASP B . n 
B 1 254 LEU 254 581 581 LEU LEU B . n 
B 1 255 VAL 255 582 582 VAL VAL B . n 
B 1 256 PRO 256 583 583 PRO PRO B . n 
B 1 257 PRO 257 584 584 PRO PRO B . n 
B 1 258 PRO 258 585 585 PRO PRO B . n 
B 1 259 ALA 259 586 586 ALA ALA B . n 
B 1 260 ILE 260 587 587 ILE ILE B . n 
B 1 261 ILE 261 588 588 ILE ILE B . n 
B 1 262 ASP 262 589 589 ASP ASP B . n 
B 1 263 LYS 263 590 590 LYS LYS B . n 
B 1 264 LEU 264 591 591 LEU LEU B . n 
B 1 265 PHE 265 592 592 PHE PHE B . n 
B 1 266 LEU 266 593 593 LEU LEU B . n 
B 1 267 ASP 267 594 594 ASP ASP B . n 
B 1 268 THR 268 595 595 THR THR B . n 
B 1 269 LEU 269 596 596 LEU LEU B . n 
B 1 270 PRO 270 597 597 PRO PRO B . n 
B 1 271 PHE 271 598 598 PHE PHE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 RPG 1   601 1   RPG RPG A . 
D 3 PGE 1   602 1   PGE PGE A . 
E 4 PEG 1   603 1   PEG PEG A . 
F 5 CL  1   604 1   CL  CL  A . 
G 6 MG  1   605 1   MG  MG  A . 
H 2 RPG 1   601 1   RPG RPG B . 
I 5 CL  1   602 1   CL  CL  B . 
J 7 HOH 1   701 169 HOH HOH A . 
J 7 HOH 2   702 279 HOH HOH A . 
J 7 HOH 3   703 135 HOH HOH A . 
J 7 HOH 4   704 141 HOH HOH A . 
J 7 HOH 5   705 214 HOH HOH A . 
J 7 HOH 6   706 228 HOH HOH A . 
J 7 HOH 7   707 191 HOH HOH A . 
J 7 HOH 8   708 280 HOH HOH A . 
J 7 HOH 9   709 130 HOH HOH A . 
J 7 HOH 10  710 59  HOH HOH A . 
J 7 HOH 11  711 54  HOH HOH A . 
J 7 HOH 12  712 229 HOH HOH A . 
J 7 HOH 13  713 71  HOH HOH A . 
J 7 HOH 14  714 25  HOH HOH A . 
J 7 HOH 15  715 21  HOH HOH A . 
J 7 HOH 16  716 245 HOH HOH A . 
J 7 HOH 17  717 283 HOH HOH A . 
J 7 HOH 18  718 205 HOH HOH A . 
J 7 HOH 19  719 231 HOH HOH A . 
J 7 HOH 20  720 200 HOH HOH A . 
J 7 HOH 21  721 35  HOH HOH A . 
J 7 HOH 22  722 239 HOH HOH A . 
J 7 HOH 23  723 87  HOH HOH A . 
J 7 HOH 24  724 53  HOH HOH A . 
J 7 HOH 25  725 6   HOH HOH A . 
J 7 HOH 26  726 63  HOH HOH A . 
J 7 HOH 27  727 67  HOH HOH A . 
J 7 HOH 28  728 126 HOH HOH A . 
J 7 HOH 29  729 11  HOH HOH A . 
J 7 HOH 30  730 103 HOH HOH A . 
J 7 HOH 31  731 227 HOH HOH A . 
J 7 HOH 32  732 131 HOH HOH A . 
J 7 HOH 33  733 194 HOH HOH A . 
J 7 HOH 34  734 180 HOH HOH A . 
J 7 HOH 35  735 247 HOH HOH A . 
J 7 HOH 36  736 202 HOH HOH A . 
J 7 HOH 37  737 109 HOH HOH A . 
J 7 HOH 38  738 104 HOH HOH A . 
J 7 HOH 39  739 224 HOH HOH A . 
J 7 HOH 40  740 95  HOH HOH A . 
J 7 HOH 41  741 4   HOH HOH A . 
J 7 HOH 42  742 134 HOH HOH A . 
J 7 HOH 43  743 56  HOH HOH A . 
J 7 HOH 44  744 58  HOH HOH A . 
J 7 HOH 45  745 281 HOH HOH A . 
J 7 HOH 46  746 289 HOH HOH A . 
J 7 HOH 47  747 66  HOH HOH A . 
J 7 HOH 48  748 34  HOH HOH A . 
J 7 HOH 49  749 234 HOH HOH A . 
J 7 HOH 50  750 226 HOH HOH A . 
J 7 HOH 51  751 33  HOH HOH A . 
J 7 HOH 52  752 1   HOH HOH A . 
J 7 HOH 53  753 99  HOH HOH A . 
J 7 HOH 54  754 203 HOH HOH A . 
J 7 HOH 55  755 219 HOH HOH A . 
J 7 HOH 56  756 113 HOH HOH A . 
J 7 HOH 57  757 133 HOH HOH A . 
J 7 HOH 58  758 18  HOH HOH A . 
J 7 HOH 59  759 173 HOH HOH A . 
J 7 HOH 60  760 139 HOH HOH A . 
J 7 HOH 61  761 12  HOH HOH A . 
J 7 HOH 62  762 189 HOH HOH A . 
J 7 HOH 63  763 80  HOH HOH A . 
J 7 HOH 64  764 75  HOH HOH A . 
J 7 HOH 65  765 5   HOH HOH A . 
J 7 HOH 66  766 179 HOH HOH A . 
J 7 HOH 67  767 232 HOH HOH A . 
J 7 HOH 68  768 39  HOH HOH A . 
J 7 HOH 69  769 45  HOH HOH A . 
J 7 HOH 70  770 61  HOH HOH A . 
J 7 HOH 71  771 49  HOH HOH A . 
J 7 HOH 72  772 128 HOH HOH A . 
J 7 HOH 73  773 101 HOH HOH A . 
J 7 HOH 74  774 305 HOH HOH A . 
J 7 HOH 75  775 223 HOH HOH A . 
J 7 HOH 76  776 68  HOH HOH A . 
J 7 HOH 77  777 32  HOH HOH A . 
J 7 HOH 78  778 254 HOH HOH A . 
J 7 HOH 79  779 37  HOH HOH A . 
J 7 HOH 80  780 275 HOH HOH A . 
J 7 HOH 81  781 311 HOH HOH A . 
J 7 HOH 82  782 298 HOH HOH A . 
J 7 HOH 83  783 310 HOH HOH A . 
J 7 HOH 84  784 144 HOH HOH A . 
J 7 HOH 85  785 62  HOH HOH A . 
J 7 HOH 86  786 138 HOH HOH A . 
J 7 HOH 87  787 70  HOH HOH A . 
J 7 HOH 88  788 84  HOH HOH A . 
J 7 HOH 89  789 197 HOH HOH A . 
J 7 HOH 90  790 15  HOH HOH A . 
J 7 HOH 91  791 307 HOH HOH A . 
J 7 HOH 92  792 81  HOH HOH A . 
J 7 HOH 93  793 260 HOH HOH A . 
J 7 HOH 94  794 253 HOH HOH A . 
J 7 HOH 95  795 315 HOH HOH A . 
J 7 HOH 96  796 285 HOH HOH A . 
J 7 HOH 97  797 29  HOH HOH A . 
J 7 HOH 98  798 72  HOH HOH A . 
J 7 HOH 99  799 167 HOH HOH A . 
J 7 HOH 100 800 129 HOH HOH A . 
J 7 HOH 101 801 271 HOH HOH A . 
J 7 HOH 102 802 69  HOH HOH A . 
J 7 HOH 103 803 282 HOH HOH A . 
J 7 HOH 104 804 26  HOH HOH A . 
J 7 HOH 105 805 98  HOH HOH A . 
J 7 HOH 106 806 171 HOH HOH A . 
J 7 HOH 107 807 19  HOH HOH A . 
J 7 HOH 108 808 220 HOH HOH A . 
J 7 HOH 109 809 295 HOH HOH A . 
J 7 HOH 110 810 300 HOH HOH A . 
J 7 HOH 111 811 277 HOH HOH A . 
J 7 HOH 112 812 249 HOH HOH A . 
J 7 HOH 113 813 255 HOH HOH A . 
J 7 HOH 114 814 302 HOH HOH A . 
J 7 HOH 115 815 246 HOH HOH A . 
J 7 HOH 116 816 136 HOH HOH A . 
J 7 HOH 117 817 47  HOH HOH A . 
J 7 HOH 118 818 225 HOH HOH A . 
J 7 HOH 119 819 124 HOH HOH A . 
J 7 HOH 120 820 204 HOH HOH A . 
J 7 HOH 121 821 132 HOH HOH A . 
J 7 HOH 122 822 306 HOH HOH A . 
J 7 HOH 123 823 127 HOH HOH A . 
J 7 HOH 124 824 284 HOH HOH A . 
J 7 HOH 125 825 122 HOH HOH A . 
J 7 HOH 126 826 287 HOH HOH A . 
J 7 HOH 127 827 7   HOH HOH A . 
J 7 HOH 128 828 294 HOH HOH A . 
J 7 HOH 129 829 74  HOH HOH A . 
J 7 HOH 130 830 212 HOH HOH A . 
J 7 HOH 131 831 215 HOH HOH A . 
J 7 HOH 132 832 241 HOH HOH A . 
J 7 HOH 133 833 170 HOH HOH A . 
J 7 HOH 134 834 213 HOH HOH A . 
J 7 HOH 135 835 190 HOH HOH A . 
J 7 HOH 136 836 278 HOH HOH A . 
J 7 HOH 137 837 89  HOH HOH A . 
J 7 HOH 138 838 123 HOH HOH A . 
J 7 HOH 139 839 208 HOH HOH A . 
J 7 HOH 140 840 216 HOH HOH A . 
J 7 HOH 141 841 312 HOH HOH A . 
J 7 HOH 142 842 14  HOH HOH A . 
J 7 HOH 143 843 184 HOH HOH A . 
J 7 HOH 144 844 273 HOH HOH A . 
J 7 HOH 145 845 140 HOH HOH A . 
J 7 HOH 146 846 286 HOH HOH A . 
J 7 HOH 147 847 119 HOH HOH A . 
J 7 HOH 148 848 265 HOH HOH A . 
J 7 HOH 149 849 142 HOH HOH A . 
J 7 HOH 150 850 293 HOH HOH A . 
J 7 HOH 151 851 175 HOH HOH A . 
J 7 HOH 152 852 288 HOH HOH A . 
J 7 HOH 153 853 188 HOH HOH A . 
J 7 HOH 154 854 301 HOH HOH A . 
J 7 HOH 155 855 308 HOH HOH A . 
J 7 HOH 156 856 261 HOH HOH A . 
J 7 HOH 157 857 274 HOH HOH A . 
J 7 HOH 158 858 276 HOH HOH A . 
J 7 HOH 159 859 96  HOH HOH A . 
J 7 HOH 160 860 192 HOH HOH A . 
J 7 HOH 161 861 299 HOH HOH A . 
J 7 HOH 162 862 91  HOH HOH A . 
J 7 HOH 163 863 176 HOH HOH A . 
J 7 HOH 164 864 187 HOH HOH A . 
J 7 HOH 165 865 267 HOH HOH A . 
J 7 HOH 166 866 174 HOH HOH A . 
J 7 HOH 167 867 269 HOH HOH A . 
J 7 HOH 168 868 304 HOH HOH A . 
J 7 HOH 169 869 303 HOH HOH A . 
K 7 HOH 1   701 159 HOH HOH B . 
K 7 HOH 2   702 207 HOH HOH B . 
K 7 HOH 3   703 48  HOH HOH B . 
K 7 HOH 4   704 313 HOH HOH B . 
K 7 HOH 5   705 199 HOH HOH B . 
K 7 HOH 6   706 55  HOH HOH B . 
K 7 HOH 7   707 40  HOH HOH B . 
K 7 HOH 8   708 112 HOH HOH B . 
K 7 HOH 9   709 108 HOH HOH B . 
K 7 HOH 10  710 106 HOH HOH B . 
K 7 HOH 11  711 222 HOH HOH B . 
K 7 HOH 12  712 31  HOH HOH B . 
K 7 HOH 13  713 50  HOH HOH B . 
K 7 HOH 14  714 3   HOH HOH B . 
K 7 HOH 15  715 236 HOH HOH B . 
K 7 HOH 16  716 250 HOH HOH B . 
K 7 HOH 17  717 258 HOH HOH B . 
K 7 HOH 18  718 22  HOH HOH B . 
K 7 HOH 19  719 152 HOH HOH B . 
K 7 HOH 20  720 317 HOH HOH B . 
K 7 HOH 21  721 237 HOH HOH B . 
K 7 HOH 22  722 193 HOH HOH B . 
K 7 HOH 23  723 28  HOH HOH B . 
K 7 HOH 24  724 86  HOH HOH B . 
K 7 HOH 25  725 252 HOH HOH B . 
K 7 HOH 26  726 235 HOH HOH B . 
K 7 HOH 27  727 17  HOH HOH B . 
K 7 HOH 28  728 51  HOH HOH B . 
K 7 HOH 29  729 145 HOH HOH B . 
K 7 HOH 30  730 52  HOH HOH B . 
K 7 HOH 31  731 244 HOH HOH B . 
K 7 HOH 32  732 243 HOH HOH B . 
K 7 HOH 33  733 2   HOH HOH B . 
K 7 HOH 34  734 38  HOH HOH B . 
K 7 HOH 35  735 77  HOH HOH B . 
K 7 HOH 36  736 115 HOH HOH B . 
K 7 HOH 37  737 13  HOH HOH B . 
K 7 HOH 38  738 150 HOH HOH B . 
K 7 HOH 39  739 24  HOH HOH B . 
K 7 HOH 40  740 65  HOH HOH B . 
K 7 HOH 41  741 163 HOH HOH B . 
K 7 HOH 42  742 147 HOH HOH B . 
K 7 HOH 43  743 172 HOH HOH B . 
K 7 HOH 44  744 233 HOH HOH B . 
K 7 HOH 45  745 43  HOH HOH B . 
K 7 HOH 46  746 143 HOH HOH B . 
K 7 HOH 47  747 9   HOH HOH B . 
K 7 HOH 48  748 36  HOH HOH B . 
K 7 HOH 49  749 160 HOH HOH B . 
K 7 HOH 50  750 60  HOH HOH B . 
K 7 HOH 51  751 97  HOH HOH B . 
K 7 HOH 52  752 76  HOH HOH B . 
K 7 HOH 53  753 292 HOH HOH B . 
K 7 HOH 54  754 44  HOH HOH B . 
K 7 HOH 55  755 23  HOH HOH B . 
K 7 HOH 56  756 316 HOH HOH B . 
K 7 HOH 57  757 10  HOH HOH B . 
K 7 HOH 58  758 94  HOH HOH B . 
K 7 HOH 59  759 238 HOH HOH B . 
K 7 HOH 60  760 242 HOH HOH B . 
K 7 HOH 61  761 218 HOH HOH B . 
K 7 HOH 62  762 42  HOH HOH B . 
K 7 HOH 63  763 79  HOH HOH B . 
K 7 HOH 64  764 240 HOH HOH B . 
K 7 HOH 65  765 57  HOH HOH B . 
K 7 HOH 66  766 259 HOH HOH B . 
K 7 HOH 67  767 83  HOH HOH B . 
K 7 HOH 68  768 73  HOH HOH B . 
K 7 HOH 69  769 110 HOH HOH B . 
K 7 HOH 70  770 41  HOH HOH B . 
K 7 HOH 71  771 297 HOH HOH B . 
K 7 HOH 72  772 64  HOH HOH B . 
K 7 HOH 73  773 46  HOH HOH B . 
K 7 HOH 74  774 20  HOH HOH B . 
K 7 HOH 75  775 100 HOH HOH B . 
K 7 HOH 76  776 309 HOH HOH B . 
K 7 HOH 77  777 248 HOH HOH B . 
K 7 HOH 78  778 263 HOH HOH B . 
K 7 HOH 79  779 102 HOH HOH B . 
K 7 HOH 80  780 78  HOH HOH B . 
K 7 HOH 81  781 183 HOH HOH B . 
K 7 HOH 82  782 92  HOH HOH B . 
K 7 HOH 83  783 85  HOH HOH B . 
K 7 HOH 84  784 314 HOH HOH B . 
K 7 HOH 85  785 111 HOH HOH B . 
K 7 HOH 86  786 154 HOH HOH B . 
K 7 HOH 87  787 27  HOH HOH B . 
K 7 HOH 88  788 30  HOH HOH B . 
K 7 HOH 89  789 182 HOH HOH B . 
K 7 HOH 90  790 120 HOH HOH B . 
K 7 HOH 91  791 93  HOH HOH B . 
K 7 HOH 92  792 149 HOH HOH B . 
K 7 HOH 93  793 146 HOH HOH B . 
K 7 HOH 94  794 148 HOH HOH B . 
K 7 HOH 95  795 8   HOH HOH B . 
K 7 HOH 96  796 318 HOH HOH B . 
K 7 HOH 97  797 251 HOH HOH B . 
K 7 HOH 98  798 16  HOH HOH B . 
K 7 HOH 99  799 195 HOH HOH B . 
K 7 HOH 100 800 296 HOH HOH B . 
K 7 HOH 101 801 168 HOH HOH B . 
K 7 HOH 102 802 161 HOH HOH B . 
K 7 HOH 103 803 158 HOH HOH B . 
K 7 HOH 104 804 206 HOH HOH B . 
K 7 HOH 105 805 116 HOH HOH B . 
K 7 HOH 106 806 82  HOH HOH B . 
K 7 HOH 107 807 217 HOH HOH B . 
K 7 HOH 108 808 257 HOH HOH B . 
K 7 HOH 109 809 164 HOH HOH B . 
K 7 HOH 110 810 262 HOH HOH B . 
K 7 HOH 111 811 319 HOH HOH B . 
K 7 HOH 112 812 290 HOH HOH B . 
K 7 HOH 113 813 125 HOH HOH B . 
K 7 HOH 114 814 151 HOH HOH B . 
K 7 HOH 115 815 137 HOH HOH B . 
K 7 HOH 116 816 117 HOH HOH B . 
K 7 HOH 117 817 121 HOH HOH B . 
K 7 HOH 118 818 178 HOH HOH B . 
K 7 HOH 119 819 162 HOH HOH B . 
K 7 HOH 120 820 186 HOH HOH B . 
K 7 HOH 121 821 201 HOH HOH B . 
K 7 HOH 122 822 268 HOH HOH B . 
K 7 HOH 123 823 88  HOH HOH B . 
K 7 HOH 124 824 291 HOH HOH B . 
K 7 HOH 125 825 211 HOH HOH B . 
K 7 HOH 126 826 90  HOH HOH B . 
K 7 HOH 127 827 155 HOH HOH B . 
K 7 HOH 128 828 157 HOH HOH B . 
K 7 HOH 129 829 181 HOH HOH B . 
K 7 HOH 130 830 156 HOH HOH B . 
K 7 HOH 131 831 196 HOH HOH B . 
K 7 HOH 132 832 165 HOH HOH B . 
K 7 HOH 133 833 210 HOH HOH B . 
K 7 HOH 134 834 221 HOH HOH B . 
K 7 HOH 135 835 118 HOH HOH B . 
K 7 HOH 136 836 198 HOH HOH B . 
K 7 HOH 137 837 177 HOH HOH B . 
K 7 HOH 138 838 185 HOH HOH B . 
K 7 HOH 139 839 256 HOH HOH B . 
K 7 HOH 140 840 107 HOH HOH B . 
K 7 HOH 141 841 153 HOH HOH B . 
K 7 HOH 142 842 209 HOH HOH B . 
K 7 HOH 143 843 230 HOH HOH B . 
K 7 HOH 144 844 166 HOH HOH B . 
K 7 HOH 145 845 105 HOH HOH B . 
K 7 HOH 146 846 266 HOH HOH B . 
K 7 HOH 147 847 264 HOH HOH B . 
K 7 HOH 148 848 270 HOH HOH B . 
K 7 HOH 149 849 272 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,J         
2 1 B,H,I,K               
3 1 A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 3040  ? 
3 MORE         -34   ? 
3 'SSA (A^2)'  21450 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     844 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   K 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A PHE 271 ? A PHE 598 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 O   ? J HOH .   ? A HOH 736 ? 1_555 90.6  ? 
2  O   ? A PHE 271 ? A PHE 598 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 O   ? J HOH .   ? A HOH 784 ? 1_555 72.8  ? 
3  O   ? J HOH .   ? A HOH 736 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 O   ? J HOH .   ? A HOH 784 ? 1_555 143.3 ? 
4  O   ? A PHE 271 ? A PHE 598 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 OD1 ? B ASP 267 ? B ASP 594 ? 1_555 85.5  ? 
5  O   ? J HOH .   ? A HOH 736 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 OD1 ? B ASP 267 ? B ASP 594 ? 1_555 5.3   ? 
6  O   ? J HOH .   ? A HOH 784 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 OD1 ? B ASP 267 ? B ASP 594 ? 1_555 141.9 ? 
7  O   ? A PHE 271 ? A PHE 598 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 O   ? K HOH .   ? B HOH 729 ? 3_554 175.7 ? 
8  O   ? J HOH .   ? A HOH 736 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 O   ? K HOH .   ? B HOH 729 ? 3_554 93.7  ? 
9  O   ? J HOH .   ? A HOH 784 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 O   ? K HOH .   ? B HOH 729 ? 3_554 104.0 ? 
10 OD1 ? B ASP 267 ? B ASP 594 ? 1_555 MG ? G MG . ? A MG 605 ? 1_555 O   ? K HOH .   ? B HOH 729 ? 3_554 98.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-12-26 
2 'Structure model' 1 1 2020-06-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.country'                 
2 2 'Structure model' '_citation.journal_abbrev'          
3 2 'Structure model' '_citation.journal_id_CSD'          
4 2 'Structure model' '_citation.journal_id_ISSN'         
5 2 'Structure model' '_citation.pdbx_database_id_DOI'    
6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
7 2 'Structure model' '_citation.title'                   
8 2 'Structure model' '_citation.year'                    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 11.9655 -25.1537 -19.7749 0.0092 0.0234 0.1030 0.0085  -0.0255 -0.0459 1.6333 3.0283 1.8998 
-0.0172 -0.1350 -1.4725 -0.0060 -0.0761 0.1024  0.0621 -0.0336 -0.0528 -0.0820 0.0520  0.0396  
'X-RAY DIFFRACTION' 2 ? refined 22.8522 -55.7218 -13.7993 0.0121 0.0541 0.1276 -0.0208 -0.0281 0.0682  2.2033 3.7101 2.5891 
-1.3661 -0.7373 1.1976  -0.0195 -0.0400 -0.0468 0.0790 0.0324  -0.0826 0.1066  -0.1694 -0.0130 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 362 ? ? A 598 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 360 ? ? B 598 ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0158 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA   ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 454 ? ? CZ A ARG 454 ? ? NH1 A ARG 454 ? ? 125.89 120.30 5.59   0.50 N 
2 1 NE A ARG 454 ? ? CZ A ARG 454 ? ? NH2 A ARG 454 ? ? 112.14 120.30 -8.16  0.50 N 
3 1 CA A LEU 546 ? ? CB A LEU 546 ? ? CG  A LEU 546 ? ? 130.48 115.30 15.18  2.30 N 
4 1 CA A LEU 578 ? ? CB A LEU 578 ? ? CG  A LEU 578 ? ? 130.19 115.30 14.89  2.30 N 
5 1 CB A LEU 578 ? ? CG A LEU 578 ? ? CD2 A LEU 578 ? ? 98.95  111.00 -12.05 1.70 N 
6 1 NE B ARG 454 ? ? CZ B ARG 454 ? ? NH1 B ARG 454 ? ? 124.56 120.30 4.26   0.50 N 
7 1 NE B ARG 454 ? ? CZ B ARG 454 ? ? NH2 B ARG 454 ? ? 114.28 120.30 -6.02  0.50 N 
8 1 CA B LEU 462 ? ? CB B LEU 462 ? ? CG  B LEU 462 ? ? 98.00  115.30 -17.30 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 390 ? ? -157.79 69.37 
2 1 ASN B 390 ? ? -147.85 46.71 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 868 ? 8.20 . 
2 1 O ? A HOH 869 ? 8.35 . 
3 1 O ? B HOH 848 ? 6.71 . 
4 1 O ? B HOH 849 ? 7.66 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 328 ? A MET 1  
2  1 Y 1 A VAL 329 ? A VAL 2  
3  1 Y 1 A LYS 330 ? A LYS 3  
4  1 Y 1 A GLU 331 ? A GLU 4  
5  1 Y 1 A VAL 332 ? A VAL 5  
6  1 Y 1 A VAL 333 ? A VAL 6  
7  1 Y 1 A ARG 334 ? A ARG 7  
8  1 Y 1 A THR 335 ? A THR 8  
9  1 Y 1 A ASP 336 ? A ASP 9  
10 1 Y 1 A SER 337 ? A SER 10 
11 1 Y 1 A LEU 338 ? A LEU 11 
12 1 Y 1 A LYS 339 ? A LYS 12 
13 1 Y 1 A GLY 340 ? A GLY 13 
14 1 Y 1 A ARG 341 ? A ARG 14 
15 1 Y 1 A ARG 342 ? A ARG 15 
16 1 Y 1 A GLY 343 ? A GLY 16 
17 1 Y 1 A ARG 344 ? A ARG 17 
18 1 Y 1 A LEU 345 ? A LEU 18 
19 1 Y 1 A PRO 346 ? A PRO 19 
20 1 Y 1 A SER 347 ? A SER 20 
21 1 Y 1 A LYS 348 ? A LYS 21 
22 1 Y 1 A PRO 349 ? A PRO 22 
23 1 Y 1 A LYS 350 ? A LYS 23 
24 1 Y 1 A SER 351 ? A SER 24 
25 1 Y 1 A PRO 352 ? A PRO 25 
26 1 Y 1 A GLN 353 ? A GLN 26 
27 1 Y 1 A GLU 354 ? A GLU 27 
28 1 Y 1 A PRO 355 ? A PRO 28 
29 1 Y 1 A SER 356 ? A SER 29 
30 1 Y 1 A PRO 357 ? A PRO 30 
31 1 Y 1 A PRO 358 ? A PRO 31 
32 1 Y 1 A SER 359 ? A SER 32 
33 1 Y 1 A PRO 360 ? A PRO 33 
34 1 Y 1 A PRO 361 ? A PRO 34 
35 1 Y 1 A TYR 393 ? A TYR 66 
36 1 Y 1 A GLN 394 ? A GLN 67 
37 1 Y 1 A MET 395 ? A MET 68 
38 1 Y 1 A SER 396 ? A SER 69 
39 1 Y 1 A GLY 397 ? A GLY 70 
40 1 Y 1 B MET 328 ? B MET 1  
41 1 Y 1 B VAL 329 ? B VAL 2  
42 1 Y 1 B LYS 330 ? B LYS 3  
43 1 Y 1 B GLU 331 ? B GLU 4  
44 1 Y 1 B VAL 332 ? B VAL 5  
45 1 Y 1 B VAL 333 ? B VAL 6  
46 1 Y 1 B ARG 334 ? B ARG 7  
47 1 Y 1 B THR 335 ? B THR 8  
48 1 Y 1 B ASP 336 ? B ASP 9  
49 1 Y 1 B SER 337 ? B SER 10 
50 1 Y 1 B LEU 338 ? B LEU 11 
51 1 Y 1 B LYS 339 ? B LYS 12 
52 1 Y 1 B GLY 340 ? B GLY 13 
53 1 Y 1 B ARG 341 ? B ARG 14 
54 1 Y 1 B ARG 342 ? B ARG 15 
55 1 Y 1 B GLY 343 ? B GLY 16 
56 1 Y 1 B ARG 344 ? B ARG 17 
57 1 Y 1 B LEU 345 ? B LEU 18 
58 1 Y 1 B PRO 346 ? B PRO 19 
59 1 Y 1 B SER 347 ? B SER 20 
60 1 Y 1 B LYS 348 ? B LYS 21 
61 1 Y 1 B PRO 349 ? B PRO 22 
62 1 Y 1 B LYS 350 ? B LYS 23 
63 1 Y 1 B SER 351 ? B SER 24 
64 1 Y 1 B PRO 352 ? B PRO 25 
65 1 Y 1 B GLN 353 ? B GLN 26 
66 1 Y 1 B GLU 354 ? B GLU 27 
67 1 Y 1 B PRO 355 ? B PRO 28 
68 1 Y 1 B SER 356 ? B SER 29 
69 1 Y 1 B PRO 357 ? B PRO 30 
70 1 Y 1 B PRO 358 ? B PRO 31 
71 1 Y 1 B SER 359 ? B SER 32 
72 1 Y 1 B ASP 392 ? B ASP 65 
73 1 Y 1 B TYR 393 ? B TYR 66 
74 1 Y 1 B GLN 394 ? B GLN 67 
75 1 Y 1 B MET 395 ? B MET 68 
76 1 Y 1 B SER 396 ? B SER 69 
77 1 Y 1 B GLY 397 ? B GLY 70 
78 1 Y 1 B ASP 398 ? B ASP 71 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(13E,15S)-15-hydroxy-9-oxoprosta-10,13-dien-1-oic acid' RPG 
3 'TRIETHYLENE GLYCOL'                                     PGE 
4 'DI(HYDROXYETHYL)ETHER'                                  PEG 
5 'CHLORIDE ION'                                           CL  
6 'MAGNESIUM ION'                                          MG  
7 water                                                    HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#