data_5Y7G
# 
_entry.id   5Y7G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5Y7G         
WWPDB D_1300004797 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5Y7G 
_pdbx_database_status.recvd_initial_deposition_date   2017-08-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Cho, Y.' 1 ? 
'Jin, H.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                6482 
_citation.page_last                 6496 
_citation.title                     'Structural mechanism of DNA interstrand cross-link unhooking by the bacterial FAN1 nuclease.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.002171 
_citation.pdbx_database_id_PubMed   29514982 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jin, H.'       1 
primary 'Roy, U.'       2 
primary 'Lee, G.'       3 
primary 'Scharer, O.D.' 4 
primary 'Cho, Y.'       5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5Y7G 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     140.290 
_cell.length_a_esd                 ? 
_cell.length_b                     143.258 
_cell.length_b_esd                 ? 
_cell.length_c                     172.712 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5Y7G 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Fanconi-associated nuclease 1 homolog'                                                   66913.266 3 3.1.4.1 ? 
? ? 
2 polymer     syn 
;DNA (5'-D(P*GP*TP*TP*GP*GP*GP*AP*TP*TP*G)-3')
;
3131.050  3 ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(P*GP*AP*AP*TP*GP*TP*GP*TP*GP*TP*CP*TP*CP*AP*AP*TP*CP*CP*CP*AP*AP*CP*TP*T)-3')
;
7319.739  3 ?       ? ? ? 
4 polymer     syn 
;DNA (5'-D(P*TP*GP*AP*CP*AP*CP*AP*CP*AP*TP*TP*CP*AP*A)-3')
;
4232.795  3 ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                                             40.078    5 ?       ? 
? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        pFAN1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMMHEQYQAPLPVNSPALPEPFYYLHNFRAVLAWIGERYADLLDDQERAFIAAFAELPEAS
QALLVRMVMRKGTLFREGKLAYAEIGDTRAAVQPLLALGWVDAQPTLELAQLFGLLKKDELSQLFRDHLGRANLRKDALL
ERLQPLFPEARRLAEWQADFAEPVYELRCMALCDRLRLMYFGNLWQDWSEFVLADLGIYRYESVEFSADSRGFRLRADVD
AYLHLFDCRQRFDLGEPLEELLAGLPGEPYANPWLEGRRVKLLFQFAQHCEKQRDFDLAQRLYRQSSHPGARLRAIRSLE
RGERFAEAHALAREASCAPESDAERQGLARLLPRLQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWAVREHLEEPG
CAVHYVENGLINSLFGLLCWEAIFAAIPGAFFHPFHSAPADLHSADFRQRRAALFEACLGRLEDGSYRDAIRCRYRDKFG
LQSPFVYWELLGEELLEQALDCLPAAHLRAWFERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQ
FCREREMPVAVCYVRWHVDD
;
;MGSSHHHHHHSSGLVPRGSHMMHEQYQAPLPVNSPALPEPFYYLHNFRAVLAWIGERYADLLDDQERAFIAAFAELPEAS
QALLVRMVMRKGTLFREGKLAYAEIGDTRAAVQPLLALGWVDAQPTLELAQLFGLLKKDELSQLFRDHLGRANLRKDALL
ERLQPLFPEARRLAEWQADFAEPVYELRCMALCDRLRLMYFGNLWQDWSEFVLADLGIYRYESVEFSADSRGFRLRADVD
AYLHLFDCRQRFDLGEPLEELLAGLPGEPYANPWLEGRRVKLLFQFAQHCEKQRDFDLAQRLYRQSSHPGARLRAIRSLE
RGERFAEAHALAREASCAPESDAERQGLARLLPRLQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWAVREHLEEPG
CAVHYVENGLINSLFGLLCWEAIFAAIPGAFFHPFHSAPADLHSADFRQRRAALFEACLGRLEDGSYRDAIRCRYRDKFG
LQSPFVYWELLGEELLEQALDCLPAAHLRAWFERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQ
FCREREMPVAVCYVRWHVDD
;
A,B,C ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DT)(DG)(DG)(DG)(DA)(DT)(DT)(DG)' GTTGGGATTG D,F,H ? 
3 polydeoxyribonucleotide no no 
;(DG)(DA)(DA)(DT)(DG)(DT)(DG)(DT)(DG)(DT)(DC)(DT)(DC)(DA)(DA)(DT)(DC)(DC)(DC)(DA)
(DA)(DC)(DT)(DT)
;
GAATGTGTGTCTCAATCCCAACTT E,G,I ? 
4 polydeoxyribonucleotide no no '(DT)(DG)(DA)(DC)(DA)(DC)(DA)(DC)(DA)(DT)(DT)(DC)(DA)(DA)' TGACACACATTCAA J,L,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  MET n 
1 23  HIS n 
1 24  GLU n 
1 25  GLN n 
1 26  TYR n 
1 27  GLN n 
1 28  ALA n 
1 29  PRO n 
1 30  LEU n 
1 31  PRO n 
1 32  VAL n 
1 33  ASN n 
1 34  SER n 
1 35  PRO n 
1 36  ALA n 
1 37  LEU n 
1 38  PRO n 
1 39  GLU n 
1 40  PRO n 
1 41  PHE n 
1 42  TYR n 
1 43  TYR n 
1 44  LEU n 
1 45  HIS n 
1 46  ASN n 
1 47  PHE n 
1 48  ARG n 
1 49  ALA n 
1 50  VAL n 
1 51  LEU n 
1 52  ALA n 
1 53  TRP n 
1 54  ILE n 
1 55  GLY n 
1 56  GLU n 
1 57  ARG n 
1 58  TYR n 
1 59  ALA n 
1 60  ASP n 
1 61  LEU n 
1 62  LEU n 
1 63  ASP n 
1 64  ASP n 
1 65  GLN n 
1 66  GLU n 
1 67  ARG n 
1 68  ALA n 
1 69  PHE n 
1 70  ILE n 
1 71  ALA n 
1 72  ALA n 
1 73  PHE n 
1 74  ALA n 
1 75  GLU n 
1 76  LEU n 
1 77  PRO n 
1 78  GLU n 
1 79  ALA n 
1 80  SER n 
1 81  GLN n 
1 82  ALA n 
1 83  LEU n 
1 84  LEU n 
1 85  VAL n 
1 86  ARG n 
1 87  MET n 
1 88  VAL n 
1 89  MET n 
1 90  ARG n 
1 91  LYS n 
1 92  GLY n 
1 93  THR n 
1 94  LEU n 
1 95  PHE n 
1 96  ARG n 
1 97  GLU n 
1 98  GLY n 
1 99  LYS n 
1 100 LEU n 
1 101 ALA n 
1 102 TYR n 
1 103 ALA n 
1 104 GLU n 
1 105 ILE n 
1 106 GLY n 
1 107 ASP n 
1 108 THR n 
1 109 ARG n 
1 110 ALA n 
1 111 ALA n 
1 112 VAL n 
1 113 GLN n 
1 114 PRO n 
1 115 LEU n 
1 116 LEU n 
1 117 ALA n 
1 118 LEU n 
1 119 GLY n 
1 120 TRP n 
1 121 VAL n 
1 122 ASP n 
1 123 ALA n 
1 124 GLN n 
1 125 PRO n 
1 126 THR n 
1 127 LEU n 
1 128 GLU n 
1 129 LEU n 
1 130 ALA n 
1 131 GLN n 
1 132 LEU n 
1 133 PHE n 
1 134 GLY n 
1 135 LEU n 
1 136 LEU n 
1 137 LYS n 
1 138 LYS n 
1 139 ASP n 
1 140 GLU n 
1 141 LEU n 
1 142 SER n 
1 143 GLN n 
1 144 LEU n 
1 145 PHE n 
1 146 ARG n 
1 147 ASP n 
1 148 HIS n 
1 149 LEU n 
1 150 GLY n 
1 151 ARG n 
1 152 ALA n 
1 153 ASN n 
1 154 LEU n 
1 155 ARG n 
1 156 LYS n 
1 157 ASP n 
1 158 ALA n 
1 159 LEU n 
1 160 LEU n 
1 161 GLU n 
1 162 ARG n 
1 163 LEU n 
1 164 GLN n 
1 165 PRO n 
1 166 LEU n 
1 167 PHE n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 ARG n 
1 172 ARG n 
1 173 LEU n 
1 174 ALA n 
1 175 GLU n 
1 176 TRP n 
1 177 GLN n 
1 178 ALA n 
1 179 ASP n 
1 180 PHE n 
1 181 ALA n 
1 182 GLU n 
1 183 PRO n 
1 184 VAL n 
1 185 TYR n 
1 186 GLU n 
1 187 LEU n 
1 188 ARG n 
1 189 CYS n 
1 190 MET n 
1 191 ALA n 
1 192 LEU n 
1 193 CYS n 
1 194 ASP n 
1 195 ARG n 
1 196 LEU n 
1 197 ARG n 
1 198 LEU n 
1 199 MET n 
1 200 TYR n 
1 201 PHE n 
1 202 GLY n 
1 203 ASN n 
1 204 LEU n 
1 205 TRP n 
1 206 GLN n 
1 207 ASP n 
1 208 TRP n 
1 209 SER n 
1 210 GLU n 
1 211 PHE n 
1 212 VAL n 
1 213 LEU n 
1 214 ALA n 
1 215 ASP n 
1 216 LEU n 
1 217 GLY n 
1 218 ILE n 
1 219 TYR n 
1 220 ARG n 
1 221 TYR n 
1 222 GLU n 
1 223 SER n 
1 224 VAL n 
1 225 GLU n 
1 226 PHE n 
1 227 SER n 
1 228 ALA n 
1 229 ASP n 
1 230 SER n 
1 231 ARG n 
1 232 GLY n 
1 233 PHE n 
1 234 ARG n 
1 235 LEU n 
1 236 ARG n 
1 237 ALA n 
1 238 ASP n 
1 239 VAL n 
1 240 ASP n 
1 241 ALA n 
1 242 TYR n 
1 243 LEU n 
1 244 HIS n 
1 245 LEU n 
1 246 PHE n 
1 247 ASP n 
1 248 CYS n 
1 249 ARG n 
1 250 GLN n 
1 251 ARG n 
1 252 PHE n 
1 253 ASP n 
1 254 LEU n 
1 255 GLY n 
1 256 GLU n 
1 257 PRO n 
1 258 LEU n 
1 259 GLU n 
1 260 GLU n 
1 261 LEU n 
1 262 LEU n 
1 263 ALA n 
1 264 GLY n 
1 265 LEU n 
1 266 PRO n 
1 267 GLY n 
1 268 GLU n 
1 269 PRO n 
1 270 TYR n 
1 271 ALA n 
1 272 ASN n 
1 273 PRO n 
1 274 TRP n 
1 275 LEU n 
1 276 GLU n 
1 277 GLY n 
1 278 ARG n 
1 279 ARG n 
1 280 VAL n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 PHE n 
1 285 GLN n 
1 286 PHE n 
1 287 ALA n 
1 288 GLN n 
1 289 HIS n 
1 290 CYS n 
1 291 GLU n 
1 292 LYS n 
1 293 GLN n 
1 294 ARG n 
1 295 ASP n 
1 296 PHE n 
1 297 ASP n 
1 298 LEU n 
1 299 ALA n 
1 300 GLN n 
1 301 ARG n 
1 302 LEU n 
1 303 TYR n 
1 304 ARG n 
1 305 GLN n 
1 306 SER n 
1 307 SER n 
1 308 HIS n 
1 309 PRO n 
1 310 GLY n 
1 311 ALA n 
1 312 ARG n 
1 313 LEU n 
1 314 ARG n 
1 315 ALA n 
1 316 ILE n 
1 317 ARG n 
1 318 SER n 
1 319 LEU n 
1 320 GLU n 
1 321 ARG n 
1 322 GLY n 
1 323 GLU n 
1 324 ARG n 
1 325 PHE n 
1 326 ALA n 
1 327 GLU n 
1 328 ALA n 
1 329 HIS n 
1 330 ALA n 
1 331 LEU n 
1 332 ALA n 
1 333 ARG n 
1 334 GLU n 
1 335 ALA n 
1 336 SER n 
1 337 CYS n 
1 338 ALA n 
1 339 PRO n 
1 340 GLU n 
1 341 SER n 
1 342 ASP n 
1 343 ALA n 
1 344 GLU n 
1 345 ARG n 
1 346 GLN n 
1 347 GLY n 
1 348 LEU n 
1 349 ALA n 
1 350 ARG n 
1 351 LEU n 
1 352 LEU n 
1 353 PRO n 
1 354 ARG n 
1 355 LEU n 
1 356 GLN n 
1 357 GLY n 
1 358 LYS n 
1 359 LEU n 
1 360 GLY n 
1 361 LEU n 
1 362 PRO n 
1 363 ARG n 
1 364 GLN n 
1 365 ALA n 
1 366 ARG n 
1 367 ALA n 
1 368 ALA n 
1 369 ALA n 
1 370 PRO n 
1 371 GLU n 
1 372 ILE n 
1 373 ASP n 
1 374 ARG n 
1 375 LEU n 
1 376 ASP n 
1 377 LEU n 
1 378 CYS n 
1 379 LEU n 
1 380 ALA n 
1 381 PHE n 
1 382 PRO n 
1 383 SER n 
1 384 GLU n 
1 385 PRO n 
1 386 CYS n 
1 387 SER n 
1 388 VAL n 
1 389 GLU n 
1 390 TRP n 
1 391 ALA n 
1 392 VAL n 
1 393 ARG n 
1 394 GLU n 
1 395 HIS n 
1 396 LEU n 
1 397 GLU n 
1 398 GLU n 
1 399 PRO n 
1 400 GLY n 
1 401 CYS n 
1 402 ALA n 
1 403 VAL n 
1 404 HIS n 
1 405 TYR n 
1 406 VAL n 
1 407 GLU n 
1 408 ASN n 
1 409 GLY n 
1 410 LEU n 
1 411 ILE n 
1 412 ASN n 
1 413 SER n 
1 414 LEU n 
1 415 PHE n 
1 416 GLY n 
1 417 LEU n 
1 418 LEU n 
1 419 CYS n 
1 420 TRP n 
1 421 GLU n 
1 422 ALA n 
1 423 ILE n 
1 424 PHE n 
1 425 ALA n 
1 426 ALA n 
1 427 ILE n 
1 428 PRO n 
1 429 GLY n 
1 430 ALA n 
1 431 PHE n 
1 432 PHE n 
1 433 HIS n 
1 434 PRO n 
1 435 PHE n 
1 436 HIS n 
1 437 SER n 
1 438 ALA n 
1 439 PRO n 
1 440 ALA n 
1 441 ASP n 
1 442 LEU n 
1 443 HIS n 
1 444 SER n 
1 445 ALA n 
1 446 ASP n 
1 447 PHE n 
1 448 ARG n 
1 449 GLN n 
1 450 ARG n 
1 451 ARG n 
1 452 ALA n 
1 453 ALA n 
1 454 LEU n 
1 455 PHE n 
1 456 GLU n 
1 457 ALA n 
1 458 CYS n 
1 459 LEU n 
1 460 GLY n 
1 461 ARG n 
1 462 LEU n 
1 463 GLU n 
1 464 ASP n 
1 465 GLY n 
1 466 SER n 
1 467 TYR n 
1 468 ARG n 
1 469 ASP n 
1 470 ALA n 
1 471 ILE n 
1 472 ARG n 
1 473 CYS n 
1 474 ARG n 
1 475 TYR n 
1 476 ARG n 
1 477 ASP n 
1 478 LYS n 
1 479 PHE n 
1 480 GLY n 
1 481 LEU n 
1 482 GLN n 
1 483 SER n 
1 484 PRO n 
1 485 PHE n 
1 486 VAL n 
1 487 TYR n 
1 488 TRP n 
1 489 GLU n 
1 490 LEU n 
1 491 LEU n 
1 492 GLY n 
1 493 GLU n 
1 494 GLU n 
1 495 LEU n 
1 496 LEU n 
1 497 GLU n 
1 498 GLN n 
1 499 ALA n 
1 500 LEU n 
1 501 ASP n 
1 502 CYS n 
1 503 LEU n 
1 504 PRO n 
1 505 ALA n 
1 506 ALA n 
1 507 HIS n 
1 508 LEU n 
1 509 ARG n 
1 510 ALA n 
1 511 TRP n 
1 512 PHE n 
1 513 GLU n 
1 514 ARG n 
1 515 LEU n 
1 516 LEU n 
1 517 GLU n 
1 518 ASP n 
1 519 ILE n 
1 520 PRO n 
1 521 GLY n 
1 522 ASN n 
1 523 ARG n 
1 524 ALA n 
1 525 GLY n 
1 526 LEU n 
1 527 PRO n 
1 528 ASP n 
1 529 LEU n 
1 530 ILE n 
1 531 GLN n 
1 532 PHE n 
1 533 TRP n 
1 534 PRO n 
1 535 ALA n 
1 536 GLN n 
1 537 ARG n 
1 538 ARG n 
1 539 TYR n 
1 540 ARG n 
1 541 MET n 
1 542 VAL n 
1 543 GLU n 
1 544 VAL n 
1 545 LYS n 
1 546 GLY n 
1 547 PRO n 
1 548 GLY n 
1 549 ASP n 
1 550 ARG n 
1 551 LEU n 
1 552 GLN n 
1 553 ASP n 
1 554 ASN n 
1 555 GLN n 
1 556 LEU n 
1 557 ARG n 
1 558 TRP n 
1 559 LEU n 
1 560 GLN n 
1 561 PHE n 
1 562 CYS n 
1 563 ARG n 
1 564 GLU n 
1 565 ARG n 
1 566 GLU n 
1 567 MET n 
1 568 PRO n 
1 569 VAL n 
1 570 ALA n 
1 571 VAL n 
1 572 CYS n 
1 573 TYR n 
1 574 VAL n 
1 575 ARG n 
1 576 TRP n 
1 577 HIS n 
1 578 VAL n 
1 579 ASP n 
1 580 ASP n 
2 1   DG  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DG  n 
2 6   DG  n 
2 7   DA  n 
2 8   DT  n 
2 9   DT  n 
2 10  DG  n 
3 1   DG  n 
3 2   DA  n 
3 3   DA  n 
3 4   DT  n 
3 5   DG  n 
3 6   DT  n 
3 7   DG  n 
3 8   DT  n 
3 9   DG  n 
3 10  DT  n 
3 11  DC  n 
3 12  DT  n 
3 13  DC  n 
3 14  DA  n 
3 15  DA  n 
3 16  DT  n 
3 17  DC  n 
3 18  DC  n 
3 19  DC  n 
3 20  DA  n 
3 21  DA  n 
3 22  DC  n 
3 23  DT  n 
3 24  DT  n 
4 1   DT  n 
4 2   DG  n 
4 3   DA  n 
4 4   DC  n 
4 5   DA  n 
4 6   DC  n 
4 7   DA  n 
4 8   DC  n 
4 9   DA  n 
4 10  DT  n 
4 11  DT  n 
4 12  DC  n 
4 13  DA  n 
4 14  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   580 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'fan1, PA1865' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    
'ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      
'Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     208964 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 10 'synthetic construct' ? 32630 ? 
3 1 sample 1 24 'synthetic construct' ? 32630 ? 
4 1 sample 1 14 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP FAN1_PSEAE Q9I2N0 ? 1 
;MHEQYQAPLPVNSPALPEPFYYLHNFRAVLAWIGERYADLLDDQERAFIAAFAELPEASQALLVRMVMRKGTLFREGKLA
YAEIGDTRAAVQPLLALGWVDAQPTLELAQLFGLLKKDELSQLFRDHLGRANLRKDALLERLQPLFPEARRLAEWQADFA
EPVYELRCMALCDRLRLMYFGNLWQDWSEFVLADLGIYRYESVEFSADSRGFRLRADVDAYLHLFDCRQRFDLGEPLEEL
LAGLPGEPYANPWLEGRRVKLLFQFAQHCEKQRDFDLAQRLYRQSSHPGARLRAIRSLERGERFAEAHALAREASCAPES
DAERQGLARLLPRLQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWAVREHLEEPGCAVHYVENGLINSLFGLLCWE
AIFAAIPGAFFHPFHSAPADLHSADFRQRRAALFEACLGRLEDGSYRDAIRCRYRDKFGLQSPFVYWELLGEELLEQALD
CLPAAHLRAWFERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCYVRWHVDD
;
1 
2 PDB 5Y7G       5Y7G   ? 2 ? 1 
3 PDB 5Y7G       5Y7G   ? 3 ? 1 
4 PDB 5Y7G       5Y7G   ? 4 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5Y7G A 22 ? 580 ? Q9I2N0 1 ? 559 ? 1 559 
2  1 5Y7G B 22 ? 580 ? Q9I2N0 1 ? 559 ? 1 559 
3  1 5Y7G C 22 ? 580 ? Q9I2N0 1 ? 559 ? 1 559 
4  2 5Y7G D 1  ? 10  ? 5Y7G   1 ? 10  ? 1 10  
5  3 5Y7G E 1  ? 24  ? 5Y7G   1 ? 24  ? 1 24  
6  2 5Y7G F 1  ? 10  ? 5Y7G   1 ? 10  ? 1 10  
7  3 5Y7G G 1  ? 24  ? 5Y7G   1 ? 24  ? 1 24  
8  2 5Y7G H 1  ? 10  ? 5Y7G   1 ? 10  ? 1 10  
9  3 5Y7G I 1  ? 24  ? 5Y7G   1 ? 24  ? 1 24  
10 4 5Y7G J 1  ? 14  ? 5Y7G   1 ? 14  ? 1 14  
11 4 5Y7G L 1  ? 14  ? 5Y7G   1 ? 14  ? 1 14  
12 4 5Y7G N 1  ? 14  ? 5Y7G   1 ? 14  ? 1 14  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5Y7G MET A 1  ? UNP Q9I2N0 ? ? 'expression tag' -20 1  
1 5Y7G GLY A 2  ? UNP Q9I2N0 ? ? 'expression tag' -19 2  
1 5Y7G SER A 3  ? UNP Q9I2N0 ? ? 'expression tag' -18 3  
1 5Y7G SER A 4  ? UNP Q9I2N0 ? ? 'expression tag' -17 4  
1 5Y7G HIS A 5  ? UNP Q9I2N0 ? ? 'expression tag' -16 5  
1 5Y7G HIS A 6  ? UNP Q9I2N0 ? ? 'expression tag' -15 6  
1 5Y7G HIS A 7  ? UNP Q9I2N0 ? ? 'expression tag' -14 7  
1 5Y7G HIS A 8  ? UNP Q9I2N0 ? ? 'expression tag' -13 8  
1 5Y7G HIS A 9  ? UNP Q9I2N0 ? ? 'expression tag' -12 9  
1 5Y7G HIS A 10 ? UNP Q9I2N0 ? ? 'expression tag' -11 10 
1 5Y7G SER A 11 ? UNP Q9I2N0 ? ? 'expression tag' -10 11 
1 5Y7G SER A 12 ? UNP Q9I2N0 ? ? 'expression tag' -9  12 
1 5Y7G GLY A 13 ? UNP Q9I2N0 ? ? 'expression tag' -8  13 
1 5Y7G LEU A 14 ? UNP Q9I2N0 ? ? 'expression tag' -7  14 
1 5Y7G VAL A 15 ? UNP Q9I2N0 ? ? 'expression tag' -6  15 
1 5Y7G PRO A 16 ? UNP Q9I2N0 ? ? 'expression tag' -5  16 
1 5Y7G ARG A 17 ? UNP Q9I2N0 ? ? 'expression tag' -4  17 
1 5Y7G GLY A 18 ? UNP Q9I2N0 ? ? 'expression tag' -3  18 
1 5Y7G SER A 19 ? UNP Q9I2N0 ? ? 'expression tag' -2  19 
1 5Y7G HIS A 20 ? UNP Q9I2N0 ? ? 'expression tag' -1  20 
1 5Y7G MET A 21 ? UNP Q9I2N0 ? ? 'expression tag' 0   21 
2 5Y7G MET B 1  ? UNP Q9I2N0 ? ? 'expression tag' -20 22 
2 5Y7G GLY B 2  ? UNP Q9I2N0 ? ? 'expression tag' -19 23 
2 5Y7G SER B 3  ? UNP Q9I2N0 ? ? 'expression tag' -18 24 
2 5Y7G SER B 4  ? UNP Q9I2N0 ? ? 'expression tag' -17 25 
2 5Y7G HIS B 5  ? UNP Q9I2N0 ? ? 'expression tag' -16 26 
2 5Y7G HIS B 6  ? UNP Q9I2N0 ? ? 'expression tag' -15 27 
2 5Y7G HIS B 7  ? UNP Q9I2N0 ? ? 'expression tag' -14 28 
2 5Y7G HIS B 8  ? UNP Q9I2N0 ? ? 'expression tag' -13 29 
2 5Y7G HIS B 9  ? UNP Q9I2N0 ? ? 'expression tag' -12 30 
2 5Y7G HIS B 10 ? UNP Q9I2N0 ? ? 'expression tag' -11 31 
2 5Y7G SER B 11 ? UNP Q9I2N0 ? ? 'expression tag' -10 32 
2 5Y7G SER B 12 ? UNP Q9I2N0 ? ? 'expression tag' -9  33 
2 5Y7G GLY B 13 ? UNP Q9I2N0 ? ? 'expression tag' -8  34 
2 5Y7G LEU B 14 ? UNP Q9I2N0 ? ? 'expression tag' -7  35 
2 5Y7G VAL B 15 ? UNP Q9I2N0 ? ? 'expression tag' -6  36 
2 5Y7G PRO B 16 ? UNP Q9I2N0 ? ? 'expression tag' -5  37 
2 5Y7G ARG B 17 ? UNP Q9I2N0 ? ? 'expression tag' -4  38 
2 5Y7G GLY B 18 ? UNP Q9I2N0 ? ? 'expression tag' -3  39 
2 5Y7G SER B 19 ? UNP Q9I2N0 ? ? 'expression tag' -2  40 
2 5Y7G HIS B 20 ? UNP Q9I2N0 ? ? 'expression tag' -1  41 
2 5Y7G MET B 21 ? UNP Q9I2N0 ? ? 'expression tag' 0   42 
3 5Y7G MET C 1  ? UNP Q9I2N0 ? ? 'expression tag' -20 43 
3 5Y7G GLY C 2  ? UNP Q9I2N0 ? ? 'expression tag' -19 44 
3 5Y7G SER C 3  ? UNP Q9I2N0 ? ? 'expression tag' -18 45 
3 5Y7G SER C 4  ? UNP Q9I2N0 ? ? 'expression tag' -17 46 
3 5Y7G HIS C 5  ? UNP Q9I2N0 ? ? 'expression tag' -16 47 
3 5Y7G HIS C 6  ? UNP Q9I2N0 ? ? 'expression tag' -15 48 
3 5Y7G HIS C 7  ? UNP Q9I2N0 ? ? 'expression tag' -14 49 
3 5Y7G HIS C 8  ? UNP Q9I2N0 ? ? 'expression tag' -13 50 
3 5Y7G HIS C 9  ? UNP Q9I2N0 ? ? 'expression tag' -12 51 
3 5Y7G HIS C 10 ? UNP Q9I2N0 ? ? 'expression tag' -11 52 
3 5Y7G SER C 11 ? UNP Q9I2N0 ? ? 'expression tag' -10 53 
3 5Y7G SER C 12 ? UNP Q9I2N0 ? ? 'expression tag' -9  54 
3 5Y7G GLY C 13 ? UNP Q9I2N0 ? ? 'expression tag' -8  55 
3 5Y7G LEU C 14 ? UNP Q9I2N0 ? ? 'expression tag' -7  56 
3 5Y7G VAL C 15 ? UNP Q9I2N0 ? ? 'expression tag' -6  57 
3 5Y7G PRO C 16 ? UNP Q9I2N0 ? ? 'expression tag' -5  58 
3 5Y7G ARG C 17 ? UNP Q9I2N0 ? ? 'expression tag' -4  59 
3 5Y7G GLY C 18 ? UNP Q9I2N0 ? ? 'expression tag' -3  60 
3 5Y7G SER C 19 ? UNP Q9I2N0 ? ? 'expression tag' -2  61 
3 5Y7G HIS C 20 ? UNP Q9I2N0 ? ? 'expression tag' -1  62 
3 5Y7G MET C 21 ? UNP Q9I2N0 ? ? 'expression tag' 0   63 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5Y7G 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.54 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.30 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.1M Bis-Tris-Propane (pH7.6), 12%(w/v) PEG 8000, 0.2M Sodium acetate trihydrate, 10mM Calcium chloride dihydrate, 1%(w/v) PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-06-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PAL/PLS BEAMLINE 5C (4A)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   '5C (4A)' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5Y7G 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.40 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       46805 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.0 
_reflns.pdbx_Rmerge_I_obs                0.162 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.162 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            26.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.913 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             1.913 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.575 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.222 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5Y7G 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.400 
_refine.ls_d_res_low                             33.580 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     46339 
_refine.ls_number_reflns_R_free                  2368 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.60 
_refine.ls_percent_reflns_R_free                 5.11 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2241 
_refine.ls_R_factor_R_free                       0.2798 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2210 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4R8A 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 36.99 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.67 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13231 
_refine_hist.pdbx_number_atoms_nucleic_acid   2928 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16164 
_refine_hist.d_res_high                       3.400 
_refine_hist.d_res_low                        33.580 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.013  ? 16868 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.426  ? 23421 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 21.792 ? 9532  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.072  ? 2458  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.009  ? 2592  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.4001 3.4694  . . 124 2437 92.00 . . . 0.4569 . 0.3920 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4694 3.5448  . . 124 2427 92.00 . . . 0.3924 . 0.3751 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5448 3.6271  . . 140 2483 92.00 . . . 0.4271 . 0.3492 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6271 3.7177  . . 152 2467 94.00 . . . 0.3889 . 0.3282 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7177 3.8181  . . 133 2517 94.00 . . . 0.3726 . 0.3180 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8181 3.9303  . . 127 2547 94.00 . . . 0.4277 . 0.3110 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9303 4.0569  . . 137 2499 94.00 . . . 0.3459 . 0.2911 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0569 4.2017  . . 153 2547 94.00 . . . 0.3743 . 0.2937 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2017 4.3696  . . 153 2555 95.00 . . . 0.3594 . 0.2734 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3696 4.5680  . . 145 2587 97.00 . . . 0.3295 . 0.2494 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5680 4.8081  . . 114 2628 97.00 . . . 0.3243 . 0.2487 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8081 5.1084  . . 143 2649 98.00 . . . 0.3248 . 0.2361 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1084 5.5013  . . 141 2676 98.00 . . . 0.3511 . 0.2345 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5013 6.0520  . . 143 2700 99.00 . . . 0.3510 . 0.2277 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.0520 6.9210  . . 130 2743 99.00 . . . 0.3211 . 0.2264 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.9210 8.6947  . . 149 2752 99.00 . . . 0.2277 . 0.1874 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.6947 33.5817 . . 160 2757 96.00 . . . 0.1765 . 0.1408 . . . . . . . . . . 
# 
_struct.entry_id                     5Y7G 
_struct.title                        
;Crystal structure of paFAN1 bound to 1nt 5'flap DNA with gap
;
_struct.pdbx_descriptor              'Fanconi-associated nuclease 1 homolog/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5Y7G 
_struct_keywords.text            'nuclease, HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PHE A 41  ? TYR A 58  ? PHE A 20  TYR A 37  1 ? 18 
HELX_P HELX_P2  AA2 ALA A 59  ? LEU A 62  ? ALA A 38  LEU A 41  5 ? 4  
HELX_P HELX_P3  AA3 ASP A 63  ? GLU A 75  ? ASP A 42  GLU A 54  1 ? 13 
HELX_P HELX_P4  AA4 PRO A 77  ? ARG A 90  ? PRO A 56  ARG A 69  1 ? 14 
HELX_P HELX_P5  AA5 GLY A 98  ? ALA A 101 ? GLY A 77  ALA A 80  5 ? 4  
HELX_P HELX_P6  AA6 ASP A 107 ? VAL A 112 ? ASP A 86  VAL A 91  1 ? 6  
HELX_P HELX_P7  AA7 VAL A 112 ? LEU A 118 ? VAL A 91  LEU A 97  1 ? 7  
HELX_P HELX_P8  AA8 GLU A 128 ? LEU A 136 ? GLU A 107 LEU A 115 1 ? 9  
HELX_P HELX_P9  AA9 LYS A 137 ? PHE A 145 ? LYS A 116 PHE A 124 1 ? 9  
HELX_P HELX_P10 AB1 ARG A 155 ? GLN A 164 ? ARG A 134 GLN A 143 1 ? 10 
HELX_P HELX_P11 AB2 ALA A 174 ? TRP A 176 ? ALA A 153 TRP A 155 5 ? 3  
HELX_P HELX_P12 AB3 CYS A 189 ? GLY A 202 ? CYS A 168 GLY A 181 1 ? 14 
HELX_P HELX_P13 AB4 SER A 209 ? GLY A 217 ? SER A 188 GLY A 196 1 ? 9  
HELX_P HELX_P14 AB5 LEU A 235 ? GLY A 255 ? LEU A 214 GLY A 234 1 ? 21 
HELX_P HELX_P15 AB6 ASN A 272 ? GLN A 293 ? ASN A 251 GLN A 272 1 ? 22 
HELX_P HELX_P16 AB7 ASP A 295 ? GLN A 305 ? ASP A 274 GLN A 284 1 ? 11 
HELX_P HELX_P17 AB8 GLY A 310 ? GLY A 322 ? GLY A 289 GLY A 301 1 ? 13 
HELX_P HELX_P18 AB9 ARG A 324 ? ALA A 338 ? ARG A 303 ALA A 317 1 ? 15 
HELX_P HELX_P19 AC1 SER A 341 ? LEU A 359 ? SER A 320 LEU A 338 1 ? 19 
HELX_P HELX_P20 AC2 SER A 387 ? LEU A 396 ? SER A 366 LEU A 375 1 ? 10 
HELX_P HELX_P21 AC3 ASN A 408 ? CYS A 419 ? ASN A 387 CYS A 398 1 ? 12 
HELX_P HELX_P22 AC4 CYS A 419 ? PHE A 424 ? CYS A 398 PHE A 403 1 ? 6  
HELX_P HELX_P23 AC5 ASP A 446 ? ARG A 451 ? ASP A 425 ARG A 430 1 ? 6  
HELX_P HELX_P24 AC6 ARG A 451 ? ARG A 461 ? ARG A 430 ARG A 440 1 ? 11 
HELX_P HELX_P25 AC7 SER A 466 ? PHE A 479 ? SER A 445 PHE A 458 1 ? 14 
HELX_P HELX_P26 AC8 GLY A 492 ? LEU A 503 ? GLY A 471 LEU A 482 1 ? 12 
HELX_P HELX_P27 AC9 PRO A 504 ? ASP A 518 ? PRO A 483 ASP A 497 1 ? 15 
HELX_P HELX_P28 AD1 ASP A 518 ? ARG A 523 ? ASP A 497 ARG A 502 1 ? 6  
HELX_P HELX_P29 AD2 GLN A 552 ? ARG A 565 ? GLN A 531 ARG A 544 1 ? 14 
HELX_P HELX_P30 AD3 PHE B 41  ? TYR B 58  ? PHE B 20  TYR B 37  1 ? 18 
HELX_P HELX_P31 AD4 ALA B 59  ? LEU B 62  ? ALA B 38  LEU B 41  5 ? 4  
HELX_P HELX_P32 AD5 ASP B 63  ? GLU B 75  ? ASP B 42  GLU B 54  1 ? 13 
HELX_P HELX_P33 AD6 PRO B 77  ? ARG B 90  ? PRO B 56  ARG B 69  1 ? 14 
HELX_P HELX_P34 AD7 GLY B 98  ? ALA B 101 ? GLY B 77  ALA B 80  5 ? 4  
HELX_P HELX_P35 AD8 ASP B 107 ? VAL B 112 ? ASP B 86  VAL B 91  1 ? 6  
HELX_P HELX_P36 AD9 VAL B 112 ? LEU B 118 ? VAL B 91  LEU B 97  1 ? 7  
HELX_P HELX_P37 AE1 GLU B 128 ? LEU B 136 ? GLU B 107 LEU B 115 1 ? 9  
HELX_P HELX_P38 AE2 LYS B 137 ? PHE B 145 ? LYS B 116 PHE B 124 1 ? 9  
HELX_P HELX_P39 AE3 ARG B 155 ? GLN B 164 ? ARG B 134 GLN B 143 1 ? 10 
HELX_P HELX_P40 AE4 LEU B 173 ? GLN B 177 ? LEU B 152 GLN B 156 1 ? 5  
HELX_P HELX_P41 AE5 CYS B 189 ? GLY B 202 ? CYS B 168 GLY B 181 1 ? 14 
HELX_P HELX_P42 AE6 TRP B 208 ? GLY B 217 ? TRP B 187 GLY B 196 1 ? 10 
HELX_P HELX_P43 AE7 LEU B 235 ? LEU B 254 ? LEU B 214 LEU B 233 1 ? 20 
HELX_P HELX_P44 AE8 PRO B 257 ? LEU B 265 ? PRO B 236 LEU B 244 1 ? 9  
HELX_P HELX_P45 AE9 ASN B 272 ? ARG B 294 ? ASN B 251 ARG B 273 1 ? 23 
HELX_P HELX_P46 AF1 ASP B 295 ? GLN B 305 ? ASP B 274 GLN B 284 1 ? 11 
HELX_P HELX_P47 AF2 GLY B 310 ? GLY B 322 ? GLY B 289 GLY B 301 1 ? 13 
HELX_P HELX_P48 AF3 ARG B 324 ? ALA B 338 ? ARG B 303 ALA B 317 1 ? 15 
HELX_P HELX_P49 AF4 SER B 341 ? GLY B 360 ? SER B 320 GLY B 339 1 ? 20 
HELX_P HELX_P50 AF5 SER B 387 ? GLU B 397 ? SER B 366 GLU B 376 1 ? 11 
HELX_P HELX_P51 AF6 ASN B 408 ? CYS B 419 ? ASN B 387 CYS B 398 1 ? 12 
HELX_P HELX_P52 AF7 CYS B 419 ? PHE B 424 ? CYS B 398 PHE B 403 1 ? 6  
HELX_P HELX_P53 AF8 ASP B 446 ? ARG B 451 ? ASP B 425 ARG B 430 1 ? 6  
HELX_P HELX_P54 AF9 ARG B 451 ? ARG B 461 ? ARG B 430 ARG B 440 1 ? 11 
HELX_P HELX_P55 AG1 SER B 466 ? PHE B 479 ? SER B 445 PHE B 458 1 ? 14 
HELX_P HELX_P56 AG2 GLY B 492 ? LEU B 503 ? GLY B 471 LEU B 482 1 ? 12 
HELX_P HELX_P57 AG3 PRO B 504 ? ASP B 518 ? PRO B 483 ASP B 497 1 ? 15 
HELX_P HELX_P58 AG4 ASP B 518 ? ARG B 523 ? ASP B 497 ARG B 502 1 ? 6  
HELX_P HELX_P59 AG5 PRO B 534 ? ARG B 537 ? PRO B 513 ARG B 516 5 ? 4  
HELX_P HELX_P60 AG6 GLN B 552 ? ARG B 565 ? GLN B 531 ARG B 544 1 ? 14 
HELX_P HELX_P61 AG7 PHE C 41  ? ARG C 57  ? PHE C 20  ARG C 36  1 ? 17 
HELX_P HELX_P62 AG8 TYR C 58  ? LEU C 62  ? TYR C 37  LEU C 41  5 ? 5  
HELX_P HELX_P63 AG9 ASP C 63  ? GLU C 75  ? ASP C 42  GLU C 54  1 ? 13 
HELX_P HELX_P64 AH1 PRO C 77  ? ARG C 90  ? PRO C 56  ARG C 69  1 ? 14 
HELX_P HELX_P65 AH2 ASP C 107 ? VAL C 112 ? ASP C 86  VAL C 91  1 ? 6  
HELX_P HELX_P66 AH3 VAL C 112 ? LEU C 118 ? VAL C 91  LEU C 97  1 ? 7  
HELX_P HELX_P67 AH4 GLU C 128 ? LEU C 136 ? GLU C 107 LEU C 115 1 ? 9  
HELX_P HELX_P68 AH5 LYS C 137 ? PHE C 145 ? LYS C 116 PHE C 124 1 ? 9  
HELX_P HELX_P69 AH6 ARG C 155 ? GLN C 164 ? ARG C 134 GLN C 143 1 ? 10 
HELX_P HELX_P70 AH7 LEU C 173 ? GLN C 177 ? LEU C 152 GLN C 156 1 ? 5  
HELX_P HELX_P71 AH8 CYS C 189 ? GLY C 202 ? CYS C 168 GLY C 181 1 ? 14 
HELX_P HELX_P72 AH9 TRP C 208 ? LEU C 216 ? TRP C 187 LEU C 195 1 ? 9  
HELX_P HELX_P73 AI1 LEU C 235 ? ASP C 253 ? LEU C 214 ASP C 232 1 ? 19 
HELX_P HELX_P74 AI2 ASN C 272 ? GLN C 293 ? ASN C 251 GLN C 272 1 ? 22 
HELX_P HELX_P75 AI3 ASP C 295 ? GLN C 305 ? ASP C 274 GLN C 284 1 ? 11 
HELX_P HELX_P76 AI4 GLY C 310 ? GLY C 322 ? GLY C 289 GLY C 301 1 ? 13 
HELX_P HELX_P77 AI5 ARG C 324 ? ALA C 338 ? ARG C 303 ALA C 317 1 ? 15 
HELX_P HELX_P78 AI6 SER C 341 ? LEU C 359 ? SER C 320 LEU C 338 1 ? 19 
HELX_P HELX_P79 AI7 SER C 387 ? LEU C 396 ? SER C 366 LEU C 375 1 ? 10 
HELX_P HELX_P80 AI8 ASN C 408 ? CYS C 419 ? ASN C 387 CYS C 398 1 ? 12 
HELX_P HELX_P81 AI9 CYS C 419 ? PHE C 424 ? CYS C 398 PHE C 403 1 ? 6  
HELX_P HELX_P82 AJ1 ASP C 446 ? GLY C 460 ? ASP C 425 GLY C 439 1 ? 15 
HELX_P HELX_P83 AJ2 ARG C 461 ? GLU C 463 ? ARG C 440 GLU C 442 5 ? 3  
HELX_P HELX_P84 AJ3 GLY C 465 ? PHE C 479 ? GLY C 444 PHE C 458 1 ? 15 
HELX_P HELX_P85 AJ4 GLY C 492 ? LEU C 503 ? GLY C 471 LEU C 482 1 ? 12 
HELX_P HELX_P86 AJ5 PRO C 504 ? ASP C 518 ? PRO C 483 ASP C 497 1 ? 15 
HELX_P HELX_P87 AJ6 ASP C 518 ? ARG C 523 ? ASP C 497 ARG C 502 1 ? 6  
HELX_P HELX_P88 AJ7 GLN C 552 ? ARG C 565 ? GLN C 531 ARG C 544 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A GLU 389 OE2   ? ? ? 1_555 M CA .  CA ? ? A GLU 368 A CA 601 1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc2   metalc ? ? A GLU 407 OE1   ? ? ? 1_555 N CA .  CA ? ? A GLU 386 A CA 602 1_555 ? ? ? ? ? ? ?            2.680 ? 
metalc3   metalc ? ? A ASP 528 OD1   ? ? ? 1_555 N CA .  CA ? ? A ASP 507 A CA 602 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc4   metalc ? ? A ASP 528 OD2   ? ? ? 1_555 M CA .  CA ? ? A ASP 507 A CA 601 1_555 ? ? ? ? ? ? ?            2.495 ? 
metalc5   metalc ? ? A GLU 543 OE2   ? ? ? 1_555 M CA .  CA ? ? A GLU 522 A CA 601 1_555 ? ? ? ? ? ? ?            2.431 ? 
metalc6   metalc ? ? A VAL 544 O     ? ? ? 1_555 M CA .  CA ? ? A VAL 523 A CA 601 1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc7   metalc ? ? B GLU 389 OE2   ? ? ? 1_555 O CA .  CA ? ? B GLU 368 B CA 601 1_555 ? ? ? ? ? ? ?            2.649 ? 
metalc8   metalc ? ? B GLU 407 OE1   ? ? ? 1_555 P CA .  CA ? ? B GLU 386 B CA 602 1_555 ? ? ? ? ? ? ?            2.555 ? 
metalc9   metalc ? ? B ASP 528 OD1   ? ? ? 1_555 P CA .  CA ? ? B ASP 507 B CA 602 1_555 ? ? ? ? ? ? ?            2.370 ? 
metalc10  metalc ? ? B ASP 528 OD2   ? ? ? 1_555 O CA .  CA ? ? B ASP 507 B CA 601 1_555 ? ? ? ? ? ? ?            2.477 ? 
metalc11  metalc ? ? B GLU 543 OE2   ? ? ? 1_555 O CA .  CA ? ? B GLU 522 B CA 601 1_555 ? ? ? ? ? ? ?            2.496 ? 
metalc12  metalc ? ? B VAL 544 O     ? ? ? 1_555 O CA .  CA ? ? B VAL 523 B CA 601 1_555 ? ? ? ? ? ? ?            2.146 ? 
metalc13  metalc ? ? C GLU 389 OE2   ? ? ? 1_555 Q CA .  CA ? ? C GLU 368 C CA 601 1_555 ? ? ? ? ? ? ?            2.435 ? 
metalc14  metalc ? ? C ASP 528 OD1   ? ? ? 1_555 Q CA .  CA ? ? C ASP 507 C CA 601 1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc15  metalc ? ? C GLU 543 OE2   ? ? ? 1_555 Q CA .  CA ? ? C GLU 522 C CA 601 1_555 ? ? ? ? ? ? ?            2.558 ? 
metalc16  metalc ? ? C VAL 544 O     ? ? ? 1_555 Q CA .  CA ? ? C VAL 523 C CA 601 1_555 ? ? ? ? ? ? ?            2.188 ? 
metalc17  metalc ? ? J DA  5   "O3'" ? ? ? 1_555 N CA .  CA ? ? J DA  5   A CA 602 1_555 ? ? ? ? ? ? ?            2.730 ? 
metalc18  metalc ? ? J DC  6   OP1   ? ? ? 1_555 M CA .  CA ? ? J DC  6   A CA 601 1_555 ? ? ? ? ? ? ?            2.191 ? 
metalc19  metalc ? ? J DC  6   OP1   ? ? ? 1_555 N CA .  CA ? ? J DC  6   A CA 602 1_555 ? ? ? ? ? ? ?            2.570 ? 
metalc20  metalc ? ? K DC  4   "O3'" ? ? ? 1_555 P CA .  CA ? ? L DC  4   B CA 602 1_555 ? ? ? ? ? ? ?            3.128 ? 
metalc21  metalc ? ? K DA  5   OP1   ? ? ? 1_555 O CA .  CA ? ? L DA  5   B CA 601 1_555 ? ? ? ? ? ? ?            2.370 ? 
metalc22  metalc ? ? K DA  5   OP1   ? ? ? 1_555 P CA .  CA ? ? L DA  5   B CA 602 1_555 ? ? ? ? ? ? ?            2.520 ? 
metalc23  metalc ? ? L DC  6   OP1   ? ? ? 1_555 Q CA .  CA ? ? N DC  6   C CA 601 1_555 ? ? ? ? ? ? ?            2.213 ? 
hydrog1   hydrog ? ? D DG  1   N1    ? ? ? 1_555 E DC 22 N3 ? ? D DG  1   E DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? D DG  1   N2    ? ? ? 1_555 E DC 22 O2 ? ? D DG  1   E DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? D DG  1   O6    ? ? ? 1_555 E DC 22 N4 ? ? D DG  1   E DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? D DT  2   N3    ? ? ? 1_555 E DA 21 N1 ? ? D DT  2   E DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? D DT  2   O4    ? ? ? 1_555 E DA 21 N6 ? ? D DT  2   E DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? D DT  3   N3    ? ? ? 1_555 E DA 20 N1 ? ? D DT  3   E DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? D DT  3   O4    ? ? ? 1_555 E DA 20 N6 ? ? D DT  3   E DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? D DG  4   N1    ? ? ? 1_555 E DC 19 N3 ? ? D DG  4   E DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? D DG  4   N2    ? ? ? 1_555 E DC 19 O2 ? ? D DG  4   E DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? D DG  4   O6    ? ? ? 1_555 E DC 19 N4 ? ? D DG  4   E DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? D DG  5   N1    ? ? ? 1_555 E DC 18 N3 ? ? D DG  5   E DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? D DG  5   N2    ? ? ? 1_555 E DC 18 O2 ? ? D DG  5   E DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? D DG  5   O6    ? ? ? 1_555 E DC 18 N4 ? ? D DG  5   E DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? D DG  6   N1    ? ? ? 1_555 E DC 17 N3 ? ? D DG  6   E DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? D DG  6   N2    ? ? ? 1_555 E DC 17 O2 ? ? D DG  6   E DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? D DG  6   O6    ? ? ? 1_555 E DC 17 N4 ? ? D DG  6   E DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? D DA  7   N1    ? ? ? 1_555 E DT 16 N3 ? ? D DA  7   E DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? D DA  7   N6    ? ? ? 1_555 E DT 16 O4 ? ? D DA  7   E DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? D DT  8   N3    ? ? ? 1_555 E DA 15 N1 ? ? D DT  8   E DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? D DT  8   O4    ? ? ? 1_555 E DA 15 N6 ? ? D DT  8   E DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? D DT  9   N3    ? ? ? 1_555 E DA 14 N1 ? ? D DT  9   E DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? D DT  9   O4    ? ? ? 1_555 E DA 14 N6 ? ? D DT  9   E DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? D DG  10  N1    ? ? ? 1_555 E DC 13 N3 ? ? D DG  10  E DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? D DG  10  N2    ? ? ? 1_555 E DC 13 O2 ? ? D DG  10  E DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? D DG  10  O6    ? ? ? 1_555 E DC 13 N4 ? ? D DG  10  E DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? E DG  1   N1    ? ? ? 1_555 J DC 12 N3 ? ? E DG  1   J DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? E DG  1   N2    ? ? ? 1_555 J DC 12 O2 ? ? E DG  1   J DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? E DG  1   O6    ? ? ? 1_555 J DC 12 N4 ? ? E DG  1   J DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? E DA  2   N1    ? ? ? 1_555 J DT 11 N3 ? ? E DA  2   J DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? E DA  2   N6    ? ? ? 1_555 J DT 11 O4 ? ? E DA  2   J DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? E DA  3   N1    ? ? ? 1_555 J DT 10 N3 ? ? E DA  3   J DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? E DA  3   N6    ? ? ? 1_555 J DT 10 O4 ? ? E DA  3   J DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? E DT  4   N3    ? ? ? 1_555 J DA 9  N1 ? ? E DT  4   J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? E DT  4   O4    ? ? ? 1_555 J DA 9  N6 ? ? E DT  4   J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? E DG  5   N1    ? ? ? 1_555 J DC 8  N3 ? ? E DG  5   J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? E DG  5   N2    ? ? ? 1_555 J DC 8  O2 ? ? E DG  5   J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? E DG  5   O6    ? ? ? 1_555 J DC 8  N4 ? ? E DG  5   J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? E DT  6   N3    ? ? ? 1_555 J DA 7  N1 ? ? E DT  6   J DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? E DT  6   O4    ? ? ? 1_555 J DA 7  N6 ? ? E DT  6   J DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? E DG  7   N1    ? ? ? 1_555 J DC 6  N3 ? ? E DG  7   J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? E DG  7   N2    ? ? ? 1_555 J DC 6  O2 ? ? E DG  7   J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? E DG  7   O6    ? ? ? 1_555 J DC 6  N4 ? ? E DG  7   J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? E DT  8   N3    ? ? ? 1_555 J DA 5  N1 ? ? E DT  8   J DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? E DT  8   O4    ? ? ? 1_555 J DA 5  N6 ? ? E DT  8   J DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? E DG  9   N1    ? ? ? 1_555 J DC 4  N3 ? ? E DG  9   J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? E DG  9   N2    ? ? ? 1_555 J DC 4  O2 ? ? E DG  9   J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? E DG  9   O6    ? ? ? 1_555 J DC 4  N4 ? ? E DG  9   J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? E DT  10  N3    ? ? ? 1_555 J DA 3  N1 ? ? E DT  10  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? E DT  10  O4    ? ? ? 1_555 J DA 3  N6 ? ? E DT  10  J DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? E DC  11  N3    ? ? ? 1_555 J DG 2  N1 ? ? E DC  11  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? E DC  11  N4    ? ? ? 1_555 J DG 2  O6 ? ? E DC  11  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? E DC  11  O2    ? ? ? 1_555 J DG 2  N2 ? ? E DC  11  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? F DG  1   N1    ? ? ? 1_555 G DC 22 N3 ? ? F DG  1   G DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? F DG  1   N2    ? ? ? 1_555 G DC 22 O2 ? ? F DG  1   G DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? F DG  1   O6    ? ? ? 1_555 G DC 22 N4 ? ? F DG  1   G DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? F DT  2   N3    ? ? ? 1_555 G DA 21 N1 ? ? F DT  2   G DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? F DT  2   O4    ? ? ? 1_555 G DA 21 N6 ? ? F DT  2   G DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? F DT  3   N3    ? ? ? 1_555 G DA 20 N1 ? ? F DT  3   G DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? F DT  3   O4    ? ? ? 1_555 G DA 20 N6 ? ? F DT  3   G DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? F DG  4   N1    ? ? ? 1_555 G DC 19 N3 ? ? F DG  4   G DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? F DG  4   N2    ? ? ? 1_555 G DC 19 O2 ? ? F DG  4   G DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? F DG  4   O6    ? ? ? 1_555 G DC 19 N4 ? ? F DG  4   G DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? F DG  5   N1    ? ? ? 1_555 G DC 18 N3 ? ? F DG  5   G DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? F DG  5   N2    ? ? ? 1_555 G DC 18 O2 ? ? F DG  5   G DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? F DG  5   O6    ? ? ? 1_555 G DC 18 N4 ? ? F DG  5   G DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? F DG  6   N1    ? ? ? 1_555 G DC 17 N3 ? ? F DG  6   G DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? F DG  6   N2    ? ? ? 1_555 G DC 17 O2 ? ? F DG  6   G DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? F DG  6   O6    ? ? ? 1_555 G DC 17 N4 ? ? F DG  6   G DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? F DA  7   N1    ? ? ? 1_555 G DT 16 N3 ? ? F DA  7   G DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? F DA  7   N6    ? ? ? 1_555 G DT 16 O4 ? ? F DA  7   G DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? F DT  8   N3    ? ? ? 1_555 G DA 15 N1 ? ? F DT  8   G DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? F DT  8   O4    ? ? ? 1_555 G DA 15 N6 ? ? F DT  8   G DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? F DT  9   N3    ? ? ? 1_555 G DA 14 N1 ? ? F DT  9   G DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? F DT  9   O4    ? ? ? 1_555 G DA 14 N6 ? ? F DT  9   G DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? F DG  10  N1    ? ? ? 1_555 G DC 13 N3 ? ? F DG  10  G DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? F DG  10  N2    ? ? ? 1_555 G DC 13 O2 ? ? F DG  10  G DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? F DG  10  O6    ? ? ? 1_555 G DC 13 N4 ? ? F DG  10  G DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? G DG  1   N1    ? ? ? 1_555 K DC 12 N3 ? ? G DG  1   L DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? G DG  1   N2    ? ? ? 1_555 K DC 12 O2 ? ? G DG  1   L DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? G DG  1   O6    ? ? ? 1_555 K DC 12 N4 ? ? G DG  1   L DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? G DA  2   N1    ? ? ? 1_555 K DT 11 N3 ? ? G DA  2   L DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? G DA  2   N6    ? ? ? 1_555 K DT 11 O4 ? ? G DA  2   L DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? G DA  3   N1    ? ? ? 1_555 K DT 10 N3 ? ? G DA  3   L DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? G DA  3   N6    ? ? ? 1_555 K DT 10 O4 ? ? G DA  3   L DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? G DT  4   N3    ? ? ? 1_555 K DA 9  N1 ? ? G DT  4   L DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? G DT  4   O4    ? ? ? 1_555 K DA 9  N6 ? ? G DT  4   L DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? G DG  5   N1    ? ? ? 1_555 K DC 8  N3 ? ? G DG  5   L DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? G DG  5   N2    ? ? ? 1_555 K DC 8  O2 ? ? G DG  5   L DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? G DG  5   O6    ? ? ? 1_555 K DC 8  N4 ? ? G DG  5   L DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? G DT  6   N3    ? ? ? 1_555 K DA 7  N1 ? ? G DT  6   L DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? G DT  6   O4    ? ? ? 1_555 K DA 7  N6 ? ? G DT  6   L DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? G DG  7   N1    ? ? ? 1_555 K DC 6  N3 ? ? G DG  7   L DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? G DG  7   N2    ? ? ? 1_555 K DC 6  O2 ? ? G DG  7   L DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? G DG  7   O6    ? ? ? 1_555 K DC 6  N4 ? ? G DG  7   L DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? G DT  8   N3    ? ? ? 1_555 K DA 5  N1 ? ? G DT  8   L DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? G DT  8   O4    ? ? ? 1_555 K DA 5  N6 ? ? G DT  8   L DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? G DG  9   N1    ? ? ? 1_555 K DC 4  N3 ? ? G DG  9   L DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? G DG  9   N2    ? ? ? 1_555 K DC 4  O2 ? ? G DG  9   L DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? G DG  9   O6    ? ? ? 1_555 K DC 4  N4 ? ? G DG  9   L DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? G DT  10  N3    ? ? ? 1_555 K DA 3  N1 ? ? G DT  10  L DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? G DT  10  O4    ? ? ? 1_555 K DA 3  N6 ? ? G DT  10  L DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? G DC  11  N3    ? ? ? 1_555 K DG 2  N1 ? ? G DC  11  L DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? G DC  11  N4    ? ? ? 1_555 K DG 2  O6 ? ? G DC  11  L DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? G DC  11  O2    ? ? ? 1_555 K DG 2  N2 ? ? G DC  11  L DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? H DG  1   N1    ? ? ? 1_555 I DC 22 N3 ? ? H DG  1   I DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? H DG  1   N2    ? ? ? 1_555 I DC 22 O2 ? ? H DG  1   I DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? H DG  1   O6    ? ? ? 1_555 I DC 22 N4 ? ? H DG  1   I DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? H DT  2   N3    ? ? ? 1_555 I DA 21 N1 ? ? H DT  2   I DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? H DT  2   O4    ? ? ? 1_555 I DA 21 N6 ? ? H DT  2   I DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? H DT  3   N3    ? ? ? 1_555 I DA 20 N1 ? ? H DT  3   I DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? H DT  3   O4    ? ? ? 1_555 I DA 20 N6 ? ? H DT  3   I DA 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? H DG  4   N1    ? ? ? 1_555 I DC 19 N3 ? ? H DG  4   I DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? H DG  4   N2    ? ? ? 1_555 I DC 19 O2 ? ? H DG  4   I DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? H DG  4   O6    ? ? ? 1_555 I DC 19 N4 ? ? H DG  4   I DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? H DG  5   N1    ? ? ? 1_555 I DC 18 N3 ? ? H DG  5   I DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? H DG  5   N2    ? ? ? 1_555 I DC 18 O2 ? ? H DG  5   I DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? H DG  5   O6    ? ? ? 1_555 I DC 18 N4 ? ? H DG  5   I DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? H DG  6   N1    ? ? ? 1_555 I DC 17 N3 ? ? H DG  6   I DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? H DG  6   N2    ? ? ? 1_555 I DC 17 O2 ? ? H DG  6   I DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? H DG  6   O6    ? ? ? 1_555 I DC 17 N4 ? ? H DG  6   I DC 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? H DA  7   N1    ? ? ? 1_555 I DT 16 N3 ? ? H DA  7   I DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? H DA  7   N6    ? ? ? 1_555 I DT 16 O4 ? ? H DA  7   I DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? H DT  8   N3    ? ? ? 1_555 I DA 15 N1 ? ? H DT  8   I DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? H DT  8   O4    ? ? ? 1_555 I DA 15 N6 ? ? H DT  8   I DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? H DT  9   N3    ? ? ? 1_555 I DA 14 N1 ? ? H DT  9   I DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? H DT  9   O4    ? ? ? 1_555 I DA 14 N6 ? ? H DT  9   I DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? H DG  10  N1    ? ? ? 1_555 I DC 13 N3 ? ? H DG  10  I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ? ? H DG  10  N2    ? ? ? 1_555 I DC 13 O2 ? ? H DG  10  I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? H DG  10  O6    ? ? ? 1_555 I DC 13 N4 ? ? H DG  10  I DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? I DG  1   N1    ? ? ? 1_555 L DC 12 N3 ? ? I DG  1   N DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? I DG  1   N2    ? ? ? 1_555 L DC 12 O2 ? ? I DG  1   N DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? I DG  1   O6    ? ? ? 1_555 L DC 12 N4 ? ? I DG  1   N DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? I DA  2   N1    ? ? ? 1_555 L DT 11 N3 ? ? I DA  2   N DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? I DA  2   N6    ? ? ? 1_555 L DT 11 O4 ? ? I DA  2   N DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? I DA  3   N1    ? ? ? 1_555 L DT 10 N3 ? ? I DA  3   N DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? I DA  3   N6    ? ? ? 1_555 L DT 10 O4 ? ? I DA  3   N DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? I DT  4   N3    ? ? ? 1_555 L DA 9  N1 ? ? I DT  4   N DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? I DT  4   O4    ? ? ? 1_555 L DA 9  N6 ? ? I DT  4   N DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? I DG  5   N1    ? ? ? 1_555 L DC 8  N3 ? ? I DG  5   N DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? I DG  5   N2    ? ? ? 1_555 L DC 8  O2 ? ? I DG  5   N DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? I DG  5   O6    ? ? ? 1_555 L DC 8  N4 ? ? I DG  5   N DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? I DT  6   N3    ? ? ? 1_555 L DA 7  N1 ? ? I DT  6   N DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? I DT  6   O4    ? ? ? 1_555 L DA 7  N6 ? ? I DT  6   N DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? I DG  7   N1    ? ? ? 1_555 L DC 6  N3 ? ? I DG  7   N DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? I DG  7   N2    ? ? ? 1_555 L DC 6  O2 ? ? I DG  7   N DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? I DG  7   O6    ? ? ? 1_555 L DC 6  N4 ? ? I DG  7   N DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? I DT  8   N3    ? ? ? 1_555 L DA 5  N1 ? ? I DT  8   N DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? I DT  8   O4    ? ? ? 1_555 L DA 5  N6 ? ? I DT  8   N DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? I DG  9   N1    ? ? ? 1_555 L DC 4  N3 ? ? I DG  9   N DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ? ? I DG  9   N2    ? ? ? 1_555 L DC 4  O2 ? ? I DG  9   N DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? I DG  9   O6    ? ? ? 1_555 L DC 4  N4 ? ? I DG  9   N DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? I DT  10  N3    ? ? ? 1_555 L DA 3  N1 ? ? I DT  10  N DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? I DT  10  O4    ? ? ? 1_555 L DA 3  N6 ? ? I DT  10  N DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? I DC  11  N3    ? ? ? 1_555 L DG 2  N1 ? ? I DC  11  N DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? I DC  11  N4    ? ? ? 1_555 L DG 2  O6 ? ? I DC  11  N DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? I DC  11  O2    ? ? ? 1_555 L DG 2  N2 ? ? I DC  11  N DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 255 A . ? GLY 234 A GLU 256 A ? GLU 235 A 1 -21.98 
2 SER 383 A . ? SER 362 A GLU 384 A ? GLU 363 A 1 10.20  
3 PRO 385 A . ? PRO 364 A CYS 386 A ? CYS 365 A 1 -2.15  
4 GLU 398 A . ? GLU 377 A PRO 399 A ? PRO 378 A 1 -8.27  
5 ILE 372 B . ? ILE 351 B ASP 373 B ? ASP 352 B 1 13.67  
6 SER 383 B . ? SER 362 B GLU 384 B ? GLU 363 B 1 7.84   
7 PRO 385 B . ? PRO 364 B CYS 386 B ? CYS 365 B 1 -0.50  
8 SER 383 C . ? SER 362 C GLU 384 C ? GLU 363 C 1 2.01   
9 PRO 385 C . ? PRO 364 C CYS 386 C ? CYS 365 C 1 -3.30  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 94  ? ARG A 96  ? LEU A 73  ARG A 75  
AA1 2 VAL A 184 ? LEU A 187 ? VAL A 163 LEU A 166 
AA1 3 VAL A 121 ? ALA A 123 ? VAL A 100 ALA A 102 
AA2 1 THR A 126 ? LEU A 127 ? THR A 105 LEU A 106 
AA2 2 ARG A 171 ? ARG A 172 ? ARG A 150 ARG A 151 
AA3 1 ARG A 374 ? LEU A 379 ? ARG A 353 LEU A 358 
AA3 2 VAL A 569 ? TRP A 576 ? VAL A 548 TRP A 555 
AA3 3 ARG A 538 ? LYS A 545 ? ARG A 517 LYS A 524 
AA3 4 LEU A 529 ? TRP A 533 ? LEU A 508 TRP A 512 
AA3 5 ALA A 402 ? TYR A 405 ? ALA A 381 TYR A 384 
AA4 1 LEU B 94  ? ARG B 96  ? LEU B 73  ARG B 75  
AA4 2 VAL B 184 ? LEU B 187 ? VAL B 163 LEU B 166 
AA4 3 VAL B 121 ? ASP B 122 ? VAL B 100 ASP B 101 
AA5 1 THR B 126 ? LEU B 127 ? THR B 105 LEU B 106 
AA5 2 ARG B 171 ? ARG B 172 ? ARG B 150 ARG B 151 
AA6 1 ARG B 374 ? ALA B 380 ? ARG B 353 ALA B 359 
AA6 2 VAL B 569 ? HIS B 577 ? VAL B 548 HIS B 556 
AA6 3 ARG B 538 ? LYS B 545 ? ARG B 517 LYS B 524 
AA6 4 LEU B 529 ? TRP B 533 ? LEU B 508 TRP B 512 
AA6 5 ALA B 402 ? TYR B 405 ? ALA B 381 TYR B 384 
AA7 1 LEU C 94  ? ARG C 96  ? LEU C 73  ARG C 75  
AA7 2 VAL C 184 ? LEU C 187 ? VAL C 163 LEU C 166 
AA7 3 VAL C 121 ? ALA C 123 ? VAL C 100 ALA C 102 
AA8 1 THR C 126 ? LEU C 127 ? THR C 105 LEU C 106 
AA8 2 ARG C 171 ? ARG C 172 ? ARG C 150 ARG C 151 
AA9 1 ARG C 374 ? LEU C 379 ? ARG C 353 LEU C 358 
AA9 2 VAL C 569 ? TRP C 576 ? VAL C 548 TRP C 555 
AA9 3 TYR C 539 ? LYS C 545 ? TYR C 518 LYS C 524 
AA9 4 LEU C 529 ? PHE C 532 ? LEU C 508 PHE C 511 
AA9 5 ALA C 402 ? TYR C 405 ? ALA C 381 TYR C 384 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 95  ? N PHE A 74  O TYR A 185 ? O TYR A 164 
AA1 2 3 O GLU A 186 ? O GLU A 165 N ASP A 122 ? N ASP A 101 
AA2 1 2 N LEU A 127 ? N LEU A 106 O ARG A 171 ? O ARG A 150 
AA3 1 2 N LEU A 375 ? N LEU A 354 O TYR A 573 ? O TYR A 552 
AA3 2 3 O CYS A 572 ? O CYS A 551 N GLU A 543 ? N GLU A 522 
AA3 3 4 O ARG A 540 ? O ARG A 519 N GLN A 531 ? N GLN A 510 
AA3 4 5 O PHE A 532 ? O PHE A 511 N ALA A 402 ? N ALA A 381 
AA4 1 2 N PHE B 95  ? N PHE B 74  O TYR B 185 ? O TYR B 164 
AA4 2 3 O GLU B 186 ? O GLU B 165 N ASP B 122 ? N ASP B 101 
AA5 1 2 N LEU B 127 ? N LEU B 106 O ARG B 171 ? O ARG B 150 
AA6 1 2 N LEU B 379 ? N LEU B 358 O ARG B 575 ? O ARG B 554 
AA6 2 3 O CYS B 572 ? O CYS B 551 N GLU B 543 ? N GLU B 522 
AA6 3 4 O ARG B 540 ? O ARG B 519 N GLN B 531 ? N GLN B 510 
AA6 4 5 O PHE B 532 ? O PHE B 511 N ALA B 402 ? N ALA B 381 
AA7 1 2 N PHE C 95  ? N PHE C 74  O TYR C 185 ? O TYR C 164 
AA7 2 3 O GLU C 186 ? O GLU C 165 N ASP C 122 ? N ASP C 101 
AA8 1 2 N LEU C 127 ? N LEU C 106 O ARG C 171 ? O ARG C 150 
AA9 1 2 N LEU C 377 ? N LEU C 356 O TYR C 573 ? O TYR C 552 
AA9 2 3 O CYS C 572 ? O CYS C 551 N LYS C 545 ? N LYS C 524 
AA9 3 4 O ARG C 540 ? O ARG C 519 N GLN C 531 ? N GLN C 510 
AA9 4 5 O ILE C 530 ? O ILE C 509 N HIS C 404 ? N HIS C 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA 601 ? 5 'binding site for residue CA A 601' 
AC2 Software A CA 602 ? 4 'binding site for residue CA A 602' 
AC3 Software B CA 601 ? 5 'binding site for residue CA B 601' 
AC4 Software B CA 602 ? 6 'binding site for residue CA B 602' 
AC5 Software C CA 601 ? 6 'binding site for residue CA C 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLU A 389 ? GLU A 368 . ? 1_555 ? 
2  AC1 5 ASP A 528 ? ASP A 507 . ? 1_555 ? 
3  AC1 5 GLU A 543 ? GLU A 522 . ? 1_555 ? 
4  AC1 5 VAL A 544 ? VAL A 523 . ? 1_555 ? 
5  AC1 5 DC  J 6   ? DC  J 6   . ? 1_555 ? 
6  AC2 4 GLU A 407 ? GLU A 386 . ? 1_555 ? 
7  AC2 4 ASP A 528 ? ASP A 507 . ? 1_555 ? 
8  AC2 4 DA  J 5   ? DA  J 5   . ? 1_555 ? 
9  AC2 4 DC  J 6   ? DC  J 6   . ? 1_555 ? 
10 AC3 5 GLU B 389 ? GLU B 368 . ? 1_555 ? 
11 AC3 5 ASP B 528 ? ASP B 507 . ? 1_555 ? 
12 AC3 5 GLU B 543 ? GLU B 522 . ? 1_555 ? 
13 AC3 5 VAL B 544 ? VAL B 523 . ? 1_555 ? 
14 AC3 5 DA  K 5   ? DA  L 5   . ? 1_555 ? 
15 AC4 6 GLU B 389 ? GLU B 368 . ? 1_555 ? 
16 AC4 6 TYR B 405 ? TYR B 384 . ? 1_555 ? 
17 AC4 6 GLU B 407 ? GLU B 386 . ? 1_555 ? 
18 AC4 6 ASP B 528 ? ASP B 507 . ? 1_555 ? 
19 AC4 6 DC  K 4   ? DC  L 4   . ? 1_555 ? 
20 AC4 6 DA  K 5   ? DA  L 5   . ? 1_555 ? 
21 AC5 6 GLU C 389 ? GLU C 368 . ? 1_555 ? 
22 AC5 6 ASP C 528 ? ASP C 507 . ? 1_555 ? 
23 AC5 6 GLU C 543 ? GLU C 522 . ? 1_555 ? 
24 AC5 6 VAL C 544 ? VAL C 523 . ? 1_555 ? 
25 AC5 6 LYS C 545 ? LYS C 524 . ? 1_555 ? 
26 AC5 6 DC  L 6   ? DC  N 6   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5Y7G 
_atom_sites.fract_transf_matrix[1][1]   0.007128 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006980 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005790 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A 1 36  ? -39.741 9.175   47.595  1.00 204.39 ? 15  ALA A N     1 
ATOM   2     C  CA    . ALA A 1 36  ? -41.161 8.937   47.363  1.00 220.03 ? 15  ALA A CA    1 
ATOM   3     C  C     . ALA A 1 36  ? -41.900 8.584   48.657  1.00 240.19 ? 15  ALA A C     1 
ATOM   4     O  O     . ALA A 1 36  ? -43.127 8.534   48.681  1.00 268.16 ? 15  ALA A O     1 
ATOM   5     C  CB    . ALA A 1 36  ? -41.350 7.838   46.317  1.00 211.93 ? 15  ALA A CB    1 
ATOM   6     N  N     . LEU A 1 37  ? -41.142 8.328   49.748  1.00 241.25 ? 16  LEU A N     1 
ATOM   7     C  CA    . LEU A 1 37  ? -41.829 8.097   51.009  1.00 237.74 ? 16  LEU A CA    1 
ATOM   8     C  C     . LEU A 1 37  ? -42.437 9.408   51.496  1.00 265.09 ? 16  LEU A C     1 
ATOM   9     O  O     . LEU A 1 37  ? -41.962 10.490  51.137  1.00 261.08 ? 16  LEU A O     1 
ATOM   10    C  CB    . LEU A 1 37  ? -40.874 7.547   52.067  1.00 192.99 ? 16  LEU A CB    1 
ATOM   11    C  CG    . LEU A 1 37  ? -41.451 6.947   53.361  1.00 193.44 ? 16  LEU A CG    1 
ATOM   12    C  CD1   . LEU A 1 37  ? -42.242 5.639   53.123  1.00 187.07 ? 16  LEU A CD1   1 
ATOM   13    C  CD2   . LEU A 1 37  ? -40.336 6.737   54.381  1.00 169.64 ? 16  LEU A CD2   1 
ATOM   14    N  N     . PRO A 1 38  ? -43.505 9.345   52.297  1.00 249.12 ? 17  PRO A N     1 
ATOM   15    C  CA    . PRO A 1 38  ? -43.994 10.576  52.936  1.00 264.68 ? 17  PRO A CA    1 
ATOM   16    C  C     . PRO A 1 38  ? -42.954 11.233  53.847  1.00 269.15 ? 17  PRO A C     1 
ATOM   17    O  O     . PRO A 1 38  ? -41.823 10.752  53.990  1.00 273.67 ? 17  PRO A O     1 
ATOM   18    C  CB    . PRO A 1 38  ? -45.223 10.090  53.720  1.00 258.46 ? 17  PRO A CB    1 
ATOM   19    C  CG    . PRO A 1 38  ? -45.727 8.920   52.920  1.00 246.21 ? 17  PRO A CG    1 
ATOM   20    C  CD    . PRO A 1 38  ? -44.507 8.258   52.341  1.00 243.51 ? 17  PRO A CD    1 
ATOM   21    N  N     . GLU A 1 39  ? -43.343 12.364  54.440  1.00 264.15 ? 18  GLU A N     1 
ATOM   22    C  CA    . GLU A 1 39  ? -42.617 13.294  55.303  1.00 226.96 ? 18  GLU A CA    1 
ATOM   23    C  C     . GLU A 1 39  ? -41.511 13.982  54.513  1.00 181.00 ? 18  GLU A C     1 
ATOM   24    O  O     . GLU A 1 39  ? -40.759 13.322  53.788  1.00 177.01 ? 18  GLU A O     1 
ATOM   25    C  CB    . GLU A 1 39  ? -41.998 12.585  56.521  1.00 243.60 ? 18  GLU A CB    1 
ATOM   26    C  CG    . GLU A 1 39  ? -42.761 11.362  57.082  1.00 268.31 ? 18  GLU A CG    1 
ATOM   27    C  CD    . GLU A 1 39  ? -41.972 10.048  56.951  1.00 270.98 ? 18  GLU A CD    1 
ATOM   28    O  OE1   . GLU A 1 39  ? -40.796 10.092  56.520  1.00 256.94 ? 18  GLU A OE1   1 
ATOM   29    O  OE2   . GLU A 1 39  ? -42.528 8.970   57.277  1.00 275.70 ? 18  GLU A OE2   1 
ATOM   30    N  N     . PRO A 1 40  ? -41.391 15.308  54.628  1.00 181.80 ? 19  PRO A N     1 
ATOM   31    C  CA    . PRO A 1 40  ? -40.290 16.047  53.989  1.00 157.56 ? 19  PRO A CA    1 
ATOM   32    C  C     . PRO A 1 40  ? -39.016 16.095  54.806  1.00 151.64 ? 19  PRO A C     1 
ATOM   33    O  O     . PRO A 1 40  ? -37.937 16.356  54.274  1.00 148.18 ? 19  PRO A O     1 
ATOM   34    C  CB    . PRO A 1 40  ? -40.873 17.449  53.812  1.00 165.30 ? 19  PRO A CB    1 
ATOM   35    C  CG    . PRO A 1 40  ? -41.820 17.589  54.981  1.00 198.37 ? 19  PRO A CG    1 
ATOM   36    C  CD    . PRO A 1 40  ? -42.349 16.201  55.299  1.00 195.34 ? 19  PRO A CD    1 
ATOM   37    N  N     . PHE A 1 41  ? -39.158 15.929  56.119  1.00 151.45 ? 20  PHE A N     1 
ATOM   38    C  CA    . PHE A 1 41  ? -38.073 16.112  57.076  1.00 148.95 ? 20  PHE A CA    1 
ATOM   39    C  C     . PHE A 1 41  ? -37.416 14.808  57.541  1.00 159.16 ? 20  PHE A C     1 
ATOM   40    O  O     . PHE A 1 41  ? -36.615 14.833  58.483  1.00 144.03 ? 20  PHE A O     1 
ATOM   41    C  CB    . PHE A 1 41  ? -38.561 16.921  58.282  1.00 163.87 ? 20  PHE A CB    1 
ATOM   42    C  CG    . PHE A 1 41  ? -38.578 18.417  58.050  1.00 172.58 ? 20  PHE A CG    1 
ATOM   43    C  CD1   . PHE A 1 41  ? -37.405 19.083  57.730  1.00 175.41 ? 20  PHE A CD1   1 
ATOM   44    C  CD2   . PHE A 1 41  ? -39.739 19.166  58.230  1.00 200.72 ? 20  PHE A CD2   1 
ATOM   45    C  CE1   . PHE A 1 41  ? -37.396 20.456  57.525  1.00 191.45 ? 20  PHE A CE1   1 
ATOM   46    C  CE2   . PHE A 1 41  ? -39.736 20.546  58.037  1.00 212.15 ? 20  PHE A CE2   1 
ATOM   47    C  CZ    . PHE A 1 41  ? -38.559 21.188  57.683  1.00 209.91 ? 20  PHE A CZ    1 
ATOM   48    N  N     . TYR A 1 42  ? -37.718 13.685  56.901  1.00 161.57 ? 21  TYR A N     1 
ATOM   49    C  CA    . TYR A 1 42  ? -37.268 12.369  57.342  1.00 168.42 ? 21  TYR A CA    1 
ATOM   50    C  C     . TYR A 1 42  ? -35.813 12.341  57.796  1.00 154.58 ? 21  TYR A C     1 
ATOM   51    O  O     . TYR A 1 42  ? -35.477 11.678  58.782  1.00 149.54 ? 21  TYR A O     1 
ATOM   52    C  CB    . TYR A 1 42  ? -37.423 11.380  56.187  1.00 175.85 ? 21  TYR A CB    1 
ATOM   53    C  CG    . TYR A 1 42  ? -36.455 11.674  55.048  1.00 137.95 ? 21  TYR A CG    1 
ATOM   54    C  CD1   . TYR A 1 42  ? -36.736 12.655  54.117  1.00 139.30 ? 21  TYR A CD1   1 
ATOM   55    C  CD2   . TYR A 1 42  ? -35.259 10.978  54.922  1.00 134.03 ? 21  TYR A CD2   1 
ATOM   56    C  CE1   . TYR A 1 42  ? -35.863 12.938  53.084  1.00 146.95 ? 21  TYR A CE1   1 
ATOM   57    C  CE2   . TYR A 1 42  ? -34.365 11.254  53.886  1.00 145.76 ? 21  TYR A CE2   1 
ATOM   58    C  CZ    . TYR A 1 42  ? -34.674 12.237  52.960  1.00 147.01 ? 21  TYR A CZ    1 
ATOM   59    O  OH    . TYR A 1 42  ? -33.813 12.524  51.907  1.00 130.63 ? 21  TYR A OH    1 
ATOM   60    N  N     . TYR A 1 43  ? -34.948 13.083  57.104  1.00 147.47 ? 22  TYR A N     1 
ATOM   61    C  CA    . TYR A 1 43  ? -33.529 13.037  57.427  1.00 133.45 ? 22  TYR A CA    1 
ATOM   62    C  C     . TYR A 1 43  ? -33.236 13.619  58.801  1.00 150.35 ? 22  TYR A C     1 
ATOM   63    O  O     . TYR A 1 43  ? -32.235 13.240  59.423  1.00 131.34 ? 22  TYR A O     1 
ATOM   64    C  CB    . TYR A 1 43  ? -32.730 13.761  56.368  1.00 130.51 ? 22  TYR A CB    1 
ATOM   65    C  CG    . TYR A 1 43  ? -33.060 15.217  56.246  1.00 132.77 ? 22  TYR A CG    1 
ATOM   66    C  CD1   . TYR A 1 43  ? -33.963 15.661  55.298  1.00 155.21 ? 22  TYR A CD1   1 
ATOM   67    C  CD2   . TYR A 1 43  ? -32.444 16.161  57.056  1.00 136.26 ? 22  TYR A CD2   1 
ATOM   68    C  CE1   . TYR A 1 43  ? -34.257 17.010  55.170  1.00 159.76 ? 22  TYR A CE1   1 
ATOM   69    C  CE2   . TYR A 1 43  ? -32.734 17.514  56.938  1.00 138.94 ? 22  TYR A CE2   1 
ATOM   70    C  CZ    . TYR A 1 43  ? -33.638 17.930  55.993  1.00 148.74 ? 22  TYR A CZ    1 
ATOM   71    O  OH    . TYR A 1 43  ? -33.929 19.267  55.865  1.00 153.82 ? 22  TYR A OH    1 
ATOM   72    N  N     . LEU A 1 44  ? -34.037 14.599  59.248  1.00 159.17 ? 23  LEU A N     1 
ATOM   73    C  CA    . LEU A 1 44  ? -33.884 15.138  60.601  1.00 148.45 ? 23  LEU A CA    1 
ATOM   74    C  C     . LEU A 1 44  ? -34.509 14.201  61.627  1.00 140.80 ? 23  LEU A C     1 
ATOM   75    O  O     . LEU A 1 44  ? -34.020 14.097  62.758  1.00 140.91 ? 23  LEU A O     1 
ATOM   76    C  CB    . LEU A 1 44  ? -34.460 16.556  60.707  1.00 142.93 ? 23  LEU A CB    1 
ATOM   77    C  CG    . LEU A 1 44  ? -34.332 17.283  62.069  1.00 145.70 ? 23  LEU A CG    1 
ATOM   78    C  CD1   . LEU A 1 44  ? -32.911 17.383  62.574  1.00 142.92 ? 23  LEU A CD1   1 
ATOM   79    C  CD2   . LEU A 1 44  ? -34.963 18.679  62.049  1.00 149.86 ? 23  LEU A CD2   1 
ATOM   80    N  N     . HIS A 1 45  ? -35.619 13.551  61.279  1.00 142.46 ? 24  HIS A N     1 
ATOM   81    C  CA    . HIS A 1 45  ? -36.099 12.466  62.125  1.00 147.27 ? 24  HIS A CA    1 
ATOM   82    C  C     . HIS A 1 45  ? -34.993 11.435  62.307  1.00 142.17 ? 24  HIS A C     1 
ATOM   83    O  O     . HIS A 1 45  ? -34.739 10.959  63.418  1.00 139.37 ? 24  HIS A O     1 
ATOM   84    C  CB    . HIS A 1 45  ? -37.353 11.823  61.531  1.00 149.36 ? 24  HIS A CB    1 
ATOM   85    C  CG    . HIS A 1 45  ? -38.498 12.771  61.381  1.00 149.81 ? 24  HIS A CG    1 
ATOM   86    N  ND1   . HIS A 1 45  ? -38.736 13.474  60.219  1.00 157.00 ? 24  HIS A ND1   1 
ATOM   87    C  CD2   . HIS A 1 45  ? -39.464 13.143  62.252  1.00 156.63 ? 24  HIS A CD2   1 
ATOM   88    C  CE1   . HIS A 1 45  ? -39.801 14.238  60.379  1.00 154.92 ? 24  HIS A CE1   1 
ATOM   89    N  NE2   . HIS A 1 45  ? -40.263 14.054  61.602  1.00 175.61 ? 24  HIS A NE2   1 
ATOM   90    N  N     . ASN A 1 46  ? -34.346 11.057  61.204  1.00 135.92 ? 25  ASN A N     1 
ATOM   91    C  CA    . ASN A 1 46  ? -33.285 10.060  61.264  1.00 142.07 ? 25  ASN A CA    1 
ATOM   92    C  C     . ASN A 1 46  ? -32.062 10.552  62.038  1.00 143.56 ? 25  ASN A C     1 
ATOM   93    O  O     . ASN A 1 46  ? -31.386 9.755   62.711  1.00 136.42 ? 25  ASN A O     1 
ATOM   94    C  CB    . ASN A 1 46  ? -32.927 9.639   59.838  1.00 130.59 ? 25  ASN A CB    1 
ATOM   95    C  CG    . ASN A 1 46  ? -34.079 8.928   59.140  1.00 138.44 ? 25  ASN A CG    1 
ATOM   96    O  OD1   . ASN A 1 46  ? -35.028 8.502   59.785  1.00 166.59 ? 25  ASN A OD1   1 
ATOM   97    N  ND2   . ASN A 1 46  ? -34.005 8.809   57.823  1.00 136.63 ? 25  ASN A ND2   1 
ATOM   98    N  N     . PHE A 1 47  ? -31.759 11.847  61.977  1.00 133.14 ? 26  PHE A N     1 
ATOM   99    C  CA    . PHE A 1 47  ? -30.594 12.318  62.720  1.00 147.35 ? 26  PHE A CA    1 
ATOM   100   C  C     . PHE A 1 47  ? -30.904 12.451  64.212  1.00 146.98 ? 26  PHE A C     1 
ATOM   101   O  O     . PHE A 1 47  ? -30.089 12.049  65.055  1.00 137.26 ? 26  PHE A O     1 
ATOM   102   C  CB    . PHE A 1 47  ? -30.040 13.621  62.121  1.00 133.50 ? 26  PHE A CB    1 
ATOM   103   C  CG    . PHE A 1 47  ? -28.796 14.086  62.800  1.00 129.00 ? 26  PHE A CG    1 
ATOM   104   C  CD1   . PHE A 1 47  ? -27.616 13.399  62.629  1.00 125.62 ? 26  PHE A CD1   1 
ATOM   105   C  CD2   . PHE A 1 47  ? -28.812 15.177  63.635  1.00 131.83 ? 26  PHE A CD2   1 
ATOM   106   C  CE1   . PHE A 1 47  ? -26.483 13.792  63.272  1.00 125.02 ? 26  PHE A CE1   1 
ATOM   107   C  CE2   . PHE A 1 47  ? -27.675 15.584  64.270  1.00 131.26 ? 26  PHE A CE2   1 
ATOM   108   C  CZ    . PHE A 1 47  ? -26.508 14.890  64.092  1.00 127.82 ? 26  PHE A CZ    1 
ATOM   109   N  N     . ARG A 1 48  ? -32.065 13.034  64.558  1.00 137.33 ? 27  ARG A N     1 
ATOM   110   C  CA    . ARG A 1 48  ? -32.504 13.008  65.953  1.00 148.32 ? 27  ARG A CA    1 
ATOM   111   C  C     . ARG A 1 48  ? -32.584 11.579  66.452  1.00 154.41 ? 27  ARG A C     1 
ATOM   112   O  O     . ARG A 1 48  ? -32.328 11.299  67.634  1.00 143.90 ? 27  ARG A O     1 
ATOM   113   C  CB    . ARG A 1 48  ? -33.880 13.657  66.133  1.00 145.27 ? 27  ARG A CB    1 
ATOM   114   C  CG    . ARG A 1 48  ? -33.989 15.110  65.840  1.00 147.46 ? 27  ARG A CG    1 
ATOM   115   C  CD    . ARG A 1 48  ? -35.207 15.614  66.539  1.00 152.88 ? 27  ARG A CD    1 
ATOM   116   N  NE    . ARG A 1 48  ? -36.287 15.723  65.577  1.00 154.26 ? 27  ARG A NE    1 
ATOM   117   C  CZ    . ARG A 1 48  ? -36.844 16.877  65.241  1.00 160.84 ? 27  ARG A CZ    1 
ATOM   118   N  NH1   . ARG A 1 48  ? -36.423 17.995  65.814  1.00 159.74 ? 27  ARG A NH1   1 
ATOM   119   N  NH2   . ARG A 1 48  ? -37.821 16.919  64.345  1.00 158.84 ? 27  ARG A NH2   1 
ATOM   120   N  N     . ALA A 1 49  ? -32.956 10.670  65.556  1.00 144.06 ? 28  ALA A N     1 
ATOM   121   C  CA    . ALA A 1 49  ? -32.972 9.261   65.887  1.00 136.43 ? 28  ALA A CA    1 
ATOM   122   C  C     . ALA A 1 49  ? -31.594 8.801   66.341  1.00 141.99 ? 28  ALA A C     1 
ATOM   123   O  O     . ALA A 1 49  ? -31.444 8.281   67.454  1.00 141.02 ? 28  ALA A O     1 
ATOM   124   C  CB    . ALA A 1 49  ? -33.454 8.467   64.674  1.00 134.92 ? 28  ALA A CB    1 
ATOM   125   N  N     . VAL A 1 50  ? -30.552 9.081   65.541  1.00 158.00 ? 29  VAL A N     1 
ATOM   126   C  CA    . VAL A 1 50  ? -29.218 8.612   65.940  1.00 159.91 ? 29  VAL A CA    1 
ATOM   127   C  C     . VAL A 1 50  ? -28.753 9.336   67.206  1.00 157.78 ? 29  VAL A C     1 
ATOM   128   O  O     . VAL A 1 50  ? -28.023 8.762   68.033  1.00 135.68 ? 29  VAL A O     1 
ATOM   129   C  CB    . VAL A 1 50  ? -28.202 8.717   64.778  1.00 146.64 ? 29  VAL A CB    1 
ATOM   130   C  CG1   . VAL A 1 50  ? -26.766 8.670   65.293  1.00 144.37 ? 29  VAL A CG1   1 
ATOM   131   C  CG2   . VAL A 1 50  ? -28.393 7.559   63.795  1.00 124.59 ? 29  VAL A CG2   1 
ATOM   132   N  N     . LEU A 1 51  ? -29.180 10.586  67.398  1.00 150.57 ? 30  LEU A N     1 
ATOM   133   C  CA    . LEU A 1 51  ? -28.857 11.268  68.646  1.00 153.10 ? 30  LEU A CA    1 
ATOM   134   C  C     . LEU A 1 51  ? -29.459 10.538  69.846  1.00 172.92 ? 30  LEU A C     1 
ATOM   135   O  O     . LEU A 1 51  ? -28.779 10.328  70.861  1.00 187.29 ? 30  LEU A O     1 
ATOM   136   C  CB    . LEU A 1 51  ? -29.331 12.715  68.571  1.00 138.36 ? 30  LEU A CB    1 
ATOM   137   C  CG    . LEU A 1 51  ? -28.458 13.448  67.569  1.00 135.79 ? 30  LEU A CG    1 
ATOM   138   C  CD1   . LEU A 1 51  ? -28.720 14.928  67.578  1.00 138.67 ? 30  LEU A CD1   1 
ATOM   139   C  CD2   . LEU A 1 51  ? -27.039 13.177  67.959  1.00 133.62 ? 30  LEU A CD2   1 
ATOM   140   N  N     . ALA A 1 52  ? -30.718 10.110  69.737  1.00 162.67 ? 31  ALA A N     1 
ATOM   141   C  CA    . ALA A 1 52  ? -31.324 9.340   70.817  1.00 165.37 ? 31  ALA A CA    1 
ATOM   142   C  C     . ALA A 1 52  ? -30.577 8.030   71.053  1.00 147.99 ? 31  ALA A C     1 
ATOM   143   O  O     . ALA A 1 52  ? -30.219 7.706   72.189  1.00 156.14 ? 31  ALA A O     1 
ATOM   144   C  CB    . ALA A 1 52  ? -32.795 9.069   70.508  1.00 180.04 ? 31  ALA A CB    1 
ATOM   145   N  N     . TRP A 1 53  ? -30.327 7.267   69.984  1.00 141.73 ? 32  TRP A N     1 
ATOM   146   C  CA    . TRP A 1 53  ? -29.645 5.975   70.096  1.00 137.74 ? 32  TRP A CA    1 
ATOM   147   C  C     . TRP A 1 53  ? -28.287 6.108   70.785  1.00 141.34 ? 32  TRP A C     1 
ATOM   148   O  O     . TRP A 1 53  ? -27.930 5.284   71.627  1.00 132.16 ? 32  TRP A O     1 
ATOM   149   C  CB    . TRP A 1 53  ? -29.475 5.369   68.703  1.00 148.95 ? 32  TRP A CB    1 
ATOM   150   C  CG    . TRP A 1 53  ? -28.977 3.937   68.607  1.00 163.88 ? 32  TRP A CG    1 
ATOM   151   C  CD1   . TRP A 1 53  ? -27.683 3.493   68.757  1.00 177.10 ? 32  TRP A CD1   1 
ATOM   152   C  CD2   . TRP A 1 53  ? -29.731 2.802   68.158  1.00 165.06 ? 32  TRP A CD2   1 
ATOM   153   N  NE1   . TRP A 1 53  ? -27.615 2.140   68.517  1.00 182.50 ? 32  TRP A NE1   1 
ATOM   154   C  CE2   . TRP A 1 53  ? -28.856 1.694   68.140  1.00 176.68 ? 32  TRP A CE2   1 
ATOM   155   C  CE3   . TRP A 1 53  ? -31.070 2.608   67.803  1.00 161.03 ? 32  TRP A CE3   1 
ATOM   156   C  CZ2   . TRP A 1 53  ? -29.282 0.413   67.789  1.00 172.41 ? 32  TRP A CZ2   1 
ATOM   157   C  CZ3   . TRP A 1 53  ? -31.487 1.336   67.455  1.00 163.07 ? 32  TRP A CZ3   1 
ATOM   158   C  CH2   . TRP A 1 53  ? -30.597 0.255   67.452  1.00 161.91 ? 32  TRP A CH2   1 
ATOM   159   N  N     . ILE A 1 54  ? -27.469 7.085   70.379  1.00 154.17 ? 33  ILE A N     1 
ATOM   160   C  CA    . ILE A 1 54  ? -26.194 7.258   71.077  1.00 146.09 ? 33  ILE A CA    1 
ATOM   161   C  C     . ILE A 1 54  ? -26.444 7.746   72.490  1.00 143.62 ? 33  ILE A C     1 
ATOM   162   O  O     . ILE A 1 54  ? -25.637 7.500   73.396  1.00 135.44 ? 33  ILE A O     1 
ATOM   163   C  CB    . ILE A 1 54  ? -25.241 8.188   70.300  1.00 154.15 ? 33  ILE A CB    1 
ATOM   164   C  CG1   . ILE A 1 54  ? -24.647 7.452   69.104  1.00 136.68 ? 33  ILE A CG1   1 
ATOM   165   C  CG2   . ILE A 1 54  ? -24.049 8.606   71.147  1.00 162.90 ? 33  ILE A CG2   1 
ATOM   166   C  CD1   . ILE A 1 54  ? -24.065 8.383   68.092  1.00 123.53 ? 33  ILE A CD1   1 
ATOM   167   N  N     . GLY A 1 55  ? -27.566 8.434   72.704  1.00 144.30 ? 34  GLY A N     1 
ATOM   168   C  CA    . GLY A 1 55  ? -27.917 8.854   74.052  1.00 169.28 ? 34  GLY A CA    1 
ATOM   169   C  C     . GLY A 1 55  ? -28.154 7.683   74.993  1.00 173.58 ? 34  GLY A C     1 
ATOM   170   O  O     . GLY A 1 55  ? -27.678 7.683   76.130  1.00 173.12 ? 34  GLY A O     1 
ATOM   171   N  N     . GLU A 1 56  ? -28.930 6.684   74.550  1.00 169.17 ? 35  GLU A N     1 
ATOM   172   C  CA    . GLU A 1 56  ? -29.217 5.546   75.417  1.00 156.07 ? 35  GLU A CA    1 
ATOM   173   C  C     . GLU A 1 56  ? -28.153 4.446   75.364  1.00 139.46 ? 35  GLU A C     1 
ATOM   174   O  O     . GLU A 1 56  ? -27.755 3.949   76.417  1.00 140.75 ? 35  GLU A O     1 
ATOM   175   C  CB    . GLU A 1 56  ? -30.600 4.980   75.099  1.00 177.34 ? 35  GLU A CB    1 
ATOM   176   C  CG    . GLU A 1 56  ? -30.734 4.286   73.773  1.00 184.20 ? 35  GLU A CG    1 
ATOM   177   C  CD    . GLU A 1 56  ? -32.158 3.845   73.516  1.00 202.71 ? 35  GLU A CD    1 
ATOM   178   O  OE1   . GLU A 1 56  ? -33.090 4.433   74.141  1.00 173.56 ? 35  GLU A OE1   1 
ATOM   179   O  OE2   . GLU A 1 56  ? -32.329 2.875   72.739  1.00 211.31 ? 35  GLU A OE2   1 
ATOM   180   N  N     . ARG A 1 57  ? -27.648 4.072   74.175  1.00 153.23 ? 36  ARG A N     1 
ATOM   181   C  CA    . ARG A 1 57  ? -26.713 2.942   74.063  1.00 153.44 ? 36  ARG A CA    1 
ATOM   182   C  C     . ARG A 1 57  ? -25.308 3.337   74.495  1.00 139.19 ? 36  ARG A C     1 
ATOM   183   O  O     . ARG A 1 57  ? -24.611 2.561   75.153  1.00 152.39 ? 36  ARG A O     1 
ATOM   184   C  CB    . ARG A 1 57  ? -26.601 2.399   72.621  1.00 146.31 ? 36  ARG A CB    1 
ATOM   185   C  CG    . ARG A 1 57  ? -27.874 2.109   71.830  1.00 156.64 ? 36  ARG A CG    1 
ATOM   186   C  CD    . ARG A 1 57  ? -28.658 0.921   72.335  1.00 170.14 ? 36  ARG A CD    1 
ATOM   187   N  NE    . ARG A 1 57  ? -28.136 -0.386  71.933  1.00 170.28 ? 36  ARG A NE    1 
ATOM   188   C  CZ    . ARG A 1 57  ? -28.808 -1.263  71.191  1.00 167.77 ? 36  ARG A CZ    1 
ATOM   189   N  NH1   . ARG A 1 57  ? -30.023 -0.981  70.746  1.00 176.58 ? 36  ARG A NH1   1 
ATOM   190   N  NH2   . ARG A 1 57  ? -28.272 -2.434  70.906  1.00 176.16 ? 36  ARG A NH2   1 
ATOM   191   N  N     . TYR A 1 58  ? -24.860 4.510   74.081  1.00 132.43 ? 37  TYR A N     1 
ATOM   192   C  CA    . TYR A 1 58  ? -23.523 5.002   74.364  1.00 159.32 ? 37  TYR A CA    1 
ATOM   193   C  C     . TYR A 1 58  ? -23.485 5.983   75.522  1.00 159.83 ? 37  TYR A C     1 
ATOM   194   O  O     . TYR A 1 58  ? -22.485 6.692   75.685  1.00 170.83 ? 37  TYR A O     1 
ATOM   195   C  CB    . TYR A 1 58  ? -22.894 5.586   73.097  1.00 177.95 ? 37  TYR A CB    1 
ATOM   196   C  CG    . TYR A 1 58  ? -22.453 4.484   72.167  1.00 156.71 ? 37  TYR A CG    1 
ATOM   197   C  CD1   . TYR A 1 58  ? -23.251 4.058   71.113  1.00 159.23 ? 37  TYR A CD1   1 
ATOM   198   C  CD2   . TYR A 1 58  ? -21.256 3.828   72.393  1.00 129.21 ? 37  TYR A CD2   1 
ATOM   199   C  CE1   . TYR A 1 58  ? -22.841 3.017   70.287  1.00 158.75 ? 37  TYR A CE1   1 
ATOM   200   C  CE2   . TYR A 1 58  ? -20.837 2.801   71.580  1.00 139.95 ? 37  TYR A CE2   1 
ATOM   201   C  CZ    . TYR A 1 58  ? -21.624 2.390   70.532  1.00 149.07 ? 37  TYR A CZ    1 
ATOM   202   O  OH    . TYR A 1 58  ? -21.166 1.354   69.740  1.00 150.54 ? 37  TYR A OH    1 
ATOM   203   N  N     . ALA A 1 59  ? -24.569 6.074   76.294  1.00 153.61 ? 38  ALA A N     1 
ATOM   204   C  CA    . ALA A 1 59  ? -24.643 7.045   77.377  1.00 164.86 ? 38  ALA A CA    1 
ATOM   205   C  C     . ALA A 1 59  ? -23.349 7.103   78.175  1.00 158.36 ? 38  ALA A C     1 
ATOM   206   O  O     . ALA A 1 59  ? -22.783 8.183   78.378  1.00 164.30 ? 38  ALA A O     1 
ATOM   207   C  CB    . ALA A 1 59  ? -25.814 6.697   78.300  1.00 171.06 ? 38  ALA A CB    1 
ATOM   208   N  N     . ASP A 1 60  ? -22.838 5.946   78.597  1.00 146.07 ? 39  ASP A N     1 
ATOM   209   C  CA    . ASP A 1 60  ? -21.650 5.979   79.440  1.00 173.04 ? 39  ASP A CA    1 
ATOM   210   C  C     . ASP A 1 60  ? -20.397 6.391   78.678  1.00 151.03 ? 39  ASP A C     1 
ATOM   211   O  O     . ASP A 1 60  ? -19.406 6.786   79.305  1.00 145.18 ? 39  ASP A O     1 
ATOM   212   C  CB    . ASP A 1 60  ? -21.427 4.609   80.096  1.00 198.60 ? 39  ASP A CB    1 
ATOM   213   C  CG    . ASP A 1 60  ? -21.298 3.484   79.088  1.00 194.29 ? 39  ASP A CG    1 
ATOM   214   O  OD1   . ASP A 1 60  ? -20.946 2.362   79.516  1.00 199.18 ? 39  ASP A OD1   1 
ATOM   215   O  OD2   . ASP A 1 60  ? -21.548 3.714   77.881  1.00 184.67 ? 39  ASP A OD2   1 
ATOM   216   N  N     . LEU A 1 61  ? -20.438 6.376   77.353  1.00 155.81 ? 40  LEU A N     1 
ATOM   217   C  CA    . LEU A 1 61  ? -19.260 6.670   76.555  1.00 147.66 ? 40  LEU A CA    1 
ATOM   218   C  C     . LEU A 1 61  ? -19.119 8.146   76.160  1.00 144.19 ? 40  LEU A C     1 
ATOM   219   O  O     . LEU A 1 61  ? -18.037 8.553   75.717  1.00 139.90 ? 40  LEU A O     1 
ATOM   220   C  CB    . LEU A 1 61  ? -19.280 5.755   75.327  1.00 132.19 ? 40  LEU A CB    1 
ATOM   221   C  CG    . LEU A 1 61  ? -17.987 5.014   74.996  1.00 159.00 ? 40  LEU A CG    1 
ATOM   222   C  CD1   . LEU A 1 61  ? -18.259 3.720   74.281  1.00 143.42 ? 40  LEU A CD1   1 
ATOM   223   C  CD2   . LEU A 1 61  ? -17.186 5.908   74.097  1.00 195.74 ? 40  LEU A CD2   1 
ATOM   224   N  N     . LEU A 1 62  ? -20.143 8.970   76.367  1.00 140.44 ? 41  LEU A N     1 
ATOM   225   C  CA    . LEU A 1 62  ? -20.103 10.375  75.976  1.00 140.58 ? 41  LEU A CA    1 
ATOM   226   C  C     . LEU A 1 62  ? -19.231 11.188  76.929  1.00 149.45 ? 41  LEU A C     1 
ATOM   227   O  O     . LEU A 1 62  ? -18.912 10.762  78.041  1.00 182.80 ? 41  LEU A O     1 
ATOM   228   C  CB    . LEU A 1 62  ? -21.515 10.948  75.912  1.00 152.20 ? 41  LEU A CB    1 
ATOM   229   C  CG    . LEU A 1 62  ? -22.393 10.318  74.839  1.00 159.79 ? 41  LEU A CG    1 
ATOM   230   C  CD1   . LEU A 1 62  ? -23.831 10.789  74.979  1.00 182.25 ? 41  LEU A CD1   1 
ATOM   231   C  CD2   . LEU A 1 62  ? -21.834 10.736  73.497  1.00 135.84 ? 41  LEU A CD2   1 
ATOM   232   N  N     . ASP A 1 63  ? -18.799 12.352  76.455  1.00 144.26 ? 42  ASP A N     1 
ATOM   233   C  CA    . ASP A 1 63  ? -17.940 13.251  77.218  1.00 170.07 ? 42  ASP A CA    1 
ATOM   234   C  C     . ASP A 1 63  ? -18.694 14.542  77.579  1.00 171.97 ? 42  ASP A C     1 
ATOM   235   O  O     . ASP A 1 63  ? -19.873 14.720  77.258  1.00 167.09 ? 42  ASP A O     1 
ATOM   236   C  CB    . ASP A 1 63  ? -16.665 13.507  76.398  1.00 178.66 ? 42  ASP A CB    1 
ATOM   237   C  CG    . ASP A 1 63  ? -15.677 14.418  77.082  1.00 202.35 ? 42  ASP A CG    1 
ATOM   238   O  OD1   . ASP A 1 63  ? -15.692 14.478  78.333  1.00 222.32 ? 42  ASP A OD1   1 
ATOM   239   O  OD2   . ASP A 1 63  ? -14.894 15.076  76.358  1.00 189.43 ? 42  ASP A OD2   1 
ATOM   240   N  N     . ASP A 1 64  ? -18.002 15.451  78.272  1.00 174.68 ? 43  ASP A N     1 
ATOM   241   C  CA    . ASP A 1 64  ? -18.618 16.719  78.647  1.00 180.04 ? 43  ASP A CA    1 
ATOM   242   C  C     . ASP A 1 64  ? -18.940 17.561  77.418  1.00 169.94 ? 43  ASP A C     1 
ATOM   243   O  O     . ASP A 1 64  ? -20.097 17.924  77.180  1.00 158.65 ? 43  ASP A O     1 
ATOM   244   C  CB    . ASP A 1 64  ? -17.687 17.494  79.580  1.00 193.13 ? 43  ASP A CB    1 
ATOM   245   C  CG    . ASP A 1 64  ? -17.982 17.246  81.032  1.00 194.07 ? 43  ASP A CG    1 
ATOM   246   O  OD1   . ASP A 1 64  ? -18.683 16.257  81.327  1.00 201.91 ? 43  ASP A OD1   1 
ATOM   247   O  OD2   . ASP A 1 64  ? -17.509 18.043  81.872  1.00 182.83 ? 43  ASP A OD2   1 
ATOM   248   N  N     . GLN A 1 65  ? -17.929 17.856  76.603  1.00 159.32 ? 44  GLN A N     1 
ATOM   249   C  CA    . GLN A 1 65  ? -18.186 18.652  75.418  1.00 152.40 ? 44  GLN A CA    1 
ATOM   250   C  C     . GLN A 1 65  ? -19.279 18.009  74.570  1.00 159.92 ? 44  GLN A C     1 
ATOM   251   O  O     . GLN A 1 65  ? -20.152 18.705  74.039  1.00 171.60 ? 44  GLN A O     1 
ATOM   252   C  CB    . GLN A 1 65  ? -16.896 18.842  74.630  1.00 153.80 ? 44  GLN A CB    1 
ATOM   253   C  CG    . GLN A 1 65  ? -16.229 20.198  74.856  1.00 180.62 ? 44  GLN A CG    1 
ATOM   254   C  CD    . GLN A 1 65  ? -15.466 20.708  73.623  1.00 202.43 ? 44  GLN A CD    1 
ATOM   255   O  OE1   . GLN A 1 65  ? -15.161 19.948  72.699  1.00 196.44 ? 44  GLN A OE1   1 
ATOM   256   N  NE2   . GLN A 1 65  ? -15.165 22.004  73.609  1.00 209.18 ? 44  GLN A NE2   1 
ATOM   257   N  N     . GLU A 1 66  ? -19.267 16.676  74.468  1.00 146.30 ? 45  GLU A N     1 
ATOM   258   C  CA    . GLU A 1 66  ? -20.170 15.969  73.561  1.00 143.02 ? 45  GLU A CA    1 
ATOM   259   C  C     . GLU A 1 66  ? -21.615 16.009  74.042  1.00 146.08 ? 45  GLU A C     1 
ATOM   260   O  O     . GLU A 1 66  ? -22.526 16.387  73.298  1.00 145.69 ? 45  GLU A O     1 
ATOM   261   C  CB    . GLU A 1 66  ? -19.722 14.515  73.399  1.00 139.56 ? 45  GLU A CB    1 
ATOM   262   C  CG    . GLU A 1 66  ? -18.420 14.370  72.671  1.00 165.10 ? 45  GLU A CG    1 
ATOM   263   C  CD    . GLU A 1 66  ? -17.525 13.334  73.276  1.00 177.82 ? 45  GLU A CD    1 
ATOM   264   O  OE1   . GLU A 1 66  ? -16.286 13.481  73.187  1.00 189.06 ? 45  GLU A OE1   1 
ATOM   265   O  OE2   . GLU A 1 66  ? -18.071 12.374  73.854  1.00 192.11 ? 45  GLU A OE2   1 
ATOM   266   N  N     . ARG A 1 67  ? -21.854 15.554  75.267  1.00 149.21 ? 46  ARG A N     1 
ATOM   267   C  CA    . ARG A 1 67  ? -23.227 15.482  75.750  1.00 152.23 ? 46  ARG A CA    1 
ATOM   268   C  C     . ARG A 1 67  ? -23.865 16.860  75.725  1.00 168.89 ? 46  ARG A C     1 
ATOM   269   O  O     . ARG A 1 67  ? -25.088 16.984  75.575  1.00 172.29 ? 46  ARG A O     1 
ATOM   270   C  CB    . ARG A 1 67  ? -23.255 14.835  77.132  1.00 155.36 ? 46  ARG A CB    1 
ATOM   271   C  CG    . ARG A 1 67  ? -24.545 14.091  77.451  1.00 158.78 ? 46  ARG A CG    1 
ATOM   272   C  CD    . ARG A 1 67  ? -24.453 13.384  78.780  1.00 159.27 ? 46  ARG A CD    1 
ATOM   273   N  NE    . ARG A 1 67  ? -23.340 12.443  78.787  1.00 156.01 ? 46  ARG A NE    1 
ATOM   274   C  CZ    . ARG A 1 67  ? -22.146 12.707  79.308  1.00 157.41 ? 46  ARG A CZ    1 
ATOM   275   N  NH1   . ARG A 1 67  ? -21.191 11.787  79.280  1.00 154.19 ? 46  ARG A NH1   1 
ATOM   276   N  NH2   . ARG A 1 67  ? -21.903 13.900  79.837  1.00 161.05 ? 46  ARG A NH2   1 
ATOM   277   N  N     . ALA A 1 68  ? -23.043 17.901  75.892  1.00 166.02 ? 47  ALA A N     1 
ATOM   278   C  CA    . ALA A 1 68  ? -23.498 19.274  75.724  1.00 163.50 ? 47  ALA A CA    1 
ATOM   279   C  C     . ALA A 1 68  ? -23.941 19.551  74.290  1.00 162.19 ? 47  ALA A C     1 
ATOM   280   O  O     . ALA A 1 68  ? -24.824 20.385  74.062  1.00 172.24 ? 47  ALA A O     1 
ATOM   281   C  CB    . ALA A 1 68  ? -22.380 20.236  76.122  1.00 162.99 ? 47  ALA A CB    1 
ATOM   282   N  N     . PHE A 1 69  ? -23.340 18.880  73.307  1.00 151.93 ? 48  PHE A N     1 
ATOM   283   C  CA    . PHE A 1 69  ? -23.791 19.066  71.934  1.00 148.86 ? 48  PHE A CA    1 
ATOM   284   C  C     . PHE A 1 69  ? -25.201 18.516  71.716  1.00 149.29 ? 48  PHE A C     1 
ATOM   285   O  O     . PHE A 1 69  ? -26.067 19.216  71.174  1.00 150.71 ? 48  PHE A O     1 
ATOM   286   C  CB    . PHE A 1 69  ? -22.811 18.409  70.969  1.00 165.51 ? 48  PHE A CB    1 
ATOM   287   C  CG    . PHE A 1 69  ? -23.252 18.481  69.550  1.00 173.62 ? 48  PHE A CG    1 
ATOM   288   C  CD1   . PHE A 1 69  ? -23.892 17.413  68.948  1.00 162.69 ? 48  PHE A CD1   1 
ATOM   289   C  CD2   . PHE A 1 69  ? -23.048 19.639  68.822  1.00 159.79 ? 48  PHE A CD2   1 
ATOM   290   C  CE1   . PHE A 1 69  ? -24.313 17.499  67.644  1.00 149.07 ? 48  PHE A CE1   1 
ATOM   291   C  CE2   . PHE A 1 69  ? -23.473 19.737  67.529  1.00 137.79 ? 48  PHE A CE2   1 
ATOM   292   C  CZ    . PHE A 1 69  ? -24.106 18.663  66.934  1.00 139.34 ? 48  PHE A CZ    1 
ATOM   293   N  N     . ILE A 1 70  ? -25.454 17.268  72.144  1.00 148.34 ? 49  ILE A N     1 
ATOM   294   C  CA    . ILE A 1 70  ? -26.762 16.637  71.930  1.00 148.68 ? 49  ILE A CA    1 
ATOM   295   C  C     . ILE A 1 70  ? -27.863 17.457  72.595  1.00 154.24 ? 49  ILE A C     1 
ATOM   296   O  O     . ILE A 1 70  ? -28.974 17.603  72.062  1.00 155.22 ? 49  ILE A O     1 
ATOM   297   C  CB    . ILE A 1 70  ? -26.742 15.189  72.451  1.00 147.21 ? 49  ILE A CB    1 
ATOM   298   C  CG1   . ILE A 1 70  ? -25.623 14.415  71.745  1.00 142.10 ? 49  ILE A CG1   1 
ATOM   299   C  CG2   . ILE A 1 70  ? -28.094 14.532  72.203  1.00 147.67 ? 49  ILE A CG2   1 
ATOM   300   C  CD1   . ILE A 1 70  ? -25.543 12.928  72.041  1.00 140.17 ? 49  ILE A CD1   1 
ATOM   301   N  N     . ALA A 1 71  ? -27.569 17.996  73.779  1.00 158.36 ? 50  ALA A N     1 
ATOM   302   C  CA    . ALA A 1 71  ? -28.507 18.882  74.447  1.00 164.28 ? 50  ALA A CA    1 
ATOM   303   C  C     . ALA A 1 71  ? -28.725 20.150  73.635  1.00 165.27 ? 50  ALA A C     1 
ATOM   304   O  O     . ALA A 1 71  ? -29.864 20.527  73.334  1.00 167.68 ? 50  ALA A O     1 
ATOM   305   C  CB    . ALA A 1 71  ? -27.978 19.228  75.839  1.00 168.61 ? 50  ALA A CB    1 
ATOM   306   N  N     . ALA A 1 72  ? -27.637 20.803  73.233  1.00 163.43 ? 51  ALA A N     1 
ATOM   307   C  CA    . ALA A 1 72  ? -27.799 22.083  72.563  1.00 164.84 ? 51  ALA A CA    1 
ATOM   308   C  C     . ALA A 1 72  ? -28.488 21.903  71.228  1.00 161.74 ? 51  ALA A C     1 
ATOM   309   O  O     . ALA A 1 72  ? -29.273 22.767  70.820  1.00 164.39 ? 51  ALA A O     1 
ATOM   310   C  CB    . ALA A 1 72  ? -26.449 22.777  72.390  1.00 163.39 ? 51  ALA A CB    1 
ATOM   311   N  N     . PHE A 1 73  ? -28.232 20.778  70.558  1.00 156.60 ? 52  PHE A N     1 
ATOM   312   C  CA    . PHE A 1 73  ? -28.842 20.544  69.258  1.00 153.79 ? 52  PHE A CA    1 
ATOM   313   C  C     . PHE A 1 73  ? -30.358 20.516  69.355  1.00 158.25 ? 52  PHE A C     1 
ATOM   314   O  O     . PHE A 1 73  ? -31.049 21.110  68.518  1.00 158.15 ? 52  PHE A O     1 
ATOM   315   C  CB    . PHE A 1 73  ? -28.325 19.242  68.656  1.00 150.58 ? 52  PHE A CB    1 
ATOM   316   C  CG    . PHE A 1 73  ? -28.941 18.912  67.327  1.00 156.02 ? 52  PHE A CG    1 
ATOM   317   C  CD1   . PHE A 1 73  ? -28.454 19.473  66.167  1.00 149.46 ? 52  PHE A CD1   1 
ATOM   318   C  CD2   . PHE A 1 73  ? -30.008 18.025  67.238  1.00 153.28 ? 52  PHE A CD2   1 
ATOM   319   C  CE1   . PHE A 1 73  ? -29.034 19.169  64.949  1.00 160.35 ? 52  PHE A CE1   1 
ATOM   320   C  CE2   . PHE A 1 73  ? -30.583 17.708  66.020  1.00 144.22 ? 52  PHE A CE2   1 
ATOM   321   C  CZ    . PHE A 1 73  ? -30.103 18.281  64.880  1.00 149.70 ? 52  PHE A CZ    1 
ATOM   322   N  N     . ALA A 1 74  ? -30.897 19.825  70.362  1.00 159.69 ? 53  ALA A N     1 
ATOM   323   C  CA    . ALA A 1 74  ? -32.343 19.667  70.442  1.00 163.01 ? 53  ALA A CA    1 
ATOM   324   C  C     . ALA A 1 74  ? -33.075 20.997  70.605  1.00 168.51 ? 53  ALA A C     1 
ATOM   325   O  O     . ALA A 1 74  ? -34.270 21.067  70.303  1.00 171.03 ? 53  ALA A O     1 
ATOM   326   C  CB    . ALA A 1 74  ? -32.697 18.707  71.570  1.00 168.64 ? 53  ALA A CB    1 
ATOM   327   N  N     . GLU A 1 75  ? -32.399 22.044  71.086  1.00 170.80 ? 54  GLU A N     1 
ATOM   328   C  CA    . GLU A 1 75  ? -33.022 23.354  71.267  1.00 176.42 ? 54  GLU A CA    1 
ATOM   329   C  C     . GLU A 1 75  ? -33.119 24.217  69.994  1.00 175.26 ? 54  GLU A C     1 
ATOM   330   O  O     . GLU A 1 75  ? -33.773 25.260  70.040  1.00 190.21 ? 54  GLU A O     1 
ATOM   331   C  CB    . GLU A 1 75  ? -32.289 24.136  72.369  1.00 180.08 ? 54  GLU A CB    1 
ATOM   332   C  CG    . GLU A 1 75  ? -32.344 23.509  73.780  1.00 199.79 ? 54  GLU A CG    1 
ATOM   333   C  CD    . GLU A 1 75  ? -33.756 23.499  74.418  1.00 223.62 ? 54  GLU A CD    1 
ATOM   334   O  OE1   . GLU A 1 75  ? -34.422 24.563  74.477  1.00 216.94 ? 54  GLU A OE1   1 
ATOM   335   O  OE2   . GLU A 1 75  ? -34.200 22.421  74.874  1.00 235.48 ? 54  GLU A OE2   1 
ATOM   336   N  N     . LEU A 1 76  ? -32.498 23.847  68.872  1.00 169.43 ? 55  LEU A N     1 
ATOM   337   C  CA    . LEU A 1 76  ? -32.563 24.670  67.661  1.00 168.43 ? 55  LEU A CA    1 
ATOM   338   C  C     . LEU A 1 76  ? -33.951 24.606  67.015  1.00 170.41 ? 55  LEU A C     1 
ATOM   339   O  O     . LEU A 1 76  ? -34.673 23.631  67.192  1.00 170.45 ? 55  LEU A O     1 
ATOM   340   C  CB    . LEU A 1 76  ? -31.533 24.204  66.630  1.00 161.84 ? 55  LEU A CB    1 
ATOM   341   C  CG    . LEU A 1 76  ? -30.006 24.392  66.709  1.00 158.67 ? 55  LEU A CG    1 
ATOM   342   C  CD1   . LEU A 1 76  ? -29.298 23.494  65.667  1.00 152.29 ? 55  LEU A CD1   1 
ATOM   343   C  CD2   . LEU A 1 76  ? -29.568 25.850  66.552  1.00 160.77 ? 55  LEU A CD2   1 
ATOM   344   N  N     . PRO A 1 77  ? -34.349 25.631  66.257  1.00 172.28 ? 56  PRO A N     1 
ATOM   345   C  CA    . PRO A 1 77  ? -35.582 25.528  65.457  1.00 173.73 ? 56  PRO A CA    1 
ATOM   346   C  C     . PRO A 1 77  ? -35.542 24.359  64.479  1.00 168.36 ? 56  PRO A C     1 
ATOM   347   O  O     . PRO A 1 77  ? -34.485 23.803  64.179  1.00 163.20 ? 56  PRO A O     1 
ATOM   348   C  CB    . PRO A 1 77  ? -35.633 26.864  64.705  1.00 175.57 ? 56  PRO A CB    1 
ATOM   349   C  CG    . PRO A 1 77  ? -34.881 27.804  65.569  1.00 177.96 ? 56  PRO A CG    1 
ATOM   350   C  CD    . PRO A 1 77  ? -33.815 27.002  66.273  1.00 174.42 ? 56  PRO A CD    1 
ATOM   351   N  N     . GLU A 1 78  ? -36.731 23.944  64.017  1.00 170.03 ? 57  GLU A N     1 
ATOM   352   C  CA    . GLU A 1 78  ? -36.802 22.838  63.056  1.00 183.82 ? 57  GLU A CA    1 
ATOM   353   C  C     . GLU A 1 78  ? -36.130 23.211  61.744  1.00 189.24 ? 57  GLU A C     1 
ATOM   354   O  O     . GLU A 1 78  ? -35.539 22.357  61.072  1.00 185.33 ? 57  GLU A O     1 
ATOM   355   C  CB    . GLU A 1 78  ? -38.249 22.383  62.807  1.00 210.03 ? 57  GLU A CB    1 
ATOM   356   C  CG    . GLU A 1 78  ? -38.877 21.582  63.969  1.00 219.75 ? 57  GLU A CG    1 
ATOM   357   C  CD    . GLU A 1 78  ? -39.120 20.099  63.640  1.00 197.97 ? 57  GLU A CD    1 
ATOM   358   O  OE1   . GLU A 1 78  ? -38.409 19.550  62.758  1.00 188.18 ? 57  GLU A OE1   1 
ATOM   359   O  OE2   . GLU A 1 78  ? -39.995 19.481  64.298  1.00 171.83 ? 57  GLU A OE2   1 
ATOM   360   N  N     . ALA A 1 79  ? -36.239 24.479  61.353  1.00 209.40 ? 58  ALA A N     1 
ATOM   361   C  CA    . ALA A 1 79  ? -35.617 24.933  60.116  1.00 206.00 ? 58  ALA A CA    1 
ATOM   362   C  C     . ALA A 1 79  ? -34.097 24.790  60.164  1.00 160.41 ? 58  ALA A C     1 
ATOM   363   O  O     . ALA A 1 79  ? -33.490 24.261  59.230  1.00 151.70 ? 58  ALA A O     1 
ATOM   364   C  CB    . ALA A 1 79  ? -36.015 26.389  59.858  1.00 234.58 ? 58  ALA A CB    1 
ATOM   365   N  N     . SER A 1 80  ? -33.467 25.245  61.258  1.00 157.44 ? 59  SER A N     1 
ATOM   366   C  CA    . SER A 1 80  ? -32.005 25.257  61.370  1.00 168.33 ? 59  SER A CA    1 
ATOM   367   C  C     . SER A 1 80  ? -31.426 23.866  61.682  1.00 178.00 ? 59  SER A C     1 
ATOM   368   O  O     . SER A 1 80  ? -30.340 23.518  61.188  1.00 149.52 ? 59  SER A O     1 
ATOM   369   C  CB    . SER A 1 80  ? -31.553 26.319  62.381  1.00 156.86 ? 59  SER A CB    1 
ATOM   370   O  OG    . SER A 1 80  ? -32.037 26.088  63.677  1.00 168.34 ? 59  SER A OG    1 
ATOM   371   N  N     . GLN A 1 81  ? -32.101 23.070  62.526  1.00 178.48 ? 60  GLN A N     1 
ATOM   372   C  CA    . GLN A 1 81  ? -31.661 21.688  62.724  1.00 152.31 ? 60  GLN A CA    1 
ATOM   373   C  C     . GLN A 1 81  ? -31.620 20.943  61.402  1.00 144.08 ? 60  GLN A C     1 
ATOM   374   O  O     . GLN A 1 81  ? -30.718 20.136  61.168  1.00 139.79 ? 60  GLN A O     1 
ATOM   375   C  CB    . GLN A 1 81  ? -32.622 20.938  63.649  1.00 159.34 ? 60  GLN A CB    1 
ATOM   376   C  CG    . GLN A 1 81  ? -32.376 20.965  65.139  1.00 165.72 ? 60  GLN A CG    1 
ATOM   377   C  CD    . GLN A 1 81  ? -33.479 20.218  65.871  1.00 168.76 ? 60  GLN A CD    1 
ATOM   378   O  OE1   . GLN A 1 81  ? -34.335 19.593  65.238  1.00 171.50 ? 60  GLN A OE1   1 
ATOM   379   N  NE2   . GLN A 1 81  ? -33.472 20.284  67.203  1.00 166.23 ? 60  GLN A NE2   1 
ATOM   380   N  N     . ALA A 1 82  ? -32.569 21.244  60.506  1.00 151.42 ? 61  ALA A N     1 
ATOM   381   C  CA    . ALA A 1 82  ? -32.628 20.599  59.195  1.00 154.73 ? 61  ALA A CA    1 
ATOM   382   C  C     . ALA A 1 82  ? -31.448 20.996  58.316  1.00 157.52 ? 61  ALA A C     1 
ATOM   383   O  O     . ALA A 1 82  ? -30.852 20.140  57.646  1.00 170.63 ? 61  ALA A O     1 
ATOM   384   C  CB    . ALA A 1 82  ? -33.950 20.951  58.506  1.00 160.67 ? 61  ALA A CB    1 
ATOM   385   N  N     . LEU A 1 83  ? -31.087 22.287  58.316  1.00 152.76 ? 62  LEU A N     1 
ATOM   386   C  CA    . LEU A 1 83  ? -29.932 22.737  57.547  1.00 136.66 ? 62  LEU A CA    1 
ATOM   387   C  C     . LEU A 1 83  ? -28.660 22.058  58.040  1.00 133.19 ? 62  LEU A C     1 
ATOM   388   O  O     . LEU A 1 83  ? -27.862 21.548  57.241  1.00 129.45 ? 62  LEU A O     1 
ATOM   389   C  CB    . LEU A 1 83  ? -29.797 24.259  57.639  1.00 139.11 ? 62  LEU A CB    1 
ATOM   390   C  CG    . LEU A 1 83  ? -28.699 24.870  56.781  1.00 136.16 ? 62  LEU A CG    1 
ATOM   391   C  CD1   . LEU A 1 83  ? -28.960 24.526  55.326  1.00 134.17 ? 62  LEU A CD1   1 
ATOM   392   C  CD2   . LEU A 1 83  ? -28.617 26.349  56.985  1.00 138.98 ? 62  LEU A CD2   1 
ATOM   393   N  N     . LEU A 1 84  ? -28.483 21.998  59.362  1.00 134.72 ? 63  LEU A N     1 
ATOM   394   C  CA    . LEU A 1 84  ? -27.267 21.420  59.908  1.00 131.97 ? 63  LEU A CA    1 
ATOM   395   C  C     . LEU A 1 84  ? -27.105 19.986  59.419  1.00 128.62 ? 63  LEU A C     1 
ATOM   396   O  O     . LEU A 1 84  ? -25.999 19.575  59.044  1.00 133.30 ? 63  LEU A O     1 
ATOM   397   C  CB    . LEU A 1 84  ? -27.297 21.510  61.433  1.00 134.86 ? 63  LEU A CB    1 
ATOM   398   C  CG    . LEU A 1 84  ? -25.999 21.565  62.256  1.00 133.87 ? 63  LEU A CG    1 
ATOM   399   C  CD1   . LEU A 1 84  ? -26.280 21.329  63.725  1.00 136.98 ? 63  LEU A CD1   1 
ATOM   400   C  CD2   . LEU A 1 84  ? -24.884 20.686  61.791  1.00 129.39 ? 63  LEU A CD2   1 
ATOM   401   N  N     . VAL A 1 85  ? -28.205 19.221  59.368  1.00 129.75 ? 64  VAL A N     1 
ATOM   402   C  CA    . VAL A 1 85  ? -28.133 17.822  58.910  1.00 137.31 ? 64  VAL A CA    1 
ATOM   403   C  C     . VAL A 1 85  ? -27.797 17.758  57.416  1.00 127.94 ? 64  VAL A C     1 
ATOM   404   O  O     . VAL A 1 85  ? -27.092 16.836  56.959  1.00 121.45 ? 64  VAL A O     1 
ATOM   405   C  CB    . VAL A 1 85  ? -29.430 17.054  59.277  1.00 139.14 ? 64  VAL A CB    1 
ATOM   406   C  CG1   . VAL A 1 85  ? -29.455 15.664  58.701  1.00 126.96 ? 64  VAL A CG1   1 
ATOM   407   C  CG2   . VAL A 1 85  ? -29.491 16.853  60.759  1.00 131.18 ? 64  VAL A CG2   1 
ATOM   408   N  N     . ARG A 1 86  ? -28.287 18.728  56.637  1.00 125.80 ? 65  ARG A N     1 
ATOM   409   C  CA    . ARG A 1 86  ? -27.908 18.805  55.232  1.00 126.18 ? 65  ARG A CA    1 
ATOM   410   C  C     . ARG A 1 86  ? -26.390 18.988  55.070  1.00 129.09 ? 65  ARG A C     1 
ATOM   411   O  O     . ARG A 1 86  ? -25.755 18.296  54.267  1.00 117.80 ? 65  ARG A O     1 
ATOM   412   C  CB    . ARG A 1 86  ? -28.671 19.940  54.551  1.00 126.04 ? 65  ARG A CB    1 
ATOM   413   C  CG    . ARG A 1 86  ? -30.157 19.737  54.429  1.00 129.22 ? 65  ARG A CG    1 
ATOM   414   C  CD    . ARG A 1 86  ? -30.561 18.435  53.770  1.00 128.15 ? 65  ARG A CD    1 
ATOM   415   N  NE    . ARG A 1 86  ? -31.936 18.517  53.275  1.00 147.72 ? 65  ARG A NE    1 
ATOM   416   C  CZ    . ARG A 1 86  ? -32.526 17.600  52.516  1.00 149.23 ? 65  ARG A CZ    1 
ATOM   417   N  NH1   . ARG A 1 86  ? -31.873 16.502  52.167  1.00 143.20 ? 65  ARG A NH1   1 
ATOM   418   N  NH2   . ARG A 1 86  ? -33.779 17.778  52.115  1.00 161.80 ? 65  ARG A NH2   1 
ATOM   419   N  N     . MET A 1 87  ? -25.784 19.922  55.818  1.00 126.16 ? 66  MET A N     1 
ATOM   420   C  CA    . MET A 1 87  ? -24.343 20.126  55.654  1.00 118.45 ? 66  MET A CA    1 
ATOM   421   C  C     . MET A 1 87  ? -23.560 18.927  56.160  1.00 116.30 ? 66  MET A C     1 
ATOM   422   O  O     . MET A 1 87  ? -22.540 18.539  55.564  1.00 113.59 ? 66  MET A O     1 
ATOM   423   C  CB    . MET A 1 87  ? -23.854 21.388  56.359  1.00 119.96 ? 66  MET A CB    1 
ATOM   424   C  CG    . MET A 1 87  ? -24.488 22.668  55.876  1.00 122.22 ? 66  MET A CG    1 
ATOM   425   S  SD    . MET A 1 87  ? -23.903 24.076  56.828  1.00 124.70 ? 66  MET A SD    1 
ATOM   426   C  CE    . MET A 1 87  ? -24.944 25.401  56.227  1.00 127.77 ? 66  MET A CE    1 
ATOM   427   N  N     . VAL A 1 88  ? -24.004 18.327  57.265  1.00 124.81 ? 67  VAL A N     1 
ATOM   428   C  CA    . VAL A 1 88  ? -23.261 17.166  57.733  1.00 120.01 ? 67  VAL A CA    1 
ATOM   429   C  C     . VAL A 1 88  ? -23.366 16.039  56.715  1.00 113.78 ? 67  VAL A C     1 
ATOM   430   O  O     . VAL A 1 88  ? -22.427 15.258  56.561  1.00 111.58 ? 67  VAL A O     1 
ATOM   431   C  CB    . VAL A 1 88  ? -23.724 16.715  59.132  1.00 117.81 ? 67  VAL A CB    1 
ATOM   432   C  CG1   . VAL A 1 88  ? -22.832 15.597  59.610  1.00 115.90 ? 67  VAL A CG1   1 
ATOM   433   C  CG2   . VAL A 1 88  ? -23.666 17.854  60.121  1.00 120.43 ? 67  VAL A CG2   1 
ATOM   434   N  N     . MET A 1 89  ? -24.491 15.937  55.996  1.00 114.85 ? 68  MET A N     1 
ATOM   435   C  CA    . MET A 1 89  ? -24.646 14.869  55.007  1.00 113.49 ? 68  MET A CA    1 
ATOM   436   C  C     . MET A 1 89  ? -24.003 15.154  53.652  1.00 119.51 ? 68  MET A C     1 
ATOM   437   O  O     . MET A 1 89  ? -23.857 14.213  52.860  1.00 145.09 ? 68  MET A O     1 
ATOM   438   C  CB    . MET A 1 89  ? -26.125 14.538  54.739  1.00 131.35 ? 68  MET A CB    1 
ATOM   439   C  CG    . MET A 1 89  ? -26.900 13.812  55.844  1.00 125.35 ? 68  MET A CG    1 
ATOM   440   S  SD    . MET A 1 89  ? -28.540 13.259  55.287  1.00 125.21 ? 68  MET A SD    1 
ATOM   441   C  CE    . MET A 1 89  ? -28.943 14.438  53.991  1.00 120.84 ? 68  MET A CE    1 
ATOM   442   N  N     . ARG A 1 90  ? -23.625 16.390  53.345  1.00 111.72 ? 69  ARG A N     1 
ATOM   443   C  CA    . ARG A 1 90  ? -22.961 16.643  52.077  1.00 110.06 ? 69  ARG A CA    1 
ATOM   444   C  C     . ARG A 1 90  ? -21.455 16.622  52.249  1.00 125.13 ? 69  ARG A C     1 
ATOM   445   O  O     . ARG A 1 90  ? -20.915 16.623  53.366  1.00 124.79 ? 69  ARG A O     1 
ATOM   446   C  CB    . ARG A 1 90  ? -23.385 17.973  51.450  1.00 111.30 ? 69  ARG A CB    1 
ATOM   447   C  CG    . ARG A 1 90  ? -24.708 17.921  50.692  1.00 128.65 ? 69  ARG A CG    1 
ATOM   448   C  CD    . ARG A 1 90  ? -25.318 19.319  50.458  1.00 121.06 ? 69  ARG A CD    1 
ATOM   449   N  NE    . ARG A 1 90  ? -24.648 20.109  49.427  1.00 114.85 ? 69  ARG A NE    1 
ATOM   450   C  CZ    . ARG A 1 90  ? -25.131 21.242  48.913  1.00 120.11 ? 69  ARG A CZ    1 
ATOM   451   N  NH1   . ARG A 1 90  ? -26.284 21.738  49.347  1.00 118.95 ? 69  ARG A NH1   1 
ATOM   452   N  NH2   . ARG A 1 90  ? -24.448 21.892  47.972  1.00 127.98 ? 69  ARG A NH2   1 
ATOM   453   N  N     . LYS A 1 91  ? -20.786 16.624  51.091  1.00 113.96 ? 70  LYS A N     1 
ATOM   454   C  CA    . LYS A 1 91  ? -19.374 16.273  51.020  1.00 104.55 ? 70  LYS A CA    1 
ATOM   455   C  C     . LYS A 1 91  ? -18.511 17.268  51.774  1.00 104.06 ? 70  LYS A C     1 
ATOM   456   O  O     . LYS A 1 91  ? -17.608 16.880  52.523  1.00 103.34 ? 70  LYS A O     1 
ATOM   457   C  CB    . LYS A 1 91  ? -18.940 16.175  49.561  1.00 125.93 ? 70  LYS A CB    1 
ATOM   458   C  CG    . LYS A 1 91  ? -17.441 16.003  49.361  1.00 156.18 ? 70  LYS A CG    1 
ATOM   459   C  CD    . LYS A 1 91  ? -17.042 14.590  49.753  1.00 164.24 ? 70  LYS A CD    1 
ATOM   460   C  CE    . LYS A 1 91  ? -16.801 13.728  48.536  1.00 156.19 ? 70  LYS A CE    1 
ATOM   461   N  NZ    . LYS A 1 91  ? -16.478 12.311  48.870  1.00 175.87 ? 70  LYS A NZ    1 
ATOM   462   N  N     . GLY A 1 92  ? -18.770 18.551  51.594  1.00 104.94 ? 71  GLY A N     1 
ATOM   463   C  CA    . GLY A 1 92  ? -17.873 19.541  52.132  1.00 113.91 ? 71  GLY A CA    1 
ATOM   464   C  C     . GLY A 1 92  ? -17.873 19.675  53.655  1.00 123.58 ? 71  GLY A C     1 
ATOM   465   O  O     . GLY A 1 92  ? -18.642 19.070  54.426  1.00 107.47 ? 71  GLY A O     1 
ATOM   466   N  N     . THR A 1 93  ? -16.868 20.439  54.069  1.00 128.92 ? 72  THR A N     1 
ATOM   467   C  CA    . THR A 1 93  ? -16.897 21.266  55.254  1.00 108.38 ? 72  THR A CA    1 
ATOM   468   C  C     . THR A 1 93  ? -17.178 22.714  54.875  1.00 112.93 ? 72  THR A C     1 
ATOM   469   O  O     . THR A 1 93  ? -17.293 23.563  55.755  1.00 112.02 ? 72  THR A O     1 
ATOM   470   C  CB    . THR A 1 93  ? -15.555 21.173  55.962  1.00 107.88 ? 72  THR A CB    1 
ATOM   471   O  OG1   . THR A 1 93  ? -15.378 22.322  56.794  1.00 123.91 ? 72  THR A OG1   1 
ATOM   472   C  CG2   . THR A 1 93  ? -14.405 21.096  54.903  1.00 105.45 ? 72  THR A CG2   1 
ATOM   473   N  N     . LEU A 1 94  ? -17.251 23.008  53.565  1.00 127.71 ? 73  LEU A N     1 
ATOM   474   C  CA    . LEU A 1 94  ? -17.416 24.347  52.998  1.00 109.41 ? 73  LEU A CA    1 
ATOM   475   C  C     . LEU A 1 94  ? -18.545 24.410  51.974  1.00 109.83 ? 73  LEU A C     1 
ATOM   476   O  O     . LEU A 1 94  ? -18.662 23.550  51.091  1.00 108.25 ? 73  LEU A O     1 
ATOM   477   C  CB    . LEU A 1 94  ? -16.126 24.816  52.339  1.00 107.59 ? 73  LEU A CB    1 
ATOM   478   C  CG    . LEU A 1 94  ? -15.017 25.129  53.315  1.00 107.93 ? 73  LEU A CG    1 
ATOM   479   C  CD1   . LEU A 1 94  ? -13.686 25.138  52.605  1.00 105.75 ? 73  LEU A CD1   1 
ATOM   480   C  CD2   . LEU A 1 94  ? -15.334 26.473  53.884  1.00 110.64 ? 73  LEU A CD2   1 
ATOM   481   N  N     . PHE A 1 95  ? -19.320 25.488  52.052  1.00 112.27 ? 74  PHE A N     1 
ATOM   482   C  CA    . PHE A 1 95  ? -20.474 25.673  51.195  1.00 123.56 ? 74  PHE A CA    1 
ATOM   483   C  C     . PHE A 1 95  ? -20.662 27.134  50.868  1.00 120.95 ? 74  PHE A C     1 
ATOM   484   O  O     . PHE A 1 95  ? -20.584 27.988  51.756  1.00 123.85 ? 74  PHE A O     1 
ATOM   485   C  CB    . PHE A 1 95  ? -21.735 25.179  51.890  1.00 115.69 ? 74  PHE A CB    1 
ATOM   486   C  CG    . PHE A 1 95  ? -21.616 23.797  52.354  1.00 114.31 ? 74  PHE A CG    1 
ATOM   487   C  CD1   . PHE A 1 95  ? -21.132 23.541  53.613  1.00 114.58 ? 74  PHE A CD1   1 
ATOM   488   C  CD2   . PHE A 1 95  ? -21.857 22.743  51.493  1.00 126.99 ? 74  PHE A CD2   1 
ATOM   489   C  CE1   . PHE A 1 95  ? -20.963 22.263  54.041  1.00 113.33 ? 74  PHE A CE1   1 
ATOM   490   C  CE2   . PHE A 1 95  ? -21.700 21.444  51.909  1.00 111.58 ? 74  PHE A CE2   1 
ATOM   491   C  CZ    . PHE A 1 95  ? -21.249 21.201  53.187  1.00 119.60 ? 74  PHE A CZ    1 
ATOM   492   N  N     . ARG A 1 96  ? -20.982 27.396  49.607  1.00 118.51 ? 75  ARG A N     1 
ATOM   493   C  CA    . ARG A 1 96  ? -21.525 28.686  49.231  1.00 117.10 ? 75  ARG A CA    1 
ATOM   494   C  C     . ARG A 1 96  ? -22.980 28.740  49.663  1.00 120.49 ? 75  ARG A C     1 
ATOM   495   O  O     . ARG A 1 96  ? -23.718 27.765  49.495  1.00 126.71 ? 75  ARG A O     1 
ATOM   496   C  CB    . ARG A 1 96  ? -21.476 28.858  47.733  1.00 131.28 ? 75  ARG A CB    1 
ATOM   497   C  CG    . ARG A 1 96  ? -20.150 28.634  47.164  1.00 151.25 ? 75  ARG A CG    1 
ATOM   498   C  CD    . ARG A 1 96  ? -20.319 28.578  45.689  1.00 149.50 ? 75  ARG A CD    1 
ATOM   499   N  NE    . ARG A 1 96  ? -21.090 29.729  45.255  1.00 126.30 ? 75  ARG A NE    1 
ATOM   500   C  CZ    . ARG A 1 96  ? -20.600 30.680  44.479  1.00 138.15 ? 75  ARG A CZ    1 
ATOM   501   N  NH1   . ARG A 1 96  ? -19.335 30.614  44.082  1.00 111.43 ? 75  ARG A NH1   1 
ATOM   502   N  NH2   . ARG A 1 96  ? -21.367 31.698  44.120  1.00 172.95 ? 75  ARG A NH2   1 
ATOM   503   N  N     . GLU A 1 97  ? -23.409 29.884  50.198  1.00 125.56 ? 76  GLU A N     1 
ATOM   504   C  CA    . GLU A 1 97  ? -24.825 30.028  50.530  1.00 134.32 ? 76  GLU A CA    1 
ATOM   505   C  C     . GLU A 1 97  ? -25.720 29.641  49.367  1.00 127.62 ? 76  GLU A C     1 
ATOM   506   O  O     . GLU A 1 97  ? -26.876 29.257  49.575  1.00 130.04 ? 76  GLU A O     1 
ATOM   507   C  CB    . GLU A 1 97  ? -25.150 31.456  50.947  1.00 147.36 ? 76  GLU A CB    1 
ATOM   508   C  CG    . GLU A 1 97  ? -26.583 31.611  51.434  1.00 141.29 ? 76  GLU A CG    1 
ATOM   509   C  CD    . GLU A 1 97  ? -26.956 33.070  51.552  1.00 157.31 ? 76  GLU A CD    1 
ATOM   510   O  OE1   . GLU A 1 97  ? -26.589 33.858  50.629  1.00 168.34 ? 76  GLU A OE1   1 
ATOM   511   O  OE2   . GLU A 1 97  ? -27.625 33.424  52.549  1.00 158.83 ? 76  GLU A OE2   1 
ATOM   512   N  N     . GLY A 1 98  ? -25.212 29.742  48.140  1.00 127.99 ? 77  GLY A N     1 
ATOM   513   C  CA    . GLY A 1 98  ? -26.038 29.445  46.988  1.00 130.46 ? 77  GLY A CA    1 
ATOM   514   C  C     . GLY A 1 98  ? -26.381 27.976  46.867  1.00 124.82 ? 77  GLY A C     1 
ATOM   515   O  O     . GLY A 1 98  ? -27.481 27.629  46.429  1.00 127.77 ? 77  GLY A O     1 
ATOM   516   N  N     . LYS A 1 99  ? -25.464 27.098  47.266  1.00 121.79 ? 78  LYS A N     1 
ATOM   517   C  CA    . LYS A 1 99  ? -25.655 25.662  47.123  1.00 120.48 ? 78  LYS A CA    1 
ATOM   518   C  C     . LYS A 1 99  ? -26.530 25.087  48.218  1.00 122.43 ? 78  LYS A C     1 
ATOM   519   O  O     . LYS A 1 99  ? -26.775 23.878  48.230  1.00 121.66 ? 78  LYS A O     1 
ATOM   520   C  CB    . LYS A 1 99  ? -24.308 24.958  47.126  1.00 116.79 ? 78  LYS A CB    1 
ATOM   521   C  CG    . LYS A 1 99  ? -23.372 25.387  46.018  1.00 123.83 ? 78  LYS A CG    1 
ATOM   522   C  CD    . LYS A 1 99  ? -23.787 24.763  44.703  1.00 127.61 ? 78  LYS A CD    1 
ATOM   523   C  CE    . LYS A 1 99  ? -22.665 24.886  43.679  1.00 116.37 ? 78  LYS A CE    1 
ATOM   524   N  NZ    . LYS A 1 99  ? -22.651 23.723  42.735  1.00 114.86 ? 78  LYS A NZ    1 
ATOM   525   N  N     . LEU A 1 100 ? -26.980 25.934  49.136  1.00 125.12 ? 79  LEU A N     1 
ATOM   526   C  CA    . LEU A 1 100 ? -27.767 25.570  50.307  1.00 145.84 ? 79  LEU A CA    1 
ATOM   527   C  C     . LEU A 1 100 ? -29.283 25.739  50.123  1.00 148.05 ? 79  LEU A C     1 
ATOM   528   O  O     . LEU A 1 100 ? -30.016 25.840  51.120  1.00 134.33 ? 79  LEU A O     1 
ATOM   529   C  CB    . LEU A 1 100 ? -27.249 26.335  51.522  1.00 146.94 ? 79  LEU A CB    1 
ATOM   530   C  CG    . LEU A 1 100 ? -25.888 25.811  52.001  1.00 124.97 ? 79  LEU A CG    1 
ATOM   531   C  CD1   . LEU A 1 100 ? -25.334 26.674  53.104  1.00 126.30 ? 79  LEU A CD1   1 
ATOM   532   C  CD2   . LEU A 1 100 ? -26.051 24.383  52.500  1.00 123.86 ? 79  LEU A CD2   1 
ATOM   533   N  N     . ALA A 1 101 ? -29.759 25.875  48.889  1.00 131.96 ? 80  ALA A N     1 
ATOM   534   C  CA    . ALA A 1 101 ? -31.198 25.944  48.665  1.00 135.91 ? 80  ALA A CA    1 
ATOM   535   C  C     . ALA A 1 101 ? -31.865 24.602  48.987  1.00 136.17 ? 80  ALA A C     1 
ATOM   536   O  O     . ALA A 1 101 ? -31.523 23.570  48.405  1.00 172.37 ? 80  ALA A O     1 
ATOM   537   C  CB    . ALA A 1 101 ? -31.479 26.344  47.218  1.00 136.50 ? 80  ALA A CB    1 
ATOM   538   N  N     . TYR A 1 102 ? -32.839 24.632  49.891  1.00 140.67 ? 81  TYR A N     1 
ATOM   539   C  CA    . TYR A 1 102 ? -33.673 23.496  50.263  1.00 161.08 ? 81  TYR A CA    1 
ATOM   540   C  C     . TYR A 1 102 ? -35.090 23.986  50.472  1.00 159.36 ? 81  TYR A C     1 
ATOM   541   O  O     . TYR A 1 102 ? -35.299 25.013  51.119  1.00 149.75 ? 81  TYR A O     1 
ATOM   542   C  CB    . TYR A 1 102 ? -33.208 22.801  51.548  1.00 161.07 ? 81  TYR A CB    1 
ATOM   543   C  CG    . TYR A 1 102 ? -31.938 22.025  51.393  1.00 156.36 ? 81  TYR A CG    1 
ATOM   544   C  CD1   . TYR A 1 102 ? -30.721 22.537  51.811  1.00 143.18 ? 81  TYR A CD1   1 
ATOM   545   C  CD2   . TYR A 1 102 ? -31.960 20.769  50.804  1.00 142.47 ? 81  TYR A CD2   1 
ATOM   546   C  CE1   . TYR A 1 102 ? -29.559 21.806  51.647  1.00 145.91 ? 81  TYR A CE1   1 
ATOM   547   C  CE2   . TYR A 1 102 ? -30.817 20.042  50.634  1.00 134.18 ? 81  TYR A CE2   1 
ATOM   548   C  CZ    . TYR A 1 102 ? -29.617 20.558  51.053  1.00 140.36 ? 81  TYR A CZ    1 
ATOM   549   O  OH    . TYR A 1 102 ? -28.474 19.810  50.878  1.00 126.26 ? 81  TYR A OH    1 
ATOM   550   N  N     . ALA A 1 103 ? -36.062 23.222  49.971  1.00 171.18 ? 82  ALA A N     1 
ATOM   551   C  CA    . ALA A 1 103 ? -37.451 23.671  50.041  1.00 177.31 ? 82  ALA A CA    1 
ATOM   552   C  C     . ALA A 1 103 ? -38.002 23.595  51.464  1.00 168.93 ? 82  ALA A C     1 
ATOM   553   O  O     . ALA A 1 103 ? -38.763 24.471  51.882  1.00 160.17 ? 82  ALA A O     1 
ATOM   554   C  CB    . ALA A 1 103 ? -38.324 22.861  49.081  1.00 189.50 ? 82  ALA A CB    1 
ATOM   555   N  N     . GLU A 1 104 ? -37.619 22.567  52.233  1.00 178.22 ? 83  GLU A N     1 
ATOM   556   C  CA    . GLU A 1 104 ? -38.189 22.392  53.572  1.00 176.44 ? 83  GLU A CA    1 
ATOM   557   C  C     . GLU A 1 104 ? -37.832 23.557  54.496  1.00 159.73 ? 83  GLU A C     1 
ATOM   558   O  O     . GLU A 1 104 ? -38.632 23.923  55.367  1.00 163.07 ? 83  GLU A O     1 
ATOM   559   C  CB    . GLU A 1 104 ? -37.715 21.053  54.169  1.00 174.99 ? 83  GLU A CB    1 
ATOM   560   C  CG    . GLU A 1 104 ? -37.544 19.910  53.138  1.00 185.85 ? 83  GLU A CG    1 
ATOM   561   C  CD    . GLU A 1 104 ? -36.148 19.874  52.481  1.00 196.65 ? 83  GLU A CD    1 
ATOM   562   O  OE1   . GLU A 1 104 ? -35.142 20.029  53.207  1.00 193.46 ? 83  GLU A OE1   1 
ATOM   563   O  OE2   . GLU A 1 104 ? -36.050 19.723  51.238  1.00 199.98 ? 83  GLU A OE2   1 
ATOM   564   N  N     . ILE A 1 105 ? -36.651 24.148  54.309  1.00 162.40 ? 84  ILE A N     1 
ATOM   565   C  CA    . ILE A 1 105 ? -36.163 25.290  55.077  1.00 155.97 ? 84  ILE A CA    1 
ATOM   566   C  C     . ILE A 1 105 ? -36.336 26.509  54.201  1.00 157.86 ? 84  ILE A C     1 
ATOM   567   O  O     . ILE A 1 105 ? -35.731 26.575  53.128  1.00 173.37 ? 84  ILE A O     1 
ATOM   568   C  CB    . ILE A 1 105 ? -34.686 25.121  55.452  1.00 164.93 ? 84  ILE A CB    1 
ATOM   569   C  CG1   . ILE A 1 105 ? -34.281 23.644  55.255  1.00 169.81 ? 84  ILE A CG1   1 
ATOM   570   C  CG2   . ILE A 1 105 ? -34.450 25.727  56.820  1.00 153.74 ? 84  ILE A CG2   1 
ATOM   571   C  CD1   . ILE A 1 105 ? -32.883 23.260  55.672  1.00 148.66 ? 84  ILE A CD1   1 
ATOM   572   N  N     . GLY A 1 106 ? -37.113 27.489  54.646  1.00 163.08 ? 85  GLY A N     1 
ATOM   573   C  CA    . GLY A 1 106 ? -37.370 28.554  53.712  1.00 165.04 ? 85  GLY A CA    1 
ATOM   574   C  C     . GLY A 1 106 ? -36.132 29.351  53.375  1.00 162.00 ? 85  GLY A C     1 
ATOM   575   O  O     . GLY A 1 106 ? -35.629 29.243  52.253  1.00 158.67 ? 85  GLY A O     1 
ATOM   576   N  N     . ASP A 1 107 ? -35.572 30.083  54.331  1.00 176.85 ? 86  ASP A N     1 
ATOM   577   C  CA    . ASP A 1 107 ? -34.429 30.942  54.047  1.00 178.10 ? 86  ASP A CA    1 
ATOM   578   C  C     . ASP A 1 107 ? -33.143 30.291  54.529  1.00 172.04 ? 86  ASP A C     1 
ATOM   579   O  O     . ASP A 1 107 ? -33.080 29.774  55.654  1.00 157.94 ? 86  ASP A O     1 
ATOM   580   C  CB    . ASP A 1 107 ? -34.579 32.334  54.661  1.00 166.31 ? 86  ASP A CB    1 
ATOM   581   C  CG    . ASP A 1 107 ? -33.644 33.354  54.023  1.00 163.77 ? 86  ASP A CG    1 
ATOM   582   O  OD1   . ASP A 1 107 ? -34.019 34.539  54.009  1.00 174.17 ? 86  ASP A OD1   1 
ATOM   583   O  OD2   . ASP A 1 107 ? -32.549 32.980  53.526  1.00 170.04 ? 86  ASP A OD2   1 
ATOM   584   N  N     . THR A 1 108 ? -32.122 30.326  53.672  1.00 174.83 ? 87  THR A N     1 
ATOM   585   C  CA    . THR A 1 108 ? -30.831 29.790  54.063  1.00 158.16 ? 87  THR A CA    1 
ATOM   586   C  C     . THR A 1 108 ? -30.174 30.682  55.104  1.00 151.43 ? 87  THR A C     1 
ATOM   587   O  O     . THR A 1 108 ? -29.625 30.191  56.097  1.00 147.92 ? 87  THR A O     1 
ATOM   588   C  CB    . THR A 1 108 ? -29.934 29.673  52.847  1.00 146.73 ? 87  THR A CB    1 
ATOM   589   O  OG1   . THR A 1 108 ? -30.616 28.962  51.809  1.00 154.04 ? 87  THR A OG1   1 
ATOM   590   C  CG2   . THR A 1 108 ? -28.696 28.928  53.233  1.00 150.31 ? 87  THR A CG2   1 
ATOM   591   N  N     . ARG A 1 109 ? -30.219 31.998  54.880  1.00 151.48 ? 88  ARG A N     1 
ATOM   592   C  CA    . ARG A 1 109 ? -29.617 32.944  55.812  1.00 153.65 ? 88  ARG A CA    1 
ATOM   593   C  C     . ARG A 1 109 ? -30.374 32.993  57.131  1.00 158.53 ? 88  ARG A C     1 
ATOM   594   O  O     . ARG A 1 109 ? -29.770 33.204  58.190  1.00 159.59 ? 88  ARG A O     1 
ATOM   595   C  CB    . ARG A 1 109 ? -29.559 34.336  55.191  1.00 155.66 ? 88  ARG A CB    1 
ATOM   596   C  CG    . ARG A 1 109 ? -28.653 35.277  55.963  1.00 157.00 ? 88  ARG A CG    1 
ATOM   597   C  CD    . ARG A 1 109 ? -28.535 36.644  55.310  1.00 158.82 ? 88  ARG A CD    1 
ATOM   598   N  NE    . ARG A 1 109 ? -28.031 36.508  53.958  1.00 162.02 ? 88  ARG A NE    1 
ATOM   599   C  CZ    . ARG A 1 109 ? -26.777 36.189  53.673  1.00 170.06 ? 88  ARG A CZ    1 
ATOM   600   N  NH1   . ARG A 1 109 ? -25.910 35.974  54.653  1.00 157.44 ? 88  ARG A NH1   1 
ATOM   601   N  NH2   . ARG A 1 109 ? -26.395 36.076  52.409  1.00 185.23 ? 88  ARG A NH2   1 
ATOM   602   N  N     . ALA A 1 110 ? -31.700 32.842  57.088  1.00 161.99 ? 89  ALA A N     1 
ATOM   603   C  CA    . ALA A 1 110 ? -32.483 32.856  58.322  1.00 187.07 ? 89  ALA A CA    1 
ATOM   604   C  C     . ALA A 1 110 ? -32.206 31.626  59.169  1.00 166.36 ? 89  ALA A C     1 
ATOM   605   O  O     . ALA A 1 110 ? -31.996 31.727  60.385  1.00 167.12 ? 89  ALA A O     1 
ATOM   606   C  CB    . ALA A 1 110 ? -33.976 32.953  58.011  1.00 214.85 ? 89  ALA A CB    1 
ATOM   607   N  N     . ALA A 1 111 ? -32.218 30.454  58.545  1.00 160.55 ? 90  ALA A N     1 
ATOM   608   C  CA    . ALA A 1 111 ? -31.989 29.245  59.314  1.00 163.80 ? 90  ALA A CA    1 
ATOM   609   C  C     . ALA A 1 111 ? -30.582 29.219  59.897  1.00 164.29 ? 90  ALA A C     1 
ATOM   610   O  O     . ALA A 1 111 ? -30.372 28.659  60.979  1.00 156.11 ? 90  ALA A O     1 
ATOM   611   C  CB    . ALA A 1 111 ? -32.235 28.020  58.438  1.00 171.53 ? 90  ALA A CB    1 
ATOM   612   N  N     . VAL A 1 112 ? -29.616 29.859  59.223  1.00 172.09 ? 91  VAL A N     1 
ATOM   613   C  CA    . VAL A 1 112 ? -28.201 29.735  59.594  1.00 159.50 ? 91  VAL A CA    1 
ATOM   614   C  C     . VAL A 1 112 ? -27.779 30.602  60.775  1.00 155.73 ? 91  VAL A C     1 
ATOM   615   O  O     . VAL A 1 112 ? -26.661 30.437  61.281  1.00 151.76 ? 91  VAL A O     1 
ATOM   616   C  CB    . VAL A 1 112 ? -27.303 30.011  58.368  1.00 145.83 ? 91  VAL A CB    1 
ATOM   617   C  CG1   . VAL A 1 112 ? -27.110 31.494  58.146  1.00 148.28 ? 91  VAL A CG1   1 
ATOM   618   C  CG2   . VAL A 1 112 ? -25.961 29.292  58.506  1.00 145.93 ? 91  VAL A CG2   1 
ATOM   619   N  N     . GLN A 1 113 ? -28.613 31.529  61.236  1.00 159.20 ? 92  GLN A N     1 
ATOM   620   C  CA    . GLN A 1 113 ? -28.158 32.350  62.355  1.00 163.05 ? 92  GLN A CA    1 
ATOM   621   C  C     . GLN A 1 113 ? -27.980 31.531  63.631  1.00 163.80 ? 92  GLN A C     1 
ATOM   622   O  O     . GLN A 1 113 ? -26.860 31.529  64.174  1.00 162.58 ? 92  GLN A O     1 
ATOM   623   C  CB    . GLN A 1 113 ? -29.089 33.550  62.540  1.00 169.32 ? 92  GLN A CB    1 
ATOM   624   C  CG    . GLN A 1 113 ? -29.050 34.564  61.386  1.00 169.01 ? 92  GLN A CG    1 
ATOM   625   C  CD    . GLN A 1 113 ? -27.741 35.362  61.274  1.00 167.47 ? 92  GLN A CD    1 
ATOM   626   O  OE1   . GLN A 1 113 ? -27.036 35.238  60.286  1.00 162.68 ? 92  GLN A OE1   1 
ATOM   627   N  NE2   . GLN A 1 113 ? -27.453 36.224  62.256  1.00 171.99 ? 92  GLN A NE2   1 
ATOM   628   N  N     . PRO A 1 114 ? -28.971 30.756  64.116  1.00 172.54 ? 93  PRO A N     1 
ATOM   629   C  CA    . PRO A 1 114 ? -28.773 30.039  65.394  1.00 166.60 ? 93  PRO A CA    1 
ATOM   630   C  C     . PRO A 1 114 ? -27.581 29.107  65.387  1.00 168.52 ? 93  PRO A C     1 
ATOM   631   O  O     . PRO A 1 114 ? -27.063 28.772  66.462  1.00 162.16 ? 93  PRO A O     1 
ATOM   632   C  CB    . PRO A 1 114 ? -30.079 29.247  65.570  1.00 168.26 ? 93  PRO A CB    1 
ATOM   633   C  CG    . PRO A 1 114 ? -31.061 29.893  64.698  1.00 170.28 ? 93  PRO A CG    1 
ATOM   634   C  CD    . PRO A 1 114 ? -30.286 30.430  63.529  1.00 166.85 ? 93  PRO A CD    1 
ATOM   635   N  N     . LEU A 1 115 ? -27.134 28.687  64.202  1.00 177.16 ? 94  LEU A N     1 
ATOM   636   C  CA    . LEU A 1 115 ? -25.893 27.939  64.040  1.00 169.80 ? 94  LEU A CA    1 
ATOM   637   C  C     . LEU A 1 115 ? -24.679 28.856  64.097  1.00 155.21 ? 94  LEU A C     1 
ATOM   638   O  O     . LEU A 1 115 ? -23.613 28.437  64.558  1.00 149.92 ? 94  LEU A O     1 
ATOM   639   C  CB    . LEU A 1 115 ? -25.938 27.125  62.741  1.00 160.44 ? 94  LEU A CB    1 
ATOM   640   C  CG    . LEU A 1 115 ? -27.064 26.083  62.642  1.00 150.18 ? 94  LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1 115 ? -27.047 25.362  61.316  1.00 146.49 ? 94  LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1 115 ? -26.893 25.050  63.741  1.00 145.73 ? 94  LEU A CD2   1 
ATOM   643   N  N     . LEU A 1 116 ? -24.801 30.088  63.611  1.00 152.69 ? 95  LEU A N     1 
ATOM   644   C  CA    . LEU A 1 116 ? -23.695 31.016  63.784  1.00 153.22 ? 95  LEU A CA    1 
ATOM   645   C  C     . LEU A 1 116 ? -23.427 31.303  65.250  1.00 162.76 ? 95  LEU A C     1 
ATOM   646   O  O     . LEU A 1 116 ? -22.277 31.552  65.622  1.00 179.53 ? 95  LEU A O     1 
ATOM   647   C  CB    . LEU A 1 116 ? -23.957 32.310  63.023  1.00 154.98 ? 95  LEU A CB    1 
ATOM   648   C  CG    . LEU A 1 116 ? -23.997 32.174  61.514  1.00 150.69 ? 95  LEU A CG    1 
ATOM   649   C  CD1   . LEU A 1 116 ? -24.476 33.442  60.910  1.00 173.06 ? 95  LEU A CD1   1 
ATOM   650   C  CD2   . LEU A 1 116 ? -22.587 31.978  61.096  1.00 146.26 ? 95  LEU A CD2   1 
ATOM   651   N  N     . ALA A 1 117 ? -24.456 31.242  66.102  1.00 162.10 ? 96  ALA A N     1 
ATOM   652   C  CA    . ALA A 1 117 ? -24.271 31.625  67.500  1.00 167.18 ? 96  ALA A CA    1 
ATOM   653   C  C     . ALA A 1 117 ? -23.369 30.652  68.249  1.00 165.09 ? 96  ALA A C     1 
ATOM   654   O  O     . ALA A 1 117 ? -22.530 31.076  69.052  1.00 167.40 ? 96  ALA A O     1 
ATOM   655   C  CB    . ALA A 1 117 ? -25.631 31.738  68.195  1.00 172.64 ? 96  ALA A CB    1 
ATOM   656   N  N     . LEU A 1 118 ? -23.466 29.362  67.952  1.00 160.80 ? 97  LEU A N     1 
ATOM   657   C  CA    . LEU A 1 118 ? -22.605 28.374  68.595  1.00 174.87 ? 97  LEU A CA    1 
ATOM   658   C  C     . LEU A 1 118 ? -21.210 28.285  67.987  1.00 162.99 ? 97  LEU A C     1 
ATOM   659   O  O     . LEU A 1 118 ? -20.393 27.480  68.451  1.00 174.53 ? 97  LEU A O     1 
ATOM   660   C  CB    . LEU A 1 118 ? -23.268 26.993  68.560  1.00 170.81 ? 97  LEU A CB    1 
ATOM   661   C  CG    . LEU A 1 118 ? -24.390 26.747  69.560  1.00 160.70 ? 97  LEU A CG    1 
ATOM   662   C  CD1   . LEU A 1 118 ? -25.454 25.907  68.911  1.00 158.59 ? 97  LEU A CD1   1 
ATOM   663   C  CD2   . LEU A 1 118 ? -23.813 26.043  70.786  1.00 161.75 ? 97  LEU A CD2   1 
ATOM   664   N  N     . GLY A 1 119 ? -20.916 29.053  66.950  1.00 164.12 ? 98  GLY A N     1 
ATOM   665   C  CA    . GLY A 1 119 ? -19.637 28.858  66.313  1.00 169.57 ? 98  GLY A CA    1 
ATOM   666   C  C     . GLY A 1 119 ? -19.543 27.552  65.574  1.00 167.98 ? 98  GLY A C     1 
ATOM   667   O  O     . GLY A 1 119 ? -18.472 27.220  65.052  1.00 176.98 ? 98  GLY A O     1 
ATOM   668   N  N     . TRP A 1 120 ? -20.655 26.817  65.496  1.00 158.39 ? 99  TRP A N     1 
ATOM   669   C  CA    . TRP A 1 120 ? -20.690 25.547  64.792  1.00 148.24 ? 99  TRP A CA    1 
ATOM   670   C  C     . TRP A 1 120 ? -20.678 25.735  63.281  1.00 161.45 ? 99  TRP A C     1 
ATOM   671   O  O     . TRP A 1 120 ? -20.243 24.832  62.560  1.00 187.69 ? 99  TRP A O     1 
ATOM   672   C  CB    . TRP A 1 120 ? -21.926 24.747  65.225  1.00 155.59 ? 99  TRP A CB    1 
ATOM   673   C  CG    . TRP A 1 120 ? -21.964 24.274  66.703  1.00 173.10 ? 99  TRP A CG    1 
ATOM   674   C  CD1   . TRP A 1 120 ? -20.954 24.348  67.633  1.00 179.31 ? 99  TRP A CD1   1 
ATOM   675   C  CD2   . TRP A 1 120 ? -23.070 23.636  67.375  1.00 158.51 ? 99  TRP A CD2   1 
ATOM   676   N  NE1   . TRP A 1 120 ? -21.365 23.794  68.829  1.00 164.52 ? 99  TRP A NE1   1 
ATOM   677   C  CE2   . TRP A 1 120 ? -22.658 23.359  68.696  1.00 153.17 ? 99  TRP A CE2   1 
ATOM   678   C  CE3   . TRP A 1 120 ? -24.366 23.277  66.982  1.00 145.92 ? 99  TRP A CE3   1 
ATOM   679   C  CZ2   . TRP A 1 120 ? -23.492 22.755  69.619  1.00 164.61 ? 99  TRP A CZ2   1 
ATOM   680   C  CZ3   . TRP A 1 120 ? -25.185 22.668  67.892  1.00 147.66 ? 99  TRP A CZ3   1 
ATOM   681   C  CH2   . TRP A 1 120 ? -24.750 22.415  69.200  1.00 167.09 ? 99  TRP A CH2   1 
ATOM   682   N  N     . VAL A 1 121 ? -21.096 26.895  62.788  1.00 161.40 ? 100 VAL A N     1 
ATOM   683   C  CA    . VAL A 1 121 ? -20.964 27.240  61.378  1.00 159.28 ? 100 VAL A CA    1 
ATOM   684   C  C     . VAL A 1 121 ? -20.299 28.600  61.322  1.00 163.94 ? 100 VAL A C     1 
ATOM   685   O  O     . VAL A 1 121 ? -20.772 29.556  61.950  1.00 191.84 ? 100 VAL A O     1 
ATOM   686   C  CB    . VAL A 1 121 ? -22.310 27.253  60.628  1.00 148.75 ? 100 VAL A CB    1 
ATOM   687   C  CG1   . VAL A 1 121 ? -22.166 27.938  59.279  1.00 152.18 ? 100 VAL A CG1   1 
ATOM   688   C  CG2   . VAL A 1 121 ? -22.789 25.831  60.405  1.00 131.88 ? 100 VAL A CG2   1 
ATOM   689   N  N     . ASP A 1 122 ? -19.195 28.677  60.594  1.00 131.91 ? 101 ASP A N     1 
ATOM   690   C  CA    . ASP A 1 122 ? -18.465 29.913  60.403  1.00 139.13 ? 101 ASP A CA    1 
ATOM   691   C  C     . ASP A 1 122 ? -18.987 30.621  59.168  1.00 160.73 ? 101 ASP A C     1 
ATOM   692   O  O     . ASP A 1 122 ? -19.222 29.983  58.130  1.00 174.49 ? 101 ASP A O     1 
ATOM   693   C  CB    . ASP A 1 122 ? -16.968 29.629  60.237  1.00 157.37 ? 101 ASP A CB    1 
ATOM   694   C  CG    . ASP A 1 122 ? -16.078 30.662  60.923  1.00 166.05 ? 101 ASP A CG    1 
ATOM   695   O  OD1   . ASP A 1 122 ? -15.617 31.600  60.240  1.00 159.29 ? 101 ASP A OD1   1 
ATOM   696   O  OD2   . ASP A 1 122 ? -15.820 30.523  62.142  1.00 184.11 ? 101 ASP A OD2   1 
ATOM   697   N  N     . ALA A 1 123 ? -19.178 31.935  59.288  1.00 150.11 ? 102 ALA A N     1 
ATOM   698   C  CA    . ALA A 1 123 ? -19.199 32.762  58.099  1.00 144.87 ? 102 ALA A CA    1 
ATOM   699   C  C     . ALA A 1 123 ? -17.850 33.442  57.970  1.00 143.02 ? 102 ALA A C     1 
ATOM   700   O  O     . ALA A 1 123 ? -17.077 33.525  58.928  1.00 138.72 ? 102 ALA A O     1 
ATOM   701   C  CB    . ALA A 1 123 ? -20.320 33.802  58.171  1.00 139.10 ? 102 ALA A CB    1 
ATOM   702   N  N     . GLN A 1 124 ? -17.633 34.033  56.808  1.00 151.86 ? 103 GLN A N     1 
ATOM   703   C  CA    . GLN A 1 124 ? -16.303 34.464  56.403  1.00 171.17 ? 103 GLN A CA    1 
ATOM   704   C  C     . GLN A 1 124 ? -15.243 33.551  57.022  1.00 138.99 ? 103 GLN A C     1 
ATOM   705   O  O     . GLN A 1 124 ? -14.419 33.989  57.838  1.00 134.83 ? 103 GLN A O     1 
ATOM   706   C  CB    . GLN A 1 124 ? -16.069 35.940  56.719  1.00 185.36 ? 103 GLN A CB    1 
ATOM   707   C  CG    . GLN A 1 124 ? -16.141 36.403  58.144  1.00 171.16 ? 103 GLN A CG    1 
ATOM   708   C  CD    . GLN A 1 124 ? -16.143 37.896  58.169  1.00 177.35 ? 103 GLN A CD    1 
ATOM   709   O  OE1   . GLN A 1 124 ? -15.077 38.520  58.172  1.00 191.26 ? 103 GLN A OE1   1 
ATOM   710   N  NE2   . GLN A 1 124 ? -17.322 38.490  58.194  1.00 181.47 ? 103 GLN A NE2   1 
ATOM   711   N  N     . PRO A 1 125 ? -15.286 32.276  56.737  1.00 126.26 ? 104 PRO A N     1 
ATOM   712   C  CA    . PRO A 1 125 ? -14.222 31.407  57.224  1.00 123.13 ? 104 PRO A CA    1 
ATOM   713   C  C     . PRO A 1 125 ? -12.984 31.676  56.402  1.00 128.01 ? 104 PRO A C     1 
ATOM   714   O  O     . PRO A 1 125 ? -13.045 32.426  55.422  1.00 125.04 ? 104 PRO A O     1 
ATOM   715   C  CB    . PRO A 1 125 ? -14.779 30.019  56.964  1.00 122.53 ? 104 PRO A CB    1 
ATOM   716   C  CG    . PRO A 1 125 ? -15.493 30.228  55.661  1.00 121.77 ? 104 PRO A CG    1 
ATOM   717   C  CD    . PRO A 1 125 ? -16.128 31.589  55.748  1.00 125.46 ? 104 PRO A CD    1 
ATOM   718   N  N     . THR A 1 126 ? -11.897 30.993  56.712  1.00 119.05 ? 105 THR A N     1 
ATOM   719   C  CA    . THR A 1 126 ? -10.641 31.183  56.005  1.00 116.90 ? 105 THR A CA    1 
ATOM   720   C  C     . THR A 1 126 ? -10.486 30.117  54.933  1.00 115.10 ? 105 THR A C     1 
ATOM   721   O  O     . THR A 1 126 ? -10.581 28.924  55.224  1.00 145.06 ? 105 THR A O     1 
ATOM   722   C  CB    . THR A 1 126 ? -9.457  31.132  56.970  1.00 118.11 ? 105 THR A CB    1 
ATOM   723   O  OG1   . THR A 1 126 ? -9.635  32.111  57.994  1.00 138.27 ? 105 THR A OG1   1 
ATOM   724   C  CG2   . THR A 1 126 ? -8.188  31.433  56.241  1.00 116.35 ? 105 THR A CG2   1 
ATOM   725   N  N     . LEU A 1 127 ? -10.241 30.545  53.702  1.00 111.22 ? 106 LEU A N     1 
ATOM   726   C  CA    . LEU A 1 127 ? -10.120 29.643  52.571  1.00 108.03 ? 106 LEU A CA    1 
ATOM   727   C  C     . LEU A 1 127 ? -8.722  29.775  52.001  1.00 106.47 ? 106 LEU A C     1 
ATOM   728   O  O     . LEU A 1 127 ? -8.317  30.869  51.614  1.00 106.97 ? 106 LEU A O     1 
ATOM   729   C  CB    . LEU A 1 127 ? -11.154 29.974  51.502  1.00 107.56 ? 106 LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 127 ? -12.581 29.849  51.995  1.00 109.38 ? 106 LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 127 ? -13.567 30.692  51.215  1.00 110.35 ? 106 LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 127 ? -12.923 28.430  51.847  1.00 107.69 ? 106 LEU A CD2   1 
ATOM   733   N  N     . GLU A 1 128 ? -7.993  28.664  51.952  1.00 104.81 ? 107 GLU A N     1 
ATOM   734   C  CA    . GLU A 1 128 ? -6.738  28.575  51.217  1.00 103.22 ? 107 GLU A CA    1 
ATOM   735   C  C     . GLU A 1 128 ? -7.020  28.624  49.716  1.00 101.36 ? 107 GLU A C     1 
ATOM   736   O  O     . GLU A 1 128 ? -8.154  28.436  49.280  1.00 101.12 ? 107 GLU A O     1 
ATOM   737   C  CB    . GLU A 1 128 ? -5.981  27.295  51.588  1.00 121.48 ? 107 GLU A CB    1 
ATOM   738   C  CG    . GLU A 1 128 ? -4.514  27.340  51.182  1.00 163.14 ? 107 GLU A CG    1 
ATOM   739   C  CD    . GLU A 1 128 ? -3.801  26.040  51.416  1.00 182.12 ? 107 GLU A CD    1 
ATOM   740   O  OE1   . GLU A 1 128 ? -4.262  25.283  52.301  1.00 181.70 ? 107 GLU A OE1   1 
ATOM   741   O  OE2   . GLU A 1 128 ? -2.791  25.785  50.713  1.00 182.00 ? 107 GLU A OE2   1 
ATOM   742   N  N     . LEU A 1 129 ? -5.988  28.927  48.917  1.00 100.36 ? 108 LEU A N     1 
ATOM   743   C  CA    . LEU A 1 129 ? -6.219  29.082  47.482  1.00 98.95  ? 108 LEU A CA    1 
ATOM   744   C  C     . LEU A 1 129 ? -6.880  27.857  46.894  1.00 97.75  ? 108 LEU A C     1 
ATOM   745   O  O     . LEU A 1 129 ? -7.856  27.958  46.139  1.00 97.58  ? 108 LEU A O     1 
ATOM   746   C  CB    . LEU A 1 129 ? -4.909  29.346  46.738  1.00 98.09  ? 108 LEU A CB    1 
ATOM   747   C  CG    . LEU A 1 129 ? -5.077  29.345  45.198  1.00 96.76  ? 108 LEU A CG    1 
ATOM   748   C  CD1   . LEU A 1 129 ? -6.061  30.407  44.703  1.00 97.31  ? 108 LEU A CD1   1 
ATOM   749   C  CD2   . LEU A 1 129 ? -3.749  29.420  44.423  1.00 96.01  ? 108 LEU A CD2   1 
ATOM   750   N  N     . ALA A 1 130 ? -6.398  26.688  47.278  1.00 97.25  ? 109 ALA A N     1 
ATOM   751   C  CA    . ALA A 1 130 ? -6.902  25.475  46.664  1.00 96.31  ? 109 ALA A CA    1 
ATOM   752   C  C     . ALA A 1 130 ? -8.380  25.279  46.957  1.00 96.92  ? 109 ALA A C     1 
ATOM   753   O  O     . ALA A 1 130 ? -9.144  24.850  46.087  1.00 96.52  ? 109 ALA A O     1 
ATOM   754   C  CB    . ALA A 1 130 ? -6.066  24.296  47.158  1.00 96.04  ? 109 ALA A CB    1 
ATOM   755   N  N     . GLN A 1 131 ? -8.808  25.659  48.155  1.00 98.23  ? 110 GLN A N     1 
ATOM   756   C  CA    . GLN A 1 131 ? -10.192 25.457  48.556  1.00 99.15  ? 110 GLN A CA    1 
ATOM   757   C  C     . GLN A 1 131 ? -11.123 26.381  47.791  1.00 99.76  ? 110 GLN A C     1 
ATOM   758   O  O     . GLN A 1 131 ? -12.233 25.981  47.423  1.00 100.06 ? 110 GLN A O     1 
ATOM   759   C  CB    . GLN A 1 131 ? -10.318 25.680  50.056  1.00 104.31 ? 110 GLN A CB    1 
ATOM   760   C  CG    . GLN A 1 131 ? -9.707  24.573  50.885  1.00 126.70 ? 110 GLN A CG    1 
ATOM   761   C  CD    . GLN A 1 131 ? -9.718  24.884  52.362  1.00 138.67 ? 110 GLN A CD    1 
ATOM   762   O  OE1   . GLN A 1 131 ? -9.783  26.048  52.764  1.00 105.87 ? 110 GLN A OE1   1 
ATOM   763   N  NE2   . GLN A 1 131 ? -9.717  23.834  53.185  1.00 173.93 ? 110 GLN A NE2   1 
ATOM   764   N  N     . LEU A 1 132 ? -10.691 27.627  47.556  1.00 100.18 ? 111 LEU A N     1 
ATOM   765   C  CA    . LEU A 1 132 ? -11.487 28.544  46.755  1.00 100.87 ? 111 LEU A CA    1 
ATOM   766   C  C     . LEU A 1 132 ? -11.707 27.952  45.378  1.00 99.59  ? 111 LEU A C     1 
ATOM   767   O  O     . LEU A 1 132 ? -12.788 28.102  44.800  1.00 112.83 ? 111 LEU A O     1 
ATOM   768   C  CB    . LEU A 1 132 ? -10.804 29.920  46.692  1.00 101.45 ? 111 LEU A CB    1 
ATOM   769   C  CG    . LEU A 1 132 ? -11.427 31.235  46.186  1.00 102.80 ? 111 LEU A CG    1 
ATOM   770   C  CD1   . LEU A 1 132 ? -12.479 31.728  47.094  1.00 105.30 ? 111 LEU A CD1   1 
ATOM   771   C  CD2   . LEU A 1 132 ? -10.383 32.310  46.065  1.00 102.85 ? 111 LEU A CD2   1 
ATOM   772   N  N     . PHE A 1 133 ? -10.740 27.191  44.876  1.00 98.02  ? 112 PHE A N     1 
ATOM   773   C  CA    . PHE A 1 133 ? -10.943 26.599  43.567  1.00 97.28  ? 112 PHE A CA    1 
ATOM   774   C  C     . PHE A 1 133 ? -12.052 25.558  43.571  1.00 102.16 ? 112 PHE A C     1 
ATOM   775   O  O     . PHE A 1 133 ? -12.608 25.247  42.513  1.00 114.70 ? 112 PHE A O     1 
ATOM   776   C  CB    . PHE A 1 133 ? -9.631  25.994  43.082  1.00 95.98  ? 112 PHE A CB    1 
ATOM   777   C  CG    . PHE A 1 133 ? -8.846  26.883  42.160  1.00 95.56  ? 112 PHE A CG    1 
ATOM   778   C  CD1   . PHE A 1 133 ? -8.579  28.200  42.488  1.00 103.15 ? 112 PHE A CD1   1 
ATOM   779   C  CD2   . PHE A 1 133 ? -8.303  26.376  41.010  1.00 94.95  ? 112 PHE A CD2   1 
ATOM   780   C  CE1   . PHE A 1 133 ? -7.852  29.019  41.636  1.00 95.64  ? 112 PHE A CE1   1 
ATOM   781   C  CE2   . PHE A 1 133 ? -7.568  27.176  40.196  1.00 94.67  ? 112 PHE A CE2   1 
ATOM   782   C  CZ    . PHE A 1 133 ? -7.351  28.502  40.504  1.00 94.91  ? 112 PHE A CZ    1 
ATOM   783   N  N     . GLY A 1 134 ? -12.419 25.048  44.731  1.00 98.57  ? 113 GLY A N     1 
ATOM   784   C  CA    . GLY A 1 134 ? -13.532 24.129  44.784  1.00 115.41 ? 113 GLY A CA    1 
ATOM   785   C  C     . GLY A 1 134 ? -14.852 24.852  44.765  1.00 108.94 ? 113 GLY A C     1 
ATOM   786   O  O     . GLY A 1 134 ? -15.796 24.436  44.083  1.00 118.60 ? 113 GLY A O     1 
ATOM   787   N  N     . LEU A 1 135 ? -14.911 25.940  45.539  1.00 101.55 ? 114 LEU A N     1 
ATOM   788   C  CA    . LEU A 1 135 ? -16.173 26.629  45.784  1.00 103.72 ? 114 LEU A CA    1 
ATOM   789   C  C     . LEU A 1 135 ? -16.639 27.401  44.563  1.00 104.35 ? 114 LEU A C     1 
ATOM   790   O  O     . LEU A 1 135 ? -17.844 27.483  44.300  1.00 106.08 ? 114 LEU A O     1 
ATOM   791   C  CB    . LEU A 1 135 ? -16.034 27.556  46.982  1.00 105.08 ? 114 LEU A CB    1 
ATOM   792   C  CG    . LEU A 1 135 ? -15.988 26.845  48.313  1.00 105.40 ? 114 LEU A CG    1 
ATOM   793   C  CD1   . LEU A 1 135 ? -15.244 27.686  49.287  1.00 106.24 ? 114 LEU A CD1   1 
ATOM   794   C  CD2   . LEU A 1 135 ? -17.426 26.651  48.767  1.00 114.73 ? 114 LEU A CD2   1 
ATOM   795   N  N     . LEU A 1 136 ? -15.701 27.964  43.806  1.00 103.18 ? 115 LEU A N     1 
ATOM   796   C  CA    . LEU A 1 136 ? -15.995 28.907  42.738  1.00 103.90 ? 115 LEU A CA    1 
ATOM   797   C  C     . LEU A 1 136 ? -15.920 28.149  41.427  1.00 102.97 ? 115 LEU A C     1 
ATOM   798   O  O     . LEU A 1 136 ? -15.185 27.168  41.324  1.00 101.43 ? 115 LEU A O     1 
ATOM   799   C  CB    . LEU A 1 136 ? -14.974 30.052  42.741  1.00 103.40 ? 115 LEU A CB    1 
ATOM   800   C  CG    . LEU A 1 136 ? -14.761 30.827  44.050  1.00 104.49 ? 115 LEU A CG    1 
ATOM   801   C  CD1   . LEU A 1 136 ? -13.895 32.050  43.857  1.00 104.45 ? 115 LEU A CD1   1 
ATOM   802   C  CD2   . LEU A 1 136 ? -16.080 31.186  44.762  1.00 107.17 ? 115 LEU A CD2   1 
ATOM   803   N  N     . LYS A 1 137 ? -16.697 28.583  40.440  1.00 104.27 ? 116 LYS A N     1 
ATOM   804   C  CA    . LYS A 1 137 ? -16.571 28.060  39.084  1.00 103.87 ? 116 LYS A CA    1 
ATOM   805   C  C     . LYS A 1 137 ? -15.270 28.538  38.441  1.00 102.32 ? 116 LYS A C     1 
ATOM   806   O  O     . LYS A 1 137 ? -14.644 29.505  38.882  1.00 123.93 ? 116 LYS A O     1 
ATOM   807   C  CB    . LYS A 1 137 ? -17.712 28.532  38.192  1.00 106.05 ? 116 LYS A CB    1 
ATOM   808   C  CG    . LYS A 1 137 ? -19.104 27.995  38.440  1.00 108.10 ? 116 LYS A CG    1 
ATOM   809   C  CD    . LYS A 1 137 ? -20.103 28.772  37.563  1.00 110.60 ? 116 LYS A CD    1 
ATOM   810   C  CE    . LYS A 1 137 ? -21.393 28.002  37.309  1.00 122.08 ? 116 LYS A CE    1 
ATOM   811   N  NZ    . LYS A 1 137 ? -22.478 28.810  36.674  1.00 138.89 ? 116 LYS A NZ    1 
ATOM   812   N  N     . LYS A 1 138 ? -14.879 27.882  37.354  1.00 101.83 ? 117 LYS A N     1 
ATOM   813   C  CA    . LYS A 1 138 ? -13.753 28.404  36.575  1.00 100.80 ? 117 LYS A CA    1 
ATOM   814   C  C     . LYS A 1 138 ? -14.058 29.780  35.971  1.00 101.80 ? 117 LYS A C     1 
ATOM   815   O  O     . LYS A 1 138 ? -13.153 30.598  35.796  1.00 100.97 ? 117 LYS A O     1 
ATOM   816   C  CB    . LYS A 1 138 ? -13.400 27.403  35.468  1.00 107.39 ? 117 LYS A CB    1 
ATOM   817   C  CG    . LYS A 1 138 ? -12.176 27.693  34.585  1.00 99.89  ? 117 LYS A CG    1 
ATOM   818   C  CD    . LYS A 1 138 ? -11.679 26.362  33.949  1.00 106.21 ? 117 LYS A CD    1 
ATOM   819   C  CE    . LYS A 1 138 ? -10.831 26.527  32.699  1.00 117.04 ? 117 LYS A CE    1 
ATOM   820   N  NZ    . LYS A 1 138 ? -9.608  27.344  32.942  1.00 137.48 ? 117 LYS A NZ    1 
ATOM   821   N  N     . ASP A 1 139 ? -15.318 30.052  35.634  1.00 115.30 ? 118 ASP A N     1 
ATOM   822   C  CA    . ASP A 1 139 ? -15.693 31.384  35.169  1.00 119.79 ? 118 ASP A CA    1 
ATOM   823   C  C     . ASP A 1 139 ? -15.381 32.436  36.222  1.00 104.86 ? 118 ASP A C     1 
ATOM   824   O  O     . ASP A 1 139 ? -14.721 33.436  35.931  1.00 104.52 ? 118 ASP A O     1 
ATOM   825   C  CB    . ASP A 1 139 ? -17.178 31.418  34.802  1.00 161.35 ? 118 ASP A CB    1 
ATOM   826   C  CG    . ASP A 1 139 ? -17.436 31.052  33.352  1.00 188.49 ? 118 ASP A CG    1 
ATOM   827   O  OD1   . ASP A 1 139 ? -16.564 31.318  32.492  1.00 188.75 ? 118 ASP A OD1   1 
ATOM   828   O  OD2   . ASP A 1 139 ? -18.529 30.511  33.077  1.00 195.43 ? 118 ASP A OD2   1 
ATOM   829   N  N     . GLU A 1 140 ? -15.901 32.252  37.442  1.00 112.26 ? 119 GLU A N     1 
ATOM   830   C  CA    . GLU A 1 140 ? -15.652 33.207  38.523  1.00 112.70 ? 119 GLU A CA    1 
ATOM   831   C  C     . GLU A 1 140 ? -14.176 33.268  38.892  1.00 103.70 ? 119 GLU A C     1 
ATOM   832   O  O     . GLU A 1 140 ? -13.645 34.353  39.153  1.00 118.05 ? 119 GLU A O     1 
ATOM   833   C  CB    . GLU A 1 140 ? -16.509 32.885  39.757  1.00 114.93 ? 119 GLU A CB    1 
ATOM   834   C  CG    . GLU A 1 140 ? -18.012 32.714  39.484  1.00 131.38 ? 119 GLU A CG    1 
ATOM   835   C  CD    . GLU A 1 140 ? -18.836 32.405  40.746  1.00 131.05 ? 119 GLU A CD    1 
ATOM   836   O  OE1   . GLU A 1 140 ? -18.651 31.286  41.304  1.00 109.72 ? 119 GLU A OE1   1 
ATOM   837   O  OE2   . GLU A 1 140 ? -19.666 33.263  41.160  1.00 127.19 ? 119 GLU A OE2   1 
ATOM   838   N  N     . LEU A 1 141 ? -13.494 32.126  38.926  1.00 101.93 ? 120 LEU A N     1 
ATOM   839   C  CA    . LEU A 1 141 ? -12.076 32.171  39.254  1.00 100.29 ? 120 LEU A CA    1 
ATOM   840   C  C     . LEU A 1 141 ? -11.281 32.890  38.173  1.00 99.68  ? 120 LEU A C     1 
ATOM   841   O  O     . LEU A 1 141 ? -10.307 33.585  38.481  1.00 99.17  ? 120 LEU A O     1 
ATOM   842   C  CB    . LEU A 1 141 ? -11.513 30.773  39.465  1.00 98.87  ? 120 LEU A CB    1 
ATOM   843   C  CG    . LEU A 1 141 ? -11.725 30.085  40.793  1.00 98.96  ? 120 LEU A CG    1 
ATOM   844   C  CD1   . LEU A 1 141 ? -11.276 28.671  40.646  1.00 97.77  ? 120 LEU A CD1   1 
ATOM   845   C  CD2   . LEU A 1 141 ? -10.858 30.785  41.751  1.00 98.87  ? 120 LEU A CD2   1 
ATOM   846   N  N     . SER A 1 142 ? -11.648 32.700  36.900  1.00 99.92  ? 121 SER A N     1 
ATOM   847   C  CA    . SER A 1 142 ? -10.921 33.342  35.812  1.00 99.50  ? 121 SER A CA    1 
ATOM   848   C  C     . SER A 1 142 ? -10.840 34.844  36.012  1.00 100.31 ? 121 SER A C     1 
ATOM   849   O  O     . SER A 1 142 ? -9.755  35.426  35.917  1.00 104.42 ? 121 SER A O     1 
ATOM   850   C  CB    . SER A 1 142 ? -11.583 33.034  34.473  1.00 124.15 ? 121 SER A CB    1 
ATOM   851   O  OG    . SER A 1 142 ? -10.764 33.485  33.413  1.00 155.66 ? 121 SER A OG    1 
ATOM   852   N  N     . GLN A 1 143 ? -11.979 35.487  36.310  1.00 106.10 ? 122 GLN A N     1 
ATOM   853   C  CA    . GLN A 1 143 ? -11.985 36.932  36.549  1.00 105.70 ? 122 GLN A CA    1 
ATOM   854   C  C     . GLN A 1 143 ? -11.270 37.335  37.835  1.00 103.12 ? 122 GLN A C     1 
ATOM   855   O  O     . GLN A 1 143 ? -10.661 38.400  37.882  1.00 123.39 ? 122 GLN A O     1 
ATOM   856   C  CB    . GLN A 1 143 ? -13.428 37.490  36.615  1.00 108.22 ? 122 GLN A CB    1 
ATOM   857   C  CG    . GLN A 1 143 ? -14.215 37.549  35.324  1.00 114.86 ? 122 GLN A CG    1 
ATOM   858   C  CD    . GLN A 1 143 ? -13.520 38.419  34.282  1.00 151.75 ? 122 GLN A CD    1 
ATOM   859   O  OE1   . GLN A 1 143 ? -13.607 39.657  34.317  1.00 150.72 ? 122 GLN A OE1   1 
ATOM   860   N  NE2   . GLN A 1 143 ? -12.807 37.771  33.354  1.00 150.30 ? 122 GLN A NE2   1 
ATOM   861   N  N     . LEU A 1 144 ? -11.315 36.515  38.876  1.00 102.82 ? 123 LEU A N     1 
ATOM   862   C  CA    . LEU A 1 144 ? -10.803 36.960  40.169  1.00 103.97 ? 123 LEU A CA    1 
ATOM   863   C  C     . LEU A 1 144 ? -9.296  37.102  40.104  1.00 101.85 ? 123 LEU A C     1 
ATOM   864   O  O     . LEU A 1 144 ? -8.710  38.015  40.695  1.00 102.69 ? 123 LEU A O     1 
ATOM   865   C  CB    . LEU A 1 144 ? -11.293 35.998  41.268  1.00 114.19 ? 123 LEU A CB    1 
ATOM   866   C  CG    . LEU A 1 144 ? -11.138 36.202  42.786  1.00 104.87 ? 123 LEU A CG    1 
ATOM   867   C  CD1   . LEU A 1 144 ? -9.785  35.812  43.307  1.00 103.48 ? 123 LEU A CD1   1 
ATOM   868   C  CD2   . LEU A 1 144 ? -11.514 37.639  43.152  1.00 107.47 ? 123 LEU A CD2   1 
ATOM   869   N  N     . PHE A 1 145 ? -8.664  36.142  39.469  1.00 99.96  ? 124 PHE A N     1 
ATOM   870   C  CA    . PHE A 1 145 ? -7.248  36.138  39.166  1.00 98.62  ? 124 PHE A CA    1 
ATOM   871   C  C     . PHE A 1 145 ? -6.969  36.655  37.752  1.00 98.18  ? 124 PHE A C     1 
ATOM   872   O  O     . PHE A 1 145 ? -5.926  36.335  37.172  1.00 97.01  ? 124 PHE A O     1 
ATOM   873   C  CB    . PHE A 1 145 ? -6.655  34.737  39.432  1.00 97.27  ? 124 PHE A CB    1 
ATOM   874   C  CG    . PHE A 1 145 ? -6.781  34.286  40.883  1.00 97.79  ? 124 PHE A CG    1 
ATOM   875   C  CD1   . PHE A 1 145 ? -7.828  33.505  41.316  1.00 98.14  ? 124 PHE A CD1   1 
ATOM   876   C  CD2   . PHE A 1 145 ? -5.830  34.676  41.813  1.00 98.18  ? 124 PHE A CD2   1 
ATOM   877   C  CE1   . PHE A 1 145 ? -7.903  33.127  42.654  1.00 98.76  ? 124 PHE A CE1   1 
ATOM   878   C  CE2   . PHE A 1 145 ? -5.925  34.314  43.132  1.00 98.99  ? 124 PHE A CE2   1 
ATOM   879   C  CZ    . PHE A 1 145 ? -6.948  33.546  43.551  1.00 99.22  ? 124 PHE A CZ    1 
ATOM   880   N  N     . ARG A 1 146 ? -7.928  37.354  37.149  1.00 101.89 ? 125 ARG A N     1 
ATOM   881   C  CA    . ARG A 1 146 ? -7.811  37.824  35.770  1.00 105.58 ? 125 ARG A CA    1 
ATOM   882   C  C     . ARG A 1 146 ? -6.430  38.437  35.485  1.00 98.36  ? 125 ARG A C     1 
ATOM   883   O  O     . ARG A 1 146 ? -5.944  38.386  34.352  1.00 97.73  ? 125 ARG A O     1 
ATOM   884   C  CB    . ARG A 1 146 ? -8.972  38.799  35.445  1.00 101.03 ? 125 ARG A CB    1 
ATOM   885   C  CG    . ARG A 1 146 ? -8.710  40.257  35.653  1.00 102.13 ? 125 ARG A CG    1 
ATOM   886   C  CD    . ARG A 1 146 ? -9.433  40.834  36.845  1.00 104.09 ? 125 ARG A CD    1 
ATOM   887   N  NE    . ARG A 1 146 ? -10.718 41.422  36.532  1.00 106.23 ? 125 ARG A NE    1 
ATOM   888   C  CZ    . ARG A 1 146 ? -11.206 42.478  37.173  1.00 119.89 ? 125 ARG A CZ    1 
ATOM   889   N  NH1   . ARG A 1 146 ? -10.494 43.015  38.152  1.00 115.55 ? 125 ARG A NH1   1 
ATOM   890   N  NH2   . ARG A 1 146 ? -12.398 42.985  36.859  1.00 125.52 ? 125 ARG A NH2   1 
ATOM   891   N  N     . ASP A 1 147 ? -5.780  39.035  36.479  1.00 103.67 ? 126 ASP A N     1 
ATOM   892   C  CA    . ASP A 1 147 ? -4.448  39.565  36.226  1.00 108.01 ? 126 ASP A CA    1 
ATOM   893   C  C     . ASP A 1 147 ? -3.462  38.443  35.930  1.00 96.62  ? 126 ASP A C     1 
ATOM   894   O  O     . ASP A 1 147 ? -2.879  38.379  34.847  1.00 107.03 ? 126 ASP A O     1 
ATOM   895   C  CB    . ASP A 1 147 ? -3.971  40.394  37.430  1.00 133.85 ? 126 ASP A CB    1 
ATOM   896   C  CG    . ASP A 1 147 ? -4.289  41.889  37.298  1.00 142.40 ? 126 ASP A CG    1 
ATOM   897   O  OD1   . ASP A 1 147 ? -4.974  42.278  36.327  1.00 158.10 ? 126 ASP A OD1   1 
ATOM   898   O  OD2   . ASP A 1 147 ? -3.845  42.674  38.178  1.00 131.08 ? 126 ASP A OD2   1 
ATOM   899   N  N     . HIS A 1 148 ? -3.331  37.500  36.829  1.00 96.27  ? 127 HIS A N     1 
ATOM   900   C  CA    . HIS A 1 148 ? -2.182  36.621  36.736  1.00 105.83 ? 127 HIS A CA    1 
ATOM   901   C  C     . HIS A 1 148 ? -2.357  35.456  35.763  1.00 126.42 ? 127 HIS A C     1 
ATOM   902   O  O     . HIS A 1 148 ? -1.460  34.604  35.698  1.00 105.55 ? 127 HIS A O     1 
ATOM   903   C  CB    . HIS A 1 148 ? -1.797  36.187  38.137  1.00 95.58  ? 127 HIS A CB    1 
ATOM   904   C  CG    . HIS A 1 148 ? -1.385  37.345  38.989  1.00 96.73  ? 127 HIS A CG    1 
ATOM   905   N  ND1   . HIS A 1 148 ? -2.247  38.377  39.291  1.00 104.18 ? 127 HIS A ND1   1 
ATOM   906   C  CD2   . HIS A 1 148 ? -0.200  37.668  39.556  1.00 97.24  ? 127 HIS A CD2   1 
ATOM   907   C  CE1   . HIS A 1 148 ? -1.621  39.264  40.043  1.00 128.67 ? 127 HIS A CE1   1 
ATOM   908   N  NE2   . HIS A 1 148 ? -0.376  38.858  40.217  1.00 128.13 ? 127 HIS A NE2   1 
ATOM   909   N  N     . LEU A 1 149 ? -3.509  35.317  35.083  1.00 121.96 ? 128 LEU A N     1 
ATOM   910   C  CA    . LEU A 1 149 ? -3.577  34.414  33.926  1.00 121.54 ? 128 LEU A CA    1 
ATOM   911   C  C     . LEU A 1 149 ? -3.487  35.263  32.679  1.00 187.91 ? 128 LEU A C     1 
ATOM   912   O  O     . LEU A 1 149 ? -4.500  35.776  32.193  1.00 225.41 ? 128 LEU A O     1 
ATOM   913   C  CB    . LEU A 1 149 ? -4.870  33.622  33.873  1.00 95.08  ? 128 LEU A CB    1 
ATOM   914   C  CG    . LEU A 1 149 ? -4.870  32.723  35.063  1.00 139.91 ? 128 LEU A CG    1 
ATOM   915   C  CD1   . LEU A 1 149 ? -3.419  32.374  35.470  1.00 153.50 ? 128 LEU A CD1   1 
ATOM   916   C  CD2   . LEU A 1 149 ? -5.603  33.466  36.145  1.00 168.54 ? 128 LEU A CD2   1 
ATOM   917   N  N     . GLY A 1 150 ? -2.305  35.347  32.101  1.00 186.55 ? 129 GLY A N     1 
ATOM   918   C  CA    . GLY A 1 150 ? -2.251  35.892  30.768  1.00 188.53 ? 129 GLY A CA    1 
ATOM   919   C  C     . GLY A 1 150 ? -1.846  34.873  29.735  1.00 181.29 ? 129 GLY A C     1 
ATOM   920   O  O     . GLY A 1 150 ? -2.216  35.002  28.562  1.00 188.52 ? 129 GLY A O     1 
ATOM   921   N  N     . ARG A 1 151 ? -1.191  33.797  30.182  1.00 189.40 ? 130 ARG A N     1 
ATOM   922   C  CA    . ARG A 1 151 ? -0.280  33.091  29.283  1.00 169.90 ? 130 ARG A CA    1 
ATOM   923   C  C     . ARG A 1 151 ? -1.062  32.344  28.216  1.00 160.43 ? 130 ARG A C     1 
ATOM   924   O  O     . ARG A 1 151 ? -1.094  32.742  27.045  1.00 117.82 ? 130 ARG A O     1 
ATOM   925   C  CB    . ARG A 1 151 ? 0.634   32.140  30.074  1.00 149.17 ? 130 ARG A CB    1 
ATOM   926   N  N     . ALA A 1 152 ? -1.763  31.313  28.628  1.00 161.62 ? 131 ALA A N     1 
ATOM   927   C  CA    . ALA A 1 152 ? -2.674  30.617  27.758  1.00 138.90 ? 131 ALA A CA    1 
ATOM   928   C  C     . ALA A 1 152 ? -3.968  30.540  28.529  1.00 173.63 ? 131 ALA A C     1 
ATOM   929   O  O     . ALA A 1 152 ? -4.005  30.815  29.732  1.00 186.98 ? 131 ALA A O     1 
ATOM   930   C  CB    . ALA A 1 152 ? -2.179  29.204  27.428  1.00 99.87  ? 131 ALA A CB    1 
ATOM   931   N  N     . ASN A 1 153 ? -5.052  30.285  27.826  1.00 170.26 ? 132 ASN A N     1 
ATOM   932   C  CA    . ASN A 1 153 ? -6.200  29.801  28.550  1.00 164.34 ? 132 ASN A CA    1 
ATOM   933   C  C     . ASN A 1 153 ? -5.902  28.324  28.758  1.00 143.21 ? 132 ASN A C     1 
ATOM   934   O  O     . ASN A 1 153 ? -5.504  27.629  27.816  1.00 140.06 ? 132 ASN A O     1 
ATOM   935   C  CB    . ASN A 1 153 ? -7.495  30.090  27.789  1.00 172.15 ? 132 ASN A CB    1 
ATOM   936   C  CG    . ASN A 1 153 ? -7.589  29.339  26.502  1.00 194.32 ? 132 ASN A CG    1 
ATOM   937   O  OD1   . ASN A 1 153 ? -8.225  28.294  26.425  1.00 203.01 ? 132 ASN A OD1   1 
ATOM   938   N  ND2   . ASN A 1 153 ? -6.945  29.871  25.465  1.00 207.85 ? 132 ASN A ND2   1 
ATOM   939   N  N     . LEU A 1 154 ? -6.051  27.856  29.994  1.00 131.71 ? 133 LEU A N     1 
ATOM   940   C  CA    . LEU A 1 154 ? -5.568  26.533  30.372  1.00 118.01 ? 133 LEU A CA    1 
ATOM   941   C  C     . LEU A 1 154 ? -6.488  26.007  31.449  1.00 127.91 ? 133 LEU A C     1 
ATOM   942   O  O     . LEU A 1 154 ? -7.433  26.680  31.871  1.00 143.83 ? 133 LEU A O     1 
ATOM   943   C  CB    . LEU A 1 154 ? -4.122  26.534  30.886  1.00 108.03 ? 133 LEU A CB    1 
ATOM   944   C  CG    . LEU A 1 154 ? -3.796  27.413  32.095  1.00 103.91 ? 133 LEU A CG    1 
ATOM   945   C  CD1   . LEU A 1 154 ? -2.784  26.827  33.073  1.00 95.85  ? 133 LEU A CD1   1 
ATOM   946   C  CD2   . LEU A 1 154 ? -3.221  28.640  31.511  1.00 141.56 ? 133 LEU A CD2   1 
ATOM   947   N  N     . ARG A 1 155 ? -6.186  24.802  31.910  1.00 107.93 ? 134 ARG A N     1 
ATOM   948   C  CA    . ARG A 1 155 ? -7.184  24.069  32.656  1.00 106.33 ? 134 ARG A CA    1 
ATOM   949   C  C     . ARG A 1 155 ? -7.287  24.532  34.113  1.00 108.08 ? 134 ARG A C     1 
ATOM   950   O  O     . ARG A 1 155 ? -6.441  25.257  34.634  1.00 127.03 ? 134 ARG A O     1 
ATOM   951   C  CB    . ARG A 1 155 ? -6.844  22.604  32.538  1.00 118.43 ? 134 ARG A CB    1 
ATOM   952   C  CG    . ARG A 1 155 ? -7.223  22.052  31.190  1.00 132.52 ? 134 ARG A CG    1 
ATOM   953   C  CD    . ARG A 1 155 ? -7.257  20.571  31.299  1.00 152.54 ? 134 ARG A CD    1 
ATOM   954   N  NE    . ARG A 1 155 ? -5.954  20.026  30.963  1.00 157.19 ? 134 ARG A NE    1 
ATOM   955   C  CZ    . ARG A 1 155 ? -5.578  18.792  31.252  1.00 173.51 ? 134 ARG A CZ    1 
ATOM   956   N  NH1   . ARG A 1 155 ? -6.414  17.989  31.903  1.00 174.60 ? 134 ARG A NH1   1 
ATOM   957   N  NH2   . ARG A 1 155 ? -4.369  18.371  30.898  1.00 187.31 ? 134 ARG A NH2   1 
ATOM   958   N  N     . LYS A 1 156 ? -8.294  24.019  34.810  1.00 97.37  ? 135 LYS A N     1 
ATOM   959   C  CA    . LYS A 1 156 ? -8.531  24.488  36.168  1.00 96.41  ? 135 LYS A CA    1 
ATOM   960   C  C     . LYS A 1 156 ? -7.545  23.874  37.126  1.00 95.58  ? 135 LYS A C     1 
ATOM   961   O  O     . LYS A 1 156 ? -7.007  24.563  37.994  1.00 109.02 ? 135 LYS A O     1 
ATOM   962   C  CB    . LYS A 1 156 ? -9.935  24.145  36.631  1.00 97.08  ? 135 LYS A CB    1 
ATOM   963   C  CG    . LYS A 1 156 ? -10.344 24.883  37.834  1.00 96.66  ? 135 LYS A CG    1 
ATOM   964   C  CD    . LYS A 1 156 ? -11.730 24.508  38.178  1.00 97.65  ? 135 LYS A CD    1 
ATOM   965   C  CE    . LYS A 1 156 ? -12.161 25.138  39.470  1.00 97.64  ? 135 LYS A CE    1 
ATOM   966   N  NZ    . LYS A 1 156 ? -13.580 24.828  39.744  1.00 98.93  ? 135 LYS A NZ    1 
ATOM   967   N  N     . ASP A 1 157 ? -7.298  22.577  36.972  1.00 124.98 ? 136 ASP A N     1 
ATOM   968   C  CA    . ASP A 1 157 ? -6.257  21.908  37.745  1.00 136.18 ? 136 ASP A CA    1 
ATOM   969   C  C     . ASP A 1 157 ? -4.887  22.530  37.495  1.00 101.97 ? 136 ASP A C     1 
ATOM   970   O  O     . ASP A 1 157 ? -3.996  22.446  38.355  1.00 101.65 ? 136 ASP A O     1 
ATOM   971   C  CB    . ASP A 1 157 ? -6.243  20.409  37.399  1.00 159.23 ? 136 ASP A CB    1 
ATOM   972   C  CG    . ASP A 1 157 ? -6.481  20.143  35.893  1.00 159.18 ? 136 ASP A CG    1 
ATOM   973   O  OD1   . ASP A 1 157 ? -7.086  21.010  35.227  1.00 185.23 ? 136 ASP A OD1   1 
ATOM   974   O  OD2   . ASP A 1 157 ? -6.011  19.107  35.359  1.00 132.91 ? 136 ASP A OD2   1 
ATOM   975   N  N     . ALA A 1 158 ? -4.704  23.126  36.308  1.00 95.64  ? 137 ALA A N     1 
ATOM   976   C  CA    . ALA A 1 158 ? -3.436  23.708  35.890  1.00 121.24 ? 137 ALA A CA    1 
ATOM   977   C  C     . ALA A 1 158 ? -3.238  25.093  36.468  1.00 100.96 ? 137 ALA A C     1 
ATOM   978   O  O     . ALA A 1 158 ? -2.127  25.440  36.901  1.00 96.37  ? 137 ALA A O     1 
ATOM   979   C  CB    . ALA A 1 158 ? -3.378  23.754  34.364  1.00 150.81 ? 137 ALA A CB    1 
ATOM   980   N  N     . LEU A 1 159 ? -4.328  25.864  36.508  1.00 94.42  ? 138 LEU A N     1 
ATOM   981   C  CA    . LEU A 1 159 ? -4.302  27.194  37.094  1.00 93.94  ? 138 LEU A CA    1 
ATOM   982   C  C     . LEU A 1 159 ? -3.724  27.157  38.486  1.00 114.95 ? 138 LEU A C     1 
ATOM   983   O  O     . LEU A 1 159 ? -2.697  27.793  38.768  1.00 108.26 ? 138 LEU A O     1 
ATOM   984   C  CB    . LEU A 1 159 ? -5.729  27.736  37.173  1.00 94.24  ? 138 LEU A CB    1 
ATOM   985   C  CG    . LEU A 1 159 ? -5.995  29.105  36.620  1.00 94.46  ? 138 LEU A CG    1 
ATOM   986   C  CD1   . LEU A 1 159 ? -4.673  29.573  36.363  1.00 94.06  ? 138 LEU A CD1   1 
ATOM   987   C  CD2   . LEU A 1 159 ? -6.787  29.000  35.316  1.00 95.22  ? 138 LEU A CD2   1 
ATOM   988   N  N     . LEU A 1 160 ? -4.284  26.281  39.317  1.00 93.68  ? 139 LEU A N     1 
ATOM   989   C  CA    . LEU A 1 160 ? -3.837  26.187  40.687  1.00 93.67  ? 139 LEU A CA    1 
ATOM   990   C  C     . LEU A 1 160 ? -2.356  25.870  40.714  1.00 93.76  ? 139 LEU A C     1 
ATOM   991   O  O     . LEU A 1 160 ? -1.587  26.510  41.442  1.00 102.54 ? 139 LEU A O     1 
ATOM   992   C  CB    . LEU A 1 160 ? -4.655  25.132  41.422  1.00 93.79  ? 139 LEU A CB    1 
ATOM   993   C  CG    . LEU A 1 160 ? -4.677  25.380  42.911  1.00 94.09  ? 139 LEU A CG    1 
ATOM   994   C  CD1   . LEU A 1 160 ? -5.514  26.565  43.097  1.00 94.47  ? 139 LEU A CD1   1 
ATOM   995   C  CD2   . LEU A 1 160 ? -5.327  24.292  43.553  1.00 94.23  ? 139 LEU A CD2   1 
ATOM   996   N  N     . GLU A 1 161 ? -1.914  24.974  39.836  1.00 96.68  ? 140 GLU A N     1 
ATOM   997   C  CA    . GLU A 1 161 ? -0.507  24.618  39.855  1.00 110.23 ? 140 GLU A CA    1 
ATOM   998   C  C     . GLU A 1 161 ? 0.341   25.857  39.612  1.00 121.41 ? 140 GLU A C     1 
ATOM   999   O  O     . GLU A 1 161 ? 1.274   26.135  40.378  1.00 129.77 ? 140 GLU A O     1 
ATOM   1000  C  CB    . GLU A 1 161 ? -0.225  23.498  38.855  1.00 132.34 ? 140 GLU A CB    1 
ATOM   1001  C  CG    . GLU A 1 161 ? 0.765   22.465  39.405  1.00 150.30 ? 140 GLU A CG    1 
ATOM   1002  C  CD    . GLU A 1 161 ? 0.623   21.110  38.735  1.00 172.02 ? 140 GLU A CD    1 
ATOM   1003  O  OE1   . GLU A 1 161 ? -0.532  20.648  38.586  1.00 172.42 ? 140 GLU A OE1   1 
ATOM   1004  O  OE2   . GLU A 1 161 ? 1.657   20.507  38.362  1.00 186.94 ? 140 GLU A OE2   1 
ATOM   1005  N  N     . ARG A 1 162 ? 0.015   26.638  38.566  1.00 127.13 ? 141 ARG A N     1 
ATOM   1006  C  CA    . ARG A 1 162 ? 0.779   27.862  38.351  1.00 125.06 ? 141 ARG A CA    1 
ATOM   1007  C  C     . ARG A 1 162 ? 0.351   29.000  39.282  1.00 107.05 ? 141 ARG A C     1 
ATOM   1008  O  O     . ARG A 1 162 ? 1.150   29.915  39.506  1.00 109.50 ? 141 ARG A O     1 
ATOM   1009  C  CB    . ARG A 1 162 ? 0.766   28.315  36.870  1.00 113.33 ? 141 ARG A CB    1 
ATOM   1010  C  CG    . ARG A 1 162 ? -0.116  29.502  36.560  1.00 95.55  ? 141 ARG A CG    1 
ATOM   1011  C  CD    . ARG A 1 162 ? 0.529   30.472  35.563  1.00 107.27 ? 141 ARG A CD    1 
ATOM   1012  N  NE    . ARG A 1 162 ? -0.425  31.043  34.605  1.00 137.20 ? 141 ARG A NE    1 
ATOM   1013  C  CZ    . ARG A 1 162 ? -0.289  32.240  34.030  1.00 122.97 ? 141 ARG A CZ    1 
ATOM   1014  N  NH1   . ARG A 1 162 ? 0.753   32.992  34.374  1.00 95.97  ? 141 ARG A NH1   1 
ATOM   1015  N  NH2   . ARG A 1 162 ? -1.189  32.684  33.131  1.00 105.79 ? 141 ARG A NH2   1 
ATOM   1016  N  N     . LEU A 1 163 ? -0.850  28.952  39.871  1.00 93.85  ? 142 LEU A N     1 
ATOM   1017  C  CA    . LEU A 1 163 ? -1.308  30.052  40.721  1.00 94.21  ? 142 LEU A CA    1 
ATOM   1018  C  C     . LEU A 1 163 ? -0.988  29.883  42.209  1.00 94.90  ? 142 LEU A C     1 
ATOM   1019  O  O     . LEU A 1 163 ? -1.091  30.852  42.956  1.00 95.70  ? 142 LEU A O     1 
ATOM   1020  C  CB    . LEU A 1 163 ? -2.810  30.213  40.558  1.00 94.15  ? 142 LEU A CB    1 
ATOM   1021  C  CG    . LEU A 1 163 ? -3.343  31.296  39.648  1.00 94.24  ? 142 LEU A CG    1 
ATOM   1022  C  CD1   . LEU A 1 163 ? -4.729  30.971  39.335  1.00 94.38  ? 142 LEU A CD1   1 
ATOM   1023  C  CD2   . LEU A 1 163 ? -3.348  32.560  40.393  1.00 95.05  ? 142 LEU A CD2   1 
ATOM   1024  N  N     . GLN A 1 164 ? -0.613  28.689  42.678  1.00 94.92  ? 143 GLN A N     1 
ATOM   1025  C  CA    . GLN A 1 164 ? -0.344  28.544  44.114  1.00 95.83  ? 143 GLN A CA    1 
ATOM   1026  C  C     . GLN A 1 164 ? 0.909   29.282  44.531  1.00 96.84  ? 143 GLN A C     1 
ATOM   1027  O  O     . GLN A 1 164 ? 0.865   29.985  45.560  1.00 98.01  ? 143 GLN A O     1 
ATOM   1028  C  CB    . GLN A 1 164 ? -0.280  27.061  44.517  1.00 102.13 ? 143 GLN A CB    1 
ATOM   1029  C  CG    . GLN A 1 164 ? -0.138  26.856  46.064  1.00 96.88  ? 143 GLN A CG    1 
ATOM   1030  C  CD    . GLN A 1 164 ? -1.488  26.746  46.775  1.00 128.50 ? 143 GLN A CD    1 
ATOM   1031  O  OE1   . GLN A 1 164 ? -2.487  27.249  46.283  1.00 149.00 ? 143 GLN A OE1   1 
ATOM   1032  N  NE2   . GLN A 1 164 ? -1.507  26.150  47.956  1.00 137.93 ? 143 GLN A NE2   1 
ATOM   1033  N  N     . PRO A 1 165 ? 2.038   29.208  43.819  1.00 96.82  ? 144 PRO A N     1 
ATOM   1034  C  CA    . PRO A 1 165 ? 3.233   29.949  44.249  1.00 116.35 ? 144 PRO A CA    1 
ATOM   1035  C  C     . PRO A 1 165 ? 3.010   31.431  44.449  1.00 123.83 ? 144 PRO A C     1 
ATOM   1036  O  O     . PRO A 1 165 ? 3.719   32.054  45.257  1.00 115.63 ? 144 PRO A O     1 
ATOM   1037  C  CB    . PRO A 1 165 ? 4.232   29.689  43.111  1.00 156.39 ? 144 PRO A CB    1 
ATOM   1038  C  CG    . PRO A 1 165 ? 3.432   29.104  41.981  1.00 145.83 ? 144 PRO A CG    1 
ATOM   1039  C  CD    . PRO A 1 165 ? 2.338   28.350  42.657  1.00 109.93 ? 144 PRO A CD    1 
ATOM   1040  N  N     . LEU A 1 166 ? 2.048   32.016  43.731  1.00 123.18 ? 145 LEU A N     1 
ATOM   1041  C  CA    . LEU A 1 166 ? 1.723   33.428  43.916  1.00 102.88 ? 145 LEU A CA    1 
ATOM   1042  C  C     . LEU A 1 166 ? 0.818   33.645  45.123  1.00 107.46 ? 145 LEU A C     1 
ATOM   1043  O  O     . LEU A 1 166 ? 0.961   34.636  45.848  1.00 101.43 ? 145 LEU A O     1 
ATOM   1044  C  CB    . LEU A 1 166 ? 1.078   34.002  42.665  1.00 97.52  ? 145 LEU A CB    1 
ATOM   1045  C  CG    . LEU A 1 166 ? 2.046   34.716  41.732  1.00 138.09 ? 145 LEU A CG    1 
ATOM   1046  C  CD1   . LEU A 1 166 ? 3.270   33.845  41.443  1.00 154.78 ? 145 LEU A CD1   1 
ATOM   1047  C  CD2   . LEU A 1 166 ? 1.295   35.040  40.462  1.00 115.70 ? 145 LEU A CD2   1 
ATOM   1048  N  N     . PHE A 1 167 ? -0.117  32.734  45.374  1.00 120.92 ? 146 PHE A N     1 
ATOM   1049  C  CA    . PHE A 1 167 ? -1.071  32.896  46.464  1.00 100.36 ? 146 PHE A CA    1 
ATOM   1050  C  C     . PHE A 1 167 ? -0.961  31.777  47.481  1.00 119.92 ? 146 PHE A C     1 
ATOM   1051  O  O     . PHE A 1 167 ? -1.906  30.994  47.660  1.00 120.26 ? 146 PHE A O     1 
ATOM   1052  C  CB    . PHE A 1 167 ? -2.466  32.981  45.877  1.00 99.68  ? 146 PHE A CB    1 
ATOM   1053  C  CG    . PHE A 1 167 ? -2.582  34.104  44.957  1.00 99.61  ? 146 PHE A CG    1 
ATOM   1054  C  CD1   . PHE A 1 167 ? -2.874  35.349  45.428  1.00 101.37 ? 146 PHE A CD1   1 
ATOM   1055  C  CD2   . PHE A 1 167 ? -2.272  33.944  43.633  1.00 98.08  ? 146 PHE A CD2   1 
ATOM   1056  C  CE1   . PHE A 1 167 ? -2.928  36.402  44.580  1.00 101.83 ? 146 PHE A CE1   1 
ATOM   1057  C  CE2   . PHE A 1 167 ? -2.332  34.976  42.785  1.00 98.09  ? 146 PHE A CE2   1 
ATOM   1058  C  CZ    . PHE A 1 167 ? -2.656  36.217  43.256  1.00 111.06 ? 146 PHE A CZ    1 
ATOM   1059  N  N     . PRO A 1 168 ? 0.149   31.723  48.226  1.00 123.46 ? 147 PRO A N     1 
ATOM   1060  C  CA    . PRO A 1 168 ? 0.253   30.677  49.250  1.00 115.42 ? 147 PRO A CA    1 
ATOM   1061  C  C     . PRO A 1 168 ? -0.736  30.868  50.378  1.00 105.31 ? 147 PRO A C     1 
ATOM   1062  O  O     . PRO A 1 168 ? -1.498  29.941  50.682  1.00 124.43 ? 147 PRO A O     1 
ATOM   1063  C  CB    . PRO A 1 168 ? 1.713   30.800  49.735  1.00 108.77 ? 147 PRO A CB    1 
ATOM   1064  C  CG    . PRO A 1 168 ? 2.324   31.979  48.982  1.00 112.06 ? 147 PRO A CG    1 
ATOM   1065  C  CD    . PRO A 1 168 ? 1.216   32.735  48.349  1.00 126.60 ? 147 PRO A CD    1 
ATOM   1066  N  N     . GLU A 1 169 ? -0.881  32.098  50.846  1.00 106.02 ? 148 GLU A N     1 
ATOM   1067  C  CA    . GLU A 1 169 ? -1.653  32.396  52.038  1.00 108.29 ? 148 GLU A CA    1 
ATOM   1068  C  C     . GLU A 1 169 ? -3.113  32.018  51.846  1.00 107.40 ? 148 GLU A C     1 
ATOM   1069  O  O     . GLU A 1 169 ? -3.587  31.858  50.719  1.00 117.36 ? 148 GLU A O     1 
ATOM   1070  C  CB    . GLU A 1 169 ? -1.542  33.886  52.327  1.00 122.56 ? 148 GLU A CB    1 
ATOM   1071  C  CG    . GLU A 1 169 ? -2.185  34.674  51.205  1.00 145.75 ? 148 GLU A CG    1 
ATOM   1072  C  CD    . GLU A 1 169 ? -1.190  35.020  50.105  1.00 165.31 ? 148 GLU A CD    1 
ATOM   1073  O  OE1   . GLU A 1 169 ? 0.033   34.819  50.308  1.00 168.09 ? 148 GLU A OE1   1 
ATOM   1074  O  OE2   . GLU A 1 169 ? -1.642  35.426  49.012  1.00 162.11 ? 148 GLU A OE2   1 
ATOM   1075  N  N     . ALA A 1 170 ? -3.793  31.766  52.965  1.00 109.13 ? 149 ALA A N     1 
ATOM   1076  C  CA    . ALA A 1 170 ? -5.239  31.611  53.023  1.00 109.22 ? 149 ALA A CA    1 
ATOM   1077  C  C     . ALA A 1 170 ? -5.841  32.925  53.506  1.00 112.07 ? 149 ALA A C     1 
ATOM   1078  O  O     . ALA A 1 170 ? -5.209  33.660  54.267  1.00 114.54 ? 149 ALA A O     1 
ATOM   1079  C  CB    . ALA A 1 170 ? -5.647  30.457  53.937  1.00 109.52 ? 149 ALA A CB    1 
ATOM   1080  N  N     . ARG A 1 171 ? -7.042  33.246  53.024  1.00 112.04 ? 150 ARG A N     1 
ATOM   1081  C  CA    . ARG A 1 171 ? -7.672  34.527  53.324  1.00 121.58 ? 150 ARG A CA    1 
ATOM   1082  C  C     . ARG A 1 171 ? -9.135  34.315  53.668  1.00 127.35 ? 150 ARG A C     1 
ATOM   1083  O  O     . ARG A 1 171 ? -9.722  33.291  53.313  1.00 141.86 ? 150 ARG A O     1 
ATOM   1084  C  CB    . ARG A 1 171 ? -7.588  35.489  52.141  1.00 131.77 ? 150 ARG A CB    1 
ATOM   1085  C  CG    . ARG A 1 171 ? -6.205  35.634  51.575  1.00 132.22 ? 150 ARG A CG    1 
ATOM   1086  C  CD    . ARG A 1 171 ? -6.276  36.226  50.193  1.00 127.28 ? 150 ARG A CD    1 
ATOM   1087  N  NE    . ARG A 1 171 ? -4.966  36.675  49.752  1.00 117.56 ? 150 ARG A NE    1 
ATOM   1088  C  CZ    . ARG A 1 171 ? -4.771  37.543  48.768  1.00 114.22 ? 150 ARG A CZ    1 
ATOM   1089  N  NH1   . ARG A 1 171 ? -5.803  38.075  48.114  1.00 117.30 ? 150 ARG A NH1   1 
ATOM   1090  N  NH2   . ARG A 1 171 ? -3.539  37.899  48.454  1.00 109.17 ? 150 ARG A NH2   1 
ATOM   1091  N  N     . ARG A 1 172 ? -9.734  35.298  54.347  1.00 127.27 ? 151 ARG A N     1 
ATOM   1092  C  CA    . ARG A 1 172 ? -11.182 35.246  54.471  1.00 122.33 ? 151 ARG A CA    1 
ATOM   1093  C  C     . ARG A 1 172 ? -11.770 35.313  53.070  1.00 126.76 ? 151 ARG A C     1 
ATOM   1094  O  O     . ARG A 1 172 ? -11.109 35.732  52.122  1.00 117.21 ? 151 ARG A O     1 
ATOM   1095  C  CB    . ARG A 1 172 ? -11.711 36.407  55.305  1.00 125.83 ? 151 ARG A CB    1 
ATOM   1096  C  CG    . ARG A 1 172 ? -11.218 36.447  56.722  1.00 135.98 ? 151 ARG A CG    1 
ATOM   1097  C  CD    . ARG A 1 172 ? -11.754 37.693  57.380  1.00 146.66 ? 151 ARG A CD    1 
ATOM   1098  N  NE    . ARG A 1 172 ? -11.782 37.603  58.833  1.00 180.09 ? 151 ARG A NE    1 
ATOM   1099  C  CZ    . ARG A 1 172 ? -12.270 38.561  59.618  1.00 215.78 ? 151 ARG A CZ    1 
ATOM   1100  N  NH1   . ARG A 1 172 ? -12.772 39.662  59.073  1.00 227.03 ? 151 ARG A NH1   1 
ATOM   1101  N  NH2   . ARG A 1 172 ? -12.271 38.424  60.940  1.00 224.63 ? 151 ARG A NH2   1 
ATOM   1102  N  N     . LEU A 1 173 ? -13.000 34.831  52.913  1.00 128.05 ? 152 LEU A N     1 
ATOM   1103  C  CA    . LEU A 1 173 ? -13.590 34.943  51.585  1.00 117.57 ? 152 LEU A CA    1 
ATOM   1104  C  C     . LEU A 1 173 ? -13.682 36.405  51.173  1.00 119.56 ? 152 LEU A C     1 
ATOM   1105  O  O     . LEU A 1 173 ? -13.573 36.735  49.984  1.00 117.92 ? 152 LEU A O     1 
ATOM   1106  C  CB    . LEU A 1 173 ? -14.959 34.275  51.537  1.00 120.24 ? 152 LEU A CB    1 
ATOM   1107  C  CG    . LEU A 1 173 ? -15.557 34.317  50.132  1.00 116.72 ? 152 LEU A CG    1 
ATOM   1108  C  CD1   . LEU A 1 173 ? -14.812 33.363  49.265  1.00 112.92 ? 152 LEU A CD1   1 
ATOM   1109  C  CD2   . LEU A 1 173 ? -17.018 33.960  50.171  1.00 125.84 ? 152 LEU A CD2   1 
ATOM   1110  N  N     . ALA A 1 174 ? -13.872 37.291  52.158  1.00 126.74 ? 153 ALA A N     1 
ATOM   1111  C  CA    . ALA A 1 174 ? -13.928 38.728  51.919  1.00 125.86 ? 153 ALA A CA    1 
ATOM   1112  C  C     . ALA A 1 174 ? -12.593 39.311  51.475  1.00 124.38 ? 153 ALA A C     1 
ATOM   1113  O  O     . ALA A 1 174 ? -12.577 40.312  50.761  1.00 140.78 ? 153 ALA A O     1 
ATOM   1114  C  CB    . ALA A 1 174 ? -14.420 39.433  53.181  1.00 156.62 ? 153 ALA A CB    1 
ATOM   1115  N  N     . GLU A 1 175 ? -11.477 38.716  51.878  1.00 126.79 ? 154 GLU A N     1 
ATOM   1116  C  CA    . GLU A 1 175 ? -10.134 39.225  51.591  1.00 130.78 ? 154 GLU A CA    1 
ATOM   1117  C  C     . GLU A 1 175 ? -9.572  38.769  50.246  1.00 117.56 ? 154 GLU A C     1 
ATOM   1118  O  O     . GLU A 1 175 ? -8.410  39.054  49.950  1.00 116.48 ? 154 GLU A O     1 
ATOM   1119  C  CB    . GLU A 1 175 ? -9.180  38.813  52.719  1.00 155.62 ? 154 GLU A CB    1 
ATOM   1120  C  CG    . GLU A 1 175 ? -9.471  39.510  54.041  1.00 154.24 ? 154 GLU A CG    1 
ATOM   1121  C  CD    . GLU A 1 175 ? -8.634  38.965  55.180  1.00 167.52 ? 154 GLU A CD    1 
ATOM   1122  O  OE1   . GLU A 1 175 ? -7.921  37.945  54.974  1.00 154.61 ? 154 GLU A OE1   1 
ATOM   1123  O  OE2   . GLU A 1 175 ? -8.718  39.546  56.287  1.00 178.32 ? 154 GLU A OE2   1 
ATOM   1124  N  N     . TRP A 1 176 ? -10.330 37.998  49.473  1.00 115.50 ? 155 TRP A N     1 
ATOM   1125  C  CA    . TRP A 1 176 ? -9.936  37.562  48.138  1.00 112.14 ? 155 TRP A CA    1 
ATOM   1126  C  C     . TRP A 1 176 ? -10.470 38.525  47.090  1.00 112.60 ? 155 TRP A C     1 
ATOM   1127  O  O     . TRP A 1 176 ? -9.719  38.998  46.236  1.00 111.29 ? 155 TRP A O     1 
ATOM   1128  C  CB    . TRP A 1 176 ? -10.422 36.136  47.877  1.00 130.65 ? 155 TRP A CB    1 
ATOM   1129  C  CG    . TRP A 1 176 ? -9.601  35.023  48.508  1.00 117.84 ? 155 TRP A CG    1 
ATOM   1130  C  CD1   . TRP A 1 176 ? -9.939  34.264  49.596  1.00 120.47 ? 155 TRP A CD1   1 
ATOM   1131  C  CD2   . TRP A 1 176 ? -8.332  34.548  48.072  1.00 106.33 ? 155 TRP A CD2   1 
ATOM   1132  N  NE1   . TRP A 1 176 ? -8.951  33.363  49.859  1.00 107.83 ? 155 TRP A NE1   1 
ATOM   1133  C  CE2   . TRP A 1 176 ? -7.954  33.518  48.933  1.00 106.00 ? 155 TRP A CE2   1 
ATOM   1134  C  CE3   . TRP A 1 176 ? -7.470  34.905  47.040  1.00 111.95 ? 155 TRP A CE3   1 
ATOM   1135  C  CZ2   . TRP A 1 176 ? -6.752  32.839  48.787  1.00 106.96 ? 155 TRP A CZ2   1 
ATOM   1136  C  CZ3   . TRP A 1 176 ? -6.276  34.227  46.901  1.00 103.14 ? 155 TRP A CZ3   1 
ATOM   1137  C  CH2   . TRP A 1 176 ? -5.929  33.212  47.764  1.00 102.99 ? 155 TRP A CH2   1 
ATOM   1138  N  N     . GLN A 1 177 ? -11.782 38.688  47.048  1.00 114.30 ? 156 GLN A N     1 
ATOM   1139  C  CA    . GLN A 1 177 ? -12.413 39.856  46.447  1.00 127.17 ? 156 GLN A CA    1 
ATOM   1140  C  C     . GLN A 1 177 ? -13.274 40.517  47.512  1.00 150.54 ? 156 GLN A C     1 
ATOM   1141  O  O     . GLN A 1 177 ? -14.168 39.877  48.083  1.00 174.01 ? 156 GLN A O     1 
ATOM   1142  C  CB    . GLN A 1 177 ? -13.249 39.509  45.221  1.00 119.67 ? 156 GLN A CB    1 
ATOM   1143  C  CG    . GLN A 1 177 ? -14.186 38.340  45.412  1.00 143.35 ? 156 GLN A CG    1 
ATOM   1144  C  CD    . GLN A 1 177 ? -15.363 38.389  44.462  1.00 171.35 ? 156 GLN A CD    1 
ATOM   1145  O  OE1   . GLN A 1 177 ? -15.618 39.416  43.841  1.00 190.84 ? 156 GLN A OE1   1 
ATOM   1146  N  NE2   . GLN A 1 177 ? -16.061 37.266  44.308  1.00 165.32 ? 156 GLN A NE2   1 
ATOM   1147  N  N     . ALA A 1 178 ? -13.011 41.802  47.767  1.00 148.63 ? 157 ALA A N     1 
ATOM   1148  C  CA    . ALA A 1 178 ? -13.630 42.487  48.894  1.00 159.65 ? 157 ALA A CA    1 
ATOM   1149  C  C     . ALA A 1 178 ? -15.129 42.653  48.745  1.00 163.72 ? 157 ALA A C     1 
ATOM   1150  O  O     . ALA A 1 178 ? -15.829 42.787  49.757  1.00 171.14 ? 157 ALA A O     1 
ATOM   1151  C  CB    . ALA A 1 178 ? -12.993 43.861  49.075  1.00 164.39 ? 157 ALA A CB    1 
ATOM   1152  N  N     . ASP A 1 179 ? -15.634 42.632  47.517  1.00 162.74 ? 158 ASP A N     1 
ATOM   1153  C  CA    . ASP A 1 179 ? -17.046 42.859  47.258  1.00 184.99 ? 158 ASP A CA    1 
ATOM   1154  C  C     . ASP A 1 179 ? -17.858 41.585  47.066  1.00 182.19 ? 158 ASP A C     1 
ATOM   1155  O  O     . ASP A 1 179 ? -19.069 41.685  46.837  1.00 189.18 ? 158 ASP A O     1 
ATOM   1156  C  CB    . ASP A 1 179 ? -17.198 43.796  46.046  1.00 205.32 ? 158 ASP A CB    1 
ATOM   1157  C  CG    . ASP A 1 179 ? -16.922 43.108  44.715  1.00 212.18 ? 158 ASP A CG    1 
ATOM   1158  O  OD1   . ASP A 1 179 ? -16.242 42.056  44.706  1.00 213.11 ? 158 ASP A OD1   1 
ATOM   1159  O  OD2   . ASP A 1 179 ? -17.350 43.647  43.670  1.00 220.21 ? 158 ASP A OD2   1 
ATOM   1160  N  N     . PHE A 1 180 ? -17.251 40.400  47.198  1.00 183.04 ? 159 PHE A N     1 
ATOM   1161  C  CA    . PHE A 1 180 ? -18.016 39.186  46.958  1.00 146.56 ? 159 PHE A CA    1 
ATOM   1162  C  C     . PHE A 1 180 ? -19.095 39.078  48.007  1.00 175.34 ? 159 PHE A C     1 
ATOM   1163  O  O     . PHE A 1 180 ? -18.804 38.895  49.193  1.00 177.37 ? 159 PHE A O     1 
ATOM   1164  C  CB    . PHE A 1 180 ? -17.130 37.963  47.042  1.00 143.64 ? 159 PHE A CB    1 
ATOM   1165  C  CG    . PHE A 1 180 ? -17.839 36.688  46.689  1.00 167.44 ? 159 PHE A CG    1 
ATOM   1166  C  CD1   . PHE A 1 180 ? -18.930 36.693  45.831  1.00 178.63 ? 159 PHE A CD1   1 
ATOM   1167  C  CD2   . PHE A 1 180 ? -17.432 35.485  47.244  1.00 148.41 ? 159 PHE A CD2   1 
ATOM   1168  C  CE1   . PHE A 1 180 ? -19.579 35.516  45.524  1.00 170.46 ? 159 PHE A CE1   1 
ATOM   1169  C  CE2   . PHE A 1 180 ? -18.081 34.313  46.950  1.00 116.49 ? 159 PHE A CE2   1 
ATOM   1170  C  CZ    . PHE A 1 180 ? -19.150 34.323  46.090  1.00 152.90 ? 159 PHE A CZ    1 
ATOM   1171  N  N     . ALA A 1 181 ? -20.339 39.107  47.550  1.00 179.31 ? 160 ALA A N     1 
ATOM   1172  C  CA    . ALA A 1 181 ? -21.489 39.293  48.420  1.00 194.54 ? 160 ALA A CA    1 
ATOM   1173  C  C     . ALA A 1 181 ? -22.164 37.982  48.795  1.00 175.97 ? 160 ALA A C     1 
ATOM   1174  O  O     . ALA A 1 181 ? -23.163 37.989  49.526  1.00 179.90 ? 160 ALA A O     1 
ATOM   1175  C  CB    . ALA A 1 181 ? -22.493 40.243  47.754  1.00 207.00 ? 160 ALA A CB    1 
ATOM   1176  N  N     . GLU A 1 182 ? -21.642 36.859  48.327  1.00 174.27 ? 161 GLU A N     1 
ATOM   1177  C  CA    . GLU A 1 182 ? -22.213 35.590  48.699  1.00 158.24 ? 161 GLU A CA    1 
ATOM   1178  C  C     . GLU A 1 182 ? -21.406 35.005  49.835  1.00 136.94 ? 161 GLU A C     1 
ATOM   1179  O  O     . GLU A 1 182 ? -20.170 34.937  49.731  1.00 125.03 ? 161 GLU A O     1 
ATOM   1180  C  CB    . GLU A 1 182 ? -22.258 34.625  47.531  1.00 160.00 ? 161 GLU A CB    1 
ATOM   1181  C  CG    . GLU A 1 182 ? -23.221 33.502  47.814  1.00 169.00 ? 161 GLU A CG    1 
ATOM   1182  C  CD    . GLU A 1 182 ? -23.424 32.600  46.642  1.00 183.56 ? 161 GLU A CD    1 
ATOM   1183  O  OE1   . GLU A 1 182 ? -23.824 33.103  45.573  1.00 191.93 ? 161 GLU A OE1   1 
ATOM   1184  O  OE2   . GLU A 1 182 ? -23.179 31.385  46.790  1.00 192.10 ? 161 GLU A OE2   1 
ATOM   1185  N  N     . PRO A 1 183 ? -22.042 34.696  50.963  1.00 144.95 ? 162 PRO A N     1 
ATOM   1186  C  CA    . PRO A 1 183 ? -21.337 34.021  52.055  1.00 137.24 ? 162 PRO A CA    1 
ATOM   1187  C  C     . PRO A 1 183 ? -20.814 32.659  51.635  1.00 127.42 ? 162 PRO A C     1 
ATOM   1188  O  O     . PRO A 1 183 ? -21.357 31.994  50.749  1.00 135.31 ? 162 PRO A O     1 
ATOM   1189  C  CB    . PRO A 1 183 ? -22.418 33.843  53.124  1.00 132.95 ? 162 PRO A CB    1 
ATOM   1190  C  CG    . PRO A 1 183 ? -23.598 34.571  52.627  1.00 136.19 ? 162 PRO A CG    1 
ATOM   1191  C  CD    . PRO A 1 183 ? -23.495 34.664  51.157  1.00 133.72 ? 162 PRO A CD    1 
ATOM   1192  N  N     . VAL A 1 184 ? -19.759 32.235  52.307  1.00 123.33 ? 163 VAL A N     1 
ATOM   1193  C  CA    . VAL A 1 184 ? -19.316 30.854  52.276  1.00 120.16 ? 163 VAL A CA    1 
ATOM   1194  C  C     . VAL A 1 184 ? -19.359 30.407  53.726  1.00 121.77 ? 163 VAL A C     1 
ATOM   1195  O  O     . VAL A 1 184 ? -18.973 31.178  54.616  1.00 124.01 ? 163 VAL A O     1 
ATOM   1196  C  CB    . VAL A 1 184 ? -17.921 30.698  51.634  1.00 116.70 ? 163 VAL A CB    1 
ATOM   1197  C  CG1   . VAL A 1 184 ? -17.265 29.442  52.068  1.00 114.47 ? 163 VAL A CG1   1 
ATOM   1198  C  CG2   . VAL A 1 184 ? -18.055 30.600  50.144  1.00 114.75 ? 163 VAL A CG2   1 
ATOM   1199  N  N     . TYR A 1 185 ? -19.929 29.222  53.971  1.00 121.14 ? 164 TYR A N     1 
ATOM   1200  C  CA    . TYR A 1 185 ? -20.054 28.682  55.318  1.00 122.66 ? 164 TYR A CA    1 
ATOM   1201  C  C     . TYR A 1 185 ? -19.112 27.503  55.507  1.00 119.57 ? 164 TYR A C     1 
ATOM   1202  O  O     . TYR A 1 185 ? -19.000 26.641  54.630  1.00 116.71 ? 164 TYR A O     1 
ATOM   1203  C  CB    . TYR A 1 185 ? -21.494 28.251  55.628  1.00 124.94 ? 164 TYR A CB    1 
ATOM   1204  C  CG    . TYR A 1 185 ? -22.504 29.374  55.547  1.00 128.69 ? 164 TYR A CG    1 
ATOM   1205  C  CD1   . TYR A 1 185 ? -22.508 30.385  56.488  1.00 132.35 ? 164 TYR A CD1   1 
ATOM   1206  C  CD2   . TYR A 1 185 ? -23.475 29.403  54.551  1.00 129.02 ? 164 TYR A CD2   1 
ATOM   1207  C  CE1   . TYR A 1 185 ? -23.420 31.408  56.424  1.00 136.16 ? 164 TYR A CE1   1 
ATOM   1208  C  CE2   . TYR A 1 185 ? -24.398 30.424  54.482  1.00 132.77 ? 164 TYR A CE2   1 
ATOM   1209  C  CZ    . TYR A 1 185 ? -24.362 31.424  55.427  1.00 137.60 ? 164 TYR A CZ    1 
ATOM   1210  O  OH    . TYR A 1 185 ? -25.266 32.457  55.384  1.00 155.76 ? 164 TYR A OH    1 
ATOM   1211  N  N     . GLU A 1 186 ? -18.462 27.465  56.675  1.00 120.57 ? 165 GLU A N     1 
ATOM   1212  C  CA    . GLU A 1 186 ? -17.593 26.363  57.083  1.00 124.54 ? 165 GLU A CA    1 
ATOM   1213  C  C     . GLU A 1 186 ? -18.222 25.735  58.311  1.00 135.94 ? 165 GLU A C     1 
ATOM   1214  O  O     . GLU A 1 186 ? -18.253 26.352  59.377  1.00 150.84 ? 165 GLU A O     1 
ATOM   1215  C  CB    . GLU A 1 186 ? -16.186 26.867  57.420  1.00 138.75 ? 165 GLU A CB    1 
ATOM   1216  C  CG    . GLU A 1 186 ? -15.114 25.835  57.854  1.00 134.69 ? 165 GLU A CG    1 
ATOM   1217  C  CD    . GLU A 1 186 ? -13.807 26.518  58.344  1.00 138.01 ? 165 GLU A CD    1 
ATOM   1218  O  OE1   . GLU A 1 186 ? -13.860 27.309  59.330  1.00 137.50 ? 165 GLU A OE1   1 
ATOM   1219  O  OE2   . GLU A 1 186 ? -12.741 26.316  57.703  1.00 119.51 ? 165 GLU A OE2   1 
ATOM   1220  N  N     . LEU A 1 187 ? -18.630 24.485  58.199  1.00 140.05 ? 166 LEU A N     1 
ATOM   1221  C  CA    . LEU A 1 187 ? -19.181 23.800  59.354  1.00 120.71 ? 166 LEU A CA    1 
ATOM   1222  C  C     . LEU A 1 187 ? -18.014 23.373  60.226  1.00 125.03 ? 166 LEU A C     1 
ATOM   1223  O  O     . LEU A 1 187 ? -17.183 22.559  59.814  1.00 149.64 ? 166 LEU A O     1 
ATOM   1224  C  CB    . LEU A 1 187 ? -20.048 22.635  58.885  1.00 124.44 ? 166 LEU A CB    1 
ATOM   1225  C  CG    . LEU A 1 187 ? -20.605 21.517  59.763  1.00 137.74 ? 166 LEU A CG    1 
ATOM   1226  C  CD1   . LEU A 1 187 ? -21.335 22.012  61.004  1.00 144.57 ? 166 LEU A CD1   1 
ATOM   1227  C  CD2   . LEU A 1 187 ? -21.537 20.680  58.905  1.00 125.63 ? 166 LEU A CD2   1 
ATOM   1228  N  N     . ARG A 1 188 ? -17.957 23.935  61.427  1.00 129.81 ? 167 ARG A N     1 
ATOM   1229  C  CA    . ARG A 1 188 ? -16.801 23.835  62.300  1.00 143.87 ? 167 ARG A CA    1 
ATOM   1230  C  C     . ARG A 1 188 ? -16.924 22.770  63.388  1.00 142.86 ? 167 ARG A C     1 
ATOM   1231  O  O     . ARG A 1 188 ? -15.972 22.584  64.155  1.00 147.75 ? 167 ARG A O     1 
ATOM   1232  C  CB    . ARG A 1 188 ? -16.571 25.194  62.959  1.00 162.56 ? 167 ARG A CB    1 
ATOM   1233  C  CG    . ARG A 1 188 ? -15.738 26.154  62.154  1.00 179.09 ? 167 ARG A CG    1 
ATOM   1234  C  CD    . ARG A 1 188 ? -15.415 27.363  63.007  1.00 183.43 ? 167 ARG A CD    1 
ATOM   1235  N  NE    . ARG A 1 188 ? -14.689 26.962  64.205  1.00 187.60 ? 167 ARG A NE    1 
ATOM   1236  C  CZ    . ARG A 1 188 ? -13.501 26.360  64.206  1.00 198.14 ? 167 ARG A CZ    1 
ATOM   1237  N  NH1   . ARG A 1 188 ? -12.939 26.032  65.359  1.00 209.30 ? 167 ARG A NH1   1 
ATOM   1238  N  NH2   . ARG A 1 188 ? -12.868 26.080  63.069  1.00 191.45 ? 167 ARG A NH2   1 
ATOM   1239  N  N     . CYS A 1 189 ? -18.077 22.111  63.527  1.00 125.28 ? 168 CYS A N     1 
ATOM   1240  C  CA    . CYS A 1 189 ? -18.245 21.077  64.533  1.00 126.08 ? 168 CYS A CA    1 
ATOM   1241  C  C     . CYS A 1 189 ? -18.199 19.662  63.972  1.00 122.62 ? 168 CYS A C     1 
ATOM   1242  O  O     . CYS A 1 189 ? -18.524 18.719  64.700  1.00 123.16 ? 168 CYS A O     1 
ATOM   1243  C  CB    . CYS A 1 189 ? -19.489 21.333  65.353  1.00 138.45 ? 168 CYS A CB    1 
ATOM   1244  S  SG    . CYS A 1 189 ? -18.962 21.916  67.042  1.00 192.28 ? 168 CYS A SG    1 
ATOM   1245  N  N     . MET A 1 190 ? -17.805 19.505  62.691  1.00 133.30 ? 169 MET A N     1 
ATOM   1246  C  CA    . MET A 1 190 ? -17.894 18.233  61.953  1.00 126.08 ? 169 MET A CA    1 
ATOM   1247  C  C     . MET A 1 190 ? -17.164 17.087  62.633  1.00 115.66 ? 169 MET A C     1 
ATOM   1248  O  O     . MET A 1 190 ? -17.561 15.925  62.477  1.00 114.47 ? 169 MET A O     1 
ATOM   1249  C  CB    . MET A 1 190 ? -17.301 18.419  60.551  1.00 129.83 ? 169 MET A CB    1 
ATOM   1250  C  CG    . MET A 1 190 ? -18.277 18.630  59.416  1.00 127.60 ? 169 MET A CG    1 
ATOM   1251  S  SD    . MET A 1 190 ? -19.152 17.108  59.030  1.00 119.40 ? 169 MET A SD    1 
ATOM   1252  C  CE    . MET A 1 190 ? -17.865 16.215  58.109  1.00 108.50 ? 169 MET A CE    1 
ATOM   1253  N  N     . ALA A 1 191 ? -16.139 17.399  63.425  1.00 127.41 ? 170 ALA A N     1 
ATOM   1254  C  CA    . ALA A 1 191 ? -15.342 16.361  64.070  1.00 125.07 ? 170 ALA A CA    1 
ATOM   1255  C  C     . ALA A 1 191 ? -16.187 15.569  65.049  1.00 133.19 ? 170 ALA A C     1 
ATOM   1256  O  O     . ALA A 1 191 ? -16.118 14.332  65.099  1.00 134.52 ? 170 ALA A O     1 
ATOM   1257  C  CB    . ALA A 1 191 ? -14.139 16.986  64.778  1.00 121.27 ? 170 ALA A CB    1 
ATOM   1258  N  N     . LEU A 1 192 ? -16.989 16.270  65.843  1.00 142.79 ? 171 LEU A N     1 
ATOM   1259  C  CA    . LEU A 1 192 ? -17.871 15.563  66.748  1.00 122.71 ? 171 LEU A CA    1 
ATOM   1260  C  C     . LEU A 1 192 ? -18.868 14.698  65.989  1.00 120.89 ? 171 LEU A C     1 
ATOM   1261  O  O     . LEU A 1 192 ? -19.132 13.565  66.398  1.00 120.62 ? 171 LEU A O     1 
ATOM   1262  C  CB    . LEU A 1 192 ? -18.598 16.573  67.628  1.00 126.73 ? 171 LEU A CB    1 
ATOM   1263  C  CG    . LEU A 1 192 ? -19.274 15.861  68.785  1.00 129.08 ? 171 LEU A CG    1 
ATOM   1264  C  CD1   . LEU A 1 192 ? -18.177 15.012  69.432  1.00 128.46 ? 171 LEU A CD1   1 
ATOM   1265  C  CD2   . LEU A 1 192 ? -19.925 16.847  69.743  1.00 133.69 ? 171 LEU A CD2   1 
ATOM   1266  N  N     . CYS A 1 193 ? -19.336 15.159  64.821  1.00 119.57 ? 172 CYS A N     1 
ATOM   1267  C  CA    . CYS A 1 193 ? -20.309 14.383  64.054  1.00 118.28 ? 172 CYS A CA    1 
ATOM   1268  C  C     . CYS A 1 193 ? -19.717 13.093  63.541  1.00 115.47 ? 172 CYS A C     1 
ATOM   1269  O  O     . CYS A 1 193 ? -20.402 12.069  63.509  1.00 115.17 ? 172 CYS A O     1 
ATOM   1270  C  CB    . CYS A 1 193 ? -20.845 15.159  62.863  1.00 119.91 ? 172 CYS A CB    1 
ATOM   1271  S  SG    . CYS A 1 193 ? -22.084 16.324  63.246  1.00 130.44 ? 172 CYS A SG    1 
ATOM   1272  N  N     . ASP A 1 194 ? -18.492 13.143  63.019  1.00 113.53 ? 173 ASP A N     1 
ATOM   1273  C  CA    . ASP A 1 194 ? -17.864 11.887  62.641  1.00 111.43 ? 173 ASP A CA    1 
ATOM   1274  C  C     . ASP A 1 194 ? -17.602 11.024  63.869  1.00 112.49 ? 173 ASP A C     1 
ATOM   1275  O  O     . ASP A 1 194 ? -17.645 9.794   63.771  1.00 123.60 ? 173 ASP A O     1 
ATOM   1276  C  CB    . ASP A 1 194 ? -16.598 12.105  61.799  1.00 138.45 ? 173 ASP A CB    1 
ATOM   1277  C  CG    . ASP A 1 194 ? -16.914 12.400  60.330  1.00 147.34 ? 173 ASP A CG    1 
ATOM   1278  O  OD1   . ASP A 1 194 ? -18.101 12.259  59.914  1.00 108.20 ? 173 ASP A OD1   1 
ATOM   1279  O  OD2   . ASP A 1 194 ? -15.955 12.730  59.587  1.00 159.72 ? 173 ASP A OD2   1 
ATOM   1280  N  N     . ARG A 1 195 ? -17.318 11.619  65.030  1.00 114.70 ? 174 ARG A N     1 
ATOM   1281  C  CA    . ARG A 1 195 ? -17.190 10.750  66.198  1.00 132.60 ? 174 ARG A CA    1 
ATOM   1282  C  C     . ARG A 1 195 ? -18.513 10.041  66.491  1.00 143.15 ? 174 ARG A C     1 
ATOM   1283  O  O     . ARG A 1 195 ? -18.538 8.834   66.772  1.00 149.04 ? 174 ARG A O     1 
ATOM   1284  C  CB    . ARG A 1 195 ? -16.730 11.526  67.429  1.00 124.36 ? 174 ARG A CB    1 
ATOM   1285  C  CG    . ARG A 1 195 ? -16.645 10.608  68.619  1.00 120.32 ? 174 ARG A CG    1 
ATOM   1286  C  CD    . ARG A 1 195 ? -16.286 11.316  69.873  1.00 123.64 ? 174 ARG A CD    1 
ATOM   1287  N  NE    . ARG A 1 195 ? -14.913 11.038  70.265  1.00 123.72 ? 174 ARG A NE    1 
ATOM   1288  C  CZ    . ARG A 1 195 ? -13.895 11.841  69.995  1.00 153.62 ? 174 ARG A CZ    1 
ATOM   1289  N  NH1   . ARG A 1 195 ? -14.092 12.980  69.332  1.00 173.24 ? 174 ARG A NH1   1 
ATOM   1290  N  NH2   . ARG A 1 195 ? -12.682 11.512  70.407  1.00 165.89 ? 174 ARG A NH2   1 
ATOM   1291  N  N     . LEU A 1 196 ? -19.630 10.750  66.331  1.00 120.93 ? 175 LEU A N     1 
ATOM   1292  C  CA    . LEU A 1 196 ? -20.920 10.135  66.601  1.00 119.10 ? 175 LEU A CA    1 
ATOM   1293  C  C     . LEU A 1 196 ? -21.254 9.098   65.533  1.00 116.72 ? 175 LEU A C     1 
ATOM   1294  O  O     . LEU A 1 196 ? -21.536 7.940   65.851  1.00 116.60 ? 175 LEU A O     1 
ATOM   1295  C  CB    . LEU A 1 196 ? -22.008 11.212  66.674  1.00 121.46 ? 175 LEU A CB    1 
ATOM   1296  C  CG    . LEU A 1 196 ? -21.845 12.275  67.766  1.00 124.62 ? 175 LEU A CG    1 
ATOM   1297  C  CD1   . LEU A 1 196 ? -22.993 13.270  67.765  1.00 127.28 ? 175 LEU A CD1   1 
ATOM   1298  C  CD2   . LEU A 1 196 ? -21.668 11.677  69.118  1.00 126.53 ? 175 LEU A CD2   1 
ATOM   1299  N  N     . ARG A 1 197 ? -21.132 9.470   64.256  1.00 114.93 ? 176 ARG A N     1 
ATOM   1300  C  CA    . ARG A 1 197 ? -21.324 8.512   63.172  1.00 112.98 ? 176 ARG A CA    1 
ATOM   1301  C  C     . ARG A 1 197 ? -20.474 7.265   63.377  1.00 111.75 ? 176 ARG A C     1 
ATOM   1302  O  O     . ARG A 1 197 ? -20.888 6.157   63.022  1.00 111.69 ? 176 ARG A O     1 
ATOM   1303  C  CB    . ARG A 1 197 ? -21.018 9.145   61.815  1.00 111.37 ? 176 ARG A CB    1 
ATOM   1304  C  CG    . ARG A 1 197 ? -21.504 8.271   60.657  1.00 110.20 ? 176 ARG A CG    1 
ATOM   1305  C  CD    . ARG A 1 197 ? -21.493 8.934   59.268  1.00 109.19 ? 176 ARG A CD    1 
ATOM   1306  N  NE    . ARG A 1 197 ? -20.161 9.402   58.874  1.00 128.27 ? 176 ARG A NE    1 
ATOM   1307  C  CZ    . ARG A 1 197 ? -19.217 8.621   58.336  1.00 119.56 ? 176 ARG A CZ    1 
ATOM   1308  N  NH1   . ARG A 1 197 ? -19.446 7.321   58.148  1.00 125.93 ? 176 ARG A NH1   1 
ATOM   1309  N  NH2   . ARG A 1 197 ? -18.030 9.126   58.000  1.00 105.00 ? 176 ARG A NH2   1 
ATOM   1310  N  N     . LEU A 1 198 ? -19.249 7.427   63.876  1.00 111.48 ? 177 LEU A N     1 
ATOM   1311  C  CA    . LEU A 1 198 ? -18.401 6.256   64.022  1.00 110.59 ? 177 LEU A CA    1 
ATOM   1312  C  C     . LEU A 1 198 ? -18.896 5.391   65.148  1.00 112.03 ? 177 LEU A C     1 
ATOM   1313  O  O     . LEU A 1 198 ? -18.900 4.162   65.033  1.00 122.99 ? 177 LEU A O     1 
ATOM   1314  C  CB    . LEU A 1 198 ? -16.957 6.638   64.300  1.00 115.95 ? 177 LEU A CB    1 
ATOM   1315  C  CG    . LEU A 1 198 ? -16.132 5.459   64.826  1.00 110.31 ? 177 LEU A CG    1 
ATOM   1316  C  CD1   . LEU A 1 198 ? -16.009 4.330   63.800  1.00 112.08 ? 177 LEU A CD1   1 
ATOM   1317  C  CD2   . LEU A 1 198 ? -14.770 5.884   65.223  1.00 110.63 ? 177 LEU A CD2   1 
ATOM   1318  N  N     . MET A 1 199 ? -19.342 6.018   66.239  1.00 114.16 ? 178 MET A N     1 
ATOM   1319  C  CA    . MET A 1 199 ? -19.850 5.237   67.367  1.00 132.29 ? 178 MET A CA    1 
ATOM   1320  C  C     . MET A 1 199 ? -21.130 4.491   67.014  1.00 117.10 ? 178 MET A C     1 
ATOM   1321  O  O     . MET A 1 199 ? -21.292 3.330   67.397  1.00 115.93 ? 178 MET A O     1 
ATOM   1322  C  CB    . MET A 1 199 ? -20.068 6.136   68.583  1.00 133.15 ? 178 MET A CB    1 
ATOM   1323  C  CG    . MET A 1 199 ? -18.811 6.378   69.366  1.00 124.76 ? 178 MET A CG    1 
ATOM   1324  S  SD    . MET A 1 199 ? -19.124 7.425   70.770  1.00 141.57 ? 178 MET A SD    1 
ATOM   1325  C  CE    . MET A 1 199 ? -19.433 8.975   69.942  1.00 161.50 ? 178 MET A CE    1 
ATOM   1326  N  N     . TYR A 1 200 ? -22.045 5.131   66.289  1.00 115.92 ? 179 TYR A N     1 
ATOM   1327  C  CA    . TYR A 1 200 ? -23.304 4.479   65.961  1.00 116.37 ? 179 TYR A CA    1 
ATOM   1328  C  C     . TYR A 1 200 ? -23.130 3.409   64.903  1.00 114.42 ? 179 TYR A C     1 
ATOM   1329  O  O     . TYR A 1 200 ? -23.763 2.350   64.979  1.00 145.20 ? 179 TYR A O     1 
ATOM   1330  C  CB    . TYR A 1 200 ? -24.349 5.495   65.536  1.00 117.56 ? 179 TYR A CB    1 
ATOM   1331  C  CG    . TYR A 1 200 ? -25.484 4.853   64.784  1.00 125.19 ? 179 TYR A CG    1 
ATOM   1332  C  CD1   . TYR A 1 200 ? -26.406 4.041   65.410  1.00 119.21 ? 179 TYR A CD1   1 
ATOM   1333  C  CD2   . TYR A 1 200 ? -25.663 5.118   63.443  1.00 144.22 ? 179 TYR A CD2   1 
ATOM   1334  C  CE1   . TYR A 1 200 ? -27.432 3.461   64.699  1.00 119.58 ? 179 TYR A CE1   1 
ATOM   1335  C  CE2   . TYR A 1 200 ? -26.691 4.564   62.737  1.00 141.17 ? 179 TYR A CE2   1 
ATOM   1336  C  CZ    . TYR A 1 200 ? -27.566 3.739   63.363  1.00 122.02 ? 179 TYR A CZ    1 
ATOM   1337  O  OH    . TYR A 1 200 ? -28.574 3.195   62.624  1.00 122.75 ? 179 TYR A OH    1 
ATOM   1338  N  N     . PHE A 1 201 ? -22.374 3.702   63.854  1.00 112.64 ? 180 PHE A N     1 
ATOM   1339  C  CA    . PHE A 1 201 ? -22.208 2.707   62.813  1.00 111.28 ? 180 PHE A CA    1 
ATOM   1340  C  C     . PHE A 1 201 ? -21.125 1.690   63.093  1.00 110.52 ? 180 PHE A C     1 
ATOM   1341  O  O     . PHE A 1 201 ? -21.240 0.562   62.635  1.00 110.27 ? 180 PHE A O     1 
ATOM   1342  C  CB    . PHE A 1 201 ? -21.888 3.390   61.527  1.00 110.04 ? 180 PHE A CB    1 
ATOM   1343  C  CG    . PHE A 1 201 ? -23.025 3.578   60.660  1.00 110.58 ? 180 PHE A CG    1 
ATOM   1344  C  CD1   . PHE A 1 201 ? -23.541 2.514   59.990  1.00 110.70 ? 180 PHE A CD1   1 
ATOM   1345  C  CD2   . PHE A 1 201 ? -23.562 4.819   60.477  1.00 111.24 ? 180 PHE A CD2   1 
ATOM   1346  C  CE1   . PHE A 1 201 ? -24.557 2.686   59.140  1.00 111.49 ? 180 PHE A CE1   1 
ATOM   1347  C  CE2   . PHE A 1 201 ? -24.607 5.002   59.640  1.00 112.02 ? 180 PHE A CE2   1 
ATOM   1348  C  CZ    . PHE A 1 201 ? -25.108 3.934   58.963  1.00 112.16 ? 180 PHE A CZ    1 
ATOM   1349  N  N     . GLY A 1 202 ? -20.073 2.047   63.807  1.00 110.43 ? 181 GLY A N     1 
ATOM   1350  C  CA    . GLY A 1 202 ? -18.986 1.123   64.057  1.00 110.01 ? 181 GLY A CA    1 
ATOM   1351  C  C     . GLY A 1 202 ? -17.979 0.869   62.952  1.00 108.61 ? 181 GLY A C     1 
ATOM   1352  O  O     . GLY A 1 202 ? -17.120 0.007   63.138  1.00 113.81 ? 181 GLY A O     1 
ATOM   1353  N  N     . ASN A 1 203 ? -18.094 1.524   61.796  1.00 107.68 ? 182 ASN A N     1 
ATOM   1354  C  CA    . ASN A 1 203 ? -17.059 1.640   60.769  1.00 106.54 ? 182 ASN A CA    1 
ATOM   1355  C  C     . ASN A 1 203 ? -17.387 2.940   60.081  1.00 105.97 ? 182 ASN A C     1 
ATOM   1356  O  O     . ASN A 1 203 ? -18.555 3.194   59.835  1.00 106.38 ? 182 ASN A O     1 
ATOM   1357  C  CB    . ASN A 1 203 ? -17.044 0.467   59.757  1.00 160.79 ? 182 ASN A CB    1 
ATOM   1358  C  CG    . ASN A 1 203 ? -16.067 -0.714  60.145  1.00 188.27 ? 182 ASN A CG    1 
ATOM   1359  O  OD1   . ASN A 1 203 ? -16.279 -1.436  61.127  1.00 220.90 ? 182 ASN A OD1   1 
ATOM   1360  N  ND2   . ASN A 1 203 ? -15.078 -0.978  59.267  1.00 134.56 ? 182 ASN A ND2   1 
ATOM   1361  N  N     . LEU A 1 204 ? -16.385 3.686   59.620  1.00 124.97 ? 183 LEU A N     1 
ATOM   1362  C  CA    . LEU A 1 204 ? -16.673 5.043   59.139  1.00 104.76 ? 183 LEU A CA    1 
ATOM   1363  C  C     . LEU A 1 204 ? -17.057 5.144   57.673  1.00 104.09 ? 183 LEU A C     1 
ATOM   1364  O  O     . LEU A 1 204 ? -17.163 6.262   57.164  1.00 103.74 ? 183 LEU A O     1 
ATOM   1365  C  CB    . LEU A 1 204 ? -15.517 6.012   59.363  1.00 104.39 ? 183 LEU A CB    1 
ATOM   1366  C  CG    . LEU A 1 204 ? -15.543 6.918   60.594  1.00 105.50 ? 183 LEU A CG    1 
ATOM   1367  C  CD1   . LEU A 1 204 ? -14.327 7.783   60.602  1.00 105.23 ? 183 LEU A CD1   1 
ATOM   1368  C  CD2   . LEU A 1 204 ? -16.726 7.795   60.549  1.00 106.14 ? 183 LEU A CD2   1 
ATOM   1369  N  N     . TRP A 1 205 ? -17.257 4.030   56.985  1.00 104.16 ? 184 TRP A N     1 
ATOM   1370  C  CA    . TRP A 1 205 ? -17.594 4.087   55.577  1.00 103.95 ? 184 TRP A CA    1 
ATOM   1371  C  C     . TRP A 1 205 ? -19.078 4.194   55.289  1.00 104.84 ? 184 TRP A C     1 
ATOM   1372  O  O     . TRP A 1 205 ? -19.436 4.513   54.153  1.00 119.25 ? 184 TRP A O     1 
ATOM   1373  C  CB    . TRP A 1 205 ? -17.114 2.843   54.868  1.00 115.34 ? 184 TRP A CB    1 
ATOM   1374  C  CG    . TRP A 1 205 ? -17.649 1.517   55.411  1.00 129.94 ? 184 TRP A CG    1 
ATOM   1375  C  CD1   . TRP A 1 205 ? -17.062 0.723   56.361  1.00 126.33 ? 184 TRP A CD1   1 
ATOM   1376  C  CD2   . TRP A 1 205 ? -18.824 0.810   54.978  1.00 124.97 ? 184 TRP A CD2   1 
ATOM   1377  N  NE1   . TRP A 1 205 ? -17.793 -0.421  56.543  1.00 106.46 ? 184 TRP A NE1   1 
ATOM   1378  C  CE2   . TRP A 1 205 ? -18.886 -0.389  55.713  1.00 128.51 ? 184 TRP A CE2   1 
ATOM   1379  C  CE3   . TRP A 1 205 ? -19.832 1.076   54.044  1.00 152.63 ? 184 TRP A CE3   1 
ATOM   1380  C  CZ2   . TRP A 1 205 ? -19.930 -1.318  55.551  1.00 159.31 ? 184 TRP A CZ2   1 
ATOM   1381  C  CZ3   . TRP A 1 205 ? -20.869 0.149   53.884  1.00 164.95 ? 184 TRP A CZ3   1 
ATOM   1382  C  CH2   . TRP A 1 205 ? -20.908 -1.030  54.634  1.00 159.05 ? 184 TRP A CH2   1 
ATOM   1383  N  N     . GLN A 1 206 ? -19.951 3.982   56.264  1.00 105.75 ? 185 GLN A N     1 
ATOM   1384  C  CA    . GLN A 1 206 ? -21.378 3.983   55.991  1.00 106.96 ? 185 GLN A CA    1 
ATOM   1385  C  C     . GLN A 1 206 ? -21.926 5.369   56.293  1.00 107.38 ? 185 GLN A C     1 
ATOM   1386  O  O     . GLN A 1 206 ? -21.569 5.974   57.306  1.00 107.36 ? 185 GLN A O     1 
ATOM   1387  C  CB    . GLN A 1 206 ? -22.072 2.950   56.868  1.00 122.58 ? 185 GLN A CB    1 
ATOM   1388  C  CG    . GLN A 1 206 ? -21.302 1.659   57.023  1.00 107.71 ? 185 GLN A CG    1 
ATOM   1389  C  CD    . GLN A 1 206 ? -22.111 0.550   57.663  1.00 113.31 ? 185 GLN A CD    1 
ATOM   1390  O  OE1   . GLN A 1 206 ? -21.674 -0.065  58.642  1.00 114.53 ? 185 GLN A OE1   1 
ATOM   1391  N  NE2   . GLN A 1 206 ? -23.282 0.263   57.095  1.00 110.11 ? 185 GLN A NE2   1 
ATOM   1392  N  N     . ASP A 1 207 ? -22.761 5.888   55.400  1.00 108.07 ? 186 ASP A N     1 
ATOM   1393  C  CA    . ASP A 1 207 ? -23.291 7.235   55.569  1.00 108.78 ? 186 ASP A CA    1 
ATOM   1394  C  C     . ASP A 1 207 ? -24.539 7.263   56.426  1.00 110.76 ? 186 ASP A C     1 
ATOM   1395  O  O     . ASP A 1 207 ? -25.021 6.240   56.905  1.00 120.07 ? 186 ASP A O     1 
ATOM   1396  C  CB    . ASP A 1 207 ? -23.630 7.877   54.231  1.00 108.95 ? 186 ASP A CB    1 
ATOM   1397  C  CG    . ASP A 1 207 ? -22.529 8.759   53.703  1.00 122.81 ? 186 ASP A CG    1 
ATOM   1398  O  OD1   . ASP A 1 207 ? -22.660 9.230   52.555  1.00 151.49 ? 186 ASP A OD1   1 
ATOM   1399  O  OD2   . ASP A 1 207 ? -21.546 9.003   54.437  1.00 162.99 ? 186 ASP A OD2   1 
ATOM   1400  N  N     . TRP A 1 208 ? -25.081 8.460   56.635  1.00 111.93 ? 187 TRP A N     1 
ATOM   1401  C  CA    . TRP A 1 208 ? -26.449 8.480   57.124  1.00 114.34 ? 187 TRP A CA    1 
ATOM   1402  C  C     . TRP A 1 208 ? -27.421 8.031   56.048  1.00 121.73 ? 187 TRP A C     1 
ATOM   1403  O  O     . TRP A 1 208 ? -28.552 7.652   56.368  1.00 145.26 ? 187 TRP A O     1 
ATOM   1404  C  CB    . TRP A 1 208 ? -26.898 9.858   57.627  1.00 116.03 ? 187 TRP A CB    1 
ATOM   1405  C  CG    . TRP A 1 208 ? -25.987 10.585  58.552  1.00 123.01 ? 187 TRP A CG    1 
ATOM   1406  C  CD1   . TRP A 1 208 ? -25.344 11.752  58.297  1.00 137.33 ? 187 TRP A CD1   1 
ATOM   1407  C  CD2   . TRP A 1 208 ? -25.556 10.164  59.858  1.00 118.03 ? 187 TRP A CD2   1 
ATOM   1408  N  NE1   . TRP A 1 208 ? -24.578 12.119  59.380  1.00 145.30 ? 187 TRP A NE1   1 
ATOM   1409  C  CE2   . TRP A 1 208 ? -24.686 11.160  60.349  1.00 126.56 ? 187 TRP A CE2   1 
ATOM   1410  C  CE3   . TRP A 1 208 ? -25.816 9.045   60.653  1.00 116.23 ? 187 TRP A CE3   1 
ATOM   1411  C  CZ2   . TRP A 1 208 ? -24.082 11.077  61.599  1.00 121.31 ? 187 TRP A CZ2   1 
ATOM   1412  C  CZ3   . TRP A 1 208 ? -25.222 8.963   61.896  1.00 118.02 ? 187 TRP A CZ3   1 
ATOM   1413  C  CH2   . TRP A 1 208 ? -24.364 9.974   62.359  1.00 129.91 ? 187 TRP A CH2   1 
ATOM   1414  N  N     . SER A 1 209 ? -27.005 8.032   54.785  1.00 114.29 ? 188 SER A N     1 
ATOM   1415  C  CA    . SER A 1 209 ? -27.919 7.649   53.725  1.00 115.70 ? 188 SER A CA    1 
ATOM   1416  C  C     . SER A 1 209 ? -28.367 6.201   53.843  1.00 116.38 ? 188 SER A C     1 
ATOM   1417  O  O     . SER A 1 209 ? -29.383 5.822   53.233  1.00 118.33 ? 188 SER A O     1 
ATOM   1418  C  CB    . SER A 1 209 ? -27.264 7.896   52.391  1.00 114.56 ? 188 SER A CB    1 
ATOM   1419  O  OG    . SER A 1 209 ? -26.022 7.240   52.381  1.00 117.49 ? 188 SER A OG    1 
ATOM   1420  N  N     . GLU A 1 210 ? -27.690 5.414   54.686  1.00 130.65 ? 189 GLU A N     1 
ATOM   1421  C  CA    . GLU A 1 210 ? -28.146 4.059   54.999  1.00 139.69 ? 189 GLU A CA    1 
ATOM   1422  C  C     . GLU A 1 210 ? -29.622 4.051   55.419  1.00 134.89 ? 189 GLU A C     1 
ATOM   1423  O  O     . GLU A 1 210 ? -30.353 3.086   55.146  1.00 120.00 ? 189 GLU A O     1 
ATOM   1424  C  CB    . GLU A 1 210 ? -27.242 3.435   56.077  1.00 114.52 ? 189 GLU A CB    1 
ATOM   1425  C  CG    . GLU A 1 210 ? -26.838 1.954   55.829  1.00 114.10 ? 189 GLU A CG    1 
ATOM   1426  C  CD    . GLU A 1 210 ? -25.669 1.696   54.864  1.00 113.07 ? 189 GLU A CD    1 
ATOM   1427  O  OE1   . GLU A 1 210 ? -24.760 2.547   54.709  1.00 136.71 ? 189 GLU A OE1   1 
ATOM   1428  O  OE2   . GLU A 1 210 ? -25.662 0.614   54.245  1.00 115.68 ? 189 GLU A OE2   1 
ATOM   1429  N  N     . PHE A 1 211 ? -30.071 5.096   56.123  1.00 142.59 ? 190 PHE A N     1 
ATOM   1430  C  CA    . PHE A 1 211 ? -31.481 5.163   56.498  1.00 134.72 ? 190 PHE A CA    1 
ATOM   1431  C  C     . PHE A 1 211 ? -32.396 5.220   55.284  1.00 129.57 ? 190 PHE A C     1 
ATOM   1432  O  O     . PHE A 1 211 ? -33.181 4.291   55.040  1.00 159.15 ? 190 PHE A O     1 
ATOM   1433  C  CB    . PHE A 1 211 ? -31.718 6.366   57.387  1.00 123.60 ? 190 PHE A CB    1 
ATOM   1434  C  CG    . PHE A 1 211 ? -31.156 6.179   58.728  1.00 122.89 ? 190 PHE A CG    1 
ATOM   1435  C  CD1   . PHE A 1 211 ? -31.910 5.653   59.729  1.00 124.72 ? 190 PHE A CD1   1 
ATOM   1436  C  CD2   . PHE A 1 211 ? -29.826 6.434   58.965  1.00 138.93 ? 190 PHE A CD2   1 
ATOM   1437  C  CE1   . PHE A 1 211 ? -31.366 5.441   60.965  1.00 138.35 ? 190 PHE A CE1   1 
ATOM   1438  C  CE2   . PHE A 1 211 ? -29.276 6.221   60.204  1.00 142.41 ? 190 PHE A CE2   1 
ATOM   1439  C  CZ    . PHE A 1 211 ? -30.039 5.726   61.201  1.00 124.48 ? 190 PHE A CZ    1 
ATOM   1440  N  N     . VAL A 1 212 ? -32.240 6.247   54.447  1.00 124.23 ? 191 VAL A N     1 
ATOM   1441  C  CA    . VAL A 1 212 ? -33.275 6.401   53.432  1.00 136.21 ? 191 VAL A CA    1 
ATOM   1442  C  C     . VAL A 1 212 ? -33.229 5.238   52.446  1.00 126.69 ? 191 VAL A C     1 
ATOM   1443  O  O     . VAL A 1 212 ? -34.286 4.720   52.055  1.00 146.16 ? 191 VAL A O     1 
ATOM   1444  C  CB    . VAL A 1 212 ? -33.225 7.788   52.743  1.00 128.78 ? 191 VAL A CB    1 
ATOM   1445  C  CG1   . VAL A 1 212 ? -31.863 8.472   52.866  1.00 123.99 ? 191 VAL A CG1   1 
ATOM   1446  C  CG2   . VAL A 1 212 ? -33.698 7.700   51.298  1.00 128.46 ? 191 VAL A CG2   1 
ATOM   1447  N  N     . LEU A 1 213 ? -32.032 4.702   52.160  1.00 124.08 ? 192 LEU A N     1 
ATOM   1448  C  CA    . LEU A 1 213 ? -31.947 3.596   51.213  1.00 124.48 ? 192 LEU A CA    1 
ATOM   1449  C  C     . LEU A 1 213 ? -32.654 2.368   51.749  1.00 147.03 ? 192 LEU A C     1 
ATOM   1450  O  O     . LEU A 1 213 ? -33.443 1.728   51.035  1.00 161.44 ? 192 LEU A O     1 
ATOM   1451  C  CB    . LEU A 1 213 ? -30.500 3.234   50.911  1.00 121.75 ? 192 LEU A CB    1 
ATOM   1452  C  CG    . LEU A 1 213 ? -29.799 4.017   49.820  1.00 120.79 ? 192 LEU A CG    1 
ATOM   1453  C  CD1   . LEU A 1 213 ? -30.730 4.084   48.609  1.00 123.52 ? 192 LEU A CD1   1 
ATOM   1454  C  CD2   . LEU A 1 213 ? -29.363 5.369   50.259  1.00 119.30 ? 192 LEU A CD2   1 
ATOM   1455  N  N     . ALA A 1 214 ? -32.472 2.081   53.034  1.00 142.58 ? 193 ALA A N     1 
ATOM   1456  C  CA    . ALA A 1 214 ? -33.167 0.927   53.570  1.00 152.05 ? 193 ALA A CA    1 
ATOM   1457  C  C     . ALA A 1 214 ? -34.668 1.148   53.494  1.00 151.23 ? 193 ALA A C     1 
ATOM   1458  O  O     . ALA A 1 214 ? -35.406 0.252   53.069  1.00 155.26 ? 193 ALA A O     1 
ATOM   1459  C  CB    . ALA A 1 214 ? -32.715 0.657   55.002  1.00 159.96 ? 193 ALA A CB    1 
ATOM   1460  N  N     . ASP A 1 215 ? -35.122 2.373   53.811  1.00 148.39 ? 194 ASP A N     1 
ATOM   1461  C  CA    . ASP A 1 215 ? -36.553 2.649   53.782  1.00 141.22 ? 194 ASP A CA    1 
ATOM   1462  C  C     . ASP A 1 215 ? -37.102 2.540   52.367  1.00 146.83 ? 194 ASP A C     1 
ATOM   1463  O  O     . ASP A 1 215 ? -38.241 2.105   52.168  1.00 181.96 ? 194 ASP A O     1 
ATOM   1464  C  CB    . ASP A 1 215 ? -36.867 4.032   54.359  1.00 166.86 ? 194 ASP A CB    1 
ATOM   1465  C  CG    . ASP A 1 215 ? -36.924 4.042   55.874  1.00 182.53 ? 194 ASP A CG    1 
ATOM   1466  O  OD1   . ASP A 1 215 ? -36.977 5.152   56.454  1.00 188.78 ? 194 ASP A OD1   1 
ATOM   1467  O  OD2   . ASP A 1 215 ? -36.974 2.950   56.480  1.00 181.12 ? 194 ASP A OD2   1 
ATOM   1468  N  N     . LEU A 1 216 ? -36.317 2.922   51.368  1.00 134.90 ? 195 LEU A N     1 
ATOM   1469  C  CA    . LEU A 1 216 ? -36.852 2.869   50.018  1.00 137.30 ? 195 LEU A CA    1 
ATOM   1470  C  C     . LEU A 1 216 ? -36.878 1.443   49.487  1.00 138.20 ? 195 LEU A C     1 
ATOM   1471  O  O     . LEU A 1 216 ? -37.535 1.178   48.473  1.00 141.10 ? 195 LEU A O     1 
ATOM   1472  C  CB    . LEU A 1 216 ? -36.024 3.801   49.117  1.00 135.67 ? 195 LEU A CB    1 
ATOM   1473  C  CG    . LEU A 1 216 ? -36.340 4.109   47.650  1.00 137.78 ? 195 LEU A CG    1 
ATOM   1474  C  CD1   . LEU A 1 216 ? -37.828 4.233   47.371  1.00 142.17 ? 195 LEU A CD1   1 
ATOM   1475  C  CD2   . LEU A 1 216 ? -35.572 5.342   47.185  1.00 135.89 ? 195 LEU A CD2   1 
ATOM   1476  N  N     . GLY A 1 217 ? -36.218 0.516   50.178  1.00 149.12 ? 196 GLY A N     1 
ATOM   1477  C  CA    . GLY A 1 217 ? -36.117 -0.840  49.693  1.00 151.33 ? 196 GLY A CA    1 
ATOM   1478  C  C     . GLY A 1 217 ? -35.038 -1.005  48.656  1.00 142.13 ? 196 GLY A C     1 
ATOM   1479  O  O     . GLY A 1 217 ? -35.127 -1.908  47.820  1.00 146.53 ? 196 GLY A O     1 
ATOM   1480  N  N     . ILE A 1 218 ? -34.033 -0.139  48.663  1.00 139.08 ? 197 ILE A N     1 
ATOM   1481  C  CA    . ILE A 1 218 ? -32.976 -0.218  47.671  1.00 135.02 ? 197 ILE A CA    1 
ATOM   1482  C  C     . ILE A 1 218 ? -31.885 -1.155  48.177  1.00 137.82 ? 197 ILE A C     1 
ATOM   1483  O  O     . ILE A 1 218 ? -31.604 -2.190  47.557  1.00 141.59 ? 197 ILE A O     1 
ATOM   1484  C  CB    . ILE A 1 218 ? -32.425 1.176   47.341  1.00 135.12 ? 197 ILE A CB    1 
ATOM   1485  C  CG1   . ILE A 1 218 ? -33.502 2.065   46.724  1.00 141.25 ? 197 ILE A CG1   1 
ATOM   1486  C  CG2   . ILE A 1 218 ? -31.377 1.045   46.296  1.00 131.47 ? 197 ILE A CG2   1 
ATOM   1487  C  CD1   . ILE A 1 218 ? -34.214 1.434   45.541  1.00 152.19 ? 197 ILE A CD1   1 
ATOM   1488  N  N     . TYR A 1 219 ? -31.243 -0.789  49.288  1.00 128.08 ? 198 TYR A N     1 
ATOM   1489  C  CA    . TYR A 1 219 ? -30.410 -1.725  50.037  1.00 122.86 ? 198 TYR A CA    1 
ATOM   1490  C  C     . TYR A 1 219 ? -31.319 -2.328  51.108  1.00 153.77 ? 198 TYR A C     1 
ATOM   1491  O  O     . TYR A 1 219 ? -31.765 -1.616  52.014  1.00 179.72 ? 198 TYR A O     1 
ATOM   1492  C  CB    . TYR A 1 219 ? -29.179 -1.033  50.634  1.00 119.52 ? 198 TYR A CB    1 
ATOM   1493  N  N     . ARG A 1 220 ? -31.645 -3.623  50.973  1.00 137.62 ? 199 ARG A N     1 
ATOM   1494  C  CA    . ARG A 1 220 ? -32.519 -4.345  51.902  1.00 128.23 ? 199 ARG A CA    1 
ATOM   1495  C  C     . ARG A 1 220 ? -31.649 -5.271  52.759  1.00 138.77 ? 199 ARG A C     1 
ATOM   1496  O  O     . ARG A 1 220 ? -30.989 -6.166  52.219  1.00 161.72 ? 199 ARG A O     1 
ATOM   1497  C  CB    . ARG A 1 220 ? -33.602 -5.119  51.134  1.00 131.64 ? 199 ARG A CB    1 
ATOM   1498  C  CG    . ARG A 1 220 ? -34.148 -6.347  51.884  1.00 142.12 ? 199 ARG A CG    1 
ATOM   1499  C  CD    . ARG A 1 220 ? -35.532 -6.839  51.399  1.00 157.80 ? 199 ARG A CD    1 
ATOM   1500  N  NE    . ARG A 1 220 ? -36.035 -8.038  52.111  1.00 166.23 ? 199 ARG A NE    1 
ATOM   1501  C  CZ    . ARG A 1 220 ? -36.944 -8.041  53.102  1.00 171.41 ? 199 ARG A CZ    1 
ATOM   1502  N  NH1   . ARG A 1 220 ? -37.466 -6.890  53.525  1.00 173.53 ? 199 ARG A NH1   1 
ATOM   1503  N  NH2   . ARG A 1 220 ? -37.345 -9.196  53.675  1.00 146.57 ? 199 ARG A NH2   1 
ATOM   1504  N  N     . TYR A 1 221 ? -31.649 -5.068  54.087  1.00 125.46 ? 200 TYR A N     1 
ATOM   1505  C  CA    . TYR A 1 221 ? -30.744 -5.778  54.994  1.00 122.64 ? 200 TYR A CA    1 
ATOM   1506  C  C     . TYR A 1 221 ? -31.468 -6.854  55.780  1.00 137.43 ? 200 TYR A C     1 
ATOM   1507  O  O     . TYR A 1 221 ? -32.682 -6.787  55.957  1.00 148.72 ? 200 TYR A O     1 
ATOM   1508  C  CB    . TYR A 1 221 ? -30.069 -4.850  56.022  1.00 127.81 ? 200 TYR A CB    1 
ATOM   1509  C  CG    . TYR A 1 221 ? -29.131 -3.863  55.404  1.00 140.82 ? 200 TYR A CG    1 
ATOM   1510  C  CD1   . TYR A 1 221 ? -29.479 -2.523  55.314  1.00 135.39 ? 200 TYR A CD1   1 
ATOM   1511  C  CD2   . TYR A 1 221 ? -27.883 -4.260  54.937  1.00 120.60 ? 200 TYR A CD2   1 
ATOM   1512  C  CE1   . TYR A 1 221 ? -28.633 -1.607  54.738  1.00 126.58 ? 200 TYR A CE1   1 
ATOM   1513  C  CE2   . TYR A 1 221 ? -27.030 -3.348  54.348  1.00 133.59 ? 200 TYR A CE2   1 
ATOM   1514  C  CZ    . TYR A 1 221 ? -27.415 -2.018  54.255  1.00 133.46 ? 200 TYR A CZ    1 
ATOM   1515  O  OH    . TYR A 1 221 ? -26.586 -1.088  53.678  1.00 148.43 ? 200 TYR A OH    1 
ATOM   1516  N  N     . GLU A 1 222 ? -30.733 -7.891  56.189  1.00 143.35 ? 201 GLU A N     1 
ATOM   1517  C  CA    . GLU A 1 222 ? -31.301 -8.821  57.162  1.00 144.57 ? 201 GLU A CA    1 
ATOM   1518  C  C     . GLU A 1 222 ? -31.374 -8.163  58.543  1.00 134.07 ? 201 GLU A C     1 
ATOM   1519  O  O     . GLU A 1 222 ? -30.537 -7.325  58.912  1.00 125.39 ? 201 GLU A O     1 
ATOM   1520  C  CB    . GLU A 1 222 ? -30.513 -10.135 57.229  1.00 137.97 ? 201 GLU A CB    1 
ATOM   1521  C  CG    . GLU A 1 222 ? -30.843 -11.038 58.452  1.00 133.09 ? 201 GLU A CG    1 
ATOM   1522  C  CD    . GLU A 1 222 ? -32.183 -11.769 58.371  1.00 163.09 ? 201 GLU A CD    1 
ATOM   1523  O  OE1   . GLU A 1 222 ? -33.065 -11.334 57.609  1.00 169.73 ? 201 GLU A OE1   1 
ATOM   1524  O  OE2   . GLU A 1 222 ? -32.374 -12.773 59.101  1.00 184.41 ? 201 GLU A OE2   1 
ATOM   1525  N  N     . SER A 1 223 ? -32.424 -8.504  59.278  1.00 132.33 ? 202 SER A N     1 
ATOM   1526  C  CA    . SER A 1 223 ? -32.681 -7.979  60.610  1.00 135.54 ? 202 SER A CA    1 
ATOM   1527  C  C     . SER A 1 223 ? -32.356 -9.023  61.673  1.00 136.04 ? 202 SER A C     1 
ATOM   1528  O  O     . SER A 1 223 ? -33.031 -10.047 61.761  1.00 138.67 ? 202 SER A O     1 
ATOM   1529  C  CB    . SER A 1 223 ? -34.130 -7.537  60.673  1.00 144.78 ? 202 SER A CB    1 
ATOM   1530  O  OG    . SER A 1 223 ? -34.919 -8.649  60.313  1.00 169.11 ? 202 SER A OG    1 
ATOM   1531  N  N     . VAL A 1 224 ? -31.328 -8.767  62.469  1.00 133.92 ? 203 VAL A N     1 
ATOM   1532  C  CA    . VAL A 1 224 ? -30.944 -9.615  63.592  1.00 134.90 ? 203 VAL A CA    1 
ATOM   1533  C  C     . VAL A 1 224 ? -31.452 -8.945  64.844  1.00 139.50 ? 203 VAL A C     1 
ATOM   1534  O  O     . VAL A 1 224 ? -31.403 -7.722  64.946  1.00 139.68 ? 203 VAL A O     1 
ATOM   1535  C  CB    . VAL A 1 224 ? -29.418 -9.812  63.662  1.00 130.03 ? 203 VAL A CB    1 
ATOM   1536  C  CG1   . VAL A 1 224 ? -29.011 -10.610 64.900  1.00 131.72 ? 203 VAL A CG1   1 
ATOM   1537  C  CG2   . VAL A 1 224 ? -28.925 -10.457 62.394  1.00 125.79 ? 203 VAL A CG2   1 
ATOM   1538  N  N     . GLU A 1 225 ? -31.923 -9.739  65.802  1.00 143.49 ? 204 GLU A N     1 
ATOM   1539  C  CA    . GLU A 1 225 ? -32.414 -9.238  67.081  1.00 148.50 ? 204 GLU A CA    1 
ATOM   1540  C  C     . GLU A 1 225 ? -31.307 -9.422  68.106  1.00 147.46 ? 204 GLU A C     1 
ATOM   1541  O  O     . GLU A 1 225 ? -31.134 -10.511 68.652  1.00 148.65 ? 204 GLU A O     1 
ATOM   1542  C  CB    . GLU A 1 225 ? -33.647 -10.009 67.537  1.00 154.37 ? 204 GLU A CB    1 
ATOM   1543  C  CG    . GLU A 1 225 ? -34.872 -9.950  66.670  1.00 156.81 ? 204 GLU A CG    1 
ATOM   1544  C  CD    . GLU A 1 225 ? -36.035 -9.268  67.384  1.00 203.75 ? 204 GLU A CD    1 
ATOM   1545  O  OE1   . GLU A 1 225 ? -36.409 -9.681  68.512  1.00 177.24 ? 204 GLU A OE1   1 
ATOM   1546  O  OE2   . GLU A 1 225 ? -36.554 -8.282  66.827  1.00 216.68 ? 204 GLU A OE2   1 
ATOM   1547  N  N     . PHE A 1 226 ? -30.634 -8.340  68.445  1.00 146.11 ? 205 PHE A N     1 
ATOM   1548  C  CA    . PHE A 1 226 ? -29.537 -8.338  69.394  1.00 145.39 ? 205 PHE A CA    1 
ATOM   1549  C  C     . PHE A 1 226 ? -29.979 -7.608  70.644  1.00 150.64 ? 205 PHE A C     1 
ATOM   1550  O  O     . PHE A 1 226 ? -30.949 -6.847  70.608  1.00 153.71 ? 205 PHE A O     1 
ATOM   1551  C  CB    . PHE A 1 226 ? -28.348 -7.618  68.770  1.00 139.97 ? 205 PHE A CB    1 
ATOM   1552  C  CG    . PHE A 1 226 ? -28.757 -6.364  68.033  1.00 160.11 ? 205 PHE A CG    1 
ATOM   1553  C  CD1   . PHE A 1 226 ? -29.265 -6.441  66.741  1.00 165.05 ? 205 PHE A CD1   1 
ATOM   1554  C  CD2   . PHE A 1 226 ? -28.681 -5.118  68.635  1.00 149.09 ? 205 PHE A CD2   1 
ATOM   1555  C  CE1   . PHE A 1 226 ? -29.675 -5.303  66.059  1.00 148.89 ? 205 PHE A CE1   1 
ATOM   1556  C  CE2   . PHE A 1 226 ? -29.079 -3.977  67.949  1.00 140.85 ? 205 PHE A CE2   1 
ATOM   1557  C  CZ    . PHE A 1 226 ? -29.579 -4.074  66.666  1.00 139.02 ? 205 PHE A CZ    1 
ATOM   1558  N  N     . SER A 1 227 ? -29.177 -7.704  71.706  1.00 168.28 ? 206 SER A N     1 
ATOM   1559  C  CA    . SER A 1 227 ? -29.578 -7.111  72.981  1.00 190.08 ? 206 SER A CA    1 
ATOM   1560  C  C     . SER A 1 227 ? -29.512 -5.588  72.903  1.00 191.12 ? 206 SER A C     1 
ATOM   1561  O  O     . SER A 1 227 ? -28.762 -5.011  72.112  1.00 163.50 ? 206 SER A O     1 
ATOM   1562  C  CB    . SER A 1 227 ? -28.738 -7.634  74.162  1.00 183.85 ? 206 SER A CB    1 
ATOM   1563  O  OG    . SER A 1 227 ? -27.454 -7.044  74.235  1.00 183.12 ? 206 SER A OG    1 
ATOM   1564  N  N     . ALA A 1 228 ? -30.350 -4.931  73.701  1.00 211.70 ? 207 ALA A N     1 
ATOM   1565  C  CA    . ALA A 1 228 ? -30.310 -3.480  73.680  1.00 184.18 ? 207 ALA A CA    1 
ATOM   1566  C  C     . ALA A 1 228 ? -29.021 -2.928  74.273  1.00 175.85 ? 207 ALA A C     1 
ATOM   1567  O  O     . ALA A 1 228 ? -28.757 -1.737  74.118  1.00 170.51 ? 207 ALA A O     1 
ATOM   1568  C  CB    . ALA A 1 228 ? -31.517 -2.902  74.427  1.00 191.84 ? 207 ALA A CB    1 
ATOM   1569  N  N     . ASP A 1 229 ? -28.203 -3.753  74.928  1.00 186.84 ? 208 ASP A N     1 
ATOM   1570  C  CA    . ASP A 1 229 ? -26.943 -3.282  75.487  1.00 191.18 ? 208 ASP A CA    1 
ATOM   1571  C  C     . ASP A 1 229 ? -25.754 -3.559  74.588  1.00 176.18 ? 208 ASP A C     1 
ATOM   1572  O  O     . ASP A 1 229 ? -24.649 -3.087  74.881  1.00 171.14 ? 208 ASP A O     1 
ATOM   1573  C  CB    . ASP A 1 229 ? -26.683 -3.919  76.853  1.00 210.83 ? 208 ASP A CB    1 
ATOM   1574  C  CG    . ASP A 1 229 ? -25.843 -3.030  77.753  1.00 239.74 ? 208 ASP A CG    1 
ATOM   1575  O  OD1   . ASP A 1 229 ? -24.621 -3.264  77.826  1.00 242.11 ? 208 ASP A OD1   1 
ATOM   1576  O  OD2   . ASP A 1 229 ? -26.385 -2.070  78.344  1.00 258.77 ? 208 ASP A OD2   1 
ATOM   1577  N  N     . SER A 1 230 ? -25.955 -4.277  73.486  1.00 183.68 ? 209 SER A N     1 
ATOM   1578  C  CA    . SER A 1 230 ? -24.855 -4.606  72.596  1.00 172.00 ? 209 SER A CA    1 
ATOM   1579  C  C     . SER A 1 230 ? -24.577 -3.426  71.686  1.00 161.90 ? 209 SER A C     1 
ATOM   1580  O  O     . SER A 1 230 ? -25.496 -2.748  71.218  1.00 142.50 ? 209 SER A O     1 
ATOM   1581  C  CB    . SER A 1 230 ? -25.185 -5.835  71.764  1.00 160.73 ? 209 SER A CB    1 
ATOM   1582  O  OG    . SER A 1 230 ? -26.213 -5.515  70.849  1.00 162.77 ? 209 SER A OG    1 
ATOM   1583  N  N     . ARG A 1 231 ? -23.297 -3.198  71.425  1.00 163.17 ? 210 ARG A N     1 
ATOM   1584  C  CA    . ARG A 1 231 ? -22.867 -1.979  70.763  1.00 154.40 ? 210 ARG A CA    1 
ATOM   1585  C  C     . ARG A 1 231 ? -21.500 -2.198  70.121  1.00 137.77 ? 210 ARG A C     1 
ATOM   1586  O  O     . ARG A 1 231 ? -20.833 -3.213  70.360  1.00 128.61 ? 210 ARG A O     1 
ATOM   1587  C  CB    . ARG A 1 231 ? -22.856 -0.811  71.756  1.00 160.59 ? 210 ARG A CB    1 
ATOM   1588  C  CG    . ARG A 1 231 ? -22.232 -1.140  73.104  1.00 149.52 ? 210 ARG A CG    1 
ATOM   1589  C  CD    . ARG A 1 231 ? -21.339 -0.006  73.481  1.00 155.14 ? 210 ARG A CD    1 
ATOM   1590  N  NE    . ARG A 1 231 ? -21.741 0.824   74.603  1.00 152.67 ? 210 ARG A NE    1 
ATOM   1591  C  CZ    . ARG A 1 231 ? -21.097 0.823   75.757  1.00 150.57 ? 210 ARG A CZ    1 
ATOM   1592  N  NH1   . ARG A 1 231 ? -20.050 0.034   75.920  1.00 148.93 ? 210 ARG A NH1   1 
ATOM   1593  N  NH2   . ARG A 1 231 ? -21.476 1.621   76.729  1.00 155.65 ? 210 ARG A NH2   1 
ATOM   1594  N  N     . GLY A 1 232 ? -21.134 -1.250  69.246  1.00 126.98 ? 211 GLY A N     1 
ATOM   1595  C  CA    . GLY A 1 232 ? -19.893 -1.350  68.480  1.00 122.75 ? 211 GLY A CA    1 
ATOM   1596  C  C     . GLY A 1 232 ? -18.622 -1.207  69.306  1.00 143.00 ? 211 GLY A C     1 
ATOM   1597  O  O     . GLY A 1 232 ? -17.665 -1.976  69.140  1.00 147.64 ? 211 GLY A O     1 
ATOM   1598  N  N     . PHE A 1 233 ? -18.551 -0.160  70.121  1.00 137.72 ? 212 PHE A N     1 
ATOM   1599  C  CA    . PHE A 1 233 ? -17.335 0.199   70.839  1.00 137.78 ? 212 PHE A CA    1 
ATOM   1600  C  C     . PHE A 1 233 ? -17.510 0.010   72.328  1.00 154.67 ? 212 PHE A C     1 
ATOM   1601  O  O     . PHE A 1 233 ? -18.496 0.477   72.893  1.00 151.40 ? 212 PHE A O     1 
ATOM   1602  C  CB    . PHE A 1 233 ? -16.972 1.649   70.570  1.00 129.13 ? 212 PHE A CB    1 
ATOM   1603  C  CG    . PHE A 1 233 ? -16.526 1.858   69.203  1.00 123.17 ? 212 PHE A CG    1 
ATOM   1604  C  CD1   . PHE A 1 233 ? -15.208 1.656   68.870  1.00 120.72 ? 212 PHE A CD1   1 
ATOM   1605  C  CD2   . PHE A 1 233 ? -17.438 2.165   68.219  1.00 123.49 ? 212 PHE A CD2   1 
ATOM   1606  C  CE1   . PHE A 1 233 ? -14.792 1.796   67.580  1.00 118.12 ? 212 PHE A CE1   1 
ATOM   1607  C  CE2   . PHE A 1 233 ? -17.033 2.315   66.913  1.00 135.23 ? 212 PHE A CE2   1 
ATOM   1608  C  CZ    . PHE A 1 233 ? -15.704 2.129   66.588  1.00 126.88 ? 212 PHE A CZ    1 
ATOM   1609  N  N     . ARG A 1 234 ? -16.545 -0.627  72.975  1.00 163.97 ? 213 ARG A N     1 
ATOM   1610  C  CA    . ARG A 1 234 ? -16.611 -0.722  74.435  1.00 161.69 ? 213 ARG A CA    1 
ATOM   1611  C  C     . ARG A 1 234 ? -16.008 0.515   75.096  1.00 141.28 ? 213 ARG A C     1 
ATOM   1612  O  O     . ARG A 1 234 ? -16.738 1.361   75.603  1.00 144.62 ? 213 ARG A O     1 
ATOM   1613  C  CB    . ARG A 1 234 ? -15.958 -2.011  74.919  1.00 175.67 ? 213 ARG A CB    1 
ATOM   1614  C  CG    . ARG A 1 234 ? -16.927 -3.193  74.954  1.00 183.56 ? 213 ARG A CG    1 
ATOM   1615  C  CD    . ARG A 1 234 ? -16.225 -4.472  75.361  1.00 184.71 ? 213 ARG A CD    1 
ATOM   1616  N  NE    . ARG A 1 234 ? -15.089 -4.161  76.221  1.00 193.92 ? 213 ARG A NE    1 
ATOM   1617  C  CZ    . ARG A 1 234 ? -15.169 -3.768  77.488  1.00 186.45 ? 213 ARG A CZ    1 
ATOM   1618  N  NH1   . ARG A 1 234 ? -16.351 -3.608  78.074  1.00 202.13 ? 213 ARG A NH1   1 
ATOM   1619  N  NH2   . ARG A 1 234 ? -14.055 -3.505  78.156  1.00 171.50 ? 213 ARG A NH2   1 
ATOM   1620  N  N     . LEU A 1 235 ? -14.696 0.661   75.043  1.00 140.16 ? 214 LEU A N     1 
ATOM   1621  C  CA    . LEU A 1 235 ? -14.077 1.810   75.690  1.00 143.27 ? 214 LEU A CA    1 
ATOM   1622  C  C     . LEU A 1 235 ? -14.120 3.037   74.794  1.00 141.09 ? 214 LEU A C     1 
ATOM   1623  O  O     . LEU A 1 235 ? -14.258 2.936   73.575  1.00 153.89 ? 214 LEU A O     1 
ATOM   1624  C  CB    . LEU A 1 235 ? -12.633 1.537   76.081  1.00 152.87 ? 214 LEU A CB    1 
ATOM   1625  C  CG    . LEU A 1 235 ? -12.404 0.650   77.298  1.00 171.40 ? 214 LEU A CG    1 
ATOM   1626  C  CD1   . LEU A 1 235 ? -12.674 -0.840  76.988  1.00 169.51 ? 214 LEU A CD1   1 
ATOM   1627  C  CD2   . LEU A 1 235 ? -11.000 0.918   77.879  1.00 175.35 ? 214 LEU A CD2   1 
ATOM   1628  N  N     . ARG A 1 236 ? -14.055 4.215   75.419  1.00 144.75 ? 215 ARG A N     1 
ATOM   1629  C  CA    . ARG A 1 236 ? -13.817 5.427   74.637  1.00 143.24 ? 215 ARG A CA    1 
ATOM   1630  C  C     . ARG A 1 236 ? -12.439 5.403   73.994  1.00 140.26 ? 215 ARG A C     1 
ATOM   1631  O  O     . ARG A 1 236 ? -12.261 5.882   72.869  1.00 136.94 ? 215 ARG A O     1 
ATOM   1632  C  CB    . ARG A 1 236 ? -13.987 6.680   75.492  1.00 148.25 ? 215 ARG A CB    1 
ATOM   1633  C  CG    . ARG A 1 236 ? -13.531 7.942   74.795  1.00 147.38 ? 215 ARG A CG    1 
ATOM   1634  C  CD    . ARG A 1 236 ? -13.749 9.134   75.666  1.00 152.68 ? 215 ARG A CD    1 
ATOM   1635  N  NE    . ARG A 1 236 ? -13.641 10.389  74.932  1.00 152.71 ? 215 ARG A NE    1 
ATOM   1636  C  CZ    . ARG A 1 236 ? -14.628 10.910  74.209  1.00 157.15 ? 215 ARG A CZ    1 
ATOM   1637  N  NH1   . ARG A 1 236 ? -14.449 12.066  73.575  1.00 151.36 ? 215 ARG A NH1   1 
ATOM   1638  N  NH2   . ARG A 1 236 ? -15.788 10.262  74.108  1.00 150.58 ? 215 ARG A NH2   1 
ATOM   1639  N  N     . ALA A 1 237 ? -11.440 4.889   74.705  1.00 148.88 ? 216 ALA A N     1 
ATOM   1640  C  CA    . ALA A 1 237 ? -10.122 4.760   74.101  1.00 154.44 ? 216 ALA A CA    1 
ATOM   1641  C  C     . ALA A 1 237 ? -10.144 3.906   72.847  1.00 133.87 ? 216 ALA A C     1 
ATOM   1642  O  O     . ALA A 1 237 ? -9.248  4.059   72.009  1.00 133.06 ? 216 ALA A O     1 
ATOM   1643  C  CB    . ALA A 1 237 ? -9.130  4.159   75.092  1.00 194.12 ? 216 ALA A CB    1 
ATOM   1644  N  N     . ASP A 1 238 ? -11.149 3.025   72.696  1.00 136.16 ? 217 ASP A N     1 
ATOM   1645  C  CA    . ASP A 1 238 ? -11.335 2.296   71.437  1.00 147.13 ? 217 ASP A CA    1 
ATOM   1646  C  C     . ASP A 1 238 ? -11.838 3.230   70.318  1.00 133.29 ? 217 ASP A C     1 
ATOM   1647  O  O     . ASP A 1 238 ? -11.283 3.248   69.206  1.00 121.41 ? 217 ASP A O     1 
ATOM   1648  C  CB    . ASP A 1 238 ? -12.302 1.094   71.622  1.00 159.95 ? 217 ASP A CB    1 
ATOM   1649  C  CG    . ASP A 1 238 ? -11.720 -0.076  72.481  1.00 152.82 ? 217 ASP A CG    1 
ATOM   1650  O  OD1   . ASP A 1 238 ? -10.506 -0.084  72.786  1.00 160.28 ? 217 ASP A OD1   1 
ATOM   1651  O  OD2   . ASP A 1 238 ? -12.487 -1.029  72.802  1.00 129.42 ? 217 ASP A OD2   1 
ATOM   1652  N  N     . VAL A 1 239 ? -12.861 4.044   70.601  1.00 127.23 ? 218 VAL A N     1 
ATOM   1653  C  CA    . VAL A 1 239 ? -13.280 5.066   69.643  1.00 125.94 ? 218 VAL A CA    1 
ATOM   1654  C  C     . VAL A 1 239 ? -12.106 5.974   69.288  1.00 125.72 ? 218 VAL A C     1 
ATOM   1655  O  O     . VAL A 1 239 ? -11.725 6.101   68.119  1.00 122.50 ? 218 VAL A O     1 
ATOM   1656  C  CB    . VAL A 1 239 ? -14.469 5.874   70.198  1.00 129.53 ? 218 VAL A CB    1 
ATOM   1657  C  CG1   . VAL A 1 239 ? -14.654 7.181   69.458  1.00 129.60 ? 218 VAL A CG1   1 
ATOM   1658  C  CG2   . VAL A 1 239 ? -15.724 5.080   70.058  1.00 128.98 ? 218 VAL A CG2   1 
ATOM   1659  N  N     . ASP A 1 240 ? -11.477 6.574   70.299  1.00 129.47 ? 219 ASP A N     1 
ATOM   1660  C  CA    . ASP A 1 240 ? -10.393 7.514   70.027  1.00 130.01 ? 219 ASP A CA    1 
ATOM   1661  C  C     . ASP A 1 240 ? -9.279  6.888   69.198  1.00 126.52 ? 219 ASP A C     1 
ATOM   1662  O  O     . ASP A 1 240 ? -8.740  7.537   68.295  1.00 125.13 ? 219 ASP A O     1 
ATOM   1663  C  CB    . ASP A 1 240 ? -9.878  8.098   71.331  1.00 135.01 ? 219 ASP A CB    1 
ATOM   1664  C  CG    . ASP A 1 240 ? -10.914 8.989   71.992  1.00 165.15 ? 219 ASP A CG    1 
ATOM   1665  O  OD1   . ASP A 1 240 ? -10.811 9.216   73.212  1.00 198.23 ? 219 ASP A OD1   1 
ATOM   1666  O  OD2   . ASP A 1 240 ? -11.846 9.461   71.292  1.00 137.62 ? 219 ASP A OD2   1 
ATOM   1667  N  N     . ALA A 1 241 ? -8.949  5.619   69.449  1.00 125.29 ? 220 ALA A N     1 
ATOM   1668  C  CA    . ALA A 1 241 ? -7.883  4.990   68.669  1.00 122.28 ? 220 ALA A CA    1 
ATOM   1669  C  C     . ALA A 1 241 ? -8.309  4.789   67.221  1.00 117.84 ? 220 ALA A C     1 
ATOM   1670  O  O     . ALA A 1 241 ? -7.558  5.122   66.297  1.00 116.56 ? 220 ALA A O     1 
ATOM   1671  C  CB    . ALA A 1 241 ? -7.474  3.659   69.287  1.00 123.03 ? 220 ALA A CB    1 
ATOM   1672  N  N     . TYR A 1 242 ? -9.505  4.231   66.996  1.00 117.71 ? 221 TYR A N     1 
ATOM   1673  C  CA    . TYR A 1 242 ? -9.970  4.108   65.619  1.00 112.64 ? 221 TYR A CA    1 
ATOM   1674  C  C     . TYR A 1 242 ? -9.865  5.459   64.931  1.00 113.06 ? 221 TYR A C     1 
ATOM   1675  O  O     . TYR A 1 242 ? -9.250  5.576   63.868  1.00 110.85 ? 221 TYR A O     1 
ATOM   1676  C  CB    . TYR A 1 242 ? -11.407 3.538   65.570  1.00 112.01 ? 221 TYR A CB    1 
ATOM   1677  C  CG    . TYR A 1 242 ? -11.890 3.153   64.174  1.00 108.40 ? 221 TYR A CG    1 
ATOM   1678  C  CD1   . TYR A 1 242 ? -12.329 4.113   63.287  1.00 108.58 ? 221 TYR A CD1   1 
ATOM   1679  C  CD2   . TYR A 1 242 ? -11.790 1.847   63.706  1.00 135.01 ? 221 TYR A CD2   1 
ATOM   1680  C  CE1   . TYR A 1 242 ? -12.726 3.788   61.994  1.00 128.48 ? 221 TYR A CE1   1 
ATOM   1681  C  CE2   . TYR A 1 242 ? -12.173 1.512   62.401  1.00 150.95 ? 221 TYR A CE2   1 
ATOM   1682  C  CZ    . TYR A 1 242 ? -12.638 2.494   61.546  1.00 142.03 ? 221 TYR A CZ    1 
ATOM   1683  O  OH    . TYR A 1 242 ? -13.021 2.191   60.246  1.00 138.11 ? 221 TYR A OH    1 
ATOM   1684  N  N     . LEU A 1 243 ? -10.339 6.516   65.598  1.00 116.44 ? 222 LEU A N     1 
ATOM   1685  C  CA    . LEU A 1 243 ? -10.321 7.843   64.988  1.00 117.40 ? 222 LEU A CA    1 
ATOM   1686  C  C     . LEU A 1 243 ? -8.900  8.306   64.675  1.00 117.52 ? 222 LEU A C     1 
ATOM   1687  O  O     . LEU A 1 243 ? -8.669  8.950   63.649  1.00 116.63 ? 222 LEU A O     1 
ATOM   1688  C  CB    . LEU A 1 243 ? -11.052 8.848   65.873  1.00 121.50 ? 222 LEU A CB    1 
ATOM   1689  C  CG    . LEU A 1 243 ? -12.474 9.153   65.406  1.00 121.56 ? 222 LEU A CG    1 
ATOM   1690  C  CD1   . LEU A 1 243 ? -12.802 8.498   64.106  1.00 117.64 ? 222 LEU A CD1   1 
ATOM   1691  C  CD2   . LEU A 1 243 ? -13.458 8.725   66.444  1.00 123.67 ? 222 LEU A CD2   1 
ATOM   1692  N  N     . HIS A 1 244 ? -7.927  7.975   65.520  1.00 118.97 ? 223 HIS A N     1 
ATOM   1693  C  CA    . HIS A 1 244 ? -6.564  8.390   65.201  1.00 119.47 ? 223 HIS A CA    1 
ATOM   1694  C  C     . HIS A 1 244 ? -6.033  7.637   63.976  1.00 115.53 ? 223 HIS A C     1 
ATOM   1695  O  O     . HIS A 1 244 ? -5.431  8.243   63.086  1.00 122.68 ? 223 HIS A O     1 
ATOM   1696  C  CB    . HIS A 1 244 ? -5.642  8.203   66.404  1.00 122.51 ? 223 HIS A CB    1 
ATOM   1697  C  CG    . HIS A 1 244 ? -4.230  8.636   66.157  1.00 123.72 ? 223 HIS A CG    1 
ATOM   1698  N  ND1   . HIS A 1 244 ? -3.176  7.749   66.137  1.00 122.95 ? 223 HIS A ND1   1 
ATOM   1699  C  CD2   . HIS A 1 244 ? -3.701  9.859   65.921  1.00 131.27 ? 223 HIS A CD2   1 
ATOM   1700  C  CE1   . HIS A 1 244 ? -2.058  8.406   65.889  1.00 124.76 ? 223 HIS A CE1   1 
ATOM   1701  N  NE2   . HIS A 1 244 ? -2.348  9.688   65.757  1.00 139.07 ? 223 HIS A NE2   1 
ATOM   1702  N  N     . LEU A 1 245 ? -6.217  6.314   63.912  1.00 112.91 ? 224 LEU A N     1 
ATOM   1703  C  CA    . LEU A 1 245 ? -5.770  5.602   62.718  1.00 109.37 ? 224 LEU A CA    1 
ATOM   1704  C  C     . LEU A 1 245 ? -6.413  6.187   61.465  1.00 107.65 ? 224 LEU A C     1 
ATOM   1705  O  O     . LEU A 1 245 ? -5.743  6.400   60.443  1.00 118.91 ? 224 LEU A O     1 
ATOM   1706  C  CB    . LEU A 1 245 ? -6.075  4.114   62.832  1.00 107.07 ? 224 LEU A CB    1 
ATOM   1707  C  CG    . LEU A 1 245 ? -5.293  3.345   63.881  1.00 108.67 ? 224 LEU A CG    1 
ATOM   1708  C  CD1   . LEU A 1 245 ? -5.756  1.914   63.845  1.00 106.41 ? 224 LEU A CD1   1 
ATOM   1709  C  CD2   . LEU A 1 245 ? -3.789  3.426   63.661  1.00 109.39 ? 224 LEU A CD2   1 
ATOM   1710  N  N     . PHE A 1 246 ? -7.704  6.499   61.540  1.00 107.96 ? 225 PHE A N     1 
ATOM   1711  C  CA    . PHE A 1 246 ? -8.395  7.084   60.399  1.00 106.98 ? 225 PHE A CA    1 
ATOM   1712  C  C     . PHE A 1 246 ? -7.780  8.413   60.028  1.00 109.11 ? 225 PHE A C     1 
ATOM   1713  O  O     . PHE A 1 246 ? -7.692  8.760   58.851  1.00 108.13 ? 225 PHE A O     1 
ATOM   1714  C  CB    . PHE A 1 246 ? -9.861  7.258   60.737  1.00 107.92 ? 225 PHE A CB    1 
ATOM   1715  C  CG    . PHE A 1 246 ? -10.691 7.670   59.602  1.00 107.15 ? 225 PHE A CG    1 
ATOM   1716  C  CD1   . PHE A 1 246 ? -11.189 8.937   59.522  1.00 109.82 ? 225 PHE A CD1   1 
ATOM   1717  C  CD2   . PHE A 1 246 ? -11.021 6.772   58.638  1.00 104.14 ? 225 PHE A CD2   1 
ATOM   1718  C  CE1   . PHE A 1 246 ? -11.991 9.307   58.479  1.00 109.61 ? 225 PHE A CE1   1 
ATOM   1719  C  CE2   . PHE A 1 246 ? -11.805 7.132   57.585  1.00 103.86 ? 225 PHE A CE2   1 
ATOM   1720  C  CZ    . PHE A 1 246 ? -12.298 8.401   57.505  1.00 107.87 ? 225 PHE A CZ    1 
ATOM   1721  N  N     . ASP A 1 247 ? -7.391  9.190   61.031  1.00 112.45 ? 226 ASP A N     1 
ATOM   1722  C  CA    . ASP A 1 247 ? -6.645  10.427  60.802  1.00 115.01 ? 226 ASP A CA    1 
ATOM   1723  C  C     . ASP A 1 247 ? -5.303  10.179  60.125  1.00 113.99 ? 226 ASP A C     1 
ATOM   1724  O  O     . ASP A 1 247 ? -4.871  10.983  59.297  1.00 116.79 ? 226 ASP A O     1 
ATOM   1725  C  CB    . ASP A 1 247 ? -6.452  11.167  62.129  1.00 138.49 ? 226 ASP A CB    1 
ATOM   1726  C  CG    . ASP A 1 247 ? -5.642  12.441  61.988  1.00 144.39 ? 226 ASP A CG    1 
ATOM   1727  O  OD1   . ASP A 1 247 ? -5.925  13.228  61.060  1.00 124.03 ? 226 ASP A OD1   1 
ATOM   1728  O  OD2   . ASP A 1 247 ? -4.725  12.654  62.819  1.00 169.91 ? 226 ASP A OD2   1 
ATOM   1729  N  N     . CYS A 1 248 ? -4.607  9.099   60.480  1.00 112.61 ? 227 CYS A N     1 
ATOM   1730  C  CA    . CYS A 1 248 ? -3.302  8.874   59.869  1.00 112.14 ? 227 CYS A CA    1 
ATOM   1731  C  C     . CYS A 1 248 ? -3.428  8.531   58.397  1.00 109.12 ? 227 CYS A C     1 
ATOM   1732  O  O     . CYS A 1 248 ? -2.695  9.083   57.580  1.00 109.88 ? 227 CYS A O     1 
ATOM   1733  C  CB    . CYS A 1 248 ? -2.491  7.827   60.629  1.00 112.01 ? 227 CYS A CB    1 
ATOM   1734  S  SG    . CYS A 1 248 ? -1.670  8.609   62.073  1.00 171.64 ? 227 CYS A SG    1 
ATOM   1735  N  N     . ARG A 1 249 ? -4.336  7.627   58.017  1.00 106.04 ? 228 ARG A N     1 
ATOM   1736  C  CA    . ARG A 1 249 ? -4.491  7.417   56.569  1.00 108.21 ? 228 ARG A CA    1 
ATOM   1737  C  C     . ARG A 1 249 ? -5.044  8.665   55.864  1.00 105.31 ? 228 ARG A C     1 
ATOM   1738  O  O     . ARG A 1 249 ? -4.626  8.973   54.748  1.00 118.45 ? 228 ARG A O     1 
ATOM   1739  C  CB    . ARG A 1 249 ? -5.324  6.166   56.239  1.00 109.66 ? 228 ARG A CB    1 
ATOM   1740  C  CG    . ARG A 1 249 ? -6.825  6.270   56.426  1.00 164.38 ? 228 ARG A CG    1 
ATOM   1741  C  CD    . ARG A 1 249 ? -7.557  5.047   55.860  1.00 188.65 ? 228 ARG A CD    1 
ATOM   1742  N  NE    . ARG A 1 249 ? -7.820  5.191   54.430  1.00 197.30 ? 228 ARG A NE    1 
ATOM   1743  C  CZ    . ARG A 1 249 ? -8.778  5.964   53.917  1.00 201.98 ? 228 ARG A CZ    1 
ATOM   1744  N  NH1   . ARG A 1 249 ? -9.577  6.677   54.705  1.00 194.51 ? 228 ARG A NH1   1 
ATOM   1745  N  NH2   . ARG A 1 249 ? -8.938  6.033   52.604  1.00 197.43 ? 228 ARG A NH2   1 
ATOM   1746  N  N     . GLN A 1 250 ? -5.957  9.417   56.478  1.00 107.20 ? 229 GLN A N     1 
ATOM   1747  C  CA    . GLN A 1 250 ? -6.394  10.640  55.812  1.00 109.28 ? 229 GLN A CA    1 
ATOM   1748  C  C     . GLN A 1 250 ? -5.206  11.555  55.546  1.00 111.80 ? 229 GLN A C     1 
ATOM   1749  O  O     . GLN A 1 250 ? -4.963  11.962  54.407  1.00 133.59 ? 229 GLN A O     1 
ATOM   1750  C  CB    . GLN A 1 250 ? -7.438  11.370  56.656  1.00 111.62 ? 229 GLN A CB    1 
ATOM   1751  C  CG    . GLN A 1 250 ? -8.814  10.729  56.685  1.00 134.18 ? 229 GLN A CG    1 
ATOM   1752  C  CD    . GLN A 1 250 ? -9.641  11.034  55.456  1.00 165.89 ? 229 GLN A CD    1 
ATOM   1753  O  OE1   . GLN A 1 250 ? -10.156 12.151  55.305  1.00 165.37 ? 229 GLN A OE1   1 
ATOM   1754  N  NE2   . GLN A 1 250 ? -9.791  10.034  54.571  1.00 158.39 ? 229 GLN A NE2   1 
ATOM   1755  N  N     . ARG A 1 251 ? -4.425  11.848  56.585  1.00 113.96 ? 230 ARG A N     1 
ATOM   1756  C  CA    . ARG A 1 251 ? -3.236  12.673  56.427  1.00 116.81 ? 230 ARG A CA    1 
ATOM   1757  C  C     . ARG A 1 251 ? -2.239  12.050  55.456  1.00 115.17 ? 230 ARG A C     1 
ATOM   1758  O  O     . ARG A 1 251 ? -1.416  12.757  54.875  1.00 117.39 ? 230 ARG A O     1 
ATOM   1759  C  CB    . ARG A 1 251 ? -2.591  12.936  57.801  1.00 126.64 ? 230 ARG A CB    1 
ATOM   1760  C  CG    . ARG A 1 251 ? -3.247  14.096  58.622  1.00 152.70 ? 230 ARG A CG    1 
ATOM   1761  C  CD    . ARG A 1 251 ? -2.973  14.084  60.145  1.00 159.00 ? 230 ARG A CD    1 
ATOM   1762  N  NE    . ARG A 1 251 ? -1.560  14.213  60.495  1.00 179.72 ? 230 ARG A NE    1 
ATOM   1763  C  CZ    . ARG A 1 251 ? -1.088  14.156  61.739  1.00 199.31 ? 230 ARG A CZ    1 
ATOM   1764  N  NH1   . ARG A 1 251 ? -1.916  13.982  62.765  1.00 200.29 ? 230 ARG A NH1   1 
ATOM   1765  N  NH2   . ARG A 1 251 ? 0.215   14.277  61.962  1.00 210.26 ? 230 ARG A NH2   1 
ATOM   1766  N  N     . PHE A 1 252 ? -2.220  10.732  55.348  1.00 111.76 ? 231 PHE A N     1 
ATOM   1767  C  CA    . PHE A 1 252 ? -1.309  10.062  54.427  1.00 110.29 ? 231 PHE A CA    1 
ATOM   1768  C  C     . PHE A 1 252 ? -1.794  10.055  52.975  1.00 113.70 ? 231 PHE A C     1 
ATOM   1769  O  O     . PHE A 1 252 ? -1.023  10.372  52.062  1.00 130.77 ? 231 PHE A O     1 
ATOM   1770  C  CB    . PHE A 1 252 ? -1.067  8.644   54.910  1.00 107.68 ? 231 PHE A CB    1 
ATOM   1771  C  CG    . PHE A 1 252 ? -0.434  7.764   53.894  1.00 105.62 ? 231 PHE A CG    1 
ATOM   1772  C  CD1   . PHE A 1 252 ? 0.872   7.949   53.517  1.00 107.45 ? 231 PHE A CD1   1 
ATOM   1773  C  CD2   . PHE A 1 252 ? -1.137  6.728   53.343  1.00 102.18 ? 231 PHE A CD2   1 
ATOM   1774  C  CE1   . PHE A 1 252 ? 1.454   7.125   52.594  1.00 105.86 ? 231 PHE A CE1   1 
ATOM   1775  C  CE2   . PHE A 1 252 ? -0.553  5.916   52.425  1.00 100.57 ? 231 PHE A CE2   1 
ATOM   1776  C  CZ    . PHE A 1 252 ? 0.744   6.109   52.056  1.00 102.39 ? 231 PHE A CZ    1 
ATOM   1777  N  N     . ASP A 1 253 ? -3.063  9.684   52.731  1.00 107.46 ? 232 ASP A N     1 
ATOM   1778  C  CA    . ASP A 1 253 ? -3.577  9.599   51.362  1.00 105.41 ? 232 ASP A CA    1 
ATOM   1779  C  C     . ASP A 1 253 ? -3.612  10.973  50.718  1.00 152.31 ? 232 ASP A C     1 
ATOM   1780  O  O     . ASP A 1 253 ? -3.888  11.082  49.518  1.00 170.30 ? 232 ASP A O     1 
ATOM   1781  C  CB    . ASP A 1 253 ? -4.965  8.920   51.325  1.00 121.05 ? 232 ASP A CB    1 
ATOM   1782  C  CG    . ASP A 1 253 ? -4.891  7.350   51.460  1.00 161.33 ? 232 ASP A CG    1 
ATOM   1783  O  OD1   . ASP A 1 253 ? -3.849  6.751   51.121  1.00 169.24 ? 232 ASP A OD1   1 
ATOM   1784  O  OD2   . ASP A 1 253 ? -5.877  6.696   51.894  1.00 156.71 ? 232 ASP A OD2   1 
ATOM   1785  N  N     . LEU A 1 254 ? -3.351  12.008  51.517  1.00 137.39 ? 233 LEU A N     1 
ATOM   1786  C  CA    . LEU A 1 254 ? -3.063  13.378  51.120  1.00 123.83 ? 233 LEU A CA    1 
ATOM   1787  C  C     . LEU A 1 254 ? -1.537  13.444  51.144  1.00 143.54 ? 233 LEU A C     1 
ATOM   1788  O  O     . LEU A 1 254 ? -0.888  13.497  50.094  1.00 143.81 ? 233 LEU A O     1 
ATOM   1789  C  CB    . LEU A 1 254 ? -3.716  14.370  52.083  1.00 126.77 ? 233 LEU A CB    1 
ATOM   1790  C  CG    . LEU A 1 254 ? -5.243  14.163  52.152  1.00 145.77 ? 233 LEU A CG    1 
ATOM   1791  C  CD1   . LEU A 1 254 ? -6.004  15.286  52.880  1.00 120.21 ? 233 LEU A CD1   1 
ATOM   1792  C  CD2   . LEU A 1 254 ? -5.850  13.870  50.763  1.00 143.58 ? 233 LEU A CD2   1 
ATOM   1793  N  N     . GLY A 1 255 ? -0.964  13.450  52.350  1.00 154.17 ? 234 GLY A N     1 
ATOM   1794  C  CA    . GLY A 1 255 ? 0.476   13.400  52.560  1.00 143.30 ? 234 GLY A CA    1 
ATOM   1795  C  C     . GLY A 1 255 ? 1.018   14.798  52.456  1.00 144.58 ? 234 GLY A C     1 
ATOM   1796  O  O     . GLY A 1 255 ? 0.372   15.591  51.782  1.00 156.78 ? 234 GLY A O     1 
ATOM   1797  N  N     . GLU A 1 256 ? 2.113   15.187  53.115  1.00 161.15 ? 235 GLU A N     1 
ATOM   1798  C  CA    . GLU A 1 256 ? 2.771   14.650  54.317  1.00 128.17 ? 235 GLU A CA    1 
ATOM   1799  C  C     . GLU A 1 256 ? 3.638   13.430  54.250  1.00 157.71 ? 235 GLU A C     1 
ATOM   1800  O  O     . GLU A 1 256 ? 3.361   12.491  53.504  1.00 170.16 ? 235 GLU A O     1 
ATOM   1801  C  CB    . GLU A 1 256 ? 1.702   14.371  55.352  1.00 126.42 ? 235 GLU A CB    1 
ATOM   1802  C  CG    . GLU A 1 256 ? 1.884   15.126  56.606  1.00 154.78 ? 235 GLU A CG    1 
ATOM   1803  C  CD    . GLU A 1 256 ? 0.565   15.403  57.271  1.00 164.40 ? 235 GLU A CD    1 
ATOM   1804  O  OE1   . GLU A 1 256 ? -0.460  15.321  56.561  1.00 168.26 ? 235 GLU A OE1   1 
ATOM   1805  O  OE2   . GLU A 1 256 ? 0.552   15.675  58.497  1.00 169.79 ? 235 GLU A OE2   1 
ATOM   1806  N  N     . PRO A 1 257 ? 4.704   13.474  55.050  1.00 153.26 ? 236 PRO A N     1 
ATOM   1807  C  CA    . PRO A 1 257 ? 5.603   12.325  55.194  1.00 168.35 ? 236 PRO A CA    1 
ATOM   1808  C  C     . PRO A 1 257 ? 5.134   11.362  56.263  1.00 164.39 ? 236 PRO A C     1 
ATOM   1809  O  O     . PRO A 1 257 ? 4.513   11.755  57.256  1.00 158.90 ? 236 PRO A O     1 
ATOM   1810  C  CB    . PRO A 1 257 ? 6.930   12.965  55.605  1.00 170.00 ? 236 PRO A CB    1 
ATOM   1811  C  CG    . PRO A 1 257 ? 6.510   14.149  56.370  1.00 154.87 ? 236 PRO A CG    1 
ATOM   1812  C  CD    . PRO A 1 257 ? 5.259   14.673  55.701  1.00 136.68 ? 236 PRO A CD    1 
ATOM   1813  N  N     . LEU A 1 258 ? 5.444   10.084  56.058  1.00 142.67 ? 237 LEU A N     1 
ATOM   1814  C  CA    . LEU A 1 258 ? 5.252   9.145   57.152  1.00 138.13 ? 237 LEU A CA    1 
ATOM   1815  C  C     . LEU A 1 258 ? 6.207   9.423   58.292  1.00 155.51 ? 237 LEU A C     1 
ATOM   1816  O  O     . LEU A 1 258 ? 5.915   9.044   59.435  1.00 150.53 ? 237 LEU A O     1 
ATOM   1817  C  CB    . LEU A 1 258 ? 5.462   7.702   56.726  1.00 118.53 ? 237 LEU A CB    1 
ATOM   1818  C  CG    . LEU A 1 258 ? 4.550   6.962   55.788  1.00 113.91 ? 237 LEU A CG    1 
ATOM   1819  C  CD1   . LEU A 1 258 ? 4.332   7.741   54.509  1.00 140.46 ? 237 LEU A CD1   1 
ATOM   1820  C  CD2   . LEU A 1 258 ? 5.299   5.683   55.533  1.00 112.67 ? 237 LEU A CD2   1 
ATOM   1821  N  N     . GLU A 1 259 ? 7.341   10.073  58.000  1.00 158.70 ? 238 GLU A N     1 
ATOM   1822  C  CA    . GLU A 1 259 ? 8.355   10.259  59.027  1.00 161.68 ? 238 GLU A CA    1 
ATOM   1823  C  C     . GLU A 1 259 ? 7.756   10.979  60.224  1.00 147.90 ? 238 GLU A C     1 
ATOM   1824  O  O     . GLU A 1 259 ? 8.081   10.664  61.374  1.00 141.46 ? 238 GLU A O     1 
ATOM   1825  C  CB    . GLU A 1 259 ? 9.563   10.993  58.442  1.00 173.25 ? 238 GLU A CB    1 
ATOM   1826  C  CG    . GLU A 1 259 ? 10.803  11.012  59.344  1.00 213.91 ? 238 GLU A CG    1 
ATOM   1827  C  CD    . GLU A 1 259 ? 11.828  12.089  58.958  1.00 257.59 ? 238 GLU A CD    1 
ATOM   1828  O  OE1   . GLU A 1 259 ? 12.932  11.729  58.485  1.00 267.71 ? 238 GLU A OE1   1 
ATOM   1829  O  OE2   . GLU A 1 259 ? 11.532  13.294  59.119  1.00 270.88 ? 238 GLU A OE2   1 
ATOM   1830  N  N     . GLU A 1 260 ? 6.842   11.905  59.982  1.00 141.49 ? 239 GLU A N     1 
ATOM   1831  C  CA    . GLU A 1 260 ? 6.116   12.511  61.085  1.00 167.46 ? 239 GLU A CA    1 
ATOM   1832  C  C     . GLU A 1 260 ? 4.855   11.739  61.458  1.00 142.38 ? 239 GLU A C     1 
ATOM   1833  O  O     . GLU A 1 260 ? 4.270   12.012  62.512  1.00 144.23 ? 239 GLU A O     1 
ATOM   1834  C  CB    . GLU A 1 260 ? 5.769   13.957  60.746  1.00 206.16 ? 239 GLU A CB    1 
ATOM   1835  C  CG    . GLU A 1 260 ? 6.813   14.613  59.874  1.00 227.95 ? 239 GLU A CG    1 
ATOM   1836  C  CD    . GLU A 1 260 ? 6.381   15.979  59.419  1.00 245.13 ? 239 GLU A CD    1 
ATOM   1837  O  OE1   . GLU A 1 260 ? 5.170   16.150  59.171  1.00 251.94 ? 239 GLU A OE1   1 
ATOM   1838  O  OE2   . GLU A 1 260 ? 7.237   16.882  59.325  1.00 251.01 ? 239 GLU A OE2   1 
ATOM   1839  N  N     . LEU A 1 261 ? 4.438   10.770  60.644  1.00 141.55 ? 240 LEU A N     1 
ATOM   1840  C  CA    . LEU A 1 261 ? 3.215   10.035  60.953  1.00 134.06 ? 240 LEU A CA    1 
ATOM   1841  C  C     . LEU A 1 261 ? 3.505   8.926   61.939  1.00 145.75 ? 240 LEU A C     1 
ATOM   1842  O  O     . LEU A 1 261 ? 2.749   8.720   62.895  1.00 145.36 ? 240 LEU A O     1 
ATOM   1843  C  CB    . LEU A 1 261 ? 2.582   9.467   59.688  1.00 125.66 ? 240 LEU A CB    1 
ATOM   1844  C  CG    . LEU A 1 261 ? 1.906   10.515  58.819  1.00 134.44 ? 240 LEU A CG    1 
ATOM   1845  C  CD1   . LEU A 1 261 ? 1.474   9.940   57.474  1.00 120.21 ? 240 LEU A CD1   1 
ATOM   1846  C  CD2   . LEU A 1 261 ? 0.709   11.051  59.600  1.00 133.00 ? 240 LEU A CD2   1 
ATOM   1847  N  N     . LEU A 1 262 ? 4.598   8.203   61.708  1.00 138.94 ? 241 LEU A N     1 
ATOM   1848  C  CA    . LEU A 1 262 ? 4.986   7.119   62.589  1.00 129.74 ? 241 LEU A CA    1 
ATOM   1849  C  C     . LEU A 1 262 ? 5.408   7.656   63.950  1.00 131.54 ? 241 LEU A C     1 
ATOM   1850  O  O     . LEU A 1 262 ? 5.493   6.891   64.912  1.00 132.68 ? 241 LEU A O     1 
ATOM   1851  C  CB    . LEU A 1 262 ? 6.163   6.373   61.957  1.00 126.49 ? 241 LEU A CB    1 
ATOM   1852  C  CG    . LEU A 1 262 ? 5.921   5.750   60.579  1.00 122.03 ? 241 LEU A CG    1 
ATOM   1853  C  CD1   . LEU A 1 262 ? 7.181   5.142   60.087  1.00 123.08 ? 241 LEU A CD1   1 
ATOM   1854  C  CD2   . LEU A 1 262 ? 4.851   4.717   60.605  1.00 117.92 ? 241 LEU A CD2   1 
ATOM   1855  N  N     . ALA A 1 263 ? 5.680   8.961   64.039  1.00 134.93 ? 242 ALA A N     1 
ATOM   1856  C  CA    . ALA A 1 263 ? 5.810   9.627   65.330  1.00 153.39 ? 242 ALA A CA    1 
ATOM   1857  C  C     . ALA A 1 263 ? 4.496   9.591   66.096  1.00 144.69 ? 242 ALA A C     1 
ATOM   1858  O  O     . ALA A 1 263 ? 4.482   9.500   67.331  1.00 151.68 ? 242 ALA A O     1 
ATOM   1859  C  CB    . ALA A 1 263 ? 6.288   11.064  65.135  1.00 178.84 ? 242 ALA A CB    1 
ATOM   1860  N  N     . GLY A 1 264 ? 3.381   9.718   65.380  1.00 138.70 ? 243 GLY A N     1 
ATOM   1861  C  CA    . GLY A 1 264 ? 2.079   9.731   66.011  1.00 147.90 ? 243 GLY A CA    1 
ATOM   1862  C  C     . GLY A 1 264 ? 1.486   8.351   66.228  1.00 153.77 ? 243 GLY A C     1 
ATOM   1863  O  O     . GLY A 1 264 ? 0.722   8.177   67.180  1.00 183.06 ? 243 GLY A O     1 
ATOM   1864  N  N     . LEU A 1 265 ? 1.834   7.353   65.408  1.00 128.82 ? 244 LEU A N     1 
ATOM   1865  C  CA    . LEU A 1 265 ? 1.282   6.026   65.639  1.00 124.81 ? 244 LEU A CA    1 
ATOM   1866  C  C     . LEU A 1 265 ? 1.878   5.421   66.899  1.00 147.86 ? 244 LEU A C     1 
ATOM   1867  O  O     . LEU A 1 265 ? 3.026   5.691   67.240  1.00 179.73 ? 244 LEU A O     1 
ATOM   1868  C  CB    . LEU A 1 265 ? 1.563   5.088   64.484  1.00 120.87 ? 244 LEU A CB    1 
ATOM   1869  C  CG    . LEU A 1 265 ? 0.628   5.323   63.318  1.00 127.05 ? 244 LEU A CG    1 
ATOM   1870  C  CD1   . LEU A 1 265 ? 0.778   4.243   62.268  1.00 113.20 ? 244 LEU A CD1   1 
ATOM   1871  C  CD2   . LEU A 1 265 ? -0.776  5.349   63.850  1.00 142.57 ? 244 LEU A CD2   1 
ATOM   1872  N  N     . PRO A 1 266 ? 1.151   4.541   67.567  1.00 145.94 ? 245 PRO A N     1 
ATOM   1873  C  CA    . PRO A 1 266 ? 1.744   3.856   68.706  1.00 161.98 ? 245 PRO A CA    1 
ATOM   1874  C  C     . PRO A 1 266 ? 2.795   2.898   68.203  1.00 171.96 ? 245 PRO A C     1 
ATOM   1875  O  O     . PRO A 1 266 ? 2.669   2.338   67.108  1.00 150.61 ? 245 PRO A O     1 
ATOM   1876  C  CB    . PRO A 1 266 ? 0.560   3.123   69.342  1.00 159.71 ? 245 PRO A CB    1 
ATOM   1877  C  CG    . PRO A 1 266 ? -0.359  2.892   68.225  1.00 148.91 ? 245 PRO A CG    1 
ATOM   1878  C  CD    . PRO A 1 266 ? -0.231  4.098   67.333  1.00 151.01 ? 245 PRO A CD    1 
ATOM   1879  N  N     . GLY A 1 267 ? 3.880   2.791   68.970  1.00 173.38 ? 246 GLY A N     1 
ATOM   1880  C  CA    . GLY A 1 267 ? 4.914   1.819   68.691  1.00 203.05 ? 246 GLY A CA    1 
ATOM   1881  C  C     . GLY A 1 267 ? 4.728   0.492   69.396  1.00 211.56 ? 246 GLY A C     1 
ATOM   1882  O  O     . GLY A 1 267 ? 5.539   -0.425  69.222  1.00 219.41 ? 246 GLY A O     1 
ATOM   1883  N  N     . GLU A 1 268 ? 3.649   0.353   70.171  1.00 202.78 ? 247 GLU A N     1 
ATOM   1884  C  CA    . GLU A 1 268 ? 3.333   -0.856  70.910  1.00 172.53 ? 247 GLU A CA    1 
ATOM   1885  C  C     . GLU A 1 268 ? 1.906   -1.254  70.556  1.00 156.30 ? 247 GLU A C     1 
ATOM   1886  O  O     . GLU A 1 268 ? 1.022   -0.384  70.497  1.00 169.03 ? 247 GLU A O     1 
ATOM   1887  C  CB    . GLU A 1 268 ? 3.446   -0.601  72.413  1.00 186.97 ? 247 GLU A CB    1 
ATOM   1888  C  CG    . GLU A 1 268 ? 4.774   0.008   72.844  1.00 207.70 ? 247 GLU A CG    1 
ATOM   1889  C  CD    . GLU A 1 268 ? 4.737   1.530   72.817  1.00 224.84 ? 247 GLU A CD    1 
ATOM   1890  O  OE1   . GLU A 1 268 ? 4.365   2.099   71.769  1.00 217.23 ? 247 GLU A OE1   1 
ATOM   1891  O  OE2   . GLU A 1 268 ? 5.061   2.159   73.854  1.00 245.19 ? 247 GLU A OE2   1 
ATOM   1892  N  N     . PRO A 1 269 ? 1.631   -2.553  70.403  1.00 145.26 ? 248 PRO A N     1 
ATOM   1893  C  CA    . PRO A 1 269 ? 0.349   -2.989  69.820  1.00 145.76 ? 248 PRO A CA    1 
ATOM   1894  C  C     . PRO A 1 269 ? -0.868  -2.506  70.591  1.00 126.73 ? 248 PRO A C     1 
ATOM   1895  O  O     . PRO A 1 269 ? -0.800  -2.174  71.766  1.00 131.23 ? 248 PRO A O     1 
ATOM   1896  C  CB    . PRO A 1 269 ? 0.448   -4.519  69.839  1.00 134.43 ? 248 PRO A CB    1 
ATOM   1897  C  CG    . PRO A 1 269 ? 1.911   -4.783  69.770  1.00 157.02 ? 248 PRO A CG    1 
ATOM   1898  C  CD    . PRO A 1 269 ? 2.556   -3.679  70.592  1.00 154.72 ? 248 PRO A CD    1 
ATOM   1899  N  N     . TYR A 1 270 ? -1.992  -2.440  69.889  1.00 125.61 ? 249 TYR A N     1 
ATOM   1900  C  CA    . TYR A 1 270 ? -3.225  -1.965  70.493  1.00 136.48 ? 249 TYR A CA    1 
ATOM   1901  C  C     . TYR A 1 270 ? -3.853  -3.009  71.399  1.00 141.46 ? 249 TYR A C     1 
ATOM   1902  O  O     . TYR A 1 270 ? -3.733  -4.222  71.178  1.00 135.12 ? 249 TYR A O     1 
ATOM   1903  C  CB    . TYR A 1 270 ? -4.246  -1.558  69.427  1.00 147.21 ? 249 TYR A CB    1 
ATOM   1904  C  CG    . TYR A 1 270 ? -4.182  -0.108  69.042  1.00 134.13 ? 249 TYR A CG    1 
ATOM   1905  C  CD1   . TYR A 1 270 ? -4.374  0.875   69.995  1.00 123.37 ? 249 TYR A CD1   1 
ATOM   1906  C  CD2   . TYR A 1 270 ? -3.975  0.280   67.736  1.00 116.12 ? 249 TYR A CD2   1 
ATOM   1907  C  CE1   . TYR A 1 270 ? -4.328  2.194   69.664  1.00 123.73 ? 249 TYR A CE1   1 
ATOM   1908  C  CE2   . TYR A 1 270 ? -3.929  1.608   67.399  1.00 116.57 ? 249 TYR A CE2   1 
ATOM   1909  C  CZ    . TYR A 1 270 ? -4.106  2.563   68.367  1.00 120.36 ? 249 TYR A CZ    1 
ATOM   1910  O  OH    . TYR A 1 270 ? -4.063  3.905   68.050  1.00 130.17 ? 249 TYR A OH    1 
ATOM   1911  N  N     . ALA A 1 271 ? -4.563  -2.511  72.417  1.00 143.39 ? 250 ALA A N     1 
ATOM   1912  C  CA    . ALA A 1 271 ? -5.261  -3.396  73.336  1.00 149.80 ? 250 ALA A CA    1 
ATOM   1913  C  C     . ALA A 1 271 ? -6.317  -4.198  72.589  1.00 144.57 ? 250 ALA A C     1 
ATOM   1914  O  O     . ALA A 1 271 ? -6.206  -5.424  72.438  1.00 126.85 ? 250 ALA A O     1 
ATOM   1915  C  CB    . ALA A 1 271 ? -5.891  -2.560  74.452  1.00 152.10 ? 250 ALA A CB    1 
ATOM   1916  N  N     . ASN A 1 272 ? -7.280  -3.495  72.011  1.00 143.63 ? 251 ASN A N     1 
ATOM   1917  C  CA    . ASN A 1 272 ? -8.380  -4.141  71.320  1.00 137.52 ? 251 ASN A CA    1 
ATOM   1918  C  C     . ASN A 1 272 ? -7.855  -4.916  70.109  1.00 129.85 ? 251 ASN A C     1 
ATOM   1919  O  O     . ASN A 1 272 ? -6.936  -4.455  69.420  1.00 149.96 ? 251 ASN A O     1 
ATOM   1920  C  CB    . ASN A 1 272 ? -9.403  -3.080  70.891  1.00 143.25 ? 251 ASN A CB    1 
ATOM   1921  C  CG    . ASN A 1 272 ? -10.716 -3.673  70.406  1.00 156.26 ? 251 ASN A CG    1 
ATOM   1922  O  OD1   . ASN A 1 272 ? -10.812 -4.190  69.282  1.00 132.36 ? 251 ASN A OD1   1 
ATOM   1923  N  ND2   . ASN A 1 272 ? -11.746 -3.595  71.261  1.00 180.40 ? 251 ASN A ND2   1 
ATOM   1924  N  N     . PRO A 1 273 ? -8.348  -6.129  69.873  1.00 116.67 ? 252 PRO A N     1 
ATOM   1925  C  CA    . PRO A 1 273 ? -7.848  -6.905  68.728  1.00 130.70 ? 252 PRO A CA    1 
ATOM   1926  C  C     . PRO A 1 273 ? -8.241  -6.304  67.390  1.00 143.33 ? 252 PRO A C     1 
ATOM   1927  O  O     . PRO A 1 273 ? -7.475  -6.388  66.420  1.00 134.55 ? 252 PRO A O     1 
ATOM   1928  C  CB    . PRO A 1 273 ? -8.481  -8.284  68.940  1.00 120.84 ? 252 PRO A CB    1 
ATOM   1929  C  CG    . PRO A 1 273 ? -8.950  -8.288  70.352  1.00 118.02 ? 252 PRO A CG    1 
ATOM   1930  C  CD    . PRO A 1 273 ? -9.306  -6.886  70.676  1.00 119.15 ? 252 PRO A CD    1 
ATOM   1931  N  N     . TRP A 1 274 ? -9.450  -5.751  67.294  1.00 135.58 ? 253 TRP A N     1 
ATOM   1932  C  CA    . TRP A 1 274 ? -9.900  -5.188  66.030  1.00 130.34 ? 253 TRP A CA    1 
ATOM   1933  C  C     . TRP A 1 274 ? -9.113  -3.929  65.701  1.00 136.44 ? 253 TRP A C     1 
ATOM   1934  O  O     . TRP A 1 274 ? -8.763  -3.700  64.531  1.00 152.39 ? 253 TRP A O     1 
ATOM   1935  C  CB    . TRP A 1 274 ? -11.425 -5.012  66.106  1.00 126.61 ? 253 TRP A CB    1 
ATOM   1936  C  CG    . TRP A 1 274 ? -12.137 -3.975  65.293  1.00 148.13 ? 253 TRP A CG    1 
ATOM   1937  C  CD1   . TRP A 1 274 ? -11.993 -3.714  63.946  1.00 155.25 ? 253 TRP A CD1   1 
ATOM   1938  C  CD2   . TRP A 1 274 ? -13.271 -3.204  65.728  1.00 164.15 ? 253 TRP A CD2   1 
ATOM   1939  N  NE1   . TRP A 1 274 ? -12.901 -2.742  63.552  1.00 155.72 ? 253 TRP A NE1   1 
ATOM   1940  C  CE2   . TRP A 1 274 ? -13.699 -2.422  64.623  1.00 165.88 ? 253 TRP A CE2   1 
ATOM   1941  C  CE3   . TRP A 1 274 ? -13.943 -3.070  66.959  1.00 153.77 ? 253 TRP A CE3   1 
ATOM   1942  C  CZ2   . TRP A 1 274 ? -14.764 -1.520  64.716  1.00 158.11 ? 253 TRP A CZ2   1 
ATOM   1943  C  CZ3   . TRP A 1 274 ? -15.008 -2.170  67.049  1.00 130.48 ? 253 TRP A CZ3   1 
ATOM   1944  C  CH2   . TRP A 1 274 ? -15.404 -1.410  65.934  1.00 144.76 ? 253 TRP A CH2   1 
ATOM   1945  N  N     . LEU A 1 275 ? -8.750  -3.156  66.728  1.00 108.09 ? 254 LEU A N     1 
ATOM   1946  C  CA    . LEU A 1 275 ? -7.861  -2.019  66.516  1.00 108.44 ? 254 LEU A CA    1 
ATOM   1947  C  C     . LEU A 1 275 ? -6.493  -2.466  66.026  1.00 124.39 ? 254 LEU A C     1 
ATOM   1948  O  O     . LEU A 1 275 ? -6.017  -1.977  65.003  1.00 129.36 ? 254 LEU A O     1 
ATOM   1949  C  CB    . LEU A 1 275 ? -7.720  -1.205  67.795  1.00 112.76 ? 254 LEU A CB    1 
ATOM   1950  C  CG    . LEU A 1 275 ? -9.002  -0.514  68.229  1.00 121.87 ? 254 LEU A CG    1 
ATOM   1951  C  CD1   . LEU A 1 275 ? -8.793  0.190   69.556  1.00 119.07 ? 254 LEU A CD1   1 
ATOM   1952  C  CD2   . LEU A 1 275 ? -9.373  0.483   67.138  1.00 112.14 ? 254 LEU A CD2   1 
ATOM   1953  N  N     . GLU A 1 276 ? -5.860  -3.430  66.710  1.00 120.99 ? 255 GLU A N     1 
ATOM   1954  C  CA    . GLU A 1 276 ? -4.566  -3.923  66.233  1.00 114.66 ? 255 GLU A CA    1 
ATOM   1955  C  C     . GLU A 1 276 ? -4.691  -4.461  64.824  1.00 104.42 ? 255 GLU A C     1 
ATOM   1956  O  O     . GLU A 1 276 ? -3.736  -4.382  64.047  1.00 110.35 ? 255 GLU A O     1 
ATOM   1957  C  CB    . GLU A 1 276 ? -4.001  -5.002  67.162  1.00 110.76 ? 255 GLU A CB    1 
ATOM   1958  C  CG    . GLU A 1 276 ? -2.709  -5.733  66.686  1.00 111.78 ? 255 GLU A CG    1 
ATOM   1959  C  CD    . GLU A 1 276 ? -1.419  -4.892  66.761  1.00 127.17 ? 255 GLU A CD    1 
ATOM   1960  O  OE1   . GLU A 1 276 ? -1.486  -3.710  67.153  1.00 118.63 ? 255 GLU A OE1   1 
ATOM   1961  O  OE2   . GLU A 1 276 ? -0.318  -5.438  66.490  1.00 133.29 ? 255 GLU A OE2   1 
ATOM   1962  N  N     . GLY A 1 277 ? -5.866  -4.983  64.468  1.00 102.04 ? 256 GLY A N     1 
ATOM   1963  C  CA    . GLY A 1 277 ? -6.108  -5.319  63.078  1.00 102.09 ? 256 GLY A CA    1 
ATOM   1964  C  C     . GLY A 1 277 ? -5.973  -4.106  62.184  1.00 100.55 ? 256 GLY A C     1 
ATOM   1965  O  O     . GLY A 1 277 ? -5.249  -4.134  61.182  1.00 107.14 ? 256 GLY A O     1 
ATOM   1966  N  N     . ARG A 1 278 ? -6.639  -3.007  62.566  1.00 98.16  ? 257 ARG A N     1 
ATOM   1967  C  CA    . ARG A 1 278 ? -6.630  -1.793  61.756  1.00 98.23  ? 257 ARG A CA    1 
ATOM   1968  C  C     . ARG A 1 278 ? -5.238  -1.160  61.701  1.00 104.26 ? 257 ARG A C     1 
ATOM   1969  O  O     . ARG A 1 278 ? -4.771  -0.776  60.619  1.00 108.71 ? 257 ARG A O     1 
ATOM   1970  C  CB    . ARG A 1 278 ? -7.680  -0.823  62.316  1.00 114.40 ? 257 ARG A CB    1 
ATOM   1971  C  CG    . ARG A 1 278 ? -8.002  0.451   61.488  1.00 150.18 ? 257 ARG A CG    1 
ATOM   1972  C  CD    . ARG A 1 278 ? -8.932  0.245   60.279  1.00 151.04 ? 257 ARG A CD    1 
ATOM   1973  N  NE    . ARG A 1 278 ? -10.250 -0.286  60.612  1.00 134.81 ? 257 ARG A NE    1 
ATOM   1974  C  CZ    . ARG A 1 278 ? -10.550 -1.586  60.630  1.00 148.62 ? 257 ARG A CZ    1 
ATOM   1975  N  NH1   . ARG A 1 278 ? -11.778 -1.983  60.938  1.00 169.71 ? 257 ARG A NH1   1 
ATOM   1976  N  NH2   . ARG A 1 278 ? -9.628  -2.500  60.348  1.00 142.44 ? 257 ARG A NH2   1 
ATOM   1977  N  N     . ARG A 1 279 ? -4.554  -1.085  62.853  1.00 101.58 ? 258 ARG A N     1 
ATOM   1978  C  CA    . ARG A 1 279 ? -3.202  -0.528  62.961  1.00 103.49 ? 258 ARG A CA    1 
ATOM   1979  C  C     . ARG A 1 279 ? -2.192  -1.347  62.191  1.00 101.96 ? 258 ARG A C     1 
ATOM   1980  O  O     . ARG A 1 279 ? -1.370  -0.818  61.432  1.00 101.77 ? 258 ARG A O     1 
ATOM   1981  C  CB    . ARG A 1 279 ? -2.768  -0.482  64.414  1.00 107.45 ? 258 ARG A CB    1 
ATOM   1982  C  CG    . ARG A 1 279 ? -1.267  -0.336  64.589  1.00 109.75 ? 258 ARG A CG    1 
ATOM   1983  C  CD    . ARG A 1 279 ? -0.867  -0.479  66.065  1.00 123.19 ? 258 ARG A CD    1 
ATOM   1984  N  NE    . ARG A 1 279 ? -0.124  -1.712  66.274  1.00 123.06 ? 258 ARG A NE    1 
ATOM   1985  C  CZ    . ARG A 1 279 ? 1.197   -1.766  66.365  1.00 126.64 ? 258 ARG A CZ    1 
ATOM   1986  N  NH1   . ARG A 1 279 ? 1.804   -2.939  66.539  1.00 117.65 ? 258 ARG A NH1   1 
ATOM   1987  N  NH2   . ARG A 1 279 ? 1.902   -0.637  66.303  1.00 118.93 ? 258 ARG A NH2   1 
ATOM   1988  N  N     . VAL A 1 280 ? -2.215  -2.645  62.404  1.00 101.29 ? 259 VAL A N     1 
ATOM   1989  C  CA    . VAL A 1 280 ? -1.253  -3.485  61.722  1.00 111.15 ? 259 VAL A CA    1 
ATOM   1990  C  C     . VAL A 1 280 ? -1.444  -3.377  60.213  1.00 111.73 ? 259 VAL A C     1 
ATOM   1991  O  O     . VAL A 1 280 ? -0.464  -3.276  59.452  1.00 113.51 ? 259 VAL A O     1 
ATOM   1992  C  CB    . VAL A 1 280 ? -1.412  -4.928  62.226  1.00 108.19 ? 259 VAL A CB    1 
ATOM   1993  C  CG1   . VAL A 1 280 ? -1.374  -5.853  61.072  1.00 106.61 ? 259 VAL A CG1   1 
ATOM   1994  C  CG2   . VAL A 1 280 ? -0.342  -5.268  63.269  1.00 109.12 ? 259 VAL A CG2   1 
ATOM   1995  N  N     . LYS A 1 281 ? -2.704  -3.257  59.764  1.00 126.68 ? 260 LYS A N     1 
ATOM   1996  C  CA    . LYS A 1 281 ? -2.913  -3.050  58.336  1.00 107.69 ? 260 LYS A CA    1 
ATOM   1997  C  C     . LYS A 1 281 ? -2.388  -1.700  57.894  1.00 93.20  ? 260 LYS A C     1 
ATOM   1998  O  O     . LYS A 1 281 ? -1.703  -1.599  56.866  1.00 95.37  ? 260 LYS A O     1 
ATOM   1999  C  CB    . LYS A 1 281 ? -4.382  -3.175  57.973  1.00 90.31  ? 260 LYS A CB    1 
ATOM   2000  C  CG    . LYS A 1 281 ? -4.697  -2.843  56.516  1.00 88.21  ? 260 LYS A CG    1 
ATOM   2001  C  CD    . LYS A 1 281 ? -6.178  -3.132  56.272  1.00 121.05 ? 260 LYS A CD    1 
ATOM   2002  C  CE    . LYS A 1 281 ? -6.597  -3.119  54.817  1.00 106.87 ? 260 LYS A CE    1 
ATOM   2003  N  NZ    . LYS A 1 281 ? -8.031  -3.538  54.780  1.00 97.91  ? 260 LYS A NZ    1 
ATOM   2004  N  N     . LEU A 1 282 ? -2.637  -0.654  58.676  1.00 95.36  ? 261 LEU A N     1 
ATOM   2005  C  CA    . LEU A 1 282 ? -2.135  0.644   58.245  1.00 107.65 ? 261 LEU A CA    1 
ATOM   2006  C  C     . LEU A 1 282 ? -0.637  0.586   58.005  1.00 97.94  ? 261 LEU A C     1 
ATOM   2007  O  O     . LEU A 1 282 ? -0.161  0.930   56.913  1.00 97.35  ? 261 LEU A O     1 
ATOM   2008  C  CB    . LEU A 1 282 ? -2.470  1.725   59.260  1.00 99.45  ? 261 LEU A CB    1 
ATOM   2009  C  CG    . LEU A 1 282 ? -1.969  2.952   58.536  1.00 100.53 ? 261 LEU A CG    1 
ATOM   2010  C  CD1   . LEU A 1 282 ? -2.780  3.104   57.268  1.00 98.10  ? 261 LEU A CD1   1 
ATOM   2011  C  CD2   . LEU A 1 282 ? -2.037  4.174   59.430  1.00 118.85 ? 261 LEU A CD2   1 
ATOM   2012  N  N     . LEU A 1 283 ? 0.101   0.069   58.996  1.00 105.31 ? 262 LEU A N     1 
ATOM   2013  C  CA    . LEU A 1 283 ? 1.539   -0.135  58.872  1.00 101.63 ? 262 LEU A CA    1 
ATOM   2014  C  C     . LEU A 1 283 ? 1.877   -0.825  57.571  1.00 99.20  ? 262 LEU A C     1 
ATOM   2015  O  O     . LEU A 1 283 ? 2.867   -0.476  56.912  1.00 100.27 ? 262 LEU A O     1 
ATOM   2016  C  CB    . LEU A 1 283 ? 2.045   -0.956  60.039  1.00 103.74 ? 262 LEU A CB    1 
ATOM   2017  C  CG    . LEU A 1 283 ? 1.914   -0.115  61.281  1.00 106.96 ? 262 LEU A CG    1 
ATOM   2018  C  CD1   . LEU A 1 283 ? 2.446   -0.862  62.477  1.00 117.37 ? 262 LEU A CD1   1 
ATOM   2019  C  CD2   . LEU A 1 283 ? 2.661   1.160   61.042  1.00 109.27 ? 262 LEU A CD2   1 
ATOM   2020  N  N     . PHE A 1 284 ? 1.100   -1.863  57.226  1.00 96.31  ? 263 PHE A N     1 
ATOM   2021  C  CA    . PHE A 1 284 ? 1.321   -2.591  55.978  1.00 94.06  ? 263 PHE A CA    1 
ATOM   2022  C  C     . PHE A 1 284 ? 1.233   -1.672  54.772  1.00 93.31  ? 263 PHE A C     1 
ATOM   2023  O  O     . PHE A 1 284 ? 2.077   -1.721  53.871  1.00 93.53  ? 263 PHE A O     1 
ATOM   2024  C  CB    . PHE A 1 284 ? 0.313   -3.729  55.857  1.00 91.39  ? 263 PHE A CB    1 
ATOM   2025  C  CG    . PHE A 1 284 ? 0.569   -4.708  54.704  1.00 89.41  ? 263 PHE A CG    1 
ATOM   2026  C  CD1   . PHE A 1 284 ? 1.247   -5.905  54.919  1.00 106.86 ? 263 PHE A CD1   1 
ATOM   2027  C  CD2   . PHE A 1 284 ? 0.076   -4.457  53.438  1.00 87.47  ? 263 PHE A CD2   1 
ATOM   2028  C  CE1   . PHE A 1 284 ? 1.449   -6.797  53.899  1.00 88.27  ? 263 PHE A CE1   1 
ATOM   2029  C  CE2   . PHE A 1 284 ? 0.272   -5.339  52.425  1.00 85.99  ? 263 PHE A CE2   1 
ATOM   2030  C  CZ    . PHE A 1 284 ? 0.948   -6.511  52.653  1.00 86.31  ? 263 PHE A CZ    1 
ATOM   2031  N  N     . GLN A 1 285 ? 0.191   -0.857  54.701  1.00 92.69  ? 264 GLN A N     1 
ATOM   2032  C  CA    . GLN A 1 285 ? 0.030   -0.083  53.479  1.00 92.16  ? 264 GLN A CA    1 
ATOM   2033  C  C     . GLN A 1 285 ? 1.085   1.014   53.371  1.00 95.01  ? 264 GLN A C     1 
ATOM   2034  O  O     . GLN A 1 285 ? 1.536   1.337   52.263  1.00 110.97 ? 264 GLN A O     1 
ATOM   2035  C  CB    . GLN A 1 285 ? -1.388  0.465   53.403  1.00 98.60  ? 264 GLN A CB    1 
ATOM   2036  C  CG    . GLN A 1 285 ? -2.409  -0.639  53.487  1.00 101.03 ? 264 GLN A CG    1 
ATOM   2037  C  CD    . GLN A 1 285 ? -3.803  -0.121  53.513  1.00 119.95 ? 264 GLN A CD    1 
ATOM   2038  O  OE1   . GLN A 1 285 ? -4.489  -0.189  54.536  1.00 107.17 ? 264 GLN A OE1   1 
ATOM   2039  N  NE2   . GLN A 1 285 ? -4.242  0.415   52.390  1.00 161.66 ? 264 GLN A NE2   1 
ATOM   2040  N  N     . PHE A 1 286 ? 1.489   1.601   54.500  1.00 97.61  ? 265 PHE A N     1 
ATOM   2041  C  CA    . PHE A 1 286 ? 2.624   2.513   54.470  1.00 100.81 ? 265 PHE A CA    1 
ATOM   2042  C  C     . PHE A 1 286 ? 3.845   1.817   53.918  1.00 101.35 ? 265 PHE A C     1 
ATOM   2043  O  O     . PHE A 1 286 ? 4.547   2.362   53.064  1.00 110.55 ? 265 PHE A O     1 
ATOM   2044  C  CB    . PHE A 1 286 ? 2.950   3.034   55.855  1.00 103.82 ? 265 PHE A CB    1 
ATOM   2045  C  CG    . PHE A 1 286 ? 1.958   4.004   56.394  1.00 104.41 ? 265 PHE A CG    1 
ATOM   2046  C  CD1   . PHE A 1 286 ? 0.821   4.332   55.691  1.00 102.35 ? 265 PHE A CD1   1 
ATOM   2047  C  CD2   . PHE A 1 286 ? 2.174   4.594   57.614  1.00 107.47 ? 265 PHE A CD2   1 
ATOM   2048  C  CE1   . PHE A 1 286 ? -0.079  5.207   56.210  1.00 103.29 ? 265 PHE A CE1   1 
ATOM   2049  C  CE2   . PHE A 1 286 ? 1.278   5.466   58.122  1.00 108.30 ? 265 PHE A CE2   1 
ATOM   2050  C  CZ    . PHE A 1 286 ? 0.160   5.777   57.425  1.00 106.23 ? 265 PHE A CZ    1 
ATOM   2051  N  N     . ALA A 1 287 ? 4.124   0.603   54.396  1.00 100.65 ? 266 ALA A N     1 
ATOM   2052  C  CA    . ALA A 1 287 ? 5.292   -0.109  53.890  1.00 101.50 ? 266 ALA A CA    1 
ATOM   2053  C  C     . ALA A 1 287 ? 5.182   -0.377  52.399  1.00 99.43  ? 266 ALA A C     1 
ATOM   2054  O  O     . ALA A 1 287 ? 6.196   -0.363  51.690  1.00 101.03 ? 266 ALA A O     1 
ATOM   2055  C  CB    . ALA A 1 287 ? 5.481   -1.418  54.631  1.00 101.18 ? 266 ALA A CB    1 
ATOM   2056  N  N     . GLN A 1 288 ? 3.962   -0.611  51.897  1.00 112.26 ? 267 GLN A N     1 
ATOM   2057  C  CA    . GLN A 1 288 ? 3.779   -0.768  50.451  1.00 108.98 ? 267 GLN A CA    1 
ATOM   2058  C  C     . GLN A 1 288 ? 4.141   0.513   49.716  1.00 102.46 ? 267 GLN A C     1 
ATOM   2059  O  O     . GLN A 1 288 ? 4.905   0.494   48.745  1.00 107.84 ? 267 GLN A O     1 
ATOM   2060  C  CB    . GLN A 1 288 ? 2.345   -1.178  50.117  1.00 110.00 ? 267 GLN A CB    1 
ATOM   2061  C  CG    . GLN A 1 288 ? 2.065   -2.621  50.433  1.00 116.86 ? 267 GLN A CG    1 
ATOM   2062  C  CD    . GLN A 1 288 ? 0.792   -3.135  49.806  1.00 127.46 ? 267 GLN A CD    1 
ATOM   2063  O  OE1   . GLN A 1 288 ? 0.792   -4.209  49.194  1.00 158.86 ? 267 GLN A OE1   1 
ATOM   2064  N  NE2   . GLN A 1 288 ? -0.313  -2.380  49.965  1.00 95.54  ? 267 GLN A NE2   1 
ATOM   2065  N  N     . HIS A 1 289 ? 3.656   1.646   50.210  1.00 101.96 ? 268 HIS A N     1 
ATOM   2066  C  CA    . HIS A 1 289 ? 4.008   2.913   49.592  1.00 100.40 ? 268 HIS A CA    1 
ATOM   2067  C  C     . HIS A 1 289 ? 5.514   3.133   49.609  1.00 103.75 ? 268 HIS A C     1 
ATOM   2068  O  O     . HIS A 1 289 ? 6.086   3.639   48.634  1.00 131.20 ? 268 HIS A O     1 
ATOM   2069  C  CB    . HIS A 1 289 ? 3.308   4.042   50.337  1.00 101.48 ? 268 HIS A CB    1 
ATOM   2070  C  CG    . HIS A 1 289 ? 3.703   5.405   49.873  1.00 104.64 ? 268 HIS A CG    1 
ATOM   2071  N  ND1   . HIS A 1 289 ? 4.685   6.143   50.499  1.00 108.25 ? 268 HIS A ND1   1 
ATOM   2072  C  CD2   . HIS A 1 289 ? 3.227   6.182   48.871  1.00 112.13 ? 268 HIS A CD2   1 
ATOM   2073  C  CE1   . HIS A 1 289 ? 4.814   7.307   49.888  1.00 135.25 ? 268 HIS A CE1   1 
ATOM   2074  N  NE2   . HIS A 1 289 ? 3.938   7.357   48.899  1.00 139.85 ? 268 HIS A NE2   1 
ATOM   2075  N  N     . CYS A 1 290 ? 6.184   2.724   50.687  1.00 105.00 ? 269 CYS A N     1 
ATOM   2076  C  CA    . CYS A 1 290 ? 7.639   2.803   50.707  1.00 108.53 ? 269 CYS A CA    1 
ATOM   2077  C  C     . CYS A 1 290 ? 8.237   1.991   49.572  1.00 112.45 ? 269 CYS A C     1 
ATOM   2078  O  O     . CYS A 1 290 ? 9.018   2.509   48.765  1.00 110.59 ? 269 CYS A O     1 
ATOM   2079  C  CB    . CYS A 1 290 ? 8.169   2.316   52.048  1.00 109.99 ? 269 CYS A CB    1 
ATOM   2080  S  SG    . CYS A 1 290 ? 7.785   3.452   53.368  1.00 116.75 ? 269 CYS A SG    1 
ATOM   2081  N  N     . GLU A 1 291 ? 7.792   0.729   49.451  1.00 120.50 ? 270 GLU A N     1 
ATOM   2082  C  CA    . GLU A 1 291 ? 8.317   -0.215  48.464  1.00 104.36 ? 270 GLU A CA    1 
ATOM   2083  C  C     . GLU A 1 291 ? 8.152   0.292   47.043  1.00 104.34 ? 270 GLU A C     1 
ATOM   2084  O  O     . GLU A 1 291 ? 8.977   -0.003  46.171  1.00 105.89 ? 270 GLU A O     1 
ATOM   2085  C  CB    . GLU A 1 291 ? 7.564   -1.538  48.590  1.00 100.76 ? 270 GLU A CB    1 
ATOM   2086  C  CG    . GLU A 1 291 ? 8.289   -2.702  49.237  1.00 101.43 ? 270 GLU A CG    1 
ATOM   2087  C  CD    . GLU A 1 291 ? 7.770   -4.055  48.725  1.00 107.24 ? 270 GLU A CD    1 
ATOM   2088  O  OE1   . GLU A 1 291 ? 6.842   -4.673  49.311  1.00 95.95  ? 270 GLU A OE1   1 
ATOM   2089  O  OE2   . GLU A 1 291 ? 8.293   -4.492  47.679  1.00 116.49 ? 270 GLU A OE2   1 
ATOM   2090  N  N     . LYS A 1 292 ? 7.082   1.041   46.785  1.00 120.88 ? 271 LYS A N     1 
ATOM   2091  C  CA    . LYS A 1 292 ? 6.867   1.598   45.456  1.00 116.70 ? 271 LYS A CA    1 
ATOM   2092  C  C     . LYS A 1 292 ? 7.772   2.803   45.212  1.00 107.74 ? 271 LYS A C     1 
ATOM   2093  O  O     . LYS A 1 292 ? 8.048   3.135   44.057  1.00 122.18 ? 271 LYS A O     1 
ATOM   2094  C  CB    . LYS A 1 292 ? 5.361   1.852   45.272  1.00 132.12 ? 271 LYS A CB    1 
ATOM   2095  C  CG    . LYS A 1 292 ? 4.632   0.473   45.058  1.00 160.69 ? 271 LYS A CG    1 
ATOM   2096  C  CD    . LYS A 1 292 ? 3.100   0.450   45.214  1.00 155.02 ? 271 LYS A CD    1 
ATOM   2097  C  CE    . LYS A 1 292 ? 2.396   1.062   44.042  1.00 141.10 ? 271 LYS A CE    1 
ATOM   2098  N  NZ    . LYS A 1 292 ? 2.643   0.203   42.858  1.00 117.45 ? 271 LYS A NZ    1 
ATOM   2099  N  N     . GLN A 1 293 ? 8.242   3.464   46.272  1.00 109.98 ? 272 GLN A N     1 
ATOM   2100  C  CA    . GLN A 1 293 ? 9.252   4.515   46.162  1.00 114.62 ? 272 GLN A CA    1 
ATOM   2101  C  C     . GLN A 1 293 ? 10.686  3.993   46.196  1.00 117.49 ? 272 GLN A C     1 
ATOM   2102  O  O     . GLN A 1 293 ? 11.612  4.812   46.229  1.00 121.83 ? 272 GLN A O     1 
ATOM   2103  C  CB    . GLN A 1 293 ? 9.054   5.573   47.251  1.00 116.27 ? 272 GLN A CB    1 
ATOM   2104  C  CG    . GLN A 1 293 ? 7.742   6.311   47.167  1.00 117.77 ? 272 GLN A CG    1 
ATOM   2105  C  CD    . GLN A 1 293 ? 7.601   7.021   45.827  1.00 157.66 ? 272 GLN A CD    1 
ATOM   2106  O  OE1   . GLN A 1 293 ? 7.993   8.184   45.688  1.00 160.64 ? 272 GLN A OE1   1 
ATOM   2107  N  NE2   . GLN A 1 293 ? 7.049   6.322   44.828  1.00 161.21 ? 272 GLN A NE2   1 
ATOM   2108  N  N     . ARG A 1 294 ? 10.880  2.659   46.188  1.00 115.52 ? 273 ARG A N     1 
ATOM   2109  C  CA    . ARG A 1 294 ? 12.177  1.949   46.236  1.00 118.11 ? 273 ARG A CA    1 
ATOM   2110  C  C     . ARG A 1 294 ? 12.946  2.178   47.540  1.00 121.12 ? 273 ARG A C     1 
ATOM   2111  O  O     . ARG A 1 294 ? 14.167  1.977   47.594  1.00 124.84 ? 273 ARG A O     1 
ATOM   2112  C  CB    . ARG A 1 294 ? 13.045  2.286   45.016  1.00 121.48 ? 273 ARG A CB    1 
ATOM   2113  C  CG    . ARG A 1 294 ? 12.258  2.180   43.723  1.00 127.15 ? 273 ARG A CG    1 
ATOM   2114  C  CD    . ARG A 1 294 ? 13.084  1.895   42.477  1.00 135.81 ? 273 ARG A CD    1 
ATOM   2115  N  NE    . ARG A 1 294 ? 13.594  0.536   42.434  1.00 144.35 ? 273 ARG A NE    1 
ATOM   2116  C  CZ    . ARG A 1 294 ? 14.881  0.224   42.545  1.00 150.09 ? 273 ARG A CZ    1 
ATOM   2117  N  NH1   . ARG A 1 294 ? 15.798  1.192   42.651  1.00 143.19 ? 273 ARG A NH1   1 
ATOM   2118  N  NH2   . ARG A 1 294 ? 15.247  -1.057  42.512  1.00 155.35 ? 273 ARG A NH2   1 
ATOM   2119  N  N     . ASP A 1 295 ? 12.239  2.555   48.608  1.00 119.86 ? 274 ASP A N     1 
ATOM   2120  C  CA    . ASP A 1 295 ? 12.832  2.643   49.938  1.00 122.54 ? 274 ASP A CA    1 
ATOM   2121  C  C     . ASP A 1 295 ? 12.630  1.282   50.577  1.00 137.18 ? 274 ASP A C     1 
ATOM   2122  O  O     . ASP A 1 295 ? 11.649  1.045   51.284  1.00 163.09 ? 274 ASP A O     1 
ATOM   2123  C  CB    . ASP A 1 295 ? 12.120  3.716   50.754  1.00 122.66 ? 274 ASP A CB    1 
ATOM   2124  C  CG    . ASP A 1 295 ? 12.799  4.002   52.068  1.00 129.73 ? 274 ASP A CG    1 
ATOM   2125  O  OD1   . ASP A 1 295 ? 13.510  3.108   52.573  1.00 140.21 ? 274 ASP A OD1   1 
ATOM   2126  O  OD2   . ASP A 1 295 ? 12.592  5.110   52.616  1.00 128.21 ? 274 ASP A OD2   1 
ATOM   2127  N  N     . PHE A 1 296 ? 13.625  0.416   50.429  1.00 121.94 ? 275 PHE A N     1 
ATOM   2128  C  CA    . PHE A 1 296 ? 13.486  -0.919  50.986  1.00 120.06 ? 275 PHE A CA    1 
ATOM   2129  C  C     . PHE A 1 296 ? 13.954  -1.002  52.427  1.00 139.19 ? 275 PHE A C     1 
ATOM   2130  O  O     . PHE A 1 296 ? 13.366  -1.767  53.200  1.00 153.55 ? 275 PHE A O     1 
ATOM   2131  C  CB    . PHE A 1 296 ? 14.208  -1.937  50.105  1.00 120.55 ? 275 PHE A CB    1 
ATOM   2132  C  CG    . PHE A 1 296 ? 13.776  -1.896  48.662  1.00 118.21 ? 275 PHE A CG    1 
ATOM   2133  C  CD1   . PHE A 1 296 ? 12.453  -1.665  48.328  1.00 118.68 ? 275 PHE A CD1   1 
ATOM   2134  C  CD2   . PHE A 1 296 ? 14.697  -2.034  47.638  1.00 120.72 ? 275 PHE A CD2   1 
ATOM   2135  C  CE1   . PHE A 1 296 ? 12.047  -1.612  46.999  1.00 115.31 ? 275 PHE A CE1   1 
ATOM   2136  C  CE2   . PHE A 1 296 ? 14.300  -1.979  46.315  1.00 131.09 ? 275 PHE A CE2   1 
ATOM   2137  C  CZ    . PHE A 1 296 ? 12.971  -1.765  45.996  1.00 121.74 ? 275 PHE A CZ    1 
ATOM   2138  N  N     . ASP A 1 297 ? 14.978  -0.220  52.818  1.00 133.54 ? 276 ASP A N     1 
ATOM   2139  C  CA    . ASP A 1 297 ? 15.460  -0.291  54.198  1.00 138.46 ? 276 ASP A CA    1 
ATOM   2140  C  C     . ASP A 1 297 ? 14.361  0.105   55.176  1.00 142.80 ? 276 ASP A C     1 
ATOM   2141  O  O     . ASP A 1 297 ? 14.275  -0.444  56.284  1.00 130.79 ? 276 ASP A O     1 
ATOM   2142  C  CB    . ASP A 1 297 ? 16.712  0.568   54.408  1.00 147.36 ? 276 ASP A CB    1 
ATOM   2143  C  CG    . ASP A 1 297 ? 17.979  -0.075  53.838  1.00 182.17 ? 276 ASP A CG    1 
ATOM   2144  O  OD1   . ASP A 1 297 ? 17.963  -1.276  53.481  1.00 175.87 ? 276 ASP A OD1   1 
ATOM   2145  O  OD2   . ASP A 1 297 ? 19.018  0.624   53.789  1.00 207.97 ? 276 ASP A OD2   1 
ATOM   2146  N  N     . LEU A 1 298 ? 13.522  1.071   54.792  1.00 138.89 ? 277 LEU A N     1 
ATOM   2147  C  CA    . LEU A 1 298 ? 12.377  1.407   55.625  1.00 124.82 ? 277 LEU A CA    1 
ATOM   2148  C  C     . LEU A 1 298 ? 11.251  0.411   55.434  1.00 119.61 ? 277 LEU A C     1 
ATOM   2149  O  O     . LEU A 1 298 ? 10.556  0.061   56.396  1.00 128.70 ? 277 LEU A O     1 
ATOM   2150  C  CB    . LEU A 1 298 ? 11.852  2.797   55.311  1.00 124.79 ? 277 LEU A CB    1 
ATOM   2151  C  CG    . LEU A 1 298 ? 10.772  3.051   56.351  1.00 123.30 ? 277 LEU A CG    1 
ATOM   2152  C  CD1   . LEU A 1 298 ? 11.376  2.971   57.747  1.00 127.23 ? 277 LEU A CD1   1 
ATOM   2153  C  CD2   . LEU A 1 298 ? 10.045  4.337   56.113  1.00 122.95 ? 277 LEU A CD2   1 
ATOM   2154  N  N     . ALA A 1 299 ? 11.038  -0.029  54.195  1.00 116.74 ? 278 ALA A N     1 
ATOM   2155  C  CA    . ALA A 1 299 ? 10.018  -1.034  53.935  1.00 112.16 ? 278 ALA A CA    1 
ATOM   2156  C  C     . ALA A 1 299 ? 10.194  -2.261  54.826  1.00 123.27 ? 278 ALA A C     1 
ATOM   2157  O  O     . ALA A 1 299 ? 9.221   -2.764  55.392  1.00 142.71 ? 278 ALA A O     1 
ATOM   2158  C  CB    . ALA A 1 299 ? 10.033  -1.410  52.467  1.00 110.12 ? 278 ALA A CB    1 
ATOM   2159  N  N     . GLN A 1 300 ? 11.420  -2.790  54.920  1.00 126.09 ? 279 GLN A N     1 
ATOM   2160  C  CA    . GLN A 1 300 ? 11.702  -3.895  55.845  1.00 122.29 ? 279 GLN A CA    1 
ATOM   2161  C  C     . GLN A 1 300 ? 11.265  -3.571  57.269  1.00 118.28 ? 279 GLN A C     1 
ATOM   2162  O  O     . GLN A 1 300 ? 10.534  -4.348  57.905  1.00 116.61 ? 279 GLN A O     1 
ATOM   2163  C  CB    . GLN A 1 300 ? 13.194  -4.252  55.791  1.00 121.48 ? 279 GLN A CB    1 
ATOM   2164  C  CG    . GLN A 1 300 ? 13.749  -5.116  56.927  1.00 124.70 ? 279 GLN A CG    1 
ATOM   2165  C  CD    . GLN A 1 300 ? 14.714  -4.339  57.817  1.00 159.51 ? 279 GLN A CD    1 
ATOM   2166  O  OE1   . GLN A 1 300 ? 14.948  -3.151  57.606  1.00 162.33 ? 279 GLN A OE1   1 
ATOM   2167  N  NE2   . GLN A 1 300 ? 15.302  -5.016  58.794  1.00 194.55 ? 279 GLN A NE2   1 
ATOM   2168  N  N     . ARG A 1 301 ? 11.695  -2.418  57.781  1.00 121.59 ? 280 ARG A N     1 
ATOM   2169  C  CA    . ARG A 1 301 ? 11.358  -2.061  59.155  1.00 144.58 ? 280 ARG A CA    1 
ATOM   2170  C  C     . ARG A 1 301 ? 9.846   -1.982  59.352  1.00 119.39 ? 280 ARG A C     1 
ATOM   2171  O  O     . ARG A 1 301 ? 9.327   -2.376  60.405  1.00 132.19 ? 280 ARG A O     1 
ATOM   2172  C  CB    . ARG A 1 301 ? 12.023  -0.727  59.541  1.00 176.06 ? 280 ARG A CB    1 
ATOM   2173  C  CG    . ARG A 1 301 ? 13.391  -0.813  60.268  1.00 187.89 ? 280 ARG A CG    1 
ATOM   2174  C  CD    . ARG A 1 301 ? 14.064  0.572   60.384  1.00 175.52 ? 280 ARG A CD    1 
ATOM   2175  N  NE    . ARG A 1 301 ? 14.975  0.845   59.266  1.00 164.95 ? 280 ARG A NE    1 
ATOM   2176  C  CZ    . ARG A 1 301 ? 15.389  2.057   58.896  1.00 163.73 ? 280 ARG A CZ    1 
ATOM   2177  N  NH1   . ARG A 1 301 ? 16.212  2.182   57.859  1.00 148.01 ? 280 ARG A NH1   1 
ATOM   2178  N  NH2   . ARG A 1 301 ? 14.974  3.142   59.547  1.00 179.73 ? 280 ARG A NH2   1 
ATOM   2179  N  N     . LEU A 1 302 ? 9.114   -1.522  58.340  1.00 115.80 ? 281 LEU A N     1 
ATOM   2180  C  CA    . LEU A 1 302 ? 7.679   -1.364  58.530  1.00 112.47 ? 281 LEU A CA    1 
ATOM   2181  C  C     . LEU A 1 302 ? 6.938   -2.691  58.446  1.00 109.73 ? 281 LEU A C     1 
ATOM   2182  O  O     . LEU A 1 302 ? 6.136   -3.024  59.329  1.00 108.66 ? 281 LEU A O     1 
ATOM   2183  C  CB    . LEU A 1 302 ? 7.148   -0.349  57.518  1.00 110.48 ? 281 LEU A CB    1 
ATOM   2184  C  CG    . LEU A 1 302 ? 7.555   1.090   57.826  1.00 113.82 ? 281 LEU A CG    1 
ATOM   2185  C  CD1   . LEU A 1 302 ? 7.321   1.953   56.637  1.00 112.56 ? 281 LEU A CD1   1 
ATOM   2186  C  CD2   . LEU A 1 302 ? 6.717   1.608   58.986  1.00 114.47 ? 281 LEU A CD2   1 
ATOM   2187  N  N     . TYR A 1 303 ? 7.208   -3.470  57.403  1.00 119.05 ? 282 TYR A N     1 
ATOM   2188  C  CA    . TYR A 1 303 ? 6.543   -4.757  57.262  1.00 104.43 ? 282 TYR A CA    1 
ATOM   2189  C  C     . TYR A 1 303 ? 6.790   -5.605  58.481  1.00 108.48 ? 282 TYR A C     1 
ATOM   2190  O  O     . TYR A 1 303 ? 5.858   -6.207  59.027  1.00 109.94 ? 282 TYR A O     1 
ATOM   2191  C  CB    . TYR A 1 303 ? 7.067   -5.490  56.028  1.00 123.66 ? 282 TYR A CB    1 
ATOM   2192  C  CG    . TYR A 1 303 ? 6.561   -5.027  54.680  1.00 120.85 ? 282 TYR A CG    1 
ATOM   2193  C  CD1   . TYR A 1 303 ? 5.202   -4.951  54.412  1.00 98.44  ? 282 TYR A CD1   1 
ATOM   2194  C  CD2   . TYR A 1 303 ? 7.455   -4.648  53.684  1.00 101.40 ? 282 TYR A CD2   1 
ATOM   2195  C  CE1   . TYR A 1 303 ? 4.756   -4.539  53.200  1.00 94.88  ? 282 TYR A CE1   1 
ATOM   2196  C  CE2   . TYR A 1 303 ? 7.009   -4.226  52.475  1.00 99.31  ? 282 TYR A CE2   1 
ATOM   2197  C  CZ    . TYR A 1 303 ? 5.661   -4.174  52.235  1.00 96.08  ? 282 TYR A CZ    1 
ATOM   2198  O  OH    . TYR A 1 303 ? 5.203   -3.772  51.012  1.00 112.30 ? 282 TYR A OH    1 
ATOM   2199  N  N     . ARG A 1 304 ? 8.038   -5.593  58.959  1.00 110.83 ? 283 ARG A N     1 
ATOM   2200  C  CA    . ARG A 1 304 ? 8.429   -6.473  60.041  1.00 113.74 ? 283 ARG A CA    1 
ATOM   2201  C  C     . ARG A 1 304 ? 7.622   -6.205  61.311  1.00 123.01 ? 283 ARG A C     1 
ATOM   2202  O  O     . ARG A 1 304 ? 7.404   -7.133  62.099  1.00 147.08 ? 283 ARG A O     1 
ATOM   2203  C  CB    . ARG A 1 304 ? 9.933   -6.350  60.257  1.00 118.53 ? 283 ARG A CB    1 
ATOM   2204  C  CG    . ARG A 1 304 ? 10.558  -7.475  61.058  1.00 121.86 ? 283 ARG A CG    1 
ATOM   2205  C  CD    . ARG A 1 304 ? 11.375  -8.420  60.182  1.00 122.07 ? 283 ARG A CD    1 
ATOM   2206  N  NE    . ARG A 1 304 ? 12.655  -7.870  59.724  1.00 125.34 ? 283 ARG A NE    1 
ATOM   2207  C  CZ    . ARG A 1 304 ? 13.837  -8.455  59.918  1.00 140.27 ? 283 ARG A CZ    1 
ATOM   2208  N  NH1   . ARG A 1 304 ? 13.913  -9.616  60.561  1.00 150.09 ? 283 ARG A NH1   1 
ATOM   2209  N  NH2   . ARG A 1 304 ? 14.947  -7.887  59.463  1.00 140.84 ? 283 ARG A NH2   1 
ATOM   2210  N  N     . GLN A 1 305 ? 7.184   -4.960  61.550  1.00 114.70 ? 284 GLN A N     1 
ATOM   2211  C  CA    . GLN A 1 305 ? 6.354   -4.677  62.721  1.00 115.67 ? 284 GLN A CA    1 
ATOM   2212  C  C     . GLN A 1 305 ? 4.846   -4.688  62.413  1.00 111.42 ? 284 GLN A C     1 
ATOM   2213  O  O     . GLN A 1 305 ? 4.049   -4.174  63.209  1.00 112.02 ? 284 GLN A O     1 
ATOM   2214  C  CB    . GLN A 1 305 ? 6.756   -3.380  63.453  1.00 119.35 ? 284 GLN A CB    1 
ATOM   2215  C  CG    . GLN A 1 305 ? 6.407   -1.995  62.909  1.00 118.17 ? 284 GLN A CG    1 
ATOM   2216  C  CD    . GLN A 1 305 ? 7.090   -0.926  63.772  1.00 152.04 ? 284 GLN A CD    1 
ATOM   2217  O  OE1   . GLN A 1 305 ? 6.448   -0.173  64.517  1.00 157.63 ? 284 GLN A OE1   1 
ATOM   2218  N  NE2   . GLN A 1 305 ? 8.423   -0.890  63.697  1.00 169.60 ? 284 GLN A NE2   1 
ATOM   2219  N  N     . SER A 1 306 ? 4.435   -5.164  61.248  1.00 107.51 ? 285 SER A N     1 
ATOM   2220  C  CA    . SER A 1 306 ? 3.025   -5.432  61.008  1.00 104.02 ? 285 SER A CA    1 
ATOM   2221  C  C     . SER A 1 306 ? 2.780   -6.940  61.034  1.00 102.95 ? 285 SER A C     1 
ATOM   2222  O  O     . SER A 1 306 ? 3.572   -7.721  60.491  1.00 104.49 ? 285 SER A O     1 
ATOM   2223  C  CB    . SER A 1 306 ? 2.542   -4.848  59.687  1.00 110.54 ? 285 SER A CB    1 
ATOM   2224  O  OG    . SER A 1 306 ? 1.308   -5.450  59.304  1.00 97.45  ? 285 SER A OG    1 
ATOM   2225  N  N     . SER A 1 307 ? 1.711   -7.350  61.708  1.00 102.51 ? 286 SER A N     1 
ATOM   2226  C  CA    . SER A 1 307 ? 1.280   -8.741  61.726  1.00 101.54 ? 286 SER A CA    1 
ATOM   2227  C  C     . SER A 1 307 ? 0.363   -9.070  60.560  1.00 97.38  ? 286 SER A C     1 
ATOM   2228  O  O     . SER A 1 307 ? -0.237  -10.153 60.536  1.00 96.40  ? 286 SER A O     1 
ATOM   2229  C  CB    . SER A 1 307 ? 0.559   -9.057  63.038  1.00 115.44 ? 286 SER A CB    1 
ATOM   2230  O  OG    . SER A 1 307 ? -0.645  -8.324  63.192  1.00 102.43 ? 286 SER A OG    1 
ATOM   2231  N  N     . HIS A 1 308 ? 0.204   -8.125  59.639  1.00 95.36  ? 287 HIS A N     1 
ATOM   2232  C  CA    . HIS A 1 308 ? -0.739  -8.240  58.551  1.00 91.92  ? 287 HIS A CA    1 
ATOM   2233  C  C     . HIS A 1 308 ? -0.408  -9.430  57.656  1.00 97.07  ? 287 HIS A C     1 
ATOM   2234  O  O     . HIS A 1 308 ? 0.764   -9.812  57.510  1.00 91.68  ? 287 HIS A O     1 
ATOM   2235  C  CB    . HIS A 1 308 ? -0.763  -6.942  57.766  1.00 90.93  ? 287 HIS A CB    1 
ATOM   2236  C  CG    . HIS A 1 308 ? -2.002  -6.747  56.947  1.00 100.44 ? 287 HIS A CG    1 
ATOM   2237  N  ND1   . HIS A 1 308 ? -2.090  -7.107  55.618  1.00 88.01  ? 287 HIS A ND1   1 
ATOM   2238  C  CD2   . HIS A 1 308 ? -3.222  -6.268  57.289  1.00 87.92  ? 287 HIS A CD2   1 
ATOM   2239  C  CE1   . HIS A 1 308 ? -3.295  -6.820  55.165  1.00 84.42  ? 287 HIS A CE1   1 
ATOM   2240  N  NE2   . HIS A 1 308 ? -4.003  -6.316  56.162  1.00 110.79 ? 287 HIS A NE2   1 
ATOM   2241  N  N     . PRO A 1 309 ? -1.431  -10.026 57.039  1.00 103.70 ? 288 PRO A N     1 
ATOM   2242  C  CA    . PRO A 1 309 ? -1.215  -11.236 56.245  1.00 98.76  ? 288 PRO A CA    1 
ATOM   2243  C  C     . PRO A 1 309 ? -0.286  -10.985 55.081  1.00 105.01 ? 288 PRO A C     1 
ATOM   2244  O  O     . PRO A 1 309 ? -0.516  -10.093 54.261  1.00 89.00  ? 288 PRO A O     1 
ATOM   2245  C  CB    . PRO A 1 309 ? -2.619  -11.574 55.755  1.00 101.80 ? 288 PRO A CB    1 
ATOM   2246  C  CG    . PRO A 1 309 ? -3.512  -10.977 56.739  1.00 85.45  ? 288 PRO A CG    1 
ATOM   2247  C  CD    . PRO A 1 309 ? -2.863  -9.735  57.197  1.00 89.77  ? 288 PRO A CD    1 
ATOM   2248  N  N     . GLY A 1 310 ? 0.742   -11.821 54.986  1.00 139.45 ? 289 GLY A N     1 
ATOM   2249  C  CA    . GLY A 1 310 ? 1.676   -11.588 53.925  1.00 129.76 ? 289 GLY A CA    1 
ATOM   2250  C  C     . GLY A 1 310 ? 2.569   -10.413 54.183  1.00 89.34  ? 289 GLY A C     1 
ATOM   2251  O  O     . GLY A 1 310 ? 3.228   -9.958  53.253  1.00 89.13  ? 289 GLY A O     1 
ATOM   2252  N  N     . ALA A 1 311 ? 2.555   -9.857  55.396  1.00 90.96  ? 290 ALA A N     1 
ATOM   2253  C  CA    . ALA A 1 311 ? 3.512   -8.804  55.713  1.00 112.49 ? 290 ALA A CA    1 
ATOM   2254  C  C     . ALA A 1 311 ? 4.916   -9.368  55.818  1.00 96.22  ? 290 ALA A C     1 
ATOM   2255  O  O     . ALA A 1 311 ? 5.875   -8.773  55.310  1.00 97.64  ? 290 ALA A O     1 
ATOM   2256  C  CB    . ALA A 1 311 ? 3.130   -8.106  57.014  1.00 107.31 ? 290 ALA A CB    1 
ATOM   2257  N  N     . ARG A 1 312 ? 5.053   -10.502 56.503  1.00 97.48  ? 291 ARG A N     1 
ATOM   2258  C  CA    . ARG A 1 312 ? 6.350   -11.159 56.621  1.00 102.64 ? 291 ARG A CA    1 
ATOM   2259  C  C     . ARG A 1 312 ? 6.957   -11.430 55.248  1.00 117.63 ? 291 ARG A C     1 
ATOM   2260  O  O     . ARG A 1 312 ? 8.168   -11.247 55.048  1.00 108.84 ? 291 ARG A O     1 
ATOM   2261  C  CB    . ARG A 1 312 ? 6.199   -12.452 57.423  1.00 113.69 ? 291 ARG A CB    1 
ATOM   2262  C  CG    . ARG A 1 312 ? 7.486   -13.169 57.722  1.00 105.63 ? 291 ARG A CG    1 
ATOM   2263  C  CD    . ARG A 1 312 ? 7.219   -14.635 57.907  1.00 105.81 ? 291 ARG A CD    1 
ATOM   2264  N  NE    . ARG A 1 312 ? 7.405   -15.143 59.259  1.00 109.50 ? 291 ARG A NE    1 
ATOM   2265  C  CZ    . ARG A 1 312 ? 6.883   -16.288 59.686  1.00 121.35 ? 291 ARG A CZ    1 
ATOM   2266  N  NH1   . ARG A 1 312 ? 6.158   -17.010 58.843  1.00 106.61 ? 291 ARG A NH1   1 
ATOM   2267  N  NH2   . ARG A 1 312 ? 7.090   -16.720 60.935  1.00 135.97 ? 291 ARG A NH2   1 
ATOM   2268  N  N     . LEU A 1 313 ? 6.125   -11.842 54.279  1.00 119.14 ? 292 LEU A N     1 
ATOM   2269  C  CA    . LEU A 1 313 ? 6.632   -12.102 52.932  1.00 97.65  ? 292 LEU A CA    1 
ATOM   2270  C  C     . LEU A 1 313 ? 7.149   -10.833 52.272  1.00 95.91  ? 292 LEU A C     1 
ATOM   2271  O  O     . LEU A 1 313 ? 8.273   -10.812 51.767  1.00 98.10  ? 292 LEU A O     1 
ATOM   2272  C  CB    . LEU A 1 313 ? 5.554   -12.754 52.077  1.00 91.95  ? 292 LEU A CB    1 
ATOM   2273  C  CG    . LEU A 1 313 ? 6.165   -13.670 51.041  1.00 92.17  ? 292 LEU A CG    1 
ATOM   2274  C  CD1   . LEU A 1 313 ? 7.110   -14.537 51.793  1.00 95.34  ? 292 LEU A CD1   1 
ATOM   2275  C  CD2   . LEU A 1 313 ? 5.062   -14.514 50.468  1.00 89.37  ? 292 LEU A CD2   1 
ATOM   2276  N  N     . ARG A 1 314 ? 6.361   -9.747  52.296  1.00 102.33 ? 293 ARG A N     1 
ATOM   2277  C  CA    . ARG A 1 314 ? 6.847   -8.489  51.729  1.00 95.31  ? 293 ARG A CA    1 
ATOM   2278  C  C     . ARG A 1 314 ? 8.086   -8.007  52.456  1.00 99.34  ? 293 ARG A C     1 
ATOM   2279  O  O     . ARG A 1 314 ? 8.881   -7.252  51.893  1.00 101.17 ? 293 ARG A O     1 
ATOM   2280  C  CB    . ARG A 1 314 ? 5.795   -7.368  51.744  1.00 93.54  ? 293 ARG A CB    1 
ATOM   2281  C  CG    . ARG A 1 314 ? 4.626   -7.431  50.743  1.00 90.18  ? 293 ARG A CG    1 
ATOM   2282  C  CD    . ARG A 1 314 ? 5.042   -7.863  49.365  1.00 89.73  ? 293 ARG A CD    1 
ATOM   2283  N  NE    . ARG A 1 314 ? 5.922   -6.930  48.668  1.00 91.72  ? 293 ARG A NE    1 
ATOM   2284  C  CZ    . ARG A 1 314 ? 6.580   -7.247  47.545  1.00 96.68  ? 293 ARG A CZ    1 
ATOM   2285  N  NH1   . ARG A 1 314 ? 6.477   -8.463  47.005  1.00 91.21  ? 293 ARG A NH1   1 
ATOM   2286  N  NH2   . ARG A 1 314 ? 7.364   -6.365  46.960  1.00 94.64  ? 293 ARG A NH2   1 
ATOM   2287  N  N     . ALA A 1 315 ? 8.268   -8.398  53.710  1.00 101.21 ? 294 ALA A N     1 
ATOM   2288  C  CA    . ALA A 1 315 ? 9.492   -7.976  54.366  1.00 105.58 ? 294 ALA A CA    1 
ATOM   2289  C  C     . ALA A 1 315 ? 10.693  -8.667  53.750  1.00 107.87 ? 294 ALA A C     1 
ATOM   2290  O  O     . ALA A 1 315 ? 11.643  -8.008  53.324  1.00 110.44 ? 294 ALA A O     1 
ATOM   2291  C  CB    . ALA A 1 315 ? 9.413   -8.258  55.857  1.00 107.58 ? 294 ALA A CB    1 
ATOM   2292  N  N     . ILE A 1 316 ? 10.629  -9.987  53.606  1.00 107.09 ? 295 ILE A N     1 
ATOM   2293  C  CA    . ILE A 1 316 ? 11.738  -10.688 52.974  1.00 109.43 ? 295 ILE A CA    1 
ATOM   2294  C  C     . ILE A 1 316 ? 11.984  -10.140 51.579  1.00 108.57 ? 295 ILE A C     1 
ATOM   2295  O  O     . ILE A 1 316 ? 13.087  -9.695  51.250  1.00 111.87 ? 295 ILE A O     1 
ATOM   2296  C  CB    . ILE A 1 316 ? 11.466  -12.199 52.923  1.00 108.39 ? 295 ILE A CB    1 
ATOM   2297  C  CG1   . ILE A 1 316 ? 11.283  -12.743 54.325  1.00 109.95 ? 295 ILE A CG1   1 
ATOM   2298  C  CG2   . ILE A 1 316 ? 12.578  -12.942 52.147  1.00 110.86 ? 295 ILE A CG2   1 
ATOM   2299  C  CD1   . ILE A 1 316 ? 10.674  -14.084 54.343  1.00 108.37 ? 295 ILE A CD1   1 
ATOM   2300  N  N     . ARG A 1 317 ? 10.928  -10.090 50.769  1.00 115.61 ? 296 ARG A N     1 
ATOM   2301  C  CA    . ARG A 1 317 ? 11.044  -9.644  49.388  1.00 103.74 ? 296 ARG A CA    1 
ATOM   2302  C  C     . ARG A 1 317 ? 11.517  -8.215  49.330  1.00 105.77 ? 296 ARG A C     1 
ATOM   2303  O  O     . ARG A 1 317 ? 12.149  -7.792  48.358  1.00 119.52 ? 296 ARG A O     1 
ATOM   2304  C  CB    . ARG A 1 317 ? 9.689   -9.809  48.702  1.00 120.64 ? 296 ARG A CB    1 
ATOM   2305  C  CG    . ARG A 1 317 ? 9.532   -9.126  47.376  1.00 125.87 ? 296 ARG A CG    1 
ATOM   2306  C  CD    . ARG A 1 317 ? 10.487  -9.672  46.402  1.00 117.54 ? 296 ARG A CD    1 
ATOM   2307  N  NE    . ARG A 1 317 ? 10.619  -8.752  45.295  1.00 100.95 ? 296 ARG A NE    1 
ATOM   2308  C  CZ    . ARG A 1 317 ? 11.514  -8.923  44.347  1.00 104.82 ? 296 ARG A CZ    1 
ATOM   2309  N  NH1   . ARG A 1 317 ? 12.319  -9.976  44.416  1.00 105.17 ? 296 ARG A NH1   1 
ATOM   2310  N  NH2   . ARG A 1 317 ? 11.618  -8.043  43.360  1.00 113.28 ? 296 ARG A NH2   1 
ATOM   2311  N  N     . SER A 1 318 ? 11.233  -7.459  50.363  1.00 106.19 ? 297 SER A N     1 
ATOM   2312  C  CA    . SER A 1 318 ? 11.753  -6.117  50.394  1.00 108.69 ? 297 SER A CA    1 
ATOM   2313  C  C     . SER A 1 318 ? 13.249  -6.121  50.702  1.00 113.75 ? 297 SER A C     1 
ATOM   2314  O  O     . SER A 1 318 ? 14.036  -5.473  49.999  1.00 116.28 ? 297 SER A O     1 
ATOM   2315  C  CB    . SER A 1 318 ? 10.963  -5.303  51.383  1.00 107.84 ? 297 SER A CB    1 
ATOM   2316  O  OG    . SER A 1 318 ? 11.000  -3.985  50.917  1.00 108.69 ? 297 SER A OG    1 
ATOM   2317  N  N     . LEU A 1 319 ? 13.672  -6.862  51.737  1.00 115.71 ? 298 LEU A N     1 
ATOM   2318  C  CA    . LEU A 1 319 ? 15.099  -6.956  52.017  1.00 120.99 ? 298 LEU A CA    1 
ATOM   2319  C  C     . LEU A 1 319 ? 15.837  -7.395  50.781  1.00 122.08 ? 298 LEU A C     1 
ATOM   2320  O  O     . LEU A 1 319 ? 16.827  -6.774  50.395  1.00 125.85 ? 298 LEU A O     1 
ATOM   2321  C  CB    . LEU A 1 319 ? 15.403  -7.934  53.150  1.00 123.01 ? 298 LEU A CB    1 
ATOM   2322  C  CG    . LEU A 1 319 ? 15.180  -7.566  54.607  1.00 124.51 ? 298 LEU A CG    1 
ATOM   2323  C  CD1   . LEU A 1 319 ? 15.194  -8.816  55.467  1.00 125.49 ? 298 LEU A CD1   1 
ATOM   2324  C  CD2   . LEU A 1 319 ? 16.248  -6.593  55.026  1.00 129.70 ? 298 LEU A CD2   1 
ATOM   2325  N  N     . GLU A 1 320 ? 15.318  -8.419  50.101  1.00 118.95 ? 299 GLU A N     1 
ATOM   2326  C  CA    . GLU A 1 320 ? 15.923  -8.848  48.848  1.00 119.88 ? 299 GLU A CA    1 
ATOM   2327  C  C     . GLU A 1 320 ? 15.955  -7.716  47.822  1.00 119.93 ? 299 GLU A C     1 
ATOM   2328  O  O     . GLU A 1 320 ? 16.998  -7.453  47.210  1.00 123.69 ? 299 GLU A O     1 
ATOM   2329  C  CB    . GLU A 1 320 ? 15.193  -10.047 48.240  1.00 116.26 ? 299 GLU A CB    1 
ATOM   2330  C  CG    . GLU A 1 320 ? 16.072  -10.652 47.129  1.00 118.53 ? 299 GLU A CG    1 
ATOM   2331  C  CD    . GLU A 1 320 ? 15.345  -11.340 45.975  1.00 142.24 ? 299 GLU A CD    1 
ATOM   2332  O  OE1   . GLU A 1 320 ? 14.162  -11.731 46.103  1.00 128.53 ? 299 GLU A OE1   1 
ATOM   2333  O  OE2   . GLU A 1 320 ? 15.982  -11.432 44.895  1.00 131.60 ? 299 GLU A OE2   1 
ATOM   2334  N  N     . ARG A 1 321 ? 14.856  -6.980  47.672  1.00 116.38 ? 300 ARG A N     1 
ATOM   2335  C  CA    . ARG A 1 321 ? 14.866  -5.932  46.661  1.00 116.79 ? 300 ARG A CA    1 
ATOM   2336  C  C     . ARG A 1 321 ? 15.944  -4.898  46.957  1.00 133.95 ? 300 ARG A C     1 
ATOM   2337  O  O     . ARG A 1 321 ? 16.574  -4.378  46.025  1.00 124.28 ? 300 ARG A O     1 
ATOM   2338  C  CB    . ARG A 1 321 ? 13.482  -5.273  46.583  1.00 112.66 ? 300 ARG A CB    1 
ATOM   2339  C  CG    . ARG A 1 321 ? 12.676  -5.610  45.340  1.00 112.51 ? 300 ARG A CG    1 
ATOM   2340  C  CD    . ARG A 1 321 ? 11.160  -5.488  45.560  1.00 116.67 ? 300 ARG A CD    1 
ATOM   2341  N  NE    . ARG A 1 321 ? 10.537  -4.176  45.367  1.00 105.62 ? 300 ARG A NE    1 
ATOM   2342  C  CZ    . ARG A 1 321 ? 10.545  -3.486  44.229  1.00 127.39 ? 300 ARG A CZ    1 
ATOM   2343  N  NH1   . ARG A 1 321 ? 11.179  -3.958  43.159  1.00 145.17 ? 300 ARG A NH1   1 
ATOM   2344  N  NH2   . ARG A 1 321 ? 9.917   -2.314  44.160  1.00 115.47 ? 300 ARG A NH2   1 
ATOM   2345  N  N     . GLY A 1 322 ? 16.247  -4.681  48.241  1.00 127.51 ? 301 GLY A N     1 
ATOM   2346  C  CA    . GLY A 1 322 ? 17.295  -3.822  48.760  1.00 143.31 ? 301 GLY A CA    1 
ATOM   2347  C  C     . GLY A 1 322 ? 18.661  -4.461  48.883  1.00 146.46 ? 301 GLY A C     1 
ATOM   2348  O  O     . GLY A 1 322 ? 19.553  -3.886  49.521  1.00 152.27 ? 301 GLY A O     1 
ATOM   2349  N  N     . GLU A 1 323 ? 18.846  -5.623  48.252  1.00 151.32 ? 302 GLU A N     1 
ATOM   2350  C  CA    . GLU A 1 323 ? 20.106  -6.347  48.142  1.00 137.79 ? 302 GLU A CA    1 
ATOM   2351  C  C     . GLU A 1 323 ? 20.698  -6.778  49.482  1.00 141.13 ? 302 GLU A C     1 
ATOM   2352  O  O     . GLU A 1 323 ? 21.881  -7.073  49.557  1.00 146.39 ? 302 GLU A O     1 
ATOM   2353  C  CB    . GLU A 1 323 ? 21.116  -5.476  47.382  1.00 145.79 ? 302 GLU A CB    1 
ATOM   2354  C  CG    . GLU A 1 323 ? 20.580  -4.925  46.047  1.00 156.14 ? 302 GLU A CG    1 
ATOM   2355  C  CD    . GLU A 1 323 ? 21.636  -4.197  45.207  1.00 175.89 ? 302 GLU A CD    1 
ATOM   2356  O  OE1   . GLU A 1 323 ? 22.725  -3.876  45.734  1.00 218.55 ? 302 GLU A OE1   1 
ATOM   2357  O  OE2   . GLU A 1 323 ? 21.360  -3.909  44.023  1.00 145.30 ? 302 GLU A OE2   1 
ATOM   2358  N  N     . ARG A 1 324 ? 19.909  -6.913  50.539  1.00 138.58 ? 303 ARG A N     1 
ATOM   2359  C  CA    . ARG A 1 324 ? 20.418  -7.465  51.790  1.00 141.91 ? 303 ARG A CA    1 
ATOM   2360  C  C     . ARG A 1 324 ? 19.930  -8.904  51.787  1.00 139.06 ? 303 ARG A C     1 
ATOM   2361  O  O     . ARG A 1 324 ? 18.840  -9.222  52.262  1.00 148.74 ? 303 ARG A O     1 
ATOM   2362  C  CB    . ARG A 1 324 ? 19.873  -6.668  52.967  1.00 141.51 ? 303 ARG A CB    1 
ATOM   2363  C  CG    . ARG A 1 324 ? 20.087  -5.168  52.786  1.00 143.26 ? 303 ARG A CG    1 
ATOM   2364  C  CD    . ARG A 1 324 ? 19.151  -4.291  53.609  1.00 141.02 ? 303 ARG A CD    1 
ATOM   2365  N  NE    . ARG A 1 324 ? 19.266  -4.504  55.044  1.00 143.50 ? 303 ARG A NE    1 
ATOM   2366  C  CZ    . ARG A 1 324 ? 18.722  -3.702  55.953  1.00 144.48 ? 303 ARG A CZ    1 
ATOM   2367  N  NH1   . ARG A 1 324 ? 18.048  -2.637  55.559  1.00 160.93 ? 303 ARG A NH1   1 
ATOM   2368  N  NH2   . ARG A 1 324 ? 18.854  -3.952  57.251  1.00 150.55 ? 303 ARG A NH2   1 
ATOM   2369  N  N     . PHE A 1 325 ? 20.773  -9.783  51.288  1.00 141.87 ? 304 PHE A N     1 
ATOM   2370  C  CA    . PHE A 1 325 ? 20.383  -11.167 51.095  1.00 139.54 ? 304 PHE A CA    1 
ATOM   2371  C  C     . PHE A 1 325 ? 20.582  -11.973 52.357  1.00 142.61 ? 304 PHE A C     1 
ATOM   2372  O  O     . PHE A 1 325 ? 19.835  -12.927 52.611  1.00 141.53 ? 304 PHE A O     1 
ATOM   2373  C  CB    . PHE A 1 325 ? 21.190  -11.748 49.944  1.00 148.63 ? 304 PHE A CB    1 
ATOM   2374  C  CG    . PHE A 1 325 ? 21.086  -10.938 48.700  1.00 153.24 ? 304 PHE A CG    1 
ATOM   2375  C  CD1   . PHE A 1 325 ? 20.051  -11.112 47.820  1.00 152.35 ? 304 PHE A CD1   1 
ATOM   2376  C  CD2   . PHE A 1 325 ? 21.966  -9.894  48.485  1.00 172.17 ? 304 PHE A CD2   1 
ATOM   2377  C  CE1   . PHE A 1 325 ? 19.956  -10.329 46.689  1.00 156.24 ? 304 PHE A CE1   1 
ATOM   2378  C  CE2   . PHE A 1 325 ? 21.872  -9.107  47.369  1.00 161.68 ? 304 PHE A CE2   1 
ATOM   2379  C  CZ    . PHE A 1 325 ? 20.864  -9.319  46.470  1.00 152.26 ? 304 PHE A CZ    1 
ATOM   2380  N  N     . ALA A 1 326 ? 21.614  -11.619 53.122  1.00 147.94 ? 305 ALA A N     1 
ATOM   2381  C  CA    . ALA A 1 326 ? 21.890  -12.332 54.352  1.00 151.27 ? 305 ALA A CA    1 
ATOM   2382  C  C     . ALA A 1 326 ? 20.672  -12.319 55.262  1.00 147.28 ? 305 ALA A C     1 
ATOM   2383  O  O     . ALA A 1 326 ? 20.143  -13.381 55.609  1.00 145.70 ? 305 ALA A O     1 
ATOM   2384  C  CB    . ALA A 1 326 ? 23.090  -11.691 55.045  1.00 165.21 ? 305 ALA A CB    1 
ATOM   2385  N  N     . GLU A 1 327 ? 20.128  -11.125 55.546  1.00 145.36 ? 306 GLU A N     1 
ATOM   2386  C  CA    . GLU A 1 327 ? 18.963  -11.040 56.425  1.00 141.95 ? 306 GLU A CA    1 
ATOM   2387  C  C     . GLU A 1 327 ? 17.757  -11.709 55.796  1.00 135.66 ? 306 GLU A C     1 
ATOM   2388  O  O     . GLU A 1 327 ? 17.011  -12.431 56.469  1.00 133.99 ? 306 GLU A O     1 
ATOM   2389  C  CB    . GLU A 1 327 ? 18.656  -9.586  56.757  1.00 141.46 ? 306 GLU A CB    1 
ATOM   2390  C  CG    . GLU A 1 327 ? 19.810  -8.903  57.421  1.00 165.83 ? 306 GLU A CG    1 
ATOM   2391  C  CD    . GLU A 1 327 ? 19.793  -7.413  57.246  1.00 159.81 ? 306 GLU A CD    1 
ATOM   2392  O  OE1   . GLU A 1 327 ? 19.544  -6.970  56.103  1.00 159.08 ? 306 GLU A OE1   1 
ATOM   2393  O  OE2   . GLU A 1 327 ? 20.029  -6.696  58.250  1.00 151.52 ? 306 GLU A OE2   1 
ATOM   2394  N  N     . ALA A 1 328 ? 17.573  -11.502 54.499  1.00 133.59 ? 307 ALA A N     1 
ATOM   2395  C  CA    . ALA A 1 328 ? 16.467  -12.133 53.812  1.00 127.06 ? 307 ALA A CA    1 
ATOM   2396  C  C     . ALA A 1 328 ? 16.456  -13.632 54.065  1.00 127.57 ? 307 ALA A C     1 
ATOM   2397  O  O     . ALA A 1 328 ? 15.476  -14.161 54.596  1.00 124.88 ? 307 ALA A O     1 
ATOM   2398  C  CB    . ALA A 1 328 ? 16.555  -11.824 52.318  1.00 125.19 ? 307 ALA A CB    1 
ATOM   2399  N  N     . HIS A 1 329 ? 17.584  -14.313 53.816  1.00 131.77 ? 308 HIS A N     1 
ATOM   2400  C  CA    . HIS A 1 329 ? 17.594  -15.774 53.924  1.00 132.47 ? 308 HIS A CA    1 
ATOM   2401  C  C     . HIS A 1 329 ? 17.248  -16.226 55.335  1.00 145.61 ? 308 HIS A C     1 
ATOM   2402  O  O     . HIS A 1 329 ? 16.543  -17.230 55.517  1.00 148.01 ? 308 HIS A O     1 
ATOM   2403  C  CB    . HIS A 1 329 ? 18.958  -16.361 53.534  1.00 137.72 ? 308 HIS A CB    1 
ATOM   2404  C  CG    . HIS A 1 329 ? 19.043  -17.857 53.691  1.00 139.18 ? 308 HIS A CG    1 
ATOM   2405  N  ND1   . HIS A 1 329 ? 19.482  -18.469 54.844  1.00 143.65 ? 308 HIS A ND1   1 
ATOM   2406  C  CD2   . HIS A 1 329 ? 18.829  -18.860 52.804  1.00 138.14 ? 308 HIS A CD2   1 
ATOM   2407  C  CE1   . HIS A 1 329 ? 19.464  -19.782 54.687  1.00 144.32 ? 308 HIS A CE1   1 
ATOM   2408  N  NE2   . HIS A 1 329 ? 19.084  -20.047 53.452  1.00 140.57 ? 308 HIS A NE2   1 
ATOM   2409  N  N     . ALA A 1 330 ? 17.741  -15.508 56.349  1.00 137.57 ? 309 ALA A N     1 
ATOM   2410  C  CA    . ALA A 1 330 ? 17.452  -15.902 57.725  1.00 139.58 ? 309 ALA A CA    1 
ATOM   2411  C  C     . ALA A 1 330 ? 15.982  -15.703 58.066  1.00 134.42 ? 309 ALA A C     1 
ATOM   2412  O  O     . ALA A 1 330 ? 15.380  -16.520 58.780  1.00 143.32 ? 309 ALA A O     1 
ATOM   2413  C  CB    . ALA A 1 330 ? 18.348  -15.147 58.698  1.00 145.22 ? 309 ALA A CB    1 
ATOM   2414  N  N     . LEU A 1 331 ? 15.380  -14.627 57.571  1.00 130.53 ? 310 LEU A N     1 
ATOM   2415  C  CA    . LEU A 1 331 ? 13.963  -14.453 57.838  1.00 125.88 ? 310 LEU A CA    1 
ATOM   2416  C  C     . LEU A 1 331 ? 13.157  -15.552 57.173  1.00 122.12 ? 310 LEU A C     1 
ATOM   2417  O  O     . LEU A 1 331 ? 12.271  -16.143 57.794  1.00 124.61 ? 310 LEU A O     1 
ATOM   2418  C  CB    . LEU A 1 331 ? 13.499  -13.086 57.344  1.00 122.80 ? 310 LEU A CB    1 
ATOM   2419  C  CG    . LEU A 1 331 ? 12.123  -12.653 57.834  1.00 119.13 ? 310 LEU A CG    1 
ATOM   2420  C  CD1   . LEU A 1 331 ? 12.060  -12.770 59.337  1.00 140.16 ? 310 LEU A CD1   1 
ATOM   2421  C  CD2   . LEU A 1 331 ? 11.886  -11.234 57.440  1.00 117.42 ? 310 LEU A CD2   1 
ATOM   2422  N  N     . ALA A 1 332 ? 13.488  -15.874 55.924  1.00 120.86 ? 311 ALA A N     1 
ATOM   2423  C  CA    . ALA A 1 332 ? 12.746  -16.902 55.208  1.00 117.53 ? 311 ALA A CA    1 
ATOM   2424  C  C     . ALA A 1 332 ? 12.858  -18.244 55.901  1.00 120.12 ? 311 ALA A C     1 
ATOM   2425  O  O     . ALA A 1 332 ? 11.862  -18.972 56.003  1.00 117.66 ? 311 ALA A O     1 
ATOM   2426  C  CB    . ALA A 1 332 ? 13.253  -17.011 53.773  1.00 124.51 ? 311 ALA A CB    1 
ATOM   2427  N  N     . ARG A 1 333 ? 14.063  -18.585 56.397  1.00 125.54 ? 312 ARG A N     1 
ATOM   2428  C  CA    . ARG A 1 333 ? 14.214  -19.840 57.130  1.00 138.63 ? 312 ARG A CA    1 
ATOM   2429  C  C     . ARG A 1 333 ? 13.345  -19.820 58.370  1.00 153.58 ? 312 ARG A C     1 
ATOM   2430  O  O     . ARG A 1 333 ? 12.716  -20.826 58.707  1.00 172.76 ? 312 ARG A O     1 
ATOM   2431  C  CB    . ARG A 1 333 ? 15.663  -20.131 57.544  1.00 135.33 ? 312 ARG A CB    1 
ATOM   2432  C  CG    . ARG A 1 333 ? 16.529  -20.699 56.459  1.00 136.77 ? 312 ARG A CG    1 
ATOM   2433  C  CD    . ARG A 1 333 ? 15.880  -21.839 55.634  1.00 156.22 ? 312 ARG A CD    1 
ATOM   2434  N  NE    . ARG A 1 333 ? 15.281  -22.985 56.324  1.00 164.87 ? 312 ARG A NE    1 
ATOM   2435  C  CZ    . ARG A 1 333 ? 15.960  -24.048 56.754  1.00 179.05 ? 312 ARG A CZ    1 
ATOM   2436  N  NH1   . ARG A 1 333 ? 17.284  -24.123 56.599  1.00 171.39 ? 312 ARG A NH1   1 
ATOM   2437  N  NH2   . ARG A 1 333 ? 15.311  -25.043 57.344  1.00 171.35 ? 312 ARG A NH2   1 
ATOM   2438  N  N     . GLU A 1 334 ? 13.315  -18.688 59.077  1.00 144.35 ? 313 GLU A N     1 
ATOM   2439  C  CA    . GLU A 1 334 ? 12.441  -18.598 60.241  1.00 141.91 ? 313 GLU A CA    1 
ATOM   2440  C  C     . GLU A 1 334 ? 10.984  -18.803 59.857  1.00 126.13 ? 313 GLU A C     1 
ATOM   2441  O  O     . GLU A 1 334 ? 10.234  -19.469 60.578  1.00 127.96 ? 313 GLU A O     1 
ATOM   2442  C  CB    . GLU A 1 334 ? 12.635  -17.263 60.945  1.00 149.98 ? 313 GLU A CB    1 
ATOM   2443  C  CG    . GLU A 1 334 ? 11.734  -17.092 62.132  1.00 160.13 ? 313 GLU A CG    1 
ATOM   2444  C  CD    . GLU A 1 334 ? 11.986  -15.787 62.818  1.00 160.62 ? 313 GLU A CD    1 
ATOM   2445  O  OE1   . GLU A 1 334 ? 13.155  -15.335 62.786  1.00 136.19 ? 313 GLU A OE1   1 
ATOM   2446  O  OE2   . GLU A 1 334 ? 11.020  -15.215 63.373  1.00 183.86 ? 313 GLU A OE2   1 
ATOM   2447  N  N     . ALA A 1 335 ? 10.572  -18.243 58.716  1.00 141.69 ? 314 ALA A N     1 
ATOM   2448  C  CA    . ALA A 1 335 ? 9.188   -18.341 58.265  1.00 115.86 ? 314 ALA A CA    1 
ATOM   2449  C  C     . ALA A 1 335 ? 8.809   -19.758 57.861  1.00 114.35 ? 314 ALA A C     1 
ATOM   2450  O  O     . ALA A 1 335 ? 7.758   -20.264 58.270  1.00 111.99 ? 314 ALA A O     1 
ATOM   2451  C  CB    . ALA A 1 335 ? 8.975   -17.396 57.095  1.00 110.18 ? 314 ALA A CB    1 
ATOM   2452  N  N     . SER A 1 336 ? 9.683   -20.442 57.124  1.00 114.80 ? 315 SER A N     1 
ATOM   2453  C  CA    . SER A 1 336 ? 9.356   -21.762 56.607  1.00 114.18 ? 315 SER A CA    1 
ATOM   2454  C  C     . SER A 1 336 ? 9.197   -22.791 57.716  1.00 125.36 ? 315 SER A C     1 
ATOM   2455  O  O     . SER A 1 336 ? 8.793   -23.930 57.441  1.00 125.68 ? 315 SER A O     1 
ATOM   2456  C  CB    . SER A 1 336 ? 10.426  -22.209 55.610  1.00 115.68 ? 315 SER A CB    1 
ATOM   2457  O  OG    . SER A 1 336 ? 11.652  -22.512 56.254  1.00 152.45 ? 315 SER A OG    1 
ATOM   2458  N  N     . CYS A 1 337 ? 9.551   -22.418 58.949  1.00 124.16 ? 316 CYS A N     1 
ATOM   2459  C  CA    . CYS A 1 337 ? 9.428   -23.274 60.123  1.00 124.84 ? 316 CYS A CA    1 
ATOM   2460  C  C     . CYS A 1 337 ? 7.993   -23.357 60.632  1.00 143.54 ? 316 CYS A C     1 
ATOM   2461  O  O     . CYS A 1 337 ? 7.533   -24.435 61.029  1.00 145.86 ? 316 CYS A O     1 
ATOM   2462  C  CB    . CYS A 1 337 ? 10.340  -22.715 61.205  1.00 129.76 ? 316 CYS A CB    1 
ATOM   2463  S  SG    . CYS A 1 337 ? 12.041  -22.868 60.695  1.00 197.80 ? 316 CYS A SG    1 
ATOM   2464  N  N     . ALA A 1 338 ? 7.299   -22.220 60.670  1.00 146.49 ? 317 ALA A N     1 
ATOM   2465  C  CA    . ALA A 1 338 ? 5.899   -22.155 61.096  1.00 141.10 ? 317 ALA A CA    1 
ATOM   2466  C  C     . ALA A 1 338 ? 5.231   -21.082 60.258  1.00 111.75 ? 317 ALA A C     1 
ATOM   2467  O  O     . ALA A 1 338 ? 5.063   -19.936 60.705  1.00 118.22 ? 317 ALA A O     1 
ATOM   2468  C  CB    . ALA A 1 338 ? 5.780   -21.850 62.592  1.00 157.56 ? 317 ALA A CB    1 
ATOM   2469  N  N     . PRO A 1 339 ? 4.863   -21.397 59.015  1.00 108.21 ? 318 PRO A N     1 
ATOM   2470  C  CA    . PRO A 1 339 ? 4.487   -20.355 58.072  1.00 104.07 ? 318 PRO A CA    1 
ATOM   2471  C  C     . PRO A 1 339 ? 3.105   -19.810 58.366  1.00 101.50 ? 318 PRO A C     1 
ATOM   2472  O  O     . PRO A 1 339 ? 2.219   -20.529 58.826  1.00 101.72 ? 318 PRO A O     1 
ATOM   2473  C  CB    . PRO A 1 339 ? 4.508   -21.082 56.728  1.00 101.98 ? 318 PRO A CB    1 
ATOM   2474  C  CG    . PRO A 1 339 ? 5.096   -22.389 56.979  1.00 105.24 ? 318 PRO A CG    1 
ATOM   2475  C  CD    . PRO A 1 339 ? 4.776   -22.715 58.379  1.00 108.13 ? 318 PRO A CD    1 
ATOM   2476  N  N     . GLU A 1 340 ? 2.911   -18.535 58.002  1.00 106.64 ? 319 GLU A N     1 
ATOM   2477  C  CA    . GLU A 1 340 ? 1.658   -17.837 58.299  1.00 97.94  ? 319 GLU A CA    1 
ATOM   2478  C  C     . GLU A 1 340 ? 0.468   -18.461 57.597  1.00 103.48 ? 319 GLU A C     1 
ATOM   2479  O  O     . GLU A 1 340 ? -0.649  -18.393 58.119  1.00 146.16 ? 319 GLU A O     1 
ATOM   2480  C  CB    . GLU A 1 340 ? 1.729   -16.362 57.899  1.00 119.77 ? 319 GLU A CB    1 
ATOM   2481  C  CG    . GLU A 1 340 ? 2.469   -15.447 58.865  1.00 149.00 ? 319 GLU A CG    1 
ATOM   2482  C  CD    . GLU A 1 340 ? 2.240   -13.981 58.530  1.00 146.53 ? 319 GLU A CD    1 
ATOM   2483  O  OE1   . GLU A 1 340 ? 1.755   -13.710 57.378  1.00 93.24  ? 319 GLU A OE1   1 
ATOM   2484  O  OE2   . GLU A 1 340 ? 2.532   -13.133 59.429  1.00 165.08 ? 319 GLU A OE2   1 
ATOM   2485  N  N     . SER A 1 341 ? 0.670   -19.091 56.441  1.00 92.85  ? 320 SER A N     1 
ATOM   2486  C  CA    . SER A 1 341 ? -0.473  -19.540 55.658  1.00 90.27  ? 320 SER A CA    1 
ATOM   2487  C  C     . SER A 1 341 ? 0.014   -20.421 54.527  1.00 90.84  ? 320 SER A C     1 
ATOM   2488  O  O     . SER A 1 341 ? 1.204   -20.463 54.214  1.00 112.61 ? 320 SER A O     1 
ATOM   2489  C  CB    . SER A 1 341 ? -1.245  -18.389 55.050  1.00 87.38  ? 320 SER A CB    1 
ATOM   2490  O  OG    . SER A 1 341 ? -0.606  -17.977 53.872  1.00 96.80  ? 320 SER A OG    1 
ATOM   2491  N  N     . ASP A 1 342 ? -0.938  -21.085 53.875  1.00 88.17  ? 321 ASP A N     1 
ATOM   2492  C  CA    . ASP A 1 342 ? -0.567  -21.859 52.707  1.00 87.64  ? 321 ASP A CA    1 
ATOM   2493  C  C     . ASP A 1 342 ? -0.046  -20.947 51.621  1.00 96.44  ? 321 ASP A C     1 
ATOM   2494  O  O     . ASP A 1 342 ? 0.843   -21.340 50.863  1.00 113.55 ? 321 ASP A O     1 
ATOM   2495  C  CB    . ASP A 1 342 ? -1.753  -22.668 52.194  1.00 136.91 ? 321 ASP A CB    1 
ATOM   2496  C  CG    . ASP A 1 342 ? -1.958  -23.953 52.957  1.00 163.32 ? 321 ASP A CG    1 
ATOM   2497  O  OD1   . ASP A 1 342 ? -3.101  -24.480 52.953  1.00 181.37 ? 321 ASP A OD1   1 
ATOM   2498  O  OD2   . ASP A 1 342 ? -0.970  -24.451 53.532  1.00 154.93 ? 321 ASP A OD2   1 
ATOM   2499  N  N     . ALA A 1 343 ? -0.546  -19.712 51.555  1.00 84.18  ? 322 ALA A N     1 
ATOM   2500  C  CA    . ALA A 1 343 ? -0.048  -18.800 50.539  1.00 82.97  ? 322 ALA A CA    1 
ATOM   2501  C  C     . ALA A 1 343 ? 1.363   -18.341 50.854  1.00 84.90  ? 322 ALA A C     1 
ATOM   2502  O  O     . ALA A 1 343 ? 2.185   -18.164 49.949  1.00 107.73 ? 322 ALA A O     1 
ATOM   2503  C  CB    . ALA A 1 343 ? -0.974  -17.614 50.412  1.00 81.08  ? 322 ALA A CB    1 
ATOM   2504  N  N     . GLU A 1 344 ? 1.664   -18.142 52.125  1.00 86.72  ? 323 GLU A N     1 
ATOM   2505  C  CA    . GLU A 1 344 ? 3.024   -17.796 52.484  1.00 89.19  ? 323 GLU A CA    1 
ATOM   2506  C  C     . GLU A 1 344 ? 3.959   -18.956 52.227  1.00 91.30  ? 323 GLU A C     1 
ATOM   2507  O  O     . GLU A 1 344 ? 5.084   -18.746 51.770  1.00 92.75  ? 323 GLU A O     1 
ATOM   2508  C  CB    . GLU A 1 344 ? 3.117   -17.409 53.940  1.00 91.22  ? 323 GLU A CB    1 
ATOM   2509  C  CG    . GLU A 1 344 ? 4.500   -17.012 54.307  1.00 107.63 ? 323 GLU A CG    1 
ATOM   2510  C  CD    . GLU A 1 344 ? 4.526   -16.232 55.574  1.00 127.57 ? 323 GLU A CD    1 
ATOM   2511  O  OE1   . GLU A 1 344 ? 4.918   -16.828 56.610  1.00 105.64 ? 323 GLU A OE1   1 
ATOM   2512  O  OE2   . GLU A 1 344 ? 4.132   -15.038 55.530  1.00 146.08 ? 323 GLU A OE2   1 
ATOM   2513  N  N     . ARG A 1 345 ? 3.516   -20.187 52.536  1.00 91.89  ? 324 ARG A N     1 
ATOM   2514  C  CA    . ARG A 1 345 ? 4.251   -21.377 52.108  1.00 96.44  ? 324 ARG A CA    1 
ATOM   2515  C  C     . ARG A 1 345 ? 4.514   -21.312 50.612  1.00 92.26  ? 324 ARG A C     1 
ATOM   2516  O  O     . ARG A 1 345 ? 5.623   -21.581 50.137  1.00 94.55  ? 324 ARG A O     1 
ATOM   2517  C  CB    . ARG A 1 345 ? 3.479   -22.679 52.438  1.00 103.29 ? 324 ARG A CB    1 
ATOM   2518  C  CG    . ARG A 1 345 ? 3.512   -23.208 53.896  1.00 113.90 ? 324 ARG A CG    1 
ATOM   2519  C  CD    . ARG A 1 345 ? 2.847   -24.624 54.094  1.00 112.72 ? 324 ARG A CD    1 
ATOM   2520  N  NE    . ARG A 1 345 ? 1.574   -24.595 54.832  1.00 132.58 ? 324 ARG A NE    1 
ATOM   2521  C  CZ    . ARG A 1 345 ? 1.458   -24.479 56.159  1.00 156.34 ? 324 ARG A CZ    1 
ATOM   2522  N  NH1   . ARG A 1 345 ? 2.541   -24.388 56.917  1.00 180.04 ? 324 ARG A NH1   1 
ATOM   2523  N  NH2   . ARG A 1 345 ? 0.259   -24.456 56.742  1.00 145.41 ? 324 ARG A NH2   1 
ATOM   2524  N  N     . GLN A 1 346 ? 3.531   -20.850 49.867  1.00 89.18  ? 325 GLN A N     1 
ATOM   2525  C  CA    . GLN A 1 346 ? 3.623   -20.955 48.431  1.00 88.07  ? 325 GLN A CA    1 
ATOM   2526  C  C     . GLN A 1 346 ? 4.645   -19.965 47.903  1.00 88.75  ? 325 GLN A C     1 
ATOM   2527  O  O     . GLN A 1 346 ? 5.415   -20.283 46.996  1.00 92.86  ? 325 GLN A O     1 
ATOM   2528  C  CB    . GLN A 1 346 ? 2.229   -20.718 47.850  1.00 85.12  ? 325 GLN A CB    1 
ATOM   2529  C  CG    . GLN A 1 346 ? 2.060   -20.868 46.363  1.00 101.65 ? 325 GLN A CG    1 
ATOM   2530  C  CD    . GLN A 1 346 ? 0.622   -20.658 45.947  1.00 119.63 ? 325 GLN A CD    1 
ATOM   2531  O  OE1   . GLN A 1 346 ? -0.205  -20.234 46.755  1.00 80.81  ? 325 GLN A OE1   1 
ATOM   2532  N  NE2   . GLN A 1 346 ? 0.305   -20.987 44.691  1.00 151.24 ? 325 GLN A NE2   1 
ATOM   2533  N  N     . GLY A 1 347 ? 4.722   -18.793 48.508  1.00 88.61  ? 326 GLY A N     1 
ATOM   2534  C  CA    . GLY A 1 347 ? 5.715   -17.813 48.114  1.00 89.76  ? 326 GLY A CA    1 
ATOM   2535  C  C     . GLY A 1 347 ? 7.101   -18.073 48.645  1.00 93.37  ? 326 GLY A C     1 
ATOM   2536  O  O     . GLY A 1 347 ? 8.111   -17.818 47.983  1.00 95.11  ? 326 GLY A O     1 
ATOM   2537  N  N     . LEU A 1 348 ? 7.151   -18.537 49.884  1.00 94.93  ? 327 LEU A N     1 
ATOM   2538  C  CA    . LEU A 1 348 ? 8.419   -18.956 50.455  1.00 98.93  ? 327 LEU A CA    1 
ATOM   2539  C  C     . LEU A 1 348 ? 9.051   -20.056 49.619  1.00 100.42 ? 327 LEU A C     1 
ATOM   2540  O  O     . LEU A 1 348 ? 10.281  -20.151 49.547  1.00 126.62 ? 327 LEU A O     1 
ATOM   2541  C  CB    . LEU A 1 348 ? 8.204   -19.410 51.898  1.00 100.55 ? 327 LEU A CB    1 
ATOM   2542  C  CG    . LEU A 1 348 ? 7.913   -18.303 52.901  1.00 100.47 ? 327 LEU A CG    1 
ATOM   2543  C  CD1   . LEU A 1 348 ? 7.419   -18.920 54.177  1.00 101.72 ? 327 LEU A CD1   1 
ATOM   2544  C  CD2   . LEU A 1 348 ? 9.191   -17.562 53.133  1.00 103.69 ? 327 LEU A CD2   1 
ATOM   2545  N  N     . ALA A 1 349 ? 8.239   -20.872 48.956  1.00 98.31  ? 328 ALA A N     1 
ATOM   2546  C  CA    . ALA A 1 349 ? 8.813   -21.906 48.116  1.00 99.88  ? 328 ALA A CA    1 
ATOM   2547  C  C     . ALA A 1 349 ? 9.523   -21.343 46.886  1.00 100.23 ? 328 ALA A C     1 
ATOM   2548  O  O     . ALA A 1 349 ? 10.258  -22.088 46.213  1.00 102.40 ? 328 ALA A O     1 
ATOM   2549  C  CB    . ALA A 1 349 ? 7.725   -22.885 47.689  1.00 140.43 ? 328 ALA A CB    1 
ATOM   2550  N  N     . ARG A 1 350 ? 9.222   -20.101 46.500  1.00 98.22  ? 329 ARG A N     1 
ATOM   2551  C  CA    . ARG A 1 350 ? 10.051  -19.386 45.537  1.00 99.44  ? 329 ARG A CA    1 
ATOM   2552  C  C     . ARG A 1 350 ? 11.173  -18.555 46.170  1.00 104.44 ? 329 ARG A C     1 
ATOM   2553  O  O     . ARG A 1 350 ? 12.252  -18.438 45.583  1.00 122.76 ? 329 ARG A O     1 
ATOM   2554  C  CB    . ARG A 1 350 ? 9.185   -18.575 44.572  1.00 111.37 ? 329 ARG A CB    1 
ATOM   2555  C  CG    . ARG A 1 350 ? 8.096   -19.443 43.918  1.00 125.17 ? 329 ARG A CG    1 
ATOM   2556  C  CD    . ARG A 1 350 ? 7.266   -18.690 42.898  1.00 124.09 ? 329 ARG A CD    1 
ATOM   2557  N  NE    . ARG A 1 350 ? 6.317   -17.729 43.446  1.00 117.95 ? 329 ARG A NE    1 
ATOM   2558  C  CZ    . ARG A 1 350 ? 5.043   -18.021 43.674  1.00 119.43 ? 329 ARG A CZ    1 
ATOM   2559  N  NH1   . ARG A 1 350 ? 4.577   -19.251 43.394  1.00 100.91 ? 329 ARG A NH1   1 
ATOM   2560  N  NH2   . ARG A 1 350 ? 4.241   -17.080 44.162  1.00 99.51  ? 329 ARG A NH2   1 
ATOM   2561  N  N     . LEU A 1 351 ? 10.954  -17.916 47.317  1.00 110.00 ? 330 LEU A N     1 
ATOM   2562  C  CA    . LEU A 1 351 ? 11.999  -17.036 47.836  1.00 105.41 ? 330 LEU A CA    1 
ATOM   2563  C  C     . LEU A 1 351 ? 13.180  -17.821 48.379  1.00 109.95 ? 330 LEU A C     1 
ATOM   2564  O  O     . LEU A 1 351 ? 14.324  -17.463 48.115  1.00 113.38 ? 330 LEU A O     1 
ATOM   2565  C  CB    . LEU A 1 351 ? 11.427  -16.101 48.893  1.00 104.24 ? 330 LEU A CB    1 
ATOM   2566  C  CG    . LEU A 1 351 ? 10.741  -14.917 48.221  1.00 110.25 ? 330 LEU A CG    1 
ATOM   2567  C  CD1   . LEU A 1 351 ? 9.809   -14.183 49.127  1.00 105.87 ? 330 LEU A CD1   1 
ATOM   2568  C  CD2   . LEU A 1 351 ? 11.855  -13.993 47.810  1.00 104.28 ? 330 LEU A CD2   1 
ATOM   2569  N  N     . LEU A 1 352 ? 12.943  -18.874 49.144  1.00 110.52 ? 331 LEU A N     1 
ATOM   2570  C  CA    . LEU A 1 352 ? 14.085  -19.577 49.719  1.00 115.43 ? 331 LEU A CA    1 
ATOM   2571  C  C     . LEU A 1 352 ? 15.087  -20.029 48.665  1.00 126.52 ? 331 LEU A C     1 
ATOM   2572  O  O     . LEU A 1 352 ? 16.252  -19.631 48.769  1.00 136.68 ? 331 LEU A O     1 
ATOM   2573  C  CB    . LEU A 1 352 ? 13.644  -20.760 50.594  1.00 115.96 ? 331 LEU A CB    1 
ATOM   2574  C  CG    . LEU A 1 352 ? 13.905  -20.622 52.120  1.00 118.91 ? 331 LEU A CG    1 
ATOM   2575  C  CD1   . LEU A 1 352 ? 13.895  -21.954 52.880  1.00 121.41 ? 331 LEU A CD1   1 
ATOM   2576  C  CD2   . LEU A 1 352 ? 15.138  -19.830 52.468  1.00 123.13 ? 331 LEU A CD2   1 
ATOM   2577  N  N     . PRO A 1 353 ? 14.717  -20.775 47.609  1.00 121.29 ? 332 PRO A N     1 
ATOM   2578  C  CA    . PRO A 1 353 ? 15.751  -21.286 46.680  1.00 126.80 ? 332 PRO A CA    1 
ATOM   2579  C  C     . PRO A 1 353 ? 16.486  -20.202 45.904  1.00 128.14 ? 332 PRO A C     1 
ATOM   2580  O  O     . PRO A 1 353 ? 17.646  -20.402 45.536  1.00 158.60 ? 332 PRO A O     1 
ATOM   2581  C  CB    . PRO A 1 353 ? 14.966  -22.211 45.733  1.00 124.44 ? 332 PRO A CB    1 
ATOM   2582  C  CG    . PRO A 1 353 ? 13.658  -22.462 46.404  1.00 125.24 ? 332 PRO A CG    1 
ATOM   2583  C  CD    . PRO A 1 353 ? 13.375  -21.201 47.190  1.00 111.78 ? 332 PRO A CD    1 
ATOM   2584  N  N     . ARG A 1 354 ? 15.845  -19.077 45.611  1.00 117.73 ? 333 ARG A N     1 
ATOM   2585  C  CA    . ARG A 1 354 ? 16.544  -17.999 44.929  1.00 119.43 ? 333 ARG A CA    1 
ATOM   2586  C  C     . ARG A 1 354 ? 17.574  -17.376 45.848  1.00 123.61 ? 333 ARG A C     1 
ATOM   2587  O  O     . ARG A 1 354 ? 18.686  -17.043 45.419  1.00 127.69 ? 333 ARG A O     1 
ATOM   2588  C  CB    . ARG A 1 354 ? 15.534  -16.959 44.443  1.00 115.17 ? 333 ARG A CB    1 
ATOM   2589  C  CG    . ARG A 1 354 ? 16.114  -15.618 44.036  1.00 116.86 ? 333 ARG A CG    1 
ATOM   2590  C  CD    . ARG A 1 354 ? 15.098  -14.881 43.178  1.00 113.02 ? 333 ARG A CD    1 
ATOM   2591  N  NE    . ARG A 1 354 ? 14.029  -14.151 43.869  1.00 116.18 ? 333 ARG A NE    1 
ATOM   2592  C  CZ    . ARG A 1 354 ? 12.755  -14.547 43.893  1.00 122.33 ? 333 ARG A CZ    1 
ATOM   2593  N  NH1   . ARG A 1 354 ? 12.401  -15.692 43.304  1.00 110.24 ? 333 ARG A NH1   1 
ATOM   2594  N  NH2   . ARG A 1 354 ? 11.834  -13.804 44.503  1.00 124.38 ? 333 ARG A NH2   1 
ATOM   2595  N  N     . LEU A 1 355 ? 17.201  -17.193 47.110  1.00 122.96 ? 334 LEU A N     1 
ATOM   2596  C  CA    . LEU A 1 355 ? 18.137  -16.695 48.102  1.00 129.23 ? 334 LEU A CA    1 
ATOM   2597  C  C     . LEU A 1 355 ? 19.251  -17.693 48.358  1.00 132.57 ? 334 LEU A C     1 
ATOM   2598  O  O     . LEU A 1 355 ? 20.421  -17.314 48.480  1.00 148.10 ? 334 LEU A O     1 
ATOM   2599  C  CB    . LEU A 1 355 ? 17.408  -16.387 49.406  1.00 129.29 ? 334 LEU A CB    1 
ATOM   2600  C  CG    . LEU A 1 355 ? 16.487  -15.180 49.484  1.00 132.61 ? 334 LEU A CG    1 
ATOM   2601  C  CD1   . LEU A 1 355 ? 15.802  -15.154 50.844  1.00 141.35 ? 334 LEU A CD1   1 
ATOM   2602  C  CD2   . LEU A 1 355 ? 17.285  -13.901 49.256  1.00 124.42 ? 334 LEU A CD2   1 
ATOM   2603  N  N     . GLN A 1 356 ? 18.905  -18.966 48.485  1.00 131.94 ? 335 GLN A N     1 
ATOM   2604  C  CA    . GLN A 1 356 ? 19.912  -20.005 48.553  1.00 136.99 ? 335 GLN A CA    1 
ATOM   2605  C  C     . GLN A 1 356 ? 20.784  -19.985 47.304  1.00 160.14 ? 335 GLN A C     1 
ATOM   2606  O  O     . GLN A 1 356 ? 21.900  -20.513 47.327  1.00 198.71 ? 335 GLN A O     1 
ATOM   2607  C  CB    . GLN A 1 356 ? 19.224  -21.355 48.792  1.00 136.33 ? 335 GLN A CB    1 
ATOM   2608  C  CG    . GLN A 1 356 ? 18.739  -21.514 50.255  1.00 139.71 ? 335 GLN A CG    1 
ATOM   2609  C  CD    . GLN A 1 356 ? 17.835  -22.727 50.485  1.00 161.04 ? 335 GLN A CD    1 
ATOM   2610  O  OE1   . GLN A 1 356 ? 17.066  -23.138 49.600  1.00 149.82 ? 335 GLN A OE1   1 
ATOM   2611  N  NE2   . GLN A 1 356 ? 17.939  -23.315 51.682  1.00 160.59 ? 335 GLN A NE2   1 
ATOM   2612  N  N     . GLY A 1 357 ? 20.271  -19.444 46.196  1.00 145.02 ? 336 GLY A N     1 
ATOM   2613  C  CA    . GLY A 1 357 ? 21.083  -19.194 45.024  1.00 138.62 ? 336 GLY A CA    1 
ATOM   2614  C  C     . GLY A 1 357 ? 22.088  -18.070 45.177  1.00 142.72 ? 336 GLY A C     1 
ATOM   2615  O  O     . GLY A 1 357 ? 23.286  -18.304 45.030  1.00 148.37 ? 336 GLY A O     1 
ATOM   2616  N  N     . LYS A 1 358 ? 21.640  -16.859 45.519  1.00 140.43 ? 337 LYS A N     1 
ATOM   2617  C  CA    . LYS A 1 358 ? 22.595  -15.762 45.686  1.00 149.33 ? 337 LYS A CA    1 
ATOM   2618  C  C     . LYS A 1 358 ? 23.443  -15.908 46.944  1.00 175.08 ? 337 LYS A C     1 
ATOM   2619  O  O     . LYS A 1 358 ? 24.437  -15.188 47.103  1.00 166.49 ? 337 LYS A O     1 
ATOM   2620  C  CB    . LYS A 1 358 ? 21.880  -14.411 45.674  1.00 141.20 ? 337 LYS A CB    1 
ATOM   2621  C  CG    . LYS A 1 358 ? 21.119  -14.197 44.384  1.00 143.48 ? 337 LYS A CG    1 
ATOM   2622  C  CD    . LYS A 1 358 ? 19.974  -13.244 44.585  1.00 162.76 ? 337 LYS A CD    1 
ATOM   2623  C  CE    . LYS A 1 358 ? 18.988  -13.351 43.434  1.00 150.75 ? 337 LYS A CE    1 
ATOM   2624  N  NZ    . LYS A 1 358 ? 17.673  -12.737 43.785  1.00 148.30 ? 337 LYS A NZ    1 
ATOM   2625  N  N     . LEU A 1 359 ? 23.081  -16.802 47.847  1.00 167.14 ? 338 LEU A N     1 
ATOM   2626  C  CA    . LEU A 1 359 ? 23.997  -17.183 48.902  1.00 156.43 ? 338 LEU A CA    1 
ATOM   2627  C  C     . LEU A 1 359 ? 24.613  -18.508 48.488  1.00 157.99 ? 338 LEU A C     1 
ATOM   2628  O  O     . LEU A 1 359 ? 24.181  -19.147 47.531  1.00 155.18 ? 338 LEU A O     1 
ATOM   2629  C  CB    . LEU A 1 359 ? 23.276  -17.273 50.252  1.00 171.85 ? 338 LEU A CB    1 
ATOM   2630  C  CG    . LEU A 1 359 ? 22.502  -16.004 50.694  1.00 167.77 ? 338 LEU A CG    1 
ATOM   2631  C  CD1   . LEU A 1 359 ? 22.245  -15.963 52.208  1.00 169.64 ? 338 LEU A CD1   1 
ATOM   2632  C  CD2   . LEU A 1 359 ? 23.181  -14.724 50.233  1.00 155.32 ? 338 LEU A CD2   1 
ATOM   2633  N  N     . GLY A 1 360 ? 25.589  -18.961 49.237  1.00 164.18 ? 339 GLY A N     1 
ATOM   2634  C  CA    . GLY A 1 360 ? 26.272  -20.139 48.744  1.00 173.88 ? 339 GLY A CA    1 
ATOM   2635  C  C     . GLY A 1 360 ? 25.534  -21.427 49.006  1.00 177.24 ? 339 GLY A C     1 
ATOM   2636  O  O     . GLY A 1 360 ? 26.113  -22.510 48.878  1.00 208.13 ? 339 GLY A O     1 
ATOM   2637  N  N     . LEU A 1 361 ? 24.279  -21.338 49.326  1.00 159.41 ? 340 LEU A N     1 
ATOM   2638  C  CA    . LEU A 1 361 ? 23.748  -22.582 49.843  1.00 158.68 ? 340 LEU A CA    1 
ATOM   2639  C  C     . LEU A 1 361 ? 23.210  -23.512 48.757  1.00 165.56 ? 340 LEU A C     1 
ATOM   2640  O  O     . LEU A 1 361 ? 22.957  -23.105 47.615  1.00 159.91 ? 340 LEU A O     1 
ATOM   2641  C  CB    . LEU A 1 361 ? 22.653  -22.273 50.854  1.00 168.07 ? 340 LEU A CB    1 
ATOM   2642  C  CG    . LEU A 1 361 ? 23.162  -21.815 52.225  1.00 169.63 ? 340 LEU A CG    1 
ATOM   2643  C  CD1   . LEU A 1 361 ? 21.985  -21.385 53.073  1.00 185.27 ? 340 LEU A CD1   1 
ATOM   2644  C  CD2   . LEU A 1 361 ? 23.954  -22.907 52.932  1.00 178.89 ? 340 LEU A CD2   1 
ATOM   2645  N  N     . PRO A 1 362 ? 23.110  -24.801 49.083  1.00 159.01 ? 341 PRO A N     1 
ATOM   2646  C  CA    . PRO A 1 362 ? 22.385  -25.742 48.221  1.00 167.68 ? 341 PRO A CA    1 
ATOM   2647  C  C     . PRO A 1 362 ? 20.906  -25.377 48.116  1.00 160.88 ? 341 PRO A C     1 
ATOM   2648  O  O     . PRO A 1 362 ? 20.271  -24.967 49.094  1.00 146.16 ? 341 PRO A O     1 
ATOM   2649  C  CB    . PRO A 1 362 ? 22.594  -27.093 48.916  1.00 160.44 ? 341 PRO A CB    1 
ATOM   2650  C  CG    . PRO A 1 362 ? 23.876  -26.912 49.691  1.00 166.58 ? 341 PRO A CG    1 
ATOM   2651  C  CD    . PRO A 1 362 ? 23.883  -25.486 50.135  1.00 165.24 ? 341 PRO A CD    1 
ATOM   2652  N  N     . ARG A 1 363 ? 20.360  -25.558 46.916  1.00 190.58 ? 342 ARG A N     1 
ATOM   2653  C  CA    . ARG A 1 363 ? 18.966  -25.242 46.648  1.00 182.11 ? 342 ARG A CA    1 
ATOM   2654  C  C     . ARG A 1 363 ? 18.034  -26.226 47.331  1.00 174.30 ? 342 ARG A C     1 
ATOM   2655  O  O     . ARG A 1 363 ? 18.397  -27.357 47.658  1.00 176.48 ? 342 ARG A O     1 
ATOM   2656  C  CB    . ARG A 1 363 ? 18.670  -25.306 45.145  1.00 161.61 ? 342 ARG A CB    1 
ATOM   2657  C  CG    . ARG A 1 363 ? 19.503  -24.401 44.292  1.00 147.87 ? 342 ARG A CG    1 
ATOM   2658  C  CD    . ARG A 1 363 ? 19.416  -23.020 44.826  1.00 143.95 ? 342 ARG A CD    1 
ATOM   2659  N  NE    . ARG A 1 363 ? 19.829  -22.024 43.855  1.00 154.59 ? 342 ARG A NE    1 
ATOM   2660  C  CZ    . ARG A 1 363 ? 19.172  -21.750 42.734  1.00 158.78 ? 342 ARG A CZ    1 
ATOM   2661  N  NH1   . ARG A 1 363 ? 19.617  -20.789 41.950  1.00 162.55 ? 342 ARG A NH1   1 
ATOM   2662  N  NH2   . ARG A 1 363 ? 18.082  -22.427 42.388  1.00 158.16 ? 342 ARG A NH2   1 
ATOM   2663  N  N     . GLN A 1 364 ? 16.821  -25.772 47.555  1.00 163.83 ? 343 GLN A N     1 
ATOM   2664  C  CA    . GLN A 1 364 ? 15.756  -26.658 47.970  1.00 169.09 ? 343 GLN A CA    1 
ATOM   2665  C  C     . GLN A 1 364 ? 15.006  -27.056 46.708  1.00 158.37 ? 343 GLN A C     1 
ATOM   2666  O  O     . GLN A 1 364 ? 14.405  -26.211 46.030  1.00 148.55 ? 343 GLN A O     1 
ATOM   2667  C  CB    . GLN A 1 364 ? 14.868  -26.009 49.029  1.00 183.86 ? 343 GLN A CB    1 
ATOM   2668  C  CG    . GLN A 1 364 ? 15.600  -25.867 50.363  1.00 198.98 ? 343 GLN A CG    1 
ATOM   2669  C  CD    . GLN A 1 364 ? 14.688  -25.504 51.514  1.00 202.05 ? 343 GLN A CD    1 
ATOM   2670  O  OE1   . GLN A 1 364 ? 13.460  -25.548 51.385  1.00 200.20 ? 343 GLN A OE1   1 
ATOM   2671  N  NE2   . GLN A 1 364 ? 15.284  -25.188 52.671  1.00 192.79 ? 343 GLN A NE2   1 
ATOM   2672  N  N     . ALA A 1 365 ? 15.136  -28.319 46.339  1.00 158.02 ? 344 ALA A N     1 
ATOM   2673  C  CA    . ALA A 1 365 ? 14.437  -28.811 45.165  1.00 161.43 ? 344 ALA A CA    1 
ATOM   2674  C  C     . ALA A 1 365 ? 12.949  -28.735 45.443  1.00 144.60 ? 344 ALA A C     1 
ATOM   2675  O  O     . ALA A 1 365 ? 12.462  -29.353 46.399  1.00 145.74 ? 344 ALA A O     1 
ATOM   2676  C  CB    . ALA A 1 365 ? 14.846  -30.248 44.864  1.00 174.43 ? 344 ALA A CB    1 
ATOM   2677  N  N     . ARG A 1 366 ? 12.223  -27.951 44.650  1.00 132.49 ? 345 ARG A N     1 
ATOM   2678  C  CA    . ARG A 1 366 ? 10.833  -27.813 45.024  1.00 130.76 ? 345 ARG A CA    1 
ATOM   2679  C  C     . ARG A 1 366 ? 10.083  -29.121 44.780  1.00 120.58 ? 345 ARG A C     1 
ATOM   2680  O  O     . ARG A 1 366 ? 10.587  -30.082 44.188  1.00 132.69 ? 345 ARG A O     1 
ATOM   2681  C  CB    . ARG A 1 366 ? 10.172  -26.645 44.290  1.00 123.90 ? 345 ARG A CB    1 
ATOM   2682  C  CG    . ARG A 1 366 ? 10.936  -26.085 43.110  1.00 113.09 ? 345 ARG A CG    1 
ATOM   2683  C  CD    . ARG A 1 366 ? 10.535  -24.607 42.860  1.00 132.38 ? 345 ARG A CD    1 
ATOM   2684  N  NE    . ARG A 1 366 ? 9.089   -24.344 42.865  1.00 134.53 ? 345 ARG A NE    1 
ATOM   2685  C  CZ    . ARG A 1 366 ? 8.549   -23.141 42.652  1.00 143.76 ? 345 ARG A CZ    1 
ATOM   2686  N  NH1   . ARG A 1 366 ? 7.225   -22.963 42.676  1.00 134.85 ? 345 ARG A NH1   1 
ATOM   2687  N  NH2   . ARG A 1 366 ? 9.339   -22.100 42.417  1.00 141.15 ? 345 ARG A NH2   1 
ATOM   2688  N  N     . ALA A 1 367 ? 8.839   -29.118 45.227  1.00 112.34 ? 346 ALA A N     1 
ATOM   2689  C  CA    . ALA A 1 367 ? 8.013   -30.302 45.334  1.00 106.99 ? 346 ALA A CA    1 
ATOM   2690  C  C     . ALA A 1 367 ? 7.513   -30.745 43.975  1.00 107.79 ? 346 ALA A C     1 
ATOM   2691  O  O     . ALA A 1 367 ? 7.688   -30.073 42.960  1.00 123.76 ? 346 ALA A O     1 
ATOM   2692  C  CB    . ALA A 1 367 ? 6.823   -30.040 46.247  1.00 104.49 ? 346 ALA A CB    1 
ATOM   2693  N  N     . ALA A 1 368 ? 7.001   -31.954 43.941  1.00 106.83 ? 347 ALA A N     1 
ATOM   2694  C  CA    . ALA A 1 368 ? 6.204   -32.344 42.796  1.00 105.58 ? 347 ALA A CA    1 
ATOM   2695  C  C     . ALA A 1 368 ? 4.765   -31.781 42.861  1.00 105.91 ? 347 ALA A C     1 
ATOM   2696  O  O     . ALA A 1 368 ? 4.175   -31.579 43.934  1.00 100.48 ? 347 ALA A O     1 
ATOM   2697  C  CB    . ALA A 1 368 ? 6.186   -33.860 42.693  1.00 138.94 ? 347 ALA A CB    1 
ATOM   2698  N  N     . ALA A 1 369 ? 4.244   -31.433 41.714  1.00 99.60  ? 348 ALA A N     1 
ATOM   2699  C  CA    . ALA A 1 369 ? 2.869   -30.993 41.805  1.00 96.57  ? 348 ALA A CA    1 
ATOM   2700  C  C     . ALA A 1 369 ? 1.976   -31.994 41.101  1.00 97.00  ? 348 ALA A C     1 
ATOM   2701  O  O     . ALA A 1 369 ? 2.404   -32.572 40.103  1.00 139.68 ? 348 ALA A O     1 
ATOM   2702  C  CB    . ALA A 1 369 ? 2.674   -29.625 41.160  1.00 119.24 ? 348 ALA A CB    1 
ATOM   2703  N  N     . PRO A 1 370 ? 0.748   -32.238 41.570  1.00 97.33  ? 349 PRO A N     1 
ATOM   2704  C  CA    . PRO A 1 370 ? -0.043  -33.359 41.026  1.00 114.52 ? 349 PRO A CA    1 
ATOM   2705  C  C     . PRO A 1 370 ? -0.434  -33.198 39.539  1.00 144.51 ? 349 PRO A C     1 
ATOM   2706  O  O     . PRO A 1 370 ? -0.949  -34.147 38.935  1.00 165.41 ? 349 PRO A O     1 
ATOM   2707  C  CB    . PRO A 1 370 ? -1.275  -33.394 41.955  1.00 100.57 ? 349 PRO A CB    1 
ATOM   2708  C  CG    . PRO A 1 370 ? -0.985  -32.424 43.071  1.00 110.00 ? 349 PRO A CG    1 
ATOM   2709  C  CD    . PRO A 1 370 ? -0.082  -31.403 42.451  1.00 114.32 ? 349 PRO A CD    1 
ATOM   2710  N  N     . GLU A 1 371 ? -0.209  -32.024 38.974  1.00 94.69  ? 350 GLU A N     1 
ATOM   2711  C  CA    . GLU A 1 371 ? -0.624  -31.482 37.686  1.00 117.61 ? 350 GLU A CA    1 
ATOM   2712  C  C     . GLU A 1 371 ? -2.141  -31.322 37.588  1.00 117.98 ? 350 GLU A C     1 
ATOM   2713  O  O     . GLU A 1 371 ? -2.916  -32.007 38.260  1.00 117.04 ? 350 GLU A O     1 
ATOM   2714  C  CB    . GLU A 1 371 ? -0.186  -32.379 36.503  1.00 118.46 ? 350 GLU A CB    1 
ATOM   2715  C  CG    . GLU A 1 371 ? 1.282   -32.277 35.956  1.00 136.31 ? 350 GLU A CG    1 
ATOM   2716  C  CD    . GLU A 1 371 ? 1.507   -33.010 34.579  1.00 152.70 ? 350 GLU A CD    1 
ATOM   2717  O  OE1   . GLU A 1 371 ? 0.527   -33.448 33.924  1.00 150.31 ? 350 GLU A OE1   1 
ATOM   2718  O  OE2   . GLU A 1 371 ? 2.676   -33.159 34.151  1.00 165.35 ? 350 GLU A OE2   1 
ATOM   2719  N  N     . ILE A 1 372 ? -2.547  -30.603 36.554  1.00 104.03 ? 351 ILE A N     1 
ATOM   2720  C  CA    . ILE A 1 372 ? -3.797  -29.870 36.717  1.00 89.74  ? 351 ILE A CA    1 
ATOM   2721  C  C     . ILE A 1 372 ? -4.807  -30.064 35.590  1.00 90.63  ? 351 ILE A C     1 
ATOM   2722  O  O     . ILE A 1 372 ? -5.726  -29.250 35.452  1.00 108.47 ? 351 ILE A O     1 
ATOM   2723  C  CB    . ILE A 1 372 ? -3.483  -28.382 37.036  1.00 109.81 ? 351 ILE A CB    1 
ATOM   2724  C  CG1   . ILE A 1 372 ? -1.936  -28.108 36.959  1.00 133.82 ? 351 ILE A CG1   1 
ATOM   2725  C  CG2   . ILE A 1 372 ? -4.008  -28.072 38.480  1.00 85.99  ? 351 ILE A CG2   1 
ATOM   2726  C  CD1   . ILE A 1 372 ? -1.357  -26.697 36.376  1.00 87.27  ? 351 ILE A CD1   1 
ATOM   2727  N  N     . ASP A 1 373 ? -4.621  -31.074 34.735  1.00 93.04  ? 352 ASP A N     1 
ATOM   2728  C  CA    . ASP A 1 373 ? -5.597  -31.324 33.667  1.00 105.77 ? 352 ASP A CA    1 
ATOM   2729  C  C     . ASP A 1 373 ? -5.686  -30.244 32.574  1.00 108.97 ? 352 ASP A C     1 
ATOM   2730  O  O     . ASP A 1 373 ? -6.498  -29.329 32.715  1.00 114.79 ? 352 ASP A O     1 
ATOM   2731  C  CB    . ASP A 1 373 ? -6.991  -31.527 34.303  1.00 113.29 ? 352 ASP A CB    1 
ATOM   2732  C  CG    . ASP A 1 373 ? -7.260  -32.976 34.742  1.00 144.90 ? 352 ASP A CG    1 
ATOM   2733  O  OD1   . ASP A 1 373 ? -7.922  -33.165 35.804  1.00 146.65 ? 352 ASP A OD1   1 
ATOM   2734  O  OD2   . ASP A 1 373 ? -6.766  -33.912 34.060  1.00 160.30 ? 352 ASP A OD2   1 
ATOM   2735  N  N     . ARG A 1 374 ? -4.856  -30.299 31.502  1.00 129.32 ? 353 ARG A N     1 
ATOM   2736  C  CA    . ARG A 1 374 ? -4.714  -29.186 30.539  1.00 99.01  ? 353 ARG A CA    1 
ATOM   2737  C  C     . ARG A 1 374 ? -5.662  -29.336 29.355  1.00 98.09  ? 353 ARG A C     1 
ATOM   2738  O  O     . ARG A 1 374 ? -5.823  -30.425 28.801  1.00 147.22 ? 353 ARG A O     1 
ATOM   2739  C  CB    . ARG A 1 374 ? -3.269  -29.065 29.990  1.00 97.08  ? 353 ARG A CB    1 
ATOM   2740  C  CG    . ARG A 1 374 ? -3.022  -27.864 28.967  1.00 97.64  ? 353 ARG A CG    1 
ATOM   2741  C  CD    . ARG A 1 374 ? -1.558  -27.255 28.869  1.00 97.96  ? 353 ARG A CD    1 
ATOM   2742  N  NE    . ARG A 1 374 ? -0.661  -27.687 29.967  1.00 178.31 ? 353 ARG A NE    1 
ATOM   2743  C  CZ    . ARG A 1 374 ? -0.673  -27.239 31.236  1.00 197.79 ? 353 ARG A CZ    1 
ATOM   2744  N  NH1   . ARG A 1 374 ? 0.188   -27.718 32.131  1.00 166.08 ? 353 ARG A NH1   1 
ATOM   2745  N  NH2   . ARG A 1 374 ? -1.543  -26.327 31.636  1.00 208.91 ? 353 ARG A NH2   1 
ATOM   2746  N  N     . LEU A 1 375 ? -6.268  -28.220 28.953  1.00 97.57  ? 354 LEU A N     1 
ATOM   2747  C  CA    . LEU A 1 375 ? -7.186  -28.165 27.812  1.00 122.68 ? 354 LEU A CA    1 
ATOM   2748  C  C     . LEU A 1 375 ? -6.848  -26.947 26.965  1.00 129.96 ? 354 LEU A C     1 
ATOM   2749  O  O     . LEU A 1 375 ? -6.832  -25.820 27.476  1.00 141.11 ? 354 LEU A O     1 
ATOM   2750  C  CB    . LEU A 1 375 ? -8.661  -28.121 28.250  1.00 126.93 ? 354 LEU A CB    1 
ATOM   2751  C  CG    . LEU A 1 375 ? -9.740  -27.722 27.222  1.00 129.68 ? 354 LEU A CG    1 
ATOM   2752  C  CD1   . LEU A 1 375 ? -9.992  -28.778 26.157  1.00 163.33 ? 354 LEU A CD1   1 
ATOM   2753  C  CD2   . LEU A 1 375 ? -11.044 -27.413 27.955  1.00 108.49 ? 354 LEU A CD2   1 
ATOM   2754  N  N     . ASP A 1 376 ? -6.503  -27.175 25.700  1.00 110.27 ? 355 ASP A N     1 
ATOM   2755  C  CA    . ASP A 1 376 ? -6.158  -26.095 24.786  1.00 133.58 ? 355 ASP A CA    1 
ATOM   2756  C  C     . ASP A 1 376 ? -7.245  -25.959 23.727  1.00 133.81 ? 355 ASP A C     1 
ATOM   2757  O  O     . ASP A 1 376 ? -7.799  -26.959 23.270  1.00 138.95 ? 355 ASP A O     1 
ATOM   2758  C  CB    . ASP A 1 376 ? -4.768  -26.305 24.154  1.00 153.63 ? 355 ASP A CB    1 
ATOM   2759  C  CG    . ASP A 1 376 ? -3.615  -26.070 25.152  1.00 150.34 ? 355 ASP A CG    1 
ATOM   2760  O  OD1   . ASP A 1 376 ? -3.356  -26.923 26.027  1.00 143.55 ? 355 ASP A OD1   1 
ATOM   2761  O  OD2   . ASP A 1 376 ? -2.958  -25.004 25.047  1.00 152.74 ? 355 ASP A OD2   1 
ATOM   2762  N  N     . LEU A 1 377 ? -7.592  -24.713 23.394  1.00 130.66 ? 356 LEU A N     1 
ATOM   2763  C  CA    . LEU A 1 377 ? -8.593  -24.384 22.387  1.00 146.74 ? 356 LEU A CA    1 
ATOM   2764  C  C     . LEU A 1 377 ? -8.004  -23.359 21.432  1.00 133.92 ? 356 LEU A C     1 
ATOM   2765  O  O     . LEU A 1 377 ? -7.371  -22.399 21.863  1.00 127.22 ? 356 LEU A O     1 
ATOM   2766  C  CB    . LEU A 1 377 ? -9.881  -23.882 23.072  1.00 141.31 ? 356 LEU A CB    1 
ATOM   2767  C  CG    . LEU A 1 377 ? -10.664 -25.080 23.638  1.00 129.82 ? 356 LEU A CG    1 
ATOM   2768  C  CD1   . LEU A 1 377 ? -11.815 -24.726 24.557  1.00 111.90 ? 356 LEU A CD1   1 
ATOM   2769  C  CD2   . LEU A 1 377 ? -11.090 -26.011 22.498  1.00 137.77 ? 356 LEU A CD2   1 
ATOM   2770  N  N     . CYS A 1 378 ? -8.196  -23.569 20.137  1.00 138.87 ? 357 CYS A N     1 
ATOM   2771  C  CA    . CYS A 1 378 ? -7.813  -22.593 19.122  1.00 147.92 ? 357 CYS A CA    1 
ATOM   2772  C  C     . CYS A 1 378 ? -9.092  -21.963 18.624  1.00 153.18 ? 357 CYS A C     1 
ATOM   2773  O  O     . CYS A 1 378 ? -9.946  -22.646 18.049  1.00 191.45 ? 357 CYS A O     1 
ATOM   2774  C  CB    . CYS A 1 378 ? -7.032  -23.202 17.948  1.00 167.14 ? 357 CYS A CB    1 
ATOM   2775  S  SG    . CYS A 1 378 ? -5.324  -23.810 18.220  1.00 159.92 ? 357 CYS A SG    1 
ATOM   2776  N  N     . LEU A 1 379 ? -9.256  -20.691 18.916  1.00 126.12 ? 358 LEU A N     1 
ATOM   2777  C  CA    . LEU A 1 379 ? -10.463 -19.979 18.565  1.00 150.53 ? 358 LEU A CA    1 
ATOM   2778  C  C     . LEU A 1 379 ? -10.159 -18.861 17.576  1.00 172.40 ? 358 LEU A C     1 
ATOM   2779  O  O     . LEU A 1 379 ? -9.073  -18.273 17.580  1.00 181.04 ? 358 LEU A O     1 
ATOM   2780  C  CB    . LEU A 1 379 ? -11.132 -19.443 19.817  1.00 153.51 ? 358 LEU A CB    1 
ATOM   2781  C  CG    . LEU A 1 379 ? -11.637 -20.525 20.761  1.00 155.60 ? 358 LEU A CG    1 
ATOM   2782  C  CD1   . LEU A 1 379 ? -12.290 -19.861 21.946  1.00 149.08 ? 358 LEU A CD1   1 
ATOM   2783  C  CD2   . LEU A 1 379 ? -12.652 -21.391 20.013  1.00 138.70 ? 358 LEU A CD2   1 
ATOM   2784  N  N     . ALA A 1 380 ? -11.139 -18.584 16.722  1.00 181.27 ? 359 ALA A N     1 
ATOM   2785  C  CA    . ALA A 1 380 ? -11.108 -17.426 15.850  1.00 174.11 ? 359 ALA A CA    1 
ATOM   2786  C  C     . ALA A 1 380 ? -11.180 -16.153 16.683  1.00 196.33 ? 359 ALA A C     1 
ATOM   2787  O  O     . ALA A 1 380 ? -11.630 -16.156 17.829  1.00 188.09 ? 359 ALA A O     1 
ATOM   2788  C  CB    . ALA A 1 380 ? -12.254 -17.477 14.851  1.00 176.56 ? 359 ALA A CB    1 
ATOM   2789  N  N     . PHE A 1 381 ? -10.759 -15.055 16.081  1.00 193.27 ? 360 PHE A N     1 
ATOM   2790  C  CA    . PHE A 1 381 ? -10.601 -13.757 16.740  1.00 219.95 ? 360 PHE A CA    1 
ATOM   2791  C  C     . PHE A 1 381 ? -11.917 -13.243 17.346  1.00 216.11 ? 360 PHE A C     1 
ATOM   2792  O  O     . PHE A 1 381 ? -12.957 -13.886 17.149  1.00 230.92 ? 360 PHE A O     1 
ATOM   2793  C  CB    . PHE A 1 381 ? -9.967  -12.810 15.713  1.00 246.01 ? 360 PHE A CB    1 
ATOM   2794  C  CG    . PHE A 1 381 ? -8.493  -13.091 15.464  1.00 252.42 ? 360 PHE A CG    1 
ATOM   2795  C  CD1   . PHE A 1 381 ? -7.524  -12.496 16.262  1.00 244.62 ? 360 PHE A CD1   1 
ATOM   2796  C  CD2   . PHE A 1 381 ? -8.078  -13.962 14.456  1.00 256.04 ? 360 PHE A CD2   1 
ATOM   2797  C  CE1   . PHE A 1 381 ? -6.169  -12.742 16.058  1.00 233.56 ? 360 PHE A CE1   1 
ATOM   2798  C  CE2   . PHE A 1 381 ? -6.716  -14.215 14.246  1.00 248.52 ? 360 PHE A CE2   1 
ATOM   2799  C  CZ    . PHE A 1 381 ? -5.765  -13.601 15.052  1.00 237.07 ? 360 PHE A CZ    1 
ATOM   2800  N  N     . PRO A 1 382 ? -11.934 -12.107 18.101  1.00 225.08 ? 361 PRO A N     1 
ATOM   2801  C  CA    . PRO A 1 382 ? -13.109 -11.905 18.983  1.00 219.95 ? 361 PRO A CA    1 
ATOM   2802  C  C     . PRO A 1 382 ? -14.564 -11.996 18.420  1.00 230.92 ? 361 PRO A C     1 
ATOM   2803  O  O     . PRO A 1 382 ? -15.256 -12.804 19.059  1.00 206.30 ? 361 PRO A O     1 
ATOM   2804  C  CB    . PRO A 1 382 ? -12.852 -10.499 19.563  1.00 227.27 ? 361 PRO A CB    1 
ATOM   2805  C  CG    . PRO A 1 382 ? -11.378 -10.323 19.527  1.00 209.53 ? 361 PRO A CG    1 
ATOM   2806  C  CD    . PRO A 1 382 ? -10.866 -11.115 18.361  1.00 204.17 ? 361 PRO A CD    1 
ATOM   2807  N  N     . SER A 1 383 ? -15.070 -11.304 17.381  1.00 241.92 ? 362 SER A N     1 
ATOM   2808  C  CA    . SER A 1 383 ? -14.877 -9.875  17.066  1.00 220.95 ? 362 SER A CA    1 
ATOM   2809  C  C     . SER A 1 383 ? -16.271 -9.252  17.232  1.00 207.18 ? 362 SER A C     1 
ATOM   2810  O  O     . SER A 1 383 ? -17.171 -9.578  16.456  1.00 205.82 ? 362 SER A O     1 
ATOM   2811  C  CB    . SER A 1 383 ? -14.335 -9.634  15.648  1.00 214.44 ? 362 SER A CB    1 
ATOM   2812  O  OG    . SER A 1 383 ? -15.264 -10.015 14.648  1.00 211.39 ? 362 SER A OG    1 
ATOM   2813  N  N     . GLU A 1 384 ? -16.467 -8.371  18.218  1.00 201.32 ? 363 GLU A N     1 
ATOM   2814  C  CA    . GLU A 1 384 ? -15.386 -7.803  19.014  1.00 211.48 ? 363 GLU A CA    1 
ATOM   2815  C  C     . GLU A 1 384 ? -15.609 -8.139  20.512  1.00 209.79 ? 363 GLU A C     1 
ATOM   2816  O  O     . GLU A 1 384 ? -16.706 -8.586  20.874  1.00 186.95 ? 363 GLU A O     1 
ATOM   2817  C  CB    . GLU A 1 384 ? -15.337 -6.279  18.768  1.00 228.48 ? 363 GLU A CB    1 
ATOM   2818  C  CG    . GLU A 1 384 ? -15.039 -5.826  17.305  1.00 227.19 ? 363 GLU A CG    1 
ATOM   2819  C  CD    . GLU A 1 384 ? -16.272 -5.807  16.392  1.00 235.35 ? 363 GLU A CD    1 
ATOM   2820  O  OE1   . GLU A 1 384 ? -17.376 -6.169  16.844  1.00 259.68 ? 363 GLU A OE1   1 
ATOM   2821  O  OE2   . GLU A 1 384 ? -16.148 -5.424  15.216  1.00 227.18 ? 363 GLU A OE2   1 
ATOM   2822  N  N     . PRO A 1 385 ? -14.625 -7.849  21.407  1.00 211.45 ? 364 PRO A N     1 
ATOM   2823  C  CA    . PRO A 1 385 ? -14.658 -8.417  22.779  1.00 215.85 ? 364 PRO A CA    1 
ATOM   2824  C  C     . PRO A 1 385 ? -15.861 -8.026  23.650  1.00 202.21 ? 364 PRO A C     1 
ATOM   2825  O  O     . PRO A 1 385 ? -16.162 -6.836  23.651  1.00 211.97 ? 364 PRO A O     1 
ATOM   2826  C  CB    . PRO A 1 385 ? -13.368 -7.878  23.397  1.00 221.59 ? 364 PRO A CB    1 
ATOM   2827  C  CG    . PRO A 1 385 ? -12.447 -7.691  22.241  1.00 228.10 ? 364 PRO A CG    1 
ATOM   2828  C  CD    . PRO A 1 385 ? -13.322 -7.211  21.119  1.00 222.29 ? 364 PRO A CD    1 
ATOM   2829  N  N     . CYS A 1 386 ? -16.561 -8.951  24.341  1.00 202.21 ? 365 CYS A N     1 
ATOM   2830  C  CA    . CYS A 1 386 ? -16.377 -10.429 24.379  1.00 176.85 ? 365 CYS A CA    1 
ATOM   2831  C  C     . CYS A 1 386 ? -15.083 -11.017 24.964  1.00 151.90 ? 365 CYS A C     1 
ATOM   2832  O  O     . CYS A 1 386 ? -14.132 -11.293 24.225  1.00 125.04 ? 365 CYS A O     1 
ATOM   2833  C  CB    . CYS A 1 386 ? -16.581 -11.040 22.995  1.00 194.18 ? 365 CYS A CB    1 
ATOM   2834  S  SG    . CYS A 1 386 ? -16.815 -12.826 23.098  1.00 184.46 ? 365 CYS A SG    1 
ATOM   2835  N  N     . SER A 1 387 ? -15.075 -11.160 26.298  1.00 150.61 ? 366 SER A N     1 
ATOM   2836  C  CA    . SER A 1 387 ? -13.960 -11.721 27.069  1.00 137.68 ? 366 SER A CA    1 
ATOM   2837  C  C     . SER A 1 387 ? -13.658 -13.167 26.704  1.00 105.17 ? 366 SER A C     1 
ATOM   2838  O  O     . SER A 1 387 ? -14.536 -13.911 26.279  1.00 110.16 ? 366 SER A O     1 
ATOM   2839  C  CB    . SER A 1 387 ? -14.281 -11.697 28.561  1.00 144.50 ? 366 SER A CB    1 
ATOM   2840  O  OG    . SER A 1 387 ? -14.906 -10.484 28.922  1.00 170.18 ? 366 SER A OG    1 
ATOM   2841  N  N     . VAL A 1 388 ? -12.397 -13.574 26.915  1.00 116.11 ? 367 VAL A N     1 
ATOM   2842  C  CA    . VAL A 1 388 ? -11.959 -14.932 26.561  1.00 106.85 ? 367 VAL A CA    1 
ATOM   2843  C  C     . VAL A 1 388 ? -12.755 -15.941 27.352  1.00 106.02 ? 367 VAL A C     1 
ATOM   2844  O  O     . VAL A 1 388 ? -12.995 -17.064 26.889  1.00 110.28 ? 367 VAL A O     1 
ATOM   2845  C  CB    . VAL A 1 388 ? -10.449 -15.153 26.816  1.00 106.86 ? 367 VAL A CB    1 
ATOM   2846  C  CG1   . VAL A 1 388 ? -10.039 -16.619 26.492  1.00 99.71  ? 367 VAL A CG1   1 
ATOM   2847  C  CG2   . VAL A 1 388 ? -9.600  -14.135 26.053  1.00 138.53 ? 367 VAL A CG2   1 
ATOM   2848  N  N     . GLU A 1 389 ? -13.153 -15.568 28.568  1.00 107.10 ? 368 GLU A N     1 
ATOM   2849  C  CA    . GLU A 1 389 ? -13.897 -16.484 29.411  1.00 96.36  ? 368 GLU A CA    1 
ATOM   2850  C  C     . GLU A 1 389 ? -15.244 -16.813 28.801  1.00 99.64  ? 368 GLU A C     1 
ATOM   2851  O  O     . GLU A 1 389 ? -15.575 -17.986 28.619  1.00 108.47 ? 368 GLU A O     1 
ATOM   2852  C  CB    . GLU A 1 389 ? -14.061 -15.888 30.812  1.00 112.00 ? 368 GLU A CB    1 
ATOM   2853  C  CG    . GLU A 1 389 ? -12.900 -16.128 31.765  1.00 94.18  ? 368 GLU A CG    1 
ATOM   2854  C  CD    . GLU A 1 389 ? -11.790 -15.145 31.653  1.00 105.32 ? 368 GLU A CD    1 
ATOM   2855  O  OE1   . GLU A 1 389 ? -12.003 -14.031 31.127  1.00 132.22 ? 368 GLU A OE1   1 
ATOM   2856  O  OE2   . GLU A 1 389 ? -10.686 -15.507 32.098  1.00 129.73 ? 368 GLU A OE2   1 
ATOM   2857  N  N     . TRP A 1 390 ? -16.017 -15.795 28.427  1.00 101.99 ? 369 TRP A N     1 
ATOM   2858  C  CA    . TRP A 1 390 ? -17.354 -16.074 27.908  1.00 117.34 ? 369 TRP A CA    1 
ATOM   2859  C  C     . TRP A 1 390 ? -17.318 -16.986 26.695  1.00 116.69 ? 369 TRP A C     1 
ATOM   2860  O  O     . TRP A 1 390 ? -18.218 -17.817 26.503  1.00 113.41 ? 369 TRP A O     1 
ATOM   2861  C  CB    . TRP A 1 390 ? -18.076 -14.793 27.520  1.00 134.65 ? 369 TRP A CB    1 
ATOM   2862  C  CG    . TRP A 1 390 ? -18.552 -13.948 28.606  1.00 127.70 ? 369 TRP A CG    1 
ATOM   2863  C  CD1   . TRP A 1 390 ? -18.039 -12.761 29.010  1.00 139.58 ? 369 TRP A CD1   1 
ATOM   2864  C  CD2   . TRP A 1 390 ? -19.690 -14.203 29.430  1.00 122.74 ? 369 TRP A CD2   1 
ATOM   2865  N  NE1   . TRP A 1 390 ? -18.793 -12.253 30.043  1.00 144.15 ? 369 TRP A NE1   1 
ATOM   2866  C  CE2   . TRP A 1 390 ? -19.814 -13.125 30.315  1.00 121.11 ? 369 TRP A CE2   1 
ATOM   2867  C  CE3   . TRP A 1 390 ? -20.611 -15.250 29.512  1.00 132.20 ? 369 TRP A CE3   1 
ATOM   2868  C  CZ2   . TRP A 1 390 ? -20.822 -13.058 31.264  1.00 120.96 ? 369 TRP A CZ2   1 
ATOM   2869  C  CZ3   . TRP A 1 390 ? -21.604 -15.183 30.458  1.00 122.25 ? 369 TRP A CZ3   1 
ATOM   2870  C  CH2   . TRP A 1 390 ? -21.706 -14.099 31.318  1.00 118.01 ? 369 TRP A CH2   1 
ATOM   2871  N  N     . ALA A 1 391 ? -16.285 -16.832 25.865  1.00 109.06 ? 370 ALA A N     1 
ATOM   2872  C  CA    . ALA A 1 391 ? -16.186 -17.565 24.608  1.00 112.83 ? 370 ALA A CA    1 
ATOM   2873  C  C     . ALA A 1 391 ? -16.049 -19.062 24.851  1.00 116.63 ? 370 ALA A C     1 
ATOM   2874  O  O     . ALA A 1 391 ? -16.711 -19.878 24.198  1.00 158.76 ? 370 ALA A O     1 
ATOM   2875  C  CB    . ALA A 1 391 ? -14.998 -17.036 23.807  1.00 122.92 ? 370 ALA A CB    1 
ATOM   2876  N  N     . VAL A 1 392 ? -15.196 -19.440 25.792  1.00 107.28 ? 371 VAL A N     1 
ATOM   2877  C  CA    . VAL A 1 392 ? -15.078 -20.834 26.168  1.00 106.27 ? 371 VAL A CA    1 
ATOM   2878  C  C     . VAL A 1 392 ? -16.372 -21.368 26.779  1.00 106.90 ? 371 VAL A C     1 
ATOM   2879  O  O     . VAL A 1 392 ? -16.628 -22.576 26.735  1.00 151.19 ? 371 VAL A O     1 
ATOM   2880  C  CB    . VAL A 1 392 ? -13.853 -20.975 27.080  1.00 102.18 ? 371 VAL A CB    1 
ATOM   2881  C  CG1   . VAL A 1 392 ? -13.709 -22.408 27.604  1.00 105.23 ? 371 VAL A CG1   1 
ATOM   2882  C  CG2   . VAL A 1 392 ? -12.608 -20.530 26.287  1.00 102.59 ? 371 VAL A CG2   1 
ATOM   2883  N  N     . ARG A 1 393 ? -17.214 -20.504 27.341  1.00 106.73 ? 372 ARG A N     1 
ATOM   2884  C  CA    . ARG A 1 393 ? -18.479 -21.012 27.863  1.00 108.00 ? 372 ARG A CA    1 
ATOM   2885  C  C     . ARG A 1 393 ? -19.412 -21.481 26.735  1.00 122.64 ? 372 ARG A C     1 
ATOM   2886  O  O     . ARG A 1 393 ? -20.046 -22.536 26.852  1.00 126.99 ? 372 ARG A O     1 
ATOM   2887  C  CB    . ARG A 1 393 ? -19.139 -19.972 28.754  1.00 106.94 ? 372 ARG A CB    1 
ATOM   2888  C  CG    . ARG A 1 393 ? -20.168 -20.564 29.678  1.00 107.20 ? 372 ARG A CG    1 
ATOM   2889  C  CD    . ARG A 1 393 ? -21.136 -19.508 29.959  1.00 108.58 ? 372 ARG A CD    1 
ATOM   2890  N  NE    . ARG A 1 393 ? -21.604 -19.103 28.659  1.00 116.16 ? 372 ARG A NE    1 
ATOM   2891  C  CZ    . ARG A 1 393 ? -22.614 -19.678 28.028  1.00 123.46 ? 372 ARG A CZ    1 
ATOM   2892  N  NH1   . ARG A 1 393 ? -23.294 -20.653 28.621  1.00 130.64 ? 372 ARG A NH1   1 
ATOM   2893  N  NH2   . ARG A 1 393 ? -22.947 -19.262 26.815  1.00 121.14 ? 372 ARG A NH2   1 
ATOM   2894  N  N     . GLU A 1 394 ? -19.513 -20.724 25.633  1.00 124.53 ? 373 GLU A N     1 
ATOM   2895  C  CA    . GLU A 1 394 ? -20.324 -21.170 24.499  1.00 121.36 ? 373 GLU A CA    1 
ATOM   2896  C  C     . GLU A 1 394 ? -19.711 -22.367 23.786  1.00 137.43 ? 373 GLU A C     1 
ATOM   2897  O  O     . GLU A 1 394 ? -20.439 -23.229 23.272  1.00 175.30 ? 373 GLU A O     1 
ATOM   2898  C  CB    . GLU A 1 394 ? -20.510 -20.058 23.485  1.00 124.77 ? 373 GLU A CB    1 
ATOM   2899  C  CG    . GLU A 1 394 ? -21.513 -19.073 23.903  1.00 133.42 ? 373 GLU A CG    1 
ATOM   2900  C  CD    . GLU A 1 394 ? -22.076 -18.316 22.721  1.00 150.90 ? 373 GLU A CD    1 
ATOM   2901  O  OE1   . GLU A 1 394 ? -21.563 -18.485 21.594  1.00 150.51 ? 373 GLU A OE1   1 
ATOM   2902  O  OE2   . GLU A 1 394 ? -23.050 -17.558 22.921  1.00 166.53 ? 373 GLU A OE2   1 
ATOM   2903  N  N     . HIS A 1 395 ? -18.379 -22.414 23.711  1.00 121.88 ? 374 HIS A N     1 
ATOM   2904  C  CA    . HIS A 1 395 ? -17.689 -23.489 23.001  1.00 128.32 ? 374 HIS A CA    1 
ATOM   2905  C  C     . HIS A 1 395 ? -17.939 -24.831 23.690  1.00 126.97 ? 374 HIS A C     1 
ATOM   2906  O  O     . HIS A 1 395 ? -18.354 -25.805 23.054  1.00 126.30 ? 374 HIS A O     1 
ATOM   2907  C  CB    . HIS A 1 395 ? -16.198 -23.132 22.936  1.00 140.98 ? 374 HIS A CB    1 
ATOM   2908  C  CG    . HIS A 1 395 ? -15.358 -23.977 22.018  1.00 165.89 ? 374 HIS A CG    1 
ATOM   2909  N  ND1   . HIS A 1 395 ? -15.281 -23.737 20.660  1.00 184.41 ? 374 HIS A ND1   1 
ATOM   2910  C  CD2   . HIS A 1 395 ? -14.520 -25.015 22.264  1.00 179.28 ? 374 HIS A CD2   1 
ATOM   2911  C  CE1   . HIS A 1 395 ? -14.468 -24.619 20.105  1.00 193.78 ? 374 HIS A CE1   1 
ATOM   2912  N  NE2   . HIS A 1 395 ? -13.988 -25.402 21.057  1.00 194.91 ? 374 HIS A NE2   1 
ATOM   2913  N  N     . LEU A 1 396 ? -17.753 -24.873 25.010  1.00 145.99 ? 375 LEU A N     1 
ATOM   2914  C  CA    . LEU A 1 396 ? -17.866 -26.077 25.834  1.00 145.73 ? 375 LEU A CA    1 
ATOM   2915  C  C     . LEU A 1 396 ? -19.294 -26.600 26.033  1.00 125.79 ? 375 LEU A C     1 
ATOM   2916  O  O     . LEU A 1 396 ? -19.452 -27.642 26.674  1.00 123.39 ? 375 LEU A O     1 
ATOM   2917  C  CB    . LEU A 1 396 ? -17.210 -25.832 27.195  1.00 141.11 ? 375 LEU A CB    1 
ATOM   2918  C  CG    . LEU A 1 396 ? -15.682 -25.731 27.037  1.00 145.40 ? 375 LEU A CG    1 
ATOM   2919  C  CD1   . LEU A 1 396 ? -14.962 -25.734 28.381  1.00 128.73 ? 375 LEU A CD1   1 
ATOM   2920  C  CD2   . LEU A 1 396 ? -15.102 -26.774 26.048  1.00 160.71 ? 375 LEU A CD2   1 
ATOM   2921  N  N     . GLU A 1 397 ? -20.338 -25.918 25.576  1.00 120.66 ? 376 GLU A N     1 
ATOM   2922  C  CA    . GLU A 1 397 ? -21.693 -26.396 25.833  1.00 129.42 ? 376 GLU A CA    1 
ATOM   2923  C  C     . GLU A 1 397 ? -22.158 -27.383 24.741  1.00 152.98 ? 376 GLU A C     1 
ATOM   2924  O  O     . GLU A 1 397 ? -22.301 -26.994 23.579  1.00 147.08 ? 376 GLU A O     1 
ATOM   2925  C  CB    . GLU A 1 397 ? -22.608 -25.181 25.972  1.00 124.82 ? 376 GLU A CB    1 
ATOM   2926  C  CG    . GLU A 1 397 ? -23.939 -25.482 26.593  1.00 150.92 ? 376 GLU A CG    1 
ATOM   2927  C  CD    . GLU A 1 397 ? -24.629 -24.242 27.090  1.00 175.66 ? 376 GLU A CD    1 
ATOM   2928  O  OE1   . GLU A 1 397 ? -23.984 -23.176 27.082  1.00 188.08 ? 376 GLU A OE1   1 
ATOM   2929  O  OE2   . GLU A 1 397 ? -25.789 -24.340 27.541  1.00 199.58 ? 376 GLU A OE2   1 
ATOM   2930  N  N     . GLU A 1 398 ? -22.410 -28.657 25.129  1.00 149.15 ? 377 GLU A N     1 
ATOM   2931  C  CA    . GLU A 1 398 ? -22.531 -29.841 24.219  1.00 133.83 ? 377 GLU A CA    1 
ATOM   2932  C  C     . GLU A 1 398 ? -23.728 -29.997 23.259  1.00 172.15 ? 377 GLU A C     1 
ATOM   2933  O  O     . GLU A 1 398 ? -23.528 -30.571 22.192  1.00 184.62 ? 377 GLU A O     1 
ATOM   2934  C  CB    . GLU A 1 398 ? -22.409 -31.147 25.021  1.00 132.91 ? 377 GLU A CB    1 
ATOM   2935  N  N     . PRO A 1 399 ? -24.980 -29.590 23.611  1.00 179.54 ? 378 PRO A N     1 
ATOM   2936  C  CA    . PRO A 1 399 ? -25.837 -29.086 24.702  1.00 171.22 ? 378 PRO A CA    1 
ATOM   2937  C  C     . PRO A 1 399 ? -26.158 -30.092 25.785  1.00 157.27 ? 378 PRO A C     1 
ATOM   2938  O  O     . PRO A 1 399 ? -26.742 -29.674 26.789  1.00 161.10 ? 378 PRO A O     1 
ATOM   2939  C  CB    . PRO A 1 399 ? -27.127 -28.673 23.987  1.00 178.07 ? 378 PRO A CB    1 
ATOM   2940  C  CG    . PRO A 1 399 ? -26.723 -28.395 22.623  1.00 174.64 ? 378 PRO A CG    1 
ATOM   2941  C  CD    . PRO A 1 399 ? -25.701 -29.466 22.331  1.00 183.10 ? 378 PRO A CD    1 
ATOM   2942  N  N     . GLY A 1 400 ? -25.860 -31.378 25.577  1.00 144.38 ? 379 GLY A N     1 
ATOM   2943  C  CA    . GLY A 1 400 ? -25.932 -32.282 26.713  1.00 142.00 ? 379 GLY A CA    1 
ATOM   2944  C  C     . GLY A 1 400 ? -25.036 -31.852 27.875  1.00 154.85 ? 379 GLY A C     1 
ATOM   2945  O  O     . GLY A 1 400 ? -25.067 -32.477 28.942  1.00 146.77 ? 379 GLY A O     1 
ATOM   2946  N  N     . CYS A 1 401 ? -24.240 -30.805 27.671  1.00 131.19 ? 380 CYS A N     1 
ATOM   2947  C  CA    . CYS A 1 401 ? -23.428 -30.133 28.677  1.00 127.80 ? 380 CYS A CA    1 
ATOM   2948  C  C     . CYS A 1 401 ? -23.974 -28.729 28.927  1.00 136.57 ? 380 CYS A C     1 
ATOM   2949  O  O     . CYS A 1 401 ? -24.337 -28.035 27.974  1.00 169.35 ? 380 CYS A O     1 
ATOM   2950  C  CB    . CYS A 1 401 ? -21.969 -30.051 28.202  1.00 137.83 ? 380 CYS A CB    1 
ATOM   2951  S  SG    . CYS A 1 401 ? -20.692 -29.675 29.417  1.00 156.72 ? 380 CYS A SG    1 
ATOM   2952  N  N     . ALA A 1 402 ? -24.147 -28.356 30.196  1.00 122.05 ? 381 ALA A N     1 
ATOM   2953  C  CA    . ALA A 1 402 ? -24.509 -26.989 30.587  1.00 130.34 ? 381 ALA A CA    1 
ATOM   2954  C  C     . ALA A 1 402 ? -23.284 -26.313 31.203  1.00 128.54 ? 381 ALA A C     1 
ATOM   2955  O  O     . ALA A 1 402 ? -22.575 -26.943 31.981  1.00 140.81 ? 381 ALA A O     1 
ATOM   2956  C  CB    . ALA A 1 402 ? -25.670 -26.989 31.584  1.00 122.36 ? 381 ALA A CB    1 
ATOM   2957  N  N     . VAL A 1 403 ? -23.004 -25.053 30.848  1.00 136.46 ? 382 VAL A N     1 
ATOM   2958  C  CA    . VAL A 1 403 ? -21.806 -24.359 31.341  1.00 119.98 ? 382 VAL A CA    1 
ATOM   2959  C  C     . VAL A 1 403 ? -22.157 -22.960 31.875  1.00 108.74 ? 382 VAL A C     1 
ATOM   2960  O  O     . VAL A 1 403 ? -22.893 -22.202 31.229  1.00 111.27 ? 382 VAL A O     1 
ATOM   2961  C  CB    . VAL A 1 403 ? -20.720 -24.282 30.239  1.00 118.51 ? 382 VAL A CB    1 
ATOM   2962  C  CG1   . VAL A 1 403 ? -19.406 -23.838 30.809  1.00 112.15 ? 382 VAL A CG1   1 
ATOM   2963  C  CG2   . VAL A 1 403 ? -20.556 -25.630 29.513  1.00 127.56 ? 382 VAL A CG2   1 
ATOM   2964  N  N     . HIS A 1 404 ? -21.572 -22.598 33.035  1.00 105.03 ? 383 HIS A N     1 
ATOM   2965  C  CA    . HIS A 1 404 ? -21.850 -21.337 33.724  1.00 110.78 ? 383 HIS A CA    1 
ATOM   2966  C  C     . HIS A 1 404 ? -20.574 -20.557 34.063  1.00 126.45 ? 383 HIS A C     1 
ATOM   2967  O  O     . HIS A 1 404 ? -19.556 -21.160 34.436  1.00 121.59 ? 383 HIS A O     1 
ATOM   2968  C  CB    . HIS A 1 404 ? -22.615 -21.609 35.024  1.00 103.51 ? 383 HIS A CB    1 
ATOM   2969  C  CG    . HIS A 1 404 ? -23.951 -22.271 34.843  1.00 107.75 ? 383 HIS A CG    1 
ATOM   2970  N  ND1   . HIS A 1 404 ? -25.140 -21.629 35.114  1.00 110.38 ? 383 HIS A ND1   1 
ATOM   2971  C  CD2   . HIS A 1 404 ? -24.283 -23.522 34.445  1.00 110.16 ? 383 HIS A CD2   1 
ATOM   2972  C  CE1   . HIS A 1 404 ? -26.144 -22.460 34.905  1.00 114.26 ? 383 HIS A CE1   1 
ATOM   2973  N  NE2   . HIS A 1 404 ? -25.652 -23.615 34.495  1.00 114.19 ? 383 HIS A NE2   1 
ATOM   2974  N  N     . TYR A 1 405 ? -20.653 -19.200 33.968  1.00 109.98 ? 384 TYR A N     1 
ATOM   2975  C  CA    . TYR A 1 405 ? -19.595 -18.286 34.423  1.00 96.50  ? 384 TYR A CA    1 
ATOM   2976  C  C     . TYR A 1 405 ? -19.942 -17.842 35.826  1.00 94.69  ? 384 TYR A C     1 
ATOM   2977  O  O     . TYR A 1 405 ? -20.806 -16.994 36.027  1.00 96.20  ? 384 TYR A O     1 
ATOM   2978  C  CB    . TYR A 1 405 ? -19.445 -17.087 33.484  1.00 112.18 ? 384 TYR A CB    1 
ATOM   2979  C  CG    . TYR A 1 405 ? -18.344 -16.067 33.800  1.00 120.72 ? 384 TYR A CG    1 
ATOM   2980  C  CD1   . TYR A 1 405 ? -18.316 -15.371 35.008  1.00 126.19 ? 384 TYR A CD1   1 
ATOM   2981  C  CD2   . TYR A 1 405 ? -17.325 -15.825 32.884  1.00 94.44  ? 384 TYR A CD2   1 
ATOM   2982  C  CE1   . TYR A 1 405 ? -17.326 -14.446 35.273  1.00 136.64 ? 384 TYR A CE1   1 
ATOM   2983  C  CE2   . TYR A 1 405 ? -16.335 -14.921 33.139  1.00 92.45  ? 384 TYR A CE2   1 
ATOM   2984  C  CZ    . TYR A 1 405 ? -16.328 -14.239 34.334  1.00 152.24 ? 384 TYR A CZ    1 
ATOM   2985  O  OH    . TYR A 1 405 ? -15.317 -13.341 34.576  1.00 159.43 ? 384 TYR A OH    1 
ATOM   2986  N  N     . VAL A 1 406 ? -19.219 -18.391 36.782  1.00 109.72 ? 385 VAL A N     1 
ATOM   2987  C  CA    . VAL A 1 406 ? -19.381 -18.114 38.192  1.00 90.59  ? 385 VAL A CA    1 
ATOM   2988  C  C     . VAL A 1 406 ? -17.984 -18.103 38.810  1.00 87.31  ? 385 VAL A C     1 
ATOM   2989  O  O     . VAL A 1 406 ? -17.268 -19.103 38.721  1.00 105.59 ? 385 VAL A O     1 
ATOM   2990  C  CB    . VAL A 1 406 ? -20.261 -19.221 38.785  1.00 92.17  ? 385 VAL A CB    1 
ATOM   2991  C  CG1   . VAL A 1 406 ? -21.643 -19.046 38.324  1.00 95.69  ? 385 VAL A CG1   1 
ATOM   2992  C  CG2   . VAL A 1 406 ? -19.851 -20.555 38.202  1.00 92.50  ? 385 VAL A CG2   1 
ATOM   2993  N  N     . GLU A 1 407 ? -17.559 -17.000 39.407  1.00 85.76  ? 386 GLU A N     1 
ATOM   2994  C  CA    . GLU A 1 407 ? -16.216 -17.013 39.990  1.00 83.12  ? 386 GLU A CA    1 
ATOM   2995  C  C     . GLU A 1 407 ? -16.402 -16.856 41.482  1.00 98.11  ? 386 GLU A C     1 
ATOM   2996  O  O     . GLU A 1 407 ? -16.799 -15.786 41.955  1.00 132.77 ? 386 GLU A O     1 
ATOM   2997  C  CB    . GLU A 1 407 ? -15.260 -15.936 39.441  1.00 86.40  ? 386 GLU A CB    1 
ATOM   2998  C  CG    . GLU A 1 407 ? -15.724 -14.480 39.494  1.00 111.57 ? 386 GLU A CG    1 
ATOM   2999  C  CD    . GLU A 1 407 ? -14.840 -13.597 38.664  1.00 123.52 ? 386 GLU A CD    1 
ATOM   3000  O  OE1   . GLU A 1 407 ? -14.019 -14.168 37.913  1.00 108.50 ? 386 GLU A OE1   1 
ATOM   3001  O  OE2   . GLU A 1 407 ? -14.972 -12.351 38.740  1.00 159.82 ? 386 GLU A OE2   1 
ATOM   3002  N  N     . ASN A 1 408 ? -16.180 -17.935 42.212  1.00 81.92  ? 387 ASN A N     1 
ATOM   3003  C  CA    . ASN A 1 408 ? -16.350 -17.974 43.660  1.00 113.79 ? 387 ASN A CA    1 
ATOM   3004  C  C     . ASN A 1 408 ? -17.787 -17.603 43.961  1.00 106.68 ? 387 ASN A C     1 
ATOM   3005  O  O     . ASN A 1 408 ? -18.145 -17.495 45.140  1.00 84.09  ? 387 ASN A O     1 
ATOM   3006  C  CB    . ASN A 1 408 ? -15.424 -17.077 44.531  1.00 118.67 ? 387 ASN A CB    1 
ATOM   3007  C  CG    . ASN A 1 408 ? -14.338 -16.319 43.777  1.00 99.55  ? 387 ASN A CG    1 
ATOM   3008  O  OD1   . ASN A 1 408 ? -13.192 -16.780 43.670  1.00 82.61  ? 387 ASN A OD1   1 
ATOM   3009  N  ND2   . ASN A 1 408 ? -14.661 -15.078 43.382  1.00 85.27  ? 387 ASN A ND2   1 
ATOM   3010  N  N     . GLY A 1 409 ? -18.571 -17.311 42.910  1.00 96.13  ? 388 GLY A N     1 
ATOM   3011  C  CA    . GLY A 1 409 ? -19.985 -17.052 43.097  1.00 94.77  ? 388 GLY A CA    1 
ATOM   3012  C  C     . GLY A 1 409 ? -20.725 -18.294 43.552  1.00 92.82  ? 388 GLY A C     1 
ATOM   3013  O  O     . GLY A 1 409 ? -21.565 -18.238 44.453  1.00 93.02  ? 388 GLY A O     1 
ATOM   3014  N  N     . LEU A 1 410 ? -20.390 -19.444 42.984  1.00 89.72  ? 389 LEU A N     1 
ATOM   3015  C  CA    . LEU A 1 410 ? -21.267 -20.550 43.269  1.00 92.18  ? 389 LEU A CA    1 
ATOM   3016  C  C     . LEU A 1 410 ? -20.936 -21.151 44.628  1.00 91.61  ? 389 LEU A C     1 
ATOM   3017  O  O     . LEU A 1 410 ? -21.845 -21.372 45.429  1.00 111.76 ? 389 LEU A O     1 
ATOM   3018  C  CB    . LEU A 1 410 ? -21.209 -21.571 42.141  1.00 93.19  ? 389 LEU A CB    1 
ATOM   3019  C  CG    . LEU A 1 410 ? -22.148 -22.765 42.300  1.00 107.04 ? 389 LEU A CG    1 
ATOM   3020  C  CD1   . LEU A 1 410 ? -23.590 -22.290 42.331  1.00 101.41 ? 389 LEU A CD1   1 
ATOM   3021  C  CD2   . LEU A 1 410 ? -21.961 -23.744 41.168  1.00 116.35 ? 389 LEU A CD2   1 
ATOM   3022  N  N     . ILE A 1 411 ? -19.657 -21.338 44.963  1.00 89.11  ? 390 ILE A N     1 
ATOM   3023  C  CA    . ILE A 1 411 ? -19.338 -21.951 46.260  1.00 89.13  ? 390 ILE A CA    1 
ATOM   3024  C  C     . ILE A 1 411 ? -19.620 -20.987 47.404  1.00 89.14  ? 390 ILE A C     1 
ATOM   3025  O  O     . ILE A 1 411 ? -20.237 -21.361 48.408  1.00 91.06  ? 390 ILE A O     1 
ATOM   3026  C  CB    . ILE A 1 411 ? -17.889 -22.470 46.305  1.00 87.07  ? 390 ILE A CB    1 
ATOM   3027  C  CG1   . ILE A 1 411 ? -17.703 -23.709 45.410  1.00 87.84  ? 390 ILE A CG1   1 
ATOM   3028  C  CG2   . ILE A 1 411 ? -17.433 -22.656 47.739  1.00 87.02  ? 390 ILE A CG2   1 
ATOM   3029  C  CD1   . ILE A 1 411 ? -17.588 -23.365 43.905  1.00 92.65  ? 390 ILE A CD1   1 
ATOM   3030  N  N     . ASN A 1 412 ? -19.182 -19.734 47.279  1.00 87.34  ? 391 ASN A N     1 
ATOM   3031  C  CA    . ASN A 1 412 ? -19.579 -18.752 48.280  1.00 87.79  ? 391 ASN A CA    1 
ATOM   3032  C  C     . ASN A 1 412 ? -21.089 -18.732 48.461  1.00 90.87  ? 391 ASN A C     1 
ATOM   3033  O  O     . ASN A 1 412 ? -21.578 -18.632 49.588  1.00 101.81 ? 391 ASN A O     1 
ATOM   3034  C  CB    . ASN A 1 412 ? -19.088 -17.338 47.953  1.00 86.64  ? 391 ASN A CB    1 
ATOM   3035  C  CG    . ASN A 1 412 ? -17.729 -17.033 48.526  1.00 102.91 ? 391 ASN A CG    1 
ATOM   3036  O  OD1   . ASN A 1 412 ? -17.164 -17.838 49.258  1.00 103.96 ? 391 ASN A OD1   1 
ATOM   3037  N  ND2   . ASN A 1 412 ? -17.260 -15.801 48.310  1.00 128.00 ? 391 ASN A ND2   1 
ATOM   3038  N  N     . SER A 1 413 ? -21.851 -18.781 47.371  1.00 92.22  ? 392 SER A N     1 
ATOM   3039  C  CA    . SER A 1 413 ? -23.285 -18.625 47.534  1.00 95.56  ? 392 SER A CA    1 
ATOM   3040  C  C     . SER A 1 413 ? -23.909 -19.830 48.217  1.00 98.10  ? 392 SER A C     1 
ATOM   3041  O  O     . SER A 1 413 ? -24.642 -19.670 49.200  1.00 106.47 ? 392 SER A O     1 
ATOM   3042  C  CB    . SER A 1 413 ? -23.931 -18.321 46.211  1.00 96.88  ? 392 SER A CB    1 
ATOM   3043  O  OG    . SER A 1 413 ? -23.484 -17.022 45.903  1.00 95.20  ? 392 SER A OG    1 
ATOM   3044  N  N     . LEU A 1 414 ? -23.612 -21.046 47.743  1.00 101.85 ? 393 LEU A N     1 
ATOM   3045  C  CA    . LEU A 1 414 ? -24.191 -22.220 48.399  1.00 100.93 ? 393 LEU A CA    1 
ATOM   3046  C  C     . LEU A 1 414 ? -23.850 -22.207 49.889  1.00 100.86 ? 393 LEU A C     1 
ATOM   3047  O  O     . LEU A 1 414 ? -24.720 -22.452 50.734  1.00 133.92 ? 393 LEU A O     1 
ATOM   3048  C  CB    . LEU A 1 414 ? -23.713 -23.531 47.750  1.00 100.81 ? 393 LEU A CB    1 
ATOM   3049  C  CG    . LEU A 1 414 ? -23.956 -23.886 46.271  1.00 101.42 ? 393 LEU A CG    1 
ATOM   3050  C  CD1   . LEU A 1 414 ? -23.422 -25.265 45.983  1.00 101.63 ? 393 LEU A CD1   1 
ATOM   3051  C  CD2   . LEU A 1 414 ? -25.374 -23.732 45.769  1.00 105.05 ? 393 LEU A CD2   1 
ATOM   3052  N  N     . PHE A 1 415 ? -22.605 -21.853 50.234  1.00 97.71  ? 394 PHE A N     1 
ATOM   3053  C  CA    . PHE A 1 415 ? -22.239 -21.727 51.642  1.00 97.90  ? 394 PHE A CA    1 
ATOM   3054  C  C     . PHE A 1 415 ? -23.100 -20.678 52.320  1.00 99.52  ? 394 PHE A C     1 
ATOM   3055  O  O     . PHE A 1 415 ? -23.679 -20.924 53.382  1.00 102.26 ? 394 PHE A O     1 
ATOM   3056  C  CB    . PHE A 1 415 ? -20.761 -21.371 51.774  1.00 94.52  ? 394 PHE A CB    1 
ATOM   3057  C  CG    . PHE A 1 415 ? -20.299 -21.069 53.189  1.00 94.81  ? 394 PHE A CG    1 
ATOM   3058  C  CD1   . PHE A 1 415 ? -20.182 -22.076 54.124  1.00 96.81  ? 394 PHE A CD1   1 
ATOM   3059  C  CD2   . PHE A 1 415 ? -19.926 -19.793 53.557  1.00 93.37  ? 394 PHE A CD2   1 
ATOM   3060  C  CE1   . PHE A 1 415 ? -19.743 -21.811 55.408  1.00 97.53  ? 394 PHE A CE1   1 
ATOM   3061  C  CE2   . PHE A 1 415 ? -19.487 -19.542 54.830  1.00 93.98  ? 394 PHE A CE2   1 
ATOM   3062  C  CZ    . PHE A 1 415 ? -19.398 -20.562 55.757  1.00 96.12  ? 394 PHE A CZ    1 
ATOM   3063  N  N     . GLY A 1 416 ? -23.242 -19.517 51.693  1.00 98.30  ? 395 GLY A N     1 
ATOM   3064  C  CA    . GLY A 1 416 ? -24.001 -18.454 52.320  1.00 99.94  ? 395 GLY A CA    1 
ATOM   3065  C  C     . GLY A 1 416 ? -25.428 -18.854 52.599  1.00 104.22 ? 395 GLY A C     1 
ATOM   3066  O  O     . GLY A 1 416 ? -25.989 -18.499 53.642  1.00 110.50 ? 395 GLY A O     1 
ATOM   3067  N  N     . LEU A 1 417 ? -26.003 -19.668 51.721  1.00 105.67 ? 396 LEU A N     1 
ATOM   3068  C  CA    . LEU A 1 417 ? -27.371 -20.097 51.930  1.00 110.22 ? 396 LEU A CA    1 
ATOM   3069  C  C     . LEU A 1 417 ? -27.442 -21.097 53.074  1.00 112.42 ? 396 LEU A C     1 
ATOM   3070  O  O     . LEU A 1 417 ? -28.166 -20.876 54.050  1.00 127.06 ? 396 LEU A O     1 
ATOM   3071  C  CB    . LEU A 1 417 ? -27.915 -20.714 50.647  1.00 111.48 ? 396 LEU A CB    1 
ATOM   3072  C  CG    . LEU A 1 417 ? -28.057 -19.738 49.486  1.00 110.49 ? 396 LEU A CG    1 
ATOM   3073  C  CD1   . LEU A 1 417 ? -28.428 -20.443 48.177  1.00 111.74 ? 396 LEU A CD1   1 
ATOM   3074  C  CD2   . LEU A 1 417 ? -29.013 -18.613 49.819  1.00 113.00 ? 396 LEU A CD2   1 
ATOM   3075  N  N     . LEU A 1 418 ? -26.618 -22.155 53.016  1.00 111.02 ? 397 LEU A N     1 
ATOM   3076  C  CA    . LEU A 1 418 ? -26.733 -23.245 53.980  1.00 113.74 ? 397 LEU A CA    1 
ATOM   3077  C  C     . LEU A 1 418 ? -26.462 -22.771 55.402  1.00 114.26 ? 397 LEU A C     1 
ATOM   3078  O  O     . LEU A 1 418 ? -27.169 -23.147 56.348  1.00 118.20 ? 397 LEU A O     1 
ATOM   3079  C  CB    . LEU A 1 418 ? -25.764 -24.345 53.615  1.00 111.97 ? 397 LEU A CB    1 
ATOM   3080  C  CG    . LEU A 1 418 ? -25.988 -25.634 54.358  1.00 115.41 ? 397 LEU A CG    1 
ATOM   3081  C  CD1   . LEU A 1 418 ? -27.286 -26.170 53.825  1.00 119.30 ? 397 LEU A CD1   1 
ATOM   3082  C  CD2   . LEU A 1 418 ? -24.838 -26.606 54.198  1.00 113.61 ? 397 LEU A CD2   1 
ATOM   3083  N  N     . CYS A 1 419 ? -25.439 -21.954 55.574  1.00 110.70 ? 398 CYS A N     1 
ATOM   3084  C  CA    . CYS A 1 419 ? -25.038 -21.465 56.878  1.00 111.09 ? 398 CYS A CA    1 
ATOM   3085  C  C     . CYS A 1 419 ? -25.630 -20.107 57.211  1.00 111.76 ? 398 CYS A C     1 
ATOM   3086  O  O     . CYS A 1 419 ? -25.161 -19.462 58.159  1.00 111.50 ? 398 CYS A O     1 
ATOM   3087  C  CB    . CYS A 1 419 ? -23.522 -21.440 56.977  1.00 116.85 ? 398 CYS A CB    1 
ATOM   3088  S  SG    . CYS A 1 419 ? -22.892 -23.096 56.821  1.00 119.36 ? 398 CYS A SG    1 
ATOM   3089  N  N     . TRP A 1 420 ? -26.597 -19.635 56.416  1.00 112.75 ? 399 TRP A N     1 
ATOM   3090  C  CA    . TRP A 1 420 ? -27.222 -18.338 56.674  1.00 113.84 ? 399 TRP A CA    1 
ATOM   3091  C  C     . TRP A 1 420 ? -27.605 -18.183 58.141  1.00 117.17 ? 399 TRP A C     1 
ATOM   3092  O  O     . TRP A 1 420 ? -27.277 -17.174 58.775  1.00 116.53 ? 399 TRP A O     1 
ATOM   3093  C  CB    . TRP A 1 420 ? -28.480 -18.164 55.821  1.00 120.09 ? 399 TRP A CB    1 
ATOM   3094  C  CG    . TRP A 1 420 ? -29.044 -16.747 55.835  1.00 117.23 ? 399 TRP A CG    1 
ATOM   3095  C  CD1   . TRP A 1 420 ? -29.846 -16.181 56.786  1.00 120.84 ? 399 TRP A CD1   1 
ATOM   3096  C  CD2   . TRP A 1 420 ? -28.915 -15.767 54.798  1.00 115.06 ? 399 TRP A CD2   1 
ATOM   3097  N  NE1   . TRP A 1 420 ? -30.177 -14.893 56.428  1.00 120.86 ? 399 TRP A NE1   1 
ATOM   3098  C  CE2   . TRP A 1 420 ? -29.622 -14.624 55.206  1.00 117.40 ? 399 TRP A CE2   1 
ATOM   3099  C  CE3   . TRP A 1 420 ? -28.257 -15.744 53.569  1.00 111.68 ? 399 TRP A CE3   1 
ATOM   3100  C  CZ2   . TRP A 1 420 ? -29.675 -13.476 54.433  1.00 116.46 ? 399 TRP A CZ2   1 
ATOM   3101  C  CZ3   . TRP A 1 420 ? -28.328 -14.612 52.807  1.00 110.86 ? 399 TRP A CZ3   1 
ATOM   3102  C  CH2   . TRP A 1 420 ? -29.020 -13.494 53.237  1.00 113.21 ? 399 TRP A CH2   1 
ATOM   3103  N  N     . GLU A 1 421 ? -28.301 -19.179 58.703  1.00 121.12 ? 400 GLU A N     1 
ATOM   3104  C  CA    . GLU A 1 421 ? -28.794 -19.031 60.068  1.00 127.21 ? 400 GLU A CA    1 
ATOM   3105  C  C     . GLU A 1 421 ? -27.649 -18.996 61.079  1.00 128.44 ? 400 GLU A C     1 
ATOM   3106  O  O     . GLU A 1 421 ? -27.812 -18.441 62.174  1.00 133.61 ? 400 GLU A O     1 
ATOM   3107  C  CB    . GLU A 1 421 ? -29.821 -20.134 60.374  1.00 140.39 ? 400 GLU A CB    1 
ATOM   3108  C  CG    . GLU A 1 421 ? -31.281 -19.776 59.930  1.00 164.18 ? 400 GLU A CG    1 
ATOM   3109  C  CD    . GLU A 1 421 ? -31.923 -18.583 60.702  1.00 179.80 ? 400 GLU A CD    1 
ATOM   3110  O  OE1   . GLU A 1 421 ? -32.288 -18.777 61.885  1.00 203.24 ? 400 GLU A OE1   1 
ATOM   3111  O  OE2   . GLU A 1 421 ? -32.078 -17.456 60.136  1.00 145.44 ? 400 GLU A OE2   1 
ATOM   3112  N  N     . ALA A 1 422 ? -26.491 -19.554 60.727  1.00 120.13 ? 401 ALA A N     1 
ATOM   3113  C  CA    . ALA A 1 422 ? -25.321 -19.461 61.587  1.00 118.79 ? 401 ALA A CA    1 
ATOM   3114  C  C     . ALA A 1 422 ? -24.589 -18.132 61.430  1.00 115.32 ? 401 ALA A C     1 
ATOM   3115  O  O     . ALA A 1 422 ? -24.054 -17.604 62.412  1.00 115.80 ? 401 ALA A O     1 
ATOM   3116  C  CB    . ALA A 1 422 ? -24.392 -20.626 61.295  1.00 117.09 ? 401 ALA A CB    1 
ATOM   3117  N  N     . ILE A 1 423 ? -24.577 -17.574 60.212  1.00 112.25 ? 402 ILE A N     1 
ATOM   3118  C  CA    . ILE A 1 423 ? -23.818 -16.351 59.923  1.00 108.95 ? 402 ILE A CA    1 
ATOM   3119  C  C     . ILE A 1 423 ? -24.416 -15.145 60.644  1.00 115.22 ? 402 ILE A C     1 
ATOM   3120  O  O     . ILE A 1 423 ? -23.728 -14.413 61.375  1.00 110.60 ? 402 ILE A O     1 
ATOM   3121  C  CB    . ILE A 1 423 ? -23.800 -16.110 58.400  1.00 105.96 ? 402 ILE A CB    1 
ATOM   3122  C  CG1   . ILE A 1 423 ? -23.009 -17.191 57.682  1.00 103.59 ? 402 ILE A CG1   1 
ATOM   3123  C  CG2   . ILE A 1 423 ? -23.351 -14.689 58.032  1.00 103.58 ? 402 ILE A CG2   1 
ATOM   3124  C  CD1   . ILE A 1 423 ? -23.194 -17.122 56.219  1.00 101.70 ? 402 ILE A CD1   1 
ATOM   3125  N  N     . PHE A 1 424 ? -25.718 -14.964 60.501  1.00 114.04 ? 403 PHE A N     1 
ATOM   3126  C  CA    . PHE A 1 424 ? -26.447 -13.859 61.081  1.00 116.65 ? 403 PHE A CA    1 
ATOM   3127  C  C     . PHE A 1 424 ? -26.948 -14.204 62.466  1.00 132.09 ? 403 PHE A C     1 
ATOM   3128  O  O     . PHE A 1 424 ? -27.846 -13.529 62.990  1.00 161.27 ? 403 PHE A O     1 
ATOM   3129  C  CB    . PHE A 1 424 ? -27.620 -13.497 60.196  1.00 118.15 ? 403 PHE A CB    1 
ATOM   3130  C  CG    . PHE A 1 424 ? -27.247 -12.846 58.928  1.00 114.64 ? 403 PHE A CG    1 
ATOM   3131  C  CD1   . PHE A 1 424 ? -26.976 -11.500 58.882  1.00 113.56 ? 403 PHE A CD1   1 
ATOM   3132  C  CD2   . PHE A 1 424 ? -27.201 -13.565 57.764  1.00 112.85 ? 403 PHE A CD2   1 
ATOM   3133  C  CE1   . PHE A 1 424 ? -26.653 -10.880 57.680  1.00 110.77 ? 403 PHE A CE1   1 
ATOM   3134  C  CE2   . PHE A 1 424 ? -26.875 -12.958 56.573  1.00 110.07 ? 403 PHE A CE2   1 
ATOM   3135  C  CZ    . PHE A 1 424 ? -26.601 -11.615 56.533  1.00 109.08 ? 403 PHE A CZ    1 
ATOM   3136  N  N     . ALA A 1 425 ? -26.454 -15.293 63.037  1.00 121.66 ? 404 ALA A N     1 
ATOM   3137  C  CA    . ALA A 1 425 ? -26.844 -15.612 64.392  1.00 135.99 ? 404 ALA A CA    1 
ATOM   3138  C  C     . ALA A 1 425 ? -26.535 -14.420 65.296  1.00 135.92 ? 404 ALA A C     1 
ATOM   3139  O  O     . ALA A 1 425 ? -25.571 -13.679 65.092  1.00 123.50 ? 404 ALA A O     1 
ATOM   3140  C  CB    . ALA A 1 425 ? -26.126 -16.877 64.859  1.00 131.57 ? 404 ALA A CB    1 
ATOM   3141  N  N     . ALA A 1 426 ? -27.329 -14.288 66.335  1.00 133.16 ? 405 ALA A N     1 
ATOM   3142  C  CA    . ALA A 1 426 ? -27.489 -13.085 67.124  1.00 133.90 ? 405 ALA A CA    1 
ATOM   3143  C  C     . ALA A 1 426 ? -26.390 -12.907 68.190  1.00 137.66 ? 405 ALA A C     1 
ATOM   3144  O  O     . ALA A 1 426 ? -26.643 -12.259 69.212  1.00 151.92 ? 405 ALA A O     1 
ATOM   3145  C  CB    . ALA A 1 426 ? -28.876 -13.077 67.758  1.00 139.78 ? 405 ALA A CB    1 
ATOM   3146  N  N     . ILE A 1 427 ? -25.232 -13.544 68.021  1.00 130.82 ? 406 ILE A N     1 
ATOM   3147  C  CA    . ILE A 1 427 ? -24.094 -13.493 68.947  1.00 130.99 ? 406 ILE A CA    1 
ATOM   3148  C  C     . ILE A 1 427 ? -23.803 -12.092 69.470  1.00 140.62 ? 406 ILE A C     1 
ATOM   3149  O  O     . ILE A 1 427 ? -23.832 -11.125 68.698  1.00 155.03 ? 406 ILE A O     1 
ATOM   3150  C  CB    . ILE A 1 427 ? -22.820 -14.023 68.277  1.00 126.44 ? 406 ILE A CB    1 
ATOM   3151  C  CG1   . ILE A 1 427 ? -23.098 -15.319 67.521  1.00 125.58 ? 406 ILE A CG1   1 
ATOM   3152  C  CG2   . ILE A 1 427 ? -21.682 -14.152 69.302  1.00 127.57 ? 406 ILE A CG2   1 
ATOM   3153  C  CD1   . ILE A 1 427 ? -23.440 -16.485 68.419  1.00 161.50 ? 406 ILE A CD1   1 
ATOM   3154  N  N     . PRO A 1 428 ? -23.554 -11.937 70.771  1.00 135.00 ? 407 PRO A N     1 
ATOM   3155  C  CA    . PRO A 1 428 ? -23.361 -10.595 71.343  1.00 160.01 ? 407 PRO A CA    1 
ATOM   3156  C  C     . PRO A 1 428 ? -22.182 -9.830  70.748  1.00 153.66 ? 407 PRO A C     1 
ATOM   3157  O  O     . PRO A 1 428 ? -21.065 -10.344 70.661  1.00 161.59 ? 407 PRO A O     1 
ATOM   3158  C  CB    . PRO A 1 428 ? -23.140 -10.884 72.834  1.00 159.65 ? 407 PRO A CB    1 
ATOM   3159  C  CG    . PRO A 1 428 ? -23.825 -12.168 73.063  1.00 149.34 ? 407 PRO A CG    1 
ATOM   3160  C  CD    . PRO A 1 428 ? -23.608 -12.968 71.816  1.00 139.32 ? 407 PRO A CD    1 
ATOM   3161  N  N     . GLY A 1 429 ? -22.433 -8.549  70.442  1.00 146.19 ? 408 GLY A N     1 
ATOM   3162  C  CA    . GLY A 1 429 ? -21.504 -7.635  69.796  1.00 139.76 ? 408 GLY A CA    1 
ATOM   3163  C  C     . GLY A 1 429 ? -21.273 -7.868  68.320  1.00 121.81 ? 408 GLY A C     1 
ATOM   3164  O  O     . GLY A 1 429 ? -20.446 -7.170  67.720  1.00 118.66 ? 408 GLY A O     1 
ATOM   3165  N  N     . ALA A 1 430 ? -21.957 -8.840  67.725  1.00 121.34 ? 409 ALA A N     1 
ATOM   3166  C  CA    . ALA A 1 430 ? -21.916 -9.048  66.290  1.00 117.23 ? 409 ALA A CA    1 
ATOM   3167  C  C     . ALA A 1 430 ? -22.901 -8.176  65.550  1.00 117.32 ? 409 ALA A C     1 
ATOM   3168  O  O     . ALA A 1 430 ? -22.789 -8.049  64.336  1.00 114.10 ? 409 ALA A O     1 
ATOM   3169  C  CB    . ALA A 1 430 ? -22.186 -10.505 65.937  1.00 141.77 ? 409 ALA A CB    1 
ATOM   3170  N  N     . PHE A 1 431 ? -23.929 -7.670  66.210  1.00 121.36 ? 410 PHE A N     1 
ATOM   3171  C  CA    . PHE A 1 431 ? -24.815 -6.707  65.568  1.00 121.98 ? 410 PHE A CA    1 
ATOM   3172  C  C     . PHE A 1 431 ? -25.192 -5.590  66.535  1.00 145.56 ? 410 PHE A C     1 
ATOM   3173  O  O     . PHE A 1 431 ? -25.712 -5.871  67.619  1.00 163.90 ? 410 PHE A O     1 
ATOM   3174  C  CB    . PHE A 1 431 ? -26.058 -7.418  65.020  1.00 123.61 ? 410 PHE A CB    1 
ATOM   3175  C  CG    . PHE A 1 431 ? -25.776 -8.382  63.885  1.00 120.07 ? 410 PHE A CG    1 
ATOM   3176  C  CD1   . PHE A 1 431 ? -26.138 -8.044  62.585  1.00 118.24 ? 410 PHE A CD1   1 
ATOM   3177  C  CD2   . PHE A 1 431 ? -25.238 -9.636  64.111  1.00 123.19 ? 410 PHE A CD2   1 
ATOM   3178  C  CE1   . PHE A 1 431 ? -25.931 -8.902  61.540  1.00 115.45 ? 410 PHE A CE1   1 
ATOM   3179  C  CE2   . PHE A 1 431 ? -25.006 -10.504 63.054  1.00 120.61 ? 410 PHE A CE2   1 
ATOM   3180  C  CZ    . PHE A 1 431 ? -25.370 -10.139 61.772  1.00 114.38 ? 410 PHE A CZ    1 
ATOM   3181  N  N     . PHE A 1 432 ? -24.827 -4.341  66.207  1.00 128.04 ? 411 PHE A N     1 
ATOM   3182  C  CA    . PHE A 1 432 ? -25.306 -3.169  66.942  1.00 128.20 ? 411 PHE A CA    1 
ATOM   3183  C  C     . PHE A 1 432 ? -26.266 -2.238  66.189  1.00 129.38 ? 411 PHE A C     1 
ATOM   3184  O  O     . PHE A 1 432 ? -26.688 -1.239  66.782  1.00 132.74 ? 411 PHE A O     1 
ATOM   3185  C  CB    . PHE A 1 432 ? -24.119 -2.361  67.478  1.00 128.57 ? 411 PHE A CB    1 
ATOM   3186  C  CG    . PHE A 1 432 ? -22.827 -2.672  66.800  1.00 138.87 ? 411 PHE A CG    1 
ATOM   3187  C  CD1   . PHE A 1 432 ? -22.430 -1.957  65.684  1.00 133.74 ? 411 PHE A CD1   1 
ATOM   3188  C  CD2   . PHE A 1 432 ? -22.022 -3.696  67.258  1.00 139.24 ? 411 PHE A CD2   1 
ATOM   3189  C  CE1   . PHE A 1 432 ? -21.259 -2.244  65.048  1.00 119.26 ? 411 PHE A CE1   1 
ATOM   3190  C  CE2   . PHE A 1 432 ? -20.839 -3.991  66.616  1.00 139.32 ? 411 PHE A CE2   1 
ATOM   3191  C  CZ    . PHE A 1 432 ? -20.455 -3.257  65.514  1.00 138.46 ? 411 PHE A CZ    1 
ATOM   3192  N  N     . HIS A 1 433 ? -26.607 -2.472  64.917  1.00 127.13 ? 412 HIS A N     1 
ATOM   3193  C  CA    . HIS A 1 433 ? -27.496 -1.564  64.220  1.00 128.81 ? 412 HIS A CA    1 
ATOM   3194  C  C     . HIS A 1 433 ? -28.246 -2.305  63.138  1.00 128.19 ? 412 HIS A C     1 
ATOM   3195  O  O     . HIS A 1 433 ? -28.017 -3.527  62.947  1.00 126.23 ? 412 HIS A O     1 
ATOM   3196  C  CB    . HIS A 1 433 ? -26.729 -0.347  63.643  1.00 126.60 ? 412 HIS A CB    1 
ATOM   3197  C  CG    . HIS A 1 433 ? -25.631 -0.709  62.691  1.00 121.44 ? 412 HIS A CG    1 
ATOM   3198  N  ND1   . HIS A 1 433 ? -25.876 -1.154  61.409  1.00 136.65 ? 412 HIS A ND1   1 
ATOM   3199  C  CD2   . HIS A 1 433 ? -24.285 -0.732  62.844  1.00 118.36 ? 412 HIS A CD2   1 
ATOM   3200  C  CE1   . HIS A 1 433 ? -24.732 -1.419  60.805  1.00 115.10 ? 412 HIS A CE1   1 
ATOM   3201  N  NE2   . HIS A 1 433 ? -23.751 -1.175  61.656  1.00 118.60 ? 412 HIS A NE2   1 
ATOM   3202  N  N     . PRO A 1 434 ? -29.217 -1.680  62.467  1.00 130.43 ? 413 PRO A N     1 
ATOM   3203  C  CA    . PRO A 1 434 ? -30.038 -2.331  61.427  1.00 130.69 ? 413 PRO A CA    1 
ATOM   3204  C  C     . PRO A 1 434 ? -29.373 -2.553  60.082  1.00 126.17 ? 413 PRO A C     1 
ATOM   3205  O  O     . PRO A 1 434 ? -29.980 -3.162  59.191  1.00 126.36 ? 413 PRO A O     1 
ATOM   3206  C  CB    . PRO A 1 434 ? -31.235 -1.397  61.267  1.00 135.34 ? 413 PRO A CB    1 
ATOM   3207  C  CG    . PRO A 1 434 ? -30.795 -0.169  61.769  1.00 135.89 ? 413 PRO A CG    1 
ATOM   3208  C  CD    . PRO A 1 434 ? -29.820 -0.395  62.854  1.00 134.31 ? 413 PRO A CD    1 
ATOM   3209  N  N     . PHE A 1 435 ? -28.244 -1.925  59.845  1.00 133.20 ? 414 PHE A N     1 
ATOM   3210  C  CA    . PHE A 1 435 ? -27.632 -1.845  58.537  1.00 119.25 ? 414 PHE A CA    1 
ATOM   3211  C  C     . PHE A 1 435 ? -26.488 -2.837  58.319  1.00 114.74 ? 414 PHE A C     1 
ATOM   3212  O  O     . PHE A 1 435 ? -25.671 -2.624  57.422  1.00 118.52 ? 414 PHE A O     1 
ATOM   3213  C  CB    . PHE A 1 435 ? -27.204 -0.427  58.354  1.00 119.26 ? 414 PHE A CB    1 
ATOM   3214  C  CG    . PHE A 1 435 ? -28.309 0.543   58.639  1.00 138.26 ? 414 PHE A CG    1 
ATOM   3215  C  CD1   . PHE A 1 435 ? -29.331 0.726   57.723  1.00 134.57 ? 414 PHE A CD1   1 
ATOM   3216  C  CD2   . PHE A 1 435 ? -28.352 1.242   59.837  1.00 126.66 ? 414 PHE A CD2   1 
ATOM   3217  C  CE1   . PHE A 1 435 ? -30.333 1.641   57.966  1.00 131.30 ? 414 PHE A CE1   1 
ATOM   3218  C  CE2   . PHE A 1 435 ? -29.349 2.160   60.075  1.00 131.35 ? 414 PHE A CE2   1 
ATOM   3219  C  CZ    . PHE A 1 435 ? -30.345 2.350   59.148  1.00 133.70 ? 414 PHE A CZ    1 
ATOM   3220  N  N     . HIS A 1 436 ? -26.365 -3.867  59.165  1.00 124.76 ? 415 HIS A N     1 
ATOM   3221  C  CA    . HIS A 1 436 ? -25.314 -4.871  59.013  1.00 113.09 ? 415 HIS A CA    1 
ATOM   3222  C  C     . HIS A 1 436 ? -25.553 -5.800  57.824  1.00 123.35 ? 415 HIS A C     1 
ATOM   3223  O  O     . HIS A 1 436 ? -26.535 -6.559  57.764  1.00 111.61 ? 415 HIS A O     1 
ATOM   3224  C  CB    . HIS A 1 436 ? -25.198 -5.684  60.290  1.00 112.27 ? 415 HIS A CB    1 
ATOM   3225  C  CG    . HIS A 1 436 ? -24.427 -4.993  61.359  1.00 112.60 ? 415 HIS A CG    1 
ATOM   3226  N  ND1   . HIS A 1 436 ? -23.054 -5.021  61.410  1.00 137.40 ? 415 HIS A ND1   1 
ATOM   3227  C  CD2   . HIS A 1 436 ? -24.826 -4.233  62.401  1.00 116.01 ? 415 HIS A CD2   1 
ATOM   3228  C  CE1   . HIS A 1 436 ? -22.640 -4.330  62.456  1.00 140.34 ? 415 HIS A CE1   1 
ATOM   3229  N  NE2   . HIS A 1 436 ? -23.697 -3.838  63.073  1.00 114.92 ? 415 HIS A NE2   1 
ATOM   3230  N  N     . SER A 1 437 ? -24.608 -5.741  56.890  1.00 106.93 ? 416 SER A N     1 
ATOM   3231  C  CA    . SER A 1 437 ? -24.520 -6.640  55.756  1.00 117.10 ? 416 SER A CA    1 
ATOM   3232  C  C     . SER A 1 437 ? -23.818 -7.943  56.089  1.00 101.81 ? 416 SER A C     1 
ATOM   3233  O  O     . SER A 1 437 ? -23.962 -8.920  55.355  1.00 101.01 ? 416 SER A O     1 
ATOM   3234  C  CB    . SER A 1 437 ? -23.856 -5.885  54.604  1.00 101.42 ? 416 SER A CB    1 
ATOM   3235  O  OG    . SER A 1 437 ? -22.619 -5.341  55.005  1.00 126.81 ? 416 SER A OG    1 
ATOM   3236  N  N     . ALA A 1 438 ? -22.989 -7.954  57.113  1.00 101.14 ? 417 ALA A N     1 
ATOM   3237  C  CA    . ALA A 1 438 ? -22.391 -9.183  57.605  1.00 100.16 ? 417 ALA A CA    1 
ATOM   3238  C  C     . ALA A 1 438 ? -22.128 -9.010  59.087  1.00 101.93 ? 417 ALA A C     1 
ATOM   3239  O  O     . ALA A 1 438 ? -22.026 -7.880  59.572  1.00 102.80 ? 417 ALA A O     1 
ATOM   3240  C  CB    . ALA A 1 438 ? -21.103 -9.524  56.844  1.00 107.58 ? 417 ALA A CB    1 
ATOM   3241  N  N     . PRO A 1 439 ? -22.018 -10.085 59.838  1.00 102.88 ? 418 PRO A N     1 
ATOM   3242  C  CA    . PRO A 1 439 ? -21.679 -9.931  61.251  1.00 104.88 ? 418 PRO A CA    1 
ATOM   3243  C  C     . PRO A 1 439 ? -20.387 -9.161  61.411  1.00 102.80 ? 418 PRO A C     1 
ATOM   3244  O  O     . PRO A 1 439 ? -19.551 -9.132  60.520  1.00 99.59  ? 418 PRO A O     1 
ATOM   3245  C  CB    . PRO A 1 439 ? -21.556 -11.374 61.753  1.00 105.77 ? 418 PRO A CB    1 
ATOM   3246  C  CG    . PRO A 1 439 ? -21.442 -12.220 60.514  1.00 103.17 ? 418 PRO A CG    1 
ATOM   3247  C  CD    . PRO A 1 439 ? -22.248 -11.488 59.480  1.00 102.77 ? 418 PRO A CD    1 
ATOM   3248  N  N     . ALA A 1 440 ? -20.253 -8.481  62.536  1.00 105.01 ? 419 ALA A N     1 
ATOM   3249  C  CA    . ALA A 1 440 ? -19.054 -7.689  62.740  1.00 103.61 ? 419 ALA A CA    1 
ATOM   3250  C  C     . ALA A 1 440 ? -17.860 -8.562  63.053  1.00 102.41 ? 419 ALA A C     1 
ATOM   3251  O  O     . ALA A 1 440 ? -16.724 -8.133  62.856  1.00 114.02 ? 419 ALA A O     1 
ATOM   3252  C  CB    . ALA A 1 440 ? -19.254 -6.670  63.852  1.00 127.14 ? 419 ALA A CB    1 
ATOM   3253  N  N     . ASP A 1 441 ? -18.081 -9.766  63.549  1.00 103.82 ? 420 ASP A N     1 
ATOM   3254  C  CA    . ASP A 1 441 ? -16.984 -10.635 63.943  1.00 103.41 ? 420 ASP A CA    1 
ATOM   3255  C  C     . ASP A 1 441 ? -16.527 -11.544 62.817  1.00 100.28 ? 420 ASP A C     1 
ATOM   3256  O  O     . ASP A 1 441 ? -15.778 -12.486 63.075  1.00 108.50 ? 420 ASP A O     1 
ATOM   3257  C  CB    . ASP A 1 441 ? -17.338 -11.415 65.240  1.00 129.21 ? 420 ASP A CB    1 
ATOM   3258  C  CG    . ASP A 1 441 ? -18.673 -12.163 65.173  1.00 133.15 ? 420 ASP A CG    1 
ATOM   3259  O  OD1   . ASP A 1 441 ? -19.572 -11.688 64.449  1.00 145.22 ? 420 ASP A OD1   1 
ATOM   3260  O  OD2   . ASP A 1 441 ? -18.871 -13.145 65.937  1.00 112.00 ? 420 ASP A OD2   1 
ATOM   3261  N  N     . LEU A 1 442 ? -16.983 -11.291 61.581  1.00 98.00  ? 421 LEU A N     1 
ATOM   3262  C  CA    . LEU A 1 442 ? -16.801 -12.229 60.464  1.00 95.59  ? 421 LEU A CA    1 
ATOM   3263  C  C     . LEU A 1 442 ? -15.359 -12.653 60.245  1.00 93.60  ? 421 LEU A C     1 
ATOM   3264  O  O     . LEU A 1 442 ? -15.085 -13.843 60.074  1.00 97.87  ? 421 LEU A O     1 
ATOM   3265  C  CB    . LEU A 1 442 ? -17.349 -11.635 59.175  1.00 93.72  ? 421 LEU A CB    1 
ATOM   3266  C  CG    . LEU A 1 442 ? -17.294 -12.622 58.035  1.00 91.80  ? 421 LEU A CG    1 
ATOM   3267  C  CD1   . LEU A 1 442 ? -18.004 -13.842 58.491  1.00 93.91  ? 421 LEU A CD1   1 
ATOM   3268  C  CD2   . LEU A 1 442 ? -18.132 -12.021 56.981  1.00 91.25  ? 421 LEU A CD2   1 
ATOM   3269  N  N     . HIS A 1 443 ? -14.421 -11.721 60.256  1.00 95.53  ? 422 HIS A N     1 
ATOM   3270  C  CA    . HIS A 1 443 ? -13.045 -12.133 60.044  1.00 91.12  ? 422 HIS A CA    1 
ATOM   3271  C  C     . HIS A 1 443 ? -12.361 -12.488 61.344  1.00 93.56  ? 422 HIS A C     1 
ATOM   3272  O  O     . HIS A 1 443 ? -11.197 -12.898 61.301  1.00 93.06  ? 422 HIS A O     1 
ATOM   3273  C  CB    . HIS A 1 443 ? -12.223 -11.032 59.382  1.00 89.19  ? 422 HIS A CB    1 
ATOM   3274  C  CG    . HIS A 1 443 ? -12.708 -10.624 58.029  1.00 96.03  ? 422 HIS A CG    1 
ATOM   3275  N  ND1   . HIS A 1 443 ? -13.046 -11.532 57.043  1.00 91.29  ? 422 HIS A ND1   1 
ATOM   3276  C  CD2   . HIS A 1 443 ? -12.864 -9.391  57.486  1.00 99.15  ? 422 HIS A CD2   1 
ATOM   3277  C  CE1   . HIS A 1 443 ? -13.410 -10.867 55.956  1.00 111.93 ? 422 HIS A CE1   1 
ATOM   3278  N  NE2   . HIS A 1 443 ? -13.308 -9.569  56.199  1.00 109.03 ? 422 HIS A NE2   1 
ATOM   3279  N  N     . SER A 1 444 ? -13.069 -12.369 62.476  1.00 103.37 ? 423 SER A N     1 
ATOM   3280  C  CA    . SER A 1 444 ? -12.516 -12.664 63.797  1.00 124.65 ? 423 SER A CA    1 
ATOM   3281  C  C     . SER A 1 444 ? -12.168 -14.137 63.923  1.00 100.42 ? 423 SER A C     1 
ATOM   3282  O  O     . SER A 1 444 ? -12.870 -15.013 63.421  1.00 99.95  ? 423 SER A O     1 
ATOM   3283  C  CB    . SER A 1 444 ? -13.491 -12.269 64.909  1.00 168.97 ? 423 SER A CB    1 
ATOM   3284  O  OG    . SER A 1 444 ? -12.976 -12.578 66.195  1.00 186.81 ? 423 SER A OG    1 
ATOM   3285  N  N     . ALA A 1 445 ? -11.109 -14.399 64.680  1.00 102.22 ? 424 ALA A N     1 
ATOM   3286  C  CA    . ALA A 1 445 ? -10.448 -15.680 64.551  1.00 102.51 ? 424 ALA A CA    1 
ATOM   3287  C  C     . ALA A 1 445 ? -11.305 -16.810 65.087  1.00 111.17 ? 424 ALA A C     1 
ATOM   3288  O  O     . ALA A 1 445 ? -11.284 -17.921 64.539  1.00 133.99 ? 424 ALA A O     1 
ATOM   3289  C  CB    . ALA A 1 445 ? -9.097  -15.622 65.255  1.00 143.11 ? 424 ALA A CB    1 
ATOM   3290  N  N     . ASP A 1 446 ? -12.054 -16.562 66.156  1.00 109.12 ? 425 ASP A N     1 
ATOM   3291  C  CA    . ASP A 1 446 ? -12.887 -17.598 66.753  1.00 136.06 ? 425 ASP A CA    1 
ATOM   3292  C  C     . ASP A 1 446 ? -14.342 -17.542 66.277  1.00 129.72 ? 425 ASP A C     1 
ATOM   3293  O  O     . ASP A 1 446 ? -15.169 -18.309 66.784  1.00 164.14 ? 425 ASP A O     1 
ATOM   3294  C  CB    . ASP A 1 446 ? -12.791 -17.562 68.279  1.00 160.36 ? 425 ASP A CB    1 
ATOM   3295  C  CG    . ASP A 1 446 ? -13.305 -16.268 68.866  1.00 209.53 ? 425 ASP A CG    1 
ATOM   3296  O  OD1   . ASP A 1 446 ? -13.765 -15.394 68.102  1.00 209.33 ? 425 ASP A OD1   1 
ATOM   3297  O  OD2   . ASP A 1 446 ? -13.265 -16.135 70.109  1.00 242.66 ? 425 ASP A OD2   1 
ATOM   3298  N  N     . PHE A 1 447 ? -14.656 -16.686 65.293  1.00 107.74 ? 426 PHE A N     1 
ATOM   3299  C  CA    . PHE A 1 447 ? -15.997 -16.529 64.733  1.00 107.11 ? 426 PHE A CA    1 
ATOM   3300  C  C     . PHE A 1 447 ? -16.695 -17.852 64.509  1.00 126.34 ? 426 PHE A C     1 
ATOM   3301  O  O     . PHE A 1 447 ? -17.881 -17.982 64.827  1.00 153.82 ? 426 PHE A O     1 
ATOM   3302  C  CB    . PHE A 1 447 ? -15.882 -15.819 63.388  1.00 118.77 ? 426 PHE A CB    1 
ATOM   3303  C  CG    . PHE A 1 447 ? -17.089 -15.967 62.483  1.00 107.09 ? 426 PHE A CG    1 
ATOM   3304  C  CD1   . PHE A 1 447 ? -18.227 -15.209 62.657  1.00 123.92 ? 426 PHE A CD1   1 
ATOM   3305  C  CD2   . PHE A 1 447 ? -17.059 -16.866 61.428  1.00 106.65 ? 426 PHE A CD2   1 
ATOM   3306  C  CE1   . PHE A 1 447 ? -19.303 -15.341 61.788  1.00 124.29 ? 426 PHE A CE1   1 
ATOM   3307  C  CE2   . PHE A 1 447 ? -18.136 -17.017 60.584  1.00 99.93  ? 426 PHE A CE2   1 
ATOM   3308  C  CZ    . PHE A 1 447 ? -19.254 -16.256 60.758  1.00 101.49 ? 426 PHE A CZ    1 
ATOM   3309  N  N     . ARG A 1 448 ? -15.969 -18.842 63.983  1.00 126.53 ? 427 ARG A N     1 
ATOM   3310  C  CA    . ARG A 1 448 ? -16.553 -20.168 63.822  1.00 137.52 ? 427 ARG A CA    1 
ATOM   3311  C  C     . ARG A 1 448 ? -16.949 -20.735 65.169  1.00 118.97 ? 427 ARG A C     1 
ATOM   3312  O  O     . ARG A 1 448 ? -18.091 -21.159 65.363  1.00 129.41 ? 427 ARG A O     1 
ATOM   3313  C  CB    . ARG A 1 448 ? -15.569 -21.102 63.119  1.00 146.78 ? 427 ARG A CB    1 
ATOM   3314  C  CG    . ARG A 1 448 ? -16.177 -22.241 62.281  1.00 133.08 ? 427 ARG A CG    1 
ATOM   3315  C  CD    . ARG A 1 448 ? -16.393 -23.530 63.071  1.00 126.52 ? 427 ARG A CD    1 
ATOM   3316  N  NE    . ARG A 1 448 ? -16.509 -24.678 62.170  1.00 137.24 ? 427 ARG A NE    1 
ATOM   3317  C  CZ    . ARG A 1 448 ? -17.012 -25.863 62.513  1.00 146.86 ? 427 ARG A CZ    1 
ATOM   3318  N  NH1   . ARG A 1 448 ? -17.451 -26.065 63.757  1.00 154.41 ? 427 ARG A NH1   1 
ATOM   3319  N  NH2   . ARG A 1 448 ? -17.063 -26.848 61.612  1.00 127.61 ? 427 ARG A NH2   1 
ATOM   3320  N  N     . GLN A 1 449 ? -16.036 -20.674 66.137  1.00 117.69 ? 428 GLN A N     1 
ATOM   3321  C  CA    . GLN A 1 449 ? -16.257 -21.350 67.408  1.00 145.20 ? 428 GLN A CA    1 
ATOM   3322  C  C     . GLN A 1 449 ? -17.483 -20.802 68.142  1.00 148.28 ? 428 GLN A C     1 
ATOM   3323  O  O     . GLN A 1 449 ? -18.283 -21.583 68.677  1.00 148.54 ? 428 GLN A O     1 
ATOM   3324  C  CB    . GLN A 1 449 ? -14.997 -21.223 68.261  1.00 145.10 ? 428 GLN A CB    1 
ATOM   3325  C  CG    . GLN A 1 449 ? -14.955 -22.128 69.460  1.00 128.75 ? 428 GLN A CG    1 
ATOM   3326  C  CD    . GLN A 1 449 ? -14.025 -21.574 70.494  1.00 149.09 ? 428 GLN A CD    1 
ATOM   3327  O  OE1   . GLN A 1 449 ? -13.628 -20.410 70.409  1.00 147.51 ? 428 GLN A OE1   1 
ATOM   3328  N  NE2   . GLN A 1 449 ? -13.670 -22.389 71.486  1.00 177.21 ? 428 GLN A NE2   1 
ATOM   3329  N  N     . ARG A 1 450 ? -17.669 -19.472 68.153  1.00 130.55 ? 429 ARG A N     1 
ATOM   3330  C  CA    . ARG A 1 450 ? -18.828 -18.880 68.828  1.00 125.59 ? 429 ARG A CA    1 
ATOM   3331  C  C     . ARG A 1 450 ? -20.167 -19.396 68.284  1.00 126.45 ? 429 ARG A C     1 
ATOM   3332  O  O     . ARG A 1 450 ? -21.152 -19.464 69.026  1.00 143.88 ? 429 ARG A O     1 
ATOM   3333  C  CB    . ARG A 1 450 ? -18.762 -17.350 68.799  1.00 134.41 ? 429 ARG A CB    1 
ATOM   3334  C  CG    . ARG A 1 450 ? -17.617 -16.725 69.652  1.00 159.42 ? 429 ARG A CG    1 
ATOM   3335  C  CD    . ARG A 1 450 ? -17.749 -15.183 69.770  1.00 159.03 ? 429 ARG A CD    1 
ATOM   3336  N  NE    . ARG A 1 450 ? -16.479 -14.458 69.708  1.00 144.69 ? 429 ARG A NE    1 
ATOM   3337  C  CZ    . ARG A 1 450 ? -16.104 -13.700 68.677  1.00 144.29 ? 429 ARG A CZ    1 
ATOM   3338  N  NH1   . ARG A 1 450 ? -16.896 -13.566 67.618  1.00 131.41 ? 429 ARG A NH1   1 
ATOM   3339  N  NH2   . ARG A 1 450 ? -14.934 -13.071 68.699  1.00 154.43 ? 429 ARG A NH2   1 
ATOM   3340  N  N     . ARG A 1 451 ? -20.253 -19.712 67.002  1.00 125.18 ? 430 ARG A N     1 
ATOM   3341  C  CA    . ARG A 1 451 ? -21.502 -20.189 66.419  1.00 123.88 ? 430 ARG A CA    1 
ATOM   3342  C  C     . ARG A 1 451 ? -21.545 -21.703 66.283  1.00 125.56 ? 430 ARG A C     1 
ATOM   3343  O  O     . ARG A 1 451 ? -22.494 -22.243 65.689  1.00 126.43 ? 430 ARG A O     1 
ATOM   3344  C  CB    . ARG A 1 451 ? -21.717 -19.524 65.070  1.00 119.55 ? 430 ARG A CB    1 
ATOM   3345  C  CG    . ARG A 1 451 ? -21.585 -18.052 65.214  1.00 118.14 ? 430 ARG A CG    1 
ATOM   3346  C  CD    . ARG A 1 451 ? -21.304 -17.391 63.952  1.00 113.57 ? 430 ARG A CD    1 
ATOM   3347  N  NE    . ARG A 1 451 ? -21.971 -16.107 63.921  1.00 113.77 ? 430 ARG A NE    1 
ATOM   3348  C  CZ    . ARG A 1 451 ? -21.494 -15.020 64.500  1.00 113.59 ? 430 ARG A CZ    1 
ATOM   3349  N  NH1   . ARG A 1 451 ? -20.359 -15.067 65.184  1.00 113.38 ? 430 ARG A NH1   1 
ATOM   3350  N  NH2   . ARG A 1 451 ? -22.168 -13.893 64.403  1.00 114.03 ? 430 ARG A NH2   1 
ATOM   3351  N  N     . ALA A 1 452 ? -20.529 -22.390 66.829  1.00 135.20 ? 431 ALA A N     1 
ATOM   3352  C  CA    . ALA A 1 452 ? -20.246 -23.785 66.498  1.00 134.67 ? 431 ALA A CA    1 
ATOM   3353  C  C     . ALA A 1 452 ? -21.487 -24.644 66.568  1.00 143.08 ? 431 ALA A C     1 
ATOM   3354  O  O     . ALA A 1 452 ? -21.539 -25.713 65.945  1.00 155.52 ? 431 ALA A O     1 
ATOM   3355  C  CB    . ALA A 1 452 ? -19.154 -24.336 67.418  1.00 129.24 ? 431 ALA A CB    1 
ATOM   3356  N  N     . ALA A 1 453 ? -22.467 -24.221 67.361  1.00 140.81 ? 432 ALA A N     1 
ATOM   3357  C  CA    . ALA A 1 453 ? -23.767 -24.865 67.374  1.00 141.44 ? 432 ALA A CA    1 
ATOM   3358  C  C     . ALA A 1 453 ? -24.413 -24.859 65.990  1.00 135.77 ? 432 ALA A C     1 
ATOM   3359  O  O     . ALA A 1 453 ? -24.484 -25.889 65.303  1.00 135.72 ? 432 ALA A O     1 
ATOM   3360  C  CB    . ALA A 1 453 ? -24.677 -24.145 68.378  1.00 142.82 ? 432 ALA A CB    1 
ATOM   3361  N  N     . LEU A 1 454 ? -24.828 -23.675 65.546  1.00 133.44 ? 433 LEU A N     1 
ATOM   3362  C  CA    . LEU A 1 454 ? -25.607 -23.596 64.327  1.00 131.78 ? 433 LEU A CA    1 
ATOM   3363  C  C     . LEU A 1 454 ? -24.766 -24.035 63.147  1.00 133.42 ? 433 LEU A C     1 
ATOM   3364  O  O     . LEU A 1 454 ? -25.322 -24.486 62.141  1.00 141.75 ? 433 LEU A O     1 
ATOM   3365  C  CB    . LEU A 1 454 ? -26.168 -22.183 64.148  1.00 130.66 ? 433 LEU A CB    1 
ATOM   3366  C  CG    . LEU A 1 454 ? -27.276 -21.733 65.117  1.00 135.73 ? 433 LEU A CG    1 
ATOM   3367  C  CD1   . LEU A 1 454 ? -26.762 -21.429 66.516  1.00 137.94 ? 433 LEU A CD1   1 
ATOM   3368  C  CD2   . LEU A 1 454 ? -28.003 -20.536 64.568  1.00 134.75 ? 433 LEU A CD2   1 
ATOM   3369  N  N     . PHE A 1 455 ? -23.433 -23.920 63.261  1.00 124.17 ? 434 PHE A N     1 
ATOM   3370  C  CA    . PHE A 1 455 ? -22.549 -24.398 62.203  1.00 120.26 ? 434 PHE A CA    1 
ATOM   3371  C  C     . PHE A 1 455 ? -22.454 -25.915 62.191  1.00 122.57 ? 434 PHE A C     1 
ATOM   3372  O  O     . PHE A 1 455 ? -22.374 -26.526 61.120  1.00 120.82 ? 434 PHE A O     1 
ATOM   3373  C  CB    . PHE A 1 455 ? -21.162 -23.796 62.347  1.00 116.88 ? 434 PHE A CB    1 
ATOM   3374  C  CG    . PHE A 1 455 ? -20.962 -22.578 61.512  1.00 112.66 ? 434 PHE A CG    1 
ATOM   3375  C  CD1   . PHE A 1 455 ? -20.705 -21.356 62.093  1.00 111.98 ? 434 PHE A CD1   1 
ATOM   3376  C  CD2   . PHE A 1 455 ? -21.006 -22.670 60.125  1.00 109.69 ? 434 PHE A CD2   1 
ATOM   3377  C  CE1   . PHE A 1 455 ? -20.518 -20.241 61.316  1.00 108.46 ? 434 PHE A CE1   1 
ATOM   3378  C  CE2   . PHE A 1 455 ? -20.825 -21.565 59.341  1.00 106.26 ? 434 PHE A CE2   1 
ATOM   3379  C  CZ    . PHE A 1 455 ? -20.583 -20.342 59.936  1.00 109.72 ? 434 PHE A CZ    1 
ATOM   3380  N  N     . GLU A 1 456 ? -22.425 -26.538 63.372  1.00 126.78 ? 435 GLU A N     1 
ATOM   3381  C  CA    . GLU A 1 456 ? -22.494 -27.990 63.414  1.00 129.86 ? 435 GLU A CA    1 
ATOM   3382  C  C     . GLU A 1 456 ? -23.804 -28.480 62.836  1.00 132.17 ? 435 GLU A C     1 
ATOM   3383  O  O     . GLU A 1 456 ? -23.839 -29.549 62.226  1.00 132.88 ? 435 GLU A O     1 
ATOM   3384  C  CB    . GLU A 1 456 ? -22.350 -28.517 64.845  1.00 134.82 ? 435 GLU A CB    1 
ATOM   3385  C  CG    . GLU A 1 456 ? -21.988 -30.033 64.916  1.00 172.36 ? 435 GLU A CG    1 
ATOM   3386  C  CD    . GLU A 1 456 ? -22.404 -30.746 66.244  1.00 190.81 ? 435 GLU A CD    1 
ATOM   3387  O  OE1   . GLU A 1 456 ? -22.533 -30.065 67.281  1.00 215.85 ? 435 GLU A OE1   1 
ATOM   3388  O  OE2   . GLU A 1 456 ? -22.632 -31.989 66.251  1.00 153.94 ? 435 GLU A OE2   1 
ATOM   3389  N  N     . ALA A 1 457 ? -24.880 -27.693 62.983  1.00 143.83 ? 436 ALA A N     1 
ATOM   3390  C  CA    . ALA A 1 457 ? -26.216 -28.066 62.499  1.00 153.85 ? 436 ALA A CA    1 
ATOM   3391  C  C     . ALA A 1 457 ? -26.355 -27.911 60.993  1.00 134.96 ? 436 ALA A C     1 
ATOM   3392  O  O     . ALA A 1 457 ? -26.867 -28.803 60.289  1.00 134.36 ? 436 ALA A O     1 
ATOM   3393  C  CB    . ALA A 1 457 ? -27.269 -27.200 63.190  1.00 163.63 ? 436 ALA A CB    1 
ATOM   3394  N  N     . CYS A 1 458 ? -25.948 -26.743 60.511  1.00 141.05 ? 437 CYS A N     1 
ATOM   3395  C  CA    . CYS A 1 458 ? -26.008 -26.429 59.097  1.00 136.96 ? 437 CYS A CA    1 
ATOM   3396  C  C     . CYS A 1 458 ? -25.036 -27.301 58.306  1.00 136.36 ? 437 CYS A C     1 
ATOM   3397  O  O     . CYS A 1 458 ? -25.399 -27.868 57.270  1.00 133.04 ? 437 CYS A O     1 
ATOM   3398  C  CB    . CYS A 1 458 ? -25.747 -24.936 58.928  1.00 133.32 ? 437 CYS A CB    1 
ATOM   3399  S  SG    . CYS A 1 458 ? -27.185 -23.971 59.518  1.00 149.59 ? 437 CYS A SG    1 
ATOM   3400  N  N     . LEU A 1 459 ? -23.789 -27.419 58.771  1.00 140.54 ? 438 LEU A N     1 
ATOM   3401  C  CA    . LEU A 1 459 ? -22.879 -28.391 58.163  1.00 146.08 ? 438 LEU A CA    1 
ATOM   3402  C  C     . LEU A 1 459 ? -23.364 -29.830 58.361  1.00 156.48 ? 438 LEU A C     1 
ATOM   3403  O  O     . LEU A 1 459 ? -23.030 -30.718 57.567  1.00 153.92 ? 438 LEU A O     1 
ATOM   3404  C  CB    . LEU A 1 459 ? -21.466 -28.204 58.710  1.00 136.53 ? 438 LEU A CB    1 
ATOM   3405  C  CG    . LEU A 1 459 ? -20.943 -26.829 58.286  1.00 112.74 ? 438 LEU A CG    1 
ATOM   3406  C  CD1   . LEU A 1 459 ? -19.551 -26.573 58.839  1.00 110.29 ? 438 LEU A CD1   1 
ATOM   3407  C  CD2   . LEU A 1 459 ? -21.004 -26.638 56.767  1.00 108.98 ? 438 LEU A CD2   1 
ATOM   3408  N  N     . GLY A 1 460 ? -24.135 -30.075 59.420  1.00 163.22 ? 439 GLY A N     1 
ATOM   3409  C  CA    . GLY A 1 460 ? -24.771 -31.372 59.602  1.00 149.96 ? 439 GLY A CA    1 
ATOM   3410  C  C     . GLY A 1 460 ? -25.718 -31.732 58.477  1.00 133.52 ? 439 GLY A C     1 
ATOM   3411  O  O     . GLY A 1 460 ? -25.815 -32.892 58.088  1.00 135.70 ? 439 GLY A O     1 
ATOM   3412  N  N     . ARG A 1 461 ? -26.425 -30.746 57.930  1.00 144.23 ? 440 ARG A N     1 
ATOM   3413  C  CA    . ARG A 1 461 ? -27.323 -31.076 56.821  1.00 141.41 ? 440 ARG A CA    1 
ATOM   3414  C  C     . ARG A 1 461 ? -26.623 -31.701 55.615  1.00 130.49 ? 440 ARG A C     1 
ATOM   3415  O  O     . ARG A 1 461 ? -27.316 -32.114 54.686  1.00 142.27 ? 440 ARG A O     1 
ATOM   3416  C  CB    . ARG A 1 461 ? -28.092 -29.850 56.327  1.00 139.80 ? 440 ARG A CB    1 
ATOM   3417  C  CG    . ARG A 1 461 ? -28.738 -29.006 57.395  1.00 137.70 ? 440 ARG A CG    1 
ATOM   3418  C  CD    . ARG A 1 461 ? -29.772 -28.134 56.746  1.00 134.94 ? 440 ARG A CD    1 
ATOM   3419  N  NE    . ARG A 1 461 ? -30.394 -27.215 57.688  1.00 156.74 ? 440 ARG A NE    1 
ATOM   3420  C  CZ    . ARG A 1 461 ? -31.463 -27.499 58.420  1.00 170.22 ? 440 ARG A CZ    1 
ATOM   3421  N  NH1   . ARG A 1 461 ? -32.040 -28.692 58.332  1.00 146.87 ? 440 ARG A NH1   1 
ATOM   3422  N  NH2   . ARG A 1 461 ? -31.951 -26.578 59.242  1.00 196.46 ? 440 ARG A NH2   1 
ATOM   3423  N  N     . LEU A 1 462 ? -25.295 -31.707 55.540  1.00 126.70 ? 441 LEU A N     1 
ATOM   3424  C  CA    . LEU A 1 462 ? -24.650 -32.452 54.459  1.00 124.90 ? 441 LEU A CA    1 
ATOM   3425  C  C     . LEU A 1 462 ? -24.660 -33.953 54.702  1.00 142.40 ? 441 LEU A C     1 
ATOM   3426  O  O     . LEU A 1 462 ? -24.609 -34.738 53.744  1.00 129.13 ? 441 LEU A O     1 
ATOM   3427  C  CB    . LEU A 1 462 ? -23.200 -32.012 54.255  1.00 126.33 ? 441 LEU A CB    1 
ATOM   3428  C  CG    . LEU A 1 462 ? -22.951 -30.838 53.334  1.00 115.54 ? 441 LEU A CG    1 
ATOM   3429  C  CD1   . LEU A 1 462 ? -24.049 -30.841 52.321  1.00 116.88 ? 441 LEU A CD1   1 
ATOM   3430  C  CD2   . LEU A 1 462 ? -22.890 -29.558 54.100  1.00 113.94 ? 441 LEU A CD2   1 
ATOM   3431  N  N     . GLU A 1 463 ? -24.724 -34.363 55.961  1.00 138.50 ? 442 GLU A N     1 
ATOM   3432  C  CA    . GLU A 1 463 ? -24.567 -35.769 56.285  1.00 152.25 ? 442 GLU A CA    1 
ATOM   3433  C  C     . GLU A 1 463 ? -25.851 -36.568 56.017  1.00 172.88 ? 442 GLU A C     1 
ATOM   3434  O  O     . GLU A 1 463 ? -25.790 -37.620 55.373  1.00 191.03 ? 442 GLU A O     1 
ATOM   3435  C  CB    . GLU A 1 463 ? -24.145 -35.870 57.747  1.00 169.42 ? 442 GLU A CB    1 
ATOM   3436  C  CG    . GLU A 1 463 ? -23.078 -34.836 58.139  1.00 157.98 ? 442 GLU A CG    1 
ATOM   3437  C  CD    . GLU A 1 463 ? -22.653 -34.969 59.601  1.00 180.24 ? 442 GLU A CD    1 
ATOM   3438  O  OE1   . GLU A 1 463 ? -23.544 -35.130 60.477  1.00 189.63 ? 442 GLU A OE1   1 
ATOM   3439  O  OE2   . GLU A 1 463 ? -21.432 -34.911 59.876  1.00 174.42 ? 442 GLU A OE2   1 
ATOM   3440  N  N     . ASP A 1 464 ? -27.019 -36.089 56.484  1.00 167.18 ? 443 ASP A N     1 
ATOM   3441  C  CA    . ASP A 1 464 ? -28.327 -36.520 55.979  1.00 148.27 ? 443 ASP A CA    1 
ATOM   3442  C  C     . ASP A 1 464 ? -28.660 -35.766 54.687  1.00 145.03 ? 443 ASP A C     1 
ATOM   3443  O  O     . ASP A 1 464 ? -27.821 -35.067 54.118  1.00 139.66 ? 443 ASP A O     1 
ATOM   3444  C  CB    . ASP A 1 464 ? -29.400 -36.339 57.037  1.00 153.25 ? 443 ASP A CB    1 
ATOM   3445  C  CG    . ASP A 1 464 ? -29.237 -35.054 57.786  1.00 172.90 ? 443 ASP A CG    1 
ATOM   3446  O  OD1   . ASP A 1 464 ? -28.353 -35.014 58.679  1.00 180.96 ? 443 ASP A OD1   1 
ATOM   3447  O  OD2   . ASP A 1 464 ? -29.933 -34.075 57.454  1.00 183.88 ? 443 ASP A OD2   1 
ATOM   3448  N  N     . GLY A 1 465 ? -29.884 -35.916 54.179  1.00 148.67 ? 444 GLY A N     1 
ATOM   3449  C  CA    . GLY A 1 465 ? -30.214 -35.308 52.886  1.00 146.35 ? 444 GLY A CA    1 
ATOM   3450  C  C     . GLY A 1 465 ? -30.653 -33.847 52.890  1.00 144.30 ? 444 GLY A C     1 
ATOM   3451  O  O     . GLY A 1 465 ? -30.811 -33.253 51.813  1.00 142.18 ? 444 GLY A O     1 
ATOM   3452  N  N     . SER A 1 466 ? -30.855 -33.264 54.073  1.00 145.27 ? 445 SER A N     1 
ATOM   3453  C  CA    . SER A 1 466 ? -31.675 -32.072 54.258  1.00 145.78 ? 445 SER A CA    1 
ATOM   3454  C  C     . SER A 1 466 ? -31.109 -30.811 53.626  1.00 140.13 ? 445 SER A C     1 
ATOM   3455  O  O     . SER A 1 466 ? -31.807 -29.792 53.595  1.00 140.60 ? 445 SER A O     1 
ATOM   3456  C  CB    . SER A 1 466 ? -31.850 -31.840 55.754  1.00 148.20 ? 445 SER A CB    1 
ATOM   3457  O  OG    . SER A 1 466 ? -30.585 -31.672 56.377  1.00 144.34 ? 445 SER A OG    1 
ATOM   3458  N  N     . TYR A 1 467 ? -29.880 -30.845 53.122  1.00 144.78 ? 446 TYR A N     1 
ATOM   3459  C  CA    . TYR A 1 467 ? -29.269 -29.615 52.648  1.00 130.14 ? 446 TYR A CA    1 
ATOM   3460  C  C     . TYR A 1 467 ? -29.935 -29.128 51.372  1.00 130.14 ? 446 TYR A C     1 
ATOM   3461  O  O     . TYR A 1 467 ? -30.139 -27.928 51.201  1.00 128.58 ? 446 TYR A O     1 
ATOM   3462  C  CB    . TYR A 1 467 ? -27.778 -29.829 52.466  1.00 125.54 ? 446 TYR A CB    1 
ATOM   3463  C  CG    . TYR A 1 467 ? -27.354 -30.539 51.211  1.00 124.24 ? 446 TYR A CG    1 
ATOM   3464  C  CD1   . TYR A 1 467 ? -27.051 -31.882 51.202  1.00 126.07 ? 446 TYR A CD1   1 
ATOM   3465  C  CD2   . TYR A 1 467 ? -27.185 -29.824 50.034  1.00 121.27 ? 446 TYR A CD2   1 
ATOM   3466  C  CE1   . TYR A 1 467 ? -26.627 -32.491 50.046  1.00 124.97 ? 446 TYR A CE1   1 
ATOM   3467  C  CE2   . TYR A 1 467 ? -26.765 -30.419 48.887  1.00 120.25 ? 446 TYR A CE2   1 
ATOM   3468  C  CZ    . TYR A 1 467 ? -26.489 -31.748 48.889  1.00 122.05 ? 446 TYR A CZ    1 
ATOM   3469  O  OH    . TYR A 1 467 ? -26.069 -32.301 47.703  1.00 130.34 ? 446 TYR A OH    1 
ATOM   3470  N  N     . ARG A 1 468 ? -30.312 -30.043 50.481  1.00 132.35 ? 447 ARG A N     1 
ATOM   3471  C  CA    . ARG A 1 468 ? -30.920 -29.639 49.218  1.00 132.85 ? 447 ARG A CA    1 
ATOM   3472  C  C     . ARG A 1 468 ? -32.174 -28.804 49.447  1.00 136.20 ? 447 ARG A C     1 
ATOM   3473  O  O     . ARG A 1 468 ? -32.310 -27.718 48.885  1.00 134.59 ? 447 ARG A O     1 
ATOM   3474  C  CB    . ARG A 1 468 ? -31.216 -30.869 48.356  1.00 145.59 ? 447 ARG A CB    1 
ATOM   3475  C  CG    . ARG A 1 468 ? -29.954 -31.636 47.923  1.00 136.76 ? 447 ARG A CG    1 
ATOM   3476  C  CD    . ARG A 1 468 ? -30.239 -32.576 46.752  1.00 142.09 ? 447 ARG A CD    1 
ATOM   3477  N  NE    . ARG A 1 468 ? -29.096 -33.402 46.349  1.00 137.99 ? 447 ARG A NE    1 
ATOM   3478  C  CZ    . ARG A 1 468 ? -28.821 -34.630 46.795  1.00 144.54 ? 447 ARG A CZ    1 
ATOM   3479  N  NH1   . ARG A 1 468 ? -29.609 -35.233 47.682  1.00 139.03 ? 447 ARG A NH1   1 
ATOM   3480  N  NH2   . ARG A 1 468 ? -27.747 -35.268 46.327  1.00 155.06 ? 447 ARG A NH2   1 
ATOM   3481  N  N     . ASP A 1 469 ? -33.117 -29.298 50.248  1.00 141.32 ? 448 ASP A N     1 
ATOM   3482  C  CA    . ASP A 1 469 ? -34.288 -28.485 50.568  1.00 144.89 ? 448 ASP A CA    1 
ATOM   3483  C  C     . ASP A 1 469 ? -33.931 -27.262 51.410  1.00 145.33 ? 448 ASP A C     1 
ATOM   3484  O  O     . ASP A 1 469 ? -34.517 -26.192 51.221  1.00 159.75 ? 448 ASP A O     1 
ATOM   3485  C  CB    . ASP A 1 469 ? -35.351 -29.327 51.264  1.00 151.46 ? 448 ASP A CB    1 
ATOM   3486  C  CG    . ASP A 1 469 ? -36.609 -29.472 50.432  1.00 156.63 ? 448 ASP A CG    1 
ATOM   3487  O  OD1   . ASP A 1 469 ? -36.787 -28.705 49.456  1.00 155.44 ? 448 ASP A OD1   1 
ATOM   3488  O  OD2   . ASP A 1 469 ? -37.418 -30.375 50.752  1.00 174.04 ? 448 ASP A OD2   1 
ATOM   3489  N  N     . ALA A 1 470 ? -32.964 -27.380 52.325  1.00 139.21 ? 449 ALA A N     1 
ATOM   3490  C  CA    . ALA A 1 470 ? -32.683 -26.267 53.235  1.00 137.28 ? 449 ALA A CA    1 
ATOM   3491  C  C     . ALA A 1 470 ? -32.188 -25.046 52.490  1.00 132.80 ? 449 ALA A C     1 
ATOM   3492  O  O     . ALA A 1 470 ? -32.458 -23.908 52.897  1.00 132.69 ? 449 ALA A O     1 
ATOM   3493  C  CB    . ALA A 1 470 ? -31.650 -26.676 54.281  1.00 135.29 ? 449 ALA A CB    1 
ATOM   3494  N  N     . ILE A 1 471 ? -31.445 -25.281 51.418  1.00 129.37 ? 450 ILE A N     1 
ATOM   3495  C  CA    . ILE A 1 471 ? -30.850 -24.229 50.624  1.00 125.18 ? 450 ILE A CA    1 
ATOM   3496  C  C     . ILE A 1 471 ? -31.912 -23.563 49.783  1.00 127.77 ? 450 ILE A C     1 
ATOM   3497  O  O     . ILE A 1 471 ? -31.943 -22.339 49.679  1.00 126.49 ? 450 ILE A O     1 
ATOM   3498  C  CB    . ILE A 1 471 ? -29.730 -24.833 49.771  1.00 121.43 ? 450 ILE A CB    1 
ATOM   3499  C  CG1   . ILE A 1 471 ? -28.491 -25.048 50.614  1.00 118.15 ? 450 ILE A CG1   1 
ATOM   3500  C  CG2   . ILE A 1 471 ? -29.389 -23.960 48.605  1.00 118.57 ? 450 ILE A CG2   1 
ATOM   3501  C  CD1   . ILE A 1 471 ? -27.545 -25.920 49.911  1.00 115.85 ? 450 ILE A CD1   1 
ATOM   3502  N  N     . ARG A 1 472 ? -32.835 -24.334 49.207  1.00 131.99 ? 451 ARG A N     1 
ATOM   3503  C  CA    . ARG A 1 472 ? -33.964 -23.680 48.559  1.00 135.51 ? 451 ARG A CA    1 
ATOM   3504  C  C     . ARG A 1 472 ? -34.816 -22.937 49.576  1.00 138.65 ? 451 ARG A C     1 
ATOM   3505  O  O     . ARG A 1 472 ? -35.459 -21.946 49.223  1.00 140.25 ? 451 ARG A O     1 
ATOM   3506  C  CB    . ARG A 1 472 ? -34.811 -24.679 47.782  1.00 140.05 ? 451 ARG A CB    1 
ATOM   3507  C  CG    . ARG A 1 472 ? -34.097 -25.272 46.620  1.00 137.57 ? 451 ARG A CG    1 
ATOM   3508  C  CD    . ARG A 1 472 ? -34.899 -26.365 45.961  1.00 142.40 ? 451 ARG A CD    1 
ATOM   3509  N  NE    . ARG A 1 472 ? -33.967 -27.395 45.507  1.00 139.89 ? 451 ARG A NE    1 
ATOM   3510  C  CZ    . ARG A 1 472 ? -34.275 -28.663 45.261  1.00 143.15 ? 451 ARG A CZ    1 
ATOM   3511  N  NH1   . ARG A 1 472 ? -35.519 -29.090 45.421  1.00 152.40 ? 451 ARG A NH1   1 
ATOM   3512  N  NH2   . ARG A 1 472 ? -33.328 -29.503 44.859  1.00 140.60 ? 451 ARG A NH2   1 
ATOM   3513  N  N     . CYS A 1 473 ? -34.796 -23.357 50.848  1.00 139.75 ? 452 CYS A N     1 
ATOM   3514  C  CA    . CYS A 1 473 ? -35.563 -22.645 51.872  1.00 142.93 ? 452 CYS A CA    1 
ATOM   3515  C  C     . CYS A 1 473 ? -34.942 -21.293 52.205  1.00 140.45 ? 452 CYS A C     1 
ATOM   3516  O  O     . CYS A 1 473 ? -35.610 -20.247 52.106  1.00 168.00 ? 452 CYS A O     1 
ATOM   3517  C  CB    . CYS A 1 473 ? -35.703 -23.495 53.135  1.00 158.40 ? 452 CYS A CB    1 
ATOM   3518  S  SG    . CYS A 1 473 ? -37.274 -24.445 53.237  1.00 191.40 ? 452 CYS A SG    1 
ATOM   3519  N  N     . ARG A 1 474 ? -33.658 -21.274 52.562  1.00 139.99 ? 453 ARG A N     1 
ATOM   3520  C  CA    . ARG A 1 474 ? -33.056 -19.973 52.793  1.00 130.68 ? 453 ARG A CA    1 
ATOM   3521  C  C     . ARG A 1 474 ? -33.092 -19.140 51.520  1.00 129.18 ? 453 ARG A C     1 
ATOM   3522  O  O     . ARG A 1 474 ? -33.227 -17.922 51.596  1.00 128.95 ? 453 ARG A O     1 
ATOM   3523  C  CB    . ARG A 1 474 ? -31.633 -20.105 53.323  1.00 125.86 ? 453 ARG A CB    1 
ATOM   3524  C  CG    . ARG A 1 474 ? -31.462 -21.080 54.480  1.00 127.40 ? 453 ARG A CG    1 
ATOM   3525  C  CD    . ARG A 1 474 ? -31.976 -20.574 55.802  1.00 130.44 ? 453 ARG A CD    1 
ATOM   3526  N  NE    . ARG A 1 474 ? -31.212 -21.092 56.948  1.00 142.12 ? 453 ARG A NE    1 
ATOM   3527  C  CZ    . ARG A 1 474 ? -31.211 -22.358 57.378  1.00 158.70 ? 453 ARG A CZ    1 
ATOM   3528  N  NH1   . ARG A 1 474 ? -31.913 -23.293 56.744  1.00 150.82 ? 453 ARG A NH1   1 
ATOM   3529  N  NH2   . ARG A 1 474 ? -30.491 -22.697 58.445  1.00 153.44 ? 453 ARG A NH2   1 
ATOM   3530  N  N     . TYR A 1 475 ? -33.063 -19.779 50.346  1.00 128.86 ? 454 TYR A N     1 
ATOM   3531  C  CA    . TYR A 1 475 ? -33.013 -19.040 49.077  1.00 127.62 ? 454 TYR A CA    1 
ATOM   3532  C  C     . TYR A 1 475 ? -34.318 -18.337 48.764  1.00 132.44 ? 454 TYR A C     1 
ATOM   3533  O  O     . TYR A 1 475 ? -34.305 -17.200 48.289  1.00 131.73 ? 454 TYR A O     1 
ATOM   3534  C  CB    . TYR A 1 475 ? -32.673 -19.963 47.913  1.00 126.64 ? 454 TYR A CB    1 
ATOM   3535  C  CG    . TYR A 1 475 ? -32.574 -19.338 46.506  1.00 125.75 ? 454 TYR A CG    1 
ATOM   3536  C  CD1   . TYR A 1 475 ? -33.712 -18.973 45.786  1.00 130.22 ? 454 TYR A CD1   1 
ATOM   3537  C  CD2   . TYR A 1 475 ? -31.342 -19.247 45.849  1.00 121.00 ? 454 TYR A CD2   1 
ATOM   3538  C  CE1   . TYR A 1 475 ? -33.613 -18.462 44.495  1.00 129.92 ? 454 TYR A CE1   1 
ATOM   3539  C  CE2   . TYR A 1 475 ? -31.247 -18.744 44.556  1.00 120.67 ? 454 TYR A CE2   1 
ATOM   3540  C  CZ    . TYR A 1 475 ? -32.386 -18.357 43.891  1.00 125.15 ? 454 TYR A CZ    1 
ATOM   3541  O  OH    . TYR A 1 475 ? -32.281 -17.862 42.621  1.00 125.25 ? 454 TYR A OH    1 
ATOM   3542  N  N     . ARG A 1 476 ? -35.447 -19.043 48.877  1.00 137.72 ? 455 ARG A N     1 
ATOM   3543  C  CA    . ARG A 1 476 ? -36.732 -18.387 48.629  1.00 143.01 ? 455 ARG A CA    1 
ATOM   3544  C  C     . ARG A 1 476 ? -37.010 -17.311 49.677  1.00 143.95 ? 455 ARG A C     1 
ATOM   3545  O  O     . ARG A 1 476 ? -37.510 -16.226 49.342  1.00 145.73 ? 455 ARG A O     1 
ATOM   3546  C  CB    . ARG A 1 476 ? -37.888 -19.402 48.604  1.00 163.02 ? 455 ARG A CB    1 
ATOM   3547  C  CG    . ARG A 1 476 ? -37.703 -20.674 47.758  1.00 179.97 ? 455 ARG A CG    1 
ATOM   3548  C  CD    . ARG A 1 476 ? -38.060 -20.499 46.291  1.00 193.07 ? 455 ARG A CD    1 
ATOM   3549  N  NE    . ARG A 1 476 ? -38.607 -21.726 45.705  1.00 189.62 ? 455 ARG A NE    1 
ATOM   3550  C  CZ    . ARG A 1 476 ? -37.888 -22.672 45.102  1.00 181.24 ? 455 ARG A CZ    1 
ATOM   3551  N  NH1   . ARG A 1 476 ? -36.565 -22.560 44.996  1.00 145.55 ? 455 ARG A NH1   1 
ATOM   3552  N  NH2   . ARG A 1 476 ? -38.503 -23.737 44.602  1.00 170.31 ? 455 ARG A NH2   1 
ATOM   3553  N  N     . ASP A 1 477 ? -36.687 -17.596 50.955  1.00 143.11 ? 456 ASP A N     1 
ATOM   3554  C  CA    . ASP A 1 477 ? -37.064 -16.683 52.038  1.00 144.94 ? 456 ASP A CA    1 
ATOM   3555  C  C     . ASP A 1 477 ? -36.187 -15.438 52.039  1.00 144.69 ? 456 ASP A C     1 
ATOM   3556  O  O     . ASP A 1 477 ? -36.687 -14.309 52.141  1.00 165.40 ? 456 ASP A O     1 
ATOM   3557  C  CB    . ASP A 1 477 ? -36.989 -17.388 53.399  1.00 153.89 ? 456 ASP A CB    1 
ATOM   3558  C  CG    . ASP A 1 477 ? -37.763 -16.639 54.501  1.00 187.55 ? 456 ASP A CG    1 
ATOM   3559  O  OD1   . ASP A 1 477 ? -37.627 -15.398 54.621  1.00 190.63 ? 456 ASP A OD1   1 
ATOM   3560  O  OD2   . ASP A 1 477 ? -38.519 -17.299 55.252  1.00 197.05 ? 456 ASP A OD2   1 
ATOM   3561  N  N     . LYS A 1 478 ? -34.878 -15.626 51.935  1.00 134.83 ? 457 LYS A N     1 
ATOM   3562  C  CA    . LYS A 1 478 ? -33.911 -14.561 52.119  1.00 130.60 ? 457 LYS A CA    1 
ATOM   3563  C  C     . LYS A 1 478 ? -33.477 -13.871 50.815  1.00 128.05 ? 457 LYS A C     1 
ATOM   3564  O  O     . LYS A 1 478 ? -32.569 -13.041 50.862  1.00 124.41 ? 457 LYS A O     1 
ATOM   3565  C  CB    . LYS A 1 478 ? -32.700 -15.116 52.872  1.00 126.47 ? 457 LYS A CB    1 
ATOM   3566  C  CG    . LYS A 1 478 ? -32.967 -15.689 54.279  1.00 128.93 ? 457 LYS A CG    1 
ATOM   3567  C  CD    . LYS A 1 478 ? -33.388 -14.637 55.311  1.00 131.24 ? 457 LYS A CD    1 
ATOM   3568  C  CE    . LYS A 1 478 ? -33.287 -15.197 56.746  1.00 132.78 ? 457 LYS A CE    1 
ATOM   3569  N  NZ    . LYS A 1 478 ? -33.812 -14.355 57.875  1.00 136.05 ? 457 LYS A NZ    1 
ATOM   3570  N  N     . PHE A 1 479 ? -34.099 -14.175 49.666  1.00 130.26 ? 458 PHE A N     1 
ATOM   3571  C  CA    . PHE A 1 479 ? -33.644 -13.654 48.366  1.00 128.15 ? 458 PHE A CA    1 
ATOM   3572  C  C     . PHE A 1 479 ? -33.491 -12.143 48.355  1.00 127.58 ? 458 PHE A C     1 
ATOM   3573  O  O     . PHE A 1 479 ? -34.450 -11.403 48.582  1.00 131.67 ? 458 PHE A O     1 
ATOM   3574  C  CB    . PHE A 1 479 ? -34.620 -14.054 47.256  1.00 132.29 ? 458 PHE A CB    1 
ATOM   3575  C  CG    . PHE A 1 479 ? -34.124 -13.765 45.849  1.00 130.50 ? 458 PHE A CG    1 
ATOM   3576  C  CD1   . PHE A 1 479 ? -33.398 -14.700 45.136  1.00 127.77 ? 458 PHE A CD1   1 
ATOM   3577  C  CD2   . PHE A 1 479 ? -34.419 -12.574 45.231  1.00 132.08 ? 458 PHE A CD2   1 
ATOM   3578  C  CE1   . PHE A 1 479 ? -32.957 -14.433 43.841  1.00 126.59 ? 458 PHE A CE1   1 
ATOM   3579  C  CE2   . PHE A 1 479 ? -33.985 -12.323 43.947  1.00 130.99 ? 458 PHE A CE2   1 
ATOM   3580  C  CZ    . PHE A 1 479 ? -33.259 -13.250 43.255  1.00 128.27 ? 458 PHE A CZ    1 
ATOM   3581  N  N     . GLY A 1 480 ? -32.302 -11.696 47.975  1.00 122.94 ? 459 GLY A N     1 
ATOM   3582  C  CA    . GLY A 1 480 ? -32.013 -10.298 47.816  1.00 122.20 ? 459 GLY A CA    1 
ATOM   3583  C  C     . GLY A 1 480 ? -31.430 -9.622  49.034  1.00 120.22 ? 459 GLY A C     1 
ATOM   3584  O  O     . GLY A 1 480 ? -30.841 -8.546  48.899  1.00 137.01 ? 459 GLY A O     1 
ATOM   3585  N  N     . LEU A 1 481 ? -31.582 -10.207 50.214  1.00 120.78 ? 460 LEU A N     1 
ATOM   3586  C  CA    . LEU A 1 481 ? -31.056 -9.572  51.408  1.00 119.43 ? 460 LEU A CA    1 
ATOM   3587  C  C     . LEU A 1 481 ? -29.550 -9.485  51.323  1.00 114.13 ? 460 LEU A C     1 
ATOM   3588  O  O     . LEU A 1 481 ? -28.896 -10.345 50.731  1.00 111.60 ? 460 LEU A O     1 
ATOM   3589  C  CB    . LEU A 1 481 ? -31.472 -10.319 52.656  1.00 121.40 ? 460 LEU A CB    1 
ATOM   3590  C  CG    . LEU A 1 481 ? -32.876 -9.981  53.107  1.00 127.07 ? 460 LEU A CG    1 
ATOM   3591  C  CD1   . LEU A 1 481 ? -33.933 -10.536 52.180  1.00 130.62 ? 460 LEU A CD1   1 
ATOM   3592  C  CD2   . LEU A 1 481 ? -33.020 -10.537 54.489  1.00 131.45 ? 460 LEU A CD2   1 
ATOM   3593  N  N     . GLN A 1 482 ? -29.009 -8.402  51.854  1.00 125.54 ? 461 GLN A N     1 
ATOM   3594  C  CA    . GLN A 1 482 ? -27.572 -8.208  51.797  1.00 132.74 ? 461 GLN A CA    1 
ATOM   3595  C  C     . GLN A 1 482 ? -26.885 -9.148  52.768  1.00 106.57 ? 461 GLN A C     1 
ATOM   3596  O  O     . GLN A 1 482 ? -27.277 -9.216  53.943  1.00 108.61 ? 461 GLN A O     1 
ATOM   3597  C  CB    . GLN A 1 482 ? -27.238 -6.751  52.097  1.00 149.89 ? 461 GLN A CB    1 
ATOM   3598  C  CG    . GLN A 1 482 ? -25.936 -6.282  51.515  1.00 148.62 ? 461 GLN A CG    1 
ATOM   3599  C  CD    . GLN A 1 482 ? -25.956 -4.805  51.383  1.00 146.00 ? 461 GLN A CD    1 
ATOM   3600  O  OE1   . GLN A 1 482 ? -27.037 -4.220  51.375  1.00 146.90 ? 461 GLN A OE1   1 
ATOM   3601  N  NE2   . GLN A 1 482 ? -24.780 -4.177  51.265  1.00 157.44 ? 461 GLN A NE2   1 
ATOM   3602  N  N     . SER A 1 483 ? -25.886 -9.875  52.248  1.00 103.14 ? 462 SER A N     1 
ATOM   3603  C  CA    . SER A 1 483 ? -25.081 -10.878 52.940  1.00 101.22 ? 462 SER A CA    1 
ATOM   3604  C  C     . SER A 1 483 ? -23.672 -10.873 52.356  1.00 97.18  ? 462 SER A C     1 
ATOM   3605  O  O     . SER A 1 483 ? -23.486 -10.590 51.170  1.00 96.04  ? 462 SER A O     1 
ATOM   3606  C  CB    . SER A 1 483 ? -25.655 -12.286 52.779  1.00 102.56 ? 462 SER A CB    1 
ATOM   3607  O  OG    . SER A 1 483 ? -25.150 -12.889 51.597  1.00 100.37 ? 462 SER A OG    1 
ATOM   3608  N  N     . PRO A 1 484 ? -22.691 -11.330 53.127  1.00 95.39  ? 463 PRO A N     1 
ATOM   3609  C  CA    . PRO A 1 484 ? -21.349 -11.375 52.546  1.00 91.97  ? 463 PRO A CA    1 
ATOM   3610  C  C     . PRO A 1 484 ? -21.203 -12.369 51.406  1.00 90.79  ? 463 PRO A C     1 
ATOM   3611  O  O     . PRO A 1 484 ? -20.568 -12.031 50.405  1.00 132.49 ? 463 PRO A O     1 
ATOM   3612  C  CB    . PRO A 1 484 ? -20.476 -11.727 53.756  1.00 91.27  ? 463 PRO A CB    1 
ATOM   3613  C  CG    . PRO A 1 484 ? -21.324 -12.440 54.624  1.00 93.89  ? 463 PRO A CG    1 
ATOM   3614  C  CD    . PRO A 1 484 ? -22.684 -11.813 54.507  1.00 96.68  ? 463 PRO A CD    1 
ATOM   3615  N  N     . PHE A 1 485 ? -21.819 -13.547 51.471  1.00 92.21  ? 464 PHE A N     1 
ATOM   3616  C  CA    . PHE A 1 485 ? -21.465 -14.621 50.543  1.00 91.03  ? 464 PHE A CA    1 
ATOM   3617  C  C     . PHE A 1 485 ? -22.420 -14.890 49.374  1.00 97.04  ? 464 PHE A C     1 
ATOM   3618  O  O     . PHE A 1 485 ? -22.119 -15.748 48.540  1.00 91.85  ? 464 PHE A O     1 
ATOM   3619  C  CB    . PHE A 1 485 ? -21.300 -15.909 51.322  1.00 91.56  ? 464 PHE A CB    1 
ATOM   3620  C  CG    . PHE A 1 485 ? -20.260 -15.821 52.370  1.00 104.94 ? 464 PHE A CG    1 
ATOM   3621  C  CD1   . PHE A 1 485 ? -20.571 -16.009 53.701  1.00 92.30  ? 464 PHE A CD1   1 
ATOM   3622  C  CD2   . PHE A 1 485 ? -18.958 -15.527 52.019  1.00 134.14 ? 464 PHE A CD2   1 
ATOM   3623  C  CE1   . PHE A 1 485 ? -19.613 -15.933 54.660  1.00 91.59  ? 464 PHE A CE1   1 
ATOM   3624  C  CE2   . PHE A 1 485 ? -17.992 -15.445 52.976  1.00 125.90 ? 464 PHE A CE2   1 
ATOM   3625  C  CZ    . PHE A 1 485 ? -18.321 -15.650 54.303  1.00 95.74  ? 464 PHE A CZ    1 
ATOM   3626  N  N     . VAL A 1 486 ? -23.569 -14.257 49.279  1.00 95.25  ? 465 VAL A N     1 
ATOM   3627  C  CA    . VAL A 1 486 ? -24.599 -14.782 48.396  1.00 97.73  ? 465 VAL A CA    1 
ATOM   3628  C  C     . VAL A 1 486 ? -24.778 -13.861 47.212  1.00 97.97  ? 465 VAL A C     1 
ATOM   3629  O  O     . VAL A 1 486 ? -25.269 -12.744 47.366  1.00 99.35  ? 465 VAL A O     1 
ATOM   3630  C  CB    . VAL A 1 486 ? -25.910 -14.982 49.156  1.00 102.38 ? 465 VAL A CB    1 
ATOM   3631  C  CG1   . VAL A 1 486 ? -26.917 -15.701 48.279  1.00 104.51 ? 465 VAL A CG1   1 
ATOM   3632  C  CG2   . VAL A 1 486 ? -25.613 -15.771 50.455  1.00 101.52 ? 465 VAL A CG2   1 
ATOM   3633  N  N     . TYR A 1 487 ? -24.445 -14.329 46.020  1.00 97.15  ? 466 TYR A N     1 
ATOM   3634  C  CA    . TYR A 1 487 ? -24.548 -13.471 44.842  1.00 118.63 ? 466 TYR A CA    1 
ATOM   3635  C  C     . TYR A 1 487 ? -25.857 -13.795 44.148  1.00 113.52 ? 466 TYR A C     1 
ATOM   3636  O  O     . TYR A 1 487 ? -25.903 -14.663 43.273  1.00 119.78 ? 466 TYR A O     1 
ATOM   3637  C  CB    . TYR A 1 487 ? -23.384 -13.725 43.896  1.00 108.30 ? 466 TYR A CB    1 
ATOM   3638  C  CG    . TYR A 1 487 ? -22.054 -13.439 44.538  1.00 121.21 ? 466 TYR A CG    1 
ATOM   3639  C  CD1   . TYR A 1 487 ? -21.594 -12.130 44.710  1.00 124.28 ? 466 TYR A CD1   1 
ATOM   3640  C  CD2   . TYR A 1 487 ? -21.272 -14.475 45.005  1.00 99.76  ? 466 TYR A CD2   1 
ATOM   3641  C  CE1   . TYR A 1 487 ? -20.382 -11.879 45.321  1.00 87.88  ? 466 TYR A CE1   1 
ATOM   3642  C  CE2   . TYR A 1 487 ? -20.074 -14.233 45.608  1.00 86.97  ? 466 TYR A CE2   1 
ATOM   3643  C  CZ    . TYR A 1 487 ? -19.627 -12.943 45.756  1.00 86.69  ? 466 TYR A CZ    1 
ATOM   3644  O  OH    . TYR A 1 487 ? -18.406 -12.731 46.351  1.00 124.27 ? 466 TYR A OH    1 
ATOM   3645  N  N     . TRP A 1 488 ? -26.892 -12.999 44.427  1.00 110.92 ? 467 TRP A N     1 
ATOM   3646  C  CA    . TRP A 1 488 ? -28.203 -13.341 43.885  1.00 113.06 ? 467 TRP A CA    1 
ATOM   3647  C  C     . TRP A 1 488 ? -28.221 -13.096 42.395  1.00 110.18 ? 467 TRP A C     1 
ATOM   3648  O  O     . TRP A 1 488 ? -28.870 -13.833 41.644  1.00 112.87 ? 467 TRP A O     1 
ATOM   3649  C  CB    . TRP A 1 488 ? -29.307 -12.533 44.556  1.00 112.65 ? 467 TRP A CB    1 
ATOM   3650  C  CG    . TRP A 1 488 ? -29.317 -12.584 46.026  1.00 112.15 ? 467 TRP A CG    1 
ATOM   3651  C  CD1   . TRP A 1 488 ? -28.908 -11.610 46.864  1.00 110.76 ? 467 TRP A CD1   1 
ATOM   3652  C  CD2   . TRP A 1 488 ? -29.737 -13.667 46.843  1.00 113.39 ? 467 TRP A CD2   1 
ATOM   3653  N  NE1   . TRP A 1 488 ? -29.071 -11.997 48.159  1.00 111.17 ? 467 TRP A NE1   1 
ATOM   3654  C  CE2   . TRP A 1 488 ? -29.572 -13.267 48.176  1.00 112.79 ? 467 TRP A CE2   1 
ATOM   3655  C  CE3   . TRP A 1 488 ? -30.245 -14.943 46.579  1.00 123.50 ? 467 TRP A CE3   1 
ATOM   3656  C  CZ2   . TRP A 1 488 ? -29.896 -14.093 49.252  1.00 116.43 ? 467 TRP A CZ2   1 
ATOM   3657  C  CZ3   . TRP A 1 488 ? -30.571 -15.769 47.653  1.00 116.60 ? 467 TRP A CZ3   1 
ATOM   3658  C  CH2   . TRP A 1 488 ? -30.394 -15.338 48.971  1.00 116.04 ? 467 TRP A CH2   1 
ATOM   3659  N  N     . GLU A 1 489 ? -27.482 -12.071 41.973  1.00 117.19 ? 468 GLU A N     1 
ATOM   3660  C  CA    . GLU A 1 489 ? -27.269 -11.787 40.566  1.00 140.94 ? 468 GLU A CA    1 
ATOM   3661  C  C     . GLU A 1 489 ? -26.848 -13.046 39.825  1.00 121.44 ? 468 GLU A C     1 
ATOM   3662  O  O     . GLU A 1 489 ? -27.360 -13.344 38.739  1.00 133.69 ? 468 GLU A O     1 
ATOM   3663  C  CB    . GLU A 1 489 ? -26.176 -10.708 40.447  1.00 189.03 ? 468 GLU A CB    1 
ATOM   3664  C  CG    . GLU A 1 489 ? -24.935 -10.976 41.391  1.00 206.75 ? 468 GLU A CG    1 
ATOM   3665  C  CD    . GLU A 1 489 ? -23.758 -9.984  41.233  1.00 205.44 ? 468 GLU A CD    1 
ATOM   3666  O  OE1   . GLU A 1 489 ? -23.849 -9.063  40.392  1.00 216.82 ? 468 GLU A OE1   1 
ATOM   3667  O  OE2   . GLU A 1 489 ? -22.737 -10.125 41.954  1.00 180.30 ? 468 GLU A OE2   1 
ATOM   3668  N  N     . LEU A 1 490 ? -25.941 -13.820 40.423  1.00 122.81 ? 469 LEU A N     1 
ATOM   3669  C  CA    . LEU A 1 490 ? -25.346 -14.949 39.730  1.00 113.11 ? 469 LEU A CA    1 
ATOM   3670  C  C     . LEU A 1 490 ? -26.260 -16.169 39.721  1.00 129.00 ? 469 LEU A C     1 
ATOM   3671  O  O     . LEU A 1 490 ? -26.273 -16.935 38.741  1.00 111.25 ? 469 LEU A O     1 
ATOM   3672  C  CB    . LEU A 1 490 ? -24.037 -15.349 40.412  1.00 99.00  ? 469 LEU A CB    1 
ATOM   3673  C  CG    . LEU A 1 490 ? -22.991 -15.844 39.433  1.00 97.21  ? 469 LEU A CG    1 
ATOM   3674  C  CD1   . LEU A 1 490 ? -22.737 -14.708 38.393  1.00 100.89 ? 469 LEU A CD1   1 
ATOM   3675  C  CD2   . LEU A 1 490 ? -21.757 -16.288 40.145  1.00 96.09  ? 469 LEU A CD2   1 
ATOM   3676  N  N     . LEU A 1 491 ? -27.036 -16.344 40.790  1.00 107.55 ? 470 LEU A N     1 
ATOM   3677  C  CA    . LEU A 1 491 ? -27.611 -17.634 41.134  1.00 109.38 ? 470 LEU A CA    1 
ATOM   3678  C  C     . LEU A 1 491 ? -29.036 -17.655 40.599  1.00 142.31 ? 470 LEU A C     1 
ATOM   3679  O  O     . LEU A 1 491 ? -29.969 -17.183 41.257  1.00 148.53 ? 470 LEU A O     1 
ATOM   3680  C  CB    . LEU A 1 491 ? -27.566 -17.796 42.649  1.00 108.25 ? 470 LEU A CB    1 
ATOM   3681  C  CG    . LEU A 1 491 ? -27.691 -19.075 43.459  1.00 108.79 ? 470 LEU A CG    1 
ATOM   3682  C  CD1   . LEU A 1 491 ? -26.685 -20.130 43.037  1.00 106.38 ? 470 LEU A CD1   1 
ATOM   3683  C  CD2   . LEU A 1 491 ? -27.536 -18.698 44.921  1.00 107.63 ? 470 LEU A CD2   1 
ATOM   3684  N  N     . GLY A 1 492 ? -29.207 -18.273 39.416  1.00 137.12 ? 471 GLY A N     1 
ATOM   3685  C  CA    . GLY A 1 492 ? -30.513 -18.449 38.817  1.00 126.85 ? 471 GLY A CA    1 
ATOM   3686  C  C     . GLY A 1 492 ? -31.123 -19.736 39.258  1.00 124.68 ? 471 GLY A C     1 
ATOM   3687  O  O     . GLY A 1 492 ? -30.438 -20.572 39.845  1.00 136.98 ? 471 GLY A O     1 
ATOM   3688  N  N     . GLU A 1 493 ? -32.413 -19.907 38.965  1.00 129.88 ? 472 GLU A N     1 
ATOM   3689  C  CA    . GLU A 1 493 ? -33.038 -21.162 39.354  1.00 132.71 ? 472 GLU A CA    1 
ATOM   3690  C  C     . GLU A 1 493 ? -32.326 -22.340 38.702  1.00 131.30 ? 472 GLU A C     1 
ATOM   3691  O  O     . GLU A 1 493 ? -31.997 -23.324 39.382  1.00 130.07 ? 472 GLU A O     1 
ATOM   3692  C  CB    . GLU A 1 493 ? -34.527 -21.144 39.008  1.00 159.59 ? 472 GLU A CB    1 
ATOM   3693  C  CG    . GLU A 1 493 ? -35.412 -22.007 39.936  1.00 181.56 ? 472 GLU A CG    1 
ATOM   3694  C  CD    . GLU A 1 493 ? -35.528 -21.461 41.355  1.00 196.19 ? 472 GLU A CD    1 
ATOM   3695  O  OE1   . GLU A 1 493 ? -35.421 -20.223 41.525  1.00 199.98 ? 472 GLU A OE1   1 
ATOM   3696  O  OE2   . GLU A 1 493 ? -35.730 -22.274 42.293  1.00 192.38 ? 472 GLU A OE2   1 
ATOM   3697  N  N     . GLU A 1 494 ? -31.945 -22.192 37.426  1.00 131.19 ? 473 GLU A N     1 
ATOM   3698  C  CA    . GLU A 1 494 ? -31.280 -23.281 36.708  1.00 139.64 ? 473 GLU A CA    1 
ATOM   3699  C  C     . GLU A 1 494 ? -29.964 -23.647 37.365  1.00 136.60 ? 473 GLU A C     1 
ATOM   3700  O  O     . GLU A 1 494 ? -29.663 -24.824 37.557  1.00 124.50 ? 473 GLU A O     1 
ATOM   3701  C  CB    . GLU A 1 494 ? -31.008 -22.894 35.258  1.00 138.08 ? 473 GLU A CB    1 
ATOM   3702  C  CG    . GLU A 1 494 ? -32.220 -22.696 34.439  1.00 178.98 ? 473 GLU A CG    1 
ATOM   3703  C  CD    . GLU A 1 494 ? -32.162 -21.370 33.739  1.00 219.38 ? 473 GLU A CD    1 
ATOM   3704  O  OE1   . GLU A 1 494 ? -31.334 -20.531 34.164  1.00 213.97 ? 473 GLU A OE1   1 
ATOM   3705  O  OE2   . GLU A 1 494 ? -32.945 -21.157 32.788  1.00 249.69 ? 473 GLU A OE2   1 
ATOM   3706  N  N     . LEU A 1 495 ? -29.154 -22.648 37.699  1.00 142.54 ? 474 LEU A N     1 
ATOM   3707  C  CA    . LEU A 1 495 ? -27.879 -22.928 38.341  1.00 115.72 ? 474 LEU A CA    1 
ATOM   3708  C  C     . LEU A 1 495 ? -28.061 -23.456 39.762  1.00 115.41 ? 474 LEU A C     1 
ATOM   3709  O  O     . LEU A 1 495 ? -27.311 -24.339 40.184  1.00 113.44 ? 474 LEU A O     1 
ATOM   3710  C  CB    . LEU A 1 495 ? -27.007 -21.683 38.301  1.00 112.01 ? 474 LEU A CB    1 
ATOM   3711  C  CG    . LEU A 1 495 ? -25.722 -21.631 39.117  1.00 107.15 ? 474 LEU A CG    1 
ATOM   3712  C  CD1   . LEU A 1 495 ? -24.705 -22.689 38.766  1.00 105.28 ? 474 LEU A CD1   1 
ATOM   3713  C  CD2   . LEU A 1 495 ? -25.155 -20.255 38.885  1.00 104.90 ? 474 LEU A CD2   1 
ATOM   3714  N  N     . LEU A 1 496 ? -29.022 -22.930 40.528  1.00 117.63 ? 475 LEU A N     1 
ATOM   3715  C  CA    . LEU A 1 496 ? -29.178 -23.427 41.891  1.00 117.71 ? 475 LEU A CA    1 
ATOM   3716  C  C     . LEU A 1 496 ? -29.549 -24.900 41.901  1.00 120.52 ? 475 LEU A C     1 
ATOM   3717  O  O     . LEU A 1 496 ? -28.937 -25.699 42.623  1.00 118.98 ? 475 LEU A O     1 
ATOM   3718  C  CB    . LEU A 1 496 ? -30.210 -22.635 42.672  1.00 120.27 ? 475 LEU A CB    1 
ATOM   3719  C  CG    . LEU A 1 496 ? -30.412 -23.362 44.008  1.00 121.18 ? 475 LEU A CG    1 
ATOM   3720  C  CD1   . LEU A 1 496 ? -29.146 -23.442 44.840  1.00 116.60 ? 475 LEU A CD1   1 
ATOM   3721  C  CD2   . LEU A 1 496 ? -31.534 -22.767 44.819  1.00 124.61 ? 475 LEU A CD2   1 
ATOM   3722  N  N     . GLU A 1 497 ? -30.584 -25.280 41.148  1.00 127.54 ? 476 GLU A N     1 
ATOM   3723  C  CA    . GLU A 1 497 ? -30.961 -26.693 41.174  1.00 128.25 ? 476 GLU A CA    1 
ATOM   3724  C  C     . GLU A 1 497 ? -30.035 -27.573 40.334  1.00 126.51 ? 476 GLU A C     1 
ATOM   3725  O  O     . GLU A 1 497 ? -29.805 -28.718 40.716  1.00 134.42 ? 476 GLU A O     1 
ATOM   3726  C  CB    . GLU A 1 497 ? -32.442 -26.876 40.800  1.00 134.51 ? 476 GLU A CB    1 
ATOM   3727  C  CG    . GLU A 1 497 ? -33.327 -27.060 42.074  1.00 137.62 ? 476 GLU A CG    1 
ATOM   3728  C  CD    . GLU A 1 497 ? -34.627 -26.216 42.124  1.00 152.18 ? 476 GLU A CD    1 
ATOM   3729  O  OE1   . GLU A 1 497 ? -34.581 -24.965 42.103  1.00 140.33 ? 476 GLU A OE1   1 
ATOM   3730  O  OE2   . GLU A 1 497 ? -35.713 -26.817 42.269  1.00 186.79 ? 476 GLU A OE2   1 
ATOM   3731  N  N     . GLN A 1 498 ? -29.423 -27.068 39.259  1.00 124.46 ? 477 GLN A N     1 
ATOM   3732  C  CA    . GLN A 1 498 ? -28.395 -27.866 38.588  1.00 122.49 ? 477 GLN A CA    1 
ATOM   3733  C  C     . GLN A 1 498 ? -27.253 -28.186 39.540  1.00 118.34 ? 477 GLN A C     1 
ATOM   3734  O  O     . GLN A 1 498 ? -26.806 -29.333 39.632  1.00 134.85 ? 477 GLN A O     1 
ATOM   3735  C  CB    . GLN A 1 498 ? -27.816 -27.150 37.362  1.00 120.83 ? 477 GLN A CB    1 
ATOM   3736  C  CG    . GLN A 1 498 ? -28.630 -27.065 36.069  1.00 127.57 ? 477 GLN A CG    1 
ATOM   3737  C  CD    . GLN A 1 498 ? -27.742 -26.792 34.825  1.00 141.01 ? 477 GLN A CD    1 
ATOM   3738  O  OE1   . GLN A 1 498 ? -26.533 -26.532 34.926  1.00 135.38 ? 477 GLN A OE1   1 
ATOM   3739  N  NE2   . GLN A 1 498 ? -28.353 -26.861 33.650  1.00 148.66 ? 477 GLN A NE2   1 
ATOM   3740  N  N     . ALA A 1 499 ? -26.770 -27.180 40.264  1.00 114.94 ? 478 ALA A N     1 
ATOM   3741  C  CA    . ALA A 1 499 ? -25.672 -27.403 41.192  1.00 111.35 ? 478 ALA A CA    1 
ATOM   3742  C  C     . ALA A 1 499 ? -26.093 -28.319 42.337  1.00 119.46 ? 478 ALA A C     1 
ATOM   3743  O  O     . ALA A 1 499 ? -25.312 -29.171 42.778  1.00 121.95 ? 478 ALA A O     1 
ATOM   3744  C  CB    . ALA A 1 499 ? -25.161 -26.069 41.715  1.00 111.69 ? 478 ALA A CB    1 
ATOM   3745  N  N     . LEU A 1 500 ? -27.309 -28.143 42.855  1.00 116.80 ? 479 LEU A N     1 
ATOM   3746  C  CA    . LEU A 1 500 ? -27.715 -28.925 44.016  1.00 119.11 ? 479 LEU A CA    1 
ATOM   3747  C  C     . LEU A 1 500 ? -27.732 -30.419 43.740  1.00 125.88 ? 479 LEU A C     1 
ATOM   3748  O  O     . LEU A 1 500 ? -27.458 -31.224 44.641  1.00 122.29 ? 479 LEU A O     1 
ATOM   3749  C  CB    . LEU A 1 500 ? -29.081 -28.473 44.469  1.00 122.93 ? 479 LEU A CB    1 
ATOM   3750  C  CG    . LEU A 1 500 ? -28.809 -27.351 45.423  1.00 120.30 ? 479 LEU A CG    1 
ATOM   3751  C  CD1   . LEU A 1 500 ? -30.121 -26.926 45.924  1.00 146.12 ? 479 LEU A CD1   1 
ATOM   3752  C  CD2   . LEU A 1 500 ? -27.959 -27.884 46.559  1.00 118.49 ? 479 LEU A CD2   1 
ATOM   3753  N  N     . ASP A 1 501 ? -28.072 -30.813 42.519  1.00 124.03 ? 480 ASP A N     1 
ATOM   3754  C  CA    . ASP A 1 501 ? -28.100 -32.220 42.170  1.00 126.49 ? 480 ASP A CA    1 
ATOM   3755  C  C     . ASP A 1 501 ? -26.834 -32.740 41.504  1.00 123.60 ? 480 ASP A C     1 
ATOM   3756  O  O     . ASP A 1 501 ? -26.693 -33.959 41.380  1.00 125.66 ? 480 ASP A O     1 
ATOM   3757  C  CB    . ASP A 1 501 ? -29.319 -32.493 41.293  1.00 154.84 ? 480 ASP A CB    1 
ATOM   3758  C  CG    . ASP A 1 501 ? -30.618 -32.425 42.087  1.00 192.39 ? 480 ASP A CG    1 
ATOM   3759  O  OD1   . ASP A 1 501 ? -30.926 -31.354 42.655  1.00 202.84 ? 480 ASP A OD1   1 
ATOM   3760  O  OD2   . ASP A 1 501 ? -31.327 -33.450 42.155  1.00 216.59 ? 480 ASP A OD2   1 
ATOM   3761  N  N     . CYS A 1 502 ? -25.940 -31.874 41.020  1.00 119.39 ? 481 CYS A N     1 
ATOM   3762  C  CA    . CYS A 1 502 ? -24.661 -32.338 40.469  1.00 130.31 ? 481 CYS A CA    1 
ATOM   3763  C  C     . CYS A 1 502 ? -23.461 -32.134 41.399  1.00 117.21 ? 481 CYS A C     1 
ATOM   3764  O  O     . CYS A 1 502 ? -22.348 -32.563 41.055  1.00 110.91 ? 481 CYS A O     1 
ATOM   3765  C  CB    . CYS A 1 502 ? -24.376 -31.659 39.123  1.00 147.36 ? 481 CYS A CB    1 
ATOM   3766  S  SG    . CYS A 1 502 ? -25.452 -32.192 37.760  1.00 170.83 ? 481 CYS A SG    1 
ATOM   3767  N  N     . LEU A 1 503 ? -23.641 -31.452 42.535  1.00 111.73 ? 482 LEU A N     1 
ATOM   3768  C  CA    . LEU A 1 503 ? -22.551 -31.258 43.466  1.00 108.54 ? 482 LEU A CA    1 
ATOM   3769  C  C     . LEU A 1 503 ? -22.699 -32.201 44.630  1.00 110.80 ? 482 LEU A C     1 
ATOM   3770  O  O     . LEU A 1 503 ? -23.712 -32.162 45.352  1.00 113.43 ? 482 LEU A O     1 
ATOM   3771  C  CB    . LEU A 1 503 ? -22.459 -29.834 43.966  1.00 105.80 ? 482 LEU A CB    1 
ATOM   3772  C  CG    . LEU A 1 503 ? -21.957 -28.976 42.828  1.00 103.28 ? 482 LEU A CG    1 
ATOM   3773  C  CD1   . LEU A 1 503 ? -21.908 -27.585 43.313  1.00 101.00 ? 482 LEU A CD1   1 
ATOM   3774  C  CD2   . LEU A 1 503 ? -20.599 -29.454 42.404  1.00 101.07 ? 482 LEU A CD2   1 
ATOM   3775  N  N     . PRO A 1 504 ? -21.688 -33.035 44.823  1.00 110.15 ? 483 PRO A N     1 
ATOM   3776  C  CA    . PRO A 1 504 ? -21.680 -34.026 45.906  1.00 112.63 ? 483 PRO A CA    1 
ATOM   3777  C  C     . PRO A 1 504 ? -21.772 -33.418 47.295  1.00 112.22 ? 483 PRO A C     1 
ATOM   3778  O  O     . PRO A 1 504 ? -21.059 -32.480 47.629  1.00 108.87 ? 483 PRO A O     1 
ATOM   3779  C  CB    . PRO A 1 504 ? -20.323 -34.708 45.718  1.00 111.16 ? 483 PRO A CB    1 
ATOM   3780  C  CG    . PRO A 1 504 ? -20.007 -34.501 44.246  1.00 109.56 ? 483 PRO A CG    1 
ATOM   3781  C  CD    . PRO A 1 504 ? -20.579 -33.196 43.871  1.00 107.87 ? 483 PRO A CD    1 
ATOM   3782  N  N     . ALA A 1 505 ? -22.569 -34.051 48.150  1.00 119.62 ? 484 ALA A N     1 
ATOM   3783  C  CA    . ALA A 1 505 ? -22.684 -33.570 49.520  1.00 116.38 ? 484 ALA A CA    1 
ATOM   3784  C  C     . ALA A 1 505 ? -21.311 -33.488 50.176  1.00 113.76 ? 484 ALA A C     1 
ATOM   3785  O  O     . ALA A 1 505 ? -20.995 -32.507 50.860  1.00 118.23 ? 484 ALA A O     1 
ATOM   3786  C  CB    . ALA A 1 505 ? -23.616 -34.485 50.318  1.00 121.55 ? 484 ALA A CB    1 
ATOM   3787  N  N     . ALA A 1 506 ? -20.461 -34.488 49.935  1.00 114.07 ? 485 ALA A N     1 
ATOM   3788  C  CA    . ALA A 1 506 ? -19.159 -34.537 50.592  1.00 112.45 ? 485 ALA A CA    1 
ATOM   3789  C  C     . ALA A 1 506 ? -18.204 -33.478 50.066  1.00 107.76 ? 485 ALA A C     1 
ATOM   3790  O  O     . ALA A 1 506 ? -17.425 -32.913 50.843  1.00 124.76 ? 485 ALA A O     1 
ATOM   3791  C  CB    . ALA A 1 506 ? -18.548 -35.922 50.432  1.00 158.28 ? 485 ALA A CB    1 
ATOM   3792  N  N     . HIS A 1 507 ? -18.245 -33.179 48.762  1.00 105.89 ? 486 HIS A N     1 
ATOM   3793  C  CA    . HIS A 1 507 ? -17.367 -32.122 48.254  1.00 101.81 ? 486 HIS A CA    1 
ATOM   3794  C  C     . HIS A 1 507 ? -17.781 -30.765 48.789  1.00 100.17 ? 486 HIS A C     1 
ATOM   3795  O  O     . HIS A 1 507 ? -16.929 -29.923 49.095  1.00 97.54  ? 486 HIS A O     1 
ATOM   3796  C  CB    . HIS A 1 507 ? -17.366 -32.086 46.730  1.00 100.70 ? 486 HIS A CB    1 
ATOM   3797  C  CG    . HIS A 1 507 ? -16.825 -33.326 46.106  1.00 105.01 ? 486 HIS A CG    1 
ATOM   3798  N  ND1   . HIS A 1 507 ? -16.660 -33.459 44.745  1.00 101.57 ? 486 HIS A ND1   1 
ATOM   3799  C  CD2   . HIS A 1 507 ? -16.399 -34.487 46.657  1.00 115.66 ? 486 HIS A CD2   1 
ATOM   3800  C  CE1   . HIS A 1 507 ? -16.155 -34.652 44.485  1.00 124.47 ? 486 HIS A CE1   1 
ATOM   3801  N  NE2   . HIS A 1 507 ? -15.990 -35.297 45.627  1.00 131.24 ? 486 HIS A NE2   1 
ATOM   3802  N  N     . LEU A 1 508 ? -19.087 -30.544 48.920  1.00 102.07 ? 487 LEU A N     1 
ATOM   3803  C  CA    . LEU A 1 508 ? -19.559 -29.330 49.560  1.00 101.22 ? 487 LEU A CA    1 
ATOM   3804  C  C     . LEU A 1 508 ? -19.051 -29.273 50.992  1.00 101.60 ? 487 LEU A C     1 
ATOM   3805  O  O     . LEU A 1 508 ? -18.588 -28.227 51.439  1.00 116.17 ? 487 LEU A O     1 
ATOM   3806  C  CB    . LEU A 1 508 ? -21.086 -29.243 49.488  1.00 104.04 ? 487 LEU A CB    1 
ATOM   3807  C  CG    . LEU A 1 508 ? -21.746 -28.877 48.151  1.00 103.86 ? 487 LEU A CG    1 
ATOM   3808  C  CD1   . LEU A 1 508 ? -23.240 -28.944 48.247  1.00 121.54 ? 487 LEU A CD1   1 
ATOM   3809  C  CD2   . LEU A 1 508 ? -21.385 -27.509 47.733  1.00 100.60 ? 487 LEU A CD2   1 
ATOM   3810  N  N     . ARG A 1 509 ? -19.070 -30.394 51.716  1.00 104.59 ? 488 ARG A N     1 
ATOM   3811  C  CA    . ARG A 1 509 ? -18.490 -30.371 53.055  1.00 105.33 ? 488 ARG A CA    1 
ATOM   3812  C  C     . ARG A 1 509 ? -17.041 -29.906 53.008  1.00 102.14 ? 488 ARG A C     1 
ATOM   3813  O  O     . ARG A 1 509 ? -16.629 -29.047 53.791  1.00 101.08 ? 488 ARG A O     1 
ATOM   3814  C  CB    . ARG A 1 509 ? -18.550 -31.758 53.698  1.00 109.29 ? 488 ARG A CB    1 
ATOM   3815  C  CG    . ARG A 1 509 ? -18.040 -31.794 55.151  1.00 110.97 ? 488 ARG A CG    1 
ATOM   3816  C  CD    . ARG A 1 509 ? -18.974 -30.980 56.089  1.00 112.39 ? 488 ARG A CD    1 
ATOM   3817  N  NE    . ARG A 1 509 ? -19.033 -31.549 57.428  1.00 116.39 ? 488 ARG A NE    1 
ATOM   3818  C  CZ    . ARG A 1 509 ? -19.886 -32.505 57.799  1.00 140.47 ? 488 ARG A CZ    1 
ATOM   3819  N  NH1   . ARG A 1 509 ? -19.852 -32.943 59.043  1.00 174.84 ? 488 ARG A NH1   1 
ATOM   3820  N  NH2   . ARG A 1 509 ? -20.739 -33.069 56.936  1.00 121.98 ? 488 ARG A NH2   1 
ATOM   3821  N  N     . ALA A 1 510 ? -16.263 -30.425 52.058  1.00 132.12 ? 489 ALA A N     1 
ATOM   3822  C  CA    . ALA A 1 510 ? -14.850 -30.051 51.966  1.00 98.26  ? 489 ALA A CA    1 
ATOM   3823  C  C     . ALA A 1 510 ? -14.660 -28.557 51.697  1.00 99.56  ? 489 ALA A C     1 
ATOM   3824  O  O     . ALA A 1 510 ? -13.878 -27.887 52.390  1.00 102.70 ? 489 ALA A O     1 
ATOM   3825  C  CB    . ALA A 1 510 ? -14.169 -30.887 50.891  1.00 97.85  ? 489 ALA A CB    1 
ATOM   3826  N  N     . TRP A 1 511 ? -15.329 -28.029 50.657  1.00 108.71 ? 490 TRP A N     1 
ATOM   3827  C  CA    . TRP A 1 511 ? -15.156 -26.620 50.294  1.00 90.76  ? 490 TRP A CA    1 
ATOM   3828  C  C     . TRP A 1 511 ? -15.644 -25.697 51.401  1.00 91.12  ? 490 TRP A C     1 
ATOM   3829  O  O     . TRP A 1 511 ? -14.997 -24.691 51.700  1.00 95.25  ? 490 TRP A O     1 
ATOM   3830  C  CB    . TRP A 1 511 ? -15.898 -26.293 49.008  1.00 90.07  ? 490 TRP A CB    1 
ATOM   3831  C  CG    . TRP A 1 511 ? -15.432 -27.036 47.841  1.00 89.77  ? 490 TRP A CG    1 
ATOM   3832  C  CD1   . TRP A 1 511 ? -14.161 -27.441 47.574  1.00 88.76  ? 490 TRP A CD1   1 
ATOM   3833  C  CD2   . TRP A 1 511 ? -16.248 -27.518 46.771  1.00 112.05 ? 490 TRP A CD2   1 
ATOM   3834  N  NE1   . TRP A 1 511 ? -14.134 -28.142 46.393  1.00 107.57 ? 490 TRP A NE1   1 
ATOM   3835  C  CE2   . TRP A 1 511 ? -15.406 -28.202 45.883  1.00 121.96 ? 490 TRP A CE2   1 
ATOM   3836  C  CE3   . TRP A 1 511 ? -17.615 -27.438 46.480  1.00 105.88 ? 490 TRP A CE3   1 
ATOM   3837  C  CZ2   . TRP A 1 511 ? -15.885 -28.803 44.727  1.00 136.99 ? 490 TRP A CZ2   1 
ATOM   3838  C  CZ3   . TRP A 1 511 ? -18.089 -28.036 45.336  1.00 94.10  ? 490 TRP A CZ3   1 
ATOM   3839  C  CH2   . TRP A 1 511 ? -17.229 -28.706 44.473  1.00 121.48 ? 490 TRP A CH2   1 
ATOM   3840  N  N     . PHE A 1 512 ? -16.793 -26.010 52.016  1.00 93.78  ? 491 PHE A N     1 
ATOM   3841  C  CA    . PHE A 1 512 ? -17.287 -25.138 53.070  1.00 94.51  ? 491 PHE A CA    1 
ATOM   3842  C  C     . PHE A 1 512 ? -16.377 -25.216 54.282  1.00 95.07  ? 491 PHE A C     1 
ATOM   3843  O  O     . PHE A 1 512 ? -16.230 -24.228 54.999  1.00 94.58  ? 491 PHE A O     1 
ATOM   3844  C  CB    . PHE A 1 512 ? -18.708 -25.490 53.514  1.00 97.83  ? 491 PHE A CB    1 
ATOM   3845  C  CG    . PHE A 1 512 ? -19.760 -25.431 52.436  1.00 98.22  ? 491 PHE A CG    1 
ATOM   3846  C  CD1   . PHE A 1 512 ? -19.581 -24.723 51.275  1.00 95.65  ? 491 PHE A CD1   1 
ATOM   3847  C  CD2   . PHE A 1 512 ? -20.963 -26.118 52.607  1.00 101.78 ? 491 PHE A CD2   1 
ATOM   3848  C  CE1   . PHE A 1 512 ? -20.587 -24.709 50.293  1.00 96.67  ? 491 PHE A CE1   1 
ATOM   3849  C  CE2   . PHE A 1 512 ? -21.965 -26.107 51.624  1.00 102.78 ? 491 PHE A CE2   1 
ATOM   3850  C  CZ    . PHE A 1 512 ? -21.778 -25.394 50.469  1.00 100.25 ? 491 PHE A CZ    1 
ATOM   3851  N  N     . GLU A 1 513 ? -15.759 -26.365 54.549  1.00 96.49  ? 492 GLU A N     1 
ATOM   3852  C  CA    . GLU A 1 513 ? -14.823 -26.380 55.668  1.00 97.34  ? 492 GLU A CA    1 
ATOM   3853  C  C     . GLU A 1 513 ? -13.580 -25.549 55.340  1.00 103.03 ? 492 GLU A C     1 
ATOM   3854  O  O     . GLU A 1 513 ? -13.130 -24.758 56.182  1.00 94.24  ? 492 GLU A O     1 
ATOM   3855  C  CB    . GLU A 1 513 ? -14.468 -27.826 56.080  1.00 100.22 ? 492 GLU A CB    1 
ATOM   3856  C  CG    . GLU A 1 513 ? -14.237 -28.035 57.628  1.00 122.80 ? 492 GLU A CG    1 
ATOM   3857  C  CD    . GLU A 1 513 ? -15.234 -28.989 58.354  1.00 157.93 ? 492 GLU A CD    1 
ATOM   3858  O  OE1   . GLU A 1 513 ? -16.123 -29.571 57.689  1.00 166.91 ? 492 GLU A OE1   1 
ATOM   3859  O  OE2   . GLU A 1 513 ? -15.122 -29.153 59.603  1.00 152.15 ? 492 GLU A OE2   1 
ATOM   3860  N  N     . ARG A 1 514 ? -13.065 -25.644 54.094  1.00 105.22 ? 493 ARG A N     1 
ATOM   3861  C  CA    . ARG A 1 514 ? -11.879 -24.869 53.709  1.00 89.51  ? 493 ARG A CA    1 
ATOM   3862  C  C     . ARG A 1 514 ? -12.149 -23.380 53.739  1.00 87.73  ? 493 ARG A C     1 
ATOM   3863  O  O     . ARG A 1 514 ? -11.282 -22.591 54.126  1.00 103.55 ? 493 ARG A O     1 
ATOM   3864  C  CB    . ARG A 1 514 ? -11.382 -25.264 52.315  1.00 93.36  ? 493 ARG A CB    1 
ATOM   3865  C  CG    . ARG A 1 514 ? -10.068 -24.530 51.889  1.00 99.04  ? 493 ARG A CG    1 
ATOM   3866  C  CD    . ARG A 1 514 ? -9.592  -24.857 50.454  1.00 84.41  ? 493 ARG A CD    1 
ATOM   3867  N  NE    . ARG A 1 514 ? -9.057  -23.694 49.726  1.00 82.20  ? 493 ARG A NE    1 
ATOM   3868  C  CZ    . ARG A 1 514 ? -7.785  -23.275 49.752  1.00 98.19  ? 493 ARG A CZ    1 
ATOM   3869  N  NH1   . ARG A 1 514 ? -7.417  -22.207 49.033  1.00 79.77  ? 493 ARG A NH1   1 
ATOM   3870  N  NH2   . ARG A 1 514 ? -6.878  -23.899 50.512  1.00 111.79 ? 493 ARG A NH2   1 
ATOM   3871  N  N     . LEU A 1 515 ? -13.354 -22.984 53.356  1.00 87.59  ? 494 LEU A N     1 
ATOM   3872  C  CA    . LEU A 1 515 ? -13.747 -21.583 53.366  1.00 86.37  ? 494 LEU A CA    1 
ATOM   3873  C  C     . LEU A 1 515 ? -13.686 -20.995 54.771  1.00 87.67  ? 494 LEU A C     1 
ATOM   3874  O  O     . LEU A 1 515 ? -13.343 -19.819 54.951  1.00 86.53  ? 494 LEU A O     1 
ATOM   3875  C  CB    . LEU A 1 515 ? -15.136 -21.487 52.775  1.00 86.92  ? 494 LEU A CB    1 
ATOM   3876  C  CG    . LEU A 1 515 ? -15.424 -20.154 52.206  1.00 85.35  ? 494 LEU A CG    1 
ATOM   3877  C  CD1   . LEU A 1 515 ? -14.209 -19.788 51.498  1.00 83.02  ? 494 LEU A CD1   1 
ATOM   3878  C  CD2   . LEU A 1 515 ? -16.445 -20.445 51.184  1.00 85.87  ? 494 LEU A CD2   1 
ATOM   3879  N  N     . LEU A 1 516 ? -14.079 -21.793 55.772  1.00 90.45  ? 495 LEU A N     1 
ATOM   3880  C  CA    . LEU A 1 516 ? -14.062 -21.395 57.170  1.00 92.43  ? 495 LEU A CA    1 
ATOM   3881  C  C     . LEU A 1 516 ? -12.673 -21.293 57.737  1.00 101.96 ? 495 LEU A C     1 
ATOM   3882  O  O     . LEU A 1 516 ? -12.519 -20.706 58.809  1.00 114.24 ? 495 LEU A O     1 
ATOM   3883  C  CB    . LEU A 1 516 ? -14.849 -22.372 58.018  1.00 95.95  ? 495 LEU A CB    1 
ATOM   3884  C  CG    . LEU A 1 516 ? -16.284 -21.910 58.017  1.00 96.96  ? 495 LEU A CG    1 
ATOM   3885  C  CD1   . LEU A 1 516 ? -17.090 -22.735 58.982  1.00 100.97 ? 495 LEU A CD1   1 
ATOM   3886  C  CD2   . LEU A 1 516 ? -16.351 -20.447 58.366  1.00 96.06  ? 495 LEU A CD2   1 
ATOM   3887  N  N     . GLU A 1 517 ? -11.685 -21.935 57.114  1.00 95.85  ? 496 GLU A N     1 
ATOM   3888  C  CA    . GLU A 1 517 ? -10.366 -21.961 57.737  1.00 108.18 ? 496 GLU A CA    1 
ATOM   3889  C  C     . GLU A 1 517 ? -9.703  -20.588 57.652  1.00 101.54 ? 496 GLU A C     1 
ATOM   3890  O  O     . GLU A 1 517 ? -9.126  -20.114 58.644  1.00 98.01  ? 496 GLU A O     1 
ATOM   3891  C  CB    . GLU A 1 517 ? -9.498  -23.060 57.110  1.00 125.69 ? 496 GLU A CB    1 
ATOM   3892  C  CG    . GLU A 1 517 ? -9.770  -24.462 57.659  1.00 163.10 ? 496 GLU A CG    1 
ATOM   3893  C  CD    . GLU A 1 517 ? -9.193  -25.577 56.777  1.00 163.76 ? 496 GLU A CD    1 
ATOM   3894  O  OE1   . GLU A 1 517 ? -8.489  -25.263 55.791  1.00 157.85 ? 496 GLU A OE1   1 
ATOM   3895  O  OE2   . GLU A 1 517 ? -9.455  -26.772 57.053  1.00 171.38 ? 496 GLU A OE2   1 
ATOM   3896  N  N     . ASP A 1 518 ? -9.788  -19.925 56.492  1.00 87.35  ? 497 ASP A N     1 
ATOM   3897  C  CA    . ASP A 1 518 ? -9.353  -18.533 56.352  1.00 85.82  ? 497 ASP A CA    1 
ATOM   3898  C  C     . ASP A 1 518 ? -10.425 -17.835 55.538  1.00 87.13  ? 497 ASP A C     1 
ATOM   3899  O  O     . ASP A 1 518 ? -10.402 -17.891 54.303  1.00 105.75 ? 497 ASP A O     1 
ATOM   3900  C  CB    . ASP A 1 518 ? -7.988  -18.436 55.631  1.00 102.61 ? 497 ASP A CB    1 
ATOM   3901  C  CG    . ASP A 1 518 ? -7.371  -16.997 55.624  1.00 120.18 ? 497 ASP A CG    1 
ATOM   3902  O  OD1   . ASP A 1 518 ? -6.192  -16.823 55.182  1.00 102.31 ? 497 ASP A OD1   1 
ATOM   3903  O  OD2   . ASP A 1 518 ? -8.057  -16.042 56.039  1.00 131.03 ? 497 ASP A OD2   1 
ATOM   3904  N  N     . ILE A 1 519 ? -11.253 -17.041 56.190  1.00 91.96  ? 498 ILE A N     1 
ATOM   3905  C  CA    . ILE A 1 519 ? -12.365 -16.463 55.452  1.00 94.85  ? 498 ILE A CA    1 
ATOM   3906  C  C     . ILE A 1 519 ? -11.811 -15.452 54.453  1.00 81.96  ? 498 ILE A C     1 
ATOM   3907  O  O     . ILE A 1 519 ? -12.176 -15.524 53.276  1.00 80.75  ? 498 ILE A O     1 
ATOM   3908  C  CB    . ILE A 1 519 ? -13.401 -15.888 56.418  1.00 86.10  ? 498 ILE A CB    1 
ATOM   3909  C  CG1   . ILE A 1 519 ? -13.776 -17.027 57.359  1.00 112.77 ? 498 ILE A CG1   1 
ATOM   3910  C  CG2   . ILE A 1 519 ? -14.621 -15.520 55.680  1.00 85.87  ? 498 ILE A CG2   1 
ATOM   3911  C  CD1   . ILE A 1 519 ? -14.857 -16.722 58.353  1.00 114.75 ? 498 ILE A CD1   1 
ATOM   3912  N  N     . PRO A 1 520 ? -10.937 -14.520 54.830  1.00 81.71  ? 499 PRO A N     1 
ATOM   3913  C  CA    . PRO A 1 520 ? -10.448 -13.577 53.826  1.00 79.99  ? 499 PRO A CA    1 
ATOM   3914  C  C     . PRO A 1 520 ? -9.549  -14.219 52.810  1.00 103.98 ? 499 PRO A C     1 
ATOM   3915  O  O     . PRO A 1 520 ? -9.547  -13.822 51.636  1.00 98.38  ? 499 PRO A O     1 
ATOM   3916  C  CB    . PRO A 1 520 ? -9.661  -12.562 54.641  1.00 96.24  ? 499 PRO A CB    1 
ATOM   3917  C  CG    . PRO A 1 520 ? -9.982  -12.850 56.028  1.00 96.31  ? 499 PRO A CG    1 
ATOM   3918  C  CD    . PRO A 1 520 ? -10.367 -14.237 56.146  1.00 89.76  ? 499 PRO A CD    1 
ATOM   3919  N  N     . GLY A 1 521 ? -8.775  -15.199 53.231  1.00 101.56 ? 500 GLY A N     1 
ATOM   3920  C  CA    . GLY A 1 521 ? -7.795  -15.775 52.349  1.00 106.14 ? 500 GLY A CA    1 
ATOM   3921  C  C     . GLY A 1 521 ? -8.330  -16.880 51.474  1.00 92.58  ? 500 GLY A C     1 
ATOM   3922  O  O     . GLY A 1 521 ? -7.762  -17.162 50.411  1.00 115.19 ? 500 GLY A O     1 
ATOM   3923  N  N     . ASN A 1 522 ? -9.387  -17.548 51.900  1.00 78.98  ? 501 ASN A N     1 
ATOM   3924  C  CA    . ASN A 1 522 ? -9.944  -18.550 51.015  1.00 78.85  ? 501 ASN A CA    1 
ATOM   3925  C  C     . ASN A 1 522 ? -11.209 -18.128 50.257  1.00 78.48  ? 501 ASN A C     1 
ATOM   3926  O  O     . ASN A 1 522 ? -11.743 -18.942 49.521  1.00 78.74  ? 501 ASN A O     1 
ATOM   3927  C  CB    . ASN A 1 522 ? -10.206 -19.843 51.776  1.00 80.66  ? 501 ASN A CB    1 
ATOM   3928  C  CG    . ASN A 1 522 ? -8.969  -20.459 52.238  1.00 81.39  ? 501 ASN A CG    1 
ATOM   3929  O  OD1   . ASN A 1 522 ? -7.902  -20.085 51.789  1.00 80.47  ? 501 ASN A OD1   1 
ATOM   3930  N  ND2   . ASN A 1 522 ? -9.078  -21.417 53.129  1.00 83.45  ? 501 ASN A ND2   1 
ATOM   3931  N  N     . ARG A 1 523 ? -11.732 -16.920 50.386  1.00 82.28  ? 502 ARG A N     1 
ATOM   3932  C  CA    . ARG A 1 523 ? -12.975 -16.799 49.625  1.00 78.56  ? 502 ARG A CA    1 
ATOM   3933  C  C     . ARG A 1 523 ? -12.745 -16.474 48.156  1.00 81.24  ? 502 ARG A C     1 
ATOM   3934  O  O     . ARG A 1 523 ? -13.733 -16.405 47.414  1.00 88.13  ? 502 ARG A O     1 
ATOM   3935  C  CB    . ARG A 1 523 ? -13.964 -15.791 50.270  1.00 82.57  ? 502 ARG A CB    1 
ATOM   3936  C  CG    . ARG A 1 523 ? -13.516 -14.391 50.330  1.00 100.12 ? 502 ARG A CG    1 
ATOM   3937  C  CD    . ARG A 1 523 ? -14.313 -13.485 51.226  1.00 115.61 ? 502 ARG A CD    1 
ATOM   3938  N  NE    . ARG A 1 523 ? -13.336 -12.443 51.532  1.00 171.63 ? 502 ARG A NE    1 
ATOM   3939  C  CZ    . ARG A 1 523 ? -13.509 -11.376 52.300  1.00 167.95 ? 502 ARG A CZ    1 
ATOM   3940  N  NH1   . ARG A 1 523 ? -14.679 -11.142 52.891  1.00 168.99 ? 502 ARG A NH1   1 
ATOM   3941  N  NH2   . ARG A 1 523 ? -12.480 -10.537 52.459  1.00 144.60 ? 502 ARG A NH2   1 
ATOM   3942  N  N     . ALA A 1 524 ? -11.500 -16.304 47.697  1.00 76.33  ? 503 ALA A N     1 
ATOM   3943  C  CA    . ALA A 1 524 ? -11.319 -16.185 46.260  1.00 75.80  ? 503 ALA A CA    1 
ATOM   3944  C  C     . ALA A 1 524 ? -10.222 -17.117 45.790  1.00 93.09  ? 503 ALA A C     1 
ATOM   3945  O  O     . ALA A 1 524 ? -9.521  -17.781 46.578  1.00 92.32  ? 503 ALA A O     1 
ATOM   3946  C  CB    . ALA A 1 524 ? -11.047 -14.757 45.808  1.00 75.33  ? 503 ALA A CB    1 
ATOM   3947  N  N     . GLY A 1 525 ? -10.060 -17.083 44.470  1.00 99.63  ? 504 GLY A N     1 
ATOM   3948  C  CA    . GLY A 1 525 ? -9.193  -17.970 43.729  1.00 113.29 ? 504 GLY A CA    1 
ATOM   3949  C  C     . GLY A 1 525 ? -9.961  -18.935 42.862  1.00 93.19  ? 504 GLY A C     1 
ATOM   3950  O  O     . GLY A 1 525 ? -9.351  -19.683 42.080  1.00 105.56 ? 504 GLY A O     1 
ATOM   3951  N  N     . LEU A 1 526 ? -11.280 -18.935 42.972  1.00 95.23  ? 505 LEU A N     1 
ATOM   3952  C  CA    . LEU A 1 526 ? -12.037 -19.967 42.327  1.00 78.16  ? 505 LEU A CA    1 
ATOM   3953  C  C     . LEU A 1 526 ? -12.068 -19.766 40.822  1.00 78.72  ? 505 LEU A C     1 
ATOM   3954  O  O     . LEU A 1 526 ? -11.756 -18.684 40.304  1.00 94.49  ? 505 LEU A O     1 
ATOM   3955  C  CB    . LEU A 1 526 ? -13.436 -20.072 42.933  1.00 79.31  ? 505 LEU A CB    1 
ATOM   3956  C  CG    . LEU A 1 526 ? -13.496 -21.015 44.148  1.00 79.82  ? 505 LEU A CG    1 
ATOM   3957  C  CD1   . LEU A 1 526 ? -12.581 -20.595 45.239  1.00 78.72  ? 505 LEU A CD1   1 
ATOM   3958  C  CD2   . LEU A 1 526 ? -14.868 -21.098 44.683  1.00 81.38  ? 505 LEU A CD2   1 
ATOM   3959  N  N     . PRO A 1 527 ? -12.397 -20.835 40.113  1.00 80.01  ? 506 PRO A N     1 
ATOM   3960  C  CA    . PRO A 1 527 ? -12.316 -20.841 38.657  1.00 80.99  ? 506 PRO A CA    1 
ATOM   3961  C  C     . PRO A 1 527 ? -13.396 -20.031 37.965  1.00 82.26  ? 506 PRO A C     1 
ATOM   3962  O  O     . PRO A 1 527 ? -14.417 -19.656 38.541  1.00 82.73  ? 506 PRO A O     1 
ATOM   3963  C  CB    . PRO A 1 527 ? -12.449 -22.328 38.324  1.00 82.34  ? 506 PRO A CB    1 
ATOM   3964  C  CG    . PRO A 1 527 ? -11.911 -23.005 39.533  1.00 87.42  ? 506 PRO A CG    1 
ATOM   3965  C  CD    . PRO A 1 527 ? -12.377 -22.196 40.663  1.00 80.62  ? 506 PRO A CD    1 
ATOM   3966  N  N     . ASP A 1 528 ? -13.130 -19.769 36.683  1.00 89.09  ? 507 ASP A N     1 
ATOM   3967  C  CA    . ASP A 1 528 ? -14.011 -18.938 35.871  1.00 103.85 ? 507 ASP A CA    1 
ATOM   3968  C  C     . ASP A 1 528 ? -15.368 -19.605 35.640  1.00 105.05 ? 507 ASP A C     1 
ATOM   3969  O  O     . ASP A 1 528 ? -16.400 -18.918 35.570  1.00 95.77  ? 507 ASP A O     1 
ATOM   3970  C  CB    . ASP A 1 528 ? -13.341 -18.625 34.521  1.00 105.20 ? 507 ASP A CB    1 
ATOM   3971  C  CG    . ASP A 1 528 ? -12.110 -17.741 34.639  1.00 93.17  ? 507 ASP A CG    1 
ATOM   3972  O  OD1   . ASP A 1 528 ? -12.087 -16.861 35.508  1.00 114.24 ? 507 ASP A OD1   1 
ATOM   3973  O  OD2   . ASP A 1 528 ? -11.191 -17.880 33.800  1.00 84.92  ? 507 ASP A OD2   1 
ATOM   3974  N  N     . LEU A 1 529 ? -15.374 -20.933 35.471  1.00 95.56  ? 508 LEU A N     1 
ATOM   3975  C  CA    . LEU A 1 529 ? -16.530 -21.683 34.989  1.00 95.89  ? 508 LEU A CA    1 
ATOM   3976  C  C     . LEU A 1 529 ? -16.799 -22.923 35.835  1.00 107.29 ? 508 LEU A C     1 
ATOM   3977  O  O     . LEU A 1 529 ? -15.911 -23.478 36.495  1.00 125.80 ? 508 LEU A O     1 
ATOM   3978  C  CB    . LEU A 1 529 ? -16.340 -22.136 33.526  1.00 93.00  ? 508 LEU A CB    1 
ATOM   3979  C  CG    . LEU A 1 529 ? -16.072 -21.052 32.492  1.00 93.78  ? 508 LEU A CG    1 
ATOM   3980  C  CD1   . LEU A 1 529 ? -15.842 -21.626 31.098  1.00 96.28  ? 508 LEU A CD1   1 
ATOM   3981  C  CD2   . LEU A 1 529 ? -17.231 -20.082 32.528  1.00 95.30  ? 508 LEU A CD2   1 
ATOM   3982  N  N     . ILE A 1 530 ? -18.048 -23.365 35.774  1.00 110.13 ? 509 ILE A N     1 
ATOM   3983  C  CA    . ILE A 1 530 ? -18.422 -24.697 36.227  1.00 95.97  ? 509 ILE A CA    1 
ATOM   3984  C  C     . ILE A 1 530 ? -19.367 -25.251 35.179  1.00 106.97 ? 509 ILE A C     1 
ATOM   3985  O  O     . ILE A 1 530 ? -20.271 -24.545 34.721  1.00 100.44 ? 509 ILE A O     1 
ATOM   3986  C  CB    . ILE A 1 530 ? -19.088 -24.702 37.616  1.00 103.22 ? 509 ILE A CB    1 
ATOM   3987  C  CG1   . ILE A 1 530 ? -19.335 -26.134 38.065  1.00 96.19  ? 509 ILE A CG1   1 
ATOM   3988  C  CG2   . ILE A 1 530 ? -20.424 -23.996 37.573  1.00 117.64 ? 509 ILE A CG2   1 
ATOM   3989  C  CD1   . ILE A 1 530 ? -19.687 -26.249 39.496  1.00 95.92  ? 509 ILE A CD1   1 
ATOM   3990  N  N     . GLN A 1 531 ? -19.164 -26.518 34.806  1.00 111.52 ? 510 GLN A N     1 
ATOM   3991  C  CA    . GLN A 1 531 ? -20.008 -27.186 33.831  1.00 103.80 ? 510 GLN A CA    1 
ATOM   3992  C  C     . GLN A 1 531 ? -20.651 -28.420 34.453  1.00 110.22 ? 510 GLN A C     1 
ATOM   3993  O  O     . GLN A 1 531 ? -20.065 -29.099 35.299  1.00 104.35 ? 510 GLN A O     1 
ATOM   3994  C  CB    . GLN A 1 531 ? -19.246 -27.567 32.554  1.00 104.60 ? 510 GLN A CB    1 
ATOM   3995  C  CG    . GLN A 1 531 ? -18.086 -28.475 32.682  1.00 103.16 ? 510 GLN A CG    1 
ATOM   3996  C  CD    . GLN A 1 531 ? -17.367 -28.631 31.351  1.00 104.24 ? 510 GLN A CD    1 
ATOM   3997  O  OE1   . GLN A 1 531 ? -16.497 -29.482 31.191  1.00 109.12 ? 510 GLN A OE1   1 
ATOM   3998  N  NE2   . GLN A 1 531 ? -17.674 -27.750 30.411  1.00 105.51 ? 510 GLN A NE2   1 
ATOM   3999  N  N     . PHE A 1 532 ? -21.888 -28.657 34.063  1.00 109.63 ? 511 PHE A N     1 
ATOM   4000  C  CA    . PHE A 1 532 ? -22.717 -29.722 34.575  1.00 112.48 ? 511 PHE A CA    1 
ATOM   4001  C  C     . PHE A 1 532 ? -23.142 -30.643 33.438  1.00 126.41 ? 511 PHE A C     1 
ATOM   4002  O  O     . PHE A 1 532 ? -23.546 -30.179 32.366  1.00 145.85 ? 511 PHE A O     1 
ATOM   4003  C  CB    . PHE A 1 532 ? -23.955 -29.144 35.274  1.00 114.08 ? 511 PHE A CB    1 
ATOM   4004  C  CG    . PHE A 1 532 ? -23.651 -28.407 36.532  1.00 110.73 ? 511 PHE A CG    1 
ATOM   4005  C  CD1   . PHE A 1 532 ? -23.019 -29.039 37.581  1.00 140.10 ? 511 PHE A CD1   1 
ATOM   4006  C  CD2   . PHE A 1 532 ? -23.993 -27.097 36.678  1.00 111.08 ? 511 PHE A CD2   1 
ATOM   4007  C  CE1   . PHE A 1 532 ? -22.745 -28.373 38.761  1.00 129.50 ? 511 PHE A CE1   1 
ATOM   4008  C  CE2   . PHE A 1 532 ? -23.713 -26.423 37.859  1.00 122.04 ? 511 PHE A CE2   1 
ATOM   4009  C  CZ    . PHE A 1 532 ? -23.094 -27.065 38.896  1.00 121.88 ? 511 PHE A CZ    1 
ATOM   4010  N  N     . TRP A 1 533 ? -23.074 -31.950 33.697  1.00 120.93 ? 512 TRP A N     1 
ATOM   4011  C  CA    . TRP A 1 533 ? -23.654 -32.986 32.845  1.00 122.66 ? 512 TRP A CA    1 
ATOM   4012  C  C     . TRP A 1 533 ? -24.710 -33.633 33.731  1.00 147.36 ? 512 TRP A C     1 
ATOM   4013  O  O     . TRP A 1 533 ? -24.405 -34.573 34.486  1.00 181.68 ? 512 TRP A O     1 
ATOM   4014  C  CB    . TRP A 1 533 ? -22.628 -34.021 32.391  1.00 122.45 ? 512 TRP A CB    1 
ATOM   4015  C  CG    . TRP A 1 533 ? -21.508 -33.538 31.564  1.00 122.90 ? 512 TRP A CG    1 
ATOM   4016  C  CD1   . TRP A 1 533 ? -21.497 -33.415 30.216  1.00 143.07 ? 512 TRP A CD1   1 
ATOM   4017  C  CD2   . TRP A 1 533 ? -20.197 -33.185 32.010  1.00 119.18 ? 512 TRP A CD2   1 
ATOM   4018  N  NE1   . TRP A 1 533 ? -20.273 -32.961 29.789  1.00 140.99 ? 512 TRP A NE1   1 
ATOM   4019  C  CE2   . TRP A 1 533 ? -19.455 -32.817 30.874  1.00 117.25 ? 512 TRP A CE2   1 
ATOM   4020  C  CE3   . TRP A 1 533 ? -19.585 -33.130 33.258  1.00 142.69 ? 512 TRP A CE3   1 
ATOM   4021  C  CZ2   . TRP A 1 533 ? -18.137 -32.404 30.946  1.00 128.63 ? 512 TRP A CZ2   1 
ATOM   4022  C  CZ3   . TRP A 1 533 ? -18.272 -32.719 33.328  1.00 155.97 ? 512 TRP A CZ3   1 
ATOM   4023  C  CH2   . TRP A 1 533 ? -17.561 -32.363 32.178  1.00 151.11 ? 512 TRP A CH2   1 
ATOM   4024  N  N     . PRO A 1 534 ? -25.939 -33.106 33.751  1.00 142.47 ? 513 PRO A N     1 
ATOM   4025  C  CA    . PRO A 1 534 ? -26.922 -33.611 34.730  1.00 153.85 ? 513 PRO A CA    1 
ATOM   4026  C  C     . PRO A 1 534 ? -27.326 -35.068 34.513  1.00 153.13 ? 513 PRO A C     1 
ATOM   4027  O  O     . PRO A 1 534 ? -27.703 -35.743 35.483  1.00 162.66 ? 513 PRO A O     1 
ATOM   4028  C  CB    . PRO A 1 534 ? -28.111 -32.648 34.564  1.00 145.07 ? 513 PRO A CB    1 
ATOM   4029  C  CG    . PRO A 1 534 ? -27.513 -31.395 33.935  1.00 130.21 ? 513 PRO A CG    1 
ATOM   4030  C  CD    . PRO A 1 534 ? -26.411 -31.898 33.048  1.00 128.75 ? 513 PRO A CD    1 
ATOM   4031  N  N     . ALA A 1 535 ? -27.292 -35.560 33.269  1.00 143.12 ? 514 ALA A N     1 
ATOM   4032  C  CA    . ALA A 1 535 ? -27.642 -36.955 33.012  1.00 142.53 ? 514 ALA A CA    1 
ATOM   4033  C  C     . ALA A 1 535 ? -26.671 -37.911 33.688  1.00 154.70 ? 514 ALA A C     1 
ATOM   4034  O  O     . ALA A 1 535 ? -27.077 -38.969 34.184  1.00 184.71 ? 514 ALA A O     1 
ATOM   4035  C  CB    . ALA A 1 535 ? -27.704 -37.222 31.509  1.00 145.67 ? 514 ALA A CB    1 
ATOM   4036  N  N     . GLN A 1 536 ? -25.386 -37.572 33.701  1.00 135.70 ? 515 GLN A N     1 
ATOM   4037  C  CA    . GLN A 1 536 ? -24.392 -38.340 34.434  1.00 137.43 ? 515 GLN A CA    1 
ATOM   4038  C  C     . GLN A 1 536 ? -24.103 -37.711 35.791  1.00 145.56 ? 515 GLN A C     1 
ATOM   4039  O  O     . GLN A 1 536 ? -23.113 -38.081 36.438  1.00 159.27 ? 515 GLN A O     1 
ATOM   4040  C  CB    . GLN A 1 536 ? -23.098 -38.535 33.615  1.00 144.96 ? 515 GLN A CB    1 
ATOM   4041  C  CG    . GLN A 1 536 ? -22.805 -37.511 32.508  1.00 160.21 ? 515 GLN A CG    1 
ATOM   4042  C  CD    . GLN A 1 536 ? -22.244 -38.135 31.224  1.00 162.94 ? 515 GLN A CD    1 
ATOM   4043  O  OE1   . GLN A 1 536 ? -21.941 -39.329 31.178  1.00 171.03 ? 515 GLN A OE1   1 
ATOM   4044  N  NE2   . GLN A 1 536 ? -22.126 -37.324 30.171  1.00 154.57 ? 515 GLN A NE2   1 
ATOM   4045  N  N     . ARG A 1 537 ? -24.907 -36.713 36.184  1.00 134.56 ? 516 ARG A N     1 
ATOM   4046  C  CA    . ARG A 1 537 ? -24.827 -36.023 37.481  1.00 130.98 ? 516 ARG A CA    1 
ATOM   4047  C  C     . ARG A 1 537 ? -23.375 -35.695 37.834  1.00 137.00 ? 516 ARG A C     1 
ATOM   4048  O  O     . ARG A 1 537 ? -22.914 -35.882 38.958  1.00 130.80 ? 516 ARG A O     1 
ATOM   4049  C  CB    . ARG A 1 537 ? -25.522 -36.824 38.591  1.00 129.70 ? 516 ARG A CB    1 
ATOM   4050  C  CG    . ARG A 1 537 ? -27.031 -37.043 38.393  1.00 135.01 ? 516 ARG A CG    1 
ATOM   4051  C  CD    . ARG A 1 537 ? -27.870 -36.155 39.298  1.00 142.84 ? 516 ARG A CD    1 
ATOM   4052  N  NE    . ARG A 1 537 ? -27.678 -36.427 40.731  1.00 172.97 ? 516 ARG A NE    1 
ATOM   4053  C  CZ    . ARG A 1 537 ? -28.597 -36.958 41.546  1.00 180.69 ? 516 ARG A CZ    1 
ATOM   4054  N  NH1   . ARG A 1 537 ? -29.799 -37.290 41.082  1.00 184.51 ? 516 ARG A NH1   1 
ATOM   4055  N  NH2   . ARG A 1 537 ? -28.321 -37.152 42.836  1.00 169.79 ? 516 ARG A NH2   1 
ATOM   4056  N  N     . ARG A 1 538 ? -22.670 -35.154 36.843  1.00 135.34 ? 517 ARG A N     1 
ATOM   4057  C  CA    . ARG A 1 538 ? -21.259 -34.807 36.892  1.00 127.52 ? 517 ARG A CA    1 
ATOM   4058  C  C     . ARG A 1 538 ? -21.106 -33.297 36.805  1.00 112.36 ? 517 ARG A C     1 
ATOM   4059  O  O     . ARG A 1 538 ? -22.003 -32.589 36.352  1.00 123.73 ? 517 ARG A O     1 
ATOM   4060  C  CB    . ARG A 1 538 ? -20.490 -35.437 35.722  1.00 142.65 ? 517 ARG A CB    1 
ATOM   4061  C  CG    . ARG A 1 538 ? -19.055 -35.861 36.004  1.00 163.79 ? 517 ARG A CG    1 
ATOM   4062  C  CD    . ARG A 1 538 ? -18.475 -36.550 34.775  1.00 182.73 ? 517 ARG A CD    1 
ATOM   4063  N  NE    . ARG A 1 538 ? -17.465 -37.548 35.105  1.00 189.79 ? 517 ARG A NE    1 
ATOM   4064  C  CZ    . ARG A 1 538 ? -17.697 -38.858 35.106  1.00 191.16 ? 517 ARG A CZ    1 
ATOM   4065  N  NH1   . ARG A 1 538 ? -16.726 -39.711 35.413  1.00 172.64 ? 517 ARG A NH1   1 
ATOM   4066  N  NH2   . ARG A 1 538 ? -18.906 -39.315 34.796  1.00 193.30 ? 517 ARG A NH2   1 
ATOM   4067  N  N     . TYR A 1 539 ? -19.949 -32.807 37.237  1.00 108.10 ? 518 TYR A N     1 
ATOM   4068  C  CA    . TYR A 1 539 ? -19.588 -31.407 37.054  1.00 105.03 ? 518 TYR A CA    1 
ATOM   4069  C  C     . TYR A 1 539 ? -18.081 -31.338 36.865  1.00 102.15 ? 518 TYR A C     1 
ATOM   4070  O  O     . TYR A 1 539 ? -17.346 -32.280 37.158  1.00 102.22 ? 518 TYR A O     1 
ATOM   4071  C  CB    . TYR A 1 539 ? -20.001 -30.506 38.236  1.00 103.44 ? 518 TYR A CB    1 
ATOM   4072  C  CG    . TYR A 1 539 ? -19.100 -30.695 39.419  1.00 101.14 ? 518 TYR A CG    1 
ATOM   4073  C  CD1   . TYR A 1 539 ? -19.327 -31.712 40.311  1.00 102.93 ? 518 TYR A CD1   1 
ATOM   4074  C  CD2   . TYR A 1 539 ? -17.986 -29.924 39.590  1.00 97.72  ? 518 TYR A CD2   1 
ATOM   4075  C  CE1   . TYR A 1 539 ? -18.497 -31.917 41.353  1.00 101.39 ? 518 TYR A CE1   1 
ATOM   4076  C  CE2   . TYR A 1 539 ? -17.163 -30.136 40.605  1.00 96.20  ? 518 TYR A CE2   1 
ATOM   4077  C  CZ    . TYR A 1 539 ? -17.414 -31.126 41.491  1.00 98.04  ? 518 TYR A CZ    1 
ATOM   4078  O  OH    . TYR A 1 539 ? -16.566 -31.338 42.541  1.00 96.94  ? 518 TYR A OH    1 
ATOM   4079  N  N     . ARG A 1 540 ? -17.631 -30.217 36.340  1.00 100.03 ? 519 ARG A N     1 
ATOM   4080  C  CA    . ARG A 1 540 ? -16.215 -29.934 36.338  1.00 97.26  ? 519 ARG A CA    1 
ATOM   4081  C  C     . ARG A 1 540 ? -16.038 -28.422 36.369  1.00 94.81  ? 519 ARG A C     1 
ATOM   4082  O  O     . ARG A 1 540 ? -16.696 -27.709 35.617  1.00 95.74  ? 519 ARG A O     1 
ATOM   4083  C  CB    . ARG A 1 540 ? -15.575 -30.530 35.096  1.00 98.51  ? 519 ARG A CB    1 
ATOM   4084  C  CG    . ARG A 1 540 ? -14.103 -30.400 35.091  1.00 114.74 ? 519 ARG A CG    1 
ATOM   4085  C  CD    . ARG A 1 540 ? -13.510 -31.051 33.895  1.00 113.89 ? 519 ARG A CD    1 
ATOM   4086  N  NE    . ARG A 1 540 ? -13.938 -30.331 32.720  1.00 99.07  ? 519 ARG A NE    1 
ATOM   4087  C  CZ    . ARG A 1 540 ? -13.239 -30.338 31.614  1.00 99.93  ? 519 ARG A CZ    1 
ATOM   4088  N  NH1   . ARG A 1 540 ? -13.647 -29.663 30.561  1.00 106.31 ? 519 ARG A NH1   1 
ATOM   4089  N  NH2   . ARG A 1 540 ? -12.096 -30.993 31.602  1.00 99.68  ? 519 ARG A NH2   1 
ATOM   4090  N  N     . MET A 1 541 ? -15.112 -27.930 37.168  1.00 92.06  ? 520 MET A N     1 
ATOM   4091  C  CA    . MET A 1 541 ? -14.837 -26.505 37.191  1.00 89.92  ? 520 MET A CA    1 
ATOM   4092  C  C     . MET A 1 541 ? -13.670 -26.224 36.258  1.00 89.50  ? 520 MET A C     1 
ATOM   4093  O  O     . MET A 1 541 ? -12.683 -26.966 36.259  1.00 88.87  ? 520 MET A O     1 
ATOM   4094  C  CB    . MET A 1 541 ? -14.487 -26.061 38.595  1.00 93.71  ? 520 MET A CB    1 
ATOM   4095  C  CG    . MET A 1 541 ? -15.358 -26.659 39.627  1.00 88.97  ? 520 MET A CG    1 
ATOM   4096  S  SD    . MET A 1 541 ? -15.252 -25.714 41.134  1.00 86.97  ? 520 MET A SD    1 
ATOM   4097  C  CE    . MET A 1 541 ? -16.235 -24.278 40.586  1.00 87.04  ? 520 MET A CE    1 
ATOM   4098  N  N     . VAL A 1 542 ? -13.759 -25.135 35.495  1.00 88.94  ? 521 VAL A N     1 
ATOM   4099  C  CA    . VAL A 1 542 ? -12.805 -24.852 34.422  1.00 88.98  ? 521 VAL A CA    1 
ATOM   4100  C  C     . VAL A 1 542 ? -12.289 -23.437 34.594  1.00 91.49  ? 521 VAL A C     1 
ATOM   4101  O  O     . VAL A 1 542 ? -13.079 -22.485 34.639  1.00 96.40  ? 521 VAL A O     1 
ATOM   4102  C  CB    . VAL A 1 542 ? -13.419 -25.005 33.017  1.00 91.82  ? 521 VAL A CB    1 
ATOM   4103  C  CG1   . VAL A 1 542 ? -12.422 -24.594 31.955  1.00 92.12  ? 521 VAL A CG1   1 
ATOM   4104  C  CG2   . VAL A 1 542 ? -13.874 -26.420 32.773  1.00 94.08  ? 521 VAL A CG2   1 
ATOM   4105  N  N     . GLU A 1 543 ? -10.975 -23.294 34.735  1.00 85.66  ? 522 GLU A N     1 
ATOM   4106  C  CA    . GLU A 1 543 ? -10.386 -21.966 34.693  1.00 100.36 ? 522 GLU A CA    1 
ATOM   4107  C  C     . GLU A 1 543 ? -9.867  -21.672 33.296  1.00 111.77 ? 522 GLU A C     1 
ATOM   4108  O  O     . GLU A 1 543 ? -9.081  -22.452 32.742  1.00 137.70 ? 522 GLU A O     1 
ATOM   4109  C  CB    . GLU A 1 543 ? -9.276  -21.826 35.731  1.00 104.27 ? 522 GLU A CB    1 
ATOM   4110  C  CG    . GLU A 1 543 ? -8.488  -20.506 35.665  1.00 102.84 ? 522 GLU A CG    1 
ATOM   4111  C  CD    . GLU A 1 543 ? -9.364  -19.261 35.806  1.00 92.39  ? 522 GLU A CD    1 
ATOM   4112  O  OE1   . GLU A 1 543 ? -10.412 -19.295 36.489  1.00 89.72  ? 522 GLU A OE1   1 
ATOM   4113  O  OE2   . GLU A 1 543 ? -8.958  -18.218 35.254  1.00 100.24 ? 522 GLU A OE2   1 
ATOM   4114  N  N     . VAL A 1 544 ? -10.284 -20.535 32.741  1.00 86.62  ? 523 VAL A N     1 
ATOM   4115  C  CA    . VAL A 1 544 ? -9.873  -20.134 31.408  1.00 88.56  ? 523 VAL A CA    1 
ATOM   4116  C  C     . VAL A 1 544 ? -8.798  -19.083 31.539  1.00 103.76 ? 523 VAL A C     1 
ATOM   4117  O  O     . VAL A 1 544 ? -8.965  -18.103 32.277  1.00 111.34 ? 523 VAL A O     1 
ATOM   4118  C  CB    . VAL A 1 544 ? -11.050 -19.573 30.620  1.00 90.81  ? 523 VAL A CB    1 
ATOM   4119  C  CG1   . VAL A 1 544 ? -10.563 -19.083 29.294  1.00 93.13  ? 523 VAL A CG1   1 
ATOM   4120  C  CG2   . VAL A 1 544 ? -12.115 -20.635 30.497  1.00 92.30  ? 523 VAL A CG2   1 
ATOM   4121  N  N     . LYS A 1 545 ? -7.713  -19.262 30.800  1.00 110.02 ? 524 LYS A N     1 
ATOM   4122  C  CA    . LYS A 1 545 ? -6.629  -18.296 30.793  1.00 108.94 ? 524 LYS A CA    1 
ATOM   4123  C  C     . LYS A 1 545 ? -6.384  -17.914 29.347  1.00 115.88 ? 524 LYS A C     1 
ATOM   4124  O  O     . LYS A 1 545 ? -5.944  -18.747 28.544  1.00 111.92 ? 524 LYS A O     1 
ATOM   4125  C  CB    . LYS A 1 545 ? -5.363  -18.893 31.402  1.00 111.41 ? 524 LYS A CB    1 
ATOM   4126  C  CG    . LYS A 1 545 ? -5.352  -19.125 32.919  1.00 118.15 ? 524 LYS A CG    1 
ATOM   4127  C  CD    . LYS A 1 545 ? -5.480  -17.855 33.709  1.00 111.72 ? 524 LYS A CD    1 
ATOM   4128  C  CE    . LYS A 1 545 ? -5.514  -18.153 35.185  1.00 100.34 ? 524 LYS A CE    1 
ATOM   4129  N  NZ    . LYS A 1 545 ? -5.656  -16.873 35.928  1.00 117.09 ? 524 LYS A NZ    1 
ATOM   4130  N  N     . GLY A 1 546 ? -6.659  -16.660 29.017  1.00 113.91 ? 525 GLY A N     1 
ATOM   4131  C  CA    . GLY A 1 546 ? -6.252  -16.155 27.737  1.00 141.31 ? 525 GLY A CA    1 
ATOM   4132  C  C     . GLY A 1 546 ? -4.756  -15.993 27.759  1.00 147.42 ? 525 GLY A C     1 
ATOM   4133  O  O     . GLY A 1 546 ? -4.107  -16.160 28.795  1.00 166.59 ? 525 GLY A O     1 
ATOM   4134  N  N     . PRO A 1 547 ? -4.168  -15.692 26.619  1.00 139.86 ? 526 PRO A N     1 
ATOM   4135  C  CA    . PRO A 1 547 ? -2.753  -15.339 26.627  1.00 120.79 ? 526 PRO A CA    1 
ATOM   4136  C  C     . PRO A 1 547 ? -2.620  -14.040 27.402  1.00 125.39 ? 526 PRO A C     1 
ATOM   4137  O  O     . PRO A 1 547 ? -3.466  -13.145 27.290  1.00 140.09 ? 526 PRO A O     1 
ATOM   4138  C  CB    . PRO A 1 547 ? -2.412  -15.163 25.148  1.00 130.27 ? 526 PRO A CB    1 
ATOM   4139  C  CG    . PRO A 1 547 ? -3.626  -15.681 24.401  1.00 147.67 ? 526 PRO A CG    1 
ATOM   4140  C  CD    . PRO A 1 547 ? -4.791  -15.487 25.309  1.00 126.96 ? 526 PRO A CD    1 
ATOM   4141  N  N     . GLY A 1 548 ? -1.586  -13.962 28.232  1.00 118.17 ? 527 GLY A N     1 
ATOM   4142  C  CA    . GLY A 1 548 ? -1.372  -12.805 29.084  1.00 129.01 ? 527 GLY A CA    1 
ATOM   4143  C  C     . GLY A 1 548 ? -2.001  -12.875 30.463  1.00 149.49 ? 527 GLY A C     1 
ATOM   4144  O  O     . GLY A 1 548 ? -2.135  -11.833 31.117  1.00 163.03 ? 527 GLY A O     1 
ATOM   4145  N  N     . ASP A 1 549 ? -2.399  -14.071 30.918  1.00 147.19 ? 528 ASP A N     1 
ATOM   4146  C  CA    . ASP A 1 549 ? -2.717  -14.395 32.307  1.00 103.11 ? 528 ASP A CA    1 
ATOM   4147  C  C     . ASP A 1 549 ? -2.092  -15.748 32.585  1.00 86.13  ? 528 ASP A C     1 
ATOM   4148  O  O     . ASP A 1 549 ? -2.117  -16.634 31.725  1.00 87.50  ? 528 ASP A O     1 
ATOM   4149  C  CB    . ASP A 1 549 ? -4.226  -14.496 32.612  1.00 126.89 ? 528 ASP A CB    1 
ATOM   4150  C  CG    . ASP A 1 549 ? -4.555  -14.362 34.130  1.00 141.44 ? 528 ASP A CG    1 
ATOM   4151  O  OD1   . ASP A 1 549 ? -3.629  -14.296 34.975  1.00 133.37 ? 528 ASP A OD1   1 
ATOM   4152  O  OD2   . ASP A 1 549 ? -5.761  -14.392 34.481  1.00 147.63 ? 528 ASP A OD2   1 
ATOM   4153  N  N     . ARG A 1 550 ? -1.536  -15.907 33.779  1.00 89.75  ? 529 ARG A N     1 
ATOM   4154  C  CA    . ARG A 1 550 ? -1.170  -17.218 34.281  1.00 100.43 ? 529 ARG A CA    1 
ATOM   4155  C  C     . ARG A 1 550 ? -2.054  -17.549 35.462  1.00 101.42 ? 529 ARG A C     1 
ATOM   4156  O  O     . ARG A 1 550 ? -2.858  -16.733 35.915  1.00 112.92 ? 529 ARG A O     1 
ATOM   4157  C  CB    . ARG A 1 550 ? 0.319   -17.284 34.670  1.00 111.67 ? 529 ARG A CB    1 
ATOM   4158  C  CG    . ARG A 1 550 ? 1.247   -17.355 33.457  1.00 140.81 ? 529 ARG A CG    1 
ATOM   4159  C  CD    . ARG A 1 550 ? 0.871   -18.611 32.667  1.00 167.69 ? 529 ARG A CD    1 
ATOM   4160  N  NE    . ARG A 1 550 ? 1.074   -18.531 31.223  1.00 184.84 ? 529 ARG A NE    1 
ATOM   4161  C  CZ    . ARG A 1 550 ? 2.080   -19.116 30.580  1.00 211.96 ? 529 ARG A CZ    1 
ATOM   4162  N  NH1   . ARG A 1 550 ? 2.978   -19.823 31.256  1.00 214.69 ? 529 ARG A NH1   1 
ATOM   4163  N  NH2   . ARG A 1 550 ? 2.182   -19.008 29.262  1.00 226.65 ? 529 ARG A NH2   1 
ATOM   4164  N  N     . LEU A 1 551 ? -1.902  -18.755 35.963  1.00 89.49  ? 530 LEU A N     1 
ATOM   4165  C  CA    . LEU A 1 551 ? -2.694  -19.122 37.113  1.00 92.11  ? 530 LEU A CA    1 
ATOM   4166  C  C     . LEU A 1 551 ? -2.162  -18.343 38.305  1.00 110.45 ? 530 LEU A C     1 
ATOM   4167  O  O     . LEU A 1 551 ? -0.954  -18.348 38.566  1.00 134.39 ? 530 LEU A O     1 
ATOM   4168  C  CB    . LEU A 1 551 ? -2.595  -20.614 37.340  1.00 94.30  ? 530 LEU A CB    1 
ATOM   4169  C  CG    . LEU A 1 551 ? -3.539  -21.347 36.439  1.00 98.08  ? 530 LEU A CG    1 
ATOM   4170  C  CD1   . LEU A 1 551 ? -3.171  -22.826 36.420  1.00 99.64  ? 530 LEU A CD1   1 
ATOM   4171  C  CD2   . LEU A 1 551 ? -4.856  -21.093 37.101  1.00 102.03 ? 530 LEU A CD2   1 
ATOM   4172  N  N     . GLN A 1 552 ? -3.041  -17.610 38.977  1.00 89.00  ? 531 GLN A N     1 
ATOM   4173  C  CA    . GLN A 1 552 ? -2.637  -16.888 40.170  1.00 83.99  ? 531 GLN A CA    1 
ATOM   4174  C  C     . GLN A 1 552 ? -2.377  -17.854 41.319  1.00 90.36  ? 531 GLN A C     1 
ATOM   4175  O  O     . GLN A 1 552 ? -2.824  -19.007 41.306  1.00 104.63 ? 531 GLN A O     1 
ATOM   4176  C  CB    . GLN A 1 552 ? -3.698  -15.881 40.568  1.00 76.34  ? 531 GLN A CB    1 
ATOM   4177  C  CG    . GLN A 1 552 ? -4.215  -15.082 39.440  1.00 76.83  ? 531 GLN A CG    1 
ATOM   4178  C  CD    . GLN A 1 552 ? -5.044  -13.923 39.908  1.00 89.86  ? 531 GLN A CD    1 
ATOM   4179  O  OE1   . GLN A 1 552 ? -5.045  -12.890 39.262  1.00 114.54 ? 531 GLN A OE1   1 
ATOM   4180  N  NE2   . GLN A 1 552 ? -5.749  -14.074 41.040  1.00 75.44  ? 531 GLN A NE2   1 
ATOM   4181  N  N     . ASP A 1 553 ? -1.682  -17.356 42.351  1.00 77.25  ? 532 ASP A N     1 
ATOM   4182  C  CA    . ASP A 1 553 ? -1.277  -18.246 43.436  1.00 77.78  ? 532 ASP A CA    1 
ATOM   4183  C  C     . ASP A 1 553 ? -2.494  -18.799 44.179  1.00 108.52 ? 532 ASP A C     1 
ATOM   4184  O  O     . ASP A 1 553 ? -2.621  -20.017 44.366  1.00 104.01 ? 532 ASP A O     1 
ATOM   4185  C  CB    . ASP A 1 553 ? -0.367  -17.502 44.413  1.00 96.46  ? 532 ASP A CB    1 
ATOM   4186  C  CG    . ASP A 1 553 ? 1.099   -17.569 44.026  1.00 147.53 ? 532 ASP A CG    1 
ATOM   4187  O  OD1   . ASP A 1 553 ? 1.948   -17.294 44.905  1.00 156.50 ? 532 ASP A OD1   1 
ATOM   4188  O  OD2   . ASP A 1 553 ? 1.407   -17.930 42.865  1.00 168.10 ? 532 ASP A OD2   1 
ATOM   4189  N  N     . ASN A 1 554 ? -3.436  -17.922 44.550  1.00 125.12 ? 533 ASN A N     1 
ATOM   4190  C  CA    . ASN A 1 554 ? -4.623  -18.389 45.259  1.00 91.05  ? 533 ASN A CA    1 
ATOM   4191  C  C     . ASN A 1 554 ? -5.453  -19.302 44.369  1.00 80.05  ? 533 ASN A C     1 
ATOM   4192  O  O     . ASN A 1 554 ? -5.995  -20.312 44.844  1.00 114.65 ? 533 ASN A O     1 
ATOM   4193  C  CB    . ASN A 1 554 ? -5.436  -17.194 45.776  1.00 102.49 ? 533 ASN A CB    1 
ATOM   4194  C  CG    . ASN A 1 554 ? -5.775  -16.213 44.688  1.00 81.63  ? 533 ASN A CG    1 
ATOM   4195  O  OD1   . ASN A 1 554 ? -5.351  -16.395 43.576  1.00 74.77  ? 533 ASN A OD1   1 
ATOM   4196  N  ND2   . ASN A 1 554 ? -6.500  -15.139 45.019  1.00 103.09 ? 533 ASN A ND2   1 
ATOM   4197  N  N     . GLN A 1 555 ? -5.543  -18.976 43.075  1.00 75.67  ? 534 GLN A N     1 
ATOM   4198  C  CA    . GLN A 1 555 ? -6.179  -19.880 42.125  1.00 87.85  ? 534 GLN A CA    1 
ATOM   4199  C  C     . GLN A 1 555 ? -5.531  -21.254 42.155  1.00 91.16  ? 534 GLN A C     1 
ATOM   4200  O  O     . GLN A 1 555 ? -6.215  -22.284 42.235  1.00 95.82  ? 534 GLN A O     1 
ATOM   4201  C  CB    . GLN A 1 555 ? -6.113  -19.289 40.723  1.00 76.42  ? 534 GLN A CB    1 
ATOM   4202  C  CG    . GLN A 1 555 ? -6.884  -18.021 40.637  1.00 75.95  ? 534 GLN A CG    1 
ATOM   4203  C  CD    . GLN A 1 555 ? -7.018  -17.523 39.248  1.00 76.71  ? 534 GLN A CD    1 
ATOM   4204  O  OE1   . GLN A 1 555 ? -6.117  -17.694 38.438  1.00 83.96  ? 534 GLN A OE1   1 
ATOM   4205  N  NE2   . GLN A 1 555 ? -8.184  -16.948 38.935  1.00 77.03  ? 534 GLN A NE2   1 
ATOM   4206  N  N     . LEU A 1 556 ? -4.206  -21.282 42.132  1.00 77.63  ? 535 LEU A N     1 
ATOM   4207  C  CA    . LEU A 1 556 ? -3.490  -22.540 42.160  1.00 78.95  ? 535 LEU A CA    1 
ATOM   4208  C  C     . LEU A 1 556 ? -3.813  -23.318 43.414  1.00 79.44  ? 535 LEU A C     1 
ATOM   4209  O  O     . LEU A 1 556 ? -3.934  -24.550 43.380  1.00 87.80  ? 535 LEU A O     1 
ATOM   4210  C  CB    . LEU A 1 556 ? -2.003  -22.251 42.099  1.00 79.70  ? 535 LEU A CB    1 
ATOM   4211  C  CG    . LEU A 1 556 ? -1.351  -23.156 41.105  1.00 81.18  ? 535 LEU A CG    1 
ATOM   4212  C  CD1   . LEU A 1 556 ? -2.108  -22.895 39.845  1.00 101.51 ? 535 LEU A CD1   1 
ATOM   4213  C  CD2   . LEU A 1 556 ? 0.085   -22.776 40.956  1.00 82.29  ? 535 LEU A CD2   1 
ATOM   4214  N  N     . ARG A 1 557 ? -3.938  -22.617 44.543  1.00 78.87  ? 536 ARG A N     1 
ATOM   4215  C  CA    . ARG A 1 557 ? -4.295  -23.320 45.766  1.00 79.75  ? 536 ARG A CA    1 
ATOM   4216  C  C     . ARG A 1 557 ? -5.649  -23.939 45.629  1.00 79.86  ? 536 ARG A C     1 
ATOM   4217  O  O     . ARG A 1 557 ? -5.850  -25.082 46.026  1.00 81.30  ? 536 ARG A O     1 
ATOM   4218  C  CB    . ARG A 1 557 ? -4.275  -22.398 46.969  1.00 102.30 ? 536 ARG A CB    1 
ATOM   4219  C  CG    . ARG A 1 557 ? -2.909  -22.168 47.520  1.00 80.36  ? 536 ARG A CG    1 
ATOM   4220  C  CD    . ARG A 1 557 ? -3.070  -21.294 48.698  1.00 96.21  ? 536 ARG A CD    1 
ATOM   4221  N  NE    . ARG A 1 557 ? -2.770  -19.937 48.266  1.00 79.10  ? 536 ARG A NE    1 
ATOM   4222  C  CZ    . ARG A 1 557 ? -3.417  -18.849 48.655  1.00 83.05  ? 536 ARG A CZ    1 
ATOM   4223  N  NH1   . ARG A 1 557 ? -4.443  -18.933 49.510  1.00 93.07  ? 536 ARG A NH1   1 
ATOM   4224  N  NH2   . ARG A 1 557 ? -3.020  -17.674 48.172  1.00 77.50  ? 536 ARG A NH2   1 
ATOM   4225  N  N     . TRP A 1 558 ? -6.580  -23.221 45.019  1.00 89.14  ? 537 TRP A N     1 
ATOM   4226  C  CA    . TRP A 1 558 ? -7.918  -23.773 44.933  1.00 84.41  ? 537 TRP A CA    1 
ATOM   4227  C  C     . TRP A 1 558 ? -7.947  -25.005 44.025  1.00 86.23  ? 537 TRP A C     1 
ATOM   4228  O  O     . TRP A 1 558 ? -8.452  -26.071 44.415  1.00 81.96  ? 537 TRP A O     1 
ATOM   4229  C  CB    . TRP A 1 558 ? -8.906  -22.696 44.497  1.00 78.33  ? 537 TRP A CB    1 
ATOM   4230  C  CG    . TRP A 1 558 ? -10.000 -22.989 45.300  1.00 87.02  ? 537 TRP A CG    1 
ATOM   4231  C  CD1   . TRP A 1 558 ? -10.831 -24.041 45.153  1.00 146.93 ? 537 TRP A CD1   1 
ATOM   4232  C  CD2   . TRP A 1 558 ? -10.285 -22.420 46.546  1.00 86.46  ? 537 TRP A CD2   1 
ATOM   4233  N  NE1   . TRP A 1 558 ? -11.697 -24.118 46.203  1.00 141.86 ? 537 TRP A NE1   1 
ATOM   4234  C  CE2   . TRP A 1 558 ? -11.386 -23.130 47.085  1.00 89.99  ? 537 TRP A CE2   1 
ATOM   4235  C  CE3   . TRP A 1 558 ? -9.761  -21.350 47.243  1.00 101.42 ? 537 TRP A CE3   1 
ATOM   4236  C  CZ2   . TRP A 1 558 ? -11.975 -22.805 48.280  1.00 81.33  ? 537 TRP A CZ2   1 
ATOM   4237  C  CZ3   . TRP A 1 558 ? -10.326 -21.039 48.436  1.00 130.63 ? 537 TRP A CZ3   1 
ATOM   4238  C  CH2   . TRP A 1 558 ? -11.438 -21.759 48.949  1.00 113.58 ? 537 TRP A CH2   1 
ATOM   4239  N  N     . LEU A 1 559 ? -7.373  -24.888 42.826  1.00 80.63  ? 538 LEU A N     1 
ATOM   4240  C  CA    . LEU A 1 559 ? -7.265  -26.035 41.932  1.00 81.67  ? 538 LEU A CA    1 
ATOM   4241  C  C     . LEU A 1 559 ? -6.563  -27.219 42.585  1.00 85.36  ? 538 LEU A C     1 
ATOM   4242  O  O     . LEU A 1 559 ? -7.044  -28.353 42.531  1.00 84.77  ? 538 LEU A O     1 
ATOM   4243  C  CB    . LEU A 1 559 ? -6.472  -25.639 40.702  1.00 81.47  ? 538 LEU A CB    1 
ATOM   4244  C  CG    . LEU A 1 559 ? -7.149  -24.584 39.886  1.00 91.00  ? 538 LEU A CG    1 
ATOM   4245  C  CD1   . LEU A 1 559 ? -6.216  -24.201 38.747  1.00 80.90  ? 538 LEU A CD1   1 
ATOM   4246  C  CD2   . LEU A 1 559 ? -8.409  -25.244 39.427  1.00 91.15  ? 538 LEU A CD2   1 
ATOM   4247  N  N     . GLN A 1 560 ? -5.417  -26.981 43.215  1.00 86.97  ? 539 GLN A N     1 
ATOM   4248  C  CA    . GLN A 1 560 ? -4.686  -28.124 43.729  1.00 87.42  ? 539 GLN A CA    1 
ATOM   4249  C  C     . GLN A 1 560 ? -5.385  -28.740 44.916  1.00 86.12  ? 539 GLN A C     1 
ATOM   4250  O  O     . GLN A 1 560 ? -5.320  -29.957 45.098  1.00 95.38  ? 539 GLN A O     1 
ATOM   4251  C  CB    . GLN A 1 560 ? -3.272  -27.730 44.072  1.00 105.41 ? 539 GLN A CB    1 
ATOM   4252  C  CG    . GLN A 1 560 ? -2.313  -28.089 43.001  1.00 120.41 ? 539 GLN A CG    1 
ATOM   4253  C  CD    . GLN A 1 560 ? -0.979  -27.721 43.475  1.00 137.75 ? 539 GLN A CD    1 
ATOM   4254  O  OE1   . GLN A 1 560 ? -0.561  -28.153 44.545  1.00 157.96 ? 539 GLN A OE1   1 
ATOM   4255  N  NE2   . GLN A 1 560 ? -0.349  -26.769 42.780  1.00 125.04 ? 539 GLN A NE2   1 
ATOM   4256  N  N     . PHE A 1 561 ? -6.047  -27.921 45.735  1.00 85.04  ? 540 PHE A N     1 
ATOM   4257  C  CA    . PHE A 1 561 ? -6.837  -28.472 46.828  1.00 86.42  ? 540 PHE A CA    1 
ATOM   4258  C  C     . PHE A 1 561 ? -7.910  -29.389 46.302  1.00 96.20  ? 540 PHE A C     1 
ATOM   4259  O  O     . PHE A 1 561 ? -8.117  -30.480 46.841  1.00 95.86  ? 540 PHE A O     1 
ATOM   4260  C  CB    . PHE A 1 561 ? -7.501  -27.375 47.631  1.00 85.22  ? 540 PHE A CB    1 
ATOM   4261  C  CG    . PHE A 1 561 ? -8.584  -27.871 48.568  1.00 93.26  ? 540 PHE A CG    1 
ATOM   4262  C  CD1   . PHE A 1 561 ? -8.272  -28.377 49.815  1.00 88.82  ? 540 PHE A CD1   1 
ATOM   4263  C  CD2   . PHE A 1 561 ? -9.925  -27.812 48.195  1.00 100.21 ? 540 PHE A CD2   1 
ATOM   4264  C  CE1   . PHE A 1 561 ? -9.267  -28.812 50.670  1.00 90.68  ? 540 PHE A CE1   1 
ATOM   4265  C  CE2   . PHE A 1 561 ? -10.914 -28.257 49.057  1.00 92.48  ? 540 PHE A CE2   1 
ATOM   4266  C  CZ    . PHE A 1 561 ? -10.577 -28.759 50.299  1.00 90.60  ? 540 PHE A CZ    1 
ATOM   4267  N  N     . CYS A 1 562 ? -8.589  -28.985 45.228  1.00 86.52  ? 541 CYS A N     1 
ATOM   4268  C  CA    . CYS A 1 562 ? -9.563  -29.905 44.660  1.00 88.13  ? 541 CYS A CA    1 
ATOM   4269  C  C     . CYS A 1 562 ? -8.860  -31.140 44.136  1.00 98.03  ? 541 CYS A C     1 
ATOM   4270  O  O     . CYS A 1 562 ? -9.319  -32.266 44.350  1.00 98.00  ? 541 CYS A O     1 
ATOM   4271  C  CB    . CYS A 1 562 ? -10.341 -29.269 43.513  1.00 87.14  ? 541 CYS A CB    1 
ATOM   4272  S  SG    . CYS A 1 562 ? -11.517 -27.973 43.920  1.00 92.07  ? 541 CYS A SG    1 
ATOM   4273  N  N     . ARG A 1 563 ? -7.694  -30.951 43.522  1.00 89.22  ? 542 ARG A N     1 
ATOM   4274  C  CA    . ARG A 1 563 ? -7.091  -32.039 42.777  1.00 91.06  ? 542 ARG A CA    1 
ATOM   4275  C  C     . ARG A 1 563 ? -6.533  -33.118 43.691  1.00 93.44  ? 542 ARG A C     1 
ATOM   4276  O  O     . ARG A 1 563 ? -6.563  -34.299 43.322  1.00 95.81  ? 542 ARG A O     1 
ATOM   4277  C  CB    . ARG A 1 563 ? -6.025  -31.477 41.850  1.00 90.00  ? 542 ARG A CB    1 
ATOM   4278  C  CG    . ARG A 1 563 ? -5.787  -32.347 40.652  1.00 91.70  ? 542 ARG A CG    1 
ATOM   4279  C  CD    . ARG A 1 563 ? -4.654  -33.247 40.962  1.00 93.70  ? 542 ARG A CD    1 
ATOM   4280  N  NE    . ARG A 1 563 ? -4.443  -34.394 40.093  1.00 96.18  ? 542 ARG A NE    1 
ATOM   4281  C  CZ    . ARG A 1 563 ? -4.769  -35.636 40.432  1.00 99.68  ? 542 ARG A CZ    1 
ATOM   4282  N  NH1   . ARG A 1 563 ? -5.353  -35.854 41.606  1.00 107.93 ? 542 ARG A NH1   1 
ATOM   4283  N  NH2   . ARG A 1 563 ? -4.501  -36.656 39.613  1.00 101.22 ? 542 ARG A NH2   1 
ATOM   4284  N  N     . GLU A 1 564 ? -6.073  -32.736 44.899  1.00 104.61 ? 543 GLU A N     1 
ATOM   4285  C  CA    . GLU A 1 564 ? -5.679  -33.702 45.930  1.00 95.95  ? 543 GLU A CA    1 
ATOM   4286  C  C     . GLU A 1 564 ? -6.893  -34.440 46.453  1.00 113.49 ? 543 GLU A C     1 
ATOM   4287  O  O     . GLU A 1 564 ? -6.779  -35.596 46.875  1.00 140.57 ? 543 GLU A O     1 
ATOM   4288  C  CB    . GLU A 1 564 ? -4.988  -33.014 47.109  1.00 95.59  ? 543 GLU A CB    1 
ATOM   4289  C  CG    . GLU A 1 564 ? -3.755  -32.225 46.732  1.00 116.54 ? 543 GLU A CG    1 
ATOM   4290  C  CD    . GLU A 1 564 ? -3.249  -31.338 47.847  1.00 132.73 ? 543 GLU A CD    1 
ATOM   4291  O  OE1   . GLU A 1 564 ? -3.925  -31.252 48.895  1.00 149.11 ? 543 GLU A OE1   1 
ATOM   4292  O  OE2   . GLU A 1 564 ? -2.221  -30.661 47.631  1.00 135.45 ? 543 GLU A OE2   1 
ATOM   4293  N  N     . ARG A 1 565 ? -8.063  -33.782 46.424  1.00 112.90 ? 544 ARG A N     1 
ATOM   4294  C  CA    . ARG A 1 565 ? -9.335  -34.352 46.859  1.00 98.15  ? 544 ARG A CA    1 
ATOM   4295  C  C     . ARG A 1 565 ? -10.034 -35.110 45.741  1.00 99.37  ? 544 ARG A C     1 
ATOM   4296  O  O     . ARG A 1 565 ? -11.141 -35.620 45.950  1.00 102.97 ? 544 ARG A O     1 
ATOM   4297  C  CB    . ARG A 1 565 ? -10.264 -33.260 47.421  1.00 96.52  ? 544 ARG A CB    1 
ATOM   4298  C  CG    . ARG A 1 565 ? -10.094 -32.966 48.925  1.00 97.20  ? 544 ARG A CG    1 
ATOM   4299  C  CD    . ARG A 1 565 ? -9.078  -31.864 49.240  1.00 94.88  ? 544 ARG A CD    1 
ATOM   4300  N  NE    . ARG A 1 565 ? -8.739  -31.872 50.656  1.00 96.48  ? 544 ARG A NE    1 
ATOM   4301  C  CZ    . ARG A 1 565 ? -7.560  -31.518 51.166  1.00 109.41 ? 544 ARG A CZ    1 
ATOM   4302  N  NH1   . ARG A 1 565 ? -6.583  -31.094 50.386  1.00 94.59  ? 544 ARG A NH1   1 
ATOM   4303  N  NH2   . ARG A 1 565 ? -7.361  -31.584 52.476  1.00 125.55 ? 544 ARG A NH2   1 
ATOM   4304  N  N     . GLU A 1 566 ? -9.379  -35.237 44.587  1.00 103.86 ? 545 GLU A N     1 
ATOM   4305  C  CA    . GLU A 1 566 ? -9.927  -35.907 43.412  1.00 107.36 ? 545 GLU A CA    1 
ATOM   4306  C  C     . GLU A 1 566 ? -11.300 -35.336 43.060  1.00 99.45  ? 545 GLU A C     1 
ATOM   4307  O  O     . GLU A 1 566 ? -12.281 -36.064 42.914  1.00 101.84 ? 545 GLU A O     1 
ATOM   4308  C  CB    . GLU A 1 566 ? -9.995  -37.426 43.633  1.00 134.75 ? 545 GLU A CB    1 
ATOM   4309  C  CG    . GLU A 1 566 ? -8.699  -38.106 44.177  1.00 170.10 ? 545 GLU A CG    1 
ATOM   4310  C  CD    . GLU A 1 566 ? -7.570  -38.333 43.147  1.00 177.14 ? 545 GLU A CD    1 
ATOM   4311  O  OE1   . GLU A 1 566 ? -7.806  -38.192 41.923  1.00 184.73 ? 545 GLU A OE1   1 
ATOM   4312  O  OE2   . GLU A 1 566 ? -6.436  -38.669 43.584  1.00 164.98 ? 545 GLU A OE2   1 
ATOM   4313  N  N     . MET A 1 567 ? -11.387 -33.937 43.026  1.00 96.43  ? 546 MET A N     1 
ATOM   4314  C  CA    . MET A 1 567 ? -12.452 -33.118 42.462  1.00 97.22  ? 546 MET A CA    1 
ATOM   4315  C  C     . MET A 1 567 ? -12.101 -32.663 41.053  1.00 108.63 ? 546 MET A C     1 
ATOM   4316  O  O     . MET A 1 567 ? -10.963 -32.242 40.787  1.00 121.68 ? 546 MET A O     1 
ATOM   4317  C  CB    . MET A 1 567 ? -12.735 -31.901 43.338  1.00 102.93 ? 546 MET A CB    1 
ATOM   4318  C  CG    . MET A 1 567 ? -13.402 -32.326 44.622  1.00 122.04 ? 546 MET A CG    1 
ATOM   4319  S  SD    . MET A 1 567 ? -13.139 -31.237 46.029  1.00 106.54 ? 546 MET A SD    1 
ATOM   4320  C  CE    . MET A 1 567 ? -13.826 -32.284 47.311  1.00 132.22 ? 546 MET A CE    1 
ATOM   4321  N  N     . PRO A 1 568 ? -13.107 -32.657 40.227  1.00 95.46  ? 547 PRO A N     1 
ATOM   4322  C  CA    . PRO A 1 568 ? -12.945 -32.350 38.797  1.00 95.30  ? 547 PRO A CA    1 
ATOM   4323  C  C     . PRO A 1 568 ? -12.707 -30.889 38.391  1.00 92.73  ? 547 PRO A C     1 
ATOM   4324  O  O     . PRO A 1 568 ? -13.648 -30.156 38.074  1.00 92.73  ? 547 PRO A O     1 
ATOM   4325  C  CB    . PRO A 1 568 ? -14.266 -32.857 38.217  1.00 98.02  ? 547 PRO A CB    1 
ATOM   4326  C  CG    . PRO A 1 568 ? -15.215 -32.809 39.348  1.00 103.39 ? 547 PRO A CG    1 
ATOM   4327  C  CD    . PRO A 1 568 ? -14.438 -33.179 40.542  1.00 97.86  ? 547 PRO A CD    1 
ATOM   4328  N  N     . VAL A 1 569 ? -11.457 -30.447 38.364  1.00 90.94  ? 548 VAL A N     1 
ATOM   4329  C  CA    . VAL A 1 569 ? -11.138 -29.109 37.881  1.00 88.97  ? 548 VAL A CA    1 
ATOM   4330  C  C     . VAL A 1 569 ? -10.239 -29.206 36.656  1.00 92.13  ? 548 VAL A C     1 
ATOM   4331  O  O     . VAL A 1 569 ? -9.524  -30.198 36.471  1.00 122.44 ? 548 VAL A O     1 
ATOM   4332  C  CB    . VAL A 1 569 ? -10.465 -28.267 38.982  1.00 98.42  ? 548 VAL A CB    1 
ATOM   4333  C  CG1   . VAL A 1 569 ? -11.469 -27.923 40.053  1.00 113.45 ? 548 VAL A CG1   1 
ATOM   4334  C  CG2   . VAL A 1 569 ? -9.309  -29.042 39.582  1.00 93.05  ? 548 VAL A CG2   1 
ATOM   4335  N  N     . ALA A 1 570 ? -10.288 -28.179 35.804  1.00 88.89  ? 549 ALA A N     1 
ATOM   4336  C  CA    . ALA A 1 570 ? -9.358  -28.136 34.684  1.00 89.52  ? 549 ALA A CA    1 
ATOM   4337  C  C     . ALA A 1 570 ? -9.088  -26.705 34.205  1.00 88.30  ? 549 ALA A C     1 
ATOM   4338  O  O     . ALA A 1 570 ? -9.935  -25.808 34.323  1.00 87.66  ? 549 ALA A O     1 
ATOM   4339  C  CB    . ALA A 1 570 ? -9.871  -29.011 33.546  1.00 104.60 ? 549 ALA A CB    1 
ATOM   4340  N  N     . VAL A 1 571 ? -7.897  -26.513 33.626  1.00 93.19  ? 550 VAL A N     1 
ATOM   4341  C  CA    . VAL A 1 571 ? -7.426  -25.209 33.168  1.00 94.47  ? 550 VAL A CA    1 
ATOM   4342  C  C     . VAL A 1 571 ? -7.385  -25.189 31.650  1.00 122.48 ? 550 VAL A C     1 
ATOM   4343  O  O     . VAL A 1 571 ? -6.576  -25.894 31.036  1.00 146.49 ? 550 VAL A O     1 
ATOM   4344  C  CB    . VAL A 1 571 ? -6.023  -24.903 33.704  1.00 93.79  ? 550 VAL A CB    1 
ATOM   4345  C  CG1   . VAL A 1 571 ? -5.678  -23.468 33.381  1.00 97.31  ? 550 VAL A CG1   1 
ATOM   4346  C  CG2   . VAL A 1 571 ? -5.936  -25.198 35.179  1.00 106.91 ? 550 VAL A CG2   1 
ATOM   4347  N  N     . CYS A 1 572 ? -8.147  -24.283 31.055  1.00 120.04 ? 551 CYS A N     1 
ATOM   4348  C  CA    . CYS A 1 572 ? -8.266  -24.163 29.608  1.00 93.54  ? 551 CYS A CA    1 
ATOM   4349  C  C     . CYS A 1 572 ? -7.467  -22.957 29.149  1.00 112.23 ? 551 CYS A C     1 
ATOM   4350  O  O     . CYS A 1 572 ? -7.825  -21.814 29.470  1.00 134.85 ? 551 CYS A O     1 
ATOM   4351  C  CB    . CYS A 1 572 ? -9.720  -24.019 29.200  1.00 96.21  ? 551 CYS A CB    1 
ATOM   4352  S  SG    . CYS A 1 572 ? -9.842  -23.413 27.548  1.00 120.68 ? 551 CYS A SG    1 
ATOM   4353  N  N     . TYR A 1 573 ? -6.370  -23.203 28.431  1.00 96.68  ? 552 TYR A N     1 
ATOM   4354  C  CA    . TYR A 1 573 ? -5.557  -22.124 27.881  1.00 109.65 ? 552 TYR A CA    1 
ATOM   4355  C  C     . TYR A 1 573 ? -5.901  -21.923 26.408  1.00 125.18 ? 552 TYR A C     1 
ATOM   4356  O  O     . TYR A 1 573 ? -5.812  -22.870 25.627  1.00 102.32 ? 552 TYR A O     1 
ATOM   4357  C  CB    . TYR A 1 573 ? -4.070  -22.426 28.035  1.00 121.57 ? 552 TYR A CB    1 
ATOM   4358  C  CG    . TYR A 1 573 ? -3.551  -22.525 29.444  1.00 93.78  ? 552 TYR A CG    1 
ATOM   4359  C  CD1   . TYR A 1 573 ? -3.010  -21.420 30.075  1.00 119.79 ? 552 TYR A CD1   1 
ATOM   4360  C  CD2   . TYR A 1 573 ? -3.541  -23.729 30.115  1.00 93.19  ? 552 TYR A CD2   1 
ATOM   4361  C  CE1   . TYR A 1 573 ? -2.492  -21.502 31.372  1.00 142.63 ? 552 TYR A CE1   1 
ATOM   4362  C  CE2   . TYR A 1 573 ? -3.038  -23.828 31.408  1.00 122.33 ? 552 TYR A CE2   1 
ATOM   4363  C  CZ    . TYR A 1 573 ? -2.508  -22.709 32.041  1.00 146.89 ? 552 TYR A CZ    1 
ATOM   4364  O  OH    . TYR A 1 573 ? -1.997  -22.787 33.332  1.00 146.99 ? 552 TYR A OH    1 
ATOM   4365  N  N     . VAL A 1 574 ? -6.245  -20.690 26.021  1.00 134.22 ? 553 VAL A N     1 
ATOM   4366  C  CA    . VAL A 1 574 ? -6.737  -20.383 24.674  1.00 135.54 ? 553 VAL A CA    1 
ATOM   4367  C  C     . VAL A 1 574 ? -5.675  -19.580 23.915  1.00 143.53 ? 553 VAL A C     1 
ATOM   4368  O  O     . VAL A 1 574 ? -5.063  -18.663 24.482  1.00 143.73 ? 553 VAL A O     1 
ATOM   4369  C  CB    . VAL A 1 574 ? -8.086  -19.630 24.722  1.00 123.35 ? 553 VAL A CB    1 
ATOM   4370  C  CG1   . VAL A 1 574 ? -8.455  -19.144 23.353  1.00 111.86 ? 553 VAL A CG1   1 
ATOM   4371  C  CG2   . VAL A 1 574 ? -9.209  -20.516 25.218  1.00 102.46 ? 553 VAL A CG2   1 
ATOM   4372  N  N     . ARG A 1 575 ? -5.427  -19.966 22.645  1.00 158.10 ? 554 ARG A N     1 
ATOM   4373  C  CA    . ARG A 1 575 ? -4.648  -19.242 21.632  1.00 161.68 ? 554 ARG A CA    1 
ATOM   4374  C  C     . ARG A 1 575 ? -5.546  -18.806 20.472  1.00 155.61 ? 554 ARG A C     1 
ATOM   4375  O  O     . ARG A 1 575 ? -6.616  -19.379 20.248  1.00 160.84 ? 554 ARG A O     1 
ATOM   4376  C  CB    . ARG A 1 575 ? -3.484  -20.088 21.057  1.00 163.48 ? 554 ARG A CB    1 
ATOM   4377  C  CG    . ARG A 1 575 ? -3.860  -20.945 19.815  1.00 154.92 ? 554 ARG A CG    1 
ATOM   4378  C  CD    . ARG A 1 575 ? -2.797  -20.974 18.676  1.00 178.36 ? 554 ARG A CD    1 
ATOM   4379  N  NE    . ARG A 1 575 ? -3.396  -21.416 17.400  1.00 197.41 ? 554 ARG A NE    1 
ATOM   4380  C  CZ    . ARG A 1 575 ? -2.734  -21.752 16.287  1.00 182.61 ? 554 ARG A CZ    1 
ATOM   4381  N  NH1   . ARG A 1 575 ? -3.411  -22.134 15.212  1.00 147.38 ? 554 ARG A NH1   1 
ATOM   4382  N  NH2   . ARG A 1 575 ? -1.407  -21.720 16.239  1.00 194.10 ? 554 ARG A NH2   1 
ATOM   4383  N  N     . TRP A 1 576 ? -5.111  -17.772 19.741  1.00 142.42 ? 555 TRP A N     1 
ATOM   4384  C  CA    . TRP A 1 576 ? -5.878  -17.219 18.629  1.00 162.30 ? 555 TRP A CA    1 
ATOM   4385  C  C     . TRP A 1 576 ? -5.259  -17.553 17.275  1.00 181.77 ? 555 TRP A C     1 
ATOM   4386  O  O     . TRP A 1 576 ? -4.039  -17.676 17.148  1.00 184.71 ? 555 TRP A O     1 
ATOM   4387  C  CB    . TRP A 1 576 ? -5.997  -15.701 18.758  1.00 162.75 ? 555 TRP A CB    1 
ATOM   4388  C  CG    . TRP A 1 576 ? -6.666  -15.268 20.016  1.00 161.69 ? 555 TRP A CG    1 
ATOM   4389  C  CD1   . TRP A 1 576 ? -6.095  -14.568 21.039  1.00 136.77 ? 555 TRP A CD1   1 
ATOM   4390  C  CD2   . TRP A 1 576 ? -8.031  -15.504 20.403  1.00 179.52 ? 555 TRP A CD2   1 
ATOM   4391  N  NE1   . TRP A 1 576 ? -7.015  -14.355 22.039  1.00 149.33 ? 555 TRP A NE1   1 
ATOM   4392  C  CE2   . TRP A 1 576 ? -8.211  -14.917 21.674  1.00 174.62 ? 555 TRP A CE2   1 
ATOM   4393  C  CE3   . TRP A 1 576 ? -9.117  -16.153 19.801  1.00 179.51 ? 555 TRP A CE3   1 
ATOM   4394  C  CZ2   . TRP A 1 576 ? -9.438  -14.957 22.354  1.00 168.37 ? 555 TRP A CZ2   1 
ATOM   4395  C  CZ3   . TRP A 1 576 ? -10.334 -16.198 20.488  1.00 166.75 ? 555 TRP A CZ3   1 
ATOM   4396  C  CH2   . TRP A 1 576 ? -10.482 -15.604 21.745  1.00 156.49 ? 555 TRP A CH2   1 
ATOM   4397  N  N     . HIS A 1 577 ? -6.114  -17.662 16.258  1.00 183.71 ? 556 HIS A N     1 
ATOM   4398  C  CA    . HIS A 1 577 ? -5.659  -17.842 14.884  1.00 186.33 ? 556 HIS A CA    1 
ATOM   4399  C  C     . HIS A 1 577 ? -6.827  -17.736 13.902  1.00 192.70 ? 556 HIS A C     1 
ATOM   4400  O  O     . HIS A 1 577 ? -7.963  -18.095 14.218  1.00 179.33 ? 556 HIS A O     1 
ATOM   4401  C  CB    . HIS A 1 577 ? -4.949  -19.179 14.697  1.00 197.22 ? 556 HIS A CB    1 
ATOM   4402  C  CG    . HIS A 1 577 ? -4.281  -19.319 13.362  1.00 215.91 ? 556 HIS A CG    1 
ATOM   4403  N  ND1   . HIS A 1 577 ? -4.982  -19.548 12.196  1.00 221.40 ? 556 HIS A ND1   1 
ATOM   4404  C  CD2   . HIS A 1 577 ? -2.975  -19.258 13.008  1.00 214.68 ? 556 HIS A CD2   1 
ATOM   4405  C  CE1   . HIS A 1 577 ? -4.138  -19.630 11.184  1.00 214.11 ? 556 HIS A CE1   1 
ATOM   4406  N  NE2   . HIS A 1 577 ? -2.914  -19.459 11.649  1.00 217.12 ? 556 HIS A NE2   1 
ATOM   4407  N  N     . PRO B 1 38  ? -9.177  -38.288 133.720 1.00 192.82 ? 17  PRO B N     1 
ATOM   4408  C  CA    . PRO B 1 38  ? -10.008 -38.208 132.514 1.00 206.67 ? 17  PRO B CA    1 
ATOM   4409  C  C     . PRO B 1 38  ? -10.392 -36.775 132.139 1.00 227.32 ? 17  PRO B C     1 
ATOM   4410  O  O     . PRO B 1 38  ? -11.048 -36.065 132.898 1.00 239.93 ? 17  PRO B O     1 
ATOM   4411  C  CB    . PRO B 1 38  ? -11.247 -39.021 132.895 1.00 195.21 ? 17  PRO B CB    1 
ATOM   4412  C  CG    . PRO B 1 38  ? -11.355 -38.855 134.353 1.00 196.65 ? 17  PRO B CG    1 
ATOM   4413  C  CD    . PRO B 1 38  ? -9.937  -38.808 134.870 1.00 201.36 ? 17  PRO B CD    1 
ATOM   4414  N  N     . GLU B 1 39  ? -9.966  -36.360 130.955 1.00 226.90 ? 18  GLU B N     1 
ATOM   4415  C  CA    . GLU B 1 39  ? -10.305 -35.057 130.404 1.00 218.57 ? 18  GLU B CA    1 
ATOM   4416  C  C     . GLU B 1 39  ? -11.683 -35.165 129.762 1.00 224.13 ? 18  GLU B C     1 
ATOM   4417  O  O     . GLU B 1 39  ? -11.855 -35.910 128.789 1.00 223.96 ? 18  GLU B O     1 
ATOM   4418  C  CB    . GLU B 1 39  ? -9.244  -34.618 129.398 1.00 196.86 ? 18  GLU B CB    1 
ATOM   4419  C  CG    . GLU B 1 39  ? -8.088  -35.606 129.278 1.00 179.98 ? 18  GLU B CG    1 
ATOM   4420  C  CD    . GLU B 1 39  ? -7.656  -35.817 127.844 1.00 161.19 ? 18  GLU B CD    1 
ATOM   4421  O  OE1   . GLU B 1 39  ? -7.170  -34.838 127.221 1.00 147.43 ? 18  GLU B OE1   1 
ATOM   4422  O  OE2   . GLU B 1 39  ? -7.821  -36.954 127.337 1.00 152.49 ? 18  GLU B OE2   1 
ATOM   4423  N  N     . PRO B 1 40  ? -12.704 -34.515 130.316 1.00 215.67 ? 19  PRO B N     1 
ATOM   4424  C  CA    . PRO B 1 40  ? -14.051 -34.681 129.746 1.00 197.38 ? 19  PRO B CA    1 
ATOM   4425  C  C     . PRO B 1 40  ? -14.315 -33.949 128.435 1.00 169.22 ? 19  PRO B C     1 
ATOM   4426  O  O     . PRO B 1 40  ? -14.693 -34.555 127.429 1.00 152.54 ? 19  PRO B O     1 
ATOM   4427  C  CB    . PRO B 1 40  ? -14.945 -34.133 130.863 1.00 201.36 ? 19  PRO B CB    1 
ATOM   4428  C  CG    . PRO B 1 40  ? -14.083 -33.044 131.524 1.00 202.62 ? 19  PRO B CG    1 
ATOM   4429  C  CD    . PRO B 1 40  ? -12.645 -33.483 131.373 1.00 202.16 ? 19  PRO B CD    1 
ATOM   4430  N  N     . PHE B 1 41  ? -14.123 -32.632 128.470 1.00 164.98 ? 20  PHE B N     1 
ATOM   4431  C  CA    . PHE B 1 41  ? -14.414 -31.697 127.393 1.00 149.71 ? 20  PHE B CA    1 
ATOM   4432  C  C     . PHE B 1 41  ? -13.212 -31.188 126.618 1.00 145.19 ? 20  PHE B C     1 
ATOM   4433  O  O     . PHE B 1 41  ? -13.354 -30.166 125.943 1.00 156.86 ? 20  PHE B O     1 
ATOM   4434  C  CB    . PHE B 1 41  ? -15.207 -30.506 127.903 1.00 152.80 ? 20  PHE B CB    1 
ATOM   4435  C  CG    . PHE B 1 41  ? -16.653 -30.782 127.996 1.00 185.08 ? 20  PHE B CG    1 
ATOM   4436  C  CD1   . PHE B 1 41  ? -17.361 -31.134 126.861 1.00 181.37 ? 20  PHE B CD1   1 
ATOM   4437  C  CD2   . PHE B 1 41  ? -17.320 -30.674 129.194 1.00 206.03 ? 20  PHE B CD2   1 
ATOM   4438  C  CE1   . PHE B 1 41  ? -18.710 -31.401 126.925 1.00 188.50 ? 20  PHE B CE1   1 
ATOM   4439  C  CE2   . PHE B 1 41  ? -18.672 -30.929 129.266 1.00 216.17 ? 20  PHE B CE2   1 
ATOM   4440  C  CZ    . PHE B 1 41  ? -19.369 -31.295 128.125 1.00 199.50 ? 20  PHE B CZ    1 
ATOM   4441  N  N     . TYR B 1 42  ? -12.035 -31.803 126.734 1.00 144.47 ? 21  TYR B N     1 
ATOM   4442  C  CA    . TYR B 1 42  ? -10.798 -31.200 126.218 1.00 146.41 ? 21  TYR B CA    1 
ATOM   4443  C  C     . TYR B 1 42  ? -10.944 -30.492 124.877 1.00 136.83 ? 21  TYR B C     1 
ATOM   4444  O  O     . TYR B 1 42  ? -10.291 -29.472 124.648 1.00 134.77 ? 21  TYR B O     1 
ATOM   4445  C  CB    . TYR B 1 42  ? -9.718  -32.263 126.074 1.00 146.56 ? 21  TYR B CB    1 
ATOM   4446  C  CG    . TYR B 1 42  ? -10.087 -33.235 125.011 1.00 138.87 ? 21  TYR B CG    1 
ATOM   4447  C  CD1   . TYR B 1 42  ? -10.972 -34.255 125.293 1.00 165.96 ? 21  TYR B CD1   1 
ATOM   4448  C  CD2   . TYR B 1 42  ? -9.583  -33.132 123.729 1.00 134.90 ? 21  TYR B CD2   1 
ATOM   4449  C  CE1   . TYR B 1 42  ? -11.344 -35.151 124.342 1.00 162.24 ? 21  TYR B CE1   1 
ATOM   4450  C  CE2   . TYR B 1 42  ? -9.954  -34.030 122.759 1.00 134.00 ? 21  TYR B CE2   1 
ATOM   4451  C  CZ    . TYR B 1 42  ? -10.837 -35.040 123.083 1.00 141.03 ? 21  TYR B CZ    1 
ATOM   4452  O  OH    . TYR B 1 42  ? -11.233 -35.956 122.162 1.00 135.14 ? 21  TYR B OH    1 
ATOM   4453  N  N     . TYR B 1 43  ? -11.786 -31.013 123.986 1.00 135.72 ? 22  TYR B N     1 
ATOM   4454  C  CA    . TYR B 1 43  ? -11.943 -30.371 122.686 1.00 135.85 ? 22  TYR B CA    1 
ATOM   4455  C  C     . TYR B 1 43  ? -12.568 -28.988 122.825 1.00 132.42 ? 22  TYR B C     1 
ATOM   4456  O  O     . TYR B 1 43  ? -12.221 -28.062 122.088 1.00 142.80 ? 22  TYR B O     1 
ATOM   4457  C  CB    . TYR B 1 43  ? -12.801 -31.228 121.741 1.00 140.89 ? 22  TYR B CB    1 
ATOM   4458  C  CG    . TYR B 1 43  ? -14.246 -31.439 122.160 1.00 134.16 ? 22  TYR B CG    1 
ATOM   4459  C  CD1   . TYR B 1 43  ? -14.640 -32.594 122.819 1.00 137.17 ? 22  TYR B CD1   1 
ATOM   4460  C  CD2   . TYR B 1 43  ? -15.218 -30.505 121.849 1.00 134.27 ? 22  TYR B CD2   1 
ATOM   4461  C  CE1   . TYR B 1 43  ? -15.955 -32.789 123.199 1.00 140.21 ? 22  TYR B CE1   1 
ATOM   4462  C  CE2   . TYR B 1 43  ? -16.529 -30.689 122.226 1.00 137.43 ? 22  TYR B CE2   1 
ATOM   4463  C  CZ    . TYR B 1 43  ? -16.895 -31.834 122.900 1.00 140.36 ? 22  TYR B CZ    1 
ATOM   4464  O  OH    . TYR B 1 43  ? -18.207 -32.016 123.273 1.00 143.80 ? 22  TYR B OH    1 
ATOM   4465  N  N     . LEU B 1 44  ? -13.482 -28.822 123.765 1.00 136.12 ? 23  LEU B N     1 
ATOM   4466  C  CA    . LEU B 1 44  ? -14.082 -27.511 123.950 1.00 147.64 ? 23  LEU B CA    1 
ATOM   4467  C  C     . LEU B 1 44  ? -13.162 -26.587 124.748 1.00 151.97 ? 23  LEU B C     1 
ATOM   4468  O  O     . LEU B 1 44  ? -13.057 -25.394 124.428 1.00 144.99 ? 23  LEU B O     1 
ATOM   4469  C  CB    . LEU B 1 44  ? -15.450 -27.669 124.618 1.00 153.02 ? 23  LEU B CB    1 
ATOM   4470  C  CG    . LEU B 1 44  ? -16.349 -26.451 124.829 1.00 148.30 ? 23  LEU B CG    1 
ATOM   4471  C  CD1   . LEU B 1 44  ? -16.670 -25.755 123.516 1.00 140.67 ? 23  LEU B CD1   1 
ATOM   4472  C  CD2   . LEU B 1 44  ? -17.612 -26.891 125.528 1.00 150.83 ? 23  LEU B CD2   1 
ATOM   4473  N  N     . HIS B 1 45  ? -12.465 -27.121 125.766 1.00 150.95 ? 24  HIS B N     1 
ATOM   4474  C  CA    . HIS B 1 45  ? -11.502 -26.307 126.510 1.00 152.96 ? 24  HIS B CA    1 
ATOM   4475  C  C     . HIS B 1 45  ? -10.526 -25.648 125.546 1.00 156.04 ? 24  HIS B C     1 
ATOM   4476  O  O     . HIS B 1 45  ? -10.343 -24.424 125.571 1.00 163.71 ? 24  HIS B O     1 
ATOM   4477  C  CB    . HIS B 1 45  ? -10.712 -27.139 127.542 1.00 166.93 ? 24  HIS B CB    1 
ATOM   4478  C  CG    . HIS B 1 45  ? -11.541 -27.820 128.600 1.00 176.75 ? 24  HIS B CG    1 
ATOM   4479  N  ND1   . HIS B 1 45  ? -12.810 -27.409 128.949 1.00 180.41 ? 24  HIS B ND1   1 
ATOM   4480  C  CD2   . HIS B 1 45  ? -11.250 -28.862 129.420 1.00 176.04 ? 24  HIS B CD2   1 
ATOM   4481  C  CE1   . HIS B 1 45  ? -13.278 -28.186 129.912 1.00 176.99 ? 24  HIS B CE1   1 
ATOM   4482  N  NE2   . HIS B 1 45  ? -12.350 -29.076 130.217 1.00 174.73 ? 24  HIS B NE2   1 
ATOM   4483  N  N     . ASN B 1 46  ? -9.938  -26.455 124.645 1.00 149.13 ? 25  ASN B N     1 
ATOM   4484  C  CA    . ASN B 1 46  ? -8.958  -25.963 123.677 1.00 136.65 ? 25  ASN B CA    1 
ATOM   4485  C  C     . ASN B 1 46  ? -9.561  -24.949 122.715 1.00 141.44 ? 25  ASN B C     1 
ATOM   4486  O  O     . ASN B 1 46  ? -8.867  -24.019 122.276 1.00 124.85 ? 25  ASN B O     1 
ATOM   4487  C  CB    . ASN B 1 46  ? -8.407  -27.121 122.846 1.00 126.87 ? 25  ASN B CB    1 
ATOM   4488  C  CG    . ASN B 1 46  ? -7.691  -28.154 123.666 1.00 141.70 ? 25  ASN B CG    1 
ATOM   4489  O  OD1   . ASN B 1 46  ? -7.345  -27.931 124.827 1.00 150.45 ? 25  ASN B OD1   1 
ATOM   4490  N  ND2   . ASN B 1 46  ? -7.472  -29.321 123.060 1.00 131.53 ? 25  ASN B ND2   1 
ATOM   4491  N  N     . PHE B 1 47  ? -10.849 -25.104 122.385 1.00 127.80 ? 26  PHE B N     1 
ATOM   4492  C  CA    . PHE B 1 47  ? -11.476 -24.199 121.429 1.00 126.33 ? 26  PHE B CA    1 
ATOM   4493  C  C     . PHE B 1 47  ? -11.722 -22.842 122.058 1.00 128.22 ? 26  PHE B C     1 
ATOM   4494  O  O     . PHE B 1 47  ? -11.354 -21.806 121.491 1.00 126.47 ? 26  PHE B O     1 
ATOM   4495  C  CB    . PHE B 1 47  ? -12.791 -24.803 120.935 1.00 127.15 ? 26  PHE B CB    1 
ATOM   4496  C  CG    . PHE B 1 47  ? -13.473 -23.994 119.868 1.00 125.86 ? 26  PHE B CG    1 
ATOM   4497  C  CD1   . PHE B 1 47  ? -13.036 -24.018 118.579 1.00 122.36 ? 26  PHE B CD1   1 
ATOM   4498  C  CD2   . PHE B 1 47  ? -14.516 -23.152 120.178 1.00 130.48 ? 26  PHE B CD2   1 
ATOM   4499  C  CE1   . PHE B 1 47  ? -13.667 -23.262 117.628 1.00 121.56 ? 26  PHE B CE1   1 
ATOM   4500  C  CE2   . PHE B 1 47  ? -15.128 -22.383 119.212 1.00 127.82 ? 26  PHE B CE2   1 
ATOM   4501  C  CZ    . PHE B 1 47  ? -14.708 -22.440 117.956 1.00 124.31 ? 26  PHE B CZ    1 
ATOM   4502  N  N     . ARG B 1 48  ? -12.312 -22.830 123.252 1.00 132.09 ? 27  ARG B N     1 
ATOM   4503  C  CA    . ARG B 1 48  ? -12.446 -21.567 123.953 1.00 134.33 ? 27  ARG B CA    1 
ATOM   4504  C  C     . ARG B 1 48  ? -11.082 -20.944 124.177 1.00 176.53 ? 27  ARG B C     1 
ATOM   4505  O  O     . ARG B 1 48  ? -10.921 -19.719 124.059 1.00 169.48 ? 27  ARG B O     1 
ATOM   4506  C  CB    . ARG B 1 48  ? -13.191 -21.777 125.255 1.00 139.12 ? 27  ARG B CB    1 
ATOM   4507  C  CG    . ARG B 1 48  ? -14.566 -22.314 124.994 1.00 141.05 ? 27  ARG B CG    1 
ATOM   4508  C  CD    . ARG B 1 48  ? -15.515 -21.995 126.129 1.00 159.37 ? 27  ARG B CD    1 
ATOM   4509  N  NE    . ARG B 1 48  ? -15.494 -20.574 126.496 1.00 174.31 ? 27  ARG B NE    1 
ATOM   4510  C  CZ    . ARG B 1 48  ? -16.365 -19.661 126.064 1.00 178.92 ? 27  ARG B CZ    1 
ATOM   4511  N  NH1   . ARG B 1 48  ? -17.335 -20.004 125.233 1.00 172.66 ? 27  ARG B NH1   1 
ATOM   4512  N  NH2   . ARG B 1 48  ? -16.270 -18.400 126.465 1.00 186.76 ? 27  ARG B NH2   1 
ATOM   4513  N  N     . ALA B 1 49  ? -10.075 -21.780 124.413 1.00 145.28 ? 28  ALA B N     1 
ATOM   4514  C  CA    . ALA B 1 49  ? -8.722  -21.269 124.486 1.00 141.88 ? 28  ALA B CA    1 
ATOM   4515  C  C     . ALA B 1 49  ? -8.378  -20.512 123.211 1.00 140.38 ? 28  ALA B C     1 
ATOM   4516  O  O     . ALA B 1 49  ? -7.918  -19.364 123.264 1.00 160.51 ? 28  ALA B O     1 
ATOM   4517  C  CB    . ALA B 1 49  ? -7.746  -22.422 124.717 1.00 146.61 ? 28  ALA B CB    1 
ATOM   4518  N  N     . VAL B 1 50  ? -8.650  -21.108 122.048 1.00 128.08 ? 29  VAL B N     1 
ATOM   4519  C  CA    . VAL B 1 50  ? -8.260  -20.395 120.837 1.00 127.16 ? 29  VAL B CA    1 
ATOM   4520  C  C     . VAL B 1 50  ? -9.088  -19.122 120.664 1.00 142.28 ? 29  VAL B C     1 
ATOM   4521  O  O     . VAL B 1 50  ? -8.553  -18.103 120.211 1.00 144.45 ? 29  VAL B O     1 
ATOM   4522  C  CB    . VAL B 1 50  ? -8.320  -21.309 119.594 1.00 141.47 ? 29  VAL B CB    1 
ATOM   4523  C  CG1   . VAL B 1 50  ? -8.287  -20.487 118.298 1.00 120.15 ? 29  VAL B CG1   1 
ATOM   4524  C  CG2   . VAL B 1 50  ? -7.158  -22.263 119.594 1.00 130.15 ? 29  VAL B CG2   1 
ATOM   4525  N  N     . LEU B 1 51  ? -10.364 -19.112 121.080 1.00 126.82 ? 30  LEU B N     1 
ATOM   4526  C  CA    . LEU B 1 51  ? -11.124 -17.867 120.959 1.00 146.57 ? 30  LEU B CA    1 
ATOM   4527  C  C     . LEU B 1 51  ? -10.497 -16.750 121.777 1.00 147.70 ? 30  LEU B C     1 
ATOM   4528  O  O     . LEU B 1 51  ? -10.400 -15.612 121.302 1.00 132.45 ? 30  LEU B O     1 
ATOM   4529  C  CB    . LEU B 1 51  ? -12.586 -18.051 121.357 1.00 137.98 ? 30  LEU B CB    1 
ATOM   4530  C  CG    . LEU B 1 51  ? -13.503 -18.798 120.400 1.00 156.76 ? 30  LEU B CG    1 
ATOM   4531  C  CD1   . LEU B 1 51  ? -14.937 -18.662 120.884 1.00 164.25 ? 30  LEU B CD1   1 
ATOM   4532  C  CD2   . LEU B 1 51  ? -13.358 -18.212 119.012 1.00 143.51 ? 30  LEU B CD2   1 
ATOM   4533  N  N     . ALA B 1 52  ? -10.070 -17.047 123.008 1.00 158.42 ? 31  ALA B N     1 
ATOM   4534  C  CA    . ALA B 1 52  ? -9.386  -16.023 123.794 1.00 158.17 ? 31  ALA B CA    1 
ATOM   4535  C  C     . ALA B 1 52  ? -8.110  -15.572 123.084 1.00 159.46 ? 31  ALA B C     1 
ATOM   4536  O  O     . ALA B 1 52  ? -7.874  -14.367 122.913 1.00 173.61 ? 31  ALA B O     1 
ATOM   4537  C  CB    . ALA B 1 52  ? -9.087  -16.530 125.213 1.00 148.91 ? 31  ALA B CB    1 
ATOM   4538  N  N     . TRP B 1 53  ? -7.296  -16.532 122.620 1.00 150.30 ? 32  TRP B N     1 
ATOM   4539  C  CA    . TRP B 1 53  ? -6.039  -16.181 121.964 1.00 133.47 ? 32  TRP B CA    1 
ATOM   4540  C  C     . TRP B 1 53  ? -6.270  -15.235 120.791 1.00 145.36 ? 32  TRP B C     1 
ATOM   4541  O  O     . TRP B 1 53  ? -5.647  -14.164 120.710 1.00 175.69 ? 32  TRP B O     1 
ATOM   4542  C  CB    . TRP B 1 53  ? -5.318  -17.443 121.501 1.00 140.47 ? 32  TRP B CB    1 
ATOM   4543  C  CG    . TRP B 1 53  ? -3.926  -17.167 120.977 1.00 162.32 ? 32  TRP B CG    1 
ATOM   4544  C  CD1   . TRP B 1 53  ? -3.588  -16.740 119.724 1.00 156.02 ? 32  TRP B CD1   1 
ATOM   4545  C  CD2   . TRP B 1 53  ? -2.695  -17.306 121.696 1.00 158.02 ? 32  TRP B CD2   1 
ATOM   4546  N  NE1   . TRP B 1 53  ? -2.230  -16.596 119.628 1.00 155.73 ? 32  TRP B NE1   1 
ATOM   4547  C  CE2   . TRP B 1 53  ? -1.660  -16.938 120.825 1.00 149.30 ? 32  TRP B CE2   1 
ATOM   4548  C  CE3   . TRP B 1 53  ? -2.373  -17.696 122.996 1.00 187.04 ? 32  TRP B CE3   1 
ATOM   4549  C  CZ2   . TRP B 1 53  ? -0.324  -16.951 121.209 1.00 167.71 ? 32  TRP B CZ2   1 
ATOM   4550  C  CZ3   . TRP B 1 53  ? -1.044  -17.707 123.376 1.00 192.64 ? 32  TRP B CZ3   1 
ATOM   4551  C  CH2   . TRP B 1 53  ? -0.037  -17.337 122.485 1.00 182.43 ? 32  TRP B CH2   1 
ATOM   4552  N  N     . ILE B 1 54  ? -7.203  -15.587 119.901 1.00 142.05 ? 33  ILE B N     1 
ATOM   4553  C  CA    . ILE B 1 54  ? -7.542  -14.707 118.783 1.00 157.30 ? 33  ILE B CA    1 
ATOM   4554  C  C     . ILE B 1 54  ? -8.104  -13.410 119.322 1.00 177.72 ? 33  ILE B C     1 
ATOM   4555  O  O     . ILE B 1 54  ? -7.951  -12.344 118.705 1.00 187.24 ? 33  ILE B O     1 
ATOM   4556  C  CB    . ILE B 1 54  ? -8.551  -15.384 117.828 1.00 152.56 ? 33  ILE B CB    1 
ATOM   4557  C  CG1   . ILE B 1 54  ? -7.870  -16.425 116.954 1.00 144.91 ? 33  ILE B CG1   1 
ATOM   4558  C  CG2   . ILE B 1 54  ? -9.249  -14.365 116.927 1.00 154.35 ? 33  ILE B CG2   1 
ATOM   4559  C  CD1   . ILE B 1 54  ? -8.849  -17.385 116.315 1.00 140.14 ? 33  ILE B CD1   1 
ATOM   4560  N  N     . GLY B 1 55  ? -8.709  -13.468 120.508 1.00 175.82 ? 34  GLY B N     1 
ATOM   4561  C  CA    . GLY B 1 55  ? -9.253  -12.267 121.104 1.00 174.81 ? 34  GLY B CA    1 
ATOM   4562  C  C     . GLY B 1 55  ? -8.188  -11.230 121.403 1.00 169.99 ? 34  GLY B C     1 
ATOM   4563  O  O     . GLY B 1 55  ? -8.341  -10.057 121.062 1.00 170.31 ? 34  GLY B O     1 
ATOM   4564  N  N     . GLU B 1 56  ? -7.091  -11.635 122.046 1.00 170.26 ? 35  GLU B N     1 
ATOM   4565  C  CA    . GLU B 1 56  ? -6.141  -10.573 122.349 1.00 174.78 ? 35  GLU B CA    1 
ATOM   4566  C  C     . GLU B 1 56  ? -5.207  -10.280 121.178 1.00 155.49 ? 35  GLU B C     1 
ATOM   4567  O  O     . GLU B 1 56  ? -5.025  -9.114  120.808 1.00 159.53 ? 35  GLU B O     1 
ATOM   4568  C  CB    . GLU B 1 56  ? -5.337  -10.871 123.626 1.00 176.79 ? 35  GLU B CB    1 
ATOM   4569  C  CG    . GLU B 1 56  ? -4.384  -12.051 123.605 1.00 184.43 ? 35  GLU B CG    1 
ATOM   4570  C  CD    . GLU B 1 56  ? -3.593  -12.167 124.906 1.00 189.28 ? 35  GLU B CD    1 
ATOM   4571  O  OE1   . GLU B 1 56  ? -4.000  -11.551 125.920 1.00 159.64 ? 35  GLU B OE1   1 
ATOM   4572  O  OE2   . GLU B 1 56  ? -2.554  -12.868 124.909 1.00 209.39 ? 35  GLU B OE2   1 
ATOM   4573  N  N     . ARG B 1 57  ? -4.683  -11.307 120.519 1.00 152.76 ? 36  ARG B N     1 
ATOM   4574  C  CA    . ARG B 1 57  ? -3.599  -11.035 119.580 1.00 169.47 ? 36  ARG B CA    1 
ATOM   4575  C  C     . ARG B 1 57  ? -4.113  -10.444 118.269 1.00 175.25 ? 36  ARG B C     1 
ATOM   4576  O  O     . ARG B 1 57  ? -3.465  -9.576  117.668 1.00 165.41 ? 36  ARG B O     1 
ATOM   4577  C  CB    . ARG B 1 57  ? -2.807  -12.318 119.342 1.00 174.80 ? 36  ARG B CB    1 
ATOM   4578  C  CG    . ARG B 1 57  ? -1.338  -12.101 119.146 1.00 187.75 ? 36  ARG B CG    1 
ATOM   4579  C  CD    . ARG B 1 57  ? -0.619  -13.424 119.194 1.00 190.49 ? 36  ARG B CD    1 
ATOM   4580  N  NE    . ARG B 1 57  ? -0.169  -13.738 120.545 1.00 196.28 ? 36  ARG B NE    1 
ATOM   4581  C  CZ    . ARG B 1 57  ? 1.110   -13.772 120.909 1.00 198.41 ? 36  ARG B CZ    1 
ATOM   4582  N  NH1   . ARG B 1 57  ? 2.068   -13.508 120.021 1.00 178.05 ? 36  ARG B NH1   1 
ATOM   4583  N  NH2   . ARG B 1 57  ? 1.426   -14.070 122.162 1.00 208.35 ? 36  ARG B NH2   1 
ATOM   4584  N  N     . TYR B 1 58  ? -5.238  -10.946 117.784 1.00 170.29 ? 37  TYR B N     1 
ATOM   4585  C  CA    . TYR B 1 58  ? -5.848  -10.498 116.547 1.00 167.00 ? 37  TYR B CA    1 
ATOM   4586  C  C     . TYR B 1 58  ? -6.987  -9.518  116.779 1.00 192.75 ? 37  TYR B C     1 
ATOM   4587  O  O     . TYR B 1 58  ? -7.767  -9.275  115.851 1.00 196.65 ? 37  TYR B O     1 
ATOM   4588  C  CB    . TYR B 1 58  ? -6.323  -11.695 115.742 1.00 157.74 ? 37  TYR B CB    1 
ATOM   4589  C  CG    . TYR B 1 58  ? -5.173  -12.456 115.168 1.00 148.97 ? 37  TYR B CG    1 
ATOM   4590  C  CD1   . TYR B 1 58  ? -4.467  -13.377 115.938 1.00 140.35 ? 37  TYR B CD1   1 
ATOM   4591  C  CD2   . TYR B 1 58  ? -4.779  -12.247 113.859 1.00 157.51 ? 37  TYR B CD2   1 
ATOM   4592  C  CE1   . TYR B 1 58  ? -3.405  -14.083 115.410 1.00 158.37 ? 37  TYR B CE1   1 
ATOM   4593  C  CE2   . TYR B 1 58  ? -3.721  -12.941 113.315 1.00 176.84 ? 37  TYR B CE2   1 
ATOM   4594  C  CZ    . TYR B 1 58  ? -3.033  -13.860 114.090 1.00 176.99 ? 37  TYR B CZ    1 
ATOM   4595  O  OH    . TYR B 1 58  ? -1.975  -14.550 113.536 1.00 179.20 ? 37  TYR B OH    1 
ATOM   4596  N  N     . ALA B 1 59  ? -7.137  -9.007  118.010 1.00 177.42 ? 38  ALA B N     1 
ATOM   4597  C  CA    . ALA B 1 59  ? -8.248  -8.118  118.355 1.00 189.33 ? 38  ALA B CA    1 
ATOM   4598  C  C     . ALA B 1 59  ? -8.501  -7.061  117.292 1.00 195.85 ? 38  ALA B C     1 
ATOM   4599  O  O     . ALA B 1 59  ? -9.637  -6.871  116.838 1.00 197.32 ? 38  ALA B O     1 
ATOM   4600  C  CB    . ALA B 1 59  ? -7.962  -7.434  119.692 1.00 184.85 ? 38  ALA B CB    1 
ATOM   4601  N  N     . ASP B 1 60  ? -7.439  -6.374  116.873 1.00 201.92 ? 39  ASP B N     1 
ATOM   4602  C  CA    . ASP B 1 60  ? -7.555  -5.313  115.884 1.00 191.97 ? 39  ASP B CA    1 
ATOM   4603  C  C     . ASP B 1 60  ? -7.938  -5.837  114.503 1.00 162.05 ? 39  ASP B C     1 
ATOM   4604  O  O     . ASP B 1 60  ? -8.314  -5.040  113.634 1.00 141.44 ? 39  ASP B O     1 
ATOM   4605  C  CB    . ASP B 1 60  ? -6.240  -4.512  115.857 1.00 194.64 ? 39  ASP B CB    1 
ATOM   4606  C  CG    . ASP B 1 60  ? -4.993  -5.399  115.768 1.00 204.28 ? 39  ASP B CG    1 
ATOM   4607  O  OD1   . ASP B 1 60  ? -5.096  -6.634  115.945 1.00 214.93 ? 39  ASP B OD1   1 
ATOM   4608  O  OD2   . ASP B 1 60  ? -3.890  -4.846  115.549 1.00 200.97 ? 39  ASP B OD2   1 
ATOM   4609  N  N     . LEU B 1 61  ? -7.873  -7.154  114.288 1.00 174.67 ? 40  LEU B N     1 
ATOM   4610  C  CA    . LEU B 1 61  ? -8.230  -7.746  113.011 1.00 173.09 ? 40  LEU B CA    1 
ATOM   4611  C  C     . LEU B 1 61  ? -9.688  -8.187  112.940 1.00 193.30 ? 40  LEU B C     1 
ATOM   4612  O  O     . LEU B 1 61  ? -10.174 -8.484  111.841 1.00 199.80 ? 40  LEU B O     1 
ATOM   4613  C  CB    . LEU B 1 61  ? -7.329  -8.948  112.722 1.00 149.41 ? 40  LEU B CB    1 
ATOM   4614  C  CG    . LEU B 1 61  ? -5.904  -8.551  112.340 1.00 162.28 ? 40  LEU B CG    1 
ATOM   4615  C  CD1   . LEU B 1 61  ? -5.132  -9.708  111.731 1.00 170.08 ? 40  LEU B CD1   1 
ATOM   4616  C  CD2   . LEU B 1 61  ? -5.878  -7.327  111.449 1.00 153.63 ? 40  LEU B CD2   1 
ATOM   4617  N  N     . LEU B 1 62  ? -10.398 -8.226  114.066 1.00 183.07 ? 41  LEU B N     1 
ATOM   4618  C  CA    . LEU B 1 62  ? -11.777 -8.689  114.052 1.00 185.88 ? 41  LEU B CA    1 
ATOM   4619  C  C     . LEU B 1 62  ? -12.714 -7.608  113.536 1.00 198.64 ? 41  LEU B C     1 
ATOM   4620  O  O     . LEU B 1 62  ? -12.435 -6.410  113.641 1.00 185.63 ? 41  LEU B O     1 
ATOM   4621  C  CB    . LEU B 1 62  ? -12.229 -9.133  115.448 1.00 183.36 ? 41  LEU B CB    1 
ATOM   4622  C  CG    . LEU B 1 62  ? -11.566 -10.345 116.108 1.00 177.47 ? 41  LEU B CG    1 
ATOM   4623  C  CD1   . LEU B 1 62  ? -12.058 -10.531 117.531 1.00 161.33 ? 41  LEU B CD1   1 
ATOM   4624  C  CD2   . LEU B 1 62  ? -11.878 -11.579 115.300 1.00 177.32 ? 41  LEU B CD2   1 
ATOM   4625  N  N     . ASP B 1 63  ? -13.841 -8.050  112.977 1.00 184.69 ? 42  ASP B N     1 
ATOM   4626  C  CA    . ASP B 1 63  ? -14.910 -7.185  112.492 1.00 193.92 ? 42  ASP B CA    1 
ATOM   4627  C  C     . ASP B 1 63  ? -16.135 -7.411  113.385 1.00 185.60 ? 42  ASP B C     1 
ATOM   4628  O  O     . ASP B 1 63  ? -16.060 -8.119  114.393 1.00 189.28 ? 42  ASP B O     1 
ATOM   4629  C  CB    . ASP B 1 63  ? -15.180 -7.419  110.986 1.00 196.47 ? 42  ASP B CB    1 
ATOM   4630  C  CG    . ASP B 1 63  ? -16.035 -8.667  110.678 1.00 215.65 ? 42  ASP B CG    1 
ATOM   4631  O  OD1   . ASP B 1 63  ? -16.277 -9.509  111.565 1.00 231.42 ? 42  ASP B OD1   1 
ATOM   4632  O  OD2   . ASP B 1 63  ? -16.475 -8.804  109.512 1.00 209.49 ? 42  ASP B OD2   1 
ATOM   4633  N  N     . ASP B 1 64  ? -17.260 -6.771  113.052 1.00 188.67 ? 43  ASP B N     1 
ATOM   4634  C  CA    . ASP B 1 64  ? -18.452 -6.951  113.881 1.00 180.33 ? 43  ASP B CA    1 
ATOM   4635  C  C     . ASP B 1 64  ? -18.964 -8.391  113.836 1.00 170.59 ? 43  ASP B C     1 
ATOM   4636  O  O     . ASP B 1 64  ? -19.240 -8.985  114.888 1.00 168.34 ? 43  ASP B O     1 
ATOM   4637  C  CB    . ASP B 1 64  ? -19.547 -5.947  113.513 1.00 194.98 ? 43  ASP B CB    1 
ATOM   4638  C  CG    . ASP B 1 64  ? -19.543 -4.710  114.436 1.00 205.64 ? 43  ASP B CG    1 
ATOM   4639  O  OD1   . ASP B 1 64  ? -20.574 -3.993  114.526 1.00 162.35 ? 43  ASP B OD1   1 
ATOM   4640  O  OD2   . ASP B 1 64  ? -18.516 -4.482  115.113 1.00 205.32 ? 43  ASP B OD2   1 
ATOM   4641  N  N     . GLN B 1 65  ? -19.106 -8.974  112.638 1.00 162.62 ? 44  GLN B N     1 
ATOM   4642  C  CA    . GLN B 1 65  ? -19.611 -10.346 112.561 1.00 181.77 ? 44  GLN B CA    1 
ATOM   4643  C  C     . GLN B 1 65  ? -18.827 -11.274 113.481 1.00 188.91 ? 44  GLN B C     1 
ATOM   4644  O  O     . GLN B 1 65  ? -19.413 -12.001 114.298 1.00 195.56 ? 44  GLN B O     1 
ATOM   4645  C  CB    . GLN B 1 65  ? -19.533 -10.858 111.115 1.00 185.09 ? 44  GLN B CB    1 
ATOM   4646  C  CG    . GLN B 1 65  ? -20.857 -10.838 110.363 1.00 200.49 ? 44  GLN B CG    1 
ATOM   4647  C  CD    . GLN B 1 65  ? -21.388 -9.426  110.145 1.00 205.74 ? 44  GLN B CD    1 
ATOM   4648  O  OE1   . GLN B 1 65  ? -20.623 -8.461  110.105 1.00 209.78 ? 44  GLN B OE1   1 
ATOM   4649  N  NE2   . GLN B 1 65  ? -22.708 -9.299  110.031 1.00 185.73 ? 44  GLN B NE2   1 
ATOM   4650  N  N     . GLU B 1 66  ? -17.501 -11.165 113.447 1.00 189.10 ? 45  GLU B N     1 
ATOM   4651  C  CA    . GLU B 1 66  ? -16.640 -12.091 114.174 1.00 187.94 ? 45  GLU B CA    1 
ATOM   4652  C  C     . GLU B 1 66  ? -16.732 -11.861 115.678 1.00 177.73 ? 45  GLU B C     1 
ATOM   4653  O  O     . GLU B 1 66  ? -17.045 -12.780 116.451 1.00 155.07 ? 45  GLU B O     1 
ATOM   4654  C  CB    . GLU B 1 66  ? -15.202 -11.927 113.670 1.00 170.94 ? 45  GLU B CB    1 
ATOM   4655  C  CG    . GLU B 1 66  ? -15.047 -12.409 112.233 1.00 185.64 ? 45  GLU B CG    1 
ATOM   4656  C  CD    . GLU B 1 66  ? -14.257 -11.461 111.349 1.00 194.64 ? 45  GLU B CD    1 
ATOM   4657  O  OE1   . GLU B 1 66  ? -14.552 -11.425 110.129 1.00 198.66 ? 45  GLU B OE1   1 
ATOM   4658  O  OE2   . GLU B 1 66  ? -13.370 -10.742 111.870 1.00 184.20 ? 45  GLU B OE2   1 
ATOM   4659  N  N     . ARG B 1 67  ? -16.476 -10.624 116.107 1.00 184.88 ? 46  ARG B N     1 
ATOM   4660  C  CA    . ARG B 1 67  ? -16.454 -10.311 117.529 1.00 170.43 ? 46  ARG B CA    1 
ATOM   4661  C  C     . ARG B 1 67  ? -17.791 -10.661 118.156 1.00 167.17 ? 46  ARG B C     1 
ATOM   4662  O  O     . ARG B 1 67  ? -17.851 -11.182 119.279 1.00 157.51 ? 46  ARG B O     1 
ATOM   4663  C  CB    . ARG B 1 67  ? -16.157 -8.825  117.699 1.00 178.09 ? 46  ARG B CB    1 
ATOM   4664  C  CG    . ARG B 1 67  ? -15.397 -8.403  118.927 1.00 181.22 ? 46  ARG B CG    1 
ATOM   4665  C  CD    . ARG B 1 67  ? -15.222 -6.879  118.900 1.00 189.15 ? 46  ARG B CD    1 
ATOM   4666  N  NE    . ARG B 1 67  ? -14.604 -6.386  117.665 1.00 189.25 ? 46  ARG B NE    1 
ATOM   4667  C  CZ    . ARG B 1 67  ? -15.281 -5.859  116.645 1.00 189.25 ? 46  ARG B CZ    1 
ATOM   4668  N  NH1   . ARG B 1 67  ? -14.647 -5.433  115.563 1.00 183.23 ? 46  ARG B NH1   1 
ATOM   4669  N  NH2   . ARG B 1 67  ? -16.599 -5.761  116.702 1.00 195.40 ? 46  ARG B NH2   1 
ATOM   4670  N  N     . ALA B 1 68  ? -18.877 -10.421 117.408 1.00 169.90 ? 47  ALA B N     1 
ATOM   4671  C  CA    . ALA B 1 68  ? -20.210 -10.811 117.845 1.00 182.24 ? 47  ALA B CA    1 
ATOM   4672  C  C     . ALA B 1 68  ? -20.344 -12.318 117.936 1.00 178.98 ? 47  ALA B C     1 
ATOM   4673  O  O     . ALA B 1 68  ? -21.084 -12.821 118.790 1.00 161.83 ? 47  ALA B O     1 
ATOM   4674  C  CB    . ALA B 1 68  ? -21.260 -10.256 116.887 1.00 184.78 ? 47  ALA B CB    1 
ATOM   4675  N  N     . PHE B 1 69  ? -19.648 -13.055 117.064 1.00 180.96 ? 48  PHE B N     1 
ATOM   4676  C  CA    . PHE B 1 69  ? -19.655 -14.507 117.195 1.00 177.69 ? 48  PHE B CA    1 
ATOM   4677  C  C     . PHE B 1 69  ? -18.951 -14.956 118.472 1.00 162.49 ? 48  PHE B C     1 
ATOM   4678  O  O     . PHE B 1 69  ? -19.534 -15.687 119.285 1.00 157.96 ? 48  PHE B O     1 
ATOM   4679  C  CB    . PHE B 1 69  ? -19.008 -15.157 115.975 1.00 167.41 ? 48  PHE B CB    1 
ATOM   4680  C  CG    . PHE B 1 69  ? -18.832 -16.636 116.121 1.00 171.78 ? 48  PHE B CG    1 
ATOM   4681  C  CD1   . PHE B 1 69  ? -17.592 -17.171 116.462 1.00 166.42 ? 48  PHE B CD1   1 
ATOM   4682  C  CD2   . PHE B 1 69  ? -19.904 -17.495 115.923 1.00 168.63 ? 48  PHE B CD2   1 
ATOM   4683  C  CE1   . PHE B 1 69  ? -17.423 -18.538 116.608 1.00 157.39 ? 48  PHE B CE1   1 
ATOM   4684  C  CE2   . PHE B 1 69  ? -19.750 -18.859 116.073 1.00 166.09 ? 48  PHE B CE2   1 
ATOM   4685  C  CZ    . PHE B 1 69  ? -18.504 -19.382 116.413 1.00 165.52 ? 48  PHE B CZ    1 
ATOM   4686  N  N     . ILE B 1 70  ? -17.723 -14.479 118.703 1.00 159.11 ? 49  ILE B N     1 
ATOM   4687  C  CA    . ILE B 1 70  ? -17.006 -14.908 119.899 1.00 147.43 ? 49  ILE B CA    1 
ATOM   4688  C  C     . ILE B 1 70  ? -17.841 -14.585 121.121 1.00 152.95 ? 49  ILE B C     1 
ATOM   4689  O  O     . ILE B 1 70  ? -17.951 -15.390 122.055 1.00 154.49 ? 49  ILE B O     1 
ATOM   4690  C  CB    . ILE B 1 70  ? -15.619 -14.241 119.970 1.00 144.79 ? 49  ILE B CB    1 
ATOM   4691  C  CG1   . ILE B 1 70  ? -14.769 -14.623 118.754 1.00 140.26 ? 49  ILE B CG1   1 
ATOM   4692  C  CG2   . ILE B 1 70  ? -14.927 -14.651 121.238 1.00 145.34 ? 49  ILE B CG2   1 
ATOM   4693  C  CD1   . ILE B 1 70  ? -13.312 -14.125 118.788 1.00 136.97 ? 49  ILE B CD1   1 
ATOM   4694  N  N     . ALA B 1 71  ? -18.502 -13.423 121.085 1.00 167.06 ? 50  ALA B N     1 
ATOM   4695  C  CA    . ALA B 1 71  ? -19.401 -13.003 122.154 1.00 164.37 ? 50  ALA B CA    1 
ATOM   4696  C  C     . ALA B 1 71  ? -20.585 -13.952 122.295 1.00 179.43 ? 50  ALA B C     1 
ATOM   4697  O  O     . ALA B 1 71  ? -20.927 -14.373 123.408 1.00 192.99 ? 50  ALA B O     1 
ATOM   4698  C  CB    . ALA B 1 71  ? -19.887 -11.581 121.879 1.00 158.27 ? 50  ALA B CB    1 
ATOM   4699  N  N     . ALA B 1 72  ? -21.236 -14.291 121.175 1.00 177.06 ? 51  ALA B N     1 
ATOM   4700  C  CA    . ALA B 1 72  ? -22.436 -15.129 121.223 1.00 180.56 ? 51  ALA B CA    1 
ATOM   4701  C  C     . ALA B 1 72  ? -22.121 -16.545 121.685 1.00 181.02 ? 51  ALA B C     1 
ATOM   4702  O  O     . ALA B 1 72  ? -22.960 -17.195 122.327 1.00 178.04 ? 51  ALA B O     1 
ATOM   4703  C  CB    . ALA B 1 72  ? -23.106 -15.171 119.852 1.00 169.14 ? 51  ALA B CB    1 
ATOM   4704  N  N     . PHE B 1 73  ? -20.930 -17.041 121.345 1.00 176.97 ? 52  PHE B N     1 
ATOM   4705  C  CA    . PHE B 1 73  ? -20.562 -18.410 121.683 1.00 168.41 ? 52  PHE B CA    1 
ATOM   4706  C  C     . PHE B 1 73  ? -20.540 -18.615 123.192 1.00 190.29 ? 52  PHE B C     1 
ATOM   4707  O  O     . PHE B 1 73  ? -21.125 -19.576 123.708 1.00 184.30 ? 52  PHE B O     1 
ATOM   4708  C  CB    . PHE B 1 73  ? -19.199 -18.728 121.064 1.00 164.36 ? 52  PHE B CB    1 
ATOM   4709  C  CG    . PHE B 1 73  ? -18.758 -20.148 121.248 1.00 147.86 ? 52  PHE B CG    1 
ATOM   4710  C  CD1   . PHE B 1 73  ? -19.188 -21.123 120.372 1.00 140.42 ? 52  PHE B CD1   1 
ATOM   4711  C  CD2   . PHE B 1 73  ? -17.907 -20.505 122.267 1.00 145.87 ? 52  PHE B CD2   1 
ATOM   4712  C  CE1   . PHE B 1 73  ? -18.797 -22.421 120.527 1.00 138.90 ? 52  PHE B CE1   1 
ATOM   4713  C  CE2   . PHE B 1 73  ? -17.512 -21.809 122.423 1.00 141.00 ? 52  PHE B CE2   1 
ATOM   4714  C  CZ    . PHE B 1 73  ? -17.958 -22.763 121.553 1.00 139.28 ? 52  PHE B CZ    1 
ATOM   4715  N  N     . ALA B 1 74  ? -19.904 -17.691 123.922 1.00 192.63 ? 53  ALA B N     1 
ATOM   4716  C  CA    . ALA B 1 74  ? -19.743 -17.870 125.360 1.00 187.28 ? 53  ALA B CA    1 
ATOM   4717  C  C     . ALA B 1 74  ? -21.080 -17.925 126.068 1.00 167.92 ? 53  ALA B C     1 
ATOM   4718  O  O     . ALA B 1 74  ? -21.178 -18.529 127.138 1.00 171.20 ? 53  ALA B O     1 
ATOM   4719  C  CB    . ALA B 1 74  ? -18.907 -16.741 125.957 1.00 190.02 ? 53  ALA B CB    1 
ATOM   4720  N  N     . GLU B 1 75  ? -22.117 -17.319 125.480 1.00 166.97 ? 54  GLU B N     1 
ATOM   4721  C  CA    . GLU B 1 75  ? -23.452 -17.278 126.066 1.00 182.70 ? 54  GLU B CA    1 
ATOM   4722  C  C     . GLU B 1 75  ? -24.255 -18.545 125.834 1.00 183.17 ? 54  GLU B C     1 
ATOM   4723  O  O     . GLU B 1 75  ? -25.332 -18.695 126.426 1.00 194.98 ? 54  GLU B O     1 
ATOM   4724  C  CB    . GLU B 1 75  ? -24.215 -16.064 125.545 1.00 190.84 ? 54  GLU B CB    1 
ATOM   4725  C  CG    . GLU B 1 75  ? -23.527 -14.793 125.946 1.00 200.80 ? 54  GLU B CG    1 
ATOM   4726  C  CD    . GLU B 1 75  ? -23.486 -14.641 127.461 1.00 223.37 ? 54  GLU B CD    1 
ATOM   4727  O  OE1   . GLU B 1 75  ? -24.559 -14.745 128.120 1.00 226.90 ? 54  GLU B OE1   1 
ATOM   4728  O  OE2   . GLU B 1 75  ? -22.362 -14.463 127.988 1.00 218.85 ? 54  GLU B OE2   1 
ATOM   4729  N  N     . LEU B 1 76  ? -23.764 -19.442 124.994 1.00 168.52 ? 55  LEU B N     1 
ATOM   4730  C  CA    . LEU B 1 76  ? -24.467 -20.679 124.714 1.00 176.57 ? 55  LEU B CA    1 
ATOM   4731  C  C     . LEU B 1 76  ? -24.382 -21.616 125.920 1.00 186.49 ? 55  LEU B C     1 
ATOM   4732  O  O     . LEU B 1 76  ? -23.419 -21.552 126.688 1.00 204.93 ? 55  LEU B O     1 
ATOM   4733  C  CB    . LEU B 1 76  ? -23.840 -21.352 123.499 1.00 179.93 ? 55  LEU B CB    1 
ATOM   4734  C  CG    . LEU B 1 76  ? -24.076 -20.700 122.139 1.00 180.46 ? 55  LEU B CG    1 
ATOM   4735  C  CD1   . LEU B 1 76  ? -23.088 -21.245 121.136 1.00 181.98 ? 55  LEU B CD1   1 
ATOM   4736  C  CD2   . LEU B 1 76  ? -25.491 -20.975 121.673 1.00 184.16 ? 55  LEU B CD2   1 
ATOM   4737  N  N     . PRO B 1 77  ? -25.378 -22.486 126.119 1.00 179.24 ? 56  PRO B N     1 
ATOM   4738  C  CA    . PRO B 1 77  ? -25.239 -23.542 127.134 1.00 191.81 ? 56  PRO B CA    1 
ATOM   4739  C  C     . PRO B 1 77  ? -24.029 -24.426 126.847 1.00 208.48 ? 56  PRO B C     1 
ATOM   4740  O  O     . PRO B 1 77  ? -23.509 -24.463 125.728 1.00 174.76 ? 56  PRO B O     1 
ATOM   4741  C  CB    . PRO B 1 77  ? -26.556 -24.323 127.026 1.00 184.58 ? 56  PRO B CB    1 
ATOM   4742  C  CG    . PRO B 1 77  ? -27.537 -23.324 126.515 1.00 187.30 ? 56  PRO B CG    1 
ATOM   4743  C  CD    . PRO B 1 77  ? -26.763 -22.373 125.628 1.00 183.66 ? 56  PRO B CD    1 
ATOM   4744  N  N     . GLU B 1 78  ? -23.557 -25.131 127.887 1.00 208.57 ? 57  GLU B N     1 
ATOM   4745  C  CA    . GLU B 1 78  ? -22.354 -25.953 127.721 1.00 210.81 ? 57  GLU B CA    1 
ATOM   4746  C  C     . GLU B 1 78  ? -22.575 -27.085 126.725 1.00 190.16 ? 57  GLU B C     1 
ATOM   4747  O  O     . GLU B 1 78  ? -21.704 -27.361 125.893 1.00 178.47 ? 57  GLU B O     1 
ATOM   4748  C  CB    . GLU B 1 78  ? -21.879 -26.505 129.074 1.00 230.23 ? 57  GLU B CB    1 
ATOM   4749  C  CG    . GLU B 1 78  ? -20.418 -27.025 129.051 1.00 229.29 ? 57  GLU B CG    1 
ATOM   4750  C  CD    . GLU B 1 78  ? -19.781 -27.181 130.441 1.00 239.60 ? 57  GLU B CD    1 
ATOM   4751  O  OE1   . GLU B 1 78  ? -20.521 -27.297 131.451 1.00 245.55 ? 57  GLU B OE1   1 
ATOM   4752  O  OE2   . GLU B 1 78  ? -18.527 -27.188 130.513 1.00 227.81 ? 57  GLU B OE2   1 
ATOM   4753  N  N     . ALA B 1 79  ? -23.742 -27.735 126.776 1.00 194.15 ? 58  ALA B N     1 
ATOM   4754  C  CA    . ALA B 1 79  ? -24.027 -28.817 125.837 1.00 169.96 ? 58  ALA B CA    1 
ATOM   4755  C  C     . ALA B 1 79  ? -24.074 -28.311 124.402 1.00 185.51 ? 58  ALA B C     1 
ATOM   4756  O  O     . ALA B 1 79  ? -23.505 -28.936 123.500 1.00 195.89 ? 58  ALA B O     1 
ATOM   4757  C  CB    . ALA B 1 79  ? -25.342 -29.507 126.192 1.00 170.17 ? 58  ALA B CB    1 
ATOM   4758  N  N     . SER B 1 80  ? -24.719 -27.164 124.170 1.00 187.86 ? 59  SER B N     1 
ATOM   4759  C  CA    . SER B 1 80  ? -24.924 -26.706 122.797 1.00 188.46 ? 59  SER B CA    1 
ATOM   4760  C  C     . SER B 1 80  ? -23.628 -26.195 122.166 1.00 171.21 ? 59  SER B C     1 
ATOM   4761  O  O     . SER B 1 80  ? -23.295 -26.570 121.036 1.00 161.63 ? 59  SER B O     1 
ATOM   4762  C  CB    . SER B 1 80  ? -26.003 -25.621 122.771 1.00 190.17 ? 59  SER B CB    1 
ATOM   4763  O  OG    . SER B 1 80  ? -25.627 -24.492 123.536 1.00 198.97 ? 59  SER B OG    1 
ATOM   4764  N  N     . GLN B 1 81  ? -22.869 -25.359 122.885 1.00 173.90 ? 60  GLN B N     1 
ATOM   4765  C  CA    . GLN B 1 81  ? -21.577 -24.895 122.378 1.00 149.46 ? 60  GLN B CA    1 
ATOM   4766  C  C     . GLN B 1 81  ? -20.591 -26.041 122.179 1.00 147.28 ? 60  GLN B C     1 
ATOM   4767  O  O     . GLN B 1 81  ? -19.685 -25.931 121.346 1.00 149.13 ? 60  GLN B O     1 
ATOM   4768  C  CB    . GLN B 1 81  ? -21.018 -23.790 123.281 1.00 151.15 ? 60  GLN B CB    1 
ATOM   4769  C  CG    . GLN B 1 81  ? -20.266 -24.245 124.504 1.00 173.96 ? 60  GLN B CG    1 
ATOM   4770  C  CD    . GLN B 1 81  ? -19.797 -23.078 125.362 1.00 178.25 ? 60  GLN B CD    1 
ATOM   4771  O  OE1   . GLN B 1 81  ? -20.261 -21.944 125.205 1.00 179.20 ? 60  GLN B OE1   1 
ATOM   4772  N  NE2   . GLN B 1 81  ? -18.876 -23.354 126.278 1.00 192.85 ? 60  GLN B NE2   1 
ATOM   4773  N  N     . ALA B 1 82  ? -20.712 -27.118 122.962 1.00 157.99 ? 61  ALA B N     1 
ATOM   4774  C  CA    . ALA B 1 82  ? -19.847 -28.283 122.766 1.00 149.55 ? 61  ALA B CA    1 
ATOM   4775  C  C     . ALA B 1 82  ? -20.163 -29.016 121.465 1.00 142.17 ? 61  ALA B C     1 
ATOM   4776  O  O     . ALA B 1 82  ? -19.246 -29.484 120.781 1.00 138.36 ? 61  ALA B O     1 
ATOM   4777  C  CB    . ALA B 1 82  ? -19.956 -29.246 123.947 1.00 156.40 ? 61  ALA B CB    1 
ATOM   4778  N  N     . LEU B 1 83  ? -21.452 -29.147 121.117 1.00 144.12 ? 62  LEU B N     1 
ATOM   4779  C  CA    . LEU B 1 83  ? -21.821 -29.811 119.864 1.00 141.46 ? 62  LEU B CA    1 
ATOM   4780  C  C     . LEU B 1 83  ? -21.203 -29.102 118.657 1.00 141.75 ? 62  LEU B C     1 
ATOM   4781  O  O     . LEU B 1 83  ? -20.633 -29.747 117.765 1.00 136.80 ? 62  LEU B O     1 
ATOM   4782  C  CB    . LEU B 1 83  ? -23.347 -29.868 119.723 1.00 144.71 ? 62  LEU B CB    1 
ATOM   4783  C  CG    . LEU B 1 83  ? -23.888 -30.635 118.505 1.00 142.58 ? 62  LEU B CG    1 
ATOM   4784  C  CD1   . LEU B 1 83  ? -23.424 -32.082 118.551 1.00 141.42 ? 62  LEU B CD1   1 
ATOM   4785  C  CD2   . LEU B 1 83  ? -25.402 -30.540 118.332 1.00 145.99 ? 62  LEU B CD2   1 
ATOM   4786  N  N     . LEU B 1 84  ? -21.263 -27.769 118.644 1.00 151.10 ? 63  LEU B N     1 
ATOM   4787  C  CA    . LEU B 1 84  ? -20.742 -26.986 117.531 1.00 133.86 ? 63  LEU B CA    1 
ATOM   4788  C  C     . LEU B 1 84  ? -19.275 -27.320 117.254 1.00 136.20 ? 63  LEU B C     1 
ATOM   4789  O  O     . LEU B 1 84  ? -18.851 -27.401 116.093 1.00 142.16 ? 63  LEU B O     1 
ATOM   4790  C  CB    . LEU B 1 84  ? -20.915 -25.508 117.868 1.00 135.73 ? 63  LEU B CB    1 
ATOM   4791  C  CG    . LEU B 1 84  ? -20.835 -24.427 116.808 1.00 139.95 ? 63  LEU B CG    1 
ATOM   4792  C  CD1   . LEU B 1 84  ? -21.778 -24.764 115.692 1.00 149.07 ? 63  LEU B CD1   1 
ATOM   4793  C  CD2   . LEU B 1 84  ? -21.207 -23.108 117.461 1.00 151.11 ? 63  LEU B CD2   1 
ATOM   4794  N  N     . VAL B 1 85  ? -18.482 -27.515 118.310 1.00 130.77 ? 64  VAL B N     1 
ATOM   4795  C  CA    . VAL B 1 85  ? -17.068 -27.825 118.124 1.00 127.66 ? 64  VAL B CA    1 
ATOM   4796  C  C     . VAL B 1 85  ? -16.898 -29.198 117.504 1.00 125.99 ? 64  VAL B C     1 
ATOM   4797  O  O     . VAL B 1 85  ? -16.015 -29.404 116.660 1.00 123.21 ? 64  VAL B O     1 
ATOM   4798  C  CB    . VAL B 1 85  ? -16.317 -27.723 119.457 1.00 133.00 ? 64  VAL B CB    1 
ATOM   4799  C  CG1   . VAL B 1 85  ? -14.895 -28.152 119.283 1.00 134.72 ? 64  VAL B CG1   1 
ATOM   4800  C  CG2   . VAL B 1 85  ? -16.341 -26.307 119.946 1.00 141.20 ? 64  VAL B CG2   1 
ATOM   4801  N  N     . ARG B 1 86  ? -17.753 -30.153 117.885 1.00 128.39 ? 65  ARG B N     1 
ATOM   4802  C  CA    . ARG B 1 86  ? -17.700 -31.475 117.265 1.00 127.36 ? 65  ARG B CA    1 
ATOM   4803  C  C     . ARG B 1 86  ? -17.889 -31.391 115.752 1.00 138.85 ? 65  ARG B C     1 
ATOM   4804  O  O     . ARG B 1 86  ? -17.086 -31.938 114.983 1.00 138.55 ? 65  ARG B O     1 
ATOM   4805  C  CB    . ARG B 1 86  ? -18.754 -32.388 117.880 1.00 130.50 ? 65  ARG B CB    1 
ATOM   4806  C  CG    . ARG B 1 86  ? -18.458 -32.818 119.288 1.00 133.65 ? 65  ARG B CG    1 
ATOM   4807  C  CD    . ARG B 1 86  ? -17.094 -33.472 119.350 1.00 138.96 ? 65  ARG B CD    1 
ATOM   4808  N  NE    . ARG B 1 86  ? -16.922 -34.290 120.548 1.00 135.30 ? 65  ARG B NE    1 
ATOM   4809  C  CZ    . ARG B 1 86  ? -15.904 -35.123 120.746 1.00 135.06 ? 65  ARG B CZ    1 
ATOM   4810  N  NH1   . ARG B 1 86  ? -14.952 -35.261 119.826 1.00 133.84 ? 65  ARG B NH1   1 
ATOM   4811  N  NH2   . ARG B 1 86  ? -15.843 -35.823 121.865 1.00 138.58 ? 65  ARG B NH2   1 
ATOM   4812  N  N     . MET B 1 87  ? -18.914 -30.652 115.306 1.00 124.61 ? 66  MET B N     1 
ATOM   4813  C  CA    . MET B 1 87  ? -19.202 -30.534 113.876 1.00 122.12 ? 66  MET B CA    1 
ATOM   4814  C  C     . MET B 1 87  ? -18.096 -29.771 113.133 1.00 130.88 ? 66  MET B C     1 
ATOM   4815  O  O     . MET B 1 87  ? -17.744 -30.119 111.993 1.00 127.66 ? 66  MET B O     1 
ATOM   4816  C  CB    . MET B 1 87  ? -20.581 -29.891 113.693 1.00 124.27 ? 66  MET B CB    1 
ATOM   4817  C  CG    . MET B 1 87  ? -21.707 -30.743 114.333 1.00 136.58 ? 66  MET B CG    1 
ATOM   4818  S  SD    . MET B 1 87  ? -23.410 -30.109 114.417 1.00 138.31 ? 66  MET B SD    1 
ATOM   4819  C  CE    . MET B 1 87  ? -23.408 -28.994 113.023 1.00 154.93 ? 66  MET B CE    1 
ATOM   4820  N  N     . VAL B 1 88  ? -17.532 -28.731 113.754 1.00 124.27 ? 67  VAL B N     1 
ATOM   4821  C  CA    . VAL B 1 88  ? -16.433 -28.030 113.098 1.00 117.31 ? 67  VAL B CA    1 
ATOM   4822  C  C     . VAL B 1 88  ? -15.237 -28.949 112.944 1.00 122.74 ? 67  VAL B C     1 
ATOM   4823  O  O     . VAL B 1 88  ? -14.499 -28.875 111.956 1.00 136.08 ? 67  VAL B O     1 
ATOM   4824  C  CB    . VAL B 1 88  ? -16.043 -26.778 113.892 1.00 117.38 ? 67  VAL B CB    1 
ATOM   4825  C  CG1   . VAL B 1 88  ? -14.944 -26.025 113.173 1.00 114.61 ? 67  VAL B CG1   1 
ATOM   4826  C  CG2   . VAL B 1 88  ? -17.230 -25.898 114.073 1.00 127.05 ? 67  VAL B CG2   1 
ATOM   4827  N  N     . MET B 1 89  ? -15.028 -29.833 113.911 1.00 116.07 ? 68  MET B N     1 
ATOM   4828  C  CA    . MET B 1 89  ? -13.862 -30.699 113.858 1.00 114.92 ? 68  MET B CA    1 
ATOM   4829  C  C     . MET B 1 89  ? -14.041 -31.927 112.979 1.00 114.02 ? 68  MET B C     1 
ATOM   4830  O  O     . MET B 1 89  ? -13.046 -32.599 112.685 1.00 113.03 ? 68  MET B O     1 
ATOM   4831  C  CB    . MET B 1 89  ? -13.487 -31.124 115.272 1.00 131.96 ? 68  MET B CB    1 
ATOM   4832  C  CG    . MET B 1 89  ? -12.904 -29.996 116.112 1.00 134.14 ? 68  MET B CG    1 
ATOM   4833  S  SD    . MET B 1 89  ? -12.355 -30.602 117.704 1.00 136.35 ? 68  MET B SD    1 
ATOM   4834  C  CE    . MET B 1 89  ? -13.504 -31.998 117.862 1.00 123.19 ? 68  MET B CE    1 
ATOM   4835  N  N     . ARG B 1 90  ? -15.257 -32.256 112.567 1.00 114.64 ? 69  ARG B N     1 
ATOM   4836  C  CA    . ARG B 1 90  ? -15.417 -33.401 111.686 1.00 113.74 ? 69  ARG B CA    1 
ATOM   4837  C  C     . ARG B 1 90  ? -15.496 -32.953 110.233 1.00 121.43 ? 69  ARG B C     1 
ATOM   4838  O  O     . ARG B 1 90  ? -15.873 -31.809 109.928 1.00 110.75 ? 69  ARG B O     1 
ATOM   4839  C  CB    . ARG B 1 90  ? -16.671 -34.188 112.051 1.00 135.73 ? 69  ARG B CB    1 
ATOM   4840  C  CG    . ARG B 1 90  ? -16.541 -35.062 113.292 1.00 147.28 ? 69  ARG B CG    1 
ATOM   4841  C  CD    . ARG B 1 90  ? -17.922 -35.482 113.806 1.00 133.69 ? 69  ARG B CD    1 
ATOM   4842  N  NE    . ARG B 1 90  ? -18.494 -36.496 112.930 1.00 120.96 ? 69  ARG B NE    1 
ATOM   4843  C  CZ    . ARG B 1 90  ? -19.552 -37.237 113.218 1.00 123.28 ? 69  ARG B CZ    1 
ATOM   4844  N  NH1   . ARG B 1 90  ? -20.198 -37.084 114.365 1.00 134.78 ? 69  ARG B NH1   1 
ATOM   4845  N  NH2   . ARG B 1 90  ? -19.965 -38.132 112.342 1.00 138.82 ? 69  ARG B NH2   1 
ATOM   4846  N  N     . LYS B 1 91  ? -15.297 -33.942 109.346 1.00 118.53 ? 70  LYS B N     1 
ATOM   4847  C  CA    . LYS B 1 91  ? -14.937 -33.686 107.949 1.00 116.70 ? 70  LYS B CA    1 
ATOM   4848  C  C     . LYS B 1 91  ? -16.014 -32.892 107.256 1.00 126.02 ? 70  LYS B C     1 
ATOM   4849  O  O     . LYS B 1 91  ? -15.725 -31.916 106.548 1.00 119.40 ? 70  LYS B O     1 
ATOM   4850  C  CB    . LYS B 1 91  ? -14.699 -35.017 107.221 1.00 107.37 ? 70  LYS B CB    1 
ATOM   4851  C  CG    . LYS B 1 91  ? -14.596 -34.997 105.690 1.00 105.46 ? 70  LYS B CG    1 
ATOM   4852  C  CD    . LYS B 1 91  ? -13.282 -34.470 105.210 1.00 122.34 ? 70  LYS B CD    1 
ATOM   4853  C  CE    . LYS B 1 91  ? -12.382 -35.579 104.679 1.00 131.19 ? 70  LYS B CE    1 
ATOM   4854  N  NZ    . LYS B 1 91  ? -11.044 -35.036 104.240 1.00 137.68 ? 70  LYS B NZ    1 
ATOM   4855  N  N     . GLY B 1 92  ? -17.264 -33.295 107.470 1.00 108.99 ? 71  GLY B N     1 
ATOM   4856  C  CA    . GLY B 1 92  ? -18.375 -32.704 106.776 1.00 109.14 ? 71  GLY B CA    1 
ATOM   4857  C  C     . GLY B 1 92  ? -18.707 -31.292 107.224 1.00 110.10 ? 71  GLY B C     1 
ATOM   4858  O  O     . GLY B 1 92  ? -18.148 -30.720 108.174 1.00 110.71 ? 71  GLY B O     1 
ATOM   4859  N  N     . THR B 1 93  ? -19.596 -30.696 106.431 1.00 110.31 ? 72  THR B N     1 
ATOM   4860  C  CA    . THR B 1 93  ? -20.483 -29.660 106.922 1.00 131.59 ? 72  THR B CA    1 
ATOM   4861  C  C     . THR B 1 93  ? -21.899 -30.181 107.223 1.00 129.82 ? 72  THR B C     1 
ATOM   4862  O  O     . THR B 1 93  ? -22.710 -29.428 107.778 1.00 123.30 ? 72  THR B O     1 
ATOM   4863  C  CB    . THR B 1 93  ? -20.556 -28.527 105.908 1.00 119.83 ? 72  THR B CB    1 
ATOM   4864  O  OG1   . THR B 1 93  ? -20.983 -27.334 106.575 1.00 128.64 ? 72  THR B OG1   1 
ATOM   4865  C  CG2   . THR B 1 93  ? -21.538 -28.875 104.794 1.00 127.63 ? 72  THR B CG2   1 
ATOM   4866  N  N     . LEU B 1 94  ? -22.184 -31.463 106.930 1.00 125.82 ? 73  LEU B N     1 
ATOM   4867  C  CA    . LEU B 1 94  ? -23.506 -32.087 107.029 1.00 123.97 ? 73  LEU B CA    1 
ATOM   4868  C  C     . LEU B 1 94  ? -23.471 -33.327 107.906 1.00 118.36 ? 73  LEU B C     1 
ATOM   4869  O  O     . LEU B 1 94  ? -22.522 -34.109 107.831 1.00 116.57 ? 73  LEU B O     1 
ATOM   4870  C  CB    . LEU B 1 94  ? -24.016 -32.510 105.662 1.00 129.28 ? 73  LEU B CB    1 
ATOM   4871  C  CG    . LEU B 1 94  ? -24.401 -31.428 104.678 1.00 138.04 ? 73  LEU B CG    1 
ATOM   4872  C  CD1   . LEU B 1 94  ? -24.452 -32.028 103.293 1.00 122.75 ? 73  LEU B CD1   1 
ATOM   4873  C  CD2   . LEU B 1 94  ? -25.758 -30.928 105.076 1.00 161.65 ? 73  LEU B CD2   1 
ATOM   4874  N  N     . PHE B 1 95  ? -24.508 -33.508 108.732 1.00 121.70 ? 74  PHE B N     1 
ATOM   4875  C  CA    . PHE B 1 95  ? -24.571 -34.633 109.657 1.00 123.41 ? 74  PHE B CA    1 
ATOM   4876  C  C     . PHE B 1 95  ? -26.002 -35.081 109.899 1.00 126.70 ? 74  PHE B C     1 
ATOM   4877  O  O     . PHE B 1 95  ? -26.881 -34.255 110.175 1.00 129.28 ? 74  PHE B O     1 
ATOM   4878  C  CB    . PHE B 1 95  ? -23.955 -34.252 110.991 1.00 124.84 ? 74  PHE B CB    1 
ATOM   4879  C  CG    . PHE B 1 95  ? -22.593 -33.721 110.865 1.00 122.08 ? 74  PHE B CG    1 
ATOM   4880  C  CD1   . PHE B 1 95  ? -22.380 -32.359 110.770 1.00 128.13 ? 74  PHE B CD1   1 
ATOM   4881  C  CD2   . PHE B 1 95  ? -21.523 -34.583 110.757 1.00 120.15 ? 74  PHE B CD2   1 
ATOM   4882  C  CE1   . PHE B 1 95  ? -21.119 -31.862 110.616 1.00 125.82 ? 74  PHE B CE1   1 
ATOM   4883  C  CE2   . PHE B 1 95  ? -20.265 -34.106 110.614 1.00 117.89 ? 74  PHE B CE2   1 
ATOM   4884  C  CZ    . PHE B 1 95  ? -20.053 -32.735 110.541 1.00 126.90 ? 74  PHE B CZ    1 
ATOM   4885  N  N     . ARG B 1 96  ? -26.199 -36.398 109.933 1.00 127.12 ? 75  ARG B N     1 
ATOM   4886  C  CA    . ARG B 1 96  ? -27.463 -36.964 110.385 1.00 130.69 ? 75  ARG B CA    1 
ATOM   4887  C  C     . ARG B 1 96  ? -27.543 -36.840 111.891 1.00 134.18 ? 75  ARG B C     1 
ATOM   4888  O  O     . ARG B 1 96  ? -26.545 -37.001 112.593 1.00 134.63 ? 75  ARG B O     1 
ATOM   4889  C  CB    . ARG B 1 96  ? -27.574 -38.442 110.036 1.00 150.89 ? 75  ARG B CB    1 
ATOM   4890  C  CG    . ARG B 1 96  ? -27.396 -38.818 108.600 1.00 162.41 ? 75  ARG B CG    1 
ATOM   4891  C  CD    . ARG B 1 96  ? -27.200 -40.310 108.563 1.00 165.98 ? 75  ARG B CD    1 
ATOM   4892  N  NE    . ARG B 1 96  ? -28.273 -40.981 109.280 1.00 164.80 ? 75  ARG B NE    1 
ATOM   4893  C  CZ    . ARG B 1 96  ? -29.056 -41.900 108.737 1.00 185.67 ? 75  ARG B CZ    1 
ATOM   4894  N  NH1   . ARG B 1 96  ? -28.860 -42.261 107.477 1.00 184.10 ? 75  ARG B NH1   1 
ATOM   4895  N  NH2   . ARG B 1 96  ? -30.015 -42.472 109.455 1.00 193.97 ? 75  ARG B NH2   1 
ATOM   4896  N  N     . GLU B 1 97  ? -28.732 -36.548 112.397 1.00 154.26 ? 76  GLU B N     1 
ATOM   4897  C  CA    . GLU B 1 97  ? -28.892 -36.514 113.842 1.00 153.25 ? 76  GLU B CA    1 
ATOM   4898  C  C     . GLU B 1 97  ? -28.351 -37.781 114.494 1.00 149.16 ? 76  GLU B C     1 
ATOM   4899  O  O     . GLU B 1 97  ? -27.910 -37.744 115.651 1.00 151.71 ? 76  GLU B O     1 
ATOM   4900  C  CB    . GLU B 1 97  ? -30.366 -36.353 114.193 1.00 156.14 ? 76  GLU B CB    1 
ATOM   4901  C  CG    . GLU B 1 97  ? -30.605 -36.039 115.634 1.00 165.58 ? 76  GLU B CG    1 
ATOM   4902  C  CD    . GLU B 1 97  ? -32.037 -36.258 115.971 1.00 187.90 ? 76  GLU B CD    1 
ATOM   4903  O  OE1   . GLU B 1 97  ? -32.573 -37.281 115.494 1.00 197.31 ? 76  GLU B OE1   1 
ATOM   4904  O  OE2   . GLU B 1 97  ? -32.624 -35.434 116.704 1.00 200.44 ? 76  GLU B OE2   1 
ATOM   4905  N  N     . GLY B 1 98  ? -28.347 -38.900 113.763 1.00 148.30 ? 77  GLY B N     1 
ATOM   4906  C  CA    . GLY B 1 98  ? -27.952 -40.157 114.371 1.00 141.72 ? 77  GLY B CA    1 
ATOM   4907  C  C     . GLY B 1 98  ? -26.467 -40.257 114.655 1.00 142.89 ? 77  GLY B C     1 
ATOM   4908  O  O     . GLY B 1 98  ? -26.068 -40.706 115.733 1.00 152.92 ? 77  GLY B O     1 
ATOM   4909  N  N     . LYS B 1 99  ? -25.634 -39.768 113.740 1.00 135.32 ? 78  LYS B N     1 
ATOM   4910  C  CA    . LYS B 1 99  ? -24.191 -39.916 113.887 1.00 133.18 ? 78  LYS B CA    1 
ATOM   4911  C  C     . LYS B 1 99  ? -23.576 -38.889 114.831 1.00 133.86 ? 78  LYS B C     1 
ATOM   4912  O  O     . LYS B 1 99  ? -22.362 -38.929 115.050 1.00 140.55 ? 78  LYS B O     1 
ATOM   4913  C  CB    . LYS B 1 99  ? -23.499 -39.834 112.517 1.00 128.85 ? 78  LYS B CB    1 
ATOM   4914  C  CG    . LYS B 1 99  ? -23.921 -40.901 111.521 1.00 132.34 ? 78  LYS B CG    1 
ATOM   4915  C  CD    . LYS B 1 99  ? -23.273 -42.233 111.850 1.00 136.66 ? 78  LYS B CD    1 
ATOM   4916  C  CE    . LYS B 1 99  ? -23.430 -43.243 110.725 1.00 129.45 ? 78  LYS B CE    1 
ATOM   4917  N  NZ    . LYS B 1 99  ? -23.129 -42.656 109.401 1.00 123.76 ? 78  LYS B NZ    1 
ATOM   4918  N  N     . LEU B 1 100 ? -24.368 -37.966 115.375 1.00 136.21 ? 79  LEU B N     1 
ATOM   4919  C  CA    . LEU B 1 100 ? -23.880 -36.944 116.294 1.00 137.22 ? 79  LEU B CA    1 
ATOM   4920  C  C     . LEU B 1 100 ? -24.072 -37.313 117.770 1.00 146.66 ? 79  LEU B C     1 
ATOM   4921  O  O     . LEU B 1 100 ? -24.085 -36.419 118.622 1.00 150.10 ? 79  LEU B O     1 
ATOM   4922  C  CB    . LEU B 1 100 ? -24.506 -35.578 116.018 1.00 137.42 ? 79  LEU B CB    1 
ATOM   4923  C  CG    . LEU B 1 100 ? -24.069 -34.885 114.739 1.00 133.29 ? 79  LEU B CG    1 
ATOM   4924  C  CD1   . LEU B 1 100 ? -24.738 -33.520 114.628 1.00 134.42 ? 79  LEU B CD1   1 
ATOM   4925  C  CD2   . LEU B 1 100 ? -22.581 -34.790 114.685 1.00 130.25 ? 79  LEU B CD2   1 
ATOM   4926  N  N     . ALA B 1 101 ? -24.342 -38.576 118.082 1.00 143.59 ? 80  ALA B N     1 
ATOM   4927  C  CA    . ALA B 1 101 ? -24.494 -38.989 119.476 1.00 166.60 ? 80  ALA B CA    1 
ATOM   4928  C  C     . ALA B 1 101 ? -23.189 -38.891 120.286 1.00 147.87 ? 80  ALA B C     1 
ATOM   4929  O  O     . ALA B 1 101 ? -22.171 -39.481 119.917 1.00 145.40 ? 80  ALA B O     1 
ATOM   4930  C  CB    . ALA B 1 101 ? -25.024 -40.422 119.513 1.00 200.28 ? 80  ALA B CB    1 
ATOM   4931  N  N     . TYR B 1 102 ? -23.233 -38.177 121.422 1.00 150.92 ? 81  TYR B N     1 
ATOM   4932  C  CA    . TYR B 1 102 ? -22.096 -38.052 122.334 1.00 151.44 ? 81  TYR B CA    1 
ATOM   4933  C  C     . TYR B 1 102 ? -22.548 -38.064 123.787 1.00 156.93 ? 81  TYR B C     1 
ATOM   4934  O  O     . TYR B 1 102 ? -23.570 -37.462 124.136 1.00 159.82 ? 81  TYR B O     1 
ATOM   4935  C  CB    . TYR B 1 102 ? -21.317 -36.765 122.124 1.00 148.50 ? 81  TYR B CB    1 
ATOM   4936  C  CG    . TYR B 1 102 ? -20.646 -36.667 120.800 1.00 143.35 ? 81  TYR B CG    1 
ATOM   4937  C  CD1   . TYR B 1 102 ? -21.175 -35.861 119.811 1.00 141.06 ? 81  TYR B CD1   1 
ATOM   4938  C  CD2   . TYR B 1 102 ? -19.477 -37.353 120.539 1.00 141.18 ? 81  TYR B CD2   1 
ATOM   4939  C  CE1   . TYR B 1 102 ? -20.579 -35.749 118.596 1.00 136.68 ? 81  TYR B CE1   1 
ATOM   4940  C  CE2   . TYR B 1 102 ? -18.868 -37.248 119.317 1.00 145.23 ? 81  TYR B CE2   1 
ATOM   4941  C  CZ    . TYR B 1 102 ? -19.426 -36.441 118.345 1.00 138.49 ? 81  TYR B CZ    1 
ATOM   4942  O  OH    . TYR B 1 102 ? -18.832 -36.316 117.111 1.00 142.10 ? 81  TYR B OH    1 
ATOM   4943  N  N     . ALA B 1 103 ? -21.757 -38.722 124.642 1.00 158.69 ? 82  ALA B N     1 
ATOM   4944  C  CA    . ALA B 1 103 ? -22.127 -38.820 126.050 1.00 164.26 ? 82  ALA B CA    1 
ATOM   4945  C  C     . ALA B 1 103 ? -21.981 -37.476 126.744 1.00 165.33 ? 82  ALA B C     1 
ATOM   4946  O  O     . ALA B 1 103 ? -22.790 -37.130 127.607 1.00 169.90 ? 82  ALA B O     1 
ATOM   4947  C  CB    . ALA B 1 103 ? -21.276 -39.875 126.756 1.00 166.07 ? 82  ALA B CB    1 
ATOM   4948  N  N     . GLU B 1 104 ? -20.945 -36.712 126.397 1.00 165.44 ? 83  GLU B N     1 
ATOM   4949  C  CA    . GLU B 1 104 ? -20.731 -35.416 127.036 1.00 171.14 ? 83  GLU B CA    1 
ATOM   4950  C  C     . GLU B 1 104 ? -21.836 -34.410 126.696 1.00 169.46 ? 83  GLU B C     1 
ATOM   4951  O  O     . GLU B 1 104 ? -22.042 -33.451 127.448 1.00 176.14 ? 83  GLU B O     1 
ATOM   4952  C  CB    . GLU B 1 104 ? -19.343 -34.862 126.671 1.00 162.64 ? 83  GLU B CB    1 
ATOM   4953  C  CG    . GLU B 1 104 ? -19.105 -34.564 125.182 1.00 172.92 ? 83  GLU B CG    1 
ATOM   4954  C  CD    . GLU B 1 104 ? -18.398 -35.693 124.422 1.00 170.06 ? 83  GLU B CD    1 
ATOM   4955  O  OE1   . GLU B 1 104 ? -18.608 -36.883 124.756 1.00 182.72 ? 83  GLU B OE1   1 
ATOM   4956  O  OE2   . GLU B 1 104 ? -17.631 -35.381 123.479 1.00 147.99 ? 83  GLU B OE2   1 
ATOM   4957  N  N     . ILE B 1 105 ? -22.512 -34.565 125.550 1.00 171.26 ? 84  ILE B N     1 
ATOM   4958  C  CA    . ILE B 1 105 ? -23.532 -33.601 125.126 1.00 161.50 ? 84  ILE B CA    1 
ATOM   4959  C  C     . ILE B 1 105 ? -24.969 -34.011 125.462 1.00 166.37 ? 84  ILE B C     1 
ATOM   4960  O  O     . ILE B 1 105 ? -25.869 -33.157 125.394 1.00 168.50 ? 84  ILE B O     1 
ATOM   4961  C  CB    . ILE B 1 105 ? -23.388 -33.307 123.615 1.00 158.33 ? 84  ILE B CB    1 
ATOM   4962  C  CG1   . ILE B 1 105 ? -21.909 -33.093 123.265 1.00 151.62 ? 84  ILE B CG1   1 
ATOM   4963  C  CG2   . ILE B 1 105 ? -24.165 -32.065 123.225 1.00 158.73 ? 84  ILE B CG2   1 
ATOM   4964  C  CD1   . ILE B 1 105 ? -21.653 -32.651 121.844 1.00 146.70 ? 84  ILE B CD1   1 
ATOM   4965  N  N     . GLY B 1 106 ? -25.214 -35.255 125.871 1.00 168.71 ? 85  GLY B N     1 
ATOM   4966  C  CA    . GLY B 1 106 ? -26.585 -35.693 126.119 1.00 177.68 ? 85  GLY B CA    1 
ATOM   4967  C  C     . GLY B 1 106 ? -27.488 -35.837 124.907 1.00 171.59 ? 85  GLY B C     1 
ATOM   4968  O  O     . GLY B 1 106 ? -27.282 -36.735 124.085 1.00 172.10 ? 85  GLY B O     1 
ATOM   4969  N  N     . ASP B 1 107 ? -28.518 -35.001 124.794 1.00 174.09 ? 86  ASP B N     1 
ATOM   4970  C  CA    . ASP B 1 107 ? -29.453 -35.116 123.685 1.00 173.04 ? 86  ASP B CA    1 
ATOM   4971  C  C     . ASP B 1 107 ? -28.960 -34.237 122.543 1.00 173.55 ? 86  ASP B C     1 
ATOM   4972  O  O     . ASP B 1 107 ? -28.704 -33.042 122.732 1.00 178.53 ? 86  ASP B O     1 
ATOM   4973  C  CB    . ASP B 1 107 ? -30.864 -34.706 124.116 1.00 179.03 ? 86  ASP B CB    1 
ATOM   4974  C  CG    . ASP B 1 107 ? -31.941 -35.174 123.141 1.00 179.06 ? 86  ASP B CG    1 
ATOM   4975  O  OD1   . ASP B 1 107 ? -31.642 -35.274 121.927 1.00 174.56 ? 86  ASP B OD1   1 
ATOM   4976  O  OD2   . ASP B 1 107 ? -33.080 -35.473 123.598 1.00 184.47 ? 86  ASP B OD2   1 
ATOM   4977  N  N     . THR B 1 108 ? -28.864 -34.825 121.349 1.00 165.96 ? 87  THR B N     1 
ATOM   4978  C  CA    . THR B 1 108 ? -28.386 -34.067 120.200 1.00 171.29 ? 87  THR B CA    1 
ATOM   4979  C  C     . THR B 1 108 ? -29.414 -33.044 119.751 1.00 178.51 ? 87  THR B C     1 
ATOM   4980  O  O     . THR B 1 108 ? -29.069 -31.884 119.482 1.00 171.11 ? 87  THR B O     1 
ATOM   4981  C  CB    . THR B 1 108 ? -28.040 -35.011 119.051 1.00 168.48 ? 87  THR B CB    1 
ATOM   4982  O  OG1   . THR B 1 108 ? -27.123 -36.007 119.517 1.00 170.40 ? 87  THR B OG1   1 
ATOM   4983  C  CG2   . THR B 1 108 ? -27.412 -34.241 117.899 1.00 155.54 ? 87  THR B CG2   1 
ATOM   4984  N  N     . ARG B 1 109 ? -30.688 -33.449 119.685 1.00 182.47 ? 88  ARG B N     1 
ATOM   4985  C  CA    . ARG B 1 109 ? -31.714 -32.535 119.199 1.00 179.21 ? 88  ARG B CA    1 
ATOM   4986  C  C     . ARG B 1 109 ? -31.927 -31.386 120.184 1.00 175.02 ? 88  ARG B C     1 
ATOM   4987  O  O     . ARG B 1 109 ? -32.217 -30.258 119.767 1.00 171.36 ? 88  ARG B O     1 
ATOM   4988  C  CB    . ARG B 1 109 ? -33.008 -33.303 118.894 1.00 169.37 ? 88  ARG B CB    1 
ATOM   4989  C  CG    . ARG B 1 109 ? -33.877 -32.550 117.907 1.00 169.84 ? 88  ARG B CG    1 
ATOM   4990  C  CD    . ARG B 1 109 ? -35.115 -33.290 117.391 1.00 172.17 ? 88  ARG B CD    1 
ATOM   4991  N  NE    . ARG B 1 109 ? -34.887 -34.584 116.727 1.00 175.78 ? 88  ARG B NE    1 
ATOM   4992  C  CZ    . ARG B 1 109 ? -35.874 -35.393 116.313 1.00 184.09 ? 88  ARG B CZ    1 
ATOM   4993  N  NH1   . ARG B 1 109 ? -37.146 -35.036 116.472 1.00 187.19 ? 88  ARG B NH1   1 
ATOM   4994  N  NH2   . ARG B 1 109 ? -35.612 -36.559 115.725 1.00 171.45 ? 88  ARG B NH2   1 
ATOM   4995  N  N     . ALA B 1 110 ? -31.780 -31.653 121.488 1.00 179.69 ? 89  ALA B N     1 
ATOM   4996  C  CA    . ALA B 1 110 ? -31.876 -30.594 122.488 1.00 178.66 ? 89  ALA B CA    1 
ATOM   4997  C  C     . ALA B 1 110 ? -30.693 -29.640 122.400 1.00 174.82 ? 89  ALA B C     1 
ATOM   4998  O  O     . ALA B 1 110 ? -30.862 -28.416 122.425 1.00 189.77 ? 89  ALA B O     1 
ATOM   4999  C  CB    . ALA B 1 110 ? -31.970 -31.200 123.887 1.00 183.40 ? 89  ALA B CB    1 
ATOM   5000  N  N     . ALA B 1 111 ? -29.482 -30.182 122.317 1.00 170.08 ? 90  ALA B N     1 
ATOM   5001  C  CA    . ALA B 1 111 ? -28.310 -29.321 122.313 1.00 166.72 ? 90  ALA B CA    1 
ATOM   5002  C  C     . ALA B 1 111 ? -28.250 -28.453 121.069 1.00 171.56 ? 90  ALA B C     1 
ATOM   5003  O  O     . ALA B 1 111 ? -27.730 -27.335 121.119 1.00 168.46 ? 90  ALA B O     1 
ATOM   5004  C  CB    . ALA B 1 111 ? -27.049 -30.161 122.429 1.00 162.73 ? 90  ALA B CB    1 
ATOM   5005  N  N     . VAL B 1 112 ? -28.795 -28.933 119.951 1.00 166.46 ? 91  VAL B N     1 
ATOM   5006  C  CA    . VAL B 1 112 ? -28.631 -28.214 118.690 1.00 160.03 ? 91  VAL B CA    1 
ATOM   5007  C  C     . VAL B 1 112 ? -29.556 -27.012 118.590 1.00 169.23 ? 91  VAL B C     1 
ATOM   5008  O  O     . VAL B 1 112 ? -29.420 -26.217 117.648 1.00 159.19 ? 91  VAL B O     1 
ATOM   5009  C  CB    . VAL B 1 112 ? -28.823 -29.191 117.513 1.00 158.11 ? 91  VAL B CB    1 
ATOM   5010  C  CG1   . VAL B 1 112 ? -30.275 -29.374 117.192 1.00 157.91 ? 91  VAL B CG1   1 
ATOM   5011  C  CG2   . VAL B 1 112 ? -28.043 -28.728 116.290 1.00 183.71 ? 91  VAL B CG2   1 
ATOM   5012  N  N     . GLN B 1 113 ? -30.483 -26.851 119.552 1.00 178.33 ? 92  GLN B N     1 
ATOM   5013  C  CA    . GLN B 1 113 ? -31.490 -25.794 119.450 1.00 172.12 ? 92  GLN B CA    1 
ATOM   5014  C  C     . GLN B 1 113 ? -30.909 -24.385 119.538 1.00 171.92 ? 92  GLN B C     1 
ATOM   5015  O  O     . GLN B 1 113 ? -31.184 -23.576 118.635 1.00 171.46 ? 92  GLN B O     1 
ATOM   5016  C  CB    . GLN B 1 113 ? -32.574 -26.024 120.502 1.00 179.17 ? 92  GLN B CB    1 
ATOM   5017  C  CG    . GLN B 1 113 ? -33.350 -27.314 120.326 1.00 180.15 ? 92  GLN B CG    1 
ATOM   5018  C  CD    . GLN B 1 113 ? -34.242 -27.327 119.110 1.00 179.89 ? 92  GLN B CD    1 
ATOM   5019  O  OE1   . GLN B 1 113 ? -34.031 -28.118 118.201 1.00 175.39 ? 92  GLN B OE1   1 
ATOM   5020  N  NE2   . GLN B 1 113 ? -35.281 -26.485 119.110 1.00 193.95 ? 92  GLN B NE2   1 
ATOM   5021  N  N     . PRO B 1 114 ? -30.136 -24.008 120.561 1.00 172.49 ? 93  PRO B N     1 
ATOM   5022  C  CA    . PRO B 1 114 ? -29.620 -22.629 120.583 1.00 172.40 ? 93  PRO B CA    1 
ATOM   5023  C  C     . PRO B 1 114 ? -28.749 -22.301 119.387 1.00 166.21 ? 93  PRO B C     1 
ATOM   5024  O  O     . PRO B 1 114 ? -28.551 -21.113 119.100 1.00 166.35 ? 93  PRO B O     1 
ATOM   5025  C  CB    . PRO B 1 114 ? -28.834 -22.558 121.895 1.00 173.44 ? 93  PRO B CB    1 
ATOM   5026  C  CG    . PRO B 1 114 ? -29.344 -23.704 122.719 1.00 176.48 ? 93  PRO B CG    1 
ATOM   5027  C  CD    . PRO B 1 114 ? -29.697 -24.771 121.744 1.00 173.55 ? 93  PRO B CD    1 
ATOM   5028  N  N     . LEU B 1 115 ? -28.223 -23.326 118.691 1.00 182.83 ? 94  LEU B N     1 
ATOM   5029  C  CA    . LEU B 1 115 ? -27.502 -23.150 117.429 1.00 168.46 ? 94  LEU B CA    1 
ATOM   5030  C  C     . LEU B 1 115 ? -28.453 -22.906 116.274 1.00 172.99 ? 94  LEU B C     1 
ATOM   5031  O  O     . LEU B 1 115 ? -28.143 -22.127 115.365 1.00 171.71 ? 94  LEU B O     1 
ATOM   5032  C  CB    . LEU B 1 115 ? -26.684 -24.390 117.076 1.00 152.43 ? 94  LEU B CB    1 
ATOM   5033  C  CG    . LEU B 1 115 ? -25.631 -25.012 117.960 1.00 166.25 ? 94  LEU B CG    1 
ATOM   5034  C  CD1   . LEU B 1 115 ? -25.048 -26.193 117.204 1.00 144.50 ? 94  LEU B CD1   1 
ATOM   5035  C  CD2   . LEU B 1 115 ? -24.574 -23.981 118.249 1.00 185.81 ? 94  LEU B CD2   1 
ATOM   5036  N  N     . LEU B 1 116 ? -29.582 -23.621 116.262 1.00 182.99 ? 95  LEU B N     1 
ATOM   5037  C  CA    . LEU B 1 116 ? -30.608 -23.369 115.262 1.00 161.90 ? 95  LEU B CA    1 
ATOM   5038  C  C     . LEU B 1 116 ? -31.212 -21.984 115.452 1.00 174.46 ? 95  LEU B C     1 
ATOM   5039  O  O     . LEU B 1 116 ? -31.595 -21.337 114.472 1.00 169.37 ? 95  LEU B O     1 
ATOM   5040  C  CB    . LEU B 1 116 ? -31.677 -24.462 115.333 1.00 163.25 ? 95  LEU B CB    1 
ATOM   5041  C  CG    . LEU B 1 116 ? -31.319 -25.944 115.123 1.00 159.48 ? 95  LEU B CG    1 
ATOM   5042  C  CD1   . LEU B 1 116 ? -32.520 -26.750 115.494 1.00 180.71 ? 95  LEU B CD1   1 
ATOM   5043  C  CD2   . LEU B 1 116 ? -30.973 -26.307 113.711 1.00 154.36 ? 95  LEU B CD2   1 
ATOM   5044  N  N     . ALA B 1 117 ? -31.290 -21.514 116.702 1.00 180.58 ? 96  ALA B N     1 
ATOM   5045  C  CA    . ALA B 1 117 ? -31.861 -20.198 116.979 1.00 196.15 ? 96  ALA B CA    1 
ATOM   5046  C  C     . ALA B 1 117 ? -30.944 -19.080 116.502 1.00 172.09 ? 96  ALA B C     1 
ATOM   5047  O  O     . ALA B 1 117 ? -31.425 -18.025 116.071 1.00 175.00 ? 96  ALA B O     1 
ATOM   5048  C  CB    . ALA B 1 117 ? -32.160 -20.045 118.470 1.00 222.46 ? 96  ALA B CB    1 
ATOM   5049  N  N     . LEU B 1 118 ? -29.629 -19.291 116.572 1.00 167.20 ? 97  LEU B N     1 
ATOM   5050  C  CA    . LEU B 1 118 ? -28.692 -18.348 115.984 1.00 163.43 ? 97  LEU B CA    1 
ATOM   5051  C  C     . LEU B 1 118 ? -28.606 -18.493 114.478 1.00 159.40 ? 97  LEU B C     1 
ATOM   5052  O  O     . LEU B 1 118 ? -27.937 -17.674 113.839 1.00 157.06 ? 97  LEU B O     1 
ATOM   5053  C  CB    . LEU B 1 118 ? -27.290 -18.541 116.557 1.00 159.30 ? 97  LEU B CB    1 
ATOM   5054  C  CG    . LEU B 1 118 ? -26.939 -18.026 117.941 1.00 169.89 ? 97  LEU B CG    1 
ATOM   5055  C  CD1   . LEU B 1 118 ? -26.000 -18.998 118.603 1.00 159.02 ? 97  LEU B CD1   1 
ATOM   5056  C  CD2   . LEU B 1 118 ? -26.278 -16.654 117.804 1.00 161.83 ? 97  LEU B CD2   1 
ATOM   5057  N  N     . GLY B 1 119 ? -29.292 -19.487 113.903 1.00 163.57 ? 98  GLY B N     1 
ATOM   5058  C  CA    . GLY B 1 119 ? -29.162 -19.824 112.498 1.00 165.30 ? 98  GLY B CA    1 
ATOM   5059  C  C     . GLY B 1 119 ? -27.857 -20.495 112.137 1.00 172.53 ? 98  GLY B C     1 
ATOM   5060  O  O     . GLY B 1 119 ? -27.588 -20.697 110.949 1.00 171.73 ? 98  GLY B O     1 
ATOM   5061  N  N     . TRP B 1 120 ? -27.046 -20.872 113.134 1.00 178.75 ? 99  TRP B N     1 
ATOM   5062  C  CA    . TRP B 1 120 ? -25.739 -21.469 112.882 1.00 152.73 ? 99  TRP B CA    1 
ATOM   5063  C  C     . TRP B 1 120 ? -25.822 -22.909 112.395 1.00 140.00 ? 99  TRP B C     1 
ATOM   5064  O  O     . TRP B 1 120 ? -24.862 -23.405 111.810 1.00 145.15 ? 99  TRP B O     1 
ATOM   5065  C  CB    . TRP B 1 120 ? -24.871 -21.391 114.144 1.00 141.79 ? 99  TRP B CB    1 
ATOM   5066  C  CG    . TRP B 1 120 ? -24.558 -19.977 114.598 1.00 143.66 ? 99  TRP B CG    1 
ATOM   5067  C  CD1   . TRP B 1 120 ? -24.863 -18.808 113.948 1.00 144.96 ? 99  TRP B CD1   1 
ATOM   5068  C  CD2   . TRP B 1 120 ? -23.821 -19.600 115.766 1.00 144.40 ? 99  TRP B CD2   1 
ATOM   5069  N  NE1   . TRP B 1 120 ? -24.390 -17.729 114.661 1.00 152.15 ? 99  TRP B NE1   1 
ATOM   5070  C  CE2   . TRP B 1 120 ? -23.742 -18.189 115.778 1.00 166.25 ? 99  TRP B CE2   1 
ATOM   5071  C  CE3   . TRP B 1 120 ? -23.228 -20.318 116.809 1.00 144.01 ? 99  TRP B CE3   1 
ATOM   5072  C  CZ2   . TRP B 1 120 ? -23.100 -17.488 116.791 1.00 180.11 ? 99  TRP B CZ2   1 
ATOM   5073  C  CZ3   . TRP B 1 120 ? -22.592 -19.623 117.810 1.00 174.74 ? 99  TRP B CZ3   1 
ATOM   5074  C  CH2   . TRP B 1 120 ? -22.537 -18.220 117.800 1.00 185.50 ? 99  TRP B CH2   1 
ATOM   5075  N  N     . VAL B 1 121 ? -26.920 -23.607 112.622 1.00 142.09 ? 100 VAL B N     1 
ATOM   5076  C  CA    . VAL B 1 121 ? -27.097 -24.933 112.050 1.00 139.90 ? 100 VAL B CA    1 
ATOM   5077  C  C     . VAL B 1 121 ? -28.462 -24.971 111.388 1.00 177.83 ? 100 VAL B C     1 
ATOM   5078  O  O     . VAL B 1 121 ? -29.449 -24.517 111.972 1.00 201.59 ? 100 VAL B O     1 
ATOM   5079  C  CB    . VAL B 1 121 ? -26.970 -26.054 113.097 1.00 140.57 ? 100 VAL B CB    1 
ATOM   5080  C  CG1   . VAL B 1 121 ? -27.408 -27.381 112.502 1.00 139.32 ? 100 VAL B CG1   1 
ATOM   5081  C  CG2   . VAL B 1 121 ? -25.553 -26.125 113.609 1.00 137.59 ? 100 VAL B CG2   1 
ATOM   5082  N  N     . ASP B 1 122 ? -28.503 -25.418 110.143 1.00 167.42 ? 101 ASP B N     1 
ATOM   5083  C  CA    . ASP B 1 122 ? -29.756 -25.630 109.442 1.00 167.13 ? 101 ASP B CA    1 
ATOM   5084  C  C     . ASP B 1 122 ? -30.190 -27.070 109.665 1.00 150.83 ? 101 ASP B C     1 
ATOM   5085  O  O     . ASP B 1 122 ? -29.362 -27.983 109.624 1.00 142.60 ? 101 ASP B O     1 
ATOM   5086  C  CB    . ASP B 1 122 ? -29.584 -25.366 107.941 1.00 172.82 ? 101 ASP B CB    1 
ATOM   5087  C  CG    . ASP B 1 122 ? -30.778 -24.675 107.315 1.00 185.08 ? 101 ASP B CG    1 
ATOM   5088  O  OD1   . ASP B 1 122 ? -31.816 -24.517 108.005 1.00 216.35 ? 101 ASP B OD1   1 
ATOM   5089  O  OD2   . ASP B 1 122 ? -30.685 -24.307 106.119 1.00 159.14 ? 101 ASP B OD2   1 
ATOM   5090  N  N     . ALA B 1 123 ? -31.478 -27.269 109.941 1.00 159.05 ? 102 ALA B N     1 
ATOM   5091  C  CA    . ALA B 1 123 ? -32.089 -28.556 109.664 1.00 146.43 ? 102 ALA B CA    1 
ATOM   5092  C  C     . ALA B 1 123 ? -32.860 -28.377 108.368 1.00 155.76 ? 102 ALA B C     1 
ATOM   5093  O  O     . ALA B 1 123 ? -32.951 -27.266 107.843 1.00 159.45 ? 102 ALA B O     1 
ATOM   5094  C  CB    . ALA B 1 123 ? -32.951 -29.046 110.821 1.00 151.22 ? 102 ALA B CB    1 
ATOM   5095  N  N     . GLN B 1 124 ? -33.419 -29.463 107.852 1.00 154.53 ? 103 GLN B N     1 
ATOM   5096  C  CA    . GLN B 1 124 ? -33.908 -29.521 106.469 1.00 166.89 ? 103 GLN B CA    1 
ATOM   5097  C  C     . GLN B 1 124 ? -33.063 -28.670 105.511 1.00 159.50 ? 103 GLN B C     1 
ATOM   5098  O  O     . GLN B 1 124 ? -33.593 -27.795 104.811 1.00 151.68 ? 103 GLN B O     1 
ATOM   5099  C  CB    . GLN B 1 124 ? -35.373 -29.089 106.358 1.00 167.74 ? 103 GLN B CB    1 
ATOM   5100  C  CG    . GLN B 1 124 ? -35.665 -27.673 106.804 1.00 165.30 ? 103 GLN B CG    1 
ATOM   5101  C  CD    . GLN B 1 124 ? -37.113 -27.360 106.771 1.00 174.57 ? 103 GLN B CD    1 
ATOM   5102  O  OE1   . GLN B 1 124 ? -37.617 -26.899 105.741 1.00 169.15 ? 103 GLN B OE1   1 
ATOM   5103  N  NE2   . GLN B 1 124 ? -37.804 -27.581 107.876 1.00 200.51 ? 103 GLN B NE2   1 
ATOM   5104  N  N     . PRO B 1 125 ? -31.756 -28.917 105.413 1.00 152.36 ? 104 PRO B N     1 
ATOM   5105  C  CA    . PRO B 1 125 ? -30.942 -28.161 104.458 1.00 157.66 ? 104 PRO B CA    1 
ATOM   5106  C  C     . PRO B 1 125 ? -31.226 -28.607 103.044 1.00 164.71 ? 104 PRO B C     1 
ATOM   5107  O  O     . PRO B 1 125 ? -32.033 -29.511 102.814 1.00 173.28 ? 104 PRO B O     1 
ATOM   5108  C  CB    . PRO B 1 125 ? -29.516 -28.530 104.849 1.00 150.54 ? 104 PRO B CB    1 
ATOM   5109  C  CG    . PRO B 1 125 ? -29.667 -29.967 105.208 1.00 148.56 ? 104 PRO B CG    1 
ATOM   5110  C  CD    . PRO B 1 125 ? -31.006 -30.068 105.937 1.00 154.39 ? 104 PRO B CD    1 
ATOM   5111  N  N     . THR B 1 126 ? -30.534 -28.011 102.091 1.00 156.84 ? 105 THR B N     1 
ATOM   5112  C  CA    . THR B 1 126 ? -30.689 -28.377 100.698 1.00 136.50 ? 105 THR B CA    1 
ATOM   5113  C  C     . THR B 1 126 ? -29.545 -29.311 100.347 1.00 123.44 ? 105 THR B C     1 
ATOM   5114  O  O     . THR B 1 126 ? -28.380 -28.968 100.562 1.00 143.15 ? 105 THR B O     1 
ATOM   5115  C  CB    . THR B 1 126 ? -30.686 -27.136 99.807  1.00 137.91 ? 105 THR B CB    1 
ATOM   5116  O  OG1   . THR B 1 126 ? -31.679 -26.215 100.276 1.00 141.09 ? 105 THR B OG1   1 
ATOM   5117  C  CG2   . THR B 1 126 ? -31.029 -27.519 98.388  1.00 136.53 ? 105 THR B CG2   1 
ATOM   5118  N  N     . LEU B 1 127 ? -29.877 -30.489 99.826  1.00 122.49 ? 106 LEU B N     1 
ATOM   5119  C  CA    . LEU B 1 127 ? -28.902 -31.533 99.523  1.00 118.92 ? 106 LEU B CA    1 
ATOM   5120  C  C     . LEU B 1 127 ? -28.935 -31.923 98.051  1.00 117.24 ? 106 LEU B C     1 
ATOM   5121  O  O     . LEU B 1 127 ? -29.980 -32.345 97.542  1.00 118.74 ? 106 LEU B O     1 
ATOM   5122  C  CB    . LEU B 1 127 ? -29.179 -32.753 100.385 1.00 119.54 ? 106 LEU B CB    1 
ATOM   5123  C  CG    . LEU B 1 127 ? -29.041 -32.434 101.847 1.00 121.23 ? 106 LEU B CG    1 
ATOM   5124  C  CD1   . LEU B 1 127 ? -29.963 -33.343 102.562 1.00 142.51 ? 106 LEU B CD1   1 
ATOM   5125  C  CD2   . LEU B 1 127 ? -27.643 -32.782 102.198 1.00 118.36 ? 106 LEU B CD2   1 
ATOM   5126  N  N     . GLU B 1 128 ? -27.776 -31.824 97.389  1.00 114.33 ? 107 GLU B N     1 
ATOM   5127  C  CA    . GLU B 1 128 ? -27.546 -32.350 96.045  1.00 112.50 ? 107 GLU B CA    1 
ATOM   5128  C  C     . GLU B 1 128 ? -27.539 -33.874 96.080  1.00 113.08 ? 107 GLU B C     1 
ATOM   5129  O  O     . GLU B 1 128 ? -27.380 -34.487 97.135  1.00 114.28 ? 107 GLU B O     1 
ATOM   5130  C  CB    . GLU B 1 128 ? -26.208 -31.853 95.470  1.00 131.60 ? 107 GLU B CB    1 
ATOM   5131  C  CG    . GLU B 1 128 ? -25.863 -30.376 95.700  1.00 166.90 ? 107 GLU B CG    1 
ATOM   5132  C  CD    . GLU B 1 128 ? -26.374 -29.454 94.601  1.00 197.34 ? 107 GLU B CD    1 
ATOM   5133  O  OE1   . GLU B 1 128 ? -27.193 -29.905 93.769  1.00 217.61 ? 107 GLU B OE1   1 
ATOM   5134  O  OE2   . GLU B 1 128 ? -25.952 -28.274 94.575  1.00 202.40 ? 107 GLU B OE2   1 
ATOM   5135  N  N     . LEU B 1 129 ? -27.728 -34.491 94.908  1.00 128.04 ? 108 LEU B N     1 
ATOM   5136  C  CA    . LEU B 1 129 ? -27.802 -35.949 94.863  1.00 134.90 ? 108 LEU B CA    1 
ATOM   5137  C  C     . LEU B 1 129 ? -26.539 -36.586 95.426  1.00 108.31 ? 108 LEU B C     1 
ATOM   5138  O  O     . LEU B 1 129 ? -26.603 -37.501 96.249  1.00 115.56 ? 108 LEU B O     1 
ATOM   5139  C  CB    . LEU B 1 129 ? -28.029 -36.441 93.433  1.00 145.36 ? 108 LEU B CB    1 
ATOM   5140  C  CG    . LEU B 1 129 ? -28.061 -37.977 93.416  1.00 146.78 ? 108 LEU B CG    1 
ATOM   5141  C  CD1   . LEU B 1 129 ? -29.212 -38.440 94.313  1.00 111.21 ? 108 LEU B CD1   1 
ATOM   5142  C  CD2   . LEU B 1 129 ? -28.154 -38.591 92.017  1.00 108.30 ? 108 LEU B CD2   1 
ATOM   5143  N  N     . ALA B 1 130 ? -25.379 -36.089 95.024  1.00 106.56 ? 109 ALA B N     1 
ATOM   5144  C  CA    . ALA B 1 130 ? -24.134 -36.680 95.505  1.00 130.31 ? 109 ALA B CA    1 
ATOM   5145  C  C     . ALA B 1 130 ? -23.998 -36.556 97.021  1.00 118.81 ? 109 ALA B C     1 
ATOM   5146  O  O     . ALA B 1 130 ? -23.406 -37.427 97.676  1.00 105.76 ? 109 ALA B O     1 
ATOM   5147  C  CB    . ALA B 1 130 ? -22.937 -36.034 94.795  1.00 135.78 ? 109 ALA B CB    1 
ATOM   5148  N  N     . GLN B 1 131 ? -24.537 -35.487 97.599  1.00 116.87 ? 110 GLN B N     1 
ATOM   5149  C  CA    . GLN B 1 131 ? -24.403 -35.323 99.035  1.00 108.25 ? 110 GLN B CA    1 
ATOM   5150  C  C     . GLN B 1 131 ? -25.215 -36.373 99.763  1.00 109.97 ? 110 GLN B C     1 
ATOM   5151  O  O     . GLN B 1 131 ? -24.775 -36.913 100.786 1.00 110.37 ? 110 GLN B O     1 
ATOM   5152  C  CB    . GLN B 1 131 ? -24.862 -33.929 99.459  1.00 109.68 ? 110 GLN B CB    1 
ATOM   5153  C  CG    . GLN B 1 131 ? -23.924 -32.797 99.097  1.00 108.30 ? 110 GLN B CG    1 
ATOM   5154  C  CD    . GLN B 1 131 ? -24.503 -31.450 99.459  1.00 113.05 ? 110 GLN B CD    1 
ATOM   5155  O  OE1   . GLN B 1 131 ? -25.709 -31.306 99.627  1.00 119.20 ? 110 GLN B OE1   1 
ATOM   5156  N  NE2   . GLN B 1 131 ? -23.647 -30.453 99.576  1.00 126.17 ? 110 GLN B NE2   1 
ATOM   5157  N  N     . LEU B 1 132 ? -26.405 -36.666 99.232  1.00 111.23 ? 111 LEU B N     1 
ATOM   5158  C  CA    . LEU B 1 132 ? -27.305 -37.664 99.802  1.00 113.16 ? 111 LEU B CA    1 
ATOM   5159  C  C     . LEU B 1 132 ? -26.674 -39.053 99.790  1.00 112.10 ? 111 LEU B C     1 
ATOM   5160  O  O     . LEU B 1 132 ? -26.903 -39.852 100.700 1.00 113.58 ? 111 LEU B O     1 
ATOM   5161  C  CB    . LEU B 1 132 ? -28.625 -37.594 99.030  1.00 115.80 ? 111 LEU B CB    1 
ATOM   5162  C  CG    . LEU B 1 132 ? -29.930 -38.130 99.584  1.00 117.56 ? 111 LEU B CG    1 
ATOM   5163  C  CD1   . LEU B 1 132 ? -30.307 -37.247 100.735 1.00 120.05 ? 111 LEU B CD1   1 
ATOM   5164  C  CD2   . LEU B 1 132 ? -31.005 -38.004 98.539  1.00 118.52 ? 111 LEU B CD2   1 
ATOM   5165  N  N     . PHE B 1 133 ? -25.862 -39.346 98.775  1.00 116.12 ? 112 PHE B N     1 
ATOM   5166  C  CA    . PHE B 1 133 ? -25.121 -40.607 98.704  1.00 128.82 ? 112 PHE B CA    1 
ATOM   5167  C  C     . PHE B 1 133 ? -23.965 -40.688 99.697  1.00 146.01 ? 112 PHE B C     1 
ATOM   5168  O  O     . PHE B 1 133 ? -23.378 -41.766 99.866  1.00 136.70 ? 112 PHE B O     1 
ATOM   5169  C  CB    . PHE B 1 133 ? -24.595 -40.838 97.293  1.00 117.57 ? 112 PHE B CB    1 
ATOM   5170  C  CG    . PHE B 1 133 ? -25.520 -41.642 96.460  1.00 139.13 ? 112 PHE B CG    1 
ATOM   5171  C  CD1   . PHE B 1 133 ? -26.823 -41.225 96.277  1.00 155.42 ? 112 PHE B CD1   1 
ATOM   5172  C  CD2   . PHE B 1 133 ? -25.122 -42.848 95.926  1.00 135.99 ? 112 PHE B CD2   1 
ATOM   5173  C  CE1   . PHE B 1 133 ? -27.695 -41.969 95.533  1.00 155.55 ? 112 PHE B CE1   1 
ATOM   5174  C  CE2   . PHE B 1 133 ? -25.993 -43.603 95.183  1.00 142.63 ? 112 PHE B CE2   1 
ATOM   5175  C  CZ    . PHE B 1 133 ? -27.282 -43.161 94.983  1.00 149.28 ? 112 PHE B CZ    1 
ATOM   5176  N  N     . GLY B 1 134 ? -23.534 -39.563 100.246 1.00 151.91 ? 113 GLY B N     1 
ATOM   5177  C  CA    . GLY B 1 134 ? -22.616 -39.618 101.354 1.00 146.53 ? 113 GLY B CA    1 
ATOM   5178  C  C     . GLY B 1 134 ? -23.363 -39.866 102.649 1.00 124.06 ? 113 GLY B C     1 
ATOM   5179  O  O     . GLY B 1 134 ? -22.975 -40.703 103.468 1.00 136.54 ? 113 GLY B O     1 
ATOM   5180  N  N     . LEU B 1 135 ? -24.473 -39.173 102.837 1.00 112.73 ? 114 LEU B N     1 
ATOM   5181  C  CA    . LEU B 1 135 ? -25.075 -39.209 104.155 1.00 115.43 ? 114 LEU B CA    1 
ATOM   5182  C  C     . LEU B 1 135 ? -25.661 -40.577 104.464 1.00 124.84 ? 114 LEU B C     1 
ATOM   5183  O  O     . LEU B 1 135 ? -25.625 -41.021 105.608 1.00 154.44 ? 114 LEU B O     1 
ATOM   5184  C  CB    . LEU B 1 135 ? -26.127 -38.116 104.305 1.00 131.22 ? 114 LEU B CB    1 
ATOM   5185  C  CG    . LEU B 1 135 ? -25.614 -36.683 104.473 1.00 129.70 ? 114 LEU B CG    1 
ATOM   5186  C  CD1   . LEU B 1 135 ? -26.620 -35.652 104.012 1.00 123.91 ? 114 LEU B CD1   1 
ATOM   5187  C  CD2   . LEU B 1 135 ? -25.294 -36.445 105.934 1.00 154.53 ? 114 LEU B CD2   1 
ATOM   5188  N  N     . LEU B 1 136 ? -26.159 -41.274 103.460 1.00 129.65 ? 115 LEU B N     1 
ATOM   5189  C  CA    . LEU B 1 136 ? -26.966 -42.469 103.684 1.00 134.03 ? 115 LEU B CA    1 
ATOM   5190  C  C     . LEU B 1 136 ? -26.259 -43.773 103.373 1.00 147.20 ? 115 LEU B C     1 
ATOM   5191  O  O     . LEU B 1 136 ? -25.276 -43.836 102.624 1.00 117.41 ? 115 LEU B O     1 
ATOM   5192  C  CB    . LEU B 1 136 ? -28.247 -42.436 102.864 1.00 130.39 ? 115 LEU B CB    1 
ATOM   5193  C  CG    . LEU B 1 136 ? -29.158 -41.271 103.159 1.00 122.79 ? 115 LEU B CG    1 
ATOM   5194  C  CD1   . LEU B 1 136 ? -30.428 -41.484 102.425 1.00 124.00 ? 115 LEU B CD1   1 
ATOM   5195  C  CD2   . LEU B 1 136 ? -29.435 -41.222 104.640 1.00 125.75 ? 115 LEU B CD2   1 
ATOM   5196  N  N     . LYS B 1 137 ? -26.816 -44.830 103.965 1.00 157.93 ? 116 LYS B N     1 
ATOM   5197  C  CA    . LYS B 1 137 ? -26.461 -46.210 103.686 1.00 148.04 ? 116 LYS B CA    1 
ATOM   5198  C  C     . LYS B 1 137 ? -26.837 -46.562 102.246 1.00 149.69 ? 116 LYS B C     1 
ATOM   5199  O  O     . LYS B 1 137 ? -27.592 -45.850 101.581 1.00 164.92 ? 116 LYS B O     1 
ATOM   5200  C  CB    . LYS B 1 137 ? -27.209 -47.160 104.634 1.00 150.10 ? 116 LYS B CB    1 
ATOM   5201  C  CG    . LYS B 1 137 ? -26.788 -47.203 106.108 1.00 140.34 ? 116 LYS B CG    1 
ATOM   5202  C  CD    . LYS B 1 137 ? -27.808 -48.039 106.890 1.00 148.04 ? 116 LYS B CD    1 
ATOM   5203  C  CE    . LYS B 1 137 ? -27.212 -48.645 108.129 1.00 149.65 ? 116 LYS B CE    1 
ATOM   5204  N  NZ    . LYS B 1 137 ? -26.439 -49.855 107.738 1.00 150.34 ? 116 LYS B NZ    1 
ATOM   5205  N  N     . LYS B 1 138 ? -26.258 -47.654 101.742 1.00 143.91 ? 117 LYS B N     1 
ATOM   5206  C  CA    . LYS B 1 138 ? -26.719 -48.167 100.456 1.00 140.36 ? 117 LYS B CA    1 
ATOM   5207  C  C     . LYS B 1 138 ? -28.140 -48.723 100.569 1.00 139.96 ? 117 LYS B C     1 
ATOM   5208  O  O     . LYS B 1 138 ? -28.922 -48.602 99.621  1.00 122.96 ? 117 LYS B O     1 
ATOM   5209  C  CB    . LYS B 1 138 ? -25.721 -49.210 99.930  1.00 127.68 ? 117 LYS B CB    1 
ATOM   5210  C  CG    . LYS B 1 138 ? -25.996 -49.693 98.517  1.00 136.68 ? 117 LYS B CG    1 
ATOM   5211  C  CD    . LYS B 1 138 ? -24.734 -50.248 97.832  1.00 152.48 ? 117 LYS B CD    1 
ATOM   5212  C  CE    . LYS B 1 138 ? -25.055 -51.160 96.628  1.00 153.31 ? 117 LYS B CE    1 
ATOM   5213  N  NZ    . LYS B 1 138 ? -23.853 -51.772 95.968  1.00 136.96 ? 117 LYS B NZ    1 
ATOM   5214  N  N     . ASP B 1 139 ? -28.495 -49.270 101.746 1.00 158.98 ? 118 ASP B N     1 
ATOM   5215  C  CA    . ASP B 1 139 ? -29.857 -49.733 102.045 1.00 167.09 ? 118 ASP B CA    1 
ATOM   5216  C  C     . ASP B 1 139 ? -30.876 -48.612 101.884 1.00 149.03 ? 118 ASP B C     1 
ATOM   5217  O  O     . ASP B 1 139 ? -31.819 -48.707 101.089 1.00 161.20 ? 118 ASP B O     1 
ATOM   5218  C  CB    . ASP B 1 139 ? -29.951 -50.234 103.504 1.00 190.95 ? 118 ASP B CB    1 
ATOM   5219  C  CG    . ASP B 1 139 ? -29.681 -51.720 103.677 1.00 215.41 ? 118 ASP B CG    1 
ATOM   5220  O  OD1   . ASP B 1 139 ? -29.947 -52.501 102.740 1.00 226.07 ? 118 ASP B OD1   1 
ATOM   5221  O  OD2   . ASP B 1 139 ? -29.267 -52.109 104.800 1.00 218.22 ? 118 ASP B OD2   1 
ATOM   5222  N  N     . GLU B 1 140 ? -30.676 -47.528 102.637 1.00 144.08 ? 119 GLU B N     1 
ATOM   5223  C  CA    . GLU B 1 140 ? -31.634 -46.434 102.667 1.00 128.21 ? 119 GLU B CA    1 
ATOM   5224  C  C     . GLU B 1 140 ? -31.805 -45.813 101.291 1.00 123.95 ? 119 GLU B C     1 
ATOM   5225  O  O     . GLU B 1 140 ? -32.930 -45.523 100.875 1.00 146.00 ? 119 GLU B O     1 
ATOM   5226  C  CB    . GLU B 1 140 ? -31.179 -45.387 103.690 1.00 145.43 ? 119 GLU B CB    1 
ATOM   5227  C  CG    . GLU B 1 140 ? -30.748 -45.975 105.033 1.00 183.67 ? 119 GLU B CG    1 
ATOM   5228  C  CD    . GLU B 1 140 ? -30.325 -44.920 106.037 1.00 214.52 ? 119 GLU B CD    1 
ATOM   5229  O  OE1   . GLU B 1 140 ? -31.177 -44.102 106.438 1.00 230.03 ? 119 GLU B OE1   1 
ATOM   5230  O  OE2   . GLU B 1 140 ? -29.131 -44.909 106.421 1.00 222.50 ? 119 GLU B OE2   1 
ATOM   5231  N  N     . LEU B 1 141 ? -30.714 -45.667 100.541 1.00 134.58 ? 120 LEU B N     1 
ATOM   5232  C  CA    . LEU B 1 141 ? -30.806 -44.974 99.259  1.00 134.46 ? 120 LEU B CA    1 
ATOM   5233  C  C     . LEU B 1 141 ? -31.626 -45.753 98.234  1.00 152.74 ? 120 LEU B C     1 
ATOM   5234  O  O     . LEU B 1 141 ? -32.499 -45.175 97.571  1.00 140.43 ? 120 LEU B O     1 
ATOM   5235  C  CB    . LEU B 1 141 ? -29.403 -44.686 98.716  1.00 125.28 ? 120 LEU B CB    1 
ATOM   5236  C  CG    . LEU B 1 141 ? -28.636 -43.487 99.286  1.00 143.69 ? 120 LEU B CG    1 
ATOM   5237  C  CD1   . LEU B 1 141 ? -27.193 -43.530 98.842  1.00 165.57 ? 120 LEU B CD1   1 
ATOM   5238  C  CD2   . LEU B 1 141 ? -29.263 -42.189 98.812  1.00 141.71 ? 120 LEU B CD2   1 
ATOM   5239  N  N     . SER B 1 142 ? -31.410 -47.067 98.123  1.00 158.21 ? 121 SER B N     1 
ATOM   5240  C  CA    . SER B 1 142 ? -32.120 -47.831 97.095  1.00 154.74 ? 121 SER B CA    1 
ATOM   5241  C  C     . SER B 1 142 ? -33.636 -47.697 97.218  1.00 167.53 ? 121 SER B C     1 
ATOM   5242  O  O     . SER B 1 142 ? -34.334 -47.596 96.203  1.00 173.10 ? 121 SER B O     1 
ATOM   5243  C  CB    . SER B 1 142 ? -31.710 -49.296 97.107  1.00 143.48 ? 121 SER B CB    1 
ATOM   5244  O  OG    . SER B 1 142 ? -32.226 -49.902 95.933  1.00 139.48 ? 121 SER B OG    1 
ATOM   5245  N  N     . GLN B 1 143 ? -34.168 -47.741 98.441  1.00 164.52 ? 122 GLN B N     1 
ATOM   5246  C  CA    . GLN B 1 143 ? -35.605 -47.583 98.627  1.00 133.12 ? 122 GLN B CA    1 
ATOM   5247  C  C     . GLN B 1 143 ? -36.111 -46.185 98.240  1.00 149.11 ? 122 GLN B C     1 
ATOM   5248  O  O     . GLN B 1 143 ? -37.302 -46.042 97.946  1.00 148.60 ? 122 GLN B O     1 
ATOM   5249  C  CB    . GLN B 1 143 ? -35.950 -47.988 100.055 1.00 134.73 ? 122 GLN B CB    1 
ATOM   5250  C  CG    . GLN B 1 143 ? -35.786 -49.500 100.224 1.00 146.62 ? 122 GLN B CG    1 
ATOM   5251  C  CD    . GLN B 1 143 ? -36.595 -50.082 101.373 1.00 184.22 ? 122 GLN B CD    1 
ATOM   5252  O  OE1   . GLN B 1 143 ? -36.684 -49.485 102.456 1.00 178.23 ? 122 GLN B OE1   1 
ATOM   5253  N  NE2   . GLN B 1 143 ? -37.215 -51.240 101.134 1.00 192.60 ? 122 GLN B NE2   1 
ATOM   5254  N  N     . LEU B 1 144 ? -35.258 -45.145 98.273  1.00 140.71 ? 123 LEU B N     1 
ATOM   5255  C  CA    . LEU B 1 144 ? -35.663 -43.803 97.818  1.00 160.36 ? 123 LEU B CA    1 
ATOM   5256  C  C     . LEU B 1 144 ? -35.787 -43.721 96.293  1.00 131.96 ? 123 LEU B C     1 
ATOM   5257  O  O     . LEU B 1 144 ? -36.735 -43.127 95.763  1.00 135.95 ? 123 LEU B O     1 
ATOM   5258  C  CB    . LEU B 1 144 ? -34.677 -42.739 98.307  1.00 142.02 ? 123 LEU B CB    1 
ATOM   5259  C  CG    . LEU B 1 144 ? -35.047 -41.281 97.968  1.00 126.09 ? 123 LEU B CG    1 
ATOM   5260  C  CD1   . LEU B 1 144 ? -36.464 -40.881 98.350  1.00 130.20 ? 123 LEU B CD1   1 
ATOM   5261  C  CD2   . LEU B 1 144 ? -34.055 -40.321 98.557  1.00 124.91 ? 123 LEU B CD2   1 
ATOM   5262  N  N     . PHE B 1 145 ? -34.779 -44.209 95.579  1.00 123.32 ? 124 PHE B N     1 
ATOM   5263  C  CA    . PHE B 1 145 ? -34.745 -44.221 94.126  1.00 138.13 ? 124 PHE B CA    1 
ATOM   5264  C  C     . PHE B 1 145 ? -35.213 -45.553 93.552  1.00 160.50 ? 124 PHE B C     1 
ATOM   5265  O  O     . PHE B 1 145 ? -34.890 -45.880 92.400  1.00 162.96 ? 124 PHE B O     1 
ATOM   5266  C  CB    . PHE B 1 145 ? -33.351 -43.823 93.650  1.00 152.78 ? 124 PHE B CB    1 
ATOM   5267  C  CG    . PHE B 1 145 ? -32.918 -42.486 94.190  1.00 118.54 ? 124 PHE B CG    1 
ATOM   5268  C  CD1   . PHE B 1 145 ? -32.191 -42.400 95.347  1.00 118.32 ? 124 PHE B CD1   1 
ATOM   5269  C  CD2   . PHE B 1 145 ? -33.289 -41.318 93.570  1.00 129.06 ? 124 PHE B CD2   1 
ATOM   5270  C  CE1   . PHE B 1 145 ? -31.822 -41.178 95.866  1.00 122.28 ? 124 PHE B CE1   1 
ATOM   5271  C  CE2   . PHE B 1 145 ? -32.915 -40.095 94.091  1.00 119.05 ? 124 PHE B CE2   1 
ATOM   5272  C  CZ    . PHE B 1 145 ? -32.187 -40.030 95.234  1.00 118.97 ? 124 PHE B CZ    1 
ATOM   5273  N  N     . ARG B 1 146 ? -35.895 -46.350 94.381  1.00 175.38 ? 125 ARG B N     1 
ATOM   5274  C  CA    . ARG B 1 146 ? -36.347 -47.684 94.008  1.00 170.58 ? 125 ARG B CA    1 
ATOM   5275  C  C     . ARG B 1 146 ? -36.977 -47.703 92.622  1.00 151.87 ? 125 ARG B C     1 
ATOM   5276  O  O     . ARG B 1 146 ? -36.733 -48.620 91.831  1.00 135.96 ? 125 ARG B O     1 
ATOM   5277  C  CB    . ARG B 1 146 ? -37.346 -48.185 95.074  1.00 155.77 ? 125 ARG B CB    1 
ATOM   5278  C  CG    . ARG B 1 146 ? -38.830 -47.757 94.872  1.00 160.09 ? 125 ARG B CG    1 
ATOM   5279  C  CD    . ARG B 1 146 ? -39.387 -46.694 95.863  1.00 171.00 ? 125 ARG B CD    1 
ATOM   5280  N  NE    . ARG B 1 146 ? -39.961 -47.275 97.086  1.00 182.37 ? 125 ARG B NE    1 
ATOM   5281  C  CZ    . ARG B 1 146 ? -40.697 -46.622 97.994  1.00 178.68 ? 125 ARG B CZ    1 
ATOM   5282  N  NH1   . ARG B 1 146 ? -40.996 -45.333 97.857  1.00 147.98 ? 125 ARG B NH1   1 
ATOM   5283  N  NH2   . ARG B 1 146 ? -41.136 -47.271 99.065  1.00 195.93 ? 125 ARG B NH2   1 
ATOM   5284  N  N     . ASP B 1 147 ? -37.708 -46.652 92.269  1.00 158.91 ? 126 ASP B N     1 
ATOM   5285  C  CA    . ASP B 1 147 ? -38.369 -46.651 90.974  1.00 157.24 ? 126 ASP B CA    1 
ATOM   5286  C  C     . ASP B 1 147 ? -37.361 -46.633 89.832  1.00 155.58 ? 126 ASP B C     1 
ATOM   5287  O  O     . ASP B 1 147 ? -37.426 -47.481 88.932  1.00 159.94 ? 126 ASP B O     1 
ATOM   5288  C  CB    . ASP B 1 147 ? -39.367 -45.492 90.891  1.00 179.55 ? 126 ASP B CB    1 
ATOM   5289  C  CG    . ASP B 1 147 ? -40.793 -45.915 91.307  1.00 182.68 ? 126 ASP B CG    1 
ATOM   5290  O  OD1   . ASP B 1 147 ? -41.718 -45.077 91.211  1.00 209.30 ? 126 ASP B OD1   1 
ATOM   5291  O  OD2   . ASP B 1 147 ? -41.006 -47.076 91.729  1.00 156.17 ? 126 ASP B OD2   1 
ATOM   5292  N  N     . HIS B 1 148 ? -36.383 -45.724 89.875  1.00 138.52 ? 127 HIS B N     1 
ATOM   5293  C  CA    . HIS B 1 148 ? -35.634 -45.488 88.650  1.00 117.18 ? 127 HIS B CA    1 
ATOM   5294  C  C     . HIS B 1 148 ? -34.611 -46.538 88.326  1.00 127.41 ? 127 HIS B C     1 
ATOM   5295  O  O     . HIS B 1 148 ? -34.640 -47.078 87.224  1.00 157.59 ? 127 HIS B O     1 
ATOM   5296  C  CB    . HIS B 1 148 ? -35.032 -44.127 88.664  1.00 116.38 ? 127 HIS B CB    1 
ATOM   5297  C  CG    . HIS B 1 148 ? -36.092 -43.107 88.561  1.00 184.48 ? 127 HIS B CG    1 
ATOM   5298  N  ND1   . HIS B 1 148 ? -36.415 -42.506 87.365  1.00 181.07 ? 127 HIS B ND1   1 
ATOM   5299  C  CD2   . HIS B 1 148 ? -37.015 -42.696 89.459  1.00 199.69 ? 127 HIS B CD2   1 
ATOM   5300  C  CE1   . HIS B 1 148 ? -37.437 -41.693 87.556  1.00 200.19 ? 127 HIS B CE1   1 
ATOM   5301  N  NE2   . HIS B 1 148 ? -37.816 -41.787 88.819  1.00 219.37 ? 127 HIS B NE2   1 
ATOM   5302  N  N     . LEU B 1 149 ? -33.675 -46.855 89.184  1.00 119.69 ? 128 LEU B N     1 
ATOM   5303  C  CA    . LEU B 1 149 ? -32.924 -48.021 88.763  1.00 128.11 ? 128 LEU B CA    1 
ATOM   5304  C  C     . LEU B 1 149 ? -33.083 -49.098 89.800  1.00 148.93 ? 128 LEU B C     1 
ATOM   5305  O  O     . LEU B 1 149 ? -32.343 -49.171 90.779  1.00 119.64 ? 128 LEU B O     1 
ATOM   5306  C  CB    . LEU B 1 149 ? -31.475 -47.668 88.499  1.00 132.92 ? 128 LEU B CB    1 
ATOM   5307  C  CG    . LEU B 1 149 ? -31.577 -46.530 87.471  1.00 151.70 ? 128 LEU B CG    1 
ATOM   5308  C  CD1   . LEU B 1 149 ? -30.543 -45.520 87.826  1.00 144.45 ? 128 LEU B CD1   1 
ATOM   5309  C  CD2   . LEU B 1 149 ? -31.578 -46.882 85.973  1.00 118.31 ? 128 LEU B CD2   1 
ATOM   5310  N  N     . GLY B 1 150 ? -34.047 -49.946 89.479  1.00 190.04 ? 129 GLY B N     1 
ATOM   5311  C  CA    . GLY B 1 150 ? -34.197 -51.316 89.903  1.00 203.78 ? 129 GLY B CA    1 
ATOM   5312  C  C     . GLY B 1 150 ? -33.848 -52.119 88.684  1.00 202.95 ? 129 GLY B C     1 
ATOM   5313  O  O     . GLY B 1 150 ? -34.271 -53.308 88.585  1.00 207.90 ? 129 GLY B O     1 
ATOM   5314  N  N     . ARG B 1 151 ? -33.174 -51.517 87.689  1.00 218.57 ? 130 ARG B N     1 
ATOM   5315  C  CA    . ARG B 1 151 ? -32.968 -52.033 86.351  1.00 200.38 ? 130 ARG B CA    1 
ATOM   5316  C  C     . ARG B 1 151 ? -31.935 -53.111 86.555  1.00 186.61 ? 130 ARG B C     1 
ATOM   5317  O  O     . ARG B 1 151 ? -32.139 -54.279 86.199  1.00 170.62 ? 130 ARG B O     1 
ATOM   5318  C  CB    . ARG B 1 151 ? -32.496 -50.940 85.417  1.00 170.40 ? 130 ARG B CB    1 
ATOM   5319  N  N     . ALA B 1 152 ? -30.779 -52.666 87.013  1.00 189.94 ? 131 ALA B N     1 
ATOM   5320  C  CA    . ALA B 1 152 ? -29.725 -53.546 87.459  1.00 180.34 ? 131 ALA B CA    1 
ATOM   5321  C  C     . ALA B 1 152 ? -29.313 -53.025 88.818  1.00 205.62 ? 131 ALA B C     1 
ATOM   5322  O  O     . ALA B 1 152 ? -29.271 -51.804 89.035  1.00 188.82 ? 131 ALA B O     1 
ATOM   5323  C  CB    . ALA B 1 152 ? -28.533 -53.577 86.482  1.00 159.69 ? 131 ALA B CB    1 
ATOM   5324  N  N     . ASN B 1 153 ? -29.150 -53.958 89.762  1.00 210.05 ? 132 ASN B N     1 
ATOM   5325  C  CA    . ASN B 1 153 ? -28.532 -53.645 91.042  1.00 205.17 ? 132 ASN B CA    1 
ATOM   5326  C  C     . ASN B 1 153 ? -27.024 -53.656 90.840  1.00 176.46 ? 132 ASN B C     1 
ATOM   5327  O  O     . ASN B 1 153 ? -26.472 -54.601 90.264  1.00 170.56 ? 132 ASN B O     1 
ATOM   5328  C  CB    . ASN B 1 153 ? -28.970 -54.621 92.150  1.00 210.91 ? 132 ASN B CB    1 
ATOM   5329  C  CG    . ASN B 1 153 ? -28.401 -56.033 91.993  1.00 203.80 ? 132 ASN B CG    1 
ATOM   5330  O  OD1   . ASN B 1 153 ? -27.214 -56.279 92.244  1.00 186.70 ? 132 ASN B OD1   1 
ATOM   5331  N  ND2   . ASN B 1 153 ? -29.269 -56.978 91.617  1.00 208.89 ? 132 ASN B ND2   1 
ATOM   5332  N  N     . LEU B 1 154 ? -26.359 -52.626 91.344  1.00 173.78 ? 133 LEU B N     1 
ATOM   5333  C  CA    . LEU B 1 154 ? -24.971 -52.367 90.992  1.00 175.78 ? 133 LEU B CA    1 
ATOM   5334  C  C     . LEU B 1 154 ? -24.345 -51.581 92.132  1.00 201.31 ? 133 LEU B C     1 
ATOM   5335  O  O     . LEU B 1 154 ? -24.954 -51.399 93.191  1.00 211.52 ? 133 LEU B O     1 
ATOM   5336  C  CB    . LEU B 1 154 ? -24.856 -51.615 89.656  1.00 162.84 ? 133 LEU B CB    1 
ATOM   5337  C  CG    . LEU B 1 154 ? -26.003 -50.737 89.129  1.00 135.61 ? 133 LEU B CG    1 
ATOM   5338  C  CD1   . LEU B 1 154 ? -25.583 -49.314 88.875  1.00 119.86 ? 133 LEU B CD1   1 
ATOM   5339  C  CD2   . LEU B 1 154 ? -26.493 -51.300 87.845  1.00 142.44 ? 133 LEU B CD2   1 
ATOM   5340  N  N     . ARG B 1 155 ? -23.100 -51.155 91.934  1.00 181.78 ? 134 ARG B N     1 
ATOM   5341  C  CA    . ARG B 1 155 ? -22.362 -50.586 93.050  1.00 179.66 ? 134 ARG B CA    1 
ATOM   5342  C  C     . ARG B 1 155 ? -22.897 -49.190 93.358  1.00 166.24 ? 134 ARG B C     1 
ATOM   5343  O  O     . ARG B 1 155 ? -23.751 -48.646 92.651  1.00 167.45 ? 134 ARG B O     1 
ATOM   5344  C  CB    . ARG B 1 155 ? -20.860 -50.543 92.763  1.00 166.45 ? 134 ARG B CB    1 
ATOM   5345  C  CG    . ARG B 1 155 ? -20.117 -51.857 92.955  1.00 164.79 ? 134 ARG B CG    1 
ATOM   5346  C  CD    . ARG B 1 155 ? -18.644 -51.584 93.185  1.00 143.22 ? 134 ARG B CD    1 
ATOM   5347  N  NE    . ARG B 1 155 ? -17.832 -51.595 91.977  1.00 146.45 ? 134 ARG B NE    1 
ATOM   5348  C  CZ    . ARG B 1 155 ? -16.598 -51.095 91.928  1.00 171.09 ? 134 ARG B CZ    1 
ATOM   5349  N  NH1   . ARG B 1 155 ? -16.062 -50.539 93.012  1.00 154.55 ? 134 ARG B NH1   1 
ATOM   5350  N  NH2   . ARG B 1 155 ? -15.902 -51.136 90.799  1.00 183.27 ? 134 ARG B NH2   1 
ATOM   5351  N  N     . LYS B 1 156 ? -22.358 -48.589 94.415  1.00 160.35 ? 135 LYS B N     1 
ATOM   5352  C  CA    . LYS B 1 156 ? -22.902 -47.325 94.889  1.00 148.62 ? 135 LYS B CA    1 
ATOM   5353  C  C     . LYS B 1 156 ? -22.475 -46.158 93.990  1.00 127.51 ? 135 LYS B C     1 
ATOM   5354  O  O     . LYS B 1 156 ? -23.312 -45.330 93.608  1.00 126.94 ? 135 LYS B O     1 
ATOM   5355  C  CB    . LYS B 1 156 ? -22.478 -47.137 96.351  1.00 142.06 ? 135 LYS B CB    1 
ATOM   5356  C  CG    . LYS B 1 156 ? -23.309 -46.163 97.159  1.00 151.83 ? 135 LYS B CG    1 
ATOM   5357  C  CD    . LYS B 1 156 ? -22.885 -46.163 98.624  1.00 150.79 ? 135 LYS B CD    1 
ATOM   5358  C  CE    . LYS B 1 156 ? -23.706 -45.169 99.425  1.00 145.86 ? 135 LYS B CE    1 
ATOM   5359  N  NZ    . LYS B 1 156 ? -23.489 -45.300 100.888 1.00 149.03 ? 135 LYS B NZ    1 
ATOM   5360  N  N     . ASP B 1 157 ? -21.203 -46.102 93.581  1.00 107.42 ? 136 ASP B N     1 
ATOM   5361  C  CA    . ASP B 1 157 ? -20.798 -45.081 92.616  1.00 160.51 ? 136 ASP B CA    1 
ATOM   5362  C  C     . ASP B 1 157 ? -21.538 -45.241 91.289  1.00 143.02 ? 136 ASP B C     1 
ATOM   5363  O  O     . ASP B 1 157 ? -21.780 -44.252 90.579  1.00 141.22 ? 136 ASP B O     1 
ATOM   5364  C  CB    . ASP B 1 157 ? -19.292 -45.145 92.376  1.00 161.63 ? 136 ASP B CB    1 
ATOM   5365  C  CG    . ASP B 1 157 ? -18.813 -46.553 92.104  1.00 178.18 ? 136 ASP B CG    1 
ATOM   5366  O  OD1   . ASP B 1 157 ? -19.555 -47.493 92.441  1.00 190.90 ? 136 ASP B OD1   1 
ATOM   5367  O  OD2   . ASP B 1 157 ? -17.707 -46.720 91.538  1.00 160.52 ? 136 ASP B OD2   1 
ATOM   5368  N  N     . ALA B 1 158 ? -21.940 -46.471 90.957  1.00 137.09 ? 137 ALA B N     1 
ATOM   5369  C  CA    . ALA B 1 158 ? -22.606 -46.720 89.684  1.00 145.77 ? 137 ALA B CA    1 
ATOM   5370  C  C     . ALA B 1 158 ? -24.068 -46.304 89.724  1.00 149.47 ? 137 ALA B C     1 
ATOM   5371  O  O     . ALA B 1 158 ? -24.581 -45.744 88.745  1.00 162.58 ? 137 ALA B O     1 
ATOM   5372  C  CB    . ALA B 1 158 ? -22.479 -48.194 89.322  1.00 157.59 ? 137 ALA B CB    1 
ATOM   5373  N  N     . LEU B 1 159 ? -24.754 -46.599 90.835  1.00 149.93 ? 138 LEU B N     1 
ATOM   5374  C  CA    . LEU B 1 159 ? -26.086 -46.041 91.052  1.00 121.80 ? 138 LEU B CA    1 
ATOM   5375  C  C     . LEU B 1 159 ? -26.047 -44.520 91.009  1.00 142.47 ? 138 LEU B C     1 
ATOM   5376  O  O     . LEU B 1 159 ? -26.988 -43.886 90.521  1.00 128.53 ? 138 LEU B O     1 
ATOM   5377  C  CB    . LEU B 1 159 ? -26.686 -46.522 92.370  1.00 112.80 ? 138 LEU B CB    1 
ATOM   5378  C  CG    . LEU B 1 159 ? -27.627 -47.721 92.264  1.00 141.73 ? 138 LEU B CG    1 
ATOM   5379  C  CD1   . LEU B 1 159 ? -27.991 -48.017 90.809  1.00 147.95 ? 138 LEU B CD1   1 
ATOM   5380  C  CD2   . LEU B 1 159 ? -27.093 -48.973 92.966  1.00 138.12 ? 138 LEU B CD2   1 
ATOM   5381  N  N     . LEU B 1 160 ? -25.011 -43.910 91.600  1.00 127.49 ? 139 LEU B N     1 
ATOM   5382  C  CA    . LEU B 1 160 ? -24.902 -42.458 91.524  1.00 108.74 ? 139 LEU B CA    1 
ATOM   5383  C  C     . LEU B 1 160 ? -24.779 -41.989 90.086  1.00 117.08 ? 139 LEU B C     1 
ATOM   5384  O  O     . LEU B 1 160 ? -25.456 -41.041 89.686  1.00 117.57 ? 139 LEU B O     1 
ATOM   5385  C  CB    . LEU B 1 160 ? -23.713 -41.967 92.333  1.00 108.02 ? 139 LEU B CB    1 
ATOM   5386  C  CG    . LEU B 1 160 ? -23.855 -40.465 92.520  1.00 111.74 ? 139 LEU B CG    1 
ATOM   5387  C  CD1   . LEU B 1 160 ? -24.995 -40.108 93.483  1.00 109.02 ? 139 LEU B CD1   1 
ATOM   5388  C  CD2   . LEU B 1 160 ? -22.524 -39.819 92.901  1.00 109.26 ? 139 LEU B CD2   1 
ATOM   5389  N  N     . GLU B 1 161 ? -23.932 -42.651 89.287  1.00 126.70 ? 140 GLU B N     1 
ATOM   5390  C  CA    . GLU B 1 161 ? -23.766 -42.269 87.880  1.00 143.00 ? 140 GLU B CA    1 
ATOM   5391  C  C     . GLU B 1 161 ? -25.073 -42.385 87.109  1.00 135.86 ? 140 GLU B C     1 
ATOM   5392  O  O     . GLU B 1 161 ? -25.408 -41.512 86.300  1.00 128.16 ? 140 GLU B O     1 
ATOM   5393  C  CB    . GLU B 1 161 ? -22.701 -43.125 87.204  1.00 157.21 ? 140 GLU B CB    1 
ATOM   5394  C  CG    . GLU B 1 161 ? -21.874 -42.397 86.159  1.00 172.65 ? 140 GLU B CG    1 
ATOM   5395  C  CD    . GLU B 1 161 ? -20.565 -43.105 85.884  1.00 196.27 ? 140 GLU B CD    1 
ATOM   5396  O  OE1   . GLU B 1 161 ? -19.881 -43.482 86.861  1.00 212.52 ? 140 GLU B OE1   1 
ATOM   5397  O  OE2   . GLU B 1 161 ? -20.245 -43.323 84.693  1.00 190.65 ? 140 GLU B OE2   1 
ATOM   5398  N  N     . ARG B 1 162 ? -25.776 -43.508 87.280  1.00 123.18 ? 141 ARG B N     1 
ATOM   5399  C  CA    . ARG B 1 162 ? -27.040 -43.713 86.588  1.00 132.16 ? 141 ARG B CA    1 
ATOM   5400  C  C     . ARG B 1 162 ? -28.181 -42.866 87.165  1.00 150.64 ? 141 ARG B C     1 
ATOM   5401  O  O     . ARG B 1 162 ? -29.197 -42.675 86.489  1.00 178.11 ? 141 ARG B O     1 
ATOM   5402  C  CB    . ARG B 1 162 ? -27.389 -45.213 86.614  1.00 134.66 ? 141 ARG B CB    1 
ATOM   5403  C  CG    . ARG B 1 162 ? -28.307 -45.646 85.478  1.00 134.76 ? 141 ARG B CG    1 
ATOM   5404  C  CD    . ARG B 1 162 ? -27.974 -46.997 84.902  1.00 130.47 ? 141 ARG B CD    1 
ATOM   5405  N  NE    . ARG B 1 162 ? -28.513 -48.073 85.702  1.00 151.06 ? 141 ARG B NE    1 
ATOM   5406  C  CZ    . ARG B 1 162 ? -28.862 -49.262 85.215  1.00 183.02 ? 141 ARG B CZ    1 
ATOM   5407  N  NH1   . ARG B 1 162 ? -28.733 -49.520 83.915  1.00 159.62 ? 141 ARG B NH1   1 
ATOM   5408  N  NH2   . ARG B 1 162 ? -29.353 -50.191 86.033  1.00 202.33 ? 141 ARG B NH2   1 
ATOM   5409  N  N     . LEU B 1 163 ? -28.063 -42.395 88.403  1.00 107.73 ? 142 LEU B N     1 
ATOM   5410  C  CA    . LEU B 1 163 ? -29.092 -41.601 89.061  1.00 108.99 ? 142 LEU B CA    1 
ATOM   5411  C  C     . LEU B 1 163 ? -28.882 -40.093 88.939  1.00 108.90 ? 142 LEU B C     1 
ATOM   5412  O  O     . LEU B 1 163 ? -29.811 -39.321 89.201  1.00 110.43 ? 142 LEU B O     1 
ATOM   5413  C  CB    . LEU B 1 163 ? -29.117 -41.973 90.535  1.00 128.09 ? 142 LEU B CB    1 
ATOM   5414  C  CG    . LEU B 1 163 ? -30.196 -42.944 90.977  1.00 151.17 ? 142 LEU B CG    1 
ATOM   5415  C  CD1   . LEU B 1 163 ? -29.899 -43.494 92.391  1.00 111.47 ? 142 LEU B CD1   1 
ATOM   5416  C  CD2   . LEU B 1 163 ? -31.554 -42.257 90.878  1.00 152.18 ? 142 LEU B CD2   1 
ATOM   5417  N  N     . GLN B 1 164 ? -27.672 -39.667 88.558  1.00 135.95 ? 143 GLN B N     1 
ATOM   5418  C  CA    . GLN B 1 164 ? -27.352 -38.241 88.500  1.00 131.16 ? 143 GLN B CA    1 
ATOM   5419  C  C     . GLN B 1 164 ? -28.094 -37.526 87.388  1.00 121.89 ? 143 GLN B C     1 
ATOM   5420  O  O     . GLN B 1 164 ? -28.594 -36.412 87.627  1.00 109.64 ? 143 GLN B O     1 
ATOM   5421  C  CB    . GLN B 1 164 ? -25.832 -38.050 88.368  1.00 113.24 ? 143 GLN B CB    1 
ATOM   5422  C  CG    . GLN B 1 164 ? -25.367 -36.599 88.445  1.00 105.52 ? 143 GLN B CG    1 
ATOM   5423  C  CD    . GLN B 1 164 ? -25.018 -36.130 89.853  1.00 118.11 ? 143 GLN B CD    1 
ATOM   5424  O  OE1   . GLN B 1 164 ? -25.552 -36.615 90.844  1.00 140.74 ? 143 GLN B OE1   1 
ATOM   5425  N  NE2   . GLN B 1 164 ? -24.121 -35.173 89.938  1.00 139.98 ? 143 GLN B NE2   1 
ATOM   5426  N  N     . PRO B 1 165 ? -28.181 -38.058 86.165  1.00 136.18 ? 144 PRO B N     1 
ATOM   5427  C  CA    . PRO B 1 165 ? -28.915 -37.335 85.119  1.00 153.03 ? 144 PRO B CA    1 
ATOM   5428  C  C     . PRO B 1 165 ? -30.349 -37.074 85.479  1.00 123.47 ? 144 PRO B C     1 
ATOM   5429  O  O     . PRO B 1 165 ? -30.939 -36.090 85.022  1.00 119.58 ? 144 PRO B O     1 
ATOM   5430  C  CB    . PRO B 1 165 ? -28.835 -38.279 83.909  1.00 173.83 ? 144 PRO B CB    1 
ATOM   5431  C  CG    . PRO B 1 165 ? -28.437 -39.601 84.461  1.00 167.25 ? 144 PRO B CG    1 
ATOM   5432  C  CD    . PRO B 1 165 ? -27.571 -39.288 85.629  1.00 150.82 ? 144 PRO B CD    1 
ATOM   5433  N  N     . LEU B 1 166 ? -30.933 -37.942 86.286  1.00 128.81 ? 145 LEU B N     1 
ATOM   5434  C  CA    . LEU B 1 166 ? -32.347 -37.810 86.597  1.00 141.85 ? 145 LEU B CA    1 
ATOM   5435  C  C     . LEU B 1 166 ? -32.598 -36.807 87.722  1.00 129.50 ? 145 LEU B C     1 
ATOM   5436  O  O     . LEU B 1 166 ? -33.524 -35.994 87.631  1.00 143.06 ? 145 LEU B O     1 
ATOM   5437  C  CB    . LEU B 1 166 ? -32.904 -39.202 86.871  1.00 117.23 ? 145 LEU B CB    1 
ATOM   5438  C  CG    . LEU B 1 166 ? -33.441 -39.845 85.584  1.00 114.58 ? 145 LEU B CG    1 
ATOM   5439  C  CD1   . LEU B 1 166 ? -32.482 -39.731 84.383  1.00 125.41 ? 145 LEU B CD1   1 
ATOM   5440  C  CD2   . LEU B 1 166 ? -33.643 -41.300 85.861  1.00 126.86 ? 145 LEU B CD2   1 
ATOM   5441  N  N     . PHE B 1 167 ? -31.759 -36.790 88.756  1.00 118.89 ? 146 PHE B N     1 
ATOM   5442  C  CA    . PHE B 1 167 ? -31.932 -35.866 89.873  1.00 116.86 ? 146 PHE B CA    1 
ATOM   5443  C  C     . PHE B 1 167 ? -30.735 -34.936 89.965  1.00 143.94 ? 146 PHE B C     1 
ATOM   5444  O  O     . PHE B 1 167 ? -29.974 -34.957 90.944  1.00 152.74 ? 146 PHE B O     1 
ATOM   5445  C  CB    . PHE B 1 167 ? -32.120 -36.609 91.185  1.00 115.78 ? 146 PHE B CB    1 
ATOM   5446  C  CG    . PHE B 1 167 ? -33.334 -37.431 91.207  1.00 127.17 ? 146 PHE B CG    1 
ATOM   5447  C  CD1   . PHE B 1 167 ? -34.514 -36.908 91.718  1.00 120.96 ? 146 PHE B CD1   1 
ATOM   5448  C  CD2   . PHE B 1 167 ? -33.311 -38.717 90.679  1.00 116.53 ? 146 PHE B CD2   1 
ATOM   5449  C  CE1   . PHE B 1 167 ? -35.649 -37.665 91.721  1.00 149.33 ? 146 PHE B CE1   1 
ATOM   5450  C  CE2   . PHE B 1 167 ? -34.432 -39.484 90.671  1.00 118.33 ? 146 PHE B CE2   1 
ATOM   5451  C  CZ    . PHE B 1 167 ? -35.618 -38.962 91.193  1.00 158.87 ? 146 PHE B CZ    1 
ATOM   5452  N  N     . PRO B 1 168 ? -30.566 -34.069 88.973  1.00 132.45 ? 147 PRO B N     1 
ATOM   5453  C  CA    . PRO B 1 168 ? -29.470 -33.115 89.061  1.00 125.59 ? 147 PRO B CA    1 
ATOM   5454  C  C     . PRO B 1 168 ? -29.734 -32.085 90.133  1.00 127.82 ? 147 PRO B C     1 
ATOM   5455  O  O     . PRO B 1 168 ? -28.822 -31.709 90.879  1.00 156.80 ? 147 PRO B O     1 
ATOM   5456  C  CB    . PRO B 1 168 ? -29.436 -32.514 87.655  1.00 134.69 ? 147 PRO B CB    1 
ATOM   5457  C  CG    . PRO B 1 168 ? -30.677 -33.106 86.929  1.00 122.79 ? 147 PRO B CG    1 
ATOM   5458  C  CD    . PRO B 1 168 ? -31.523 -33.715 87.918  1.00 116.07 ? 147 PRO B CD    1 
ATOM   5459  N  N     . GLU B 1 169 ? -30.986 -31.665 90.262  1.00 117.51 ? 148 GLU B N     1 
ATOM   5460  C  CA    . GLU B 1 169 ? -31.371 -30.602 91.175  1.00 142.33 ? 148 GLU B CA    1 
ATOM   5461  C  C     . GLU B 1 169 ? -31.127 -31.006 92.631  1.00 128.07 ? 148 GLU B C     1 
ATOM   5462  O  O     . GLU B 1 169 ? -30.993 -32.185 92.966  1.00 117.95 ? 148 GLU B O     1 
ATOM   5463  C  CB    . GLU B 1 169 ? -32.846 -30.234 90.962  1.00 176.61 ? 148 GLU B CB    1 
ATOM   5464  C  CG    . GLU B 1 169 ? -33.852 -31.324 91.338  1.00 192.91 ? 148 GLU B CG    1 
ATOM   5465  C  CD    . GLU B 1 169 ? -34.226 -32.221 90.170  1.00 198.86 ? 148 GLU B CD    1 
ATOM   5466  O  OE1   . GLU B 1 169 ? -33.820 -31.915 89.022  1.00 164.04 ? 148 GLU B OE1   1 
ATOM   5467  O  OE2   . GLU B 1 169 ? -34.940 -33.225 90.410  1.00 206.62 ? 148 GLU B OE2   1 
ATOM   5468  N  N     . ALA B 1 170 ? -31.000 -29.996 93.486  1.00 123.21 ? 149 ALA B N     1 
ATOM   5469  C  CA    . ALA B 1 170 ? -30.946 -30.190 94.928  1.00 125.95 ? 149 ALA B CA    1 
ATOM   5470  C  C     . ALA B 1 170 ? -32.311 -30.013 95.581  1.00 136.82 ? 149 ALA B C     1 
ATOM   5471  O  O     . ALA B 1 170 ? -33.104 -29.173 95.160  1.00 152.18 ? 149 ALA B O     1 
ATOM   5472  C  CB    . ALA B 1 170 ? -29.951 -29.212 95.541  1.00 140.26 ? 149 ALA B CB    1 
ATOM   5473  N  N     . ARG B 1 171 ? -32.568 -30.803 96.629  1.00 131.64 ? 150 ARG B N     1 
ATOM   5474  C  CA    . ARG B 1 171 ? -33.858 -30.798 97.325  1.00 149.81 ? 150 ARG B CA    1 
ATOM   5475  C  C     . ARG B 1 171 ? -33.628 -30.846 98.835  1.00 139.89 ? 150 ARG B C     1 
ATOM   5476  O  O     . ARG B 1 171 ? -32.587 -31.322 99.298  1.00 128.04 ? 150 ARG B O     1 
ATOM   5477  C  CB    . ARG B 1 171 ? -34.753 -31.986 96.915  1.00 153.50 ? 150 ARG B CB    1 
ATOM   5478  C  CG    . ARG B 1 171 ? -34.953 -32.170 95.408  1.00 165.60 ? 150 ARG B CG    1 
ATOM   5479  C  CD    . ARG B 1 171 ? -35.450 -33.579 95.066  1.00 167.16 ? 150 ARG B CD    1 
ATOM   5480  N  NE    . ARG B 1 171 ? -36.908 -33.661 94.948  1.00 175.27 ? 150 ARG B NE    1 
ATOM   5481  C  CZ    . ARG B 1 171 ? -37.553 -33.819 93.796  1.00 177.67 ? 150 ARG B CZ    1 
ATOM   5482  N  NH1   . ARG B 1 171 ? -36.862 -33.912 92.660  1.00 160.40 ? 150 ARG B NH1   1 
ATOM   5483  N  NH2   . ARG B 1 171 ? -38.883 -33.886 93.782  1.00 179.46 ? 150 ARG B NH2   1 
ATOM   5484  N  N     . ARG B 1 172 ? -34.612 -30.367 99.612  1.00 135.41 ? 151 ARG B N     1 
ATOM   5485  C  CA    . ARG B 1 172 ? -34.535 -30.584 101.055 1.00 136.80 ? 151 ARG B CA    1 
ATOM   5486  C  C     . ARG B 1 172 ? -34.624 -32.078 101.361 1.00 135.72 ? 151 ARG B C     1 
ATOM   5487  O  O     . ARG B 1 172 ? -35.079 -32.870 100.542 1.00 135.04 ? 151 ARG B O     1 
ATOM   5488  C  CB    . ARG B 1 172 ? -35.627 -29.813 101.807 1.00 145.40 ? 151 ARG B CB    1 
ATOM   5489  C  CG    . ARG B 1 172 ? -35.539 -28.290 101.703 1.00 166.44 ? 151 ARG B CG    1 
ATOM   5490  C  CD    . ARG B 1 172 ? -36.664 -27.590 102.478 1.00 182.20 ? 151 ARG B CD    1 
ATOM   5491  N  NE    . ARG B 1 172 ? -37.678 -26.993 101.610 1.00 205.58 ? 151 ARG B NE    1 
ATOM   5492  C  CZ    . ARG B 1 172 ? -38.912 -27.468 101.460 1.00 209.72 ? 151 ARG B CZ    1 
ATOM   5493  N  NH1   . ARG B 1 172 ? -39.287 -28.550 102.125 1.00 206.44 ? 151 ARG B NH1   1 
ATOM   5494  N  NH2   . ARG B 1 172 ? -39.774 -26.866 100.646 1.00 214.72 ? 151 ARG B NH2   1 
ATOM   5495  N  N     . LEU B 1 173 ? -34.143 -32.471 102.547 1.00 135.64 ? 152 LEU B N     1 
ATOM   5496  C  CA    . LEU B 1 173 ? -34.236 -33.881 102.927 1.00 135.17 ? 152 LEU B CA    1 
ATOM   5497  C  C     . LEU B 1 173 ? -35.677 -34.344 102.933 1.00 139.04 ? 152 LEU B C     1 
ATOM   5498  O  O     . LEU B 1 173 ? -35.959 -35.495 102.566 1.00 138.24 ? 152 LEU B O     1 
ATOM   5499  C  CB    . LEU B 1 173 ? -33.617 -34.124 104.308 1.00 135.50 ? 152 LEU B CB    1 
ATOM   5500  C  CG    . LEU B 1 173 ? -34.132 -33.266 105.487 1.00 157.52 ? 152 LEU B CG    1 
ATOM   5501  C  CD1   . LEU B 1 173 ? -35.383 -33.794 106.257 1.00 144.73 ? 152 LEU B CD1   1 
ATOM   5502  C  CD2   . LEU B 1 173 ? -32.991 -33.026 106.442 1.00 155.50 ? 152 LEU B CD2   1 
ATOM   5503  N  N     . ALA B 1 174 ? -36.592 -33.442 103.334 1.00 151.24 ? 153 ALA B N     1 
ATOM   5504  C  CA    . ALA B 1 174 ? -38.034 -33.686 103.327 1.00 148.01 ? 153 ALA B CA    1 
ATOM   5505  C  C     . ALA B 1 174 ? -38.594 -33.810 101.916 1.00 147.30 ? 153 ALA B C     1 
ATOM   5506  O  O     . ALA B 1 174 ? -39.547 -34.560 101.696 1.00 149.29 ? 153 ALA B O     1 
ATOM   5507  C  CB    . ALA B 1 174 ? -38.749 -32.562 104.076 1.00 153.26 ? 153 ALA B CB    1 
ATOM   5508  N  N     . GLU B 1 175 ? -38.003 -33.120 100.949 1.00 144.58 ? 154 GLU B N     1 
ATOM   5509  C  CA    . GLU B 1 175 ? -38.464 -33.183 99.571  1.00 143.96 ? 154 GLU B CA    1 
ATOM   5510  C  C     . GLU B 1 175 ? -37.889 -34.375 98.809  1.00 139.55 ? 154 GLU B C     1 
ATOM   5511  O  O     . GLU B 1 175 ? -38.234 -34.568 97.640  1.00 138.85 ? 154 GLU B O     1 
ATOM   5512  C  CB    . GLU B 1 175 ? -38.109 -31.876 98.841  1.00 159.65 ? 154 GLU B CB    1 
ATOM   5513  C  CG    . GLU B 1 175 ? -38.906 -30.650 99.275  1.00 189.92 ? 154 GLU B CG    1 
ATOM   5514  C  CD    . GLU B 1 175 ? -38.438 -29.375 98.590  1.00 223.25 ? 154 GLU B CD    1 
ATOM   5515  O  OE1   . GLU B 1 175 ? -37.374 -29.403 97.927  1.00 220.09 ? 154 GLU B OE1   1 
ATOM   5516  O  OE2   . GLU B 1 175 ? -39.169 -28.361 98.670  1.00 242.46 ? 154 GLU B OE2   1 
ATOM   5517  N  N     . TRP B 1 176 ? -37.017 -35.173 99.427  1.00 136.85 ? 155 TRP B N     1 
ATOM   5518  C  CA    . TRP B 1 176 ? -36.493 -36.372 98.784  1.00 133.29 ? 155 TRP B CA    1 
ATOM   5519  C  C     . TRP B 1 176 ? -37.357 -37.569 99.140  1.00 135.26 ? 155 TRP B C     1 
ATOM   5520  O  O     . TRP B 1 176 ? -37.955 -38.193 98.262  1.00 166.83 ? 155 TRP B O     1 
ATOM   5521  C  CB    . TRP B 1 176 ? -35.032 -36.601 99.185  1.00 129.61 ? 155 TRP B CB    1 
ATOM   5522  C  CG    . TRP B 1 176 ? -34.027 -35.770 98.440  1.00 126.66 ? 155 TRP B CG    1 
ATOM   5523  C  CD1   . TRP B 1 176 ? -33.359 -34.672 98.904  1.00 140.49 ? 155 TRP B CD1   1 
ATOM   5524  C  CD2   . TRP B 1 176 ? -33.554 -35.990 97.117  1.00 123.79 ? 155 TRP B CD2   1 
ATOM   5525  N  NE1   . TRP B 1 176 ? -32.513 -34.184 97.942  1.00 123.56 ? 155 TRP B NE1   1 
ATOM   5526  C  CE2   . TRP B 1 176 ? -32.617 -34.980 96.834  1.00 123.77 ? 155 TRP B CE2   1 
ATOM   5527  C  CE3   . TRP B 1 176 ? -33.837 -36.935 96.136  1.00 122.77 ? 155 TRP B CE3   1 
ATOM   5528  C  CZ2   . TRP B 1 176 ? -31.965 -34.896 95.611  1.00 149.69 ? 155 TRP B CZ2   1 
ATOM   5529  C  CZ3   . TRP B 1 176 ? -33.197 -36.845 94.924  1.00 120.21 ? 155 TRP B CZ3   1 
ATOM   5530  C  CH2   . TRP B 1 176 ? -32.271 -35.840 94.670  1.00 132.77 ? 155 TRP B CH2   1 
ATOM   5531  N  N     . GLN B 1 177 ? -37.404 -37.935 100.409 1.00 137.03 ? 156 GLN B N     1 
ATOM   5532  C  CA    . GLN B 1 177 ? -38.526 -38.720 100.890 1.00 155.31 ? 156 GLN B CA    1 
ATOM   5533  C  C     . GLN B 1 177 ? -39.129 -38.028 102.108 1.00 177.72 ? 156 GLN B C     1 
ATOM   5534  O  O     . GLN B 1 177 ? -38.440 -37.797 103.110 1.00 174.93 ? 156 GLN B O     1 
ATOM   5535  C  CB    . GLN B 1 177 ? -38.139 -40.153 101.206 1.00 150.55 ? 156 GLN B CB    1 
ATOM   5536  C  CG    . GLN B 1 177 ? -36.969 -40.304 102.083 1.00 166.46 ? 156 GLN B CG    1 
ATOM   5537  C  CD    . GLN B 1 177 ? -37.083 -41.609 102.808 1.00 200.74 ? 156 GLN B CD    1 
ATOM   5538  O  OE1   . GLN B 1 177 ? -38.136 -42.252 102.753 1.00 204.10 ? 156 GLN B OE1   1 
ATOM   5539  N  NE2   . GLN B 1 177 ? -36.034 -42.000 103.525 1.00 212.98 ? 156 GLN B NE2   1 
ATOM   5540  N  N     . ALA B 1 178 ? -40.420 -37.703 102.016 1.00 186.46 ? 157 ALA B N     1 
ATOM   5541  C  CA    . ALA B 1 178 ? -41.110 -36.941 103.050 1.00 175.72 ? 157 ALA B CA    1 
ATOM   5542  C  C     . ALA B 1 178 ? -41.210 -37.699 104.367 1.00 187.61 ? 157 ALA B C     1 
ATOM   5543  O  O     . ALA B 1 178 ? -41.422 -37.073 105.410 1.00 199.21 ? 157 ALA B O     1 
ATOM   5544  C  CB    . ALA B 1 178 ? -42.512 -36.542 102.553 1.00 159.18 ? 157 ALA B CB    1 
ATOM   5545  N  N     . ASP B 1 179 ? -41.049 -39.020 104.355 1.00 181.56 ? 158 ASP B N     1 
ATOM   5546  C  CA    . ASP B 1 179 ? -41.247 -39.823 105.553 1.00 197.37 ? 158 ASP B CA    1 
ATOM   5547  C  C     . ASP B 1 179 ? -39.962 -40.138 106.323 1.00 196.01 ? 158 ASP B C     1 
ATOM   5548  O  O     . ASP B 1 179 ? -40.011 -40.951 107.249 1.00 230.99 ? 158 ASP B O     1 
ATOM   5549  C  CB    . ASP B 1 179 ? -41.977 -41.122 105.190 1.00 210.84 ? 158 ASP B CB    1 
ATOM   5550  C  CG    . ASP B 1 179 ? -42.925 -41.606 106.293 1.00 236.15 ? 158 ASP B CG    1 
ATOM   5551  O  OD1   . ASP B 1 179 ? -42.574 -41.513 107.488 1.00 248.95 ? 158 ASP B OD1   1 
ATOM   5552  O  OD2   . ASP B 1 179 ? -44.031 -42.090 105.966 1.00 242.50 ? 158 ASP B OD2   1 
ATOM   5553  N  N     . PHE B 1 180 ? -38.810 -39.559 105.974 1.00 171.46 ? 159 PHE B N     1 
ATOM   5554  C  CA    . PHE B 1 180 ? -37.608 -39.909 106.726 1.00 163.47 ? 159 PHE B CA    1 
ATOM   5555  C  C     . PHE B 1 180 ? -37.522 -39.079 108.006 1.00 186.34 ? 159 PHE B C     1 
ATOM   5556  O  O     . PHE B 1 180 ? -37.350 -37.856 107.950 1.00 200.25 ? 159 PHE B O     1 
ATOM   5557  C  CB    . PHE B 1 180 ? -36.351 -39.714 105.905 1.00 152.07 ? 159 PHE B CB    1 
ATOM   5558  C  CG    . PHE B 1 180 ? -35.129 -40.183 106.612 1.00 190.28 ? 159 PHE B CG    1 
ATOM   5559  C  CD1   . PHE B 1 180 ? -35.214 -41.206 107.551 1.00 216.31 ? 159 PHE B CD1   1 
ATOM   5560  C  CD2   . PHE B 1 180 ? -33.909 -39.563 106.404 1.00 204.19 ? 159 PHE B CD2   1 
ATOM   5561  C  CE1   . PHE B 1 180 ? -34.095 -41.634 108.233 1.00 239.66 ? 159 PHE B CE1   1 
ATOM   5562  C  CE2   . PHE B 1 180 ? -32.779 -39.982 107.083 1.00 219.34 ? 159 PHE B CE2   1 
ATOM   5563  C  CZ    . PHE B 1 180 ? -32.869 -41.019 107.999 1.00 238.68 ? 159 PHE B CZ    1 
ATOM   5564  N  N     . ALA B 1 181 ? -37.544 -39.766 109.155 1.00 192.68 ? 160 ALA B N     1 
ATOM   5565  C  CA    . ALA B 1 181 ? -37.775 -39.171 110.470 1.00 189.48 ? 160 ALA B CA    1 
ATOM   5566  C  C     . ALA B 1 181 ? -36.535 -38.574 111.116 1.00 187.23 ? 160 ALA B C     1 
ATOM   5567  O  O     . ALA B 1 181 ? -36.650 -37.996 112.202 1.00 189.94 ? 160 ALA B O     1 
ATOM   5568  C  CB    . ALA B 1 181 ? -38.384 -40.218 111.419 1.00 176.43 ? 160 ALA B CB    1 
ATOM   5569  N  N     . GLU B 1 182 ? -35.362 -38.694 110.494 1.00 189.72 ? 161 GLU B N     1 
ATOM   5570  C  CA    . GLU B 1 182 ? -34.140 -38.103 111.040 1.00 194.32 ? 161 GLU B CA    1 
ATOM   5571  C  C     . GLU B 1 182 ? -33.880 -36.759 110.396 1.00 165.31 ? 161 GLU B C     1 
ATOM   5572  O  O     . GLU B 1 182 ? -33.864 -36.672 109.158 1.00 144.26 ? 161 GLU B O     1 
ATOM   5573  C  CB    . GLU B 1 182 ? -32.911 -38.988 110.846 1.00 185.28 ? 161 GLU B CB    1 
ATOM   5574  C  CG    . GLU B 1 182 ? -32.904 -40.312 111.566 1.00 191.64 ? 161 GLU B CG    1 
ATOM   5575  C  CD    . GLU B 1 182 ? -31.511 -40.904 111.623 1.00 183.96 ? 161 GLU B CD    1 
ATOM   5576  O  OE1   . GLU B 1 182 ? -30.556 -40.196 111.241 1.00 175.93 ? 161 GLU B OE1   1 
ATOM   5577  O  OE2   . GLU B 1 182 ? -31.368 -42.079 112.025 1.00 188.74 ? 161 GLU B OE2   1 
ATOM   5578  N  N     . PRO B 1 183 ? -33.782 -35.681 111.164 1.00 153.97 ? 162 PRO B N     1 
ATOM   5579  C  CA    . PRO B 1 183 ? -33.295 -34.442 110.585 1.00 147.07 ? 162 PRO B CA    1 
ATOM   5580  C  C     . PRO B 1 183 ? -31.887 -34.706 110.102 1.00 166.39 ? 162 PRO B C     1 
ATOM   5581  O  O     . PRO B 1 183 ? -31.231 -35.666 110.518 1.00 169.40 ? 162 PRO B O     1 
ATOM   5582  C  CB    . PRO B 1 183 ? -33.300 -33.451 111.754 1.00 150.52 ? 162 PRO B CB    1 
ATOM   5583  C  CG    . PRO B 1 183 ? -33.966 -34.144 112.878 1.00 163.44 ? 162 PRO B CG    1 
ATOM   5584  C  CD    . PRO B 1 183 ? -33.789 -35.611 112.628 1.00 161.91 ? 162 PRO B CD    1 
ATOM   5585  N  N     . VAL B 1 184 ? -31.446 -33.881 109.169 1.00 148.32 ? 163 VAL B N     1 
ATOM   5586  C  CA    . VAL B 1 184 ? -30.047 -33.813 108.785 1.00 134.82 ? 163 VAL B CA    1 
ATOM   5587  C  C     . VAL B 1 184 ? -29.613 -32.385 109.085 1.00 143.85 ? 163 VAL B C     1 
ATOM   5588  O  O     . VAL B 1 184 ? -30.341 -31.441 108.753 1.00 163.40 ? 163 VAL B O     1 
ATOM   5589  C  CB    . VAL B 1 184 ? -29.851 -34.199 107.309 1.00 130.76 ? 163 VAL B CB    1 
ATOM   5590  C  CG1   . VAL B 1 184 ? -28.561 -33.675 106.786 1.00 126.92 ? 163 VAL B CG1   1 
ATOM   5591  C  CG2   . VAL B 1 184 ? -29.873 -35.691 107.176 1.00 129.94 ? 163 VAL B CG2   1 
ATOM   5592  N  N     . TYR B 1 185 ? -28.464 -32.222 109.750 1.00 133.00 ? 164 TYR B N     1 
ATOM   5593  C  CA    . TYR B 1 185 ? -27.995 -30.899 110.138 1.00 133.35 ? 164 TYR B CA    1 
ATOM   5594  C  C     . TYR B 1 185 ? -26.834 -30.462 109.262 1.00 128.98 ? 164 TYR B C     1 
ATOM   5595  O  O     . TYR B 1 185 ? -25.955 -31.259 108.927 1.00 125.84 ? 164 TYR B O     1 
ATOM   5596  C  CB    . TYR B 1 185 ? -27.570 -30.845 111.602 1.00 135.30 ? 164 TYR B CB    1 
ATOM   5597  C  CG    . TYR B 1 185 ? -28.670 -31.199 112.547 1.00 140.14 ? 164 TYR B CG    1 
ATOM   5598  C  CD1   . TYR B 1 185 ? -29.762 -30.346 112.735 1.00 156.10 ? 164 TYR B CD1   1 
ATOM   5599  C  CD2   . TYR B 1 185 ? -28.621 -32.374 113.269 1.00 141.05 ? 164 TYR B CD2   1 
ATOM   5600  C  CE1   . TYR B 1 185 ? -30.786 -30.674 113.608 1.00 149.21 ? 164 TYR B CE1   1 
ATOM   5601  C  CE2   . TYR B 1 185 ? -29.632 -32.707 114.149 1.00 147.36 ? 164 TYR B CE2   1 
ATOM   5602  C  CZ    . TYR B 1 185 ? -30.707 -31.857 114.313 1.00 149.90 ? 164 TYR B CZ    1 
ATOM   5603  O  OH    . TYR B 1 185 ? -31.691 -32.223 115.187 1.00 155.00 ? 164 TYR B OH    1 
ATOM   5604  N  N     . GLU B 1 186 ? -26.851 -29.185 108.900 1.00 129.22 ? 165 GLU B N     1 
ATOM   5605  C  CA    . GLU B 1 186 ? -25.809 -28.523 108.130 1.00 125.79 ? 165 GLU B CA    1 
ATOM   5606  C  C     . GLU B 1 186 ? -25.229 -27.415 108.992 1.00 126.71 ? 165 GLU B C     1 
ATOM   5607  O  O     . GLU B 1 186 ? -25.960 -26.522 109.434 1.00 133.22 ? 165 GLU B O     1 
ATOM   5608  C  CB    . GLU B 1 186 ? -26.407 -27.963 106.841 1.00 125.60 ? 165 GLU B CB    1 
ATOM   5609  C  CG    . GLU B 1 186 ? -25.495 -27.210 105.921 1.00 153.59 ? 165 GLU B CG    1 
ATOM   5610  C  CD    . GLU B 1 186 ? -26.279 -26.595 104.771 1.00 168.85 ? 165 GLU B CD    1 
ATOM   5611  O  OE1   . GLU B 1 186 ? -25.952 -26.885 103.590 1.00 190.02 ? 165 GLU B OE1   1 
ATOM   5612  O  OE2   . GLU B 1 186 ? -27.234 -25.829 105.064 1.00 145.55 ? 165 GLU B OE2   1 
ATOM   5613  N  N     . LEU B 1 187 ? -23.928 -27.474 109.259 1.00 124.04 ? 166 LEU B N     1 
ATOM   5614  C  CA    . LEU B 1 187 ? -23.294 -26.374 109.976 1.00 136.98 ? 166 LEU B CA    1 
ATOM   5615  C  C     . LEU B 1 187 ? -23.001 -25.244 108.988 1.00 133.32 ? 166 LEU B C     1 
ATOM   5616  O  O     . LEU B 1 187 ? -22.169 -25.385 108.088 1.00 119.85 ? 166 LEU B O     1 
ATOM   5617  C  CB    . LEU B 1 187 ? -22.045 -26.870 110.702 1.00 141.48 ? 166 LEU B CB    1 
ATOM   5618  C  CG    . LEU B 1 187 ? -21.014 -25.932 111.345 1.00 146.70 ? 166 LEU B CG    1 
ATOM   5619  C  CD1   . LEU B 1 187 ? -21.607 -24.863 112.246 1.00 145.45 ? 166 LEU B CD1   1 
ATOM   5620  C  CD2   . LEU B 1 187 ? -20.087 -26.797 112.159 1.00 146.03 ? 166 LEU B CD2   1 
ATOM   5621  N  N     . ARG B 1 188 ? -23.670 -24.110 109.184 1.00 137.61 ? 167 ARG B N     1 
ATOM   5622  C  CA    . ARG B 1 188 ? -23.648 -22.982 108.266 1.00 125.93 ? 167 ARG B CA    1 
ATOM   5623  C  C     . ARG B 1 188 ? -22.678 -21.904 108.709 1.00 125.62 ? 167 ARG B C     1 
ATOM   5624  O  O     . ARG B 1 188 ? -22.655 -20.832 108.102 1.00 145.41 ? 167 ARG B O     1 
ATOM   5625  C  CB    . ARG B 1 188 ? -25.050 -22.387 108.095 1.00 132.81 ? 167 ARG B CB    1 
ATOM   5626  C  CG    . ARG B 1 188 ? -25.864 -23.114 107.029 1.00 161.74 ? 167 ARG B CG    1 
ATOM   5627  C  CD    . ARG B 1 188 ? -27.134 -22.386 106.664 1.00 194.18 ? 167 ARG B CD    1 
ATOM   5628  N  NE    . ARG B 1 188 ? -26.827 -21.083 106.085 1.00 224.40 ? 167 ARG B NE    1 
ATOM   5629  C  CZ    . ARG B 1 188 ? -26.985 -19.924 106.715 1.00 239.64 ? 167 ARG B CZ    1 
ATOM   5630  N  NH1   . ARG B 1 188 ? -26.675 -18.792 106.100 1.00 245.44 ? 167 ARG B NH1   1 
ATOM   5631  N  NH2   . ARG B 1 188 ? -27.468 -19.895 107.949 1.00 246.69 ? 167 ARG B NH2   1 
ATOM   5632  N  N     . CYS B 1 189 ? -21.937 -22.132 109.800 1.00 125.01 ? 168 CYS B N     1 
ATOM   5633  C  CA    . CYS B 1 189 ? -21.002 -21.168 110.369 1.00 133.87 ? 168 CYS B CA    1 
ATOM   5634  C  C     . CYS B 1 189 ? -19.543 -21.398 109.981 1.00 127.21 ? 168 CYS B C     1 
ATOM   5635  O  O     . CYS B 1 189 ? -18.666 -20.750 110.548 1.00 135.35 ? 168 CYS B O     1 
ATOM   5636  C  CB    . CYS B 1 189 ? -21.120 -21.169 111.887 1.00 166.13 ? 168 CYS B CB    1 
ATOM   5637  S  SG    . CYS B 1 189 ? -22.014 -19.725 112.480 1.00 230.21 ? 168 CYS B SG    1 
ATOM   5638  N  N     . MET B 1 190 ? -19.253 -22.334 109.078 1.00 128.98 ? 169 MET B N     1 
ATOM   5639  C  CA    . MET B 1 190 ? -17.870 -22.729 108.821 1.00 127.82 ? 169 MET B CA    1 
ATOM   5640  C  C     . MET B 1 190 ? -17.011 -21.620 108.213 1.00 146.14 ? 169 MET B C     1 
ATOM   5641  O  O     . MET B 1 190 ? -15.781 -21.725 108.258 1.00 145.49 ? 169 MET B O     1 
ATOM   5642  C  CB    . MET B 1 190 ? -17.819 -23.966 107.922 1.00 131.41 ? 169 MET B CB    1 
ATOM   5643  C  CG    . MET B 1 190 ? -17.782 -25.302 108.680 1.00 132.90 ? 169 MET B CG    1 
ATOM   5644  S  SD    . MET B 1 190 ? -16.335 -25.661 109.708 1.00 140.29 ? 169 MET B SD    1 
ATOM   5645  C  CE    . MET B 1 190 ? -15.055 -26.092 108.495 1.00 138.14 ? 169 MET B CE    1 
ATOM   5646  N  N     . ALA B 1 191 ? -17.601 -20.586 107.608 1.00 146.75 ? 170 ALA B N     1 
ATOM   5647  C  CA    . ALA B 1 191 ? -16.761 -19.596 106.930 1.00 151.67 ? 170 ALA B CA    1 
ATOM   5648  C  C     . ALA B 1 191 ? -15.860 -18.844 107.910 1.00 142.29 ? 170 ALA B C     1 
ATOM   5649  O  O     . ALA B 1 191 ? -14.625 -18.893 107.806 1.00 143.78 ? 170 ALA B O     1 
ATOM   5650  C  CB    . ALA B 1 191 ? -17.647 -18.615 106.159 1.00 167.41 ? 170 ALA B CB    1 
ATOM   5651  N  N     . LEU B 1 192 ? -16.456 -18.200 108.915 1.00 142.68 ? 171 LEU B N     1 
ATOM   5652  C  CA    . LEU B 1 192 ? -15.643 -17.544 109.930 1.00 126.86 ? 171 LEU B CA    1 
ATOM   5653  C  C     . LEU B 1 192 ? -14.858 -18.542 110.776 1.00 143.69 ? 171 LEU B C     1 
ATOM   5654  O  O     . LEU B 1 192 ? -13.855 -18.155 111.373 1.00 166.13 ? 171 LEU B O     1 
ATOM   5655  C  CB    . LEU B 1 192 ? -16.490 -16.592 110.771 1.00 120.41 ? 171 LEU B CB    1 
ATOM   5656  C  CG    . LEU B 1 192 ? -16.906 -15.461 109.816 1.00 131.34 ? 171 LEU B CG    1 
ATOM   5657  C  CD1   . LEU B 1 192 ? -17.912 -14.487 110.470 1.00 135.59 ? 171 LEU B CD1   1 
ATOM   5658  C  CD2   . LEU B 1 192 ? -15.676 -14.730 109.194 1.00 119.19 ? 171 LEU B CD2   1 
ATOM   5659  N  N     . CYS B 1 193 ? -15.311 -19.800 110.893 1.00 141.37 ? 172 CYS B N     1 
ATOM   5660  C  CA    . CYS B 1 193 ? -14.521 -20.795 111.630 1.00 131.06 ? 172 CYS B CA    1 
ATOM   5661  C  C     . CYS B 1 193 ? -13.221 -21.110 110.913 1.00 130.16 ? 172 CYS B C     1 
ATOM   5662  O  O     . CYS B 1 193 ? -12.173 -21.276 111.557 1.00 129.02 ? 172 CYS B O     1 
ATOM   5663  C  CB    . CYS B 1 193 ? -15.283 -22.101 111.828 1.00 130.90 ? 172 CYS B CB    1 
ATOM   5664  S  SG    . CYS B 1 193 ? -16.503 -22.086 113.095 1.00 146.95 ? 172 CYS B SG    1 
ATOM   5665  N  N     . ASP B 1 194 ? -13.282 -21.283 109.589 1.00 134.18 ? 173 ASP B N     1 
ATOM   5666  C  CA    . ASP B 1 194 ? -12.048 -21.467 108.844 1.00 124.51 ? 173 ASP B CA    1 
ATOM   5667  C  C     . ASP B 1 194 ? -11.203 -20.204 108.928 1.00 117.58 ? 173 ASP B C     1 
ATOM   5668  O  O     . ASP B 1 194 ? -9.984  -20.295 109.089 1.00 104.91 ? 173 ASP B O     1 
ATOM   5669  C  CB    . ASP B 1 194 ? -12.324 -21.853 107.381 1.00 134.64 ? 173 ASP B CB    1 
ATOM   5670  C  CG    . ASP B 1 194 ? -12.740 -23.329 107.194 1.00 140.75 ? 173 ASP B CG    1 
ATOM   5671  O  OD1   . ASP B 1 194 ? -12.677 -24.140 108.137 1.00 137.27 ? 173 ASP B OD1   1 
ATOM   5672  O  OD2   . ASP B 1 194 ? -13.093 -23.693 106.052 1.00 146.89 ? 173 ASP B OD2   1 
ATOM   5673  N  N     . ARG B 1 195 ? -11.841 -19.016 108.897 1.00 117.53 ? 174 ARG B N     1 
ATOM   5674  C  CA    . ARG B 1 195 ? -11.079 -17.772 109.042 1.00 111.61 ? 174 ARG B CA    1 
ATOM   5675  C  C     . ARG B 1 195 ? -10.386 -17.678 110.395 1.00 132.26 ? 174 ARG B C     1 
ATOM   5676  O  O     . ARG B 1 195 ? -9.229  -17.251 110.477 1.00 171.13 ? 174 ARG B O     1 
ATOM   5677  C  CB    . ARG B 1 195 ? -11.961 -16.534 108.858 1.00 121.73 ? 174 ARG B CB    1 
ATOM   5678  C  CG    . ARG B 1 195 ? -11.159 -15.240 109.160 1.00 139.70 ? 174 ARG B CG    1 
ATOM   5679  C  CD    . ARG B 1 195 ? -11.944 -13.936 109.095 1.00 148.50 ? 174 ARG B CD    1 
ATOM   5680  N  NE    . ARG B 1 195 ? -11.603 -13.099 107.943 1.00 139.89 ? 174 ARG B NE    1 
ATOM   5681  C  CZ    . ARG B 1 195 ? -12.281 -13.108 106.799 1.00 156.66 ? 174 ARG B CZ    1 
ATOM   5682  N  NH1   . ARG B 1 195 ? -13.330 -13.917 106.652 1.00 166.61 ? 174 ARG B NH1   1 
ATOM   5683  N  NH2   . ARG B 1 195 ? -11.916 -12.312 105.803 1.00 145.22 ? 174 ARG B NH2   1 
ATOM   5684  N  N     . LEU B 1 196 ? -11.049 -18.111 111.460 1.00 111.31 ? 175 LEU B N     1 
ATOM   5685  C  CA    . LEU B 1 196 ? -10.436 -18.034 112.779 1.00 112.19 ? 175 LEU B CA    1 
ATOM   5686  C  C     . LEU B 1 196 ? -9.272  -19.018 112.878 1.00 134.79 ? 175 LEU B C     1 
ATOM   5687  O  O     . LEU B 1 196 ? -8.173  -18.670 113.342 1.00 109.80 ? 175 LEU B O     1 
ATOM   5688  C  CB    . LEU B 1 196 ? -11.495 -18.301 113.857 1.00 115.07 ? 175 LEU B CB    1 
ATOM   5689  C  CG    . LEU B 1 196 ? -12.655 -17.291 113.976 1.00 117.94 ? 175 LEU B CG    1 
ATOM   5690  C  CD1   . LEU B 1 196 ? -13.654 -17.670 115.036 1.00 121.12 ? 175 LEU B CD1   1 
ATOM   5691  C  CD2   . LEU B 1 196 ? -12.164 -15.890 114.231 1.00 118.72 ? 175 LEU B CD2   1 
ATOM   5692  N  N     . ARG B 1 197 ? -9.487  -20.252 112.413 1.00 145.85 ? 176 ARG B N     1 
ATOM   5693  C  CA    . ARG B 1 197 ? -8.376  -21.191 112.315 1.00 134.15 ? 176 ARG B CA    1 
ATOM   5694  C  C     . ARG B 1 197 ? -7.225  -20.582 111.552 1.00 123.54 ? 176 ARG B C     1 
ATOM   5695  O  O     . ARG B 1 197 ? -6.077  -20.638 111.999 1.00 150.19 ? 176 ARG B O     1 
ATOM   5696  C  CB    . ARG B 1 197 ? -8.819  -22.479 111.621 1.00 126.30 ? 176 ARG B CB    1 
ATOM   5697  C  CG    . ARG B 1 197 ? -7.818  -23.627 111.684 1.00 118.65 ? 176 ARG B CG    1 
ATOM   5698  C  CD    . ARG B 1 197 ? -8.559  -24.899 111.338 1.00 121.02 ? 176 ARG B CD    1 
ATOM   5699  N  NE    . ARG B 1 197 ? -9.180  -24.801 110.027 1.00 104.19 ? 176 ARG B NE    1 
ATOM   5700  C  CZ    . ARG B 1 197 ? -8.599  -25.181 108.904 1.00 102.65 ? 176 ARG B CZ    1 
ATOM   5701  N  NH1   . ARG B 1 197 ? -7.397  -25.711 108.946 1.00 126.04 ? 176 ARG B NH1   1 
ATOM   5702  N  NH2   . ARG B 1 197 ? -9.223  -25.048 107.745 1.00 133.88 ? 176 ARG B NH2   1 
ATOM   5703  N  N     . LEU B 1 198 ? -7.525  -19.921 110.439 1.00 116.85 ? 177 LEU B N     1 
ATOM   5704  C  CA    . LEU B 1 198 ? -6.460  -19.459 109.563 1.00 128.04 ? 177 LEU B CA    1 
ATOM   5705  C  C     . LEU B 1 198 ? -5.672  -18.359 110.235 1.00 127.33 ? 177 LEU B C     1 
ATOM   5706  O  O     . LEU B 1 198 ? -4.450  -18.262 110.064 1.00 127.12 ? 177 LEU B O     1 
ATOM   5707  C  CB    . LEU B 1 198 ? -7.038  -19.012 108.227 1.00 128.28 ? 177 LEU B CB    1 
ATOM   5708  C  CG    . LEU B 1 198 ? -6.168  -18.165 107.317 1.00 133.52 ? 177 LEU B CG    1 
ATOM   5709  C  CD1   . LEU B 1 198 ? -4.914  -18.944 106.971 1.00 137.20 ? 177 LEU B CD1   1 
ATOM   5710  C  CD2   . LEU B 1 198 ? -6.950  -17.853 106.046 1.00 114.44 ? 177 LEU B CD2   1 
ATOM   5711  N  N     . MET B 1 199 ? -6.362  -17.539 111.020 1.00 137.61 ? 178 MET B N     1 
ATOM   5712  C  CA    . MET B 1 199 ? -5.689  -16.508 111.793 1.00 144.34 ? 178 MET B CA    1 
ATOM   5713  C  C     . MET B 1 199 ? -4.778  -17.126 112.847 1.00 142.66 ? 178 MET B C     1 
ATOM   5714  O  O     . MET B 1 199 ? -3.666  -16.636 113.082 1.00 149.15 ? 178 MET B O     1 
ATOM   5715  C  CB    . MET B 1 199 ? -6.738  -15.599 112.436 1.00 130.46 ? 178 MET B CB    1 
ATOM   5716  C  CG    . MET B 1 199 ? -7.272  -14.569 111.476 1.00 121.01 ? 178 MET B CG    1 
ATOM   5717  S  SD    . MET B 1 199 ? -8.531  -13.496 112.144 1.00 131.26 ? 178 MET B SD    1 
ATOM   5718  C  CE    . MET B 1 199 ? -8.950  -12.605 110.639 1.00 125.87 ? 178 MET B CE    1 
ATOM   5719  N  N     . TYR B 1 200 ? -5.222  -18.209 113.487 1.00 115.62 ? 179 TYR B N     1 
ATOM   5720  C  CA    . TYR B 1 200 ? -4.437  -18.748 114.593 1.00 120.17 ? 179 TYR B CA    1 
ATOM   5721  C  C     . TYR B 1 200 ? -3.198  -19.482 114.093 1.00 135.57 ? 179 TYR B C     1 
ATOM   5722  O  O     . TYR B 1 200 ? -2.085  -19.258 114.584 1.00 151.96 ? 179 TYR B O     1 
ATOM   5723  C  CB    . TYR B 1 200 ? -5.310  -19.670 115.443 1.00 131.42 ? 179 TYR B CB    1 
ATOM   5724  C  CG    . TYR B 1 200 ? -4.593  -20.364 116.580 1.00 144.09 ? 179 TYR B CG    1 
ATOM   5725  C  CD1   . TYR B 1 200 ? -4.284  -19.672 117.744 1.00 133.80 ? 179 TYR B CD1   1 
ATOM   5726  C  CD2   . TYR B 1 200 ? -4.238  -21.699 116.504 1.00 144.52 ? 179 TYR B CD2   1 
ATOM   5727  C  CE1   . TYR B 1 200 ? -3.642  -20.284 118.794 1.00 127.53 ? 179 TYR B CE1   1 
ATOM   5728  C  CE2   . TYR B 1 200 ? -3.596  -22.321 117.559 1.00 138.41 ? 179 TYR B CE2   1 
ATOM   5729  C  CZ    . TYR B 1 200 ? -3.308  -21.605 118.699 1.00 124.75 ? 179 TYR B CZ    1 
ATOM   5730  O  OH    . TYR B 1 200 ? -2.674  -22.205 119.751 1.00 132.07 ? 179 TYR B OH    1 
ATOM   5731  N  N     . PHE B 1 201 ? -3.373  -20.355 113.116 1.00 119.78 ? 180 PHE B N     1 
ATOM   5732  C  CA    . PHE B 1 201 ? -2.294  -21.205 112.646 1.00 129.48 ? 180 PHE B CA    1 
ATOM   5733  C  C     . PHE B 1 201 ? -1.394  -20.546 111.597 1.00 132.36 ? 180 PHE B C     1 
ATOM   5734  O  O     . PHE B 1 201 ? -0.274  -21.030 111.369 1.00 130.94 ? 180 PHE B O     1 
ATOM   5735  C  CB    . PHE B 1 201 ? -2.885  -22.495 112.084 1.00 144.20 ? 180 PHE B CB    1 
ATOM   5736  C  CG    . PHE B 1 201 ? -3.259  -23.508 113.135 1.00 126.93 ? 180 PHE B CG    1 
ATOM   5737  C  CD1   . PHE B 1 201 ? -2.288  -24.147 113.878 1.00 122.60 ? 180 PHE B CD1   1 
ATOM   5738  C  CD2   . PHE B 1 201 ? -4.575  -23.873 113.321 1.00 124.23 ? 180 PHE B CD2   1 
ATOM   5739  C  CE1   . PHE B 1 201 ? -2.629  -25.094 114.821 1.00 110.86 ? 180 PHE B CE1   1 
ATOM   5740  C  CE2   . PHE B 1 201 ? -4.920  -24.820 114.264 1.00 127.52 ? 180 PHE B CE2   1 
ATOM   5741  C  CZ    . PHE B 1 201 ? -3.940  -25.430 115.015 1.00 117.41 ? 180 PHE B CZ    1 
ATOM   5742  N  N     . GLY B 1 202 ? -1.872  -19.508 110.903 1.00 116.28 ? 181 GLY B N     1 
ATOM   5743  C  CA    . GLY B 1 202 ? -1.103  -18.918 109.824 1.00 126.03 ? 181 GLY B CA    1 
ATOM   5744  C  C     . GLY B 1 202 ? -1.110  -19.720 108.547 1.00 140.15 ? 181 GLY B C     1 
ATOM   5745  O  O     . GLY B 1 202 ? -0.352  -19.401 107.625 1.00 160.99 ? 181 GLY B O     1 
ATOM   5746  N  N     . ASN B 1 203 ? -1.892  -20.789 108.501 1.00 146.67 ? 182 ASN B N     1 
ATOM   5747  C  CA    . ASN B 1 203 ? -2.069  -21.662 107.351 1.00 135.61 ? 182 ASN B CA    1 
ATOM   5748  C  C     . ASN B 1 203 ? -3.407  -22.369 107.509 1.00 116.18 ? 182 ASN B C     1 
ATOM   5749  O  O     . ASN B 1 203 ? -4.007  -22.359 108.584 1.00 110.12 ? 182 ASN B O     1 
ATOM   5750  C  CB    . ASN B 1 203 ? -0.965  -22.694 107.297 1.00 132.10 ? 182 ASN B CB    1 
ATOM   5751  C  CG    . ASN B 1 203 ? -0.992  -23.580 108.528 1.00 135.88 ? 182 ASN B CG    1 
ATOM   5752  O  OD1   . ASN B 1 203 ? -1.661  -24.619 108.553 1.00 133.34 ? 182 ASN B OD1   1 
ATOM   5753  N  ND2   . ASN B 1 203 ? -0.326  -23.128 109.589 1.00 139.62 ? 182 ASN B ND2   1 
ATOM   5754  N  N     . LEU B 1 204 ? -3.913  -22.927 106.428 1.00 100.80 ? 183 LEU B N     1 
ATOM   5755  C  CA    . LEU B 1 204 ? -5.183  -23.621 106.541 1.00 111.82 ? 183 LEU B CA    1 
ATOM   5756  C  C     . LEU B 1 204 ? -5.044  -25.145 106.708 1.00 114.07 ? 183 LEU B C     1 
ATOM   5757  O  O     . LEU B 1 204 ? -6.059  -25.857 106.624 1.00 113.84 ? 183 LEU B O     1 
ATOM   5758  C  CB    . LEU B 1 204 ? -6.060  -23.260 105.345 1.00 135.01 ? 183 LEU B CB    1 
ATOM   5759  C  CG    . LEU B 1 204 ? -6.909  -21.994 105.530 1.00 106.27 ? 183 LEU B CG    1 
ATOM   5760  C  CD1   . LEU B 1 204 ? -7.631  -21.723 104.228 1.00 99.25  ? 183 LEU B CD1   1 
ATOM   5761  C  CD2   . LEU B 1 204 ? -7.879  -22.099 106.717 1.00 100.76 ? 183 LEU B CD2   1 
ATOM   5762  N  N     . TRP B 1 205 ? -3.816  -25.677 106.857 1.00 112.49 ? 184 TRP B N     1 
ATOM   5763  C  CA    . TRP B 1 205 ? -3.644  -27.133 106.865 1.00 110.65 ? 184 TRP B CA    1 
ATOM   5764  C  C     . TRP B 1 205 ? -3.602  -27.823 108.228 1.00 118.15 ? 184 TRP B C     1 
ATOM   5765  O  O     . TRP B 1 205 ? -3.467  -29.048 108.257 1.00 148.23 ? 184 TRP B O     1 
ATOM   5766  C  CB    . TRP B 1 205 ? -2.422  -27.578 106.073 1.00 101.27 ? 184 TRP B CB    1 
ATOM   5767  C  CG    . TRP B 1 205 ? -1.159  -26.990 106.426 1.00 125.30 ? 184 TRP B CG    1 
ATOM   5768  C  CD1   . TRP B 1 205 ? -0.768  -25.706 106.244 1.00 142.05 ? 184 TRP B CD1   1 
ATOM   5769  C  CD2   . TRP B 1 205 ? -0.082  -27.658 107.061 1.00 149.36 ? 184 TRP B CD2   1 
ATOM   5770  N  NE1   . TRP B 1 205 ? 0.517   -25.529 106.708 1.00 144.37 ? 184 TRP B NE1   1 
ATOM   5771  C  CE2   . TRP B 1 205 ? 0.955   -26.720 107.222 1.00 147.06 ? 184 TRP B CE2   1 
ATOM   5772  C  CE3   . TRP B 1 205 ? 0.115   -28.969 107.496 1.00 154.91 ? 184 TRP B CE3   1 
ATOM   5773  C  CZ2   . TRP B 1 205 ? 2.157   -27.048 107.801 1.00 146.84 ? 184 TRP B CZ2   1 
ATOM   5774  C  CZ3   . TRP B 1 205 ? 1.309   -29.293 108.066 1.00 163.60 ? 184 TRP B CZ3   1 
ATOM   5775  C  CH2   . TRP B 1 205 ? 2.318   -28.340 108.219 1.00 166.39 ? 184 TRP B CH2   1 
ATOM   5776  N  N     . GLN B 1 206 ? -3.606  -27.126 109.347 1.00 103.01 ? 185 GLN B N     1 
ATOM   5777  C  CA    . GLN B 1 206 ? -3.578  -27.828 110.623 1.00 104.71 ? 185 GLN B CA    1 
ATOM   5778  C  C     . GLN B 1 206 ? -4.973  -27.932 111.252 1.00 121.10 ? 185 GLN B C     1 
ATOM   5779  O  O     . GLN B 1 206 ? -5.745  -26.962 111.267 1.00 104.85 ? 185 GLN B O     1 
ATOM   5780  C  CB    . GLN B 1 206 ? -2.635  -27.150 111.611 1.00 126.94 ? 185 GLN B CB    1 
ATOM   5781  C  CG    . GLN B 1 206 ? -1.274  -26.757 111.083 1.00 132.36 ? 185 GLN B CG    1 
ATOM   5782  C  CD    . GLN B 1 206 ? -0.343  -26.326 112.207 1.00 127.00 ? 185 GLN B CD    1 
ATOM   5783  O  OE1   . GLN B 1 206 ? 0.293   -25.274 112.139 1.00 109.91 ? 185 GLN B OE1   1 
ATOM   5784  N  NE2   . GLN B 1 206 ? -0.277  -27.132 113.258 1.00 143.10 ? 185 GLN B NE2   1 
ATOM   5785  N  N     . ASP B 1 207 ? -5.289  -29.110 111.800 1.00 113.07 ? 186 ASP B N     1 
ATOM   5786  C  CA    . ASP B 1 207 ? -6.574  -29.243 112.466 1.00 120.18 ? 186 ASP B CA    1 
ATOM   5787  C  C     . ASP B 1 207 ? -6.490  -28.679 113.866 1.00 110.73 ? 186 ASP B C     1 
ATOM   5788  O  O     . ASP B 1 207 ? -5.419  -28.368 114.378 1.00 129.79 ? 186 ASP B O     1 
ATOM   5789  C  CB    . ASP B 1 207 ? -6.994  -30.708 112.614 1.00 149.53 ? 186 ASP B CB    1 
ATOM   5790  C  CG    . ASP B 1 207 ? -7.825  -31.212 111.469 1.00 189.86 ? 186 ASP B CG    1 
ATOM   5791  O  OD1   . ASP B 1 207 ? -8.210  -30.401 110.601 1.00 208.78 ? 186 ASP B OD1   1 
ATOM   5792  O  OD2   . ASP B 1 207 ? -8.122  -32.430 111.463 1.00 191.01 ? 186 ASP B OD2   1 
ATOM   5793  N  N     . TRP B 1 208 ? -7.634  -28.646 114.530 1.00 129.72 ? 187 TRP B N     1 
ATOM   5794  C  CA    . TRP B 1 208 ? -7.627  -28.445 115.968 1.00 112.94 ? 187 TRP B CA    1 
ATOM   5795  C  C     . TRP B 1 208 ? -7.071  -29.663 116.685 1.00 114.80 ? 187 TRP B C     1 
ATOM   5796  O  O     . TRP B 1 208 ? -6.758  -29.586 117.881 1.00 116.83 ? 187 TRP B O     1 
ATOM   5797  C  CB    . TRP B 1 208 ? -9.034  -28.167 116.433 1.00 136.76 ? 187 TRP B CB    1 
ATOM   5798  C  CG    . TRP B 1 208 ? -9.714  -27.142 115.640 1.00 145.17 ? 187 TRP B CG    1 
ATOM   5799  C  CD1   . TRP B 1 208 ? -10.689 -27.329 114.701 1.00 157.36 ? 187 TRP B CD1   1 
ATOM   5800  C  CD2   . TRP B 1 208 ? -9.542  -25.745 115.770 1.00 138.37 ? 187 TRP B CD2   1 
ATOM   5801  N  NE1   . TRP B 1 208 ? -11.112 -26.120 114.213 1.00 155.28 ? 187 TRP B NE1   1 
ATOM   5802  C  CE2   . TRP B 1 208 ? -10.427 -25.129 114.864 1.00 142.93 ? 187 TRP B CE2   1 
ATOM   5803  C  CE3   . TRP B 1 208 ? -8.714  -24.949 116.558 1.00 135.69 ? 187 TRP B CE3   1 
ATOM   5804  C  CZ2   . TRP B 1 208 ? -10.502 -23.760 114.724 1.00 140.31 ? 187 TRP B CZ2   1 
ATOM   5805  C  CZ3   . TRP B 1 208 ? -8.789  -23.597 116.421 1.00 149.95 ? 187 TRP B CZ3   1 
ATOM   5806  C  CH2   . TRP B 1 208 ? -9.672  -23.010 115.508 1.00 145.10 ? 187 TRP B CH2   1 
ATOM   5807  N  N     . SER B 1 209 ? -6.982  -30.800 115.980 1.00 114.45 ? 188 SER B N     1 
ATOM   5808  C  CA    . SER B 1 209 ? -6.459  -32.010 116.591 1.00 130.84 ? 188 SER B CA    1 
ATOM   5809  C  C     . SER B 1 209 ? -4.998  -31.840 116.965 1.00 132.30 ? 188 SER B C     1 
ATOM   5810  O  O     . SER B 1 209 ? -4.496  -32.572 117.834 1.00 156.84 ? 188 SER B O     1 
ATOM   5811  C  CB    . SER B 1 209 ? -6.646  -33.224 115.659 1.00 135.31 ? 188 SER B CB    1 
ATOM   5812  O  OG    . SER B 1 209 ? -6.087  -33.045 114.366 1.00 126.40 ? 188 SER B OG    1 
ATOM   5813  N  N     . GLU B 1 210 ? -4.342  -30.820 116.406 1.00 115.77 ? 189 GLU B N     1 
ATOM   5814  C  CA    . GLU B 1 210 ? -2.997  -30.490 116.849 1.00 122.65 ? 189 GLU B CA    1 
ATOM   5815  C  C     . GLU B 1 210 ? -2.968  -30.376 118.368 1.00 128.22 ? 189 GLU B C     1 
ATOM   5816  O  O     . GLU B 1 210 ? -2.179  -31.062 119.038 1.00 121.07 ? 189 GLU B O     1 
ATOM   5817  C  CB    . GLU B 1 210 ? -2.544  -29.189 116.172 1.00 113.97 ? 189 GLU B CB    1 
ATOM   5818  C  CG    . GLU B 1 210 ? -1.114  -29.253 115.611 1.00 130.17 ? 189 GLU B CG    1 
ATOM   5819  C  CD    . GLU B 1 210 ? -0.994  -30.014 114.266 1.00 156.15 ? 189 GLU B CD    1 
ATOM   5820  O  OE1   . GLU B 1 210 ? -1.963  -30.057 113.461 1.00 146.56 ? 189 GLU B OE1   1 
ATOM   5821  O  OE2   . GLU B 1 210 ? 0.081   -30.612 114.029 1.00 166.74 ? 189 GLU B OE2   1 
ATOM   5822  N  N     . PHE B 1 211 ? -3.971  -29.701 118.934 1.00 138.86 ? 190 PHE B N     1 
ATOM   5823  C  CA    . PHE B 1 211 ? -4.021  -29.571 120.382 1.00 126.72 ? 190 PHE B CA    1 
ATOM   5824  C  C     . PHE B 1 211 ? -4.017  -30.933 121.052 1.00 127.25 ? 190 PHE B C     1 
ATOM   5825  O  O     . PHE B 1 211 ? -3.054  -31.277 121.749 1.00 140.67 ? 190 PHE B O     1 
ATOM   5826  C  CB    . PHE B 1 211 ? -5.256  -28.781 120.796 1.00 121.92 ? 190 PHE B CB    1 
ATOM   5827  C  CG    . PHE B 1 211 ? -5.129  -27.316 120.568 1.00 119.74 ? 190 PHE B CG    1 
ATOM   5828  C  CD1   . PHE B 1 211 ? -4.673  -26.498 121.587 1.00 122.34 ? 190 PHE B CD1   1 
ATOM   5829  C  CD2   . PHE B 1 211 ? -5.448  -26.753 119.338 1.00 117.05 ? 190 PHE B CD2   1 
ATOM   5830  C  CE1   . PHE B 1 211 ? -4.545  -25.143 121.401 1.00 138.76 ? 190 PHE B CE1   1 
ATOM   5831  C  CE2   . PHE B 1 211 ? -5.327  -25.393 119.140 1.00 126.49 ? 190 PHE B CE2   1 
ATOM   5832  C  CZ    . PHE B 1 211 ? -4.865  -24.586 120.174 1.00 136.27 ? 190 PHE B CZ    1 
ATOM   5833  N  N     . VAL B 1 212 ? -5.013  -31.779 120.752 1.00 124.39 ? 191 VAL B N     1 
ATOM   5834  C  CA    . VAL B 1 212 ? -5.070  -33.021 121.519 1.00 127.62 ? 191 VAL B CA    1 
ATOM   5835  C  C     . VAL B 1 212 ? -3.842  -33.857 121.211 1.00 128.16 ? 191 VAL B C     1 
ATOM   5836  O  O     . VAL B 1 212 ? -3.239  -34.444 122.124 1.00 136.80 ? 191 VAL B O     1 
ATOM   5837  C  CB    . VAL B 1 212 ? -6.384  -33.802 121.292 1.00 128.29 ? 191 VAL B CB    1 
ATOM   5838  C  CG1   . VAL B 1 212 ? -7.036  -33.452 119.957 1.00 133.29 ? 191 VAL B CG1   1 
ATOM   5839  C  CG2   . VAL B 1 212 ? -6.155  -35.306 121.434 1.00 130.67 ? 191 VAL B CG2   1 
ATOM   5840  N  N     . LEU B 1 213 ? -3.338  -33.766 119.976 1.00 125.52 ? 192 LEU B N     1 
ATOM   5841  C  CA    . LEU B 1 213 ? -2.190  -34.585 119.616 1.00 130.18 ? 192 LEU B CA    1 
ATOM   5842  C  C     . LEU B 1 213 ? -0.958  -34.148 120.409 1.00 146.98 ? 192 LEU B C     1 
ATOM   5843  O  O     . LEU B 1 213 ? -0.247  -34.988 120.993 1.00 131.72 ? 192 LEU B O     1 
ATOM   5844  C  CB    . LEU B 1 213 ? -1.967  -34.483 118.107 1.00 123.56 ? 192 LEU B CB    1 
ATOM   5845  C  CG    . LEU B 1 213 ? -2.894  -35.363 117.260 1.00 122.94 ? 192 LEU B CG    1 
ATOM   5846  C  CD1   . LEU B 1 213 ? -2.813  -35.002 115.806 1.00 119.92 ? 192 LEU B CD1   1 
ATOM   5847  C  CD2   . LEU B 1 213 ? -2.595  -36.838 117.451 1.00 125.95 ? 192 LEU B CD2   1 
ATOM   5848  N  N     . ALA B 1 214 ? -0.786  -32.827 120.567 1.00 143.20 ? 193 ALA B N     1 
ATOM   5849  C  CA    . ALA B 1 214 ? 0.343   -32.314 121.330 1.00 127.53 ? 193 ALA B CA    1 
ATOM   5850  C  C     . ALA B 1 214 ? 0.263   -32.769 122.778 1.00 131.23 ? 193 ALA B C     1 
ATOM   5851  O  O     . ALA B 1 214 ? 1.272   -33.181 123.364 1.00 133.81 ? 193 ALA B O     1 
ATOM   5852  C  CB    . ALA B 1 214 ? 0.374   -30.784 121.246 1.00 125.05 ? 193 ALA B CB    1 
ATOM   5853  N  N     . ASP B 1 215 ? -0.940  -32.727 123.362 1.00 131.92 ? 194 ASP B N     1 
ATOM   5854  C  CA    . ASP B 1 215 ? -1.089  -33.125 124.754 1.00 144.82 ? 194 ASP B CA    1 
ATOM   5855  C  C     . ASP B 1 215 ? -0.879  -34.624 124.924 1.00 151.27 ? 194 ASP B C     1 
ATOM   5856  O  O     . ASP B 1 215 ? -0.423  -35.062 125.990 1.00 166.15 ? 194 ASP B O     1 
ATOM   5857  C  CB    . ASP B 1 215 ? -2.440  -32.652 125.298 1.00 157.16 ? 194 ASP B CB    1 
ATOM   5858  C  CG    . ASP B 1 215 ? -2.408  -31.180 125.743 1.00 174.21 ? 194 ASP B CG    1 
ATOM   5859  O  OD1   . ASP B 1 215 ? -3.499  -30.563 125.879 1.00 169.82 ? 194 ASP B OD1   1 
ATOM   5860  O  OD2   . ASP B 1 215 ? -1.287  -30.638 125.933 1.00 170.26 ? 194 ASP B OD2   1 
ATOM   5861  N  N     . LEU B 1 216 ? -1.242  -35.425 123.909 1.00 137.70 ? 195 LEU B N     1 
ATOM   5862  C  CA    . LEU B 1 216 ? -1.095  -36.873 124.005 1.00 140.79 ? 195 LEU B CA    1 
ATOM   5863  C  C     . LEU B 1 216 ? 0.342   -37.304 123.761 1.00 142.09 ? 195 LEU B C     1 
ATOM   5864  O  O     . LEU B 1 216 ? 0.681   -38.478 123.982 1.00 145.48 ? 195 LEU B O     1 
ATOM   5865  C  CB    . LEU B 1 216 ? -2.053  -37.552 123.027 1.00 139.28 ? 195 LEU B CB    1 
ATOM   5866  C  CG    . LEU B 1 216 ? -2.271  -39.060 123.049 1.00 142.29 ? 195 LEU B CG    1 
ATOM   5867  C  CD1   . LEU B 1 216 ? -2.260  -39.578 124.450 1.00 146.87 ? 195 LEU B CD1   1 
ATOM   5868  C  CD2   . LEU B 1 216 ? -3.602  -39.346 122.386 1.00 140.55 ? 195 LEU B CD2   1 
ATOM   5869  N  N     . GLY B 1 217 ? 1.175   -36.370 123.293 1.00 122.65 ? 196 GLY B N     1 
ATOM   5870  C  CA    . GLY B 1 217 ? 2.569   -36.617 123.015 1.00 137.26 ? 196 GLY B CA    1 
ATOM   5871  C  C     . GLY B 1 217 ? 2.831   -37.279 121.691 1.00 150.83 ? 196 GLY B C     1 
ATOM   5872  O  O     . GLY B 1 217 ? 3.890   -37.890 121.509 1.00 164.79 ? 196 GLY B O     1 
ATOM   5873  N  N     . ILE B 1 218 ? 1.896   -37.202 120.758 1.00 148.32 ? 197 ILE B N     1 
ATOM   5874  C  CA    . ILE B 1 218 ? 2.168   -37.775 119.453 1.00 147.68 ? 197 ILE B CA    1 
ATOM   5875  C  C     . ILE B 1 218 ? 2.897   -36.777 118.565 1.00 140.35 ? 197 ILE B C     1 
ATOM   5876  O  O     . ILE B 1 218 ? 3.847   -37.138 117.862 1.00 131.65 ? 197 ILE B O     1 
ATOM   5877  C  CB    . ILE B 1 218 ? 0.868   -38.306 118.826 1.00 130.77 ? 197 ILE B CB    1 
ATOM   5878  C  CG1   . ILE B 1 218 ? 0.396   -39.492 119.643 1.00 126.74 ? 197 ILE B CG1   1 
ATOM   5879  C  CG2   . ILE B 1 218 ? 1.127   -38.806 117.451 1.00 145.17 ? 197 ILE B CG2   1 
ATOM   5880  C  CD1   . ILE B 1 218 ? 1.529   -40.521 119.841 1.00 134.52 ? 197 ILE B CD1   1 
ATOM   5881  N  N     . TYR B 1 219 ? 2.491   -35.512 118.604 1.00 137.44 ? 198 TYR B N     1 
ATOM   5882  C  CA    . TYR B 1 219 ? 3.254   -34.430 117.995 1.00 124.08 ? 198 TYR B CA    1 
ATOM   5883  C  C     . TYR B 1 219 ? 3.756   -33.565 119.136 1.00 130.16 ? 198 TYR B C     1 
ATOM   5884  O  O     . TYR B 1 219 ? 3.009   -32.745 119.666 1.00 148.82 ? 198 TYR B O     1 
ATOM   5885  C  CB    . TYR B 1 219 ? 2.399   -33.608 117.024 1.00 117.62 ? 198 TYR B CB    1 
ATOM   5886  C  CG    . TYR B 1 219 ? 1.963   -34.371 115.783 1.00 126.76 ? 198 TYR B CG    1 
ATOM   5887  C  CD1   . TYR B 1 219 ? 2.679   -35.478 115.352 1.00 156.84 ? 198 TYR B CD1   1 
ATOM   5888  C  CD2   . TYR B 1 219 ? 0.842   -33.990 115.045 1.00 118.21 ? 198 TYR B CD2   1 
ATOM   5889  C  CE1   . TYR B 1 219 ? 2.301   -36.191 114.228 1.00 171.80 ? 198 TYR B CE1   1 
ATOM   5890  C  CE2   . TYR B 1 219 ? 0.444   -34.708 113.914 1.00 126.84 ? 198 TYR B CE2   1 
ATOM   5891  C  CZ    . TYR B 1 219 ? 1.186   -35.810 113.513 1.00 165.19 ? 198 TYR B CZ    1 
ATOM   5892  O  OH    . TYR B 1 219 ? 0.837   -36.547 112.400 1.00 184.07 ? 198 TYR B OH    1 
ATOM   5893  N  N     . ARG B 1 220 ? 5.032   -33.694 119.469 1.00 116.87 ? 199 ARG B N     1 
ATOM   5894  C  CA    . ARG B 1 220 ? 5.691   -32.747 120.358 1.00 116.99 ? 199 ARG B CA    1 
ATOM   5895  C  C     . ARG B 1 220 ? 6.382   -31.686 119.513 1.00 120.29 ? 199 ARG B C     1 
ATOM   5896  O  O     . ARG B 1 220 ? 7.182   -32.011 118.635 1.00 131.68 ? 199 ARG B O     1 
ATOM   5897  C  CB    . ARG B 1 220 ? 6.704   -33.412 121.291 1.00 123.46 ? 199 ARG B CB    1 
ATOM   5898  C  CG    . ARG B 1 220 ? 6.182   -34.520 122.174 1.00 141.73 ? 199 ARG B CG    1 
ATOM   5899  C  CD    . ARG B 1 220 ? 7.257   -34.953 123.196 1.00 163.07 ? 199 ARG B CD    1 
ATOM   5900  N  NE    . ARG B 1 220 ? 8.426   -35.578 122.575 1.00 163.93 ? 199 ARG B NE    1 
ATOM   5901  C  CZ    . ARG B 1 220 ? 8.492   -36.862 122.227 1.00 165.38 ? 199 ARG B CZ    1 
ATOM   5902  N  NH1   . ARG B 1 220 ? 7.460   -37.670 122.439 1.00 150.79 ? 199 ARG B NH1   1 
ATOM   5903  N  NH2   . ARG B 1 220 ? 9.592   -37.341 121.662 1.00 166.51 ? 199 ARG B NH2   1 
ATOM   5904  N  N     . TYR B 1 221 ? 6.047   -30.435 119.742 1.00 111.54 ? 200 TYR B N     1 
ATOM   5905  C  CA    . TYR B 1 221 ? 6.639   -29.354 118.982 1.00 110.87 ? 200 TYR B CA    1 
ATOM   5906  C  C     . TYR B 1 221 ? 7.672   -28.669 119.861 1.00 112.29 ? 200 TYR B C     1 
ATOM   5907  O  O     . TYR B 1 221 ? 7.591   -28.722 121.084 1.00 113.92 ? 200 TYR B O     1 
ATOM   5908  C  CB    . TYR B 1 221 ? 5.582   -28.356 118.508 1.00 116.77 ? 200 TYR B CB    1 
ATOM   5909  C  CG    . TYR B 1 221 ? 4.645   -28.861 117.426 1.00 109.31 ? 200 TYR B CG    1 
ATOM   5910  C  CD1   . TYR B 1 221 ? 3.365   -29.305 117.728 1.00 109.67 ? 200 TYR B CD1   1 
ATOM   5911  C  CD2   . TYR B 1 221 ? 5.049   -28.887 116.102 1.00 136.49 ? 200 TYR B CD2   1 
ATOM   5912  C  CE1   . TYR B 1 221 ? 2.509   -29.755 116.742 1.00 108.80 ? 200 TYR B CE1   1 
ATOM   5913  C  CE2   . TYR B 1 221 ? 4.209   -29.333 115.110 1.00 141.27 ? 200 TYR B CE2   1 
ATOM   5914  C  CZ    . TYR B 1 221 ? 2.942   -29.768 115.432 1.00 155.44 ? 200 TYR B CZ    1 
ATOM   5915  O  OH    . TYR B 1 221 ? 2.121   -30.220 114.426 1.00 166.07 ? 200 TYR B OH    1 
ATOM   5916  N  N     . GLU B 1 222 ? 8.684   -28.080 119.244 1.00 111.91 ? 201 GLU B N     1 
ATOM   5917  C  CA    . GLU B 1 222 ? 9.617   -27.329 120.059 1.00 113.55 ? 201 GLU B CA    1 
ATOM   5918  C  C     . GLU B 1 222 ? 8.918   -26.113 120.619 1.00 128.05 ? 201 GLU B C     1 
ATOM   5919  O  O     . GLU B 1 222 ? 8.010   -25.550 120.000 1.00 129.85 ? 201 GLU B O     1 
ATOM   5920  C  CB    . GLU B 1 222 ? 10.861  -26.903 119.271 1.00 113.14 ? 201 GLU B CB    1 
ATOM   5921  C  CG    . GLU B 1 222 ? 11.717  -25.810 119.944 1.00 115.02 ? 201 GLU B CG    1 
ATOM   5922  C  CD    . GLU B 1 222 ? 12.526  -26.275 121.150 1.00 156.40 ? 201 GLU B CD    1 
ATOM   5923  O  OE1   . GLU B 1 222 ? 11.976  -26.945 122.055 1.00 163.44 ? 201 GLU B OE1   1 
ATOM   5924  O  OE2   . GLU B 1 222 ? 13.722  -25.913 121.220 1.00 179.66 ? 201 GLU B OE2   1 
ATOM   5925  N  N     . SER B 1 223 ? 9.326   -25.741 121.827 1.00 152.52 ? 202 SER B N     1 
ATOM   5926  C  CA    . SER B 1 223 ? 8.793   -24.576 122.520 1.00 165.20 ? 202 SER B CA    1 
ATOM   5927  C  C     . SER B 1 223 ? 9.791   -23.439 122.334 1.00 148.83 ? 202 SER B C     1 
ATOM   5928  O  O     . SER B 1 223 ? 10.886  -23.448 122.907 1.00 153.66 ? 202 SER B O     1 
ATOM   5929  C  CB    . SER B 1 223 ? 8.536   -24.885 123.998 1.00 169.17 ? 202 SER B CB    1 
ATOM   5930  O  OG    . SER B 1 223 ? 9.721   -25.308 124.651 1.00 174.18 ? 202 SER B OG    1 
ATOM   5931  N  N     . VAL B 1 224 ? 9.398   -22.483 121.524 1.00 141.05 ? 203 VAL B N     1 
ATOM   5932  C  CA    . VAL B 1 224 ? 10.126  -21.258 121.267 1.00 130.56 ? 203 VAL B CA    1 
ATOM   5933  C  C     . VAL B 1 224 ? 9.467   -20.174 122.081 1.00 140.32 ? 203 VAL B C     1 
ATOM   5934  O  O     . VAL B 1 224 ? 8.239   -20.129 122.196 1.00 168.50 ? 203 VAL B O     1 
ATOM   5935  C  CB    . VAL B 1 224 ? 10.111  -20.908 119.770 1.00 121.32 ? 203 VAL B CB    1 
ATOM   5936  C  CG1   . VAL B 1 224 ? 10.635  -19.517 119.544 1.00 137.52 ? 203 VAL B CG1   1 
ATOM   5937  C  CG2   . VAL B 1 224 ? 10.977  -21.879 119.032 1.00 121.22 ? 203 VAL B CG2   1 
ATOM   5938  N  N     . GLU B 1 225 ? 10.267  -19.291 122.625 1.00 144.47 ? 204 GLU B N     1 
ATOM   5939  C  CA    . GLU B 1 225 ? 9.741   -18.193 123.405 1.00 162.09 ? 204 GLU B CA    1 
ATOM   5940  C  C     . GLU B 1 225 ? 9.767   -17.021 122.427 1.00 162.93 ? 204 GLU B C     1 
ATOM   5941  O  O     . GLU B 1 225 ? 10.827  -16.467 122.128 1.00 155.21 ? 204 GLU B O     1 
ATOM   5942  C  CB    . GLU B 1 225 ? 10.622  -18.021 124.642 1.00 191.02 ? 204 GLU B CB    1 
ATOM   5943  C  CG    . GLU B 1 225 ? 9.987   -17.528 125.943 1.00 208.35 ? 204 GLU B CG    1 
ATOM   5944  C  CD    . GLU B 1 225 ? 10.841  -17.899 127.170 1.00 213.15 ? 204 GLU B CD    1 
ATOM   5945  O  OE1   . GLU B 1 225 ? 11.396  -19.023 127.205 1.00 203.36 ? 204 GLU B OE1   1 
ATOM   5946  O  OE2   . GLU B 1 225 ? 10.983  -17.058 128.085 1.00 213.33 ? 204 GLU B OE2   1 
ATOM   5947  N  N     . PHE B 1 226 ? 8.597   -16.667 121.897 1.00 163.42 ? 205 PHE B N     1 
ATOM   5948  C  CA    . PHE B 1 226 ? 8.493   -15.573 120.942 1.00 175.03 ? 205 PHE B CA    1 
ATOM   5949  C  C     . PHE B 1 226 ? 7.760   -14.402 121.589 1.00 187.67 ? 205 PHE B C     1 
ATOM   5950  O  O     . PHE B 1 226 ? 7.136   -14.533 122.645 1.00 193.26 ? 205 PHE B O     1 
ATOM   5951  C  CB    . PHE B 1 226 ? 7.746   -16.026 119.680 1.00 181.11 ? 205 PHE B CB    1 
ATOM   5952  C  CG    . PHE B 1 226 ? 6.510   -16.849 119.961 1.00 181.76 ? 205 PHE B CG    1 
ATOM   5953  C  CD1   . PHE B 1 226 ? 6.572   -18.238 120.003 1.00 176.03 ? 205 PHE B CD1   1 
ATOM   5954  C  CD2   . PHE B 1 226 ? 5.286   -16.233 120.172 1.00 176.11 ? 205 PHE B CD2   1 
ATOM   5955  C  CE1   . PHE B 1 226 ? 5.438   -18.995 120.252 1.00 158.24 ? 205 PHE B CE1   1 
ATOM   5956  C  CE2   . PHE B 1 226 ? 4.152   -16.985 120.422 1.00 163.43 ? 205 PHE B CE2   1 
ATOM   5957  C  CZ    . PHE B 1 226 ? 4.228   -18.369 120.462 1.00 151.93 ? 205 PHE B CZ    1 
ATOM   5958  N  N     . SER B 1 227 ? 7.767   -13.265 120.898 1.00 197.98 ? 206 SER B N     1 
ATOM   5959  C  CA    . SER B 1 227 ? 7.151   -12.082 121.478 1.00 199.90 ? 206 SER B CA    1 
ATOM   5960  C  C     . SER B 1 227 ? 5.635   -12.237 121.490 1.00 191.34 ? 206 SER B C     1 
ATOM   5961  O  O     . SER B 1 227 ? 5.043   -12.847 120.598 1.00 191.02 ? 206 SER B O     1 
ATOM   5962  C  CB    . SER B 1 227 ? 7.576   -10.816 120.725 1.00 200.82 ? 206 SER B CB    1 
ATOM   5963  O  OG    . SER B 1 227 ? 6.928   -10.700 119.474 1.00 203.41 ? 206 SER B OG    1 
ATOM   5964  N  N     . ALA B 1 228 ? 5.009   -11.697 122.534 1.00 204.10 ? 207 ALA B N     1 
ATOM   5965  C  CA    . ALA B 1 228 ? 3.558   -11.758 122.641 1.00 196.02 ? 207 ALA B CA    1 
ATOM   5966  C  C     . ALA B 1 228 ? 2.852   -10.815 121.675 1.00 196.38 ? 207 ALA B C     1 
ATOM   5967  O  O     . ALA B 1 228 ? 1.622   -10.887 121.561 1.00 171.80 ? 207 ALA B O     1 
ATOM   5968  C  CB    . ALA B 1 228 ? 3.119   -11.463 124.072 1.00 197.13 ? 207 ALA B CB    1 
ATOM   5969  N  N     . ASP B 1 229 ? 3.585   -9.913  121.015 1.00 196.46 ? 208 ASP B N     1 
ATOM   5970  C  CA    . ASP B 1 229 ? 2.993   -8.991  120.058 1.00 209.91 ? 208 ASP B CA    1 
ATOM   5971  C  C     . ASP B 1 229 ? 3.162   -9.463  118.612 1.00 214.16 ? 208 ASP B C     1 
ATOM   5972  O  O     . ASP B 1 229 ? 2.590   -8.850  117.701 1.00 216.80 ? 208 ASP B O     1 
ATOM   5973  C  CB    . ASP B 1 229 ? 3.619   -7.599  120.249 1.00 210.06 ? 208 ASP B CB    1 
ATOM   5974  C  CG    . ASP B 1 229 ? 2.636   -6.464  120.014 1.00 212.43 ? 208 ASP B CG    1 
ATOM   5975  O  OD1   . ASP B 1 229 ? 1.488   -6.740  119.598 1.00 226.68 ? 208 ASP B OD1   1 
ATOM   5976  O  OD2   . ASP B 1 229 ? 3.019   -5.294  120.256 1.00 192.58 ? 208 ASP B OD2   1 
ATOM   5977  N  N     . SER B 1 230 ? 3.921   -10.543 118.381 1.00 213.87 ? 209 SER B N     1 
ATOM   5978  C  CA    . SER B 1 230 ? 4.110   -11.107 117.047 1.00 206.60 ? 209 SER B CA    1 
ATOM   5979  C  C     . SER B 1 230 ? 2.992   -12.096 116.748 1.00 186.72 ? 209 SER B C     1 
ATOM   5980  O  O     . SER B 1 230 ? 2.592   -12.891 117.611 1.00 164.63 ? 209 SER B O     1 
ATOM   5981  C  CB    . SER B 1 230 ? 5.464   -11.809 116.906 1.00 211.57 ? 209 SER B CB    1 
ATOM   5982  O  OG    . SER B 1 230 ? 5.503   -13.005 117.664 1.00 215.10 ? 209 SER B OG    1 
ATOM   5983  N  N     . ARG B 1 231 ? 2.539   -12.092 115.500 1.00 191.18 ? 210 ARG B N     1 
ATOM   5984  C  CA    . ARG B 1 231 ? 1.354   -12.852 115.140 1.00 162.78 ? 210 ARG B CA    1 
ATOM   5985  C  C     . ARG B 1 231 ? 1.399   -13.173 113.653 1.00 170.26 ? 210 ARG B C     1 
ATOM   5986  O  O     . ARG B 1 231 ? 2.191   -12.603 112.894 1.00 187.35 ? 210 ARG B O     1 
ATOM   5987  C  CB    . ARG B 1 231 ? 0.082   -12.091 115.524 1.00 159.27 ? 210 ARG B CB    1 
ATOM   5988  C  CG    . ARG B 1 231 ? 0.030   -10.609 115.103 1.00 176.72 ? 210 ARG B CG    1 
ATOM   5989  C  CD    . ARG B 1 231 ? -1.402  -10.220 114.670 1.00 185.80 ? 210 ARG B CD    1 
ATOM   5990  N  NE    . ARG B 1 231 ? -1.942  -9.086  115.408 1.00 176.57 ? 210 ARG B NE    1 
ATOM   5991  C  CZ    . ARG B 1 231 ? -1.759  -7.827  115.044 1.00 179.80 ? 210 ARG B CZ    1 
ATOM   5992  N  NH1   . ARG B 1 231 ? -1.054  -7.553  113.955 1.00 190.11 ? 210 ARG B NH1   1 
ATOM   5993  N  NH2   . ARG B 1 231 ? -2.271  -6.849  115.770 1.00 173.66 ? 210 ARG B NH2   1 
ATOM   5994  N  N     . GLY B 1 232 ? 0.536   -14.113 113.253 1.00 156.84 ? 211 GLY B N     1 
ATOM   5995  C  CA    . GLY B 1 232 ? 0.586   -14.634 111.894 1.00 166.31 ? 211 GLY B CA    1 
ATOM   5996  C  C     . GLY B 1 232 ? 0.249   -13.587 110.854 1.00 173.10 ? 211 GLY B C     1 
ATOM   5997  O  O     . GLY B 1 232 ? 0.967   -13.413 109.864 1.00 190.34 ? 211 GLY B O     1 
ATOM   5998  N  N     . PHE B 1 233 ? -0.866  -12.901 111.037 1.00 168.61 ? 212 PHE B N     1 
ATOM   5999  C  CA    . PHE B 1 233 ? -1.313  -11.936 110.052 1.00 182.23 ? 212 PHE B CA    1 
ATOM   6000  C  C     . PHE B 1 233 ? -1.193  -10.531 110.602 1.00 182.96 ? 212 PHE B C     1 
ATOM   6001  O  O     . PHE B 1 233 ? -1.692  -10.228 111.688 1.00 170.37 ? 212 PHE B O     1 
ATOM   6002  C  CB    . PHE B 1 233 ? -2.738  -12.221 109.600 1.00 178.69 ? 212 PHE B CB    1 
ATOM   6003  C  CG    . PHE B 1 233 ? -2.827  -13.385 108.694 1.00 153.42 ? 212 PHE B CG    1 
ATOM   6004  C  CD1   . PHE B 1 233 ? -2.882  -13.197 107.327 1.00 136.66 ? 212 PHE B CD1   1 
ATOM   6005  C  CD2   . PHE B 1 233 ? -2.810  -14.659 109.196 1.00 141.60 ? 212 PHE B CD2   1 
ATOM   6006  C  CE1   . PHE B 1 233 ? -2.944  -14.259 106.483 1.00 135.57 ? 212 PHE B CE1   1 
ATOM   6007  C  CE2   . PHE B 1 233 ? -2.873  -15.724 108.357 1.00 153.78 ? 212 PHE B CE2   1 
ATOM   6008  C  CZ    . PHE B 1 233 ? -2.939  -15.529 106.994 1.00 151.68 ? 212 PHE B CZ    1 
ATOM   6009  N  N     . ARG B 1 234 ? -0.598  -9.663  109.801 1.00 181.93 ? 213 ARG B N     1 
ATOM   6010  C  CA    . ARG B 1 234 ? -0.491  -8.268  110.187 1.00 185.31 ? 213 ARG B CA    1 
ATOM   6011  C  C     . ARG B 1 234 ? -1.814  -7.577  109.870 1.00 177.90 ? 213 ARG B C     1 
ATOM   6012  O  O     . ARG B 1 234 ? -2.594  -7.269  110.776 1.00 148.59 ? 213 ARG B O     1 
ATOM   6013  C  CB    . ARG B 1 234 ? 0.701   -7.657  109.451 1.00 199.69 ? 213 ARG B CB    1 
ATOM   6014  C  CG    . ARG B 1 234 ? 2.047   -7.944  110.117 1.00 208.59 ? 213 ARG B CG    1 
ATOM   6015  C  CD    . ARG B 1 234 ? 3.174   -7.429  109.241 1.00 212.77 ? 213 ARG B CD    1 
ATOM   6016  N  NE    . ARG B 1 234 ? 2.725   -6.267  108.476 1.00 217.54 ? 213 ARG B NE    1 
ATOM   6017  C  CZ    . ARG B 1 234 ? 2.550   -5.050  108.984 1.00 224.77 ? 213 ARG B CZ    1 
ATOM   6018  N  NH1   . ARG B 1 234 ? 2.776   -4.830  110.274 1.00 229.58 ? 213 ARG B NH1   1 
ATOM   6019  N  NH2   . ARG B 1 234 ? 2.129   -4.057  108.210 1.00 221.18 ? 213 ARG B NH2   1 
ATOM   6020  N  N     . LEU B 1 235 ? -2.122  -7.415  108.587 1.00 170.48 ? 214 LEU B N     1 
ATOM   6021  C  CA    . LEU B 1 235 ? -3.355  -6.767  108.158 1.00 184.57 ? 214 LEU B CA    1 
ATOM   6022  C  C     . LEU B 1 235 ? -4.507  -7.774  108.158 1.00 180.76 ? 214 LEU B C     1 
ATOM   6023  O  O     . LEU B 1 235 ? -4.306  -8.971  107.927 1.00 197.15 ? 214 LEU B O     1 
ATOM   6024  C  CB    . LEU B 1 235 ? -3.207  -6.189  106.744 1.00 176.12 ? 214 LEU B CB    1 
ATOM   6025  C  CG    . LEU B 1 235 ? -2.345  -4.953  106.457 1.00 163.59 ? 214 LEU B CG    1 
ATOM   6026  C  CD1   . LEU B 1 235 ? -0.860  -5.317  106.503 1.00 164.53 ? 214 LEU B CD1   1 
ATOM   6027  C  CD2   . LEU B 1 235 ? -2.729  -4.300  105.130 1.00 158.13 ? 214 LEU B CD2   1 
ATOM   6028  N  N     . ARG B 1 236 ? -5.725  -7.287  108.415 1.00 165.48 ? 215 ARG B N     1 
ATOM   6029  C  CA    . ARG B 1 236 ? -6.887  -8.129  108.144 1.00 138.43 ? 215 ARG B CA    1 
ATOM   6030  C  C     . ARG B 1 236 ? -7.031  -8.378  106.652 1.00 145.62 ? 215 ARG B C     1 
ATOM   6031  O  O     . ARG B 1 236 ? -7.358  -9.491  106.233 1.00 168.85 ? 215 ARG B O     1 
ATOM   6032  C  CB    . ARG B 1 236 ? -8.161  -7.504  108.694 1.00 137.83 ? 215 ARG B CB    1 
ATOM   6033  C  CG    . ARG B 1 236 ? -9.418  -8.164  108.160 1.00 137.87 ? 215 ARG B CG    1 
ATOM   6034  C  CD    . ARG B 1 236 ? -10.658 -7.464  108.641 1.00 140.63 ? 215 ARG B CD    1 
ATOM   6035  N  NE    . ARG B 1 236 ? -11.838 -8.250  108.337 1.00 160.49 ? 215 ARG B NE    1 
ATOM   6036  C  CZ    . ARG B 1 236 ? -12.285 -9.238  109.098 1.00 181.37 ? 215 ARG B CZ    1 
ATOM   6037  N  NH1   . ARG B 1 236 ? -13.373 -9.909  108.744 1.00 191.72 ? 215 ARG B NH1   1 
ATOM   6038  N  NH2   . ARG B 1 236 ? -11.659 -9.532  110.229 1.00 184.79 ? 215 ARG B NH2   1 
ATOM   6039  N  N     . ALA B 1 237 ? -6.793  -7.353  105.834 1.00 137.43 ? 216 ALA B N     1 
ATOM   6040  C  CA    . ALA B 1 237 ? -6.842  -7.539  104.392 1.00 137.65 ? 216 ALA B CA    1 
ATOM   6041  C  C     . ALA B 1 237 ? -5.868  -8.612  103.915 1.00 138.81 ? 216 ALA B C     1 
ATOM   6042  O  O     . ALA B 1 237 ? -6.056  -9.160  102.821 1.00 145.34 ? 216 ALA B O     1 
ATOM   6043  C  CB    . ALA B 1 237 ? -6.549  -6.212  103.694 1.00 140.58 ? 216 ALA B CB    1 
ATOM   6044  N  N     . ASP B 1 238 ? -4.828  -8.915  104.702 1.00 132.81 ? 217 ASP B N     1 
ATOM   6045  C  CA    . ASP B 1 238 ? -3.962  -10.051 104.392 1.00 143.63 ? 217 ASP B CA    1 
ATOM   6046  C  C     . ASP B 1 238 ? -4.662  -11.390 104.654 1.00 149.89 ? 217 ASP B C     1 
ATOM   6047  O  O     . ASP B 1 238 ? -4.526  -12.326 103.851 1.00 168.25 ? 217 ASP B O     1 
ATOM   6048  C  CB    . ASP B 1 238 ? -2.635  -9.955  105.155 1.00 172.22 ? 217 ASP B CB    1 
ATOM   6049  C  CG    . ASP B 1 238 ? -1.724  -8.834  104.634 1.00 192.19 ? 217 ASP B CG    1 
ATOM   6050  O  OD1   . ASP B 1 238 ? -0.677  -8.559  105.274 1.00 198.45 ? 217 ASP B OD1   1 
ATOM   6051  O  OD2   . ASP B 1 238 ? -2.030  -8.262  103.562 1.00 192.79 ? 217 ASP B OD2   1 
ATOM   6052  N  N     . VAL B 1 239 ? -5.383  -11.520 105.779 1.00 136.69 ? 218 VAL B N     1 
ATOM   6053  C  CA    . VAL B 1 239 ? -6.250  -12.688 105.973 1.00 127.13 ? 218 VAL B CA    1 
ATOM   6054  C  C     . VAL B 1 239 ? -7.216  -12.819 104.800 1.00 128.30 ? 218 VAL B C     1 
ATOM   6055  O  O     . VAL B 1 239 ? -7.342  -13.883 104.178 1.00 138.19 ? 218 VAL B O     1 
ATOM   6056  C  CB    . VAL B 1 239 ? -7.007  -12.587 107.310 1.00 140.70 ? 218 VAL B CB    1 
ATOM   6057  C  CG1   . VAL B 1 239 ? -8.202  -13.524 107.326 1.00 127.44 ? 218 VAL B CG1   1 
ATOM   6058  C  CG2   . VAL B 1 239 ? -6.092  -12.939 108.451 1.00 146.43 ? 218 VAL B CG2   1 
ATOM   6059  N  N     . ASP B 1 240 ? -7.908  -11.723 104.482 1.00 130.67 ? 219 ASP B N     1 
ATOM   6060  C  CA    . ASP B 1 240 ? -8.837  -11.700 103.358 1.00 132.35 ? 219 ASP B CA    1 
ATOM   6061  C  C     . ASP B 1 240 ? -8.144  -12.192 102.090 1.00 131.47 ? 219 ASP B C     1 
ATOM   6062  O  O     . ASP B 1 240 ? -8.740  -12.902 101.269 1.00 136.20 ? 219 ASP B O     1 
ATOM   6063  C  CB    . ASP B 1 240 ? -9.376  -10.270 103.171 1.00 165.53 ? 219 ASP B CB    1 
ATOM   6064  C  CG    . ASP B 1 240 ? -10.244 -9.777  104.364 1.00 184.98 ? 219 ASP B CG    1 
ATOM   6065  O  OD1   . ASP B 1 240 ? -10.358 -8.538  104.543 1.00 178.33 ? 219 ASP B OD1   1 
ATOM   6066  O  OD2   . ASP B 1 240 ? -10.790 -10.603 105.135 1.00 180.61 ? 219 ASP B OD2   1 
ATOM   6067  N  N     . ALA B 1 241 ? -6.864  -11.854 101.934 1.00 139.55 ? 220 ALA B N     1 
ATOM   6068  C  CA    . ALA B 1 241 ? -6.136  -12.282 100.749 1.00 134.90 ? 220 ALA B CA    1 
ATOM   6069  C  C     . ALA B 1 241 ? -5.893  -13.785 100.755 1.00 127.27 ? 220 ALA B C     1 
ATOM   6070  O  O     . ALA B 1 241 ? -6.268  -14.473 99.796  1.00 130.92 ? 220 ALA B O     1 
ATOM   6071  C  CB    . ALA B 1 241 ? -4.805  -11.535 100.648 1.00 134.33 ? 220 ALA B CB    1 
ATOM   6072  N  N     . TYR B 1 242 ? -5.312  -14.324 101.842 1.00 125.09 ? 221 TYR B N     1 
ATOM   6073  C  CA    . TYR B 1 242 ? -5.041  -15.770 101.899 1.00 135.55 ? 221 TYR B CA    1 
ATOM   6074  C  C     . TYR B 1 242 ? -6.308  -16.556 101.619 1.00 133.30 ? 221 TYR B C     1 
ATOM   6075  O  O     . TYR B 1 242 ? -6.326  -17.500 100.811 1.00 122.38 ? 221 TYR B O     1 
ATOM   6076  C  CB    . TYR B 1 242 ? -4.497  -16.193 103.272 1.00 120.78 ? 221 TYR B CB    1 
ATOM   6077  C  CG    . TYR B 1 242 ? -3.841  -17.583 103.322 1.00 120.11 ? 221 TYR B CG    1 
ATOM   6078  C  CD1   . TYR B 1 242 ? -4.559  -18.718 102.999 1.00 119.85 ? 221 TYR B CD1   1 
ATOM   6079  C  CD2   . TYR B 1 242 ? -2.550  -17.763 103.834 1.00 116.79 ? 221 TYR B CD2   1 
ATOM   6080  C  CE1   . TYR B 1 242 ? -3.986  -19.978 103.063 1.00 151.32 ? 221 TYR B CE1   1 
ATOM   6081  C  CE2   . TYR B 1 242 ? -1.969  -19.032 103.924 1.00 114.77 ? 221 TYR B CE2   1 
ATOM   6082  C  CZ    . TYR B 1 242 ? -2.703  -20.136 103.533 1.00 141.66 ? 221 TYR B CZ    1 
ATOM   6083  O  OH    . TYR B 1 242 ? -2.192  -21.413 103.599 1.00 137.10 ? 221 TYR B OH    1 
ATOM   6084  N  N     . LEU B 1 243 ? -7.383  -16.160 102.295 1.00 135.56 ? 222 LEU B N     1 
ATOM   6085  C  CA    . LEU B 1 243 ? -8.652  -16.836 102.142 1.00 125.06 ? 222 LEU B CA    1 
ATOM   6086  C  C     . LEU B 1 243 ? -9.114  -16.751 100.690 1.00 126.82 ? 222 LEU B C     1 
ATOM   6087  O  O     . LEU B 1 243 ? -9.607  -17.739 100.130 1.00 127.55 ? 222 LEU B O     1 
ATOM   6088  C  CB    . LEU B 1 243 ? -9.651  -16.185 103.095 1.00 126.59 ? 222 LEU B CB    1 
ATOM   6089  C  CG    . LEU B 1 243 ? -10.801 -16.919 103.773 1.00 142.43 ? 222 LEU B CG    1 
ATOM   6090  C  CD1   . LEU B 1 243 ? -10.235 -17.658 104.958 1.00 124.50 ? 222 LEU B CD1   1 
ATOM   6091  C  CD2   . LEU B 1 243 ? -11.979 -15.988 104.185 1.00 152.23 ? 222 LEU B CD2   1 
ATOM   6092  N  N     . HIS B 1 244 ? -8.869  -15.608 100.025 1.00 128.60 ? 223 HIS B N     1 
ATOM   6093  C  CA    . HIS B 1 244 ? -9.351  -15.466 98.653  1.00 131.43 ? 223 HIS B CA    1 
ATOM   6094  C  C     . HIS B 1 244 ? -8.598  -16.397 97.716  1.00 137.84 ? 223 HIS B C     1 
ATOM   6095  O  O     . HIS B 1 244 ? -9.210  -17.166 96.957  1.00 143.53 ? 223 HIS B O     1 
ATOM   6096  C  CB    . HIS B 1 244 ? -9.212  -14.022 98.170  1.00 133.16 ? 223 HIS B CB    1 
ATOM   6097  C  CG    . HIS B 1 244 ? -9.778  -13.790 96.798  1.00 144.45 ? 223 HIS B CG    1 
ATOM   6098  N  ND1   . HIS B 1 244 ? -11.060 -14.164 96.445  1.00 139.29 ? 223 HIS B ND1   1 
ATOM   6099  C  CD2   . HIS B 1 244 ? -9.229  -13.245 95.686  1.00 140.11 ? 223 HIS B CD2   1 
ATOM   6100  C  CE1   . HIS B 1 244 ? -11.281 -13.848 95.182  1.00 139.96 ? 223 HIS B CE1   1 
ATOM   6101  N  NE2   . HIS B 1 244 ? -10.185 -13.290 94.699  1.00 149.76 ? 223 HIS B NE2   1 
ATOM   6102  N  N     . LEU B 1 245 ? -7.264  -16.370 97.787  1.00 133.27 ? 224 LEU B N     1 
ATOM   6103  C  CA    . LEU B 1 245 ? -6.465  -17.255 96.944  1.00 143.76 ? 224 LEU B CA    1 
ATOM   6104  C  C     . LEU B 1 245 ? -6.836  -18.711 97.178  1.00 125.54 ? 224 LEU B C     1 
ATOM   6105  O  O     . LEU B 1 245 ? -7.069  -19.468 96.223  1.00 125.19 ? 224 LEU B O     1 
ATOM   6106  C  CB    . LEU B 1 245 ? -4.969  -17.021 97.197  1.00 124.65 ? 224 LEU B CB    1 
ATOM   6107  C  CG    . LEU B 1 245 ? -4.460  -15.666 96.701  1.00 126.50 ? 224 LEU B CG    1 
ATOM   6108  C  CD1   . LEU B 1 245 ? -3.026  -15.463 97.034  1.00 125.02 ? 224 LEU B CD1   1 
ATOM   6109  C  CD2   . LEU B 1 245 ? -4.642  -15.590 95.197  1.00 130.55 ? 224 LEU B CD2   1 
ATOM   6110  N  N     . PHE B 1 246 ? -6.972  -19.102 98.447  1.00 126.36 ? 225 PHE B N     1 
ATOM   6111  C  CA    . PHE B 1 246 ? -7.274  -20.498 98.735  1.00 125.41 ? 225 PHE B CA    1 
ATOM   6112  C  C     . PHE B 1 246 ? -8.630  -20.912 98.190  1.00 136.41 ? 225 PHE B C     1 
ATOM   6113  O  O     . PHE B 1 246 ? -8.772  -22.009 97.625  1.00 146.84 ? 225 PHE B O     1 
ATOM   6114  C  CB    . PHE B 1 246 ? -7.211  -20.783 100.228 1.00 120.16 ? 225 PHE B CB    1 
ATOM   6115  C  CG    . PHE B 1 246 ? -7.413  -22.217 100.536 1.00 118.86 ? 225 PHE B CG    1 
ATOM   6116  C  CD1   . PHE B 1 246 ? -8.635  -22.662 100.970 1.00 119.72 ? 225 PHE B CD1   1 
ATOM   6117  C  CD2   . PHE B 1 246 ? -6.395  -23.133 100.322 1.00 141.65 ? 225 PHE B CD2   1 
ATOM   6118  C  CE1   . PHE B 1 246 ? -8.840  -23.965 101.230 1.00 118.83 ? 225 PHE B CE1   1 
ATOM   6119  C  CE2   . PHE B 1 246 ? -6.590  -24.460 100.582 1.00 141.76 ? 225 PHE B CE2   1 
ATOM   6120  C  CZ    . PHE B 1 246 ? -7.816  -24.879 101.040 1.00 138.57 ? 225 PHE B CZ    1 
ATOM   6121  N  N     . ASP B 1 247 ? -9.643  -20.062 98.350  1.00 125.75 ? 226 ASP B N     1 
ATOM   6122  C  CA    . ASP B 1 247 ? -10.910 -20.396 97.726  1.00 127.92 ? 226 ASP B CA    1 
ATOM   6123  C  C     . ASP B 1 247 ? -10.747 -20.534 96.222  1.00 136.11 ? 226 ASP B C     1 
ATOM   6124  O  O     . ASP B 1 247 ? -11.391 -21.384 95.602  1.00 153.51 ? 226 ASP B O     1 
ATOM   6125  C  CB    . ASP B 1 247 ? -12.002 -19.392 98.046  1.00 130.30 ? 226 ASP B CB    1 
ATOM   6126  C  CG    . ASP B 1 247 ? -13.308 -19.777 97.366  1.00 165.38 ? 226 ASP B CG    1 
ATOM   6127  O  OD1   . ASP B 1 247 ? -13.667 -20.972 97.457  1.00 132.13 ? 226 ASP B OD1   1 
ATOM   6128  O  OD2   . ASP B 1 247 ? -13.942 -18.923 96.702  1.00 187.39 ? 226 ASP B OD2   1 
ATOM   6129  N  N     . CYS B 1 248 ? -9.871  -19.726 95.620  1.00 130.46 ? 227 CYS B N     1 
ATOM   6130  C  CA    . CYS B 1 248 ? -9.708  -19.765 94.168  1.00 136.54 ? 227 CYS B CA    1 
ATOM   6131  C  C     . CYS B 1 248 ? -9.119  -21.102 93.709  1.00 139.01 ? 227 CYS B C     1 
ATOM   6132  O  O     . CYS B 1 248 ? -9.633  -21.738 92.767  1.00 131.04 ? 227 CYS B O     1 
ATOM   6133  C  CB    . CYS B 1 248 ? -8.821  -18.601 93.731  1.00 146.11 ? 227 CYS B CB    1 
ATOM   6134  S  SG    . CYS B 1 248 ? -9.637  -16.975 93.744  1.00 165.63 ? 227 CYS B SG    1 
ATOM   6135  N  N     . ARG B 1 249 ? -8.056  -21.571 94.383  1.00 133.61 ? 228 ARG B N     1 
ATOM   6136  C  CA    . ARG B 1 249 ? -7.540  -22.890 94.028  1.00 146.16 ? 228 ARG B CA    1 
ATOM   6137  C  C     . ARG B 1 249 ? -8.601  -23.956 94.256  1.00 155.67 ? 228 ARG B C     1 
ATOM   6138  O  O     . ARG B 1 249 ? -8.730  -24.889 93.457  1.00 184.67 ? 228 ARG B O     1 
ATOM   6139  C  CB    . ARG B 1 249 ? -6.274  -23.249 94.812  1.00 141.76 ? 228 ARG B CB    1 
ATOM   6140  C  CG    . ARG B 1 249 ? -5.715  -24.661 94.473  1.00 142.77 ? 228 ARG B CG    1 
ATOM   6141  C  CD    . ARG B 1 249 ? -4.413  -24.921 95.195  1.00 160.50 ? 228 ARG B CD    1 
ATOM   6142  N  NE    . ARG B 1 249 ? -3.886  -26.264 94.977  1.00 171.68 ? 228 ARG B NE    1 
ATOM   6143  C  CZ    . ARG B 1 249 ? -2.920  -26.808 95.718  1.00 190.39 ? 228 ARG B CZ    1 
ATOM   6144  N  NH1   . ARG B 1 249 ? -2.383  -26.131 96.724  1.00 176.12 ? 228 ARG B NH1   1 
ATOM   6145  N  NH2   . ARG B 1 249 ? -2.486  -28.032 95.459  1.00 210.45 ? 228 ARG B NH2   1 
ATOM   6146  N  N     . GLN B 1 250 ? -9.399  -23.821 95.318  1.00 147.82 ? 229 GLN B N     1 
ATOM   6147  C  CA    . GLN B 1 250 ? -10.479 -24.782 95.512  1.00 133.99 ? 229 GLN B CA    1 
ATOM   6148  C  C     . GLN B 1 250 ? -11.415 -24.785 94.314  1.00 136.01 ? 229 GLN B C     1 
ATOM   6149  O  O     . GLN B 1 250 ? -11.766 -25.850 93.792  1.00 138.24 ? 229 GLN B O     1 
ATOM   6150  C  CB    . GLN B 1 250 ? -11.227 -24.504 96.812  1.00 148.75 ? 229 GLN B CB    1 
ATOM   6151  C  CG    . GLN B 1 250 ? -10.394 -24.898 98.020  1.00 166.01 ? 229 GLN B CG    1 
ATOM   6152  C  CD    . GLN B 1 250 ? -10.356 -26.407 98.226  1.00 185.42 ? 229 GLN B CD    1 
ATOM   6153  O  OE1   . GLN B 1 250 ? -9.472  -27.103 97.700  1.00 169.73 ? 229 GLN B OE1   1 
ATOM   6154  N  NE2   . GLN B 1 250 ? -11.314 -26.921 98.986  1.00 195.62 ? 229 GLN B NE2   1 
ATOM   6155  N  N     . ARG B 1 251 ? -11.803 -23.593 93.847  1.00 144.58 ? 230 ARG B N     1 
ATOM   6156  C  CA    . ARG B 1 251 ? -12.673 -23.469 92.677  1.00 160.07 ? 230 ARG B CA    1 
ATOM   6157  C  C     . ARG B 1 251 ? -12.088 -24.155 91.456  1.00 183.83 ? 230 ARG B C     1 
ATOM   6158  O  O     . ARG B 1 251 ? -12.841 -24.569 90.568  1.00 192.53 ? 230 ARG B O     1 
ATOM   6159  C  CB    . ARG B 1 251 ? -12.950 -22.001 92.340  1.00 154.34 ? 230 ARG B CB    1 
ATOM   6160  C  CG    . ARG B 1 251 ? -14.078 -21.306 93.115  1.00 166.17 ? 230 ARG B CG    1 
ATOM   6161  C  CD    . ARG B 1 251 ? -13.895 -19.786 93.047  1.00 166.92 ? 230 ARG B CD    1 
ATOM   6162  N  NE    . ARG B 1 251 ? -15.002 -19.021 93.609  1.00 163.21 ? 230 ARG B NE    1 
ATOM   6163  C  CZ    . ARG B 1 251 ? -15.070 -17.695 93.577  1.00 176.65 ? 230 ARG B CZ    1 
ATOM   6164  N  NH1   . ARG B 1 251 ? -14.078 -16.988 93.033  1.00 160.59 ? 230 ARG B NH1   1 
ATOM   6165  N  NH2   . ARG B 1 251 ? -16.124 -17.077 94.095  1.00 195.73 ? 230 ARG B NH2   1 
ATOM   6166  N  N     . PHE B 1 252 ? -10.760 -24.259 91.362  1.00 191.76 ? 231 PHE B N     1 
ATOM   6167  C  CA    . PHE B 1 252 ? -10.208 -24.988 90.219  1.00 183.49 ? 231 PHE B CA    1 
ATOM   6168  C  C     . PHE B 1 252 ? -10.443 -26.494 90.330  1.00 165.54 ? 231 PHE B C     1 
ATOM   6169  O  O     . PHE B 1 252 ? -10.858 -27.141 89.356  1.00 145.36 ? 231 PHE B O     1 
ATOM   6170  C  CB    . PHE B 1 252 ? -8.712  -24.744 90.092  1.00 188.54 ? 231 PHE B CB    1 
ATOM   6171  C  CG    . PHE B 1 252 ? -8.036  -25.725 89.176  1.00 199.72 ? 231 PHE B CG    1 
ATOM   6172  C  CD1   . PHE B 1 252 ? -8.201  -25.647 87.802  1.00 196.94 ? 231 PHE B CD1   1 
ATOM   6173  C  CD2   . PHE B 1 252 ? -7.306  -26.785 89.705  1.00 202.57 ? 231 PHE B CD2   1 
ATOM   6174  C  CE1   . PHE B 1 252 ? -7.599  -26.567 86.975  1.00 194.84 ? 231 PHE B CE1   1 
ATOM   6175  C  CE2   . PHE B 1 252 ? -6.712  -27.715 88.885  1.00 197.70 ? 231 PHE B CE2   1 
ATOM   6176  C  CZ    . PHE B 1 252 ? -6.859  -27.609 87.524  1.00 196.01 ? 231 PHE B CZ    1 
ATOM   6177  N  N     . ASP B 1 253 ? -10.143 -27.076 91.499  1.00 172.92 ? 232 ASP B N     1 
ATOM   6178  C  CA    . ASP B 1 253 ? -10.261 -28.517 91.704  1.00 183.21 ? 232 ASP B CA    1 
ATOM   6179  C  C     . ASP B 1 253 ? -11.703 -29.014 91.668  1.00 180.37 ? 232 ASP B C     1 
ATOM   6180  O  O     . ASP B 1 253 ? -11.918 -30.230 91.654  1.00 191.04 ? 232 ASP B O     1 
ATOM   6181  C  CB    . ASP B 1 253 ? -9.580  -28.932 93.024  1.00 183.42 ? 232 ASP B CB    1 
ATOM   6182  C  CG    . ASP B 1 253 ? -8.041  -29.067 92.897  1.00 181.10 ? 232 ASP B CG    1 
ATOM   6183  O  OD1   . ASP B 1 253 ? -7.333  -28.917 93.925  1.00 181.79 ? 232 ASP B OD1   1 
ATOM   6184  O  OD2   . ASP B 1 253 ? -7.541  -29.327 91.772  1.00 157.66 ? 232 ASP B OD2   1 
ATOM   6185  N  N     . LEU B 1 254 ? -12.691 -28.127 91.649  1.00 183.62 ? 233 LEU B N     1 
ATOM   6186  C  CA    . LEU B 1 254 ? -14.073 -28.542 91.459  1.00 192.00 ? 233 LEU B CA    1 
ATOM   6187  C  C     . LEU B 1 254 ? -14.570 -28.402 90.020  1.00 188.78 ? 233 LEU B C     1 
ATOM   6188  O  O     . LEU B 1 254 ? -15.716 -28.766 89.752  1.00 204.70 ? 233 LEU B O     1 
ATOM   6189  C  CB    . LEU B 1 254 ? -14.999 -27.771 92.405  1.00 189.75 ? 233 LEU B CB    1 
ATOM   6190  C  CG    . LEU B 1 254 ? -14.778 -27.979 93.912  1.00 177.28 ? 233 LEU B CG    1 
ATOM   6191  C  CD1   . LEU B 1 254 ? -15.934 -27.388 94.699  1.00 179.82 ? 233 LEU B CD1   1 
ATOM   6192  C  CD2   . LEU B 1 254 ? -14.576 -29.450 94.269  1.00 171.68 ? 233 LEU B CD2   1 
ATOM   6193  N  N     . GLY B 1 255 ? -13.759 -27.892 89.087  1.00 200.86 ? 234 GLY B N     1 
ATOM   6194  C  CA    . GLY B 1 255 ? -14.182 -27.817 87.693  1.00 197.86 ? 234 GLY B CA    1 
ATOM   6195  C  C     . GLY B 1 255 ? -14.941 -26.593 87.195  1.00 188.25 ? 234 GLY B C     1 
ATOM   6196  O  O     . GLY B 1 255 ? -15.791 -26.729 86.304  1.00 165.55 ? 234 GLY B O     1 
ATOM   6197  N  N     . GLU B 1 256 ? -14.653 -25.403 87.723  1.00 169.76 ? 235 GLU B N     1 
ATOM   6198  C  CA    . GLU B 1 256 ? -15.116 -24.149 87.123  1.00 201.67 ? 235 GLU B CA    1 
ATOM   6199  C  C     . GLU B 1 256 ? -14.413 -23.947 85.767  1.00 211.69 ? 235 GLU B C     1 
ATOM   6200  O  O     . GLU B 1 256 ? -13.324 -24.490 85.547  1.00 239.11 ? 235 GLU B O     1 
ATOM   6201  C  CB    . GLU B 1 256 ? -14.805 -22.994 88.094  1.00 216.04 ? 235 GLU B CB    1 
ATOM   6202  C  CG    . GLU B 1 256 ? -15.609 -21.677 87.999  1.00 224.21 ? 235 GLU B CG    1 
ATOM   6203  C  CD    . GLU B 1 256 ? -15.680 -20.940 89.344  1.00 217.69 ? 235 GLU B CD    1 
ATOM   6204  O  OE1   . GLU B 1 256 ? -15.421 -21.580 90.385  1.00 209.35 ? 235 GLU B OE1   1 
ATOM   6205  O  OE2   . GLU B 1 256 ? -15.959 -19.721 89.363  1.00 218.24 ? 235 GLU B OE2   1 
ATOM   6206  N  N     . PRO B 1 257 ? -15.017 -23.210 84.818  1.00 196.60 ? 236 PRO B N     1 
ATOM   6207  C  CA    . PRO B 1 257 ? -14.329 -23.004 83.532  1.00 191.87 ? 236 PRO B CA    1 
ATOM   6208  C  C     . PRO B 1 257 ? -13.198 -21.995 83.665  1.00 214.76 ? 236 PRO B C     1 
ATOM   6209  O  O     . PRO B 1 257 ? -13.302 -21.004 84.392  1.00 223.00 ? 236 PRO B O     1 
ATOM   6210  C  CB    . PRO B 1 257 ? -15.436 -22.485 82.609  1.00 200.80 ? 236 PRO B CB    1 
ATOM   6211  C  CG    . PRO B 1 257 ? -16.368 -21.791 83.526  1.00 210.58 ? 236 PRO B CG    1 
ATOM   6212  C  CD    . PRO B 1 257 ? -16.357 -22.593 84.813  1.00 208.81 ? 236 PRO B CD    1 
ATOM   6213  N  N     . LEU B 1 258 ? -12.112 -22.258 82.931  1.00 209.48 ? 237 LEU B N     1 
ATOM   6214  C  CA    . LEU B 1 258 ? -10.922 -21.411 82.985  1.00 203.34 ? 237 LEU B CA    1 
ATOM   6215  C  C     . LEU B 1 258 ? -11.143 -20.010 82.420  1.00 199.95 ? 237 LEU B C     1 
ATOM   6216  O  O     . LEU B 1 258 ? -10.408 -19.089 82.789  1.00 208.99 ? 237 LEU B O     1 
ATOM   6217  C  CB    . LEU B 1 258 ? -9.771  -22.116 82.273  1.00 213.21 ? 237 LEU B CB    1 
ATOM   6218  C  CG    . LEU B 1 258 ? -9.385  -23.412 82.999  1.00 225.47 ? 237 LEU B CG    1 
ATOM   6219  C  CD1   . LEU B 1 258 ? -8.168  -24.067 82.353  1.00 239.40 ? 237 LEU B CD1   1 
ATOM   6220  C  CD2   . LEU B 1 258 ? -9.162  -23.180 84.497  1.00 217.00 ? 237 LEU B CD2   1 
ATOM   6221  N  N     . GLU B 1 259 ? -12.101 -19.820 81.509  1.00 209.54 ? 238 GLU B N     1 
ATOM   6222  C  CA    . GLU B 1 259 ? -12.332 -18.469 81.006  1.00 207.55 ? 238 GLU B CA    1 
ATOM   6223  C  C     . GLU B 1 259 ? -12.730 -17.539 82.150  1.00 202.54 ? 238 GLU B C     1 
ATOM   6224  O  O     . GLU B 1 259 ? -12.276 -16.388 82.224  1.00 171.21 ? 238 GLU B O     1 
ATOM   6225  C  CB    . GLU B 1 259 ? -13.423 -18.475 79.928  1.00 220.76 ? 238 GLU B CB    1 
ATOM   6226  C  CG    . GLU B 1 259 ? -13.585 -17.124 79.198  1.00 232.13 ? 238 GLU B CG    1 
ATOM   6227  C  CD    . GLU B 1 259 ? -14.956 -16.922 78.522  1.00 231.71 ? 238 GLU B CD    1 
ATOM   6228  O  OE1   . GLU B 1 259 ? -15.019 -16.894 77.275  1.00 213.10 ? 238 GLU B OE1   1 
ATOM   6229  O  OE2   . GLU B 1 259 ? -15.974 -16.780 79.238  1.00 244.52 ? 238 GLU B OE2   1 
ATOM   6230  N  N     . GLU B 1 260 ? -13.514 -18.066 83.098  1.00 202.69 ? 239 GLU B N     1 
ATOM   6231  C  CA    . GLU B 1 260 ? -14.031 -17.309 84.235  1.00 195.84 ? 239 GLU B CA    1 
ATOM   6232  C  C     . GLU B 1 260 ? -13.040 -17.198 85.391  1.00 177.11 ? 239 GLU B C     1 
ATOM   6233  O  O     . GLU B 1 260 ? -12.902 -16.118 85.972  1.00 178.98 ? 239 GLU B O     1 
ATOM   6234  C  CB    . GLU B 1 260 ? -15.331 -17.959 84.728  1.00 210.53 ? 239 GLU B CB    1 
ATOM   6235  C  CG    . GLU B 1 260 ? -15.655 -17.720 86.200  1.00 216.13 ? 239 GLU B CG    1 
ATOM   6236  C  CD    . GLU B 1 260 ? -16.972 -18.349 86.626  1.00 224.98 ? 239 GLU B CD    1 
ATOM   6237  O  OE1   . GLU B 1 260 ? -17.582 -19.082 85.817  1.00 237.65 ? 239 GLU B OE1   1 
ATOM   6238  O  OE2   . GLU B 1 260 ? -17.399 -18.102 87.774  1.00 222.26 ? 239 GLU B OE2   1 
ATOM   6239  N  N     . LEU B 1 261 ? -12.349 -18.285 85.749  1.00 171.46 ? 240 LEU B N     1 
ATOM   6240  C  CA    . LEU B 1 261 ? -11.484 -18.252 86.930  1.00 148.14 ? 240 LEU B CA    1 
ATOM   6241  C  C     . LEU B 1 261 ? -10.456 -17.133 86.847  1.00 147.96 ? 240 LEU B C     1 
ATOM   6242  O  O     . LEU B 1 261 ? -10.293 -16.353 87.794  1.00 146.85 ? 240 LEU B O     1 
ATOM   6243  C  CB    . LEU B 1 261 ? -10.777 -19.593 87.126  1.00 144.94 ? 240 LEU B CB    1 
ATOM   6244  C  CG    . LEU B 1 261 ? -11.575 -20.801 87.605  1.00 144.12 ? 240 LEU B CG    1 
ATOM   6245  C  CD1   . LEU B 1 261 ? -10.735 -22.091 87.594  1.00 141.44 ? 240 LEU B CD1   1 
ATOM   6246  C  CD2   . LEU B 1 261 ? -12.128 -20.513 88.985  1.00 142.73 ? 240 LEU B CD2   1 
ATOM   6247  N  N     . LEU B 1 262 ? -9.737  -17.051 85.723  1.00 150.52 ? 241 LEU B N     1 
ATOM   6248  C  CA    . LEU B 1 262 ? -8.678  -16.057 85.580  1.00 158.25 ? 241 LEU B CA    1 
ATOM   6249  C  C     . LEU B 1 262 ? -9.246  -14.648 85.413  1.00 152.55 ? 241 LEU B C     1 
ATOM   6250  O  O     . LEU B 1 262 ? -8.510  -13.665 85.547  1.00 152.66 ? 241 LEU B O     1 
ATOM   6251  C  CB    . LEU B 1 262 ? -7.772  -16.442 84.392  1.00 149.77 ? 241 LEU B CB    1 
ATOM   6252  C  CG    . LEU B 1 262 ? -6.939  -17.758 84.361  1.00 146.77 ? 241 LEU B CG    1 
ATOM   6253  C  CD1   . LEU B 1 262 ? -6.251  -17.878 83.026  1.00 148.57 ? 241 LEU B CD1   1 
ATOM   6254  C  CD2   . LEU B 1 262 ? -5.896  -17.971 85.474  1.00 142.61 ? 241 LEU B CD2   1 
ATOM   6255  N  N     . ALA B 1 263 ? -10.534 -14.526 85.101  1.00 155.56 ? 242 ALA B N     1 
ATOM   6256  C  CA    . ALA B 1 263 ? -11.224 -13.250 85.256  1.00 161.52 ? 242 ALA B CA    1 
ATOM   6257  C  C     . ALA B 1 263 ? -11.370 -12.878 86.732  1.00 164.86 ? 242 ALA B C     1 
ATOM   6258  O  O     . ALA B 1 263 ? -11.188 -11.715 87.115  1.00 157.08 ? 242 ALA B O     1 
ATOM   6259  C  CB    . ALA B 1 263 ? -12.588 -13.313 84.575  1.00 165.05 ? 242 ALA B CB    1 
ATOM   6260  N  N     . GLY B 1 264 ? -11.653 -13.875 87.580  1.00 166.25 ? 243 GLY B N     1 
ATOM   6261  C  CA    . GLY B 1 264 ? -11.945 -13.668 88.989  1.00 154.39 ? 243 GLY B CA    1 
ATOM   6262  C  C     . GLY B 1 264 ? -10.728 -13.504 89.855  1.00 147.99 ? 243 GLY B C     1 
ATOM   6263  O  O     . GLY B 1 264 ? -10.856 -13.042 90.987  1.00 146.97 ? 243 GLY B O     1 
ATOM   6264  N  N     . LEU B 1 265 ? -9.575  -13.953 89.380  1.00 146.29 ? 244 LEU B N     1 
ATOM   6265  C  CA    . LEU B 1 265 ? -8.305  -13.804 90.083  1.00 143.38 ? 244 LEU B CA    1 
ATOM   6266  C  C     . LEU B 1 265 ? -7.872  -12.337 90.086  1.00 154.25 ? 244 LEU B C     1 
ATOM   6267  O  O     . LEU B 1 265 ? -8.371  -11.537 89.292  1.00 165.64 ? 244 LEU B O     1 
ATOM   6268  C  CB    . LEU B 1 265 ? -7.244  -14.651 89.400  1.00 141.72 ? 244 LEU B CB    1 
ATOM   6269  C  CG    . LEU B 1 265 ? -7.414  -16.108 89.702  1.00 139.26 ? 244 LEU B CG    1 
ATOM   6270  C  CD1   . LEU B 1 265 ? -6.276  -16.839 89.095  1.00 137.72 ? 244 LEU B CD1   1 
ATOM   6271  C  CD2   . LEU B 1 265 ? -7.398  -16.218 91.198  1.00 136.59 ? 244 LEU B CD2   1 
ATOM   6272  N  N     . PRO B 1 266 ? -6.973  -11.949 90.991  1.00 145.54 ? 245 PRO B N     1 
ATOM   6273  C  CA    . PRO B 1 266 ? -6.415  -10.586 90.918  1.00 157.00 ? 245 PRO B CA    1 
ATOM   6274  C  C     . PRO B 1 266 ? -5.470  -10.398 89.733  1.00 178.17 ? 245 PRO B C     1 
ATOM   6275  O  O     . PRO B 1 266 ? -4.583  -11.215 89.492  1.00 175.12 ? 245 PRO B O     1 
ATOM   6276  C  CB    . PRO B 1 266 ? -5.663  -10.448 92.243  1.00 154.91 ? 245 PRO B CB    1 
ATOM   6277  C  CG    . PRO B 1 266 ? -5.306  -11.870 92.617  1.00 152.61 ? 245 PRO B CG    1 
ATOM   6278  C  CD    . PRO B 1 266 ? -6.463  -12.710 92.143  1.00 140.27 ? 245 PRO B CD    1 
ATOM   6279  N  N     . GLY B 1 267 ? -5.628  -9.278  89.020  1.00 194.06 ? 246 GLY B N     1 
ATOM   6280  C  CA    . GLY B 1 267 ? -4.750  -8.968  87.904  1.00 198.36 ? 246 GLY B CA    1 
ATOM   6281  C  C     . GLY B 1 267 ? -3.567  -8.080  88.205  1.00 197.43 ? 246 GLY B C     1 
ATOM   6282  O  O     . GLY B 1 267 ? -2.758  -7.795  87.314  1.00 188.19 ? 246 GLY B O     1 
ATOM   6283  N  N     . GLU B 1 268 ? -3.433  -7.638  89.450  1.00 196.26 ? 247 GLU B N     1 
ATOM   6284  C  CA    . GLU B 1 268 ? -2.349  -6.773  89.869  1.00 199.78 ? 247 GLU B CA    1 
ATOM   6285  C  C     . GLU B 1 268 ? -1.716  -7.357  91.120  1.00 191.57 ? 247 GLU B C     1 
ATOM   6286  O  O     . GLU B 1 268 ? -2.426  -7.887  91.986  1.00 193.23 ? 247 GLU B O     1 
ATOM   6287  C  CB    . GLU B 1 268 ? -2.865  -5.372  90.160  1.00 210.17 ? 247 GLU B CB    1 
ATOM   6288  C  CG    . GLU B 1 268 ? -3.587  -4.782  88.998  1.00 223.16 ? 247 GLU B CG    1 
ATOM   6289  C  CD    . GLU B 1 268 ? -5.006  -4.477  89.363  1.00 233.66 ? 247 GLU B CD    1 
ATOM   6290  O  OE1   . GLU B 1 268 ? -5.646  -5.380  89.943  1.00 227.65 ? 247 GLU B OE1   1 
ATOM   6291  O  OE2   . GLU B 1 268 ? -5.473  -3.350  89.099  1.00 248.04 ? 247 GLU B OE2   1 
ATOM   6292  N  N     . PRO B 1 269 ? -0.399  -7.255  91.254  1.00 184.80 ? 248 PRO B N     1 
ATOM   6293  C  CA    . PRO B 1 269 ? 0.286   -7.957  92.343  1.00 196.33 ? 248 PRO B CA    1 
ATOM   6294  C  C     . PRO B 1 269 ? -0.173  -7.509  93.727  1.00 200.23 ? 248 PRO B C     1 
ATOM   6295  O  O     . PRO B 1 269 ? -0.642  -6.383  93.921  1.00 191.68 ? 248 PRO B O     1 
ATOM   6296  C  CB    . PRO B 1 269 ? 1.759   -7.610  92.103  1.00 204.08 ? 248 PRO B CB    1 
ATOM   6297  C  CG    . PRO B 1 269 ? 1.840   -7.313  90.626  1.00 198.58 ? 248 PRO B CG    1 
ATOM   6298  C  CD    . PRO B 1 269 ? 0.542   -6.633  90.307  1.00 191.38 ? 248 PRO B CD    1 
ATOM   6299  N  N     . TYR B 1 270 ? -0.054  -8.436  94.684  1.00 205.05 ? 249 TYR B N     1 
ATOM   6300  C  CA    . TYR B 1 270 ? -0.374  -8.210  96.090  1.00 192.90 ? 249 TYR B CA    1 
ATOM   6301  C  C     . TYR B 1 270 ? 0.778   -7.493  96.796  1.00 187.56 ? 249 TYR B C     1 
ATOM   6302  O  O     . TYR B 1 270 ? 1.954   -7.675  96.453  1.00 169.26 ? 249 TYR B O     1 
ATOM   6303  C  CB    . TYR B 1 270 ? -0.667  -9.540  96.791  1.00 172.87 ? 249 TYR B CB    1 
ATOM   6304  C  CG    . TYR B 1 270 ? -2.091  -10.024 96.663  1.00 167.53 ? 249 TYR B CG    1 
ATOM   6305  C  CD1   . TYR B 1 270 ? -3.147  -9.263  97.149  1.00 189.38 ? 249 TYR B CD1   1 
ATOM   6306  C  CD2   . TYR B 1 270 ? -2.383  -11.243 96.047  1.00 161.87 ? 249 TYR B CD2   1 
ATOM   6307  C  CE1   . TYR B 1 270 ? -4.466  -9.705  97.031  1.00 192.43 ? 249 TYR B CE1   1 
ATOM   6308  C  CE2   . TYR B 1 270 ? -3.698  -11.697 95.926  1.00 164.93 ? 249 TYR B CE2   1 
ATOM   6309  C  CZ    . TYR B 1 270 ? -4.736  -10.919 96.422  1.00 177.96 ? 249 TYR B CZ    1 
ATOM   6310  O  OH    . TYR B 1 270 ? -6.045  -11.341 96.311  1.00 169.77 ? 249 TYR B OH    1 
ATOM   6311  N  N     . ALA B 1 271 ? 0.432   -6.707  97.823  1.00 189.99 ? 250 ALA B N     1 
ATOM   6312  C  CA    . ALA B 1 271 ? 1.438   -5.955  98.577  1.00 178.07 ? 250 ALA B CA    1 
ATOM   6313  C  C     . ALA B 1 271 ? 2.418   -6.868  99.316  1.00 177.16 ? 250 ALA B C     1 
ATOM   6314  O  O     . ALA B 1 271 ? 3.630   -6.810  99.086  1.00 171.48 ? 250 ALA B O     1 
ATOM   6315  C  CB    . ALA B 1 271 ? 0.747   -5.010  99.558  1.00 179.35 ? 250 ALA B CB    1 
ATOM   6316  N  N     . ASN B 1 272 ? 1.910   -7.709  100.221 1.00 195.29 ? 251 ASN B N     1 
ATOM   6317  C  CA    . ASN B 1 272 ? 2.763   -8.537  101.078 1.00 184.08 ? 251 ASN B CA    1 
ATOM   6318  C  C     . ASN B 1 272 ? 3.536   -9.549  100.221 1.00 149.65 ? 251 ASN B C     1 
ATOM   6319  O  O     . ASN B 1 272 ? 2.964   -10.179 99.323  1.00 133.09 ? 251 ASN B O     1 
ATOM   6320  C  CB    . ASN B 1 272 ? 1.877   -9.247  102.124 1.00 187.15 ? 251 ASN B CB    1 
ATOM   6321  C  CG    . ASN B 1 272 ? 2.647   -9.777  103.332 1.00 180.38 ? 251 ASN B CG    1 
ATOM   6322  O  OD1   . ASN B 1 272 ? 3.385   -10.764 103.247 1.00 178.23 ? 251 ASN B OD1   1 
ATOM   6323  N  ND2   . ASN B 1 272 ? 2.392   -9.167  104.495 1.00 164.64 ? 251 ASN B ND2   1 
ATOM   6324  N  N     . PRO B 1 273 ? 4.832   -9.742  100.463 1.00 149.10 ? 252 PRO B N     1 
ATOM   6325  C  CA    . PRO B 1 273 ? 5.612   -10.601 99.544  1.00 172.18 ? 252 PRO B CA    1 
ATOM   6326  C  C     . PRO B 1 273 ? 5.201   -12.067 99.550  1.00 156.53 ? 252 PRO B C     1 
ATOM   6327  O  O     . PRO B 1 273 ? 5.141   -12.700 98.485  1.00 149.38 ? 252 PRO B O     1 
ATOM   6328  C  CB    . PRO B 1 273 ? 7.059   -10.415 100.028 1.00 183.58 ? 252 PRO B CB    1 
ATOM   6329  C  CG    . PRO B 1 273 ? 7.037   -9.165  100.881 1.00 191.20 ? 252 PRO B CG    1 
ATOM   6330  C  CD    . PRO B 1 273 ? 5.669   -9.106  101.491 1.00 167.10 ? 252 PRO B CD    1 
ATOM   6331  N  N     . TRP B 1 274 ? 4.903   -12.624 100.720 1.00 153.13 ? 253 TRP B N     1 
ATOM   6332  C  CA    . TRP B 1 274 ? 4.581   -14.044 100.805 1.00 177.92 ? 253 TRP B CA    1 
ATOM   6333  C  C     . TRP B 1 274 ? 3.250   -14.327 100.119 1.00 172.84 ? 253 TRP B C     1 
ATOM   6334  O  O     . TRP B 1 274 ? 3.090   -15.349 99.423  1.00 175.05 ? 253 TRP B O     1 
ATOM   6335  C  CB    . TRP B 1 274 ? 4.600   -14.435 102.292 1.00 195.63 ? 253 TRP B CB    1 
ATOM   6336  C  CG    . TRP B 1 274 ? 3.796   -15.616 102.806 1.00 192.75 ? 253 TRP B CG    1 
ATOM   6337  C  CD1   . TRP B 1 274 ? 3.849   -16.922 102.370 1.00 186.20 ? 253 TRP B CD1   1 
ATOM   6338  C  CD2   . TRP B 1 274 ? 2.872   -15.596 103.909 1.00 175.19 ? 253 TRP B CD2   1 
ATOM   6339  N  NE1   . TRP B 1 274 ? 2.995   -17.698 103.129 1.00 175.47 ? 253 TRP B NE1   1 
ATOM   6340  C  CE2   . TRP B 1 274 ? 2.385   -16.905 104.074 1.00 169.62 ? 253 TRP B CE2   1 
ATOM   6341  C  CE3   . TRP B 1 274 ? 2.400   -14.590 104.761 1.00 160.78 ? 253 TRP B CE3   1 
ATOM   6342  C  CZ2   . TRP B 1 274 ? 1.448   -17.230 105.057 1.00 152.87 ? 253 TRP B CZ2   1 
ATOM   6343  C  CZ3   . TRP B 1 274 ? 1.462   -14.922 105.741 1.00 138.40 ? 253 TRP B CZ3   1 
ATOM   6344  C  CH2   . TRP B 1 274 ? 1.001   -16.224 105.877 1.00 135.13 ? 253 TRP B CH2   1 
ATOM   6345  N  N     . LEU B 1 275 ? 2.315   -13.384 100.237 1.00 170.88 ? 254 LEU B N     1 
ATOM   6346  C  CA    . LEU B 1 275 ? 1.049   -13.509 99.528  1.00 157.34 ? 254 LEU B CA    1 
ATOM   6347  C  C     . LEU B 1 275 ? 1.267   -13.485 98.017  1.00 141.87 ? 254 LEU B C     1 
ATOM   6348  O  O     . LEU B 1 275 ? 0.710   -14.316 97.292  1.00 135.28 ? 254 LEU B O     1 
ATOM   6349  C  CB    . LEU B 1 275 ? 0.073   -12.416 99.974  1.00 129.58 ? 254 LEU B CB    1 
ATOM   6350  C  CG    . LEU B 1 275 ? -0.371  -12.402 101.457 1.00 128.98 ? 254 LEU B CG    1 
ATOM   6351  C  CD1   . LEU B 1 275 ? -1.357  -11.263 101.747 1.00 131.53 ? 254 LEU B CD1   1 
ATOM   6352  C  CD2   . LEU B 1 275 ? -0.919  -13.728 101.961 1.00 126.82 ? 254 LEU B CD2   1 
ATOM   6353  N  N     . GLU B 1 276 ? 2.087   -12.543 97.520  1.00 142.41 ? 255 GLU B N     1 
ATOM   6354  C  CA    . GLU B 1 276 ? 2.384   -12.499 96.082  1.00 157.32 ? 255 GLU B CA    1 
ATOM   6355  C  C     . GLU B 1 276 ? 3.039   -13.785 95.589  1.00 139.23 ? 255 GLU B C     1 
ATOM   6356  O  O     . GLU B 1 276 ? 2.794   -14.219 94.450  1.00 133.27 ? 255 GLU B O     1 
ATOM   6357  C  CB    . GLU B 1 276 ? 3.284   -11.306 95.751  1.00 174.85 ? 255 GLU B CB    1 
ATOM   6358  C  CG    . GLU B 1 276 ? 3.829   -11.306 94.311  1.00 195.93 ? 255 GLU B CG    1 
ATOM   6359  C  CD    . GLU B 1 276 ? 2.803   -10.960 93.241  1.00 221.24 ? 255 GLU B CD    1 
ATOM   6360  O  OE1   . GLU B 1 276 ? 1.639   -10.657 93.587  1.00 232.04 ? 255 GLU B OE1   1 
ATOM   6361  O  OE2   . GLU B 1 276 ? 3.163   -11.018 92.041  1.00 229.23 ? 255 GLU B OE2   1 
ATOM   6362  N  N     . GLY B 1 277 ? 3.845   -14.425 96.435  1.00 137.50 ? 256 GLY B N     1 
ATOM   6363  C  CA    . GLY B 1 277 ? 4.316   -15.750 96.086  1.00 129.79 ? 256 GLY B CA    1 
ATOM   6364  C  C     . GLY B 1 277 ? 3.163   -16.710 95.883  1.00 138.27 ? 256 GLY B C     1 
ATOM   6365  O  O     . GLY B 1 277 ? 3.078   -17.400 94.861  1.00 122.62 ? 256 GLY B O     1 
ATOM   6366  N  N     . ARG B 1 278 ? 2.224   -16.728 96.835  1.00 144.89 ? 257 ARG B N     1 
ATOM   6367  C  CA    . ARG B 1 278 ? 1.113   -17.665 96.704  1.00 141.52 ? 257 ARG B CA    1 
ATOM   6368  C  C     . ARG B 1 278 ? 0.321   -17.383 95.436  1.00 150.59 ? 257 ARG B C     1 
ATOM   6369  O  O     . ARG B 1 278 ? -0.007  -18.313 94.686  1.00 147.95 ? 257 ARG B O     1 
ATOM   6370  C  CB    . ARG B 1 278 ? 0.207   -17.581 97.935  1.00 147.18 ? 257 ARG B CB    1 
ATOM   6371  C  CG    . ARG B 1 278 ? 0.873   -17.875 99.273  1.00 142.57 ? 257 ARG B CG    1 
ATOM   6372  C  CD    . ARG B 1 278 ? 1.259   -19.335 99.389  1.00 158.10 ? 257 ARG B CD    1 
ATOM   6373  N  NE    . ARG B 1 278 ? 0.386   -20.038 100.325 1.00 157.34 ? 257 ARG B NE    1 
ATOM   6374  C  CZ    . ARG B 1 278 ? 0.800   -20.529 101.488 1.00 173.65 ? 257 ARG B CZ    1 
ATOM   6375  N  NH1   . ARG B 1 278 ? 2.071   -20.390 101.847 1.00 177.79 ? 257 ARG B NH1   1 
ATOM   6376  N  NH2   . ARG B 1 278 ? -0.050  -21.155 102.290 1.00 179.64 ? 257 ARG B NH2   1 
ATOM   6377  N  N     . ARG B 1 279 ? 0.097   -16.095 95.136  1.00 172.76 ? 258 ARG B N     1 
ATOM   6378  C  CA    . ARG B 1 279 ? -0.664  -15.686 93.954  1.00 168.63 ? 258 ARG B CA    1 
ATOM   6379  C  C     . ARG B 1 279 ? -0.001  -16.188 92.682  1.00 145.36 ? 258 ARG B C     1 
ATOM   6380  O  O     . ARG B 1 279 ? -0.632  -16.866 91.854  1.00 126.96 ? 258 ARG B O     1 
ATOM   6381  C  CB    . ARG B 1 279 ? -0.774  -14.151 93.909  1.00 155.72 ? 258 ARG B CB    1 
ATOM   6382  C  CG    . ARG B 1 279 ? -1.128  -13.601 92.528  1.00 143.75 ? 258 ARG B CG    1 
ATOM   6383  C  CD    . ARG B 1 279 ? -0.975  -12.073 92.367  1.00 149.36 ? 258 ARG B CD    1 
ATOM   6384  N  NE    . ARG B 1 279 ? -1.022  -11.728 90.933  1.00 175.07 ? 258 ARG B NE    1 
ATOM   6385  C  CZ    . ARG B 1 279 ? 0.036   -11.469 90.149  1.00 169.12 ? 258 ARG B CZ    1 
ATOM   6386  N  NH1   . ARG B 1 279 ? -0.136  -11.189 88.862  1.00 147.73 ? 258 ARG B NH1   1 
ATOM   6387  N  NH2   . ARG B 1 279 ? 1.269   -11.472 90.631  1.00 178.88 ? 258 ARG B NH2   1 
ATOM   6388  N  N     . VAL B 1 280 ? 1.292   -15.894 92.531  1.00 139.25 ? 259 VAL B N     1 
ATOM   6389  C  CA    . VAL B 1 280 ? 1.977   -16.294 91.313  1.00 133.94 ? 259 VAL B CA    1 
ATOM   6390  C  C     . VAL B 1 280 ? 2.039   -17.813 91.226  1.00 131.79 ? 259 VAL B C     1 
ATOM   6391  O  O     . VAL B 1 280 ? 1.991   -18.386 90.127  1.00 140.41 ? 259 VAL B O     1 
ATOM   6392  C  CB    . VAL B 1 280 ? 3.351   -15.606 91.231  1.00 126.61 ? 259 VAL B CB    1 
ATOM   6393  C  CG1   . VAL B 1 280 ? 4.335   -16.489 90.558  1.00 125.60 ? 259 VAL B CG1   1 
ATOM   6394  C  CG2   . VAL B 1 280 ? 3.222   -14.280 90.451  1.00 129.92 ? 259 VAL B CG2   1 
ATOM   6395  N  N     . LYS B 1 281 ? 2.075   -18.498 92.368  1.00 122.41 ? 260 LYS B N     1 
ATOM   6396  C  CA    . LYS B 1 281 ? 2.003   -19.951 92.307  1.00 143.61 ? 260 LYS B CA    1 
ATOM   6397  C  C     . LYS B 1 281 ? 0.637   -20.405 91.789  1.00 134.13 ? 260 LYS B C     1 
ATOM   6398  O  O     . LYS B 1 281 ? 0.545   -21.387 91.046  1.00 122.09 ? 260 LYS B O     1 
ATOM   6399  C  CB    . LYS B 1 281 ? 2.340   -20.567 93.667  1.00 144.93 ? 260 LYS B CB    1 
ATOM   6400  C  CG    . LYS B 1 281 ? 2.187   -22.085 93.676  1.00 154.74 ? 260 LYS B CG    1 
ATOM   6401  C  CD    . LYS B 1 281 ? 2.666   -22.712 94.970  1.00 156.28 ? 260 LYS B CD    1 
ATOM   6402  C  CE    . LYS B 1 281 ? 2.751   -24.229 94.841  1.00 147.45 ? 260 LYS B CE    1 
ATOM   6403  N  NZ    . LYS B 1 281 ? 3.297   -24.858 96.081  1.00 139.54 ? 260 LYS B NZ    1 
ATOM   6404  N  N     . LEU B 1 282 ? -0.442  -19.736 92.186  1.00 124.05 ? 261 LEU B N     1 
ATOM   6405  C  CA    . LEU B 1 282 ? -1.738  -20.086 91.609  1.00 140.22 ? 261 LEU B CA    1 
ATOM   6406  C  C     . LEU B 1 282 ? -1.743  -19.871 90.092  1.00 147.99 ? 261 LEU B C     1 
ATOM   6407  O  O     . LEU B 1 282 ? -2.080  -20.791 89.329  1.00 144.04 ? 261 LEU B O     1 
ATOM   6408  C  CB    . LEU B 1 282 ? -2.860  -19.308 92.311  1.00 139.67 ? 261 LEU B CB    1 
ATOM   6409  C  CG    . LEU B 1 282 ? -4.353  -19.587 92.033  1.00 127.12 ? 261 LEU B CG    1 
ATOM   6410  C  CD1   . LEU B 1 282 ? -4.767  -21.032 92.335  1.00 125.63 ? 261 LEU B CD1   1 
ATOM   6411  C  CD2   . LEU B 1 282 ? -5.174  -18.633 92.895  1.00 128.01 ? 261 LEU B CD2   1 
ATOM   6412  N  N     . LEU B 1 283 ? -1.324  -18.677 89.633  1.00 139.03 ? 262 LEU B N     1 
ATOM   6413  C  CA    . LEU B 1 283 ? -1.216  -18.424 88.193  1.00 139.64 ? 262 LEU B CA    1 
ATOM   6414  C  C     . LEU B 1 283 ? -0.511  -19.583 87.529  1.00 145.64 ? 262 LEU B C     1 
ATOM   6415  O  O     . LEU B 1 283 ? -0.956  -20.124 86.506  1.00 172.03 ? 262 LEU B O     1 
ATOM   6416  C  CB    . LEU B 1 283 ? -0.419  -17.143 87.913  1.00 138.80 ? 262 LEU B CB    1 
ATOM   6417  C  CG    . LEU B 1 283 ? -0.880  -15.711 88.196  1.00 141.45 ? 262 LEU B CG    1 
ATOM   6418  C  CD1   . LEU B 1 283 ? 0.223   -14.744 87.742  1.00 146.69 ? 262 LEU B CD1   1 
ATOM   6419  C  CD2   . LEU B 1 283 ? -2.204  -15.400 87.507  1.00 137.67 ? 262 LEU B CD2   1 
ATOM   6420  N  N     . PHE B 1 284 ? 0.593   -19.984 88.139  1.00 142.09 ? 263 PHE B N     1 
ATOM   6421  C  CA    . PHE B 1 284 ? 1.376   -21.091 87.635  1.00 153.84 ? 263 PHE B CA    1 
ATOM   6422  C  C     . PHE B 1 284 ? 0.546   -22.371 87.519  1.00 154.27 ? 263 PHE B C     1 
ATOM   6423  O  O     . PHE B 1 284 ? 0.500   -22.988 86.450  1.00 146.53 ? 263 PHE B O     1 
ATOM   6424  C  CB    . PHE B 1 284 ? 2.585   -21.290 88.554  1.00 150.66 ? 263 PHE B CB    1 
ATOM   6425  C  CG    . PHE B 1 284 ? 3.584   -22.236 88.013  1.00 122.86 ? 263 PHE B CG    1 
ATOM   6426  C  CD1   . PHE B 1 284 ? 4.640   -21.767 87.270  1.00 123.81 ? 263 PHE B CD1   1 
ATOM   6427  C  CD2   . PHE B 1 284 ? 3.442   -23.603 88.224  1.00 121.35 ? 263 PHE B CD2   1 
ATOM   6428  C  CE1   . PHE B 1 284 ? 5.552   -22.643 86.748  1.00 168.90 ? 263 PHE B CE1   1 
ATOM   6429  C  CE2   . PHE B 1 284 ? 4.329   -24.476 87.713  1.00 136.69 ? 263 PHE B CE2   1 
ATOM   6430  C  CZ    . PHE B 1 284 ? 5.400   -24.007 86.972  1.00 175.42 ? 263 PHE B CZ    1 
ATOM   6431  N  N     . GLN B 1 285 ? -0.151  -22.770 88.592  1.00 148.09 ? 264 GLN B N     1 
ATOM   6432  C  CA    . GLN B 1 285 ? -0.796  -24.085 88.576  1.00 139.35 ? 264 GLN B CA    1 
ATOM   6433  C  C     . GLN B 1 285 ? -1.959  -24.107 87.597  1.00 159.19 ? 264 GLN B C     1 
ATOM   6434  O  O     . GLN B 1 285 ? -2.207  -25.128 86.943  1.00 161.53 ? 264 GLN B O     1 
ATOM   6435  C  CB    . GLN B 1 285 ? -1.281  -24.481 89.980  1.00 129.73 ? 264 GLN B CB    1 
ATOM   6436  C  CG    . GLN B 1 285 ? -0.212  -24.488 91.066  1.00 143.08 ? 264 GLN B CG    1 
ATOM   6437  C  CD    . GLN B 1 285 ? -0.759  -24.753 92.464  1.00 144.96 ? 264 GLN B CD    1 
ATOM   6438  O  OE1   . GLN B 1 285 ? -0.707  -25.874 92.965  1.00 169.07 ? 264 GLN B OE1   1 
ATOM   6439  N  NE2   . GLN B 1 285 ? -1.260  -23.698 93.113  1.00 123.66 ? 264 GLN B NE2   1 
ATOM   6440  N  N     . PHE B 1 286 ? -2.693  -22.994 87.490  1.00 157.74 ? 265 PHE B N     1 
ATOM   6441  C  CA    . PHE B 1 286 ? -3.713  -22.898 86.450  1.00 167.98 ? 265 PHE B CA    1 
ATOM   6442  C  C     . PHE B 1 286 ? -3.094  -23.065 85.077  1.00 145.94 ? 265 PHE B C     1 
ATOM   6443  O  O     . PHE B 1 286 ? -3.612  -23.814 84.239  1.00 135.90 ? 265 PHE B O     1 
ATOM   6444  C  CB    . PHE B 1 286 ? -4.482  -21.580 86.539  1.00 181.54 ? 265 PHE B CB    1 
ATOM   6445  C  CG    . PHE B 1 286 ? -5.441  -21.526 87.687  1.00 173.41 ? 265 PHE B CG    1 
ATOM   6446  C  CD1   . PHE B 1 286 ? -5.504  -22.565 88.602  1.00 149.71 ? 265 PHE B CD1   1 
ATOM   6447  C  CD2   . PHE B 1 286 ? -6.334  -20.483 87.807  1.00 170.87 ? 265 PHE B CD2   1 
ATOM   6448  C  CE1   . PHE B 1 286 ? -6.376  -22.528 89.647  1.00 141.34 ? 265 PHE B CE1   1 
ATOM   6449  C  CE2   . PHE B 1 286 ? -7.225  -20.450 88.852  1.00 164.44 ? 265 PHE B CE2   1 
ATOM   6450  C  CZ    . PHE B 1 286 ? -7.250  -21.476 89.772  1.00 154.59 ? 265 PHE B CZ    1 
ATOM   6451  N  N     . ALA B 1 287 ? -1.974  -22.375 84.835  1.00 138.54 ? 266 ALA B N     1 
ATOM   6452  C  CA    . ALA B 1 287 ? -1.299  -22.516 83.556  1.00 135.59 ? 266 ALA B CA    1 
ATOM   6453  C  C     . ALA B 1 287 ? -0.867  -23.957 83.341  1.00 134.27 ? 266 ALA B C     1 
ATOM   6454  O  O     . ALA B 1 287 ? -0.853  -24.438 82.203  1.00 150.35 ? 266 ALA B O     1 
ATOM   6455  C  CB    . ALA B 1 287 ? -0.113  -21.555 83.482  1.00 135.36 ? 266 ALA B CB    1 
ATOM   6456  N  N     . GLN B 1 288 ? -0.561  -24.668 84.433  1.00 135.96 ? 267 GLN B N     1 
ATOM   6457  C  CA    . GLN B 1 288 ? -0.179  -26.079 84.375  1.00 148.53 ? 267 GLN B CA    1 
ATOM   6458  C  C     . GLN B 1 288 ? -1.312  -26.954 83.861  1.00 164.34 ? 267 GLN B C     1 
ATOM   6459  O  O     . GLN B 1 288 ? -1.108  -27.813 82.998  1.00 158.78 ? 267 GLN B O     1 
ATOM   6460  C  CB    . GLN B 1 288 ? 0.212   -26.552 85.771  1.00 168.98 ? 267 GLN B CB    1 
ATOM   6461  C  CG    . GLN B 1 288 ? 1.534   -26.080 86.305  1.00 183.77 ? 267 GLN B CG    1 
ATOM   6462  C  CD    . GLN B 1 288 ? 1.893   -26.837 87.564  1.00 193.53 ? 267 GLN B CD    1 
ATOM   6463  O  OE1   . GLN B 1 288 ? 3.033   -27.249 87.764  1.00 189.40 ? 267 GLN B OE1   1 
ATOM   6464  N  NE2   . GLN B 1 288 ? 0.897   -27.030 88.429  1.00 200.06 ? 267 GLN B NE2   1 
ATOM   6465  N  N     . HIS B 1 289 ? -2.508  -26.788 84.428  1.00 175.01 ? 268 HIS B N     1 
ATOM   6466  C  CA    . HIS B 1 289 ? -3.659  -27.559 83.974  1.00 177.71 ? 268 HIS B CA    1 
ATOM   6467  C  C     . HIS B 1 289 ? -4.075  -27.169 82.559  1.00 180.47 ? 268 HIS B C     1 
ATOM   6468  O  O     . HIS B 1 289 ? -4.624  -28.006 81.832  1.00 160.69 ? 268 HIS B O     1 
ATOM   6469  C  CB    . HIS B 1 289 ? -4.817  -27.410 84.944  1.00 188.98 ? 268 HIS B CB    1 
ATOM   6470  C  CG    . HIS B 1 289 ? -6.020  -28.206 84.554  1.00 206.84 ? 268 HIS B CG    1 
ATOM   6471  N  ND1   . HIS B 1 289 ? -7.087  -27.663 83.873  1.00 227.37 ? 268 HIS B ND1   1 
ATOM   6472  C  CD2   . HIS B 1 289 ? -6.324  -29.510 84.757  1.00 200.10 ? 268 HIS B CD2   1 
ATOM   6473  C  CE1   . HIS B 1 289 ? -7.998  -28.600 83.673  1.00 232.50 ? 268 HIS B CE1   1 
ATOM   6474  N  NE2   . HIS B 1 289 ? -7.559  -29.730 84.199  1.00 213.71 ? 268 HIS B NE2   1 
ATOM   6475  N  N     . CYS B 1 290 ? -3.864  -25.903 82.166  1.00 187.06 ? 269 CYS B N     1 
ATOM   6476  C  CA    . CYS B 1 290 ? -4.069  -25.522 80.769  1.00 174.99 ? 269 CYS B CA    1 
ATOM   6477  C  C     . CYS B 1 290 ? -3.299  -26.469 79.861  1.00 156.45 ? 269 CYS B C     1 
ATOM   6478  O  O     . CYS B 1 290 ? -3.841  -26.992 78.883  1.00 175.82 ? 269 CYS B O     1 
ATOM   6479  C  CB    . CYS B 1 290 ? -3.634  -24.071 80.515  1.00 168.06 ? 269 CYS B CB    1 
ATOM   6480  S  SG    . CYS B 1 290 ? -4.714  -22.733 81.141  1.00 171.11 ? 269 CYS B SG    1 
ATOM   6481  N  N     . GLU B 1 291 ? -2.034  -26.723 80.190  1.00 140.91 ? 270 GLU B N     1 
ATOM   6482  C  CA    . GLU B 1 291 ? -1.243  -27.689 79.433  1.00 181.91 ? 270 GLU B CA    1 
ATOM   6483  C  C     . GLU B 1 291 ? -1.883  -29.082 79.482  1.00 187.80 ? 270 GLU B C     1 
ATOM   6484  O  O     . GLU B 1 291 ? -1.689  -29.884 78.562  1.00 178.50 ? 270 GLU B O     1 
ATOM   6485  C  CB    . GLU B 1 291 ? 0.201   -27.674 79.962  1.00 180.19 ? 270 GLU B CB    1 
ATOM   6486  C  CG    . GLU B 1 291 ? 1.188   -26.908 79.042  1.00 169.60 ? 270 GLU B CG    1 
ATOM   6487  C  CD    . GLU B 1 291 ? 2.523   -26.568 79.708  1.00 146.53 ? 270 GLU B CD    1 
ATOM   6488  O  OE1   . GLU B 1 291 ? 2.555   -26.524 80.958  1.00 133.92 ? 270 GLU B OE1   1 
ATOM   6489  O  OE2   . GLU B 1 291 ? 3.526   -26.333 78.981  1.00 144.91 ? 270 GLU B OE2   1 
ATOM   6490  N  N     . LYS B 1 292 ? -2.643  -29.398 80.540  1.00 202.20 ? 271 LYS B N     1 
ATOM   6491  C  CA    . LYS B 1 292 ? -3.381  -30.663 80.536  1.00 200.32 ? 271 LYS B CA    1 
ATOM   6492  C  C     . LYS B 1 292 ? -4.576  -30.628 79.588  1.00 200.88 ? 271 LYS B C     1 
ATOM   6493  O  O     . LYS B 1 292 ? -4.901  -31.645 78.961  1.00 194.90 ? 271 LYS B O     1 
ATOM   6494  C  CB    . LYS B 1 292 ? -3.855  -31.024 81.949  1.00 196.99 ? 271 LYS B CB    1 
ATOM   6495  C  CG    . LYS B 1 292 ? -2.828  -31.755 82.799  1.00 184.99 ? 271 LYS B CG    1 
ATOM   6496  C  CD    . LYS B 1 292 ? -2.531  -33.131 82.188  1.00 179.82 ? 271 LYS B CD    1 
ATOM   6497  C  CE    . LYS B 1 292 ? -3.816  -33.877 81.775  1.00 165.61 ? 271 LYS B CE    1 
ATOM   6498  N  NZ    . LYS B 1 292 ? -3.898  -34.192 80.312  1.00 152.15 ? 271 LYS B NZ    1 
ATOM   6499  N  N     . GLN B 1 293 ? -5.198  -29.464 79.425  1.00 204.93 ? 272 GLN B N     1 
ATOM   6500  C  CA    . GLN B 1 293 ? -6.259  -29.262 78.449  1.00 196.25 ? 272 GLN B CA    1 
ATOM   6501  C  C     . GLN B 1 293 ? -5.708  -28.914 77.082  1.00 168.72 ? 272 GLN B C     1 
ATOM   6502  O  O     . GLN B 1 293 ? -6.475  -28.840 76.122  1.00 185.91 ? 272 GLN B O     1 
ATOM   6503  C  CB    . GLN B 1 293 ? -7.212  -28.145 78.910  1.00 206.86 ? 272 GLN B CB    1 
ATOM   6504  C  CG    . GLN B 1 293 ? -7.835  -28.381 80.265  1.00 200.10 ? 272 GLN B CG    1 
ATOM   6505  C  CD    . GLN B 1 293 ? -8.608  -29.675 80.310  1.00 185.24 ? 272 GLN B CD    1 
ATOM   6506  O  OE1   . GLN B 1 293 ? -8.391  -30.495 81.198  1.00 173.97 ? 272 GLN B OE1   1 
ATOM   6507  N  NE2   . GLN B 1 293 ? -9.527  -29.863 79.358  1.00 182.21 ? 272 GLN B NE2   1 
ATOM   6508  N  N     . ARG B 1 294 ? -4.393  -28.734 76.987  1.00 170.15 ? 273 ARG B N     1 
ATOM   6509  C  CA    . ARG B 1 294 ? -3.635  -28.346 75.797  1.00 162.06 ? 273 ARG B CA    1 
ATOM   6510  C  C     . ARG B 1 294 ? -3.875  -26.904 75.335  1.00 169.15 ? 273 ARG B C     1 
ATOM   6511  O  O     . ARG B 1 294 ? -3.652  -26.606 74.148  1.00 171.14 ? 273 ARG B O     1 
ATOM   6512  C  CB    . ARG B 1 294 ? -3.882  -29.304 74.618  1.00 157.26 ? 273 ARG B CB    1 
ATOM   6513  C  CG    . ARG B 1 294 ? -3.931  -30.775 74.992  1.00 155.79 ? 273 ARG B CG    1 
ATOM   6514  C  CD    . ARG B 1 294 ? -3.316  -31.630 73.910  1.00 157.81 ? 273 ARG B CD    1 
ATOM   6515  N  NE    . ARG B 1 294 ? -1.859  -31.589 74.006  1.00 155.30 ? 273 ARG B NE    1 
ATOM   6516  C  CZ    . ARG B 1 294 ? -1.059  -30.918 73.188  1.00 208.25 ? 273 ARG B CZ    1 
ATOM   6517  N  NH1   . ARG B 1 294 ? -1.572  -30.230 72.175  1.00 227.11 ? 273 ARG B NH1   1 
ATOM   6518  N  NH2   . ARG B 1 294 ? 0.258   -30.955 73.373  1.00 206.53 ? 273 ARG B NH2   1 
ATOM   6519  N  N     . ASP B 1 295 ? -4.305  -25.988 76.225  1.00 155.01 ? 274 ASP B N     1 
ATOM   6520  C  CA    . ASP B 1 295 ? -4.426  -24.576 75.839  1.00 157.30 ? 274 ASP B CA    1 
ATOM   6521  C  C     . ASP B 1 295 ? -3.108  -23.897 76.167  1.00 162.11 ? 274 ASP B C     1 
ATOM   6522  O  O     . ASP B 1 295 ? -2.905  -23.407 77.275  1.00 182.60 ? 274 ASP B O     1 
ATOM   6523  C  CB    . ASP B 1 295 ? -5.582  -23.914 76.579  1.00 157.57 ? 274 ASP B CB    1 
ATOM   6524  C  CG    . ASP B 1 295 ? -5.951  -22.554 75.997  1.00 205.04 ? 274 ASP B CG    1 
ATOM   6525  O  OD1   . ASP B 1 295 ? -7.144  -22.166 76.092  1.00 222.81 ? 274 ASP B OD1   1 
ATOM   6526  O  OD2   . ASP B 1 295 ? -5.070  -21.891 75.404  1.00 216.08 ? 274 ASP B OD2   1 
ATOM   6527  N  N     . PHE B 1 296 ? -2.230  -23.808 75.155  1.00 161.00 ? 275 PHE B N     1 
ATOM   6528  C  CA    . PHE B 1 296 ? -0.886  -23.251 75.308  1.00 154.82 ? 275 PHE B CA    1 
ATOM   6529  C  C     . PHE B 1 296 ? -0.810  -21.743 75.103  1.00 156.79 ? 275 PHE B C     1 
ATOM   6530  O  O     . PHE B 1 296 ? 0.063   -21.093 75.692  1.00 154.72 ? 275 PHE B O     1 
ATOM   6531  C  CB    . PHE B 1 296 ? 0.105   -23.942 74.361  1.00 155.62 ? 275 PHE B CB    1 
ATOM   6532  C  CG    . PHE B 1 296 ? 0.123   -25.443 74.476  1.00 154.06 ? 275 PHE B CG    1 
ATOM   6533  C  CD1   . PHE B 1 296 ? -0.066  -26.064 75.691  1.00 181.27 ? 275 PHE B CD1   1 
ATOM   6534  C  CD2   . PHE B 1 296 ? 0.349   -26.232 73.369  1.00 156.45 ? 275 PHE B CD2   1 
ATOM   6535  C  CE1   . PHE B 1 296 ? -0.043  -27.446 75.787  1.00 176.43 ? 275 PHE B CE1   1 
ATOM   6536  C  CE2   . PHE B 1 296 ? 0.362   -27.609 73.467  1.00 161.26 ? 275 PHE B CE2   1 
ATOM   6537  C  CZ    . PHE B 1 296 ? 0.169   -28.210 74.673  1.00 160.58 ? 275 PHE B CZ    1 
ATOM   6538  N  N     . ASP B 1 297 ? -1.644  -21.174 74.224  1.00 161.08 ? 276 ASP B N     1 
ATOM   6539  C  CA    . ASP B 1 297 ? -1.581  -19.731 74.014  1.00 171.83 ? 276 ASP B CA    1 
ATOM   6540  C  C     . ASP B 1 297 ? -1.954  -18.987 75.286  1.00 190.34 ? 276 ASP B C     1 
ATOM   6541  O  O     . ASP B 1 297 ? -1.398  -17.921 75.576  1.00 203.56 ? 276 ASP B O     1 
ATOM   6542  C  CB    . ASP B 1 297 ? -2.456  -19.302 72.837  1.00 176.17 ? 276 ASP B CB    1 
ATOM   6543  C  CG    . ASP B 1 297 ? -1.807  -19.596 71.482  1.00 183.28 ? 276 ASP B CG    1 
ATOM   6544  O  OD1   . ASP B 1 297 ? -0.592  -19.890 71.418  1.00 169.74 ? 276 ASP B OD1   1 
ATOM   6545  O  OD2   . ASP B 1 297 ? -2.528  -19.499 70.458  1.00 230.82 ? 276 ASP B OD2   1 
ATOM   6546  N  N     . LEU B 1 298 ? -2.912  -19.519 76.044  1.00 197.69 ? 277 LEU B N     1 
ATOM   6547  C  CA    . LEU B 1 298 ? -3.208  -18.939 77.348  1.00 199.31 ? 277 LEU B CA    1 
ATOM   6548  C  C     . LEU B 1 298 ? -2.187  -19.395 78.395  1.00 170.88 ? 277 LEU B C     1 
ATOM   6549  O  O     . LEU B 1 298 ? -1.750  -18.594 79.232  1.00 157.44 ? 277 LEU B O     1 
ATOM   6550  C  CB    . LEU B 1 298 ? -4.624  -19.319 77.781  1.00 188.35 ? 277 LEU B CB    1 
ATOM   6551  C  CG    . LEU B 1 298 ? -5.167  -18.675 79.053  1.00 168.40 ? 277 LEU B CG    1 
ATOM   6552  C  CD1   . LEU B 1 298 ? -5.211  -17.142 78.912  1.00 158.14 ? 277 LEU B CD1   1 
ATOM   6553  C  CD2   . LEU B 1 298 ? -6.508  -19.288 79.388  1.00 159.02 ? 277 LEU B CD2   1 
ATOM   6554  N  N     . ALA B 1 299 ? -1.789  -20.674 78.357  1.00 176.33 ? 278 ALA B N     1 
ATOM   6555  C  CA    . ALA B 1 299 ? -0.779  -21.171 79.287  1.00 151.10 ? 278 ALA B CA    1 
ATOM   6556  C  C     . ALA B 1 299 ? 0.483   -20.318 79.240  1.00 145.77 ? 278 ALA B C     1 
ATOM   6557  O  O     . ALA B 1 299 ? 0.918   -19.786 80.264  1.00 143.45 ? 278 ALA B O     1 
ATOM   6558  C  CB    . ALA B 1 299 ? -0.456  -22.640 78.986  1.00 145.03 ? 278 ALA B CB    1 
ATOM   6559  N  N     . GLN B 1 300 ? 1.059   -20.137 78.051  1.00 148.34 ? 279 GLN B N     1 
ATOM   6560  C  CA    . GLN B 1 300 ? 2.227   -19.267 77.925  1.00 151.79 ? 279 GLN B CA    1 
ATOM   6561  C  C     . GLN B 1 300 ? 1.943   -17.877 78.472  1.00 157.59 ? 279 GLN B C     1 
ATOM   6562  O  O     . GLN B 1 300 ? 2.713   -17.348 79.286  1.00 173.74 ? 279 GLN B O     1 
ATOM   6563  C  CB    . GLN B 1 300 ? 2.677   -19.146 76.469  1.00 152.00 ? 279 GLN B CB    1 
ATOM   6564  C  CG    . GLN B 1 300 ? 3.789   -18.097 76.294  1.00 152.78 ? 279 GLN B CG    1 
ATOM   6565  C  CD    . GLN B 1 300 ? 3.331   -16.797 75.689  1.00 156.75 ? 279 GLN B CD    1 
ATOM   6566  O  OE1   . GLN B 1 300 ? 2.151   -16.614 75.404  1.00 159.01 ? 279 GLN B OE1   1 
ATOM   6567  N  NE2   . GLN B 1 300 ? 4.267   -15.873 75.502  1.00 157.82 ? 279 GLN B NE2   1 
ATOM   6568  N  N     . ARG B 1 301 ? 0.834   -17.267 78.030  1.00 174.68 ? 280 ARG B N     1 
ATOM   6569  C  CA    . ARG B 1 301 ? 0.529   -15.889 78.405  1.00 153.85 ? 280 ARG B CA    1 
ATOM   6570  C  C     . ARG B 1 301 ? 0.498   -15.739 79.918  1.00 165.52 ? 280 ARG B C     1 
ATOM   6571  O  O     . ARG B 1 301 ? 0.873   -14.683 80.449  1.00 150.36 ? 280 ARG B O     1 
ATOM   6572  C  CB    . ARG B 1 301 ? -0.787  -15.461 77.755  1.00 157.73 ? 280 ARG B CB    1 
ATOM   6573  C  CG    . ARG B 1 301 ? -1.375  -14.132 78.226  1.00 177.04 ? 280 ARG B CG    1 
ATOM   6574  C  CD    . ARG B 1 301 ? -2.762  -13.926 77.625  1.00 163.10 ? 280 ARG B CD    1 
ATOM   6575  N  NE    . ARG B 1 301 ? -2.741  -14.267 76.208  1.00 178.43 ? 280 ARG B NE    1 
ATOM   6576  C  CZ    . ARG B 1 301 ? -3.786  -14.712 75.519  1.00 202.99 ? 280 ARG B CZ    1 
ATOM   6577  N  NH1   . ARG B 1 301 ? -3.649  -14.997 74.230  1.00 217.21 ? 280 ARG B NH1   1 
ATOM   6578  N  NH2   . ARG B 1 301 ? -4.962  -14.880 76.112  1.00 224.58 ? 280 ARG B NH2   1 
ATOM   6579  N  N     . LEU B 1 302 ? 0.099   -16.801 80.624  1.00 166.21 ? 281 LEU B N     1 
ATOM   6580  C  CA    . LEU B 1 302 ? 0.146   -16.814 82.082  1.00 176.10 ? 281 LEU B CA    1 
ATOM   6581  C  C     . LEU B 1 302 ? 1.580   -17.005 82.581  1.00 160.97 ? 281 LEU B C     1 
ATOM   6582  O  O     . LEU B 1 302 ? 2.035   -16.277 83.470  1.00 168.27 ? 281 LEU B O     1 
ATOM   6583  C  CB    . LEU B 1 302 ? -0.777  -17.914 82.623  1.00 166.21 ? 281 LEU B CB    1 
ATOM   6584  C  CG    . LEU B 1 302 ? -2.279  -17.659 82.479  1.00 147.42 ? 281 LEU B CG    1 
ATOM   6585  C  CD1   . LEU B 1 302 ? -3.064  -18.931 82.728  1.00 154.18 ? 281 LEU B CD1   1 
ATOM   6586  C  CD2   . LEU B 1 302 ? -2.664  -16.606 83.481  1.00 144.45 ? 281 LEU B CD2   1 
ATOM   6587  N  N     . TYR B 1 303 ? 2.307   -17.965 81.994  1.00 145.61 ? 282 TYR B N     1 
ATOM   6588  C  CA    . TYR B 1 303 ? 3.673   -18.263 82.419  1.00 137.95 ? 282 TYR B CA    1 
ATOM   6589  C  C     . TYR B 1 303 ? 4.576   -17.040 82.395  1.00 139.51 ? 282 TYR B C     1 
ATOM   6590  O  O     . TYR B 1 303 ? 5.479   -16.922 83.233  1.00 159.09 ? 282 TYR B O     1 
ATOM   6591  C  CB    . TYR B 1 303 ? 4.278   -19.352 81.552  1.00 137.90 ? 282 TYR B CB    1 
ATOM   6592  C  CG    . TYR B 1 303 ? 3.807   -20.740 81.842  1.00 135.98 ? 282 TYR B CG    1 
ATOM   6593  C  CD1   . TYR B 1 303 ? 3.801   -21.237 83.123  1.00 132.72 ? 282 TYR B CD1   1 
ATOM   6594  C  CD2   . TYR B 1 303 ? 3.449   -21.588 80.814  1.00 137.63 ? 282 TYR B CD2   1 
ATOM   6595  C  CE1   . TYR B 1 303 ? 3.404   -22.550 83.382  1.00 131.16 ? 282 TYR B CE1   1 
ATOM   6596  C  CE2   . TYR B 1 303 ? 3.055   -22.895 81.054  1.00 136.12 ? 282 TYR B CE2   1 
ATOM   6597  C  CZ    . TYR B 1 303 ? 3.034   -23.378 82.337  1.00 132.88 ? 282 TYR B CZ    1 
ATOM   6598  O  OH    . TYR B 1 303 ? 2.643   -24.688 82.560  1.00 131.65 ? 282 TYR B OH    1 
ATOM   6599  N  N     . ARG B 1 304 ? 4.414   -16.168 81.394  1.00 142.63 ? 283 ARG B N     1 
ATOM   6600  C  CA    . ARG B 1 304 ? 5.297   -15.006 81.303  1.00 148.81 ? 283 ARG B CA    1 
ATOM   6601  C  C     . ARG B 1 304 ? 5.101   -14.065 82.485  1.00 155.02 ? 283 ARG B C     1 
ATOM   6602  O  O     . ARG B 1 304 ? 6.070   -13.476 82.980  1.00 179.23 ? 283 ARG B O     1 
ATOM   6603  C  CB    . ARG B 1 304 ? 5.109   -14.258 79.974  1.00 154.56 ? 283 ARG B CB    1 
ATOM   6604  C  CG    . ARG B 1 304 ? 5.467   -15.077 78.734  1.00 149.76 ? 283 ARG B CG    1 
ATOM   6605  C  CD    . ARG B 1 304 ? 7.003   -15.152 78.565  1.00 155.82 ? 283 ARG B CD    1 
ATOM   6606  N  NE    . ARG B 1 304 ? 7.583   -13.974 77.945  1.00 152.15 ? 283 ARG B NE    1 
ATOM   6607  C  CZ    . ARG B 1 304 ? 7.500   -13.711 76.652  1.00 155.93 ? 283 ARG B CZ    1 
ATOM   6608  N  NH1   . ARG B 1 304 ? 6.847   -14.534 75.839  1.00 157.05 ? 283 ARG B NH1   1 
ATOM   6609  N  NH2   . ARG B 1 304 ? 8.068   -12.619 76.179  1.00 158.83 ? 283 ARG B NH2   1 
ATOM   6610  N  N     . GLN B 1 305 ? 3.865   -13.939 82.974  1.00 156.24 ? 284 GLN B N     1 
ATOM   6611  C  CA    . GLN B 1 305 ? 3.537   -13.072 84.107  1.00 165.62 ? 284 GLN B CA    1 
ATOM   6612  C  C     . GLN B 1 305 ? 3.535   -13.807 85.447  1.00 152.17 ? 284 GLN B C     1 
ATOM   6613  O  O     . GLN B 1 305 ? 3.043   -13.276 86.455  1.00 148.52 ? 284 GLN B O     1 
ATOM   6614  C  CB    . GLN B 1 305 ? 2.216   -12.360 83.867  1.00 178.87 ? 284 GLN B CB    1 
ATOM   6615  C  CG    . GLN B 1 305 ? 1.012   -13.234 83.903  1.00 179.26 ? 284 GLN B CG    1 
ATOM   6616  C  CD    . GLN B 1 305 ? -0.180  -12.463 83.453  1.00 175.27 ? 284 GLN B CD    1 
ATOM   6617  O  OE1   . GLN B 1 305 ? -0.254  -11.247 83.654  1.00 180.11 ? 284 GLN B OE1   1 
ATOM   6618  N  NE2   . GLN B 1 305 ? -1.113  -13.143 82.809  1.00 178.29 ? 284 GLN B NE2   1 
ATOM   6619  N  N     . SER B 1 306 ? 4.024   -15.029 85.459  1.00 150.96 ? 285 SER B N     1 
ATOM   6620  C  CA    . SER B 1 306 ? 4.316   -15.738 86.687  1.00 152.83 ? 285 SER B CA    1 
ATOM   6621  C  C     . SER B 1 306 ? 5.814   -15.535 86.895  1.00 155.23 ? 285 SER B C     1 
ATOM   6622  O  O     . SER B 1 306 ? 6.611   -15.794 85.984  1.00 169.99 ? 285 SER B O     1 
ATOM   6623  C  CB    . SER B 1 306 ? 3.923   -17.219 86.537  1.00 152.83 ? 285 SER B CB    1 
ATOM   6624  O  OG    . SER B 1 306 ? 4.549   -18.137 87.427  1.00 127.95 ? 285 SER B OG    1 
ATOM   6625  N  N     . SER B 1 307 ? 6.179   -14.956 88.042  1.00 145.89 ? 286 SER B N     1 
ATOM   6626  C  CA    . SER B 1 307 ? 7.562   -14.792 88.473  1.00 129.74 ? 286 SER B CA    1 
ATOM   6627  C  C     . SER B 1 307 ? 8.034   -15.974 89.322  1.00 126.39 ? 286 SER B C     1 
ATOM   6628  O  O     . SER B 1 307 ? 9.118   -15.925 89.912  1.00 139.75 ? 286 SER B O     1 
ATOM   6629  C  CB    . SER B 1 307 ? 7.737   -13.441 89.169  1.00 130.95 ? 286 SER B CB    1 
ATOM   6630  O  OG    . SER B 1 307 ? 6.924   -13.328 90.310  1.00 155.86 ? 286 SER B OG    1 
ATOM   6631  N  N     . HIS B 1 308 ? 7.201   -17.007 89.415  1.00 125.02 ? 287 HIS B N     1 
ATOM   6632  C  CA    . HIS B 1 308 ? 7.502   -18.270 90.069  1.00 122.20 ? 287 HIS B CA    1 
ATOM   6633  C  C     . HIS B 1 308 ? 8.727   -18.899 89.412  1.00 138.08 ? 287 HIS B C     1 
ATOM   6634  O  O     . HIS B 1 308 ? 8.978   -18.698 88.221  1.00 145.17 ? 287 HIS B O     1 
ATOM   6635  C  CB    . HIS B 1 308 ? 6.301   -19.208 89.886  1.00 126.03 ? 287 HIS B CB    1 
ATOM   6636  C  CG    . HIS B 1 308 ? 6.277   -20.423 90.760  1.00 119.10 ? 287 HIS B CG    1 
ATOM   6637  N  ND1   . HIS B 1 308 ? 6.886   -21.605 90.396  1.00 156.45 ? 287 HIS B ND1   1 
ATOM   6638  C  CD2   . HIS B 1 308 ? 5.582   -20.695 91.887  1.00 117.68 ? 287 HIS B CD2   1 
ATOM   6639  C  CE1   . HIS B 1 308 ? 6.642   -22.528 91.310  1.00 142.06 ? 287 HIS B CE1   1 
ATOM   6640  N  NE2   . HIS B 1 308 ? 5.845   -22.003 92.222  1.00 130.89 ? 287 HIS B NE2   1 
ATOM   6641  N  N     . PRO B 1 309 ? 9.536   -19.622 90.171  1.00 140.76 ? 288 PRO B N     1 
ATOM   6642  C  CA    . PRO B 1 309 ? 10.673  -20.323 89.563  1.00 153.00 ? 288 PRO B CA    1 
ATOM   6643  C  C     . PRO B 1 309 ? 10.213  -21.408 88.601  1.00 156.95 ? 288 PRO B C     1 
ATOM   6644  O  O     . PRO B 1 309 ? 9.381   -22.258 88.943  1.00 131.30 ? 288 PRO B O     1 
ATOM   6645  C  CB    . PRO B 1 309 ? 11.410  -20.899 90.771  1.00 139.14 ? 288 PRO B CB    1 
ATOM   6646  C  CG    . PRO B 1 309 ? 11.088  -19.940 91.855  1.00 128.62 ? 288 PRO B CG    1 
ATOM   6647  C  CD    . PRO B 1 309 ? 9.694   -19.469 91.621  1.00 129.79 ? 288 PRO B CD    1 
ATOM   6648  N  N     . GLY B 1 310 ? 10.815  -21.405 87.408  1.00 163.47 ? 289 GLY B N     1 
ATOM   6649  C  CA    . GLY B 1 310 ? 10.453  -22.321 86.350  1.00 150.64 ? 289 GLY B CA    1 
ATOM   6650  C  C     . GLY B 1 310 ? 9.260   -21.919 85.514  1.00 136.37 ? 289 GLY B C     1 
ATOM   6651  O  O     . GLY B 1 310 ? 8.775   -22.734 84.722  1.00 134.40 ? 289 GLY B O     1 
ATOM   6652  N  N     . ALA B 1 311 ? 8.745   -20.701 85.664  1.00 129.63 ? 290 ALA B N     1 
ATOM   6653  C  CA    . ALA B 1 311 ? 7.719   -20.266 84.721  1.00 141.91 ? 290 ALA B CA    1 
ATOM   6654  C  C     . ALA B 1 311 ? 8.327   -19.967 83.362  1.00 132.19 ? 290 ALA B C     1 
ATOM   6655  O  O     . ALA B 1 311 ? 7.870   -20.503 82.357  1.00 156.81 ? 290 ALA B O     1 
ATOM   6656  C  CB    . ALA B 1 311 ? 6.958   -19.048 85.241  1.00 150.34 ? 290 ALA B CB    1 
ATOM   6657  N  N     . ARG B 1 312 ? 9.410   -19.190 83.319  1.00 131.35 ? 291 ARG B N     1 
ATOM   6658  C  CA    . ARG B 1 312 ? 10.057  -18.884 82.045  1.00 134.01 ? 291 ARG B CA    1 
ATOM   6659  C  C     . ARG B 1 312 ? 10.362  -20.134 81.224  1.00 133.95 ? 291 ARG B C     1 
ATOM   6660  O  O     . ARG B 1 312 ? 10.197  -20.149 79.993  1.00 136.64 ? 291 ARG B O     1 
ATOM   6661  C  CB    . ARG B 1 312 ? 11.324  -18.109 82.313  1.00 134.12 ? 291 ARG B CB    1 
ATOM   6662  C  CG    . ARG B 1 312 ? 12.076  -17.789 81.082  1.00 136.87 ? 291 ARG B CG    1 
ATOM   6663  C  CD    . ARG B 1 312 ? 13.479  -17.541 81.497  1.00 136.09 ? 291 ARG B CD    1 
ATOM   6664  N  NE    . ARG B 1 312 ? 13.815  -16.145 81.284  1.00 140.37 ? 291 ARG B NE    1 
ATOM   6665  C  CZ    . ARG B 1 312 ? 14.768  -15.503 81.941  1.00 145.61 ? 291 ARG B CZ    1 
ATOM   6666  N  NH1   . ARG B 1 312 ? 15.469  -16.128 82.883  1.00 135.49 ? 291 ARG B NH1   1 
ATOM   6667  N  NH2   . ARG B 1 312 ? 14.993  -14.227 81.661  1.00 154.66 ? 291 ARG B NH2   1 
ATOM   6668  N  N     . LEU B 1 313 ? 10.801  -21.195 81.896  1.00 140.26 ? 292 LEU B N     1 
ATOM   6669  C  CA    . LEU B 1 313 ? 11.040  -22.472 81.228  1.00 131.43 ? 292 LEU B CA    1 
ATOM   6670  C  C     . LEU B 1 313 ? 9.733   -23.053 80.689  1.00 132.08 ? 292 LEU B C     1 
ATOM   6671  O  O     . LEU B 1 313 ? 9.649   -23.490 79.530  1.00 134.23 ? 292 LEU B O     1 
ATOM   6672  C  CB    . LEU B 1 313 ? 11.705  -23.440 82.216  1.00 127.79 ? 292 LEU B CB    1 
ATOM   6673  C  CG    . LEU B 1 313 ? 12.633  -24.555 81.771  1.00 127.36 ? 292 LEU B CG    1 
ATOM   6674  C  CD1   . LEU B 1 313 ? 13.712  -23.993 80.888  1.00 129.39 ? 292 LEU B CD1   1 
ATOM   6675  C  CD2   . LEU B 1 313 ? 13.258  -25.145 83.016  1.00 154.43 ? 292 LEU B CD2   1 
ATOM   6676  N  N     . ARG B 1 314 ? 8.692   -23.046 81.521  1.00 130.85 ? 293 ARG B N     1 
ATOM   6677  C  CA    . ARG B 1 314 ? 7.402   -23.567 81.102  1.00 131.99 ? 293 ARG B CA    1 
ATOM   6678  C  C     . ARG B 1 314 ? 6.824   -22.785 79.931  1.00 135.71 ? 293 ARG B C     1 
ATOM   6679  O  O     . ARG B 1 314 ? 6.035   -23.336 79.163  1.00 137.52 ? 293 ARG B O     1 
ATOM   6680  C  CB    . ARG B 1 314 ? 6.451   -23.531 82.285  1.00 130.15 ? 293 ARG B CB    1 
ATOM   6681  C  CG    . ARG B 1 314 ? 6.790   -24.503 83.331  1.00 126.97 ? 293 ARG B CG    1 
ATOM   6682  C  CD    . ARG B 1 314 ? 7.109   -25.846 82.733  1.00 136.97 ? 293 ARG B CD    1 
ATOM   6683  N  NE    . ARG B 1 314 ? 5.927   -26.484 82.160  1.00 128.44 ? 293 ARG B NE    1 
ATOM   6684  C  CZ    . ARG B 1 314 ? 5.970   -27.603 81.449  1.00 129.21 ? 293 ARG B CZ    1 
ATOM   6685  N  NH1   . ARG B 1 314 ? 7.128   -28.198 81.221  1.00 154.62 ? 293 ARG B NH1   1 
ATOM   6686  N  NH2   . ARG B 1 314 ? 4.865   -28.140 80.983  1.00 130.81 ? 293 ARG B NH2   1 
ATOM   6687  N  N     . ALA B 1 315 ? 7.161   -21.491 79.822  1.00 137.10 ? 294 ALA B N     1 
ATOM   6688  C  CA    . ALA B 1 315 ? 6.718   -20.648 78.714  1.00 140.96 ? 294 ALA B CA    1 
ATOM   6689  C  C     . ALA B 1 315 ? 7.436   -21.010 77.424  1.00 143.17 ? 294 ALA B C     1 
ATOM   6690  O  O     . ALA B 1 315 ? 6.801   -21.126 76.375  1.00 146.15 ? 294 ALA B O     1 
ATOM   6691  C  CB    . ALA B 1 315 ? 6.923   -19.170 79.043  1.00 141.89 ? 294 ALA B CB    1 
ATOM   6692  N  N     . ILE B 1 316 ? 8.765   -21.176 77.465  1.00 154.06 ? 295 ILE B N     1 
ATOM   6693  C  CA    . ILE B 1 316 ? 9.456   -21.652 76.260  1.00 144.08 ? 295 ILE B CA    1 
ATOM   6694  C  C     . ILE B 1 316 ? 8.883   -22.996 75.801  1.00 155.36 ? 295 ILE B C     1 
ATOM   6695  O  O     . ILE B 1 316 ? 8.569   -23.174 74.618  1.00 161.27 ? 295 ILE B O     1 
ATOM   6696  C  CB    . ILE B 1 316 ? 10.978  -21.736 76.488  1.00 142.61 ? 295 ILE B CB    1 
ATOM   6697  C  CG1   . ILE B 1 316 ? 11.563  -20.369 76.779  1.00 143.27 ? 295 ILE B CG1   1 
ATOM   6698  C  CG2   . ILE B 1 316 ? 11.700  -22.321 75.296  1.00 144.64 ? 295 ILE B CG2   1 
ATOM   6699  C  CD1   . ILE B 1 316 ? 12.927  -20.460 77.391  1.00 141.19 ? 295 ILE B CD1   1 
ATOM   6700  N  N     . ARG B 1 317 ? 8.757   -23.974 76.721  1.00 161.83 ? 296 ARG B N     1 
ATOM   6701  C  CA    . ARG B 1 317 ? 8.206   -25.285 76.340  1.00 148.98 ? 296 ARG B CA    1 
ATOM   6702  C  C     . ARG B 1 317 ? 6.725   -25.214 75.974  1.00 145.86 ? 296 ARG B C     1 
ATOM   6703  O  O     . ARG B 1 317 ? 6.226   -26.052 75.217  1.00 155.08 ? 296 ARG B O     1 
ATOM   6704  C  CB    . ARG B 1 317 ? 8.401   -26.323 77.447  1.00 149.75 ? 296 ARG B CB    1 
ATOM   6705  C  CG    . ARG B 1 317 ? 7.623   -27.636 77.189  1.00 152.63 ? 296 ARG B CG    1 
ATOM   6706  C  CD    . ARG B 1 317 ? 8.099   -28.360 75.916  1.00 150.34 ? 296 ARG B CD    1 
ATOM   6707  N  NE    . ARG B 1 317 ? 7.151   -29.360 75.414  1.00 151.33 ? 296 ARG B NE    1 
ATOM   6708  C  CZ    . ARG B 1 317 ? 7.335   -30.070 74.298  1.00 173.76 ? 296 ARG B CZ    1 
ATOM   6709  N  NH1   . ARG B 1 317 ? 8.432   -29.909 73.568  1.00 172.89 ? 296 ARG B NH1   1 
ATOM   6710  N  NH2   . ARG B 1 317 ? 6.429   -30.953 73.907  1.00 187.95 ? 296 ARG B NH2   1 
ATOM   6711  N  N     . SER B 1 318 ? 5.996   -24.254 76.515  1.00 143.24 ? 297 SER B N     1 
ATOM   6712  C  CA    . SER B 1 318 ? 4.607   -24.113 76.120  1.00 145.62 ? 297 SER B CA    1 
ATOM   6713  C  C     . SER B 1 318 ? 4.533   -23.619 74.676  1.00 150.05 ? 297 SER B C     1 
ATOM   6714  O  O     . SER B 1 318 ? 3.893   -24.250 73.824  1.00 152.52 ? 297 SER B O     1 
ATOM   6715  C  CB    . SER B 1 318 ? 3.908   -23.153 77.096  1.00 144.62 ? 297 SER B CB    1 
ATOM   6716  O  OG    . SER B 1 318 ? 2.506   -23.367 77.229  1.00 145.48 ? 297 SER B OG    1 
ATOM   6717  N  N     . LEU B 1 319 ? 5.258   -22.529 74.375  1.00 160.93 ? 298 LEU B N     1 
ATOM   6718  C  CA    . LEU B 1 319 ? 5.342   -21.990 73.015  1.00 155.65 ? 298 LEU B CA    1 
ATOM   6719  C  C     . LEU B 1 319 ? 5.836   -23.041 72.030  1.00 157.00 ? 298 LEU B C     1 
ATOM   6720  O  O     . LEU B 1 319 ? 5.342   -23.122 70.903  1.00 176.71 ? 298 LEU B O     1 
ATOM   6721  C  CB    . LEU B 1 319 ? 6.255   -20.756 72.972  1.00 156.37 ? 298 LEU B CB    1 
ATOM   6722  C  CG    . LEU B 1 319 ? 5.793   -19.396 73.511  1.00 156.92 ? 298 LEU B CG    1 
ATOM   6723  C  CD1   . LEU B 1 319 ? 6.985   -18.502 73.755  1.00 156.46 ? 298 LEU B CD1   1 
ATOM   6724  C  CD2   . LEU B 1 319 ? 4.852   -18.706 72.574  1.00 161.44 ? 298 LEU B CD2   1 
ATOM   6725  N  N     . GLU B 1 320 ? 6.843   -23.821 72.411  1.00 154.22 ? 299 GLU B N     1 
ATOM   6726  C  CA    . GLU B 1 320 ? 7.266   -24.912 71.543  1.00 155.44 ? 299 GLU B CA    1 
ATOM   6727  C  C     . GLU B 1 320 ? 6.107   -25.879 71.277  1.00 160.45 ? 299 GLU B C     1 
ATOM   6728  O  O     . GLU B 1 320 ? 5.858   -26.242 70.119  1.00 160.70 ? 299 GLU B O     1 
ATOM   6729  C  CB    . GLU B 1 320 ? 8.474   -25.611 72.167  1.00 152.05 ? 299 GLU B CB    1 
ATOM   6730  C  CG    . GLU B 1 320 ? 9.250   -26.557 71.279  1.00 153.35 ? 299 GLU B CG    1 
ATOM   6731  C  CD    . GLU B 1 320 ? 10.052  -27.567 72.096  1.00 178.69 ? 299 GLU B CD    1 
ATOM   6732  O  OE1   . GLU B 1 320 ? 10.273  -27.302 73.291  1.00 182.43 ? 299 GLU B OE1   1 
ATOM   6733  O  OE2   . GLU B 1 320 ? 10.460  -28.624 71.566  1.00 184.14 ? 299 GLU B OE2   1 
ATOM   6734  N  N     . ARG B 1 321 ? 5.331   -26.237 72.319  1.00 166.32 ? 300 ARG B N     1 
ATOM   6735  C  CA    . ARG B 1 321 ? 4.235   -27.196 72.142  1.00 154.87 ? 300 ARG B CA    1 
ATOM   6736  C  C     . ARG B 1 321 ? 3.118   -26.656 71.284  1.00 159.07 ? 300 ARG B C     1 
ATOM   6737  O  O     . ARG B 1 321 ? 2.399   -27.439 70.656  1.00 161.39 ? 300 ARG B O     1 
ATOM   6738  C  CB    . ARG B 1 321 ? 3.630   -27.631 73.471  1.00 151.35 ? 300 ARG B CB    1 
ATOM   6739  C  CG    . ARG B 1 321 ? 4.008   -29.015 73.828  1.00 149.20 ? 300 ARG B CG    1 
ATOM   6740  C  CD    . ARG B 1 321 ? 3.855   -29.275 75.281  1.00 145.21 ? 300 ARG B CD    1 
ATOM   6741  N  NE    . ARG B 1 321 ? 2.525   -29.764 75.604  1.00 145.58 ? 300 ARG B NE    1 
ATOM   6742  C  CZ    . ARG B 1 321 ? 2.170   -30.174 76.817  1.00 152.48 ? 300 ARG B CZ    1 
ATOM   6743  N  NH1   . ARG B 1 321 ? 3.054   -30.155 77.798  1.00 168.13 ? 300 ARG B NH1   1 
ATOM   6744  N  NH2   . ARG B 1 321 ? 0.952   -30.636 77.049  1.00 143.29 ? 300 ARG B NH2   1 
ATOM   6745  N  N     . GLY B 1 322 ? 2.926   -25.345 71.293  1.00 160.22 ? 301 GLY B N     1 
ATOM   6746  C  CA    . GLY B 1 322 ? 2.006   -24.593 70.456  1.00 164.57 ? 301 GLY B CA    1 
ATOM   6747  C  C     . GLY B 1 322 ? 2.552   -24.176 69.108  1.00 168.65 ? 301 GLY B C     1 
ATOM   6748  O  O     . GLY B 1 322 ? 2.023   -23.247 68.489  1.00 172.24 ? 301 GLY B O     1 
ATOM   6749  N  N     . GLU B 1 323 ? 3.661   -24.787 68.695  1.00 181.23 ? 302 GLU B N     1 
ATOM   6750  C  CA    . GLU B 1 323 ? 4.248   -24.625 67.370  1.00 182.24 ? 302 GLU B CA    1 
ATOM   6751  C  C     . GLU B 1 323 ? 4.584   -23.173 67.018  1.00 182.37 ? 302 GLU B C     1 
ATOM   6752  O  O     . GLU B 1 323 ? 4.604   -22.803 65.838  1.00 191.68 ? 302 GLU B O     1 
ATOM   6753  C  CB    . GLU B 1 323 ? 3.363   -25.296 66.312  1.00 177.67 ? 302 GLU B CB    1 
ATOM   6754  C  CG    . GLU B 1 323 ? 3.163   -26.772 66.672  1.00 181.62 ? 302 GLU B CG    1 
ATOM   6755  C  CD    . GLU B 1 323 ? 2.479   -27.591 65.601  1.00 217.86 ? 302 GLU B CD    1 
ATOM   6756  O  OE1   . GLU B 1 323 ? 1.865   -27.007 64.672  1.00 245.86 ? 302 GLU B OE1   1 
ATOM   6757  O  OE2   . GLU B 1 323 ? 2.578   -28.837 65.698  1.00 215.88 ? 302 GLU B OE2   1 
ATOM   6758  N  N     . ARG B 1 324 ? 4.863   -22.342 68.026  1.00 171.40 ? 303 ARG B N     1 
ATOM   6759  C  CA    . ARG B 1 324 ? 5.452   -21.027 67.790  1.00 173.06 ? 303 ARG B CA    1 
ATOM   6760  C  C     . ARG B 1 324 ? 6.929   -21.200 68.128  1.00 170.29 ? 303 ARG B C     1 
ATOM   6761  O  O     . ARG B 1 324 ? 7.365   -20.948 69.247  1.00 166.55 ? 303 ARG B O     1 
ATOM   6762  C  CB    . ARG B 1 324 ? 4.804   -20.008 68.707  1.00 171.93 ? 303 ARG B CB    1 
ATOM   6763  C  CG    . ARG B 1 324 ? 3.319   -20.111 68.664  1.00 173.57 ? 303 ARG B CG    1 
ATOM   6764  C  CD    . ARG B 1 324 ? 2.641   -19.448 69.841  1.00 171.31 ? 303 ARG B CD    1 
ATOM   6765  N  NE    . ARG B 1 324 ? 2.948   -18.026 69.933  1.00 172.59 ? 303 ARG B NE    1 
ATOM   6766  C  CZ    . ARG B 1 324 ? 2.272   -17.172 70.690  1.00 172.16 ? 303 ARG B CZ    1 
ATOM   6767  N  NH1   . ARG B 1 324 ? 1.228   -17.586 71.399  1.00 170.54 ? 303 ARG B NH1   1 
ATOM   6768  N  NH2   . ARG B 1 324 ? 2.627   -15.899 70.721  1.00 173.63 ? 303 ARG B NH2   1 
ATOM   6769  N  N     . PHE B 1 325 ? 7.724   -21.544 67.134  1.00 172.49 ? 304 PHE B N     1 
ATOM   6770  C  CA    . PHE B 1 325 ? 9.093   -21.847 67.476  1.00 169.85 ? 304 PHE B CA    1 
ATOM   6771  C  C     . PHE B 1 325 ? 9.955   -20.610 67.498  1.00 170.62 ? 304 PHE B C     1 
ATOM   6772  O  O     . PHE B 1 325 ? 10.728  -20.426 68.433  1.00 167.28 ? 304 PHE B O     1 
ATOM   6773  C  CB    . PHE B 1 325 ? 9.609   -22.916 66.533  1.00 171.42 ? 304 PHE B CB    1 
ATOM   6774  C  CG    . PHE B 1 325 ? 8.788   -24.138 66.582  1.00 170.69 ? 304 PHE B CG    1 
ATOM   6775  C  CD1   . PHE B 1 325 ? 8.963   -25.059 67.568  1.00 166.40 ? 304 PHE B CD1   1 
ATOM   6776  C  CD2   . PHE B 1 325 ? 7.730   -24.288 65.738  1.00 174.41 ? 304 PHE B CD2   1 
ATOM   6777  C  CE1   . PHE B 1 325 ? 8.167   -26.168 67.653  1.00 165.89 ? 304 PHE B CE1   1 
ATOM   6778  C  CE2   . PHE B 1 325 ? 6.937   -25.398 65.818  1.00 173.91 ? 304 PHE B CE2   1 
ATOM   6779  C  CZ    . PHE B 1 325 ? 7.151   -26.335 66.793  1.00 169.59 ? 304 PHE B CZ    1 
ATOM   6780  N  N     . ALA B 1 326 ? 9.745   -19.692 66.562  1.00 175.11 ? 305 ALA B N     1 
ATOM   6781  C  CA    . ALA B 1 326 ? 10.576  -18.495 66.512  1.00 183.20 ? 305 ALA B CA    1 
ATOM   6782  C  C     . ALA B 1 326 ? 10.576  -17.800 67.865  1.00 180.17 ? 305 ALA B C     1 
ATOM   6783  O  O     . ALA B 1 326 ? 11.635  -17.459 68.405  1.00 180.54 ? 305 ALA B O     1 
ATOM   6784  C  CB    . ALA B 1 326 ? 10.074  -17.552 65.413  1.00 201.53 ? 305 ALA B CB    1 
ATOM   6785  N  N     . GLU B 1 327 ? 9.389   -17.618 68.445  1.00 194.51 ? 306 GLU B N     1 
ATOM   6786  C  CA    . GLU B 1 327 ? 9.289   -16.990 69.756  1.00 170.88 ? 306 GLU B CA    1 
ATOM   6787  C  C     . GLU B 1 327 ? 9.849   -17.893 70.848  1.00 163.82 ? 306 GLU B C     1 
ATOM   6788  O  O     . GLU B 1 327 ? 10.585  -17.418 71.716  1.00 161.50 ? 306 GLU B O     1 
ATOM   6789  C  CB    . GLU B 1 327 ? 7.838   -16.602 70.003  1.00 169.83 ? 306 GLU B CB    1 
ATOM   6790  C  CG    . GLU B 1 327 ? 7.369   -15.725 68.862  1.00 175.43 ? 306 GLU B CG    1 
ATOM   6791  C  CD    . GLU B 1 327 ? 5.896   -15.804 68.644  1.00 177.17 ? 306 GLU B CD    1 
ATOM   6792  O  OE1   . GLU B 1 327 ? 5.373   -16.934 68.718  1.00 184.95 ? 306 GLU B OE1   1 
ATOM   6793  O  OE2   . GLU B 1 327 ? 5.277   -14.758 68.350  1.00 180.51 ? 306 GLU B OE2   1 
ATOM   6794  N  N     . ALA B 1 328 ? 9.537   -19.198 70.813  1.00 162.26 ? 307 ALA B N     1 
ATOM   6795  C  CA    . ALA B 1 328 ? 10.106  -20.126 71.796  1.00 157.74 ? 307 ALA B CA    1 
ATOM   6796  C  C     . ALA B 1 328 ? 11.618  -20.011 71.804  1.00 157.01 ? 307 ALA B C     1 
ATOM   6797  O  O     . ALA B 1 328 ? 12.244  -19.915 72.865  1.00 157.29 ? 307 ALA B O     1 
ATOM   6798  C  CB    . ALA B 1 328 ? 9.677   -21.569 71.515  1.00 157.07 ? 307 ALA B CB    1 
ATOM   6799  N  N     . HIS B 1 329 ? 12.223  -20.060 70.620  1.00 160.13 ? 308 HIS B N     1 
ATOM   6800  C  CA    . HIS B 1 329 ? 13.660  -19.859 70.515  1.00 160.06 ? 308 HIS B CA    1 
ATOM   6801  C  C     . HIS B 1 329 ? 14.075  -18.465 70.958  1.00 160.57 ? 308 HIS B C     1 
ATOM   6802  O  O     . HIS B 1 329 ? 15.151  -18.293 71.542  1.00 176.18 ? 308 HIS B O     1 
ATOM   6803  C  CB    . HIS B 1 329 ? 14.149  -20.110 69.098  1.00 163.82 ? 308 HIS B CB    1 
ATOM   6804  C  CG    . HIS B 1 329 ? 15.526  -19.593 68.875  1.00 164.73 ? 308 HIS B CG    1 
ATOM   6805  N  ND1   . HIS B 1 329 ? 15.766  -18.387 68.255  1.00 168.33 ? 308 HIS B ND1   1 
ATOM   6806  C  CD2   . HIS B 1 329 ? 16.729  -20.051 69.293  1.00 164.19 ? 308 HIS B CD2   1 
ATOM   6807  C  CE1   . HIS B 1 329 ? 17.065  -18.155 68.246  1.00 179.54 ? 308 HIS B CE1   1 
ATOM   6808  N  NE2   . HIS B 1 329 ? 17.672  -19.147 68.875  1.00 177.45 ? 308 HIS B NE2   1 
ATOM   6809  N  N     . ALA B 1 330 ? 13.265  -17.450 70.660  1.00 163.28 ? 309 ALA B N     1 
ATOM   6810  C  CA    . ALA B 1 330 ? 13.630  -16.099 71.082  1.00 164.07 ? 309 ALA B CA    1 
ATOM   6811  C  C     . ALA B 1 330 ? 13.629  -15.978 72.602  1.00 160.54 ? 309 ALA B C     1 
ATOM   6812  O  O     . ALA B 1 330 ? 14.481  -15.292 73.178  1.00 159.25 ? 309 ALA B O     1 
ATOM   6813  C  CB    . ALA B 1 330 ? 12.692  -15.068 70.449  1.00 169.43 ? 309 ALA B CB    1 
ATOM   6814  N  N     . LEU B 1 331 ? 12.663  -16.609 73.268  1.00 164.36 ? 310 LEU B N     1 
ATOM   6815  C  CA    . LEU B 1 331 ? 12.669  -16.620 74.726  1.00 153.43 ? 310 LEU B CA    1 
ATOM   6816  C  C     . LEU B 1 331 ? 13.838  -17.450 75.242  1.00 156.42 ? 310 LEU B C     1 
ATOM   6817  O  O     . LEU B 1 331 ? 14.480  -17.069 76.222  1.00 181.09 ? 310 LEU B O     1 
ATOM   6818  C  CB    . LEU B 1 331 ? 11.329  -17.141 75.262  1.00 155.31 ? 310 LEU B CB    1 
ATOM   6819  C  CG    . LEU B 1 331 ? 10.927  -16.940 76.730  1.00 148.48 ? 310 LEU B CG    1 
ATOM   6820  C  CD1   . LEU B 1 331 ? 11.036  -15.478 77.087  1.00 149.91 ? 310 LEU B CD1   1 
ATOM   6821  C  CD2   . LEU B 1 331 ? 9.513   -17.480 77.011  1.00 147.63 ? 310 LEU B CD2   1 
ATOM   6822  N  N     . ALA B 1 332 ? 14.139  -18.578 74.582  1.00 150.37 ? 311 ALA B N     1 
ATOM   6823  C  CA    . ALA B 1 332 ? 15.232  -19.449 75.019  1.00 147.77 ? 311 ALA B CA    1 
ATOM   6824  C  C     . ALA B 1 332 ? 16.576  -18.709 75.028  1.00 157.72 ? 311 ALA B C     1 
ATOM   6825  O  O     . ALA B 1 332 ? 17.406  -18.914 75.929  1.00 164.26 ? 311 ALA B O     1 
ATOM   6826  C  CB    . ALA B 1 332 ? 15.277  -20.696 74.135  1.00 148.39 ? 311 ALA B CB    1 
ATOM   6827  N  N     . ARG B 1 333 ? 16.804  -17.840 74.037  1.00 161.31 ? 312 ARG B N     1 
ATOM   6828  C  CA    . ARG B 1 333 ? 17.989  -16.980 74.024  1.00 160.40 ? 312 ARG B CA    1 
ATOM   6829  C  C     . ARG B 1 333 ? 17.974  -16.017 75.224  1.00 171.44 ? 312 ARG B C     1 
ATOM   6830  O  O     . ARG B 1 333 ? 18.956  -15.920 75.989  1.00 175.45 ? 312 ARG B O     1 
ATOM   6831  C  CB    . ARG B 1 333 ? 18.011  -16.209 72.690  1.00 174.55 ? 312 ARG B CB    1 
ATOM   6832  C  CG    . ARG B 1 333 ? 19.364  -15.923 72.032  1.00 196.78 ? 312 ARG B CG    1 
ATOM   6833  C  CD    . ARG B 1 333 ? 19.773  -17.014 71.040  1.00 219.22 ? 312 ARG B CD    1 
ATOM   6834  N  NE    . ARG B 1 333 ? 20.760  -16.549 70.056  1.00 232.20 ? 312 ARG B NE    1 
ATOM   6835  C  CZ    . ARG B 1 333 ? 22.081  -16.714 70.154  1.00 214.39 ? 312 ARG B CZ    1 
ATOM   6836  N  NH1   . ARG B 1 333 ? 22.609  -17.347 71.194  1.00 179.82 ? 312 ARG B NH1   1 
ATOM   6837  N  NH2   . ARG B 1 333 ? 22.882  -16.249 69.199  1.00 214.83 ? 312 ARG B NH2   1 
ATOM   6838  N  N     . GLU B 1 334 ? 16.817  -15.367 75.457  1.00 160.91 ? 313 GLU B N     1 
ATOM   6839  C  CA    . GLU B 1 334 ? 16.658  -14.461 76.599  1.00 177.24 ? 313 GLU B CA    1 
ATOM   6840  C  C     . GLU B 1 334 ? 16.975  -15.173 77.904  1.00 183.95 ? 313 GLU B C     1 
ATOM   6841  O  O     . GLU B 1 334 ? 17.622  -14.605 78.794  1.00 192.74 ? 313 GLU B O     1 
ATOM   6842  C  CB    . GLU B 1 334 ? 15.226  -13.892 76.644  1.00 190.44 ? 313 GLU B CB    1 
ATOM   6843  C  CG    . GLU B 1 334 ? 14.955  -13.014 77.893  1.00 208.00 ? 313 GLU B CG    1 
ATOM   6844  C  CD    . GLU B 1 334 ? 13.532  -12.454 78.001  1.00 218.14 ? 313 GLU B CD    1 
ATOM   6845  O  OE1   . GLU B 1 334 ? 12.893  -12.171 76.961  1.00 222.01 ? 313 GLU B OE1   1 
ATOM   6846  O  OE2   . GLU B 1 334 ? 13.056  -12.305 79.156  1.00 214.76 ? 313 GLU B OE2   1 
ATOM   6847  N  N     . ALA B 1 335 ? 16.534  -16.425 78.026  1.00 199.37 ? 314 ALA B N     1 
ATOM   6848  C  CA    . ALA B 1 335 ? 16.799  -17.197 79.231  1.00 175.23 ? 314 ALA B CA    1 
ATOM   6849  C  C     . ALA B 1 335 ? 18.283  -17.495 79.379  1.00 145.82 ? 314 ALA B C     1 
ATOM   6850  O  O     . ALA B 1 335 ? 18.797  -17.483 80.499  1.00 143.62 ? 314 ALA B O     1 
ATOM   6851  C  CB    . ALA B 1 335 ? 15.977  -18.483 79.225  1.00 190.80 ? 314 ALA B CB    1 
ATOM   6852  N  N     . SER B 1 336 ? 18.988  -17.805 78.277  1.00 160.07 ? 315 SER B N     1 
ATOM   6853  C  CA    . SER B 1 336 ? 20.415  -18.084 78.453  1.00 161.08 ? 315 SER B CA    1 
ATOM   6854  C  C     . SER B 1 336 ? 21.236  -16.830 78.774  1.00 198.72 ? 315 SER B C     1 
ATOM   6855  O  O     . SER B 1 336 ? 22.403  -16.977 79.163  1.00 203.27 ? 315 SER B O     1 
ATOM   6856  C  CB    . SER B 1 336 ? 21.045  -18.768 77.231  1.00 150.15 ? 315 SER B CB    1 
ATOM   6857  O  OG    . SER B 1 336 ? 21.263  -17.872 76.152  1.00 152.91 ? 315 SER B OG    1 
ATOM   6858  N  N     . CYS B 1 337 ? 20.687  -15.606 78.611  1.00 193.72 ? 316 CYS B N     1 
ATOM   6859  C  CA    . CYS B 1 337 ? 21.451  -14.421 79.046  1.00 193.95 ? 316 CYS B CA    1 
ATOM   6860  C  C     . CYS B 1 337 ? 21.504  -14.259 80.569  1.00 184.43 ? 316 CYS B C     1 
ATOM   6861  O  O     . CYS B 1 337 ? 22.542  -13.865 81.115  1.00 177.41 ? 316 CYS B O     1 
ATOM   6862  C  CB    . CYS B 1 337 ? 20.885  -13.125 78.445  1.00 183.47 ? 316 CYS B CB    1 
ATOM   6863  S  SG    . CYS B 1 337 ? 21.312  -12.713 76.744  1.00 203.67 ? 316 CYS B SG    1 
ATOM   6864  N  N     . ALA B 1 338 ? 20.393  -14.501 81.264  1.00 196.55 ? 317 ALA B N     1 
ATOM   6865  C  CA    . ALA B 1 338 ? 20.307  -14.333 82.718  1.00 163.84 ? 317 ALA B CA    1 
ATOM   6866  C  C     . ALA B 1 338 ? 19.403  -15.416 83.281  1.00 152.58 ? 317 ALA B C     1 
ATOM   6867  O  O     . ALA B 1 338 ? 18.206  -15.183 83.515  1.00 136.28 ? 317 ALA B O     1 
ATOM   6868  C  CB    . ALA B 1 338 ? 19.778  -12.943 83.082  1.00 168.45 ? 317 ALA B CB    1 
ATOM   6869  N  N     . PRO B 1 339 ? 19.931  -16.633 83.475  1.00 134.40 ? 318 PRO B N     1 
ATOM   6870  C  CA    . PRO B 1 339 ? 19.058  -17.785 83.772  1.00 131.83 ? 318 PRO B CA    1 
ATOM   6871  C  C     . PRO B 1 339 ? 18.528  -17.758 85.203  1.00 129.39 ? 318 PRO B C     1 
ATOM   6872  O  O     . PRO B 1 339 ? 19.166  -17.216 86.103  1.00 129.03 ? 318 PRO B O     1 
ATOM   6873  C  CB    . PRO B 1 339 ? 19.976  -18.993 83.534  1.00 130.73 ? 318 PRO B CB    1 
ATOM   6874  C  CG    . PRO B 1 339 ? 21.229  -18.422 82.843  1.00 133.19 ? 318 PRO B CG    1 
ATOM   6875  C  CD    . PRO B 1 339 ? 21.346  -17.025 83.327  1.00 134.55 ? 318 PRO B CD    1 
ATOM   6876  N  N     . GLU B 1 340 ? 17.333  -18.331 85.415  1.00 127.94 ? 319 GLU B N     1 
ATOM   6877  C  CA    . GLU B 1 340 ? 16.759  -18.298 86.763  1.00 125.83 ? 319 GLU B CA    1 
ATOM   6878  C  C     . GLU B 1 340 ? 17.565  -19.127 87.755  1.00 123.43 ? 319 GLU B C     1 
ATOM   6879  O  O     . GLU B 1 340 ? 17.586  -18.804 88.948  1.00 122.31 ? 319 GLU B O     1 
ATOM   6880  C  CB    . GLU B 1 340 ? 15.322  -18.824 86.804  1.00 148.02 ? 319 GLU B CB    1 
ATOM   6881  C  CG    . GLU B 1 340 ? 14.213  -17.897 86.343  1.00 173.80 ? 319 GLU B CG    1 
ATOM   6882  C  CD    . GLU B 1 340 ? 12.841  -18.451 86.732  1.00 172.41 ? 319 GLU B CD    1 
ATOM   6883  O  OE1   . GLU B 1 340 ? 12.781  -19.648 87.108  1.00 157.78 ? 319 GLU B OE1   1 
ATOM   6884  O  OE2   . GLU B 1 340 ? 11.836  -17.700 86.651  1.00 163.14 ? 319 GLU B OE2   1 
ATOM   6885  N  N     . SER B 1 341 ? 18.227  -20.189 87.292  1.00 122.82 ? 320 SER B N     1 
ATOM   6886  C  CA    . SER B 1 341 ? 18.744  -21.227 88.179  1.00 125.73 ? 320 SER B CA    1 
ATOM   6887  C  C     . SER B 1 341 ? 19.584  -22.200 87.380  1.00 122.78 ? 320 SER B C     1 
ATOM   6888  O  O     . SER B 1 341 ? 19.662  -22.133 86.155  1.00 122.89 ? 320 SER B O     1 
ATOM   6889  C  CB    . SER B 1 341 ? 17.632  -22.045 88.831  1.00 146.78 ? 320 SER B CB    1 
ATOM   6890  O  OG    . SER B 1 341 ? 17.177  -23.040 87.919  1.00 134.64 ? 320 SER B OG    1 
ATOM   6891  N  N     . ASP B 1 342 ? 20.229  -23.104 88.102  1.00 145.94 ? 321 ASP B N     1 
ATOM   6892  C  CA    . ASP B 1 342 ? 20.857  -24.228 87.436  1.00 141.92 ? 321 ASP B CA    1 
ATOM   6893  C  C     . ASP B 1 342 ? 19.817  -25.168 86.840  1.00 118.57 ? 321 ASP B C     1 
ATOM   6894  O  O     . ASP B 1 342 ? 20.133  -25.924 85.923  1.00 119.34 ? 321 ASP B O     1 
ATOM   6895  C  CB    . ASP B 1 342 ? 21.794  -24.940 88.397  1.00 158.51 ? 321 ASP B CB    1 
ATOM   6896  C  CG    . ASP B 1 342 ? 23.108  -24.240 88.497  1.00 164.09 ? 321 ASP B CG    1 
ATOM   6897  O  OD1   . ASP B 1 342 ? 23.452  -23.552 87.512  1.00 147.46 ? 321 ASP B OD1   1 
ATOM   6898  O  OD2   . ASP B 1 342 ? 23.780  -24.364 89.545  1.00 178.98 ? 321 ASP B OD2   1 
ATOM   6899  N  N     . ALA B 1 343 ? 18.603  -25.201 87.392  1.00 117.44 ? 322 ALA B N     1 
ATOM   6900  C  CA    . ALA B 1 343 ? 17.581  -26.063 86.814  1.00 117.32 ? 322 ALA B CA    1 
ATOM   6901  C  C     . ALA B 1 343 ? 17.048  -25.499 85.500  1.00 119.64 ? 322 ALA B C     1 
ATOM   6902  O  O     . ALA B 1 343 ? 16.693  -26.262 84.588  1.00 120.46 ? 322 ALA B O     1 
ATOM   6903  C  CB    . ALA B 1 343 ? 16.459  -26.285 87.814  1.00 115.61 ? 322 ALA B CB    1 
ATOM   6904  N  N     . GLU B 1 344 ? 16.943  -24.168 85.395  1.00 120.97 ? 323 GLU B N     1 
ATOM   6905  C  CA    . GLU B 1 344 ? 16.586  -23.556 84.114  1.00 123.61 ? 323 GLU B CA    1 
ATOM   6906  C  C     . GLU B 1 344 ? 17.712  -23.710 83.084  1.00 126.22 ? 323 GLU B C     1 
ATOM   6907  O  O     . GLU B 1 344 ? 17.448  -23.946 81.899  1.00 151.11 ? 323 GLU B O     1 
ATOM   6908  C  CB    . GLU B 1 344 ? 16.216  -22.085 84.296  1.00 124.83 ? 323 GLU B CB    1 
ATOM   6909  C  CG    . GLU B 1 344 ? 15.859  -21.394 82.989  1.00 127.90 ? 323 GLU B CG    1 
ATOM   6910  C  CD    . GLU B 1 344 ? 15.016  -20.147 83.171  1.00 144.69 ? 323 GLU B CD    1 
ATOM   6911  O  OE1   . GLU B 1 344 ? 13.793  -20.275 83.424  1.00 153.15 ? 323 GLU B OE1   1 
ATOM   6912  O  OE2   . GLU B 1 344 ? 15.587  -19.037 83.087  1.00 141.86 ? 323 GLU B OE2   1 
ATOM   6913  N  N     . ARG B 1 345 ? 18.970  -23.558 83.509  1.00 124.96 ? 324 ARG B N     1 
ATOM   6914  C  CA    . ARG B 1 345 ? 20.110  -23.942 82.678  1.00 126.28 ? 324 ARG B CA    1 
ATOM   6915  C  C     . ARG B 1 345 ? 19.999  -25.384 82.225  1.00 125.70 ? 324 ARG B C     1 
ATOM   6916  O  O     . ARG B 1 345 ? 20.423  -25.746 81.125  1.00 127.50 ? 324 ARG B O     1 
ATOM   6917  C  CB    . ARG B 1 345 ? 21.391  -23.781 83.470  1.00 125.52 ? 324 ARG B CB    1 
ATOM   6918  C  CG    . ARG B 1 345 ? 21.867  -22.390 83.640  1.00 130.34 ? 324 ARG B CG    1 
ATOM   6919  C  CD    . ARG B 1 345 ? 23.140  -22.407 84.464  1.00 133.05 ? 324 ARG B CD    1 
ATOM   6920  N  NE    . ARG B 1 345 ? 23.553  -21.056 84.791  1.00 130.41 ? 324 ARG B NE    1 
ATOM   6921  C  CZ    . ARG B 1 345 ? 24.379  -20.352 84.030  1.00 154.39 ? 324 ARG B CZ    1 
ATOM   6922  N  NH1   . ARG B 1 345 ? 24.867  -20.901 82.920  1.00 146.24 ? 324 ARG B NH1   1 
ATOM   6923  N  NH2   . ARG B 1 345 ? 24.712  -19.111 84.373  1.00 168.42 ? 324 ARG B NH2   1 
ATOM   6924  N  N     . GLN B 1 346 ? 19.501  -26.239 83.096  1.00 123.36 ? 325 GLN B N     1 
ATOM   6925  C  CA    . GLN B 1 346 ? 19.535  -27.659 82.803  1.00 131.97 ? 325 GLN B CA    1 
ATOM   6926  C  C     . GLN B 1 346 ? 18.455  -28.025 81.803  1.00 124.21 ? 325 GLN B C     1 
ATOM   6927  O  O     . GLN B 1 346 ? 18.619  -28.988 81.050  1.00 151.55 ? 325 GLN B O     1 
ATOM   6928  C  CB    . GLN B 1 346 ? 19.475  -28.458 84.112  1.00 156.89 ? 325 GLN B CB    1 
ATOM   6929  C  CG    . GLN B 1 346 ? 19.566  -29.971 83.966  1.00 160.58 ? 325 GLN B CG    1 
ATOM   6930  C  CD    . GLN B 1 346 ? 19.739  -30.657 85.304  1.00 142.14 ? 325 GLN B CD    1 
ATOM   6931  O  OE1   . GLN B 1 346 ? 19.673  -30.013 86.359  1.00 128.39 ? 325 GLN B OE1   1 
ATOM   6932  N  NE2   . GLN B 1 346 ? 19.993  -31.970 85.269  1.00 138.46 ? 325 GLN B NE2   1 
ATOM   6933  N  N     . GLY B 1 347 ? 17.338  -27.306 81.802  1.00 124.61 ? 326 GLY B N     1 
ATOM   6934  C  CA    . GLY B 1 347 ? 16.382  -27.479 80.715  1.00 126.59 ? 326 GLY B CA    1 
ATOM   6935  C  C     . GLY B 1 347 ? 16.741  -26.785 79.398  1.00 129.73 ? 326 GLY B C     1 
ATOM   6936  O  O     . GLY B 1 347 ? 16.552  -27.361 78.323  1.00 131.63 ? 326 GLY B O     1 
ATOM   6937  N  N     . LEU B 1 348 ? 17.259  -25.550 79.464  1.00 130.55 ? 327 LEU B N     1 
ATOM   6938  C  CA    . LEU B 1 348 ? 17.730  -24.862 78.261  1.00 133.71 ? 327 LEU B CA    1 
ATOM   6939  C  C     . LEU B 1 348 ? 18.842  -25.615 77.538  1.00 134.68 ? 327 LEU B C     1 
ATOM   6940  O  O     . LEU B 1 348 ? 18.955  -25.507 76.312  1.00 157.07 ? 327 LEU B O     1 
ATOM   6941  C  CB    . LEU B 1 348 ? 18.219  -23.464 78.606  1.00 134.35 ? 327 LEU B CB    1 
ATOM   6942  C  CG    . LEU B 1 348 ? 17.198  -22.403 78.956  1.00 134.71 ? 327 LEU B CG    1 
ATOM   6943  C  CD1   . LEU B 1 348 ? 17.910  -21.227 79.531  1.00 134.90 ? 327 LEU B CD1   1 
ATOM   6944  C  CD2   . LEU B 1 348 ? 16.529  -21.983 77.699  1.00 137.97 ? 327 LEU B CD2   1 
ATOM   6945  N  N     . ALA B 1 349 ? 19.678  -26.367 78.258  1.00 132.57 ? 328 ALA B N     1 
ATOM   6946  C  CA    . ALA B 1 349 ? 20.703  -27.139 77.570  1.00 133.61 ? 328 ALA B CA    1 
ATOM   6947  C  C     . ALA B 1 349 ? 20.088  -28.208 76.684  1.00 134.74 ? 328 ALA B C     1 
ATOM   6948  O  O     . ALA B 1 349 ? 20.800  -28.783 75.849  1.00 139.70 ? 328 ALA B O     1 
ATOM   6949  C  CB    . ALA B 1 349 ? 21.644  -27.801 78.575  1.00 143.28 ? 328 ALA B CB    1 
ATOM   6950  N  N     . ARG B 1 350 ? 18.812  -28.536 76.918  1.00 133.92 ? 329 ARG B N     1 
ATOM   6951  C  CA    . ARG B 1 350 ? 17.930  -29.336 76.074  1.00 135.41 ? 329 ARG B CA    1 
ATOM   6952  C  C     . ARG B 1 350 ? 17.166  -28.526 75.016  1.00 144.59 ? 329 ARG B C     1 
ATOM   6953  O  O     . ARG B 1 350 ? 17.072  -28.934 73.847  1.00 141.20 ? 329 ARG B O     1 
ATOM   6954  C  CB    . ARG B 1 350 ? 16.895  -30.000 76.968  1.00 133.10 ? 329 ARG B CB    1 
ATOM   6955  C  CG    . ARG B 1 350 ? 17.440  -30.617 78.198  1.00 130.05 ? 329 ARG B CG    1 
ATOM   6956  C  CD    . ARG B 1 350 ? 16.299  -30.990 79.118  1.00 128.04 ? 329 ARG B CD    1 
ATOM   6957  N  NE    . ARG B 1 350 ? 16.758  -31.864 80.188  1.00 165.47 ? 329 ARG B NE    1 
ATOM   6958  C  CZ    . ARG B 1 350 ? 16.167  -31.987 81.372  1.00 169.94 ? 329 ARG B CZ    1 
ATOM   6959  N  NH1   . ARG B 1 350 ? 15.090  -31.269 81.656  1.00 148.31 ? 329 ARG B NH1   1 
ATOM   6960  N  NH2   . ARG B 1 350 ? 16.666  -32.825 82.274  1.00 183.61 ? 329 ARG B NH2   1 
ATOM   6961  N  N     . LEU B 1 351 ? 16.604  -27.375 75.424  1.00 138.32 ? 330 LEU B N     1 
ATOM   6962  C  CA    . LEU B 1 351 ? 15.663  -26.627 74.591  1.00 141.11 ? 330 LEU B CA    1 
ATOM   6963  C  C     . LEU B 1 351 ? 16.358  -25.866 73.479  1.00 151.64 ? 330 LEU B C     1 
ATOM   6964  O  O     . LEU B 1 351 ? 15.841  -25.786 72.360  1.00 165.68 ? 330 LEU B O     1 
ATOM   6965  C  CB    . LEU B 1 351 ? 14.839  -25.656 75.433  1.00 139.97 ? 330 LEU B CB    1 
ATOM   6966  C  CG    . LEU B 1 351 ? 13.680  -26.240 76.246  1.00 147.95 ? 330 LEU B CG    1 
ATOM   6967  C  CD1   . LEU B 1 351 ? 13.165  -25.228 77.254  1.00 138.94 ? 330 LEU B CD1   1 
ATOM   6968  C  CD2   . LEU B 1 351 ? 12.558  -26.702 75.342  1.00 163.02 ? 330 LEU B CD2   1 
ATOM   6969  N  N     . LEU B 1 352 ? 17.467  -25.231 73.791  1.00 146.32 ? 331 LEU B N     1 
ATOM   6970  C  CA    . LEU B 1 352 ? 18.137  -24.450 72.772  1.00 147.34 ? 331 LEU B CA    1 
ATOM   6971  C  C     . LEU B 1 352 ? 18.417  -25.304 71.536  1.00 149.86 ? 331 LEU B C     1 
ATOM   6972  O  O     . LEU B 1 352 ? 17.936  -24.962 70.454  1.00 153.27 ? 331 LEU B O     1 
ATOM   6973  C  CB    . LEU B 1 352 ? 19.427  -23.841 73.328  1.00 146.47 ? 331 LEU B CB    1 
ATOM   6974  C  CG    . LEU B 1 352 ? 19.458  -22.319 73.444  1.00 147.85 ? 331 LEU B CG    1 
ATOM   6975  C  CD1   . LEU B 1 352 ? 18.232  -21.695 72.780  1.00 150.33 ? 331 LEU B CD1   1 
ATOM   6976  C  CD2   . LEU B 1 352 ? 19.584  -21.892 74.884  1.00 144.74 ? 331 LEU B CD2   1 
ATOM   6977  N  N     . PRO B 1 353 ? 19.105  -26.447 71.639  1.00 148.55 ? 332 PRO B N     1 
ATOM   6978  C  CA    . PRO B 1 353 ? 19.479  -27.157 70.408  1.00 151.38 ? 332 PRO B CA    1 
ATOM   6979  C  C     . PRO B 1 353 ? 18.320  -27.714 69.595  1.00 161.16 ? 332 PRO B C     1 
ATOM   6980  O  O     . PRO B 1 353 ? 18.410  -27.706 68.362  1.00 177.12 ? 332 PRO B O     1 
ATOM   6981  C  CB    . PRO B 1 353 ? 20.378  -28.294 70.920  1.00 159.71 ? 332 PRO B CB    1 
ATOM   6982  C  CG    . PRO B 1 353 ? 20.760  -27.912 72.288  1.00 145.72 ? 332 PRO B CG    1 
ATOM   6983  C  CD    . PRO B 1 353 ? 19.614  -27.151 72.825  1.00 144.82 ? 332 PRO B CD    1 
ATOM   6984  N  N     . ARG B 1 354 ? 17.238  -28.184 70.216  1.00 151.51 ? 333 ARG B N     1 
ATOM   6985  C  CA    . ARG B 1 354 ? 16.145  -28.731 69.416  1.00 153.81 ? 333 ARG B CA    1 
ATOM   6986  C  C     . ARG B 1 354 ? 15.364  -27.641 68.679  1.00 157.01 ? 333 ARG B C     1 
ATOM   6987  O  O     . ARG B 1 354 ? 14.986  -27.826 67.514  1.00 160.66 ? 333 ARG B O     1 
ATOM   6988  C  CB    . ARG B 1 354 ? 15.249  -29.543 70.307  1.00 151.04 ? 333 ARG B CB    1 
ATOM   6989  C  CG    . ARG B 1 354 ? 14.975  -28.743 71.455  1.00 148.29 ? 333 ARG B CG    1 
ATOM   6990  C  CD    . ARG B 1 354 ? 13.771  -29.217 72.063  1.00 146.79 ? 333 ARG B CD    1 
ATOM   6991  N  NE    . ARG B 1 354 ? 14.167  -30.130 73.099  1.00 151.64 ? 333 ARG B NE    1 
ATOM   6992  C  CZ    . ARG B 1 354 ? 13.334  -30.589 74.011  1.00 171.74 ? 333 ARG B CZ    1 
ATOM   6993  N  NH1   . ARG B 1 354 ? 12.055  -30.217 73.976  1.00 163.67 ? 333 ARG B NH1   1 
ATOM   6994  N  NH2   . ARG B 1 354 ? 13.784  -31.423 74.938  1.00 138.20 ? 333 ARG B NH2   1 
ATOM   6995  N  N     . LEU B 1 355 ? 15.083  -26.515 69.350  1.00 155.91 ? 334 LEU B N     1 
ATOM   6996  C  CA    . LEU B 1 355 ? 14.441  -25.379 68.683  1.00 159.15 ? 334 LEU B CA    1 
ATOM   6997  C  C     . LEU B 1 355 ? 15.337  -24.775 67.614  1.00 162.68 ? 334 LEU B C     1 
ATOM   6998  O  O     . LEU B 1 355 ? 14.850  -24.370 66.556  1.00 169.09 ? 334 LEU B O     1 
ATOM   6999  C  CB    . LEU B 1 355 ? 14.073  -24.270 69.666  1.00 157.33 ? 334 LEU B CB    1 
ATOM   7000  C  CG    . LEU B 1 355 ? 12.973  -24.341 70.704  1.00 154.66 ? 334 LEU B CG    1 
ATOM   7001  C  CD1   . LEU B 1 355 ? 13.062  -23.087 71.485  1.00 153.60 ? 334 LEU B CD1   1 
ATOM   7002  C  CD2   . LEU B 1 355 ? 11.651  -24.398 70.063  1.00 157.21 ? 334 LEU B CD2   1 
ATOM   7003  N  N     . GLN B 1 356 ? 16.636  -24.622 67.898  1.00 184.52 ? 335 GLN B N     1 
ATOM   7004  C  CA    . GLN B 1 356 ? 17.568  -24.190 66.857  1.00 176.32 ? 335 GLN B CA    1 
ATOM   7005  C  C     . GLN B 1 356 ? 17.564  -25.166 65.688  1.00 190.06 ? 335 GLN B C     1 
ATOM   7006  O  O     . GLN B 1 356 ? 17.723  -24.755 64.525  1.00 172.04 ? 335 GLN B O     1 
ATOM   7007  C  CB    . GLN B 1 356 ? 18.992  -24.073 67.427  1.00 163.04 ? 335 GLN B CB    1 
ATOM   7008  C  CG    . GLN B 1 356 ? 19.293  -22.857 68.301  1.00 161.65 ? 335 GLN B CG    1 
ATOM   7009  C  CD    . GLN B 1 356 ? 20.641  -22.972 69.007  1.00 173.10 ? 335 GLN B CD    1 
ATOM   7010  O  OE1   . GLN B 1 356 ? 21.094  -24.070 69.351  1.00 160.35 ? 335 GLN B OE1   1 
ATOM   7011  N  NE2   . GLN B 1 356 ? 21.285  -21.835 69.231  1.00 190.40 ? 335 GLN B NE2   1 
ATOM   7012  N  N     . GLY B 1 357 ? 17.315  -26.449 65.977  1.00 182.46 ? 336 GLY B N     1 
ATOM   7013  C  CA    . GLY B 1 357 ? 17.180  -27.431 64.915  1.00 201.77 ? 336 GLY B CA    1 
ATOM   7014  C  C     . GLY B 1 357 ? 15.948  -27.177 64.072  1.00 212.30 ? 336 GLY B C     1 
ATOM   7015  O  O     . GLY B 1 357 ? 16.024  -27.117 62.840  1.00 217.35 ? 336 GLY B O     1 
ATOM   7016  N  N     . LYS B 1 358 ? 14.797  -27.004 64.727  1.00 226.76 ? 337 LYS B N     1 
ATOM   7017  C  CA    . LYS B 1 358 ? 13.576  -26.719 63.988  1.00 196.55 ? 337 LYS B CA    1 
ATOM   7018  C  C     . LYS B 1 358 ? 13.572  -25.342 63.348  1.00 177.40 ? 337 LYS B C     1 
ATOM   7019  O  O     . LYS B 1 358 ? 12.671  -25.085 62.563  1.00 181.05 ? 337 LYS B O     1 
ATOM   7020  C  CB    . LYS B 1 358 ? 12.323  -26.862 64.872  1.00 186.54 ? 337 LYS B CB    1 
ATOM   7021  C  CG    . LYS B 1 358 ? 12.141  -28.249 65.497  1.00 198.56 ? 337 LYS B CG    1 
ATOM   7022  C  CD    . LYS B 1 358 ? 12.473  -29.384 64.522  1.00 199.45 ? 337 LYS B CD    1 
ATOM   7023  C  CE    . LYS B 1 358 ? 11.450  -29.485 63.389  1.00 205.71 ? 337 LYS B CE    1 
ATOM   7024  N  NZ    . LYS B 1 358 ? 11.980  -30.228 62.194  1.00 199.39 ? 337 LYS B NZ    1 
ATOM   7025  N  N     . LEU B 1 359 ? 14.501  -24.440 63.672  1.00 176.59 ? 338 LEU B N     1 
ATOM   7026  C  CA    . LEU B 1 359 ? 14.638  -23.218 62.883  1.00 180.60 ? 338 LEU B CA    1 
ATOM   7027  C  C     . LEU B 1 359 ? 15.756  -23.305 61.851  1.00 183.72 ? 338 LEU B C     1 
ATOM   7028  O  O     . LEU B 1 359 ? 15.911  -22.374 61.046  1.00 187.69 ? 338 LEU B O     1 
ATOM   7029  C  CB    . LEU B 1 359 ? 14.850  -21.964 63.759  1.00 178.81 ? 338 LEU B CB    1 
ATOM   7030  C  CG    . LEU B 1 359 ? 13.894  -21.413 64.841  1.00 176.17 ? 338 LEU B CG    1 
ATOM   7031  C  CD1   . LEU B 1 359 ? 14.182  -19.937 65.137  1.00 176.93 ? 338 LEU B CD1   1 
ATOM   7032  C  CD2   . LEU B 1 359 ? 12.450  -21.579 64.453  1.00 178.14 ? 338 LEU B CD2   1 
ATOM   7033  N  N     . GLY B 1 360 ? 16.519  -24.403 61.840  1.00 196.33 ? 339 GLY B N     1 
ATOM   7034  C  CA    . GLY B 1 360 ? 17.616  -24.588 60.895  1.00 224.16 ? 339 GLY B CA    1 
ATOM   7035  C  C     . GLY B 1 360 ? 18.947  -23.976 61.273  1.00 202.79 ? 339 GLY B C     1 
ATOM   7036  O  O     . GLY B 1 360 ? 19.811  -23.818 60.403  1.00 197.07 ? 339 GLY B O     1 
ATOM   7037  N  N     . LEU B 1 361 ? 19.114  -23.579 62.524  1.00 196.93 ? 340 LEU B N     1 
ATOM   7038  C  CA    . LEU B 1 361 ? 20.262  -22.925 63.132  1.00 183.69 ? 340 LEU B CA    1 
ATOM   7039  C  C     . LEU B 1 361 ? 21.250  -23.945 63.709  1.00 176.06 ? 340 LEU B C     1 
ATOM   7040  O  O     . LEU B 1 361 ? 20.954  -25.146 63.786  1.00 173.58 ? 340 LEU B O     1 
ATOM   7041  C  CB    . LEU B 1 361 ? 19.787  -21.909 64.179  1.00 192.35 ? 340 LEU B CB    1 
ATOM   7042  C  CG    . LEU B 1 361 ? 19.381  -20.523 63.617  1.00 179.74 ? 340 LEU B CG    1 
ATOM   7043  C  CD1   . LEU B 1 361 ? 18.540  -20.582 62.343  1.00 184.30 ? 340 LEU B CD1   1 
ATOM   7044  C  CD2   . LEU B 1 361 ? 18.730  -19.595 64.658  1.00 177.58 ? 340 LEU B CD2   1 
ATOM   7045  N  N     . PRO B 1 362 ? 22.477  -23.509 64.018  1.00 174.50 ? 341 PRO B N     1 
ATOM   7046  C  CA    . PRO B 1 362 ? 23.451  -24.393 64.688  1.00 180.07 ? 341 PRO B CA    1 
ATOM   7047  C  C     . PRO B 1 362 ? 22.998  -24.910 66.052  1.00 175.09 ? 341 PRO B C     1 
ATOM   7048  O  O     . PRO B 1 362 ? 22.455  -24.169 66.873  1.00 184.45 ? 341 PRO B O     1 
ATOM   7049  C  CB    . PRO B 1 362 ? 24.689  -23.500 64.829  1.00 193.12 ? 341 PRO B CB    1 
ATOM   7050  C  CG    . PRO B 1 362 ? 24.554  -22.492 63.737  1.00 181.89 ? 341 PRO B CG    1 
ATOM   7051  C  CD    . PRO B 1 362 ? 23.088  -22.236 63.594  1.00 177.47 ? 341 PRO B CD    1 
ATOM   7052  N  N     . ARG B 1 363 ? 23.274  -26.190 66.303  1.00 164.50 ? 342 ARG B N     1 
ATOM   7053  C  CA    . ARG B 1 363 ? 22.933  -26.869 67.551  1.00 181.38 ? 342 ARG B CA    1 
ATOM   7054  C  C     . ARG B 1 363 ? 23.885  -26.561 68.707  1.00 197.65 ? 342 ARG B C     1 
ATOM   7055  O  O     . ARG B 1 363 ? 23.815  -27.238 69.747  1.00 192.34 ? 342 ARG B O     1 
ATOM   7056  C  CB    . ARG B 1 363 ? 22.859  -28.370 67.313  1.00 174.74 ? 342 ARG B CB    1 
ATOM   7057  C  CG    . ARG B 1 363 ? 21.808  -28.728 66.308  1.00 170.64 ? 342 ARG B CG    1 
ATOM   7058  C  CD    . ARG B 1 363 ? 21.409  -30.149 66.521  1.00 174.26 ? 342 ARG B CD    1 
ATOM   7059  N  NE    . ARG B 1 363 ? 20.044  -30.390 66.087  1.00 187.09 ? 342 ARG B NE    1 
ATOM   7060  C  CZ    . ARG B 1 363 ? 19.406  -31.535 66.290  1.00 178.87 ? 342 ARG B CZ    1 
ATOM   7061  N  NH1   . ARG B 1 363 ? 20.039  -32.526 66.917  1.00 158.78 ? 342 ARG B NH1   1 
ATOM   7062  N  NH2   . ARG B 1 363 ? 18.148  -31.687 65.867  1.00 168.97 ? 342 ARG B NH2   1 
ATOM   7063  N  N     . GLN B 1 364 ? 24.848  -25.667 68.496  1.00 201.50 ? 343 GLN B N     1 
ATOM   7064  C  CA    . GLN B 1 364 ? 25.713  -25.122 69.540  1.00 213.82 ? 343 GLN B CA    1 
ATOM   7065  C  C     . GLN B 1 364 ? 26.654  -26.129 70.196  1.00 236.51 ? 343 GLN B C     1 
ATOM   7066  O  O     . GLN B 1 364 ? 27.617  -25.704 70.845  1.00 235.06 ? 343 GLN B O     1 
ATOM   7067  C  CB    . GLN B 1 364 ? 24.893  -24.438 70.644  1.00 201.03 ? 343 GLN B CB    1 
ATOM   7068  C  CG    . GLN B 1 364 ? 24.872  -25.189 71.974  1.00 172.10 ? 343 GLN B CG    1 
ATOM   7069  C  CD    . GLN B 1 364 ? 23.880  -24.608 72.962  1.00 170.11 ? 343 GLN B CD    1 
ATOM   7070  O  OE1   . GLN B 1 364 ? 23.013  -23.785 72.589  1.00 148.95 ? 343 GLN B OE1   1 
ATOM   7071  N  NE2   . GLN B 1 364 ? 24.000  -25.027 74.243  1.00 145.51 ? 343 GLN B NE2   1 
ATOM   7072  N  N     . ALA B 1 365 ? 26.437  -27.440 70.012  1.00 221.09 ? 344 ALA B N     1 
ATOM   7073  C  CA    . ALA B 1 365 ? 27.345  -28.431 70.596  1.00 220.21 ? 344 ALA B CA    1 
ATOM   7074  C  C     . ALA B 1 365 ? 27.371  -28.319 72.112  1.00 219.40 ? 344 ALA B C     1 
ATOM   7075  O  O     . ALA B 1 365 ? 28.146  -27.525 72.655  1.00 228.51 ? 344 ALA B O     1 
ATOM   7076  C  CB    . ALA B 1 365 ? 28.770  -28.304 70.041  1.00 203.24 ? 344 ALA B CB    1 
ATOM   7077  N  N     . ARG B 1 366 ? 26.539  -29.085 72.816  1.00 230.92 ? 345 ARG B N     1 
ATOM   7078  C  CA    . ARG B 1 366 ? 26.427  -28.836 74.243  1.00 209.34 ? 345 ARG B CA    1 
ATOM   7079  C  C     . ARG B 1 366 ? 27.767  -29.121 74.927  1.00 181.49 ? 345 ARG B C     1 
ATOM   7080  O  O     . ARG B 1 366 ? 28.717  -29.621 74.325  1.00 179.45 ? 345 ARG B O     1 
ATOM   7081  C  CB    . ARG B 1 366 ? 25.309  -29.695 74.846  1.00 202.99 ? 345 ARG B CB    1 
ATOM   7082  C  CG    . ARG B 1 366 ? 24.697  -29.151 76.139  1.00 180.17 ? 345 ARG B CG    1 
ATOM   7083  C  CD    . ARG B 1 366 ? 24.824  -30.176 77.257  1.00 158.44 ? 345 ARG B CD    1 
ATOM   7084  N  NE    . ARG B 1 366 ? 24.165  -31.434 76.921  1.00 148.07 ? 345 ARG B NE    1 
ATOM   7085  C  CZ    . ARG B 1 366 ? 23.271  -32.044 77.694  1.00 146.14 ? 345 ARG B CZ    1 
ATOM   7086  N  NH1   . ARG B 1 366 ? 22.929  -31.525 78.866  1.00 133.41 ? 345 ARG B NH1   1 
ATOM   7087  N  NH2   . ARG B 1 366 ? 22.726  -33.185 77.299  1.00 156.79 ? 345 ARG B NH2   1 
ATOM   7088  N  N     . ALA B 1 367 ? 27.826  -28.805 76.212  1.00 174.51 ? 346 ALA B N     1 
ATOM   7089  C  CA    . ALA B 1 367 ? 29.107  -28.717 76.892  1.00 179.75 ? 346 ALA B CA    1 
ATOM   7090  C  C     . ALA B 1 367 ? 29.662  -30.090 77.197  1.00 161.56 ? 346 ALA B C     1 
ATOM   7091  O  O     . ALA B 1 367 ? 29.017  -31.119 76.980  1.00 162.68 ? 346 ALA B O     1 
ATOM   7092  C  CB    . ALA B 1 367 ? 28.995  -27.903 78.175  1.00 195.53 ? 346 ALA B CB    1 
ATOM   7093  N  N     . ALA B 1 368 ? 30.879  -30.089 77.729  1.00 145.58 ? 347 ALA B N     1 
ATOM   7094  C  CA    . ALA B 1 368 ? 31.494  -31.297 78.239  1.00 145.86 ? 347 ALA B CA    1 
ATOM   7095  C  C     . ALA B 1 368 ? 31.411  -31.263 79.754  1.00 160.11 ? 347 ALA B C     1 
ATOM   7096  O  O     . ALA B 1 368 ? 31.704  -30.236 80.381  1.00 143.37 ? 347 ALA B O     1 
ATOM   7097  C  CB    . ALA B 1 368 ? 32.941  -31.404 77.774  1.00 137.81 ? 347 ALA B CB    1 
ATOM   7098  N  N     . ALA B 1 369 ? 31.012  -32.400 80.329  1.00 151.98 ? 348 ALA B N     1 
ATOM   7099  C  CA    . ALA B 1 369 ? 30.783  -32.580 81.744  1.00 143.68 ? 348 ALA B CA    1 
ATOM   7100  C  C     . ALA B 1 369 ? 31.225  -33.970 82.180  1.00 127.83 ? 348 ALA B C     1 
ATOM   7101  O  O     . ALA B 1 369 ? 30.888  -34.960 81.509  1.00 128.38 ? 348 ALA B O     1 
ATOM   7102  C  CB    . ALA B 1 369 ? 29.290  -32.391 82.057  1.00 175.35 ? 348 ALA B CB    1 
ATOM   7103  N  N     . PRO B 1 370 ? 31.838  -34.081 83.386  1.00 137.50 ? 349 PRO B N     1 
ATOM   7104  C  CA    . PRO B 1 370 ? 32.570  -35.302 83.768  1.00 126.71 ? 349 PRO B CA    1 
ATOM   7105  C  C     . PRO B 1 370 ? 31.763  -36.587 83.881  1.00 127.07 ? 349 PRO B C     1 
ATOM   7106  O  O     . PRO B 1 370 ? 30.534  -36.574 83.743  1.00 144.10 ? 349 PRO B O     1 
ATOM   7107  C  CB    . PRO B 1 370 ? 33.152  -34.920 85.128  1.00 125.67 ? 349 PRO B CB    1 
ATOM   7108  C  CG    . PRO B 1 370 ? 32.287  -33.786 85.602  1.00 124.35 ? 349 PRO B CG    1 
ATOM   7109  C  CD    . PRO B 1 370 ? 31.985  -33.028 84.401  1.00 125.71 ? 349 PRO B CD    1 
ATOM   7110  N  N     . GLU B 1 371 ? 32.451  -37.699 84.157  1.00 126.91 ? 350 GLU B N     1 
ATOM   7111  C  CA    . GLU B 1 371 ? 31.787  -38.996 84.189  1.00 135.50 ? 350 GLU B CA    1 
ATOM   7112  C  C     . GLU B 1 371 ? 30.890  -39.132 85.412  1.00 152.61 ? 350 GLU B C     1 
ATOM   7113  O  O     . GLU B 1 371 ? 31.280  -38.791 86.536  1.00 129.22 ? 350 GLU B O     1 
ATOM   7114  C  CB    . GLU B 1 371 ? 32.795  -40.133 84.180  1.00 156.32 ? 350 GLU B CB    1 
ATOM   7115  C  CG    . GLU B 1 371 ? 32.134  -41.496 84.325  1.00 167.00 ? 350 GLU B CG    1 
ATOM   7116  C  CD    . GLU B 1 371 ? 32.241  -42.321 83.070  1.00 190.44 ? 350 GLU B CD    1 
ATOM   7117  O  OE1   . GLU B 1 371 ? 33.376  -42.721 82.742  1.00 209.49 ? 350 GLU B OE1   1 
ATOM   7118  O  OE2   . GLU B 1 371 ? 31.206  -42.551 82.405  1.00 172.15 ? 350 GLU B OE2   1 
ATOM   7119  N  N     . ILE B 1 372 ? 29.743  -39.779 85.193  1.00 179.47 ? 351 ILE B N     1 
ATOM   7120  C  CA    . ILE B 1 372 ? 28.557  -39.737 86.052  1.00 166.68 ? 351 ILE B CA    1 
ATOM   7121  C  C     . ILE B 1 372 ? 28.883  -39.786 87.583  1.00 149.65 ? 351 ILE B C     1 
ATOM   7122  O  O     . ILE B 1 372 ? 28.503  -38.815 88.293  1.00 117.78 ? 351 ILE B O     1 
ATOM   7123  C  CB    . ILE B 1 372 ? 27.505  -40.865 85.583  1.00 169.01 ? 351 ILE B CB    1 
ATOM   7124  C  CG1   . ILE B 1 372 ? 27.258  -40.866 84.050  1.00 122.63 ? 351 ILE B CG1   1 
ATOM   7125  C  CG2   . ILE B 1 372 ? 26.165  -40.704 86.258  1.00 152.66 ? 351 ILE B CG2   1 
ATOM   7126  C  CD1   . ILE B 1 372 ? 26.205  -39.908 83.522  1.00 122.36 ? 351 ILE B CD1   1 
ATOM   7127  N  N     . ASP B 1 373 ? 29.557  -40.819 88.128  1.00 132.64 ? 352 ASP B N     1 
ATOM   7128  C  CA    . ASP B 1 373 ? 30.321  -41.878 87.445  1.00 121.42 ? 352 ASP B CA    1 
ATOM   7129  C  C     . ASP B 1 373 ? 29.739  -43.304 87.652  1.00 146.42 ? 352 ASP B C     1 
ATOM   7130  O  O     . ASP B 1 373 ? 29.413  -43.733 88.775  1.00 127.97 ? 352 ASP B O     1 
ATOM   7131  C  CB    . ASP B 1 373 ? 31.797  -41.832 87.887  1.00 134.79 ? 352 ASP B CB    1 
ATOM   7132  C  CG    . ASP B 1 373 ? 32.076  -42.589 89.194  1.00 139.35 ? 352 ASP B CG    1 
ATOM   7133  O  OD1   . ASP B 1 373 ? 31.296  -42.460 90.155  1.00 138.10 ? 352 ASP B OD1   1 
ATOM   7134  O  OD2   . ASP B 1 373 ? 33.096  -43.307 89.257  1.00 123.45 ? 352 ASP B OD2   1 
ATOM   7135  N  N     . ARG B 1 374 ? 29.647  -44.037 86.539  1.00 155.85 ? 353 ARG B N     1 
ATOM   7136  C  CA    . ARG B 1 374 ? 28.812  -45.233 86.456  1.00 152.44 ? 353 ARG B CA    1 
ATOM   7137  C  C     . ARG B 1 374 ? 29.320  -46.388 87.313  1.00 123.82 ? 353 ARG B C     1 
ATOM   7138  O  O     . ARG B 1 374 ? 30.524  -46.590 87.481  1.00 124.88 ? 353 ARG B O     1 
ATOM   7139  C  CB    . ARG B 1 374 ? 28.690  -45.660 84.988  1.00 164.43 ? 353 ARG B CB    1 
ATOM   7140  C  CG    . ARG B 1 374 ? 27.816  -44.702 84.176  1.00 197.25 ? 353 ARG B CG    1 
ATOM   7141  C  CD    . ARG B 1 374 ? 28.181  -44.643 82.691  1.00 224.42 ? 353 ARG B CD    1 
ATOM   7142  N  NE    . ARG B 1 374 ? 27.697  -43.394 82.089  1.00 244.43 ? 353 ARG B NE    1 
ATOM   7143  C  CZ    . ARG B 1 374 ? 28.272  -42.775 81.059  1.00 257.01 ? 353 ARG B CZ    1 
ATOM   7144  N  NH1   . ARG B 1 374 ? 27.754  -41.642 80.587  1.00 257.90 ? 353 ARG B NH1   1 
ATOM   7145  N  NH2   . ARG B 1 374 ? 29.372  -43.280 80.510  1.00 260.55 ? 353 ARG B NH2   1 
ATOM   7146  N  N     . LEU B 1 375 ? 28.368  -47.081 87.936  1.00 127.56 ? 354 LEU B N     1 
ATOM   7147  C  CA    . LEU B 1 375 ? 28.615  -48.285 88.729  1.00 134.95 ? 354 LEU B CA    1 
ATOM   7148  C  C     . LEU B 1 375 ? 27.489  -49.264 88.384  1.00 173.28 ? 354 LEU B C     1 
ATOM   7149  O  O     . LEU B 1 375 ? 26.331  -48.989 88.708  1.00 207.00 ? 354 LEU B O     1 
ATOM   7150  C  CB    . LEU B 1 375 ? 28.613  -47.901 90.203  1.00 125.79 ? 354 LEU B CB    1 
ATOM   7151  C  CG    . LEU B 1 375 ? 28.639  -48.862 91.365  1.00 135.03 ? 354 LEU B CG    1 
ATOM   7152  C  CD1   . LEU B 1 375 ? 30.058  -49.393 91.484  1.00 173.01 ? 354 LEU B CD1   1 
ATOM   7153  C  CD2   . LEU B 1 375 ? 28.200  -48.134 92.624  1.00 120.26 ? 354 LEU B CD2   1 
ATOM   7154  N  N     . ASP B 1 376 ? 27.792  -50.413 87.769  1.00 164.74 ? 355 ASP B N     1 
ATOM   7155  C  CA    . ASP B 1 376 ? 26.736  -51.275 87.225  1.00 158.01 ? 355 ASP B CA    1 
ATOM   7156  C  C     . ASP B 1 376 ? 26.592  -52.641 87.899  1.00 165.11 ? 355 ASP B C     1 
ATOM   7157  O  O     . ASP B 1 376 ? 27.583  -53.264 88.283  1.00 165.66 ? 355 ASP B O     1 
ATOM   7158  C  CB    . ASP B 1 376 ? 26.911  -51.414 85.713  1.00 140.69 ? 355 ASP B CB    1 
ATOM   7159  C  CG    . ASP B 1 376 ? 26.601  -50.100 84.989  1.00 167.63 ? 355 ASP B CG    1 
ATOM   7160  O  OD1   . ASP B 1 376 ? 25.475  -49.953 84.454  1.00 180.55 ? 355 ASP B OD1   1 
ATOM   7161  O  OD2   . ASP B 1 376 ? 27.447  -49.181 85.020  1.00 180.50 ? 355 ASP B OD2   1 
ATOM   7162  N  N     . LEU B 1 377 ? 25.332  -53.099 88.036  1.00 176.88 ? 356 LEU B N     1 
ATOM   7163  C  CA    . LEU B 1 377 ? 24.975  -54.386 88.642  1.00 169.65 ? 356 LEU B CA    1 
ATOM   7164  C  C     . LEU B 1 377 ? 24.052  -55.248 87.797  1.00 191.91 ? 356 LEU B C     1 
ATOM   7165  O  O     . LEU B 1 377 ? 23.148  -54.734 87.135  1.00 180.70 ? 356 LEU B O     1 
ATOM   7166  C  CB    . LEU B 1 377 ? 24.276  -54.210 89.981  1.00 139.87 ? 356 LEU B CB    1 
ATOM   7167  C  CG    . LEU B 1 377 ? 25.155  -53.996 91.185  1.00 146.71 ? 356 LEU B CG    1 
ATOM   7168  C  CD1   . LEU B 1 377 ? 24.295  -53.874 92.438  1.00 150.78 ? 356 LEU B CD1   1 
ATOM   7169  C  CD2   . LEU B 1 377 ? 26.054  -55.209 91.251  1.00 149.63 ? 356 LEU B CD2   1 
ATOM   7170  N  N     . CYS B 1 378 ? 24.334  -56.563 87.775  1.00 213.47 ? 357 CYS B N     1 
ATOM   7171  C  CA    . CYS B 1 378 ? 23.380  -57.590 87.345  1.00 204.86 ? 357 CYS B CA    1 
ATOM   7172  C  C     . CYS B 1 378 ? 22.998  -58.447 88.549  1.00 181.44 ? 357 CYS B C     1 
ATOM   7173  O  O     . CYS B 1 378 ? 23.812  -59.238 89.037  1.00 181.75 ? 357 CYS B O     1 
ATOM   7174  C  CB    . CYS B 1 378 ? 23.934  -58.457 86.215  1.00 191.92 ? 357 CYS B CB    1 
ATOM   7175  S  SG    . CYS B 1 378 ? 24.086  -57.604 84.638  1.00 185.39 ? 357 CYS B SG    1 
ATOM   7176  N  N     . LEU B 1 379 ? 21.764  -58.294 89.022  1.00 178.71 ? 358 LEU B N     1 
ATOM   7177  C  CA    . LEU B 1 379 ? 21.302  -58.996 90.208  1.00 178.93 ? 358 LEU B CA    1 
ATOM   7178  C  C     . LEU B 1 379 ? 20.151  -59.921 89.829  1.00 208.17 ? 358 LEU B C     1 
ATOM   7179  O  O     . LEU B 1 379 ? 19.374  -59.623 88.919  1.00 222.18 ? 358 LEU B O     1 
ATOM   7180  C  CB    . LEU B 1 379 ? 20.825  -58.013 91.296  1.00 182.19 ? 358 LEU B CB    1 
ATOM   7181  C  CG    . LEU B 1 379 ? 21.794  -56.947 91.829  1.00 179.97 ? 358 LEU B CG    1 
ATOM   7182  C  CD1   . LEU B 1 379 ? 21.229  -56.144 93.060  1.00 141.66 ? 358 LEU B CD1   1 
ATOM   7183  C  CD2   . LEU B 1 379 ? 23.190  -57.521 92.065  1.00 192.19 ? 358 LEU B CD2   1 
ATOM   7184  N  N     . ALA B 1 380 ? 20.044  -61.055 90.512  1.00 216.50 ? 359 ALA B N     1 
ATOM   7185  C  CA    . ALA B 1 380 ? 18.833  -61.855 90.393  1.00 221.79 ? 359 ALA B CA    1 
ATOM   7186  C  C     . ALA B 1 380 ? 17.664  -61.159 91.098  1.00 226.58 ? 359 ALA B C     1 
ATOM   7187  O  O     . ALA B 1 380 ? 17.856  -60.326 91.990  1.00 223.00 ? 359 ALA B O     1 
ATOM   7188  C  CB    . ALA B 1 380 ? 19.054  -63.254 90.965  1.00 210.03 ? 359 ALA B CB    1 
ATOM   7189  N  N     . PHE B 1 381 ? 16.434  -61.513 90.690  1.00 231.30 ? 360 PHE B N     1 
ATOM   7190  C  CA    . PHE B 1 381 ? 15.227  -60.947 91.299  1.00 230.86 ? 360 PHE B CA    1 
ATOM   7191  C  C     . PHE B 1 381 ? 15.227  -61.296 92.797  1.00 239.64 ? 360 PHE B C     1 
ATOM   7192  O  O     . PHE B 1 381 ? 15.985  -62.175 93.216  1.00 245.11 ? 360 PHE B O     1 
ATOM   7193  C  CB    . PHE B 1 381 ? 13.987  -61.497 90.574  1.00 226.87 ? 360 PHE B CB    1 
ATOM   7194  C  CG    . PHE B 1 381 ? 12.756  -60.626 90.695  1.00 223.97 ? 360 PHE B CG    1 
ATOM   7195  C  CD1   . PHE B 1 381 ? 12.732  -59.352 90.146  1.00 219.71 ? 360 PHE B CD1   1 
ATOM   7196  C  CD2   . PHE B 1 381 ? 11.621  -61.084 91.356  1.00 214.43 ? 360 PHE B CD2   1 
ATOM   7197  C  CE1   . PHE B 1 381 ? 11.604  -58.544 90.268  1.00 205.73 ? 360 PHE B CE1   1 
ATOM   7198  C  CE2   . PHE B 1 381 ? 10.497  -60.281 91.480  1.00 198.25 ? 360 PHE B CE2   1 
ATOM   7199  C  CZ    . PHE B 1 381 ? 10.488  -59.011 90.932  1.00 194.75 ? 360 PHE B CZ    1 
ATOM   7200  N  N     . PRO B 1 382 ? 14.405  -60.608 93.645  1.00 235.81 ? 361 PRO B N     1 
ATOM   7201  C  CA    . PRO B 1 382 ? 14.597  -60.889 95.083  1.00 242.68 ? 361 PRO B CA    1 
ATOM   7202  C  C     . PRO B 1 382 ? 14.489  -62.368 95.562  1.00 261.53 ? 361 PRO B C     1 
ATOM   7203  O  O     . PRO B 1 382 ? 15.471  -62.757 96.201  1.00 271.77 ? 361 PRO B O     1 
ATOM   7204  C  CB    . PRO B 1 382 ? 13.535  -59.995 95.750  1.00 227.75 ? 361 PRO B CB    1 
ATOM   7205  C  CG    . PRO B 1 382 ? 13.342  -58.875 94.819  1.00 214.09 ? 361 PRO B CG    1 
ATOM   7206  C  CD    . PRO B 1 382 ? 13.595  -59.393 93.434  1.00 225.20 ? 361 PRO B CD    1 
ATOM   7207  N  N     . SER B 1 383 ? 13.441  -63.174 95.333  1.00 258.09 ? 362 SER B N     1 
ATOM   7208  C  CA    . SER B 1 383 ? 12.020  -62.808 95.373  1.00 249.79 ? 362 SER B CA    1 
ATOM   7209  C  C     . SER B 1 383 ? 11.657  -62.807 96.865  1.00 234.36 ? 362 SER B C     1 
ATOM   7210  O  O     . SER B 1 383 ? 12.239  -63.569 97.641  1.00 231.01 ? 362 SER B O     1 
ATOM   7211  C  CB    . SER B 1 383 ? 11.159  -63.790 94.582  1.00 254.12 ? 362 SER B CB    1 
ATOM   7212  O  OG    . SER B 1 383 ? 11.180  -65.090 95.154  1.00 258.79 ? 362 SER B OG    1 
ATOM   7213  N  N     . GLU B 1 384 ? 10.732  -61.952 97.291  1.00 242.85 ? 363 GLU B N     1 
ATOM   7214  C  CA    . GLU B 1 384 ? 9.920   -61.126 96.415  1.00 233.38 ? 363 GLU B CA    1 
ATOM   7215  C  C     . GLU B 1 384 ? 10.191  -59.685 96.861  1.00 226.84 ? 363 GLU B C     1 
ATOM   7216  O  O     . GLU B 1 384 ? 10.853  -59.495 97.875  1.00 217.83 ? 363 GLU B O     1 
ATOM   7217  C  CB    . GLU B 1 384 ? 8.444   -61.526 96.555  1.00 233.47 ? 363 GLU B CB    1 
ATOM   7218  C  CG    . GLU B 1 384 ? 8.143   -62.986 96.154  1.00 237.40 ? 363 GLU B CG    1 
ATOM   7219  C  CD    . GLU B 1 384 ? 6.959   -63.596 96.918  1.00 237.80 ? 363 GLU B CD    1 
ATOM   7220  O  OE1   . GLU B 1 384 ? 6.036   -62.846 97.299  1.00 238.82 ? 363 GLU B OE1   1 
ATOM   7221  O  OE2   . GLU B 1 384 ? 6.951   -64.830 97.141  1.00 226.91 ? 363 GLU B OE2   1 
ATOM   7222  N  N     . PRO B 1 385 ? 9.690   -58.666 96.124  1.00 223.46 ? 364 PRO B N     1 
ATOM   7223  C  CA    . PRO B 1 385 ? 10.102  -57.270 96.399  1.00 229.97 ? 364 PRO B CA    1 
ATOM   7224  C  C     . PRO B 1 385 ? 9.698   -56.702 97.778  1.00 227.80 ? 364 PRO B C     1 
ATOM   7225  O  O     . PRO B 1 385 ? 8.495   -56.755 98.048  1.00 215.89 ? 364 PRO B O     1 
ATOM   7226  C  CB    . PRO B 1 385 ? 9.396   -56.490 95.286  1.00 225.10 ? 364 PRO B CB    1 
ATOM   7227  C  CG    . PRO B 1 385 ? 9.287   -57.457 94.172  1.00 222.16 ? 364 PRO B CG    1 
ATOM   7228  C  CD    . PRO B 1 385 ? 9.005   -58.778 94.820  1.00 223.92 ? 364 PRO B CD    1 
ATOM   7229  N  N     . CYS B 1 386 ? 10.592  -56.120 98.606  1.00 214.36 ? 365 CYS B N     1 
ATOM   7230  C  CA    . CYS B 1 386 ? 12.059  -55.911 98.415  1.00 214.11 ? 365 CYS B CA    1 
ATOM   7231  C  C     . CYS B 1 386 ? 12.413  -54.928 97.291  1.00 201.88 ? 365 CYS B C     1 
ATOM   7232  O  O     . CYS B 1 386 ? 12.687  -55.316 96.155  1.00 210.85 ? 365 CYS B O     1 
ATOM   7233  C  CB    . CYS B 1 386 ? 12.805  -57.243 98.209  1.00 225.02 ? 365 CYS B CB    1 
ATOM   7234  S  SG    . CYS B 1 386 ? 14.595  -57.189 98.474  1.00 226.36 ? 365 CYS B SG    1 
ATOM   7235  N  N     . SER B 1 387 ? 12.397  -53.645 97.663  1.00 192.44 ? 366 SER B N     1 
ATOM   7236  C  CA    . SER B 1 387 ? 12.664  -52.514 96.775  1.00 177.22 ? 366 SER B CA    1 
ATOM   7237  C  C     . SER B 1 387 ? 14.064  -52.581 96.151  1.00 174.28 ? 366 SER B C     1 
ATOM   7238  O  O     . SER B 1 387 ? 14.976  -53.242 96.664  1.00 180.77 ? 366 SER B O     1 
ATOM   7239  C  CB    . SER B 1 387 ? 12.561  -51.201 97.553  1.00 150.45 ? 366 SER B CB    1 
ATOM   7240  O  OG    . SER B 1 387 ? 11.478  -51.230 98.456  1.00 135.95 ? 366 SER B OG    1 
ATOM   7241  N  N     . VAL B 1 388 ? 14.224  -51.891 95.010  1.00 151.49 ? 367 VAL B N     1 
ATOM   7242  C  CA    . VAL B 1 388 ? 15.492  -51.949 94.287  1.00 139.64 ? 367 VAL B CA    1 
ATOM   7243  C  C     . VAL B 1 388 ? 16.623  -51.448 95.163  1.00 157.60 ? 367 VAL B C     1 
ATOM   7244  O  O     . VAL B 1 388 ? 17.743  -51.967 95.106  1.00 155.82 ? 367 VAL B O     1 
ATOM   7245  C  CB    . VAL B 1 388 ? 15.421  -51.124 92.993  1.00 147.03 ? 367 VAL B CB    1 
ATOM   7246  C  CG1   . VAL B 1 388 ? 14.970  -49.702 93.305  1.00 133.63 ? 367 VAL B CG1   1 
ATOM   7247  C  CG2   . VAL B 1 388 ? 16.798  -51.107 92.308  1.00 136.70 ? 367 VAL B CG2   1 
ATOM   7248  N  N     . GLU B 1 389 ? 16.356  -50.431 95.987  1.00 147.39 ? 368 GLU B N     1 
ATOM   7249  C  CA    . GLU B 1 389 ? 17.406  -49.886 96.838  1.00 148.39 ? 368 GLU B CA    1 
ATOM   7250  C  C     . GLU B 1 389 ? 17.781  -50.878 97.934  1.00 157.72 ? 368 GLU B C     1 
ATOM   7251  O  O     . GLU B 1 389 ? 18.964  -51.152 98.162  1.00 175.88 ? 368 GLU B O     1 
ATOM   7252  C  CB    . GLU B 1 389 ? 16.975  -48.550 97.430  1.00 144.97 ? 368 GLU B CB    1 
ATOM   7253  C  CG    . GLU B 1 389 ? 16.957  -47.371 96.455  1.00 146.40 ? 368 GLU B CG    1 
ATOM   7254  C  CD    . GLU B 1 389 ? 15.595  -47.200 95.785  1.00 143.81 ? 368 GLU B CD    1 
ATOM   7255  O  OE1   . GLU B 1 389 ? 14.604  -47.677 96.379  1.00 149.35 ? 368 GLU B OE1   1 
ATOM   7256  O  OE2   . GLU B 1 389 ? 15.508  -46.630 94.669  1.00 129.44 ? 368 GLU B OE2   1 
ATOM   7257  N  N     . TRP B 1 390 ? 16.781  -51.426 98.624  1.00 117.29 ? 369 TRP B N     1 
ATOM   7258  C  CA    . TRP B 1 390 ? 17.045  -52.392 99.682  1.00 132.10 ? 369 TRP B CA    1 
ATOM   7259  C  C     . TRP B 1 390 ? 17.845  -53.584 99.176  1.00 162.41 ? 369 TRP B C     1 
ATOM   7260  O  O     . TRP B 1 390 ? 18.648  -54.151 99.927  1.00 183.91 ? 369 TRP B O     1 
ATOM   7261  C  CB    . TRP B 1 390 ? 15.731  -52.858 100.291 1.00 129.62 ? 369 TRP B CB    1 
ATOM   7262  C  CG    . TRP B 1 390 ? 15.091  -51.769 101.004 1.00 131.96 ? 369 TRP B CG    1 
ATOM   7263  C  CD1   . TRP B 1 390 ? 14.055  -51.023 100.573 1.00 142.11 ? 369 TRP B CD1   1 
ATOM   7264  C  CD2   . TRP B 1 390 ? 15.436  -51.277 102.295 1.00 135.31 ? 369 TRP B CD2   1 
ATOM   7265  N  NE1   . TRP B 1 390 ? 13.729  -50.080 101.508 1.00 135.13 ? 369 TRP B NE1   1 
ATOM   7266  C  CE2   . TRP B 1 390 ? 14.564  -50.220 102.582 1.00 130.73 ? 369 TRP B CE2   1 
ATOM   7267  C  CE3   . TRP B 1 390 ? 16.398  -51.630 103.240 1.00 178.20 ? 369 TRP B CE3   1 
ATOM   7268  C  CZ2   . TRP B 1 390 ? 14.620  -49.506 103.776 1.00 151.16 ? 369 TRP B CZ2   1 
ATOM   7269  C  CZ3   . TRP B 1 390 ? 16.456  -50.916 104.430 1.00 184.51 ? 369 TRP B CZ3   1 
ATOM   7270  C  CH2   . TRP B 1 390 ? 15.570  -49.868 104.686 1.00 164.54 ? 369 TRP B CH2   1 
ATOM   7271  N  N     . ALA B 1 391 ? 17.636  -53.991 97.922  1.00 144.06 ? 370 ALA B N     1 
ATOM   7272  C  CA    . ALA B 1 391 ? 18.356  -55.151 97.401  1.00 155.57 ? 370 ALA B CA    1 
ATOM   7273  C  C     . ALA B 1 391 ? 19.845  -54.863 97.279  1.00 166.97 ? 370 ALA B C     1 
ATOM   7274  O  O     . ALA B 1 391 ? 20.678  -55.712 97.618  1.00 171.36 ? 370 ALA B O     1 
ATOM   7275  C  CB    . ALA B 1 391 ? 17.786  -55.562 96.049  1.00 176.06 ? 370 ALA B CB    1 
ATOM   7276  N  N     . VAL B 1 392 ? 20.190  -53.697 96.719  1.00 156.49 ? 371 VAL B N     1 
ATOM   7277  C  CA    . VAL B 1 392 ? 21.576  -53.233 96.646  1.00 153.95 ? 371 VAL B CA    1 
ATOM   7278  C  C     . VAL B 1 392 ? 22.141  -52.864 98.024  1.00 153.84 ? 371 VAL B C     1 
ATOM   7279  O  O     . VAL B 1 392 ? 23.364  -52.924 98.238  1.00 189.17 ? 371 VAL B O     1 
ATOM   7280  C  CB    . VAL B 1 392 ? 21.665  -52.097 95.609  1.00 127.22 ? 371 VAL B CB    1 
ATOM   7281  C  CG1   . VAL B 1 392 ? 23.052  -51.500 95.550  1.00 119.42 ? 371 VAL B CG1   1 
ATOM   7282  C  CG2   . VAL B 1 392 ? 21.309  -52.668 94.244  1.00 121.01 ? 371 VAL B CG2   1 
ATOM   7283  N  N     . ARG B 1 393 ? 21.287  -52.509 98.985  1.00 127.87 ? 372 ARG B N     1 
ATOM   7284  C  CA    . ARG B 1 393 ? 21.790  -52.213 100.329 1.00 158.90 ? 372 ARG B CA    1 
ATOM   7285  C  C     . ARG B 1 393 ? 22.345  -53.458 101.037 1.00 166.97 ? 372 ARG B C     1 
ATOM   7286  O  O     . ARG B 1 393 ? 23.408  -53.392 101.668 1.00 180.91 ? 372 ARG B O     1 
ATOM   7287  C  CB    . ARG B 1 393 ? 20.701  -51.565 101.176 1.00 165.39 ? 372 ARG B CB    1 
ATOM   7288  C  CG    . ARG B 1 393 ? 21.246  -50.866 102.408 1.00 156.33 ? 372 ARG B CG    1 
ATOM   7289  C  CD    . ARG B 1 393 ? 20.235  -50.923 103.514 1.00 143.62 ? 372 ARG B CD    1 
ATOM   7290  N  NE    . ARG B 1 393 ? 19.906  -52.322 103.729 1.00 141.53 ? 372 ARG B NE    1 
ATOM   7291  C  CZ    . ARG B 1 393 ? 20.620  -53.147 104.475 1.00 129.42 ? 372 ARG B CZ    1 
ATOM   7292  N  NH1   . ARG B 1 393 ? 21.705  -52.711 105.105 1.00 120.29 ? 372 ARG B NH1   1 
ATOM   7293  N  NH2   . ARG B 1 393 ? 20.239  -54.407 104.585 1.00 145.15 ? 372 ARG B NH2   1 
ATOM   7294  N  N     . GLU B 1 394 ? 21.640  -54.598 100.963 1.00 145.31 ? 373 GLU B N     1 
ATOM   7295  C  CA    . GLU B 1 394 ? 22.175  -55.829 101.550 1.00 141.29 ? 373 GLU B CA    1 
ATOM   7296  C  C     . GLU B 1 394 ? 23.398  -56.320 100.785 1.00 164.82 ? 373 GLU B C     1 
ATOM   7297  O  O     . GLU B 1 394 ? 24.280  -56.971 101.364 1.00 187.29 ? 373 GLU B O     1 
ATOM   7298  C  CB    . GLU B 1 394 ? 21.130  -56.944 101.564 1.00 156.73 ? 373 GLU B CB    1 
ATOM   7299  C  CG    . GLU B 1 394 ? 20.050  -56.841 102.626 1.00 183.75 ? 373 GLU B CG    1 
ATOM   7300  C  CD    . GLU B 1 394 ? 19.357  -58.185 102.890 1.00 201.85 ? 373 GLU B CD    1 
ATOM   7301  O  OE1   . GLU B 1 394 ? 19.635  -59.166 102.164 1.00 202.98 ? 373 GLU B OE1   1 
ATOM   7302  O  OE2   . GLU B 1 394 ? 18.526  -58.259 103.824 1.00 200.64 ? 373 GLU B OE2   1 
ATOM   7303  N  N     . HIS B 1 395 ? 23.418  -56.080 99.471  1.00 153.91 ? 374 HIS B N     1 
ATOM   7304  C  CA    . HIS B 1 395 ? 24.518  -56.520 98.615  1.00 148.64 ? 374 HIS B CA    1 
ATOM   7305  C  C     . HIS B 1 395 ? 25.824  -55.809 98.959  1.00 159.14 ? 374 HIS B C     1 
ATOM   7306  O  O     . HIS B 1 395 ? 26.817  -56.458 99.331  1.00 152.03 ? 374 HIS B O     1 
ATOM   7307  C  CB    . HIS B 1 395 ? 24.121  -56.267 97.161  1.00 127.24 ? 374 HIS B CB    1 
ATOM   7308  C  CG    . HIS B 1 395 ? 25.169  -56.612 96.148  1.00 128.81 ? 374 HIS B CG    1 
ATOM   7309  N  ND1   . HIS B 1 395 ? 26.013  -55.665 95.601  1.00 136.60 ? 374 HIS B ND1   1 
ATOM   7310  C  CD2   . HIS B 1 395 ? 25.468  -57.779 95.531  1.00 131.42 ? 374 HIS B CD2   1 
ATOM   7311  C  CE1   . HIS B 1 395 ? 26.807  -56.241 94.716  1.00 129.78 ? 374 HIS B CE1   1 
ATOM   7312  N  NE2   . HIS B 1 395 ? 26.496  -57.523 94.653  1.00 131.96 ? 374 HIS B NE2   1 
ATOM   7313  N  N     . LEU B 1 396 ? 25.819  -54.466 98.929  1.00 147.53 ? 375 LEU B N     1 
ATOM   7314  C  CA    . LEU B 1 396 ? 27.055  -53.729 99.183  1.00 156.96 ? 375 LEU B CA    1 
ATOM   7315  C  C     . LEU B 1 396 ? 27.554  -53.849 100.605 1.00 169.57 ? 375 LEU B C     1 
ATOM   7316  O  O     . LEU B 1 396 ? 28.703  -53.466 100.863 1.00 178.71 ? 375 LEU B O     1 
ATOM   7317  C  CB    . LEU B 1 396 ? 26.913  -52.244 98.872  1.00 138.06 ? 375 LEU B CB    1 
ATOM   7318  C  CG    . LEU B 1 396 ? 26.983  -51.907 97.399  1.00 149.57 ? 375 LEU B CG    1 
ATOM   7319  C  CD1   . LEU B 1 396 ? 27.098  -50.405 97.218  1.00 120.21 ? 375 LEU B CD1   1 
ATOM   7320  C  CD2   . LEU B 1 396 ? 28.194  -52.626 96.822  1.00 167.26 ? 375 LEU B CD2   1 
ATOM   7321  N  N     . GLU B 1 397 ? 26.762  -54.410 101.512 1.00 161.05 ? 376 GLU B N     1 
ATOM   7322  C  CA    . GLU B 1 397 ? 27.178  -54.505 102.898 1.00 144.17 ? 376 GLU B CA    1 
ATOM   7323  C  C     . GLU B 1 397 ? 27.992  -55.775 103.001 1.00 178.46 ? 376 GLU B C     1 
ATOM   7324  O  O     . GLU B 1 397 ? 27.460  -56.886 102.895 1.00 189.52 ? 376 GLU B O     1 
ATOM   7325  C  CB    . GLU B 1 397 ? 25.979  -54.512 103.839 1.00 129.52 ? 376 GLU B CB    1 
ATOM   7326  C  CG    . GLU B 1 397 ? 26.343  -54.382 105.299 1.00 150.08 ? 376 GLU B CG    1 
ATOM   7327  C  CD    . GLU B 1 397 ? 25.162  -53.987 106.176 1.00 178.88 ? 376 GLU B CD    1 
ATOM   7328  O  OE1   . GLU B 1 397 ? 24.109  -53.606 105.621 1.00 170.40 ? 376 GLU B OE1   1 
ATOM   7329  O  OE2   . GLU B 1 397 ? 25.288  -54.054 107.420 1.00 197.94 ? 376 GLU B OE2   1 
ATOM   7330  N  N     . GLU B 1 398 ? 29.294  -55.584 103.111 1.00 173.21 ? 377 GLU B N     1 
ATOM   7331  C  CA    . GLU B 1 398 ? 30.325  -56.575 103.330 1.00 185.50 ? 377 GLU B CA    1 
ATOM   7332  C  C     . GLU B 1 398 ? 30.821  -56.356 104.751 1.00 165.09 ? 377 GLU B C     1 
ATOM   7333  O  O     . GLU B 1 398 ? 30.290  -55.481 105.447 1.00 151.28 ? 377 GLU B O     1 
ATOM   7334  C  CB    . GLU B 1 398 ? 31.412  -56.423 102.263 1.00 199.29 ? 377 GLU B CB    1 
ATOM   7335  C  CG    . GLU B 1 398 ? 30.853  -56.540 100.860 1.00 203.11 ? 377 GLU B CG    1 
ATOM   7336  C  CD    . GLU B 1 398 ? 31.918  -56.521 99.798  1.00 194.99 ? 377 GLU B CD    1 
ATOM   7337  O  OE1   . GLU B 1 398 ? 32.955  -57.207 99.972  1.00 180.70 ? 377 GLU B OE1   1 
ATOM   7338  O  OE2   . GLU B 1 398 ? 31.704  -55.812 98.788  1.00 196.49 ? 377 GLU B OE2   1 
ATOM   7339  N  N     . PRO B 1 399 ? 31.801  -57.117 105.232 1.00 168.43 ? 378 PRO B N     1 
ATOM   7340  C  CA    . PRO B 1 399 ? 32.373  -56.811 106.551 1.00 166.47 ? 378 PRO B CA    1 
ATOM   7341  C  C     . PRO B 1 399 ? 33.071  -55.458 106.547 1.00 151.82 ? 378 PRO B C     1 
ATOM   7342  O  O     . PRO B 1 399 ? 33.910  -55.181 105.684 1.00 148.10 ? 378 PRO B O     1 
ATOM   7343  C  CB    . PRO B 1 399 ? 33.371  -57.950 106.769 1.00 186.55 ? 378 PRO B CB    1 
ATOM   7344  C  CG    . PRO B 1 399 ? 32.844  -59.053 105.917 1.00 191.86 ? 378 PRO B CG    1 
ATOM   7345  C  CD    . PRO B 1 399 ? 32.331  -58.381 104.695 1.00 171.02 ? 378 PRO B CD    1 
ATOM   7346  N  N     . GLY B 1 400 ? 32.743  -54.618 107.535 1.00 136.23 ? 379 GLY B N     1 
ATOM   7347  C  CA    . GLY B 1 400 ? 33.445  -53.354 107.716 1.00 135.38 ? 379 GLY B CA    1 
ATOM   7348  C  C     . GLY B 1 400 ? 33.071  -52.253 106.749 1.00 132.38 ? 379 GLY B C     1 
ATOM   7349  O  O     . GLY B 1 400 ? 33.589  -51.133 106.872 1.00 131.67 ? 379 GLY B O     1 
ATOM   7350  N  N     . CYS B 1 401 ? 32.228  -52.552 105.770 1.00 159.90 ? 380 CYS B N     1 
ATOM   7351  C  CA    . CYS B 1 401 ? 31.595  -51.569 104.907 1.00 135.16 ? 380 CYS B CA    1 
ATOM   7352  C  C     . CYS B 1 401 ? 30.130  -51.548 105.300 1.00 126.45 ? 380 CYS B C     1 
ATOM   7353  O  O     . CYS B 1 401 ? 29.413  -52.531 105.085 1.00 141.36 ? 380 CYS B O     1 
ATOM   7354  C  CB    . CYS B 1 401 ? 31.750  -51.956 103.440 1.00 130.86 ? 380 CYS B CB    1 
ATOM   7355  S  SG    . CYS B 1 401 ? 31.373  -50.660 102.300 1.00 134.50 ? 380 CYS B SG    1 
ATOM   7356  N  N     . ALA B 1 402 ? 29.674  -50.411 105.790 1.00 124.64 ? 381 ALA B N     1 
ATOM   7357  C  CA    . ALA B 1 402 ? 28.323  -50.248 106.287 1.00 141.72 ? 381 ALA B CA    1 
ATOM   7358  C  C     . ALA B 1 402 ? 27.525  -49.550 105.210 1.00 139.85 ? 381 ALA B C     1 
ATOM   7359  O  O     . ALA B 1 402 ? 28.072  -48.761 104.437 1.00 127.90 ? 381 ALA B O     1 
ATOM   7360  C  CB    . ALA B 1 402 ? 28.286  -49.437 107.589 1.00 122.96 ? 381 ALA B CB    1 
ATOM   7361  N  N     . VAL B 1 403 ? 26.281  -49.963 105.052 1.00 143.27 ? 382 VAL B N     1 
ATOM   7362  C  CA    . VAL B 1 403 ? 25.421  -49.359 104.057 1.00 121.80 ? 382 VAL B CA    1 
ATOM   7363  C  C     . VAL B 1 403 ? 24.118  -48.988 104.741 1.00 116.66 ? 382 VAL B C     1 
ATOM   7364  O  O     . VAL B 1 403 ? 23.578  -49.768 105.531 1.00 135.91 ? 382 VAL B O     1 
ATOM   7365  C  CB    . VAL B 1 403 ? 25.195  -50.296 102.861 1.00 118.62 ? 382 VAL B CB    1 
ATOM   7366  C  CG1   . VAL B 1 403 ? 24.548  -49.538 101.765 1.00 117.59 ? 382 VAL B CG1   1 
ATOM   7367  C  CG2   . VAL B 1 403 ? 26.517  -50.850 102.384 1.00 120.41 ? 382 VAL B CG2   1 
ATOM   7368  N  N     . HIS B 1 404 ? 23.647  -47.787 104.473 1.00 114.76 ? 383 HIS B N     1 
ATOM   7369  C  CA    . HIS B 1 404 ? 22.413  -47.251 105.016 1.00 115.30 ? 383 HIS B CA    1 
ATOM   7370  C  C     . HIS B 1 404 ? 21.570  -46.693 103.884 1.00 132.71 ? 383 HIS B C     1 
ATOM   7371  O  O     . HIS B 1 404 ? 22.085  -46.033 102.973 1.00 132.04 ? 383 HIS B O     1 
ATOM   7372  C  CB    . HIS B 1 404 ? 22.687  -46.119 105.975 1.00 123.83 ? 383 HIS B CB    1 
ATOM   7373  C  CG    . HIS B 1 404 ? 23.471  -46.505 107.174 1.00 114.51 ? 383 HIS B CG    1 
ATOM   7374  N  ND1   . HIS B 1 404 ? 22.949  -46.430 108.442 1.00 114.80 ? 383 HIS B ND1   1 
ATOM   7375  C  CD2   . HIS B 1 404 ? 24.711  -47.027 107.300 1.00 120.41 ? 383 HIS B CD2   1 
ATOM   7376  C  CE1   . HIS B 1 404 ? 23.859  -46.839 109.309 1.00 126.08 ? 383 HIS B CE1   1 
ATOM   7377  N  NE2   . HIS B 1 404 ? 24.933  -47.219 108.641 1.00 124.24 ? 383 HIS B NE2   1 
ATOM   7378  N  N     . TYR B 1 405 ? 20.275  -46.874 103.986 1.00 121.61 ? 384 TYR B N     1 
ATOM   7379  C  CA    . TYR B 1 405 ? 19.355  -46.211 103.089 1.00 110.01 ? 384 TYR B CA    1 
ATOM   7380  C  C     . TYR B 1 405 ? 18.909  -44.960 103.826 1.00 111.80 ? 384 TYR B C     1 
ATOM   7381  O  O     . TYR B 1 405 ? 18.218  -45.050 104.842 1.00 130.69 ? 384 TYR B O     1 
ATOM   7382  C  CB    . TYR B 1 405 ? 18.204  -47.146 102.742 1.00 112.74 ? 384 TYR B CB    1 
ATOM   7383  C  CG    . TYR B 1 405 ? 17.181  -46.680 101.726 1.00 124.90 ? 384 TYR B CG    1 
ATOM   7384  C  CD1   . TYR B 1 405 ? 16.582  -45.426 101.804 1.00 125.84 ? 384 TYR B CD1   1 
ATOM   7385  C  CD2   . TYR B 1 405 ? 16.716  -47.552 100.760 1.00 138.49 ? 384 TYR B CD2   1 
ATOM   7386  C  CE1   . TYR B 1 405 ? 15.604  -45.040 100.895 1.00 122.88 ? 384 TYR B CE1   1 
ATOM   7387  C  CE2   . TYR B 1 405 ? 15.735  -47.175 99.878  1.00 147.75 ? 384 TYR B CE2   1 
ATOM   7388  C  CZ    . TYR B 1 405 ? 15.192  -45.924 99.929  1.00 135.91 ? 384 TYR B CZ    1 
ATOM   7389  O  OH    . TYR B 1 405 ? 14.220  -45.587 99.007  1.00 131.44 ? 384 TYR B OH    1 
ATOM   7390  N  N     . VAL B 1 406 ? 19.395  -43.810 103.362 1.00 109.19 ? 385 VAL B N     1 
ATOM   7391  C  CA    . VAL B 1 406 ? 18.970  -42.475 103.781 1.00 106.70 ? 385 VAL B CA    1 
ATOM   7392  C  C     . VAL B 1 406 ? 18.932  -41.670 102.500 1.00 129.24 ? 385 VAL B C     1 
ATOM   7393  O  O     . VAL B 1 406 ? 19.906  -41.671 101.742 1.00 158.09 ? 385 VAL B O     1 
ATOM   7394  C  CB    . VAL B 1 406 ? 19.911  -41.802 104.803 1.00 106.99 ? 385 VAL B CB    1 
ATOM   7395  C  CG1   . VAL B 1 406 ? 21.039  -42.725 105.229 1.00 108.45 ? 385 VAL B CG1   1 
ATOM   7396  C  CG2   . VAL B 1 406 ? 20.449  -40.450 104.279 1.00 106.38 ? 385 VAL B CG2   1 
ATOM   7397  N  N     . GLU B 1 407 ? 17.815  -41.088 102.184 1.00 105.14 ? 386 GLU B N     1 
ATOM   7398  C  CA    . GLU B 1 407 ? 17.794  -40.287 100.973 1.00 115.21 ? 386 GLU B CA    1 
ATOM   7399  C  C     . GLU B 1 407 ? 17.629  -38.879 101.497 1.00 118.23 ? 386 GLU B C     1 
ATOM   7400  O  O     . GLU B 1 407 ? 16.575  -38.525 102.027 1.00 149.30 ? 386 GLU B O     1 
ATOM   7401  C  CB    . GLU B 1 407 ? 16.702  -40.691 99.978  1.00 135.57 ? 386 GLU B CB    1 
ATOM   7402  C  CG    . GLU B 1 407 ? 15.278  -40.838 100.502 1.00 151.78 ? 386 GLU B CG    1 
ATOM   7403  C  CD    . GLU B 1 407 ? 14.368  -41.490 99.474  1.00 157.46 ? 386 GLU B CD    1 
ATOM   7404  O  OE1   . GLU B 1 407 ? 14.891  -41.992 98.443  1.00 151.17 ? 386 GLU B OE1   1 
ATOM   7405  O  OE2   . GLU B 1 407 ? 13.135  -41.495 99.698  1.00 160.41 ? 386 GLU B OE2   1 
ATOM   7406  N  N     . ASN B 1 408 ? 18.719  -38.124 101.464 1.00 115.44 ? 387 ASN B N     1 
ATOM   7407  C  CA    . ASN B 1 408 ? 18.745  -36.745 101.943 1.00 136.53 ? 387 ASN B CA    1 
ATOM   7408  C  C     . ASN B 1 408 ? 18.303  -36.710 103.402 1.00 124.70 ? 387 ASN B C     1 
ATOM   7409  O  O     . ASN B 1 408 ? 18.140  -35.627 103.978 1.00 131.19 ? 387 ASN B O     1 
ATOM   7410  C  CB    . ASN B 1 408 ? 18.014  -35.726 101.020 1.00 127.50 ? 387 ASN B CB    1 
ATOM   7411  C  CG    . ASN B 1 408 ? 16.581  -36.019 100.777 1.00 102.94 ? 387 ASN B CG    1 
ATOM   7412  O  OD1   . ASN B 1 408 ? 15.773  -35.939 101.682 1.00 110.14 ? 387 ASN B OD1   1 
ATOM   7413  N  ND2   . ASN B 1 408 ? 16.234  -36.274 99.508  1.00 103.16 ? 387 ASN B ND2   1 
ATOM   7414  N  N     . GLY B 1 409 ? 18.048  -37.877 103.998 1.00 103.94 ? 388 GLY B N     1 
ATOM   7415  C  CA    . GLY B 1 409 ? 17.746  -37.874 105.413 1.00 110.14 ? 388 GLY B CA    1 
ATOM   7416  C  C     . GLY B 1 409 ? 18.924  -37.419 106.254 1.00 104.86 ? 388 GLY B C     1 
ATOM   7417  O  O     . GLY B 1 409 ? 18.761  -36.619 107.178 1.00 104.94 ? 388 GLY B O     1 
ATOM   7418  N  N     . LEU B 1 410 ? 20.131  -37.884 105.916 1.00 105.62 ? 389 LEU B N     1 
ATOM   7419  C  CA    . LEU B 1 410 ? 21.256  -37.693 106.819 1.00 106.73 ? 389 LEU B CA    1 
ATOM   7420  C  C     . LEU B 1 410 ? 21.862  -36.316 106.665 1.00 106.82 ? 389 LEU B C     1 
ATOM   7421  O  O     . LEU B 1 410 ? 22.303  -35.703 107.650 1.00 107.61 ? 389 LEU B O     1 
ATOM   7422  C  CB    . LEU B 1 410 ? 22.300  -38.800 106.633 1.00 107.82 ? 389 LEU B CB    1 
ATOM   7423  C  CG    . LEU B 1 410 ? 23.641  -38.747 107.401 1.00 109.37 ? 389 LEU B CG    1 
ATOM   7424  C  CD1   . LEU B 1 410 ? 23.491  -38.671 108.878 1.00 110.16 ? 389 LEU B CD1   1 
ATOM   7425  C  CD2   . LEU B 1 410 ? 24.473  -39.994 107.110 1.00 110.50 ? 389 LEU B CD2   1 
ATOM   7426  N  N     . ILE B 1 411 ? 21.943  -35.833 105.434 1.00 113.21 ? 390 ILE B N     1 
ATOM   7427  C  CA    . ILE B 1 411 ? 22.591  -34.548 105.255 1.00 115.88 ? 390 ILE B CA    1 
ATOM   7428  C  C     . ILE B 1 411 ? 21.684  -33.463 105.814 1.00 106.21 ? 390 ILE B C     1 
ATOM   7429  O  O     . ILE B 1 411 ? 22.117  -32.591 106.583 1.00 106.99 ? 390 ILE B O     1 
ATOM   7430  C  CB    . ILE B 1 411 ? 22.961  -34.329 103.779 1.00 107.63 ? 390 ILE B CB    1 
ATOM   7431  C  CG1   . ILE B 1 411 ? 23.857  -35.476 103.264 1.00 111.25 ? 390 ILE B CG1   1 
ATOM   7432  C  CG2   . ILE B 1 411 ? 23.832  -33.091 103.678 1.00 107.42 ? 390 ILE B CG2   1 
ATOM   7433  C  CD1   . ILE B 1 411 ? 23.130  -36.859 102.900 1.00 106.75 ? 390 ILE B CD1   1 
ATOM   7434  N  N     . ASN B 1 412 ? 20.395  -33.543 105.492 1.00 109.66 ? 391 ASN B N     1 
ATOM   7435  C  CA    . ASN B 1 412 ? 19.431  -32.674 106.147 1.00 112.54 ? 391 ASN B CA    1 
ATOM   7436  C  C     . ASN B 1 412 ? 19.548  -32.788 107.659 1.00 105.49 ? 391 ASN B C     1 
ATOM   7437  O  O     . ASN B 1 412 ? 19.674  -31.784 108.361 1.00 106.11 ? 391 ASN B O     1 
ATOM   7438  C  CB    . ASN B 1 412 ? 18.006  -33.023 105.709 1.00 108.55 ? 391 ASN B CB    1 
ATOM   7439  C  CG    . ASN B 1 412 ? 17.607  -32.334 104.430 1.00 105.22 ? 391 ASN B CG    1 
ATOM   7440  O  OD1   . ASN B 1 412 ? 17.557  -31.103 104.357 1.00 110.07 ? 391 ASN B OD1   1 
ATOM   7441  N  ND2   . ASN B 1 412 ? 17.323  -33.123 103.408 1.00 130.42 ? 391 ASN B ND2   1 
ATOM   7442  N  N     . SER B 1 413 ? 19.613  -34.007 108.174 1.00 105.72 ? 392 SER B N     1 
ATOM   7443  C  CA    . SER B 1 413 ? 19.516  -34.162 109.618 1.00 106.53 ? 392 SER B CA    1 
ATOM   7444  C  C     . SER B 1 413 ? 20.718  -33.542 110.314 1.00 114.79 ? 392 SER B C     1 
ATOM   7445  O  O     . SER B 1 413 ? 20.567  -32.776 111.272 1.00 108.66 ? 392 SER B O     1 
ATOM   7446  C  CB    . SER B 1 413 ? 19.367  -35.636 109.964 1.00 106.77 ? 392 SER B CB    1 
ATOM   7447  O  OG    . SER B 1 413 ? 18.129  -36.098 109.444 1.00 105.68 ? 392 SER B OG    1 
ATOM   7448  N  N     . LEU B 1 414 ? 21.921  -33.858 109.841 1.00 108.63 ? 393 LEU B N     1 
ATOM   7449  C  CA    . LEU B 1 414 ? 23.112  -33.260 110.426 1.00 110.24 ? 393 LEU B CA    1 
ATOM   7450  C  C     . LEU B 1 414 ? 23.061  -31.742 110.360 1.00 110.38 ? 393 LEU B C     1 
ATOM   7451  O  O     . LEU B 1 414 ? 23.405  -31.056 111.333 1.00 111.73 ? 393 LEU B O     1 
ATOM   7452  C  CB    . LEU B 1 414 ? 24.355  -33.803 109.732 1.00 110.92 ? 393 LEU B CB    1 
ATOM   7453  C  CG    . LEU B 1 414 ? 24.640  -35.262 110.056 1.00 111.48 ? 393 LEU B CG    1 
ATOM   7454  C  CD1   . LEU B 1 414 ? 25.828  -35.768 109.293 1.00 112.22 ? 393 LEU B CD1   1 
ATOM   7455  C  CD2   . LEU B 1 414 ? 24.906  -35.312 111.540 1.00 113.10 ? 393 LEU B CD2   1 
ATOM   7456  N  N     . PHE B 1 415 ? 22.610  -31.192 109.234 1.00 109.24 ? 394 PHE B N     1 
ATOM   7457  C  CA    . PHE B 1 415 ? 22.478  -29.740 109.177 1.00 114.21 ? 394 PHE B CA    1 
ATOM   7458  C  C     . PHE B 1 415 ? 21.540  -29.221 110.264 1.00 130.12 ? 394 PHE B C     1 
ATOM   7459  O  O     . PHE B 1 415 ? 21.895  -28.316 111.034 1.00 115.22 ? 394 PHE B O     1 
ATOM   7460  C  CB    . PHE B 1 415 ? 21.950  -29.303 107.813 1.00 119.84 ? 394 PHE B CB    1 
ATOM   7461  C  CG    . PHE B 1 415 ? 21.521  -27.869 107.788 1.00 108.77 ? 394 PHE B CG    1 
ATOM   7462  C  CD1   . PHE B 1 415 ? 22.451  -26.862 107.833 1.00 110.24 ? 394 PHE B CD1   1 
ATOM   7463  C  CD2   . PHE B 1 415 ? 20.190  -27.535 107.794 1.00 107.86 ? 394 PHE B CD2   1 
ATOM   7464  C  CE1   . PHE B 1 415 ? 22.066  -25.548 107.837 1.00 110.82 ? 394 PHE B CE1   1 
ATOM   7465  C  CE2   . PHE B 1 415 ? 19.804  -26.224 107.809 1.00 109.38 ? 394 PHE B CE2   1 
ATOM   7466  C  CZ    . PHE B 1 415 ? 20.752  -25.226 107.827 1.00 109.91 ? 394 PHE B CZ    1 
ATOM   7467  N  N     . GLY B 1 416 ? 20.336  -29.801 110.341 1.00 122.24 ? 395 GLY B N     1 
ATOM   7468  C  CA    . GLY B 1 416 ? 19.334  -29.347 111.287 1.00 108.56 ? 395 GLY B CA    1 
ATOM   7469  C  C     . GLY B 1 416 ? 19.755  -29.517 112.722 1.00 110.07 ? 395 GLY B C     1 
ATOM   7470  O  O     . GLY B 1 416 ? 19.342  -28.749 113.591 1.00 118.80 ? 395 GLY B O     1 
ATOM   7471  N  N     . LEU B 1 417 ? 20.553  -30.535 113.000 1.00 110.67 ? 396 LEU B N     1 
ATOM   7472  C  CA    . LEU B 1 417 ? 21.024  -30.717 114.358 1.00 112.46 ? 396 LEU B CA    1 
ATOM   7473  C  C     . LEU B 1 417 ? 22.030  -29.636 114.711 1.00 123.15 ? 396 LEU B C     1 
ATOM   7474  O  O     . LEU B 1 417 ? 21.909  -28.990 115.761 1.00 115.61 ? 396 LEU B O     1 
ATOM   7475  C  CB    . LEU B 1 417 ? 21.630  -32.103 114.516 1.00 112.91 ? 396 LEU B CB    1 
ATOM   7476  C  CG    . LEU B 1 417 ? 20.618  -33.222 114.532 1.00 111.85 ? 396 LEU B CG    1 
ATOM   7477  C  CD1   . LEU B 1 417 ? 21.341  -34.516 114.397 1.00 112.35 ? 396 LEU B CD1   1 
ATOM   7478  C  CD2   . LEU B 1 417 ? 19.917  -33.137 115.862 1.00 112.79 ? 396 LEU B CD2   1 
ATOM   7479  N  N     . LEU B 1 418 ? 23.020  -29.411 113.823 1.00 125.88 ? 397 LEU B N     1 
ATOM   7480  C  CA    . LEU B 1 418 ? 24.093  -28.447 114.096 1.00 117.01 ? 397 LEU B CA    1 
ATOM   7481  C  C     . LEU B 1 418 ? 23.586  -27.014 114.204 1.00 119.11 ? 397 LEU B C     1 
ATOM   7482  O  O     . LEU B 1 418 ? 24.043  -26.252 115.066 1.00 130.10 ? 397 LEU B O     1 
ATOM   7483  C  CB    . LEU B 1 418 ? 25.180  -28.541 113.031 1.00 116.40 ? 397 LEU B CB    1 
ATOM   7484  C  CG    . LEU B 1 418 ? 26.331  -27.614 113.402 1.00 118.78 ? 397 LEU B CG    1 
ATOM   7485  C  CD1   . LEU B 1 418 ? 26.910  -28.072 114.685 1.00 120.82 ? 397 LEU B CD1   1 
ATOM   7486  C  CD2   . LEU B 1 418 ? 27.374  -27.601 112.311 1.00 119.01 ? 397 LEU B CD2   1 
ATOM   7487  N  N     . CYS B 1 419 ? 22.682  -26.617 113.312 1.00 116.37 ? 398 CYS B N     1 
ATOM   7488  C  CA    . CYS B 1 419 ? 22.137  -25.267 113.239 1.00 124.61 ? 398 CYS B CA    1 
ATOM   7489  C  C     . CYS B 1 419 ? 20.815  -25.106 113.990 1.00 128.93 ? 398 CYS B C     1 
ATOM   7490  O  O     . CYS B 1 419 ? 20.055  -24.177 113.694 1.00 114.54 ? 398 CYS B O     1 
ATOM   7491  C  CB    . CYS B 1 419 ? 22.012  -24.839 111.786 1.00 140.67 ? 398 CYS B CB    1 
ATOM   7492  S  SG    . CYS B 1 419 ? 23.641  -24.824 111.053 1.00 144.91 ? 398 CYS B SG    1 
ATOM   7493  N  N     . TRP B 1 420 ? 20.470  -26.066 114.850 1.00 132.41 ? 399 TRP B N     1 
ATOM   7494  C  CA    . TRP B 1 420 ? 19.204  -26.025 115.573 1.00 131.44 ? 399 TRP B CA    1 
ATOM   7495  C  C     . TRP B 1 420 ? 18.949  -24.643 116.161 1.00 115.87 ? 399 TRP B C     1 
ATOM   7496  O  O     . TRP B 1 420 ? 17.835  -24.119 116.074 1.00 129.10 ? 399 TRP B O     1 
ATOM   7497  C  CB    . TRP B 1 420 ? 19.189  -27.107 116.660 1.00 138.48 ? 399 TRP B CB    1 
ATOM   7498  C  CG    . TRP B 1 420 ? 17.823  -27.350 117.298 1.00 140.14 ? 399 TRP B CG    1 
ATOM   7499  C  CD1   . TRP B 1 420 ? 17.284  -26.697 118.367 1.00 126.69 ? 399 TRP B CD1   1 
ATOM   7500  C  CD2   . TRP B 1 420 ? 16.831  -28.306 116.876 1.00 132.69 ? 399 TRP B CD2   1 
ATOM   7501  N  NE1   . TRP B 1 420 ? 16.031  -27.192 118.644 1.00 116.43 ? 399 TRP B NE1   1 
ATOM   7502  C  CE2   . TRP B 1 420 ? 15.731  -28.177 117.743 1.00 113.98 ? 399 TRP B CE2   1 
ATOM   7503  C  CE3   . TRP B 1 420 ? 16.771  -29.260 115.849 1.00 125.60 ? 399 TRP B CE3   1 
ATOM   7504  C  CZ2   . TRP B 1 420 ? 14.602  -28.969 117.628 1.00 111.94 ? 399 TRP B CZ2   1 
ATOM   7505  C  CZ3   . TRP B 1 420 ? 15.643  -30.038 115.734 1.00 109.98 ? 399 TRP B CZ3   1 
ATOM   7506  C  CH2   . TRP B 1 420 ? 14.579  -29.891 116.618 1.00 110.40 ? 399 TRP B CH2   1 
ATOM   7507  N  N     . GLU B 1 421 ? 19.957  -24.041 116.789 1.00 118.07 ? 400 GLU B N     1 
ATOM   7508  C  CA    . GLU B 1 421 ? 19.687  -22.744 117.391 1.00 119.75 ? 400 GLU B CA    1 
ATOM   7509  C  C     . GLU B 1 421 ? 19.405  -21.658 116.364 1.00 129.07 ? 400 GLU B C     1 
ATOM   7510  O  O     . GLU B 1 421 ? 18.715  -20.696 116.699 1.00 127.81 ? 400 GLU B O     1 
ATOM   7511  C  CB    . GLU B 1 421 ? 20.822  -22.346 118.314 1.00 125.52 ? 400 GLU B CB    1 
ATOM   7512  C  CG    . GLU B 1 421 ? 20.545  -22.840 119.718 1.00 175.35 ? 400 GLU B CG    1 
ATOM   7513  C  CD    . GLU B 1 421 ? 21.683  -23.623 120.302 1.00 212.50 ? 400 GLU B CD    1 
ATOM   7514  O  OE1   . GLU B 1 421 ? 22.847  -23.338 119.942 1.00 230.74 ? 400 GLU B OE1   1 
ATOM   7515  O  OE2   . GLU B 1 421 ? 21.405  -24.535 121.114 1.00 219.72 ? 400 GLU B OE2   1 
ATOM   7516  N  N     . ALA B 1 422 ? 19.872  -21.798 115.119 1.00 137.68 ? 401 ALA B N     1 
ATOM   7517  C  CA    . ALA B 1 422 ? 19.534  -20.802 114.096 1.00 132.35 ? 401 ALA B CA    1 
ATOM   7518  C  C     . ALA B 1 422 ? 18.128  -21.023 113.549 1.00 139.95 ? 401 ALA B C     1 
ATOM   7519  O  O     . ALA B 1 422 ? 17.424  -20.063 113.219 1.00 147.47 ? 401 ALA B O     1 
ATOM   7520  C  CB    . ALA B 1 422 ? 20.560  -20.823 112.955 1.00 120.04 ? 401 ALA B CB    1 
ATOM   7521  N  N     . ILE B 1 423 ? 17.707  -22.281 113.453 1.00 149.80 ? 402 ILE B N     1 
ATOM   7522  C  CA    . ILE B 1 423 ? 16.403  -22.613 112.895 1.00 127.07 ? 402 ILE B CA    1 
ATOM   7523  C  C     . ILE B 1 423 ? 15.276  -22.206 113.846 1.00 112.83 ? 402 ILE B C     1 
ATOM   7524  O  O     . ILE B 1 423 ? 14.239  -21.691 113.419 1.00 116.16 ? 402 ILE B O     1 
ATOM   7525  C  CB    . ILE B 1 423 ? 16.394  -24.106 112.551 1.00 110.70 ? 402 ILE B CB    1 
ATOM   7526  C  CG1   . ILE B 1 423 ? 17.415  -24.332 111.448 1.00 110.33 ? 402 ILE B CG1   1 
ATOM   7527  C  CG2   . ILE B 1 423 ? 15.024  -24.539 112.135 1.00 109.21 ? 402 ILE B CG2   1 
ATOM   7528  C  CD1   . ILE B 1 423 ? 17.736  -25.731 111.203 1.00 109.31 ? 402 ILE B CD1   1 
ATOM   7529  N  N     . PHE B 1 424 ? 15.437  -22.465 115.138 1.00 119.14 ? 403 PHE B N     1 
ATOM   7530  C  CA    . PHE B 1 424 ? 14.444  -22.133 116.148 1.00 117.81 ? 403 PHE B CA    1 
ATOM   7531  C  C     . PHE B 1 424 ? 14.698  -20.782 116.849 1.00 125.82 ? 403 PHE B C     1 
ATOM   7532  O  O     . PHE B 1 424 ? 14.207  -20.557 117.964 1.00 130.17 ? 403 PHE B O     1 
ATOM   7533  C  CB    . PHE B 1 424 ? 14.302  -23.298 117.115 1.00 126.91 ? 403 PHE B CB    1 
ATOM   7534  C  CG    . PHE B 1 424 ? 13.609  -24.476 116.493 1.00 114.55 ? 403 PHE B CG    1 
ATOM   7535  C  CD1   . PHE B 1 424 ? 12.229  -24.504 116.380 1.00 124.49 ? 403 PHE B CD1   1 
ATOM   7536  C  CD2   . PHE B 1 424 ? 14.327  -25.529 115.988 1.00 124.94 ? 403 PHE B CD2   1 
ATOM   7537  C  CE1   . PHE B 1 424 ? 11.572  -25.575 115.794 1.00 125.45 ? 403 PHE B CE1   1 
ATOM   7538  C  CE2   . PHE B 1 424 ? 13.684  -26.600 115.398 1.00 140.91 ? 403 PHE B CE2   1 
ATOM   7539  C  CZ    . PHE B 1 424 ? 12.300  -26.620 115.300 1.00 138.25 ? 403 PHE B CZ    1 
ATOM   7540  N  N     . ALA B 1 425 ? 15.558  -19.939 116.288 1.00 129.39 ? 404 ALA B N     1 
ATOM   7541  C  CA    . ALA B 1 425 ? 15.726  -18.584 116.805 1.00 132.19 ? 404 ALA B CA    1 
ATOM   7542  C  C     . ALA B 1 425 ? 14.414  -17.805 116.769 1.00 125.47 ? 404 ALA B C     1 
ATOM   7543  O  O     . ALA B 1 425 ? 13.575  -17.999 115.887 1.00 118.62 ? 404 ALA B O     1 
ATOM   7544  C  CB    . ALA B 1 425 ? 16.776  -17.826 115.996 1.00 154.65 ? 404 ALA B CB    1 
ATOM   7545  N  N     . ALA B 1 426 ? 14.308  -16.831 117.679 1.00 144.26 ? 405 ALA B N     1 
ATOM   7546  C  CA    . ALA B 1 426 ? 13.111  -16.114 118.130 1.00 160.38 ? 405 ALA B CA    1 
ATOM   7547  C  C     . ALA B 1 426 ? 12.710  -14.911 117.238 1.00 161.78 ? 405 ALA B C     1 
ATOM   7548  O  O     . ALA B 1 426 ? 11.984  -14.026 117.711 1.00 158.44 ? 405 ALA B O     1 
ATOM   7549  C  CB    . ALA B 1 426 ? 13.293  -15.643 119.574 1.00 172.11 ? 405 ALA B CB    1 
ATOM   7550  N  N     . ILE B 1 427 ? 13.187  -14.855 115.999 1.00 170.89 ? 406 ILE B N     1 
ATOM   7551  C  CA    . ILE B 1 427 ? 12.953  -13.795 115.010 1.00 164.70 ? 406 ILE B CA    1 
ATOM   7552  C  C     . ILE B 1 427 ? 11.491  -13.340 114.975 1.00 174.06 ? 406 ILE B C     1 
ATOM   7553  O  O     . ILE B 1 427 ? 10.586  -14.180 115.079 1.00 183.97 ? 406 ILE B O     1 
ATOM   7554  C  CB    . ILE B 1 427 ? 13.407  -14.300 113.630 1.00 140.88 ? 406 ILE B CB    1 
ATOM   7555  C  CG1   . ILE B 1 427 ? 14.731  -15.064 113.785 1.00 139.37 ? 406 ILE B CG1   1 
ATOM   7556  C  CG2   . ILE B 1 427 ? 13.503  -13.172 112.602 1.00 127.71 ? 406 ILE B CG2   1 
ATOM   7557  C  CD1   . ILE B 1 427 ? 15.907  -14.232 114.230 1.00 139.44 ? 406 ILE B CD1   1 
ATOM   7558  N  N     . PRO B 1 428 ? 11.212  -12.027 114.911 1.00 167.46 ? 407 PRO B N     1 
ATOM   7559  C  CA    . PRO B 1 428 ? 9.821   -11.557 114.977 1.00 170.88 ? 407 PRO B CA    1 
ATOM   7560  C  C     . PRO B 1 428 ? 8.983   -12.140 113.855 1.00 194.63 ? 407 PRO B C     1 
ATOM   7561  O  O     . PRO B 1 428 ? 9.406   -12.192 112.696 1.00 193.60 ? 407 PRO B O     1 
ATOM   7562  C  CB    . PRO B 1 428 ? 9.949   -10.037 114.813 1.00 168.14 ? 407 PRO B CB    1 
ATOM   7563  C  CG    . PRO B 1 428 ? 11.313  -9.721  115.221 1.00 167.49 ? 407 PRO B CG    1 
ATOM   7564  C  CD    . PRO B 1 428 ? 12.142  -10.894 114.772 1.00 171.55 ? 407 PRO B CD    1 
ATOM   7565  N  N     . GLY B 1 429 ? 7.780   -12.580 114.209 1.00 183.52 ? 408 GLY B N     1 
ATOM   7566  C  CA    . GLY B 1 429 ? 6.914   -13.181 113.225 1.00 177.91 ? 408 GLY B CA    1 
ATOM   7567  C  C     . GLY B 1 429 ? 7.356   -14.535 112.720 1.00 165.14 ? 408 GLY B C     1 
ATOM   7568  O  O     . GLY B 1 429 ? 6.739   -15.046 111.782 1.00 181.16 ? 408 GLY B O     1 
ATOM   7569  N  N     . ALA B 1 430 ? 8.444   -15.101 113.258 1.00 154.11 ? 409 ALA B N     1 
ATOM   7570  C  CA    . ALA B 1 430 ? 8.871   -16.457 112.923 1.00 152.77 ? 409 ALA B CA    1 
ATOM   7571  C  C     . ALA B 1 430 ? 8.163   -17.543 113.729 1.00 141.18 ? 409 ALA B C     1 
ATOM   7572  O  O     . ALA B 1 430 ? 8.143   -18.697 113.285 1.00 150.34 ? 409 ALA B O     1 
ATOM   7573  C  CB    . ALA B 1 430 ? 10.383  -16.604 113.103 1.00 168.62 ? 409 ALA B CB    1 
ATOM   7574  N  N     . PHE B 1 431 ? 7.650   -17.234 114.923 1.00 139.88 ? 410 PHE B N     1 
ATOM   7575  C  CA    . PHE B 1 431 ? 6.808   -18.171 115.666 1.00 143.73 ? 410 PHE B CA    1 
ATOM   7576  C  C     . PHE B 1 431 ? 5.645   -17.426 116.303 1.00 165.98 ? 410 PHE B C     1 
ATOM   7577  O  O     . PHE B 1 431 ? 5.866   -16.484 117.074 1.00 155.53 ? 410 PHE B O     1 
ATOM   7578  C  CB    . PHE B 1 431 ? 7.611   -18.920 116.734 1.00 124.98 ? 410 PHE B CB    1 
ATOM   7579  C  CG    . PHE B 1 431 ? 8.719   -19.722 116.182 1.00 114.88 ? 410 PHE B CG    1 
ATOM   7580  C  CD1   . PHE B 1 431 ? 8.540   -21.048 115.909 1.00 113.16 ? 410 PHE B CD1   1 
ATOM   7581  C  CD2   . PHE B 1 431 ? 9.913   -19.143 115.875 1.00 117.99 ? 410 PHE B CD2   1 
ATOM   7582  C  CE1   . PHE B 1 431 ? 9.554   -21.794 115.363 1.00 122.97 ? 410 PHE B CE1   1 
ATOM   7583  C  CE2   . PHE B 1 431 ? 10.932  -19.882 115.335 1.00 142.09 ? 410 PHE B CE2   1 
ATOM   7584  C  CZ    . PHE B 1 431 ? 10.751  -21.215 115.080 1.00 133.77 ? 410 PHE B CZ    1 
ATOM   7585  N  N     . PHE B 1 432 ? 4.412   -17.781 115.922 1.00 164.63 ? 411 PHE B N     1 
ATOM   7586  C  CA    . PHE B 1 432 ? 3.239   -17.285 116.632 1.00 158.44 ? 411 PHE B CA    1 
ATOM   7587  C  C     . PHE B 1 432 ? 2.489   -18.334 117.463 1.00 150.21 ? 411 PHE B C     1 
ATOM   7588  O  O     . PHE B 1 432 ? 1.546   -17.968 118.168 1.00 160.13 ? 411 PHE B O     1 
ATOM   7589  C  CB    . PHE B 1 432 ? 2.270   -16.599 115.656 1.00 146.54 ? 411 PHE B CB    1 
ATOM   7590  C  CG    . PHE B 1 432 ? 2.489   -16.956 114.214 1.00 136.25 ? 411 PHE B CG    1 
ATOM   7591  C  CD1   . PHE B 1 432 ? 1.797   -18.001 113.640 1.00 160.19 ? 411 PHE B CD1   1 
ATOM   7592  C  CD2   . PHE B 1 432 ? 3.366   -16.228 113.427 1.00 122.41 ? 411 PHE B CD2   1 
ATOM   7593  C  CE1   . PHE B 1 432 ? 1.988   -18.332 112.318 1.00 178.21 ? 411 PHE B CE1   1 
ATOM   7594  C  CE2   . PHE B 1 432 ? 3.566   -16.554 112.108 1.00 130.90 ? 411 PHE B CE2   1 
ATOM   7595  C  CZ    . PHE B 1 432 ? 2.876   -17.610 111.550 1.00 160.66 ? 411 PHE B CZ    1 
ATOM   7596  N  N     . HIS B 1 433 ? 2.878   -19.615 117.449 1.00 130.38 ? 412 HIS B N     1 
ATOM   7597  C  CA    . HIS B 1 433 ? 2.081   -20.537 118.261 1.00 119.80 ? 412 HIS B CA    1 
ATOM   7598  C  C     . HIS B 1 433 ? 2.911   -21.727 118.728 1.00 131.33 ? 412 HIS B C     1 
ATOM   7599  O  O     . HIS B 1 433 ? 4.080   -21.831 118.342 1.00 167.53 ? 412 HIS B O     1 
ATOM   7600  C  CB    . HIS B 1 433 ? 0.848   -20.995 117.473 1.00 128.68 ? 412 HIS B CB    1 
ATOM   7601  C  CG    . HIS B 1 433 ? 1.151   -21.612 116.147 1.00 133.20 ? 412 HIS B CG    1 
ATOM   7602  N  ND1   . HIS B 1 433 ? 1.771   -22.836 116.022 1.00 145.04 ? 412 HIS B ND1   1 
ATOM   7603  C  CD2   . HIS B 1 433 ? 0.865   -21.204 114.887 1.00 123.26 ? 412 HIS B CD2   1 
ATOM   7604  C  CE1   . HIS B 1 433 ? 1.891   -23.138 114.741 1.00 148.70 ? 412 HIS B CE1   1 
ATOM   7605  N  NE2   . HIS B 1 433 ? 1.344   -22.167 114.031 1.00 138.66 ? 412 HIS B NE2   1 
ATOM   7606  N  N     . PRO B 1 434 ? 2.386   -22.635 119.562 1.00 121.01 ? 413 PRO B N     1 
ATOM   7607  C  CA    . PRO B 1 434 ? 3.233   -23.742 120.050 1.00 139.94 ? 413 PRO B CA    1 
ATOM   7608  C  C     . PRO B 1 434 ? 3.535   -24.803 119.013 1.00 158.02 ? 413 PRO B C     1 
ATOM   7609  O  O     . PRO B 1 434 ? 4.474   -25.585 119.214 1.00 163.95 ? 413 PRO B O     1 
ATOM   7610  C  CB    . PRO B 1 434 ? 2.421   -24.333 121.207 1.00 134.52 ? 413 PRO B CB    1 
ATOM   7611  C  CG    . PRO B 1 434 ? 1.059   -23.903 120.960 1.00 116.36 ? 413 PRO B CG    1 
ATOM   7612  C  CD    . PRO B 1 434 ? 1.108   -22.589 120.288 1.00 116.52 ? 413 PRO B CD    1 
ATOM   7613  N  N     . PHE B 1 435 ? 2.787   -24.834 117.913 1.00 151.35 ? 414 PHE B N     1 
ATOM   7614  C  CA    . PHE B 1 435 ? 2.739   -25.954 116.982 1.00 138.25 ? 414 PHE B CA    1 
ATOM   7615  C  C     . PHE B 1 435 ? 3.624   -25.776 115.758 1.00 137.19 ? 414 PHE B C     1 
ATOM   7616  O  O     . PHE B 1 435 ? 3.418   -26.460 114.747 1.00 121.50 ? 414 PHE B O     1 
ATOM   7617  C  CB    . PHE B 1 435 ? 1.296   -26.217 116.615 1.00 133.07 ? 414 PHE B CB    1 
ATOM   7618  C  CG    . PHE B 1 435 ? 0.432   -26.340 117.824 1.00 146.96 ? 414 PHE B CG    1 
ATOM   7619  C  CD1   . PHE B 1 435 ? 0.517   -27.473 118.626 1.00 154.69 ? 414 PHE B CD1   1 
ATOM   7620  C  CD2   . PHE B 1 435 ? -0.420  -25.318 118.196 1.00 126.29 ? 414 PHE B CD2   1 
ATOM   7621  C  CE1   . PHE B 1 435 ? -0.250  -27.598 119.754 1.00 131.40 ? 414 PHE B CE1   1 
ATOM   7622  C  CE2   . PHE B 1 435 ? -1.205  -25.447 119.311 1.00 114.27 ? 414 PHE B CE2   1 
ATOM   7623  C  CZ    . PHE B 1 435 ? -1.113  -26.589 120.095 1.00 127.90 ? 414 PHE B CZ    1 
ATOM   7624  N  N     . HIS B 1 436 ? 4.553   -24.828 115.798 1.00 145.45 ? 415 HIS B N     1 
ATOM   7625  C  CA    . HIS B 1 436 ? 5.475   -24.669 114.688 1.00 132.31 ? 415 HIS B CA    1 
ATOM   7626  C  C     . HIS B 1 436 ? 6.484   -25.815 114.666 1.00 131.55 ? 415 HIS B C     1 
ATOM   7627  O  O     . HIS B 1 436 ? 7.274   -26.009 115.608 1.00 116.78 ? 415 HIS B O     1 
ATOM   7628  C  CB    . HIS B 1 436 ? 6.208   -23.340 114.780 1.00 118.33 ? 415 HIS B CB    1 
ATOM   7629  C  CG    . HIS B 1 436 ? 5.396   -22.152 114.373 1.00 134.13 ? 415 HIS B CG    1 
ATOM   7630  N  ND1   . HIS B 1 436 ? 5.117   -21.865 113.053 1.00 156.32 ? 415 HIS B ND1   1 
ATOM   7631  C  CD2   . HIS B 1 436 ? 4.951   -21.090 115.088 1.00 124.56 ? 415 HIS B CD2   1 
ATOM   7632  C  CE1   . HIS B 1 436 ? 4.456   -20.722 112.983 1.00 149.07 ? 415 HIS B CE1   1 
ATOM   7633  N  NE2   . HIS B 1 436 ? 4.355   -20.223 114.203 1.00 122.67 ? 415 HIS B NE2   1 
ATOM   7634  N  N     . SER B 1 437 ? 6.458   -26.556 113.561 1.00 118.89 ? 416 SER B N     1 
ATOM   7635  C  CA    . SER B 1 437 ? 7.470   -27.553 113.285 1.00 106.10 ? 416 SER B CA    1 
ATOM   7636  C  C     . SER B 1 437 ? 8.711   -26.904 112.730 1.00 115.83 ? 416 SER B C     1 
ATOM   7637  O  O     . SER B 1 437 ? 9.822   -27.391 112.952 1.00 161.02 ? 416 SER B O     1 
ATOM   7638  C  CB    . SER B 1 437 ? 6.929   -28.541 112.264 1.00 126.33 ? 416 SER B CB    1 
ATOM   7639  O  OG    . SER B 1 437 ? 6.612   -27.833 111.076 1.00 127.76 ? 416 SER B OG    1 
ATOM   7640  N  N     . ALA B 1 438 ? 8.534   -25.790 112.041 1.00 106.27 ? 417 ALA B N     1 
ATOM   7641  C  CA    . ALA B 1 438 ? 9.628   -24.978 111.532 1.00 116.67 ? 417 ALA B CA    1 
ATOM   7642  C  C     . ALA B 1 438 ? 9.178   -23.529 111.582 1.00 132.38 ? 417 ALA B C     1 
ATOM   7643  O  O     . ALA B 1 438 ? 7.975   -23.252 111.546 1.00 151.59 ? 417 ALA B O     1 
ATOM   7644  C  CB    . ALA B 1 438 ? 9.999   -25.371 110.099 1.00 105.64 ? 417 ALA B CB    1 
ATOM   7645  N  N     . PRO B 1 439 ? 10.112  -22.583 111.647 1.00 111.84 ? 418 PRO B N     1 
ATOM   7646  C  CA    . PRO B 1 439 ? 9.714   -21.176 111.614 1.00 113.11 ? 418 PRO B CA    1 
ATOM   7647  C  C     . PRO B 1 439 ? 8.886   -20.929 110.367 1.00 132.40 ? 418 PRO B C     1 
ATOM   7648  O  O     . PRO B 1 439 ? 8.942   -21.687 109.393 1.00 111.42 ? 418 PRO B O     1 
ATOM   7649  C  CB    . PRO B 1 439 ? 11.041  -20.419 111.556 1.00 114.20 ? 418 PRO B CB    1 
ATOM   7650  C  CG    . PRO B 1 439 ? 12.022  -21.434 111.055 1.00 124.74 ? 418 PRO B CG    1 
ATOM   7651  C  CD    . PRO B 1 439 ? 11.572  -22.742 111.617 1.00 112.05 ? 418 PRO B CD    1 
ATOM   7652  N  N     . ALA B 1 440 ? 8.052   -19.893 110.435 1.00 135.55 ? 419 ALA B N     1 
ATOM   7653  C  CA    . ALA B 1 440 ? 7.168   -19.609 109.314 1.00 135.66 ? 419 ALA B CA    1 
ATOM   7654  C  C     . ALA B 1 440 ? 7.918   -19.026 108.121 1.00 121.77 ? 419 ALA B C     1 
ATOM   7655  O  O     . ALA B 1 440 ? 7.464   -19.169 106.981 1.00 128.06 ? 419 ALA B O     1 
ATOM   7656  C  CB    . ALA B 1 440 ? 6.049   -18.675 109.759 1.00 156.17 ? 419 ALA B CB    1 
ATOM   7657  N  N     . ASP B 1 441 ? 9.064   -18.392 108.347 1.00 114.60 ? 420 ASP B N     1 
ATOM   7658  C  CA    . ASP B 1 441 ? 9.808   -17.764 107.262 1.00 134.90 ? 420 ASP B CA    1 
ATOM   7659  C  C     . ASP B 1 441 ? 10.809  -18.712 106.615 1.00 136.29 ? 420 ASP B C     1 
ATOM   7660  O  O     . ASP B 1 441 ? 11.693  -18.245 105.894 1.00 162.93 ? 420 ASP B O     1 
ATOM   7661  C  CB    . ASP B 1 441 ? 10.510  -16.456 107.708 1.00 149.28 ? 420 ASP B CB    1 
ATOM   7662  C  CG    . ASP B 1 441 ? 11.449  -16.622 108.894 1.00 145.12 ? 420 ASP B CG    1 
ATOM   7663  O  OD1   . ASP B 1 441 ? 12.477  -15.913 108.905 1.00 125.47 ? 420 ASP B OD1   1 
ATOM   7664  O  OD2   . ASP B 1 441 ? 11.172  -17.432 109.806 1.00 164.70 ? 420 ASP B OD2   1 
ATOM   7665  N  N     . LEU B 1 442 ? 10.726  -20.016 106.902 1.00 131.86 ? 421 LEU B N     1 
ATOM   7666  C  CA    . LEU B 1 442 ? 11.755  -20.955 106.456 1.00 136.93 ? 421 LEU B CA    1 
ATOM   7667  C  C     . LEU B 1 442 ? 12.094  -20.777 104.979 1.00 129.93 ? 421 LEU B C     1 
ATOM   7668  O  O     . LEU B 1 442 ? 13.272  -20.738 104.604 1.00 121.95 ? 421 LEU B O     1 
ATOM   7669  C  CB    . LEU B 1 442 ? 11.294  -22.392 106.684 1.00 130.10 ? 421 LEU B CB    1 
ATOM   7670  C  CG    . LEU B 1 442 ? 12.418  -23.331 106.257 1.00 106.46 ? 421 LEU B CG    1 
ATOM   7671  C  CD1   . LEU B 1 442 ? 13.615  -23.043 107.138 1.00 107.27 ? 421 LEU B CD1   1 
ATOM   7672  C  CD2   . LEU B 1 442 ? 12.025  -24.804 106.223 1.00 105.15 ? 421 LEU B CD2   1 
ATOM   7673  N  N     . HIS B 1 443 ? 11.078  -20.604 104.140 1.00 132.02 ? 422 HIS B N     1 
ATOM   7674  C  CA    . HIS B 1 443 ? 11.245  -20.480 102.700 1.00 128.54 ? 422 HIS B CA    1 
ATOM   7675  C  C     . HIS B 1 443 ? 11.489  -19.042 102.267 1.00 140.84 ? 422 HIS B C     1 
ATOM   7676  O  O     . HIS B 1 443 ? 11.382  -18.745 101.070 1.00 122.69 ? 422 HIS B O     1 
ATOM   7677  C  CB    . HIS B 1 443 ? 10.042  -21.068 101.966 1.00 133.65 ? 422 HIS B CB    1 
ATOM   7678  C  CG    . HIS B 1 443 ? 9.864   -22.532 102.211 1.00 136.06 ? 422 HIS B CG    1 
ATOM   7679  N  ND1   . HIS B 1 443 ? 10.912  -23.426 102.159 1.00 136.85 ? 422 HIS B ND1   1 
ATOM   7680  C  CD2   . HIS B 1 443 ? 8.759   -23.261 102.488 1.00 144.91 ? 422 HIS B CD2   1 
ATOM   7681  C  CE1   . HIS B 1 443 ? 10.463  -24.643 102.407 1.00 143.74 ? 422 HIS B CE1   1 
ATOM   7682  N  NE2   . HIS B 1 443 ? 9.159   -24.570 102.610 1.00 150.07 ? 422 HIS B NE2   1 
ATOM   7683  N  N     . SER B 1 444 ? 11.668  -18.127 103.225 1.00 146.36 ? 423 SER B N     1 
ATOM   7684  C  CA    . SER B 1 444 ? 12.059  -16.764 102.894 1.00 153.55 ? 423 SER B CA    1 
ATOM   7685  C  C     . SER B 1 444 ? 13.452  -16.766 102.285 1.00 160.58 ? 423 SER B C     1 
ATOM   7686  O  O     . SER B 1 444 ? 14.323  -17.560 102.662 1.00 157.39 ? 423 SER B O     1 
ATOM   7687  C  CB    . SER B 1 444 ? 12.083  -15.871 104.142 1.00 149.52 ? 423 SER B CB    1 
ATOM   7688  O  OG    . SER B 1 444 ? 10.869  -15.178 104.356 1.00 154.81 ? 423 SER B OG    1 
ATOM   7689  N  N     . ALA B 1 445 ? 13.659  -15.860 101.331 1.00 157.90 ? 424 ALA B N     1 
ATOM   7690  C  CA    . ALA B 1 445 ? 14.963  -15.789 100.694 1.00 166.35 ? 424 ALA B CA    1 
ATOM   7691  C  C     . ALA B 1 445 ? 15.982  -15.211 101.667 1.00 163.41 ? 424 ALA B C     1 
ATOM   7692  O  O     . ALA B 1 445 ? 17.161  -15.603 101.645 1.00 177.83 ? 424 ALA B O     1 
ATOM   7693  C  CB    . ALA B 1 445 ? 14.883  -14.980 99.398  1.00 163.00 ? 424 ALA B CB    1 
ATOM   7694  N  N     . ASP B 1 446 ? 15.528  -14.331 102.568 1.00 132.54 ? 425 ASP B N     1 
ATOM   7695  C  CA    . ASP B 1 446 ? 16.404  -13.667 103.520 1.00 157.76 ? 425 ASP B CA    1 
ATOM   7696  C  C     . ASP B 1 446 ? 16.562  -14.460 104.802 1.00 168.02 ? 425 ASP B C     1 
ATOM   7697  O  O     . ASP B 1 446 ? 17.234  -13.995 105.732 1.00 183.30 ? 425 ASP B O     1 
ATOM   7698  C  CB    . ASP B 1 446 ? 15.841  -12.291 103.892 1.00 168.26 ? 425 ASP B CB    1 
ATOM   7699  C  CG    . ASP B 1 446 ? 14.490  -12.378 104.638 1.00 177.47 ? 425 ASP B CG    1 
ATOM   7700  O  OD1   . ASP B 1 446 ? 13.940  -11.309 104.993 1.00 198.94 ? 425 ASP B OD1   1 
ATOM   7701  O  OD2   . ASP B 1 446 ? 13.976  -13.489 104.891 1.00 155.83 ? 425 ASP B OD2   1 
ATOM   7702  N  N     . PHE B 1 447 ? 15.946  -15.637 104.867 1.00 176.46 ? 426 PHE B N     1 
ATOM   7703  C  CA    . PHE B 1 447 ? 16.031  -16.457 106.062 1.00 158.05 ? 426 PHE B CA    1 
ATOM   7704  C  C     . PHE B 1 447 ? 17.473  -16.631 106.526 1.00 129.66 ? 426 PHE B C     1 
ATOM   7705  O  O     . PHE B 1 447 ? 17.752  -16.561 107.730 1.00 117.49 ? 426 PHE B O     1 
ATOM   7706  C  CB    . PHE B 1 447 ? 15.335  -17.784 105.796 1.00 146.69 ? 426 PHE B CB    1 
ATOM   7707  C  CG    . PHE B 1 447 ? 15.575  -18.791 106.841 1.00 127.63 ? 426 PHE B CG    1 
ATOM   7708  C  CD1   . PHE B 1 447 ? 14.956  -18.665 108.070 1.00 115.54 ? 426 PHE B CD1   1 
ATOM   7709  C  CD2   . PHE B 1 447 ? 16.372  -19.886 106.587 1.00 111.72 ? 426 PHE B CD2   1 
ATOM   7710  C  CE1   . PHE B 1 447 ? 15.158  -19.585 109.043 1.00 133.92 ? 426 PHE B CE1   1 
ATOM   7711  C  CE2   . PHE B 1 447 ? 16.587  -20.811 107.553 1.00 131.43 ? 426 PHE B CE2   1 
ATOM   7712  C  CZ    . PHE B 1 447 ? 15.977  -20.664 108.794 1.00 151.90 ? 426 PHE B CZ    1 
ATOM   7713  N  N     . ARG B 1 448 ? 18.405  -16.812 105.577 1.00 138.44 ? 427 ARG B N     1 
ATOM   7714  C  CA    . ARG B 1 448 ? 19.818  -16.961 105.923 1.00 135.60 ? 427 ARG B CA    1 
ATOM   7715  C  C     . ARG B 1 448 ? 20.323  -15.716 106.622 1.00 151.57 ? 427 ARG B C     1 
ATOM   7716  O  O     . ARG B 1 448 ? 20.874  -15.775 107.728 1.00 135.44 ? 427 ARG B O     1 
ATOM   7717  C  CB    . ARG B 1 448 ? 20.668  -17.193 104.659 1.00 121.00 ? 427 ARG B CB    1 
ATOM   7718  C  CG    . ARG B 1 448 ? 21.882  -18.124 104.881 1.00 153.72 ? 427 ARG B CG    1 
ATOM   7719  C  CD    . ARG B 1 448 ? 23.131  -17.422 105.478 1.00 168.60 ? 427 ARG B CD    1 
ATOM   7720  N  NE    . ARG B 1 448 ? 24.373  -18.204 105.371 1.00 149.43 ? 427 ARG B NE    1 
ATOM   7721  C  CZ    . ARG B 1 448 ? 25.437  -18.018 106.154 1.00 148.55 ? 427 ARG B CZ    1 
ATOM   7722  N  NH1   . ARG B 1 448 ? 25.404  -17.095 107.105 1.00 149.75 ? 427 ARG B NH1   1 
ATOM   7723  N  NH2   . ARG B 1 448 ? 26.527  -18.761 106.008 1.00 141.85 ? 427 ARG B NH2   1 
ATOM   7724  N  N     . GLN B 1 449 ? 20.100  -14.571 105.982 1.00 163.10 ? 428 GLN B N     1 
ATOM   7725  C  CA    . GLN B 1 449 ? 20.640  -13.289 106.415 1.00 180.63 ? 428 GLN B CA    1 
ATOM   7726  C  C     . GLN B 1 449 ? 20.056  -12.849 107.756 1.00 165.67 ? 428 GLN B C     1 
ATOM   7727  O  O     . GLN B 1 449 ? 20.790  -12.329 108.606 1.00 156.52 ? 428 GLN B O     1 
ATOM   7728  C  CB    . GLN B 1 449 ? 20.393  -12.267 105.297 1.00 194.94 ? 428 GLN B CB    1 
ATOM   7729  C  CG    . GLN B 1 449 ? 21.123  -10.933 105.366 1.00 194.27 ? 428 GLN B CG    1 
ATOM   7730  C  CD    . GLN B 1 449 ? 20.448  -9.867  104.490 1.00 194.25 ? 428 GLN B CD    1 
ATOM   7731  O  OE1   . GLN B 1 449 ? 19.316  -10.049 104.031 1.00 187.13 ? 428 GLN B OE1   1 
ATOM   7732  N  NE2   . GLN B 1 449 ? 21.148  -8.757  104.252 1.00 190.56 ? 428 GLN B NE2   1 
ATOM   7733  N  N     . ARG B 1 450 ? 18.751  -13.074 107.979 1.00 166.34 ? 429 ARG B N     1 
ATOM   7734  C  CA    . ARG B 1 450 ? 18.125  -12.647 109.233 1.00 146.22 ? 429 ARG B CA    1 
ATOM   7735  C  C     . ARG B 1 450 ? 18.862  -13.207 110.447 1.00 142.80 ? 429 ARG B C     1 
ATOM   7736  O  O     . ARG B 1 450 ? 18.969  -12.539 111.483 1.00 127.32 ? 429 ARG B O     1 
ATOM   7737  C  CB    . ARG B 1 450 ? 16.650  -13.080 109.268 1.00 142.67 ? 429 ARG B CB    1 
ATOM   7738  C  CG    . ARG B 1 450 ? 15.748  -12.395 108.255 1.00 145.71 ? 429 ARG B CG    1 
ATOM   7739  C  CD    . ARG B 1 450 ? 14.269  -12.797 108.402 1.00 166.35 ? 429 ARG B CD    1 
ATOM   7740  N  NE    . ARG B 1 450 ? 13.495  -12.054 109.401 1.00 183.02 ? 429 ARG B NE    1 
ATOM   7741  C  CZ    . ARG B 1 450 ? 12.167  -12.121 109.504 1.00 200.83 ? 429 ARG B CZ    1 
ATOM   7742  N  NH1   . ARG B 1 450 ? 11.470  -12.889 108.673 1.00 203.63 ? 429 ARG B NH1   1 
ATOM   7743  N  NH2   . ARG B 1 450 ? 11.530  -11.423 110.436 1.00 198.14 ? 429 ARG B NH2   1 
ATOM   7744  N  N     . ARG B 1 451 ? 19.321  -14.451 110.356 1.00 149.67 ? 430 ARG B N     1 
ATOM   7745  C  CA    . ARG B 1 451 ? 20.003  -15.131 111.445 1.00 142.83 ? 430 ARG B CA    1 
ATOM   7746  C  C     . ARG B 1 451 ? 21.514  -15.216 111.255 1.00 161.15 ? 430 ARG B C     1 
ATOM   7747  O  O     . ARG B 1 451 ? 22.191  -15.836 112.085 1.00 172.23 ? 430 ARG B O     1 
ATOM   7748  C  CB    . ARG B 1 451 ? 19.401  -16.517 111.617 1.00 136.27 ? 430 ARG B CB    1 
ATOM   7749  C  CG    . ARG B 1 451 ? 17.892  -16.454 111.680 1.00 133.16 ? 430 ARG B CG    1 
ATOM   7750  C  CD    . ARG B 1 451 ? 17.294  -17.771 111.306 1.00 135.23 ? 430 ARG B CD    1 
ATOM   7751  N  NE    . ARG B 1 451 ? 16.067  -18.038 112.044 1.00 127.78 ? 430 ARG B NE    1 
ATOM   7752  C  CZ    . ARG B 1 451 ? 14.870  -17.607 111.669 1.00 128.67 ? 430 ARG B CZ    1 
ATOM   7753  N  NH1   . ARG B 1 451 ? 14.750  -16.877 110.562 1.00 130.35 ? 430 ARG B NH1   1 
ATOM   7754  N  NH2   . ARG B 1 451 ? 13.801  -17.899 112.404 1.00 123.32 ? 430 ARG B NH2   1 
ATOM   7755  N  N     . ALA B 1 452 ? 22.058  -14.581 110.205 1.00 158.79 ? 431 ALA B N     1 
ATOM   7756  C  CA    . ALA B 1 452 ? 23.401  -14.897 109.707 1.00 154.46 ? 431 ALA B CA    1 
ATOM   7757  C  C     . ALA B 1 452 ? 24.457  -14.981 110.805 1.00 157.41 ? 431 ALA B C     1 
ATOM   7758  O  O     . ALA B 1 452 ? 25.500  -15.612 110.603 1.00 172.57 ? 431 ALA B O     1 
ATOM   7759  C  CB    . ALA B 1 452 ? 23.823  -13.874 108.650 1.00 149.21 ? 431 ALA B CB    1 
ATOM   7760  N  N     . ALA B 1 453 ? 24.253  -14.292 111.931 1.00 152.95 ? 432 ALA B N     1 
ATOM   7761  C  CA    . ALA B 1 453 ? 25.106  -14.510 113.100 1.00 151.44 ? 432 ALA B CA    1 
ATOM   7762  C  C     . ALA B 1 453 ? 25.032  -15.959 113.563 1.00 167.33 ? 432 ALA B C     1 
ATOM   7763  O  O     . ALA B 1 453 ? 26.047  -16.664 113.604 1.00 169.31 ? 432 ALA B O     1 
ATOM   7764  C  CB    . ALA B 1 453 ? 24.719  -13.577 114.246 1.00 157.09 ? 432 ALA B CB    1 
ATOM   7765  N  N     . LEU B 1 454 ? 23.829  -16.415 113.946 1.00 174.16 ? 433 LEU B N     1 
ATOM   7766  C  CA    . LEU B 1 454 ? 23.701  -17.746 114.535 1.00 158.33 ? 433 LEU B CA    1 
ATOM   7767  C  C     . LEU B 1 454 ? 24.093  -18.813 113.527 1.00 151.16 ? 433 LEU B C     1 
ATOM   7768  O  O     . LEU B 1 454 ? 24.580  -19.883 113.908 1.00 158.66 ? 433 LEU B O     1 
ATOM   7769  C  CB    . LEU B 1 454 ? 22.267  -18.011 115.011 1.00 125.91 ? 433 LEU B CB    1 
ATOM   7770  C  CG    . LEU B 1 454 ? 21.654  -17.210 116.164 1.00 126.91 ? 433 LEU B CG    1 
ATOM   7771  C  CD1   . LEU B 1 454 ? 21.224  -15.803 115.678 1.00 143.67 ? 433 LEU B CD1   1 
ATOM   7772  C  CD2   . LEU B 1 454 ? 20.525  -17.950 116.884 1.00 125.52 ? 433 LEU B CD2   1 
ATOM   7773  N  N     . PHE B 1 455 ? 23.904  -18.526 112.237 1.00 134.79 ? 434 PHE B N     1 
ATOM   7774  C  CA    . PHE B 1 455 ? 24.320  -19.463 111.208 1.00 139.78 ? 434 PHE B CA    1 
ATOM   7775  C  C     . PHE B 1 455 ? 25.830  -19.458 111.062 1.00 169.10 ? 434 PHE B C     1 
ATOM   7776  O  O     . PHE B 1 455 ? 26.447  -20.507 110.841 1.00 184.52 ? 434 PHE B O     1 
ATOM   7777  C  CB    . PHE B 1 455 ? 23.633  -19.128 109.896 1.00 134.52 ? 434 PHE B CB    1 
ATOM   7778  C  CG    . PHE B 1 455 ? 22.355  -19.872 109.721 1.00 153.10 ? 434 PHE B CG    1 
ATOM   7779  C  CD1   . PHE B 1 455 ? 22.364  -21.251 109.579 1.00 140.64 ? 434 PHE B CD1   1 
ATOM   7780  C  CD2   . PHE B 1 455 ? 21.143  -19.211 109.736 1.00 162.39 ? 434 PHE B CD2   1 
ATOM   7781  C  CE1   . PHE B 1 455 ? 21.190  -21.947 109.426 1.00 128.70 ? 434 PHE B CE1   1 
ATOM   7782  C  CE2   . PHE B 1 455 ? 19.961  -19.904 109.587 1.00 150.60 ? 434 PHE B CE2   1 
ATOM   7783  C  CZ    . PHE B 1 455 ? 19.984  -21.273 109.431 1.00 140.90 ? 434 PHE B CZ    1 
ATOM   7784  N  N     . GLU B 1 456 ? 26.443  -18.287 111.198 1.00 156.57 ? 435 GLU B N     1 
ATOM   7785  C  CA    . GLU B 1 456 ? 27.894  -18.238 111.191 1.00 154.92 ? 435 GLU B CA    1 
ATOM   7786  C  C     . GLU B 1 456 ? 28.505  -18.953 112.395 1.00 146.29 ? 435 GLU B C     1 
ATOM   7787  O  O     . GLU B 1 456 ? 29.591  -19.529 112.271 1.00 181.22 ? 435 GLU B O     1 
ATOM   7788  C  CB    . GLU B 1 456 ? 28.353  -16.784 111.131 1.00 168.47 ? 435 GLU B CB    1 
ATOM   7789  C  CG    . GLU B 1 456 ? 29.716  -16.648 110.535 1.00 192.36 ? 435 GLU B CG    1 
ATOM   7790  C  CD    . GLU B 1 456 ? 29.795  -17.355 109.197 1.00 217.97 ? 435 GLU B CD    1 
ATOM   7791  O  OE1   . GLU B 1 456 ? 28.837  -17.232 108.390 1.00 217.19 ? 435 GLU B OE1   1 
ATOM   7792  O  OE2   . GLU B 1 456 ? 30.806  -18.051 108.964 1.00 231.61 ? 435 GLU B OE2   1 
ATOM   7793  N  N     . ALA B 1 457 ? 27.833  -18.947 113.557 1.00 132.63 ? 436 ALA B N     1 
ATOM   7794  C  CA    . ALA B 1 457 ? 28.366  -19.631 114.743 1.00 148.06 ? 436 ALA B CA    1 
ATOM   7795  C  C     . ALA B 1 457 ? 28.160  -21.145 114.682 1.00 173.52 ? 436 ALA B C     1 
ATOM   7796  O  O     . ALA B 1 457 ? 29.086  -21.928 114.950 1.00 168.33 ? 436 ALA B O     1 
ATOM   7797  C  CB    . ALA B 1 457 ? 27.743  -19.059 116.019 1.00 145.26 ? 436 ALA B CB    1 
ATOM   7798  N  N     . CYS B 1 458 ? 26.941  -21.571 114.346 1.00 165.76 ? 437 CYS B N     1 
ATOM   7799  C  CA    . CYS B 1 458 ? 26.650  -22.999 114.253 1.00 163.87 ? 437 CYS B CA    1 
ATOM   7800  C  C     . CYS B 1 458 ? 27.486  -23.647 113.155 1.00 150.88 ? 437 CYS B C     1 
ATOM   7801  O  O     . CYS B 1 458 ? 28.042  -24.734 113.344 1.00 161.06 ? 437 CYS B O     1 
ATOM   7802  C  CB    . CYS B 1 458 ? 25.152  -23.218 114.009 1.00 176.77 ? 437 CYS B CB    1 
ATOM   7803  S  SG    . CYS B 1 458 ? 24.044  -22.977 115.461 1.00 183.15 ? 437 CYS B SG    1 
ATOM   7804  N  N     . LEU B 1 459 ? 27.558  -23.008 111.982 1.00 155.53 ? 438 LEU B N     1 
ATOM   7805  C  CA    . LEU B 1 459 ? 28.499  -23.462 110.962 1.00 153.49 ? 438 LEU B CA    1 
ATOM   7806  C  C     . LEU B 1 459 ? 29.946  -23.349 111.434 1.00 162.99 ? 438 LEU B C     1 
ATOM   7807  O  O     . LEU B 1 459 ? 30.810  -24.123 111.000 1.00 133.59 ? 438 LEU B O     1 
ATOM   7808  C  CB    . LEU B 1 459 ? 28.308  -22.638 109.696 1.00 144.89 ? 438 LEU B CB    1 
ATOM   7809  C  CG    . LEU B 1 459 ? 26.977  -22.784 108.979 1.00 138.36 ? 438 LEU B CG    1 
ATOM   7810  C  CD1   . LEU B 1 459 ? 26.941  -21.803 107.811 1.00 147.71 ? 438 LEU B CD1   1 
ATOM   7811  C  CD2   . LEU B 1 459 ? 26.815  -24.218 108.511 1.00 128.25 ? 438 LEU B CD2   1 
ATOM   7812  N  N     . GLY B 1 460 ? 30.221  -22.390 112.321 1.00 165.79 ? 439 GLY B N     1 
ATOM   7813  C  CA    . GLY B 1 460 ? 31.545  -22.267 112.908 1.00 157.96 ? 439 GLY B CA    1 
ATOM   7814  C  C     . GLY B 1 460 ? 31.983  -23.491 113.688 1.00 158.88 ? 439 GLY B C     1 
ATOM   7815  O  O     . GLY B 1 460 ? 33.164  -23.857 113.665 1.00 163.87 ? 439 GLY B O     1 
ATOM   7816  N  N     . ARG B 1 461 ? 31.047  -24.144 114.397 1.00 165.44 ? 440 ARG B N     1 
ATOM   7817  C  CA    . ARG B 1 461 ? 31.459  -25.346 115.129 1.00 146.86 ? 440 ARG B CA    1 
ATOM   7818  C  C     . ARG B 1 461 ? 32.022  -26.432 114.202 1.00 154.95 ? 440 ARG B C     1 
ATOM   7819  O  O     . ARG B 1 461 ? 32.571  -27.417 114.702 1.00 184.64 ? 440 ARG B O     1 
ATOM   7820  C  CB    . ARG B 1 461 ? 30.322  -25.930 116.019 1.00 129.21 ? 440 ARG B CB    1 
ATOM   7821  C  CG    . ARG B 1 461 ? 29.559  -24.970 116.986 1.00 130.13 ? 440 ARG B CG    1 
ATOM   7822  C  CD    . ARG B 1 461 ? 30.341  -24.639 118.296 1.00 169.10 ? 440 ARG B CD    1 
ATOM   7823  N  NE    . ARG B 1 461 ? 31.384  -23.601 118.115 1.00 206.61 ? 440 ARG B NE    1 
ATOM   7824  C  CZ    . ARG B 1 461 ? 31.996  -22.919 119.097 1.00 200.11 ? 440 ARG B CZ    1 
ATOM   7825  N  NH1   . ARG B 1 461 ? 31.691  -23.146 120.368 1.00 204.86 ? 440 ARG B NH1   1 
ATOM   7826  N  NH2   . ARG B 1 461 ? 32.921  -21.998 118.813 1.00 162.07 ? 440 ARG B NH2   1 
ATOM   7827  N  N     . LEU B 1 462 ? 31.906  -26.280 112.877 1.00 136.40 ? 441 LEU B N     1 
ATOM   7828  C  CA    . LEU B 1 462 ? 32.504  -27.222 111.933 1.00 126.92 ? 441 LEU B CA    1 
ATOM   7829  C  C     . LEU B 1 462 ? 34.002  -27.106 111.759 1.00 144.26 ? 441 LEU B C     1 
ATOM   7830  O  O     . LEU B 1 462 ? 34.638  -28.104 111.414 1.00 157.79 ? 441 LEU B O     1 
ATOM   7831  C  CB    . LEU B 1 462 ? 31.954  -27.021 110.537 1.00 124.66 ? 441 LEU B CB    1 
ATOM   7832  C  CG    . LEU B 1 462 ? 30.742  -27.747 110.071 1.00 121.80 ? 441 LEU B CG    1 
ATOM   7833  C  CD1   . LEU B 1 462 ? 30.319  -27.071 108.798 1.00 120.51 ? 441 LEU B CD1   1 
ATOM   7834  C  CD2   . LEU B 1 462 ? 31.280  -29.123 109.808 1.00 122.37 ? 441 LEU B CD2   1 
ATOM   7835  N  N     . GLU B 1 463 ? 34.581  -25.917 111.905 1.00 158.45 ? 442 GLU B N     1 
ATOM   7836  C  CA    . GLU B 1 463 ? 35.976  -25.786 111.493 1.00 158.07 ? 442 GLU B CA    1 
ATOM   7837  C  C     . GLU B 1 463 ? 36.940  -26.292 112.554 1.00 155.28 ? 442 GLU B C     1 
ATOM   7838  O  O     . GLU B 1 463 ? 37.883  -27.020 112.233 1.00 151.17 ? 442 GLU B O     1 
ATOM   7839  C  CB    . GLU B 1 463 ? 36.283  -24.346 111.072 1.00 160.98 ? 442 GLU B CB    1 
ATOM   7840  C  CG    . GLU B 1 463 ? 35.256  -23.742 110.093 1.00 149.16 ? 442 GLU B CG    1 
ATOM   7841  C  CD    . GLU B 1 463 ? 35.114  -24.527 108.773 1.00 140.27 ? 442 GLU B CD    1 
ATOM   7842  O  OE1   . GLU B 1 463 ? 35.845  -25.511 108.527 1.00 158.93 ? 442 GLU B OE1   1 
ATOM   7843  O  OE2   . GLU B 1 463 ? 34.247  -24.156 107.962 1.00 130.96 ? 442 GLU B OE2   1 
ATOM   7844  N  N     . ASP B 1 464 ? 36.688  -25.977 113.814 1.00 158.36 ? 443 ASP B N     1 
ATOM   7845  C  CA    . ASP B 1 464 ? 37.312  -26.684 114.923 1.00 165.17 ? 443 ASP B CA    1 
ATOM   7846  C  C     . ASP B 1 464 ? 36.635  -28.055 115.054 1.00 172.97 ? 443 ASP B C     1 
ATOM   7847  O  O     . ASP B 1 464 ? 35.855  -28.474 114.196 1.00 185.76 ? 443 ASP B O     1 
ATOM   7848  C  CB    . ASP B 1 464 ? 37.193  -25.828 116.174 1.00 173.34 ? 443 ASP B CB    1 
ATOM   7849  C  CG    . ASP B 1 464 ? 35.818  -25.174 116.290 1.00 182.49 ? 443 ASP B CG    1 
ATOM   7850  O  OD1   . ASP B 1 464 ? 34.992  -25.652 117.084 1.00 197.65 ? 443 ASP B OD1   1 
ATOM   7851  O  OD2   . ASP B 1 464 ? 35.546  -24.189 115.558 1.00 174.01 ? 443 ASP B OD2   1 
ATOM   7852  N  N     . GLY B 1 465 ? 36.943  -28.800 116.112 1.00 179.23 ? 444 GLY B N     1 
ATOM   7853  C  CA    . GLY B 1 465 ? 36.356  -30.134 116.191 1.00 170.79 ? 444 GLY B CA    1 
ATOM   7854  C  C     . GLY B 1 465 ? 34.930  -30.194 116.699 1.00 148.84 ? 444 GLY B C     1 
ATOM   7855  O  O     . GLY B 1 465 ? 34.297  -31.255 116.596 1.00 134.26 ? 444 GLY B O     1 
ATOM   7856  N  N     . SER B 1 466 ? 34.412  -29.058 117.202 1.00 142.99 ? 445 SER B N     1 
ATOM   7857  C  CA    . SER B 1 466 ? 33.252  -28.921 118.089 1.00 139.17 ? 445 SER B CA    1 
ATOM   7858  C  C     . SER B 1 466 ? 31.920  -29.232 117.430 1.00 132.03 ? 445 SER B C     1 
ATOM   7859  O  O     . SER B 1 466 ? 30.890  -29.129 118.096 1.00 142.91 ? 445 SER B O     1 
ATOM   7860  C  CB    . SER B 1 466 ? 33.192  -27.517 118.688 1.00 140.14 ? 445 SER B CB    1 
ATOM   7861  O  OG    . SER B 1 466 ? 33.045  -26.541 117.681 1.00 153.95 ? 445 SER B OG    1 
ATOM   7862  N  N     . TYR B 1 467 ? 31.868  -29.499 116.140 1.00 129.82 ? 446 TYR B N     1 
ATOM   7863  C  CA    . TYR B 1 467 ? 30.575  -29.812 115.569 1.00 126.67 ? 446 TYR B CA    1 
ATOM   7864  C  C     . TYR B 1 467 ? 30.085  -31.144 116.118 1.00 126.17 ? 446 TYR B C     1 
ATOM   7865  O  O     . TYR B 1 467 ? 28.906  -31.286 116.457 1.00 124.77 ? 446 TYR B O     1 
ATOM   7866  C  CB    . TYR B 1 467 ? 30.664  -29.791 114.037 1.00 124.77 ? 446 TYR B CB    1 
ATOM   7867  C  CG    . TYR B 1 467 ? 31.356  -30.962 113.350 1.00 124.57 ? 446 TYR B CG    1 
ATOM   7868  C  CD1   . TYR B 1 467 ? 32.653  -30.859 112.886 1.00 126.21 ? 446 TYR B CD1   1 
ATOM   7869  C  CD2   . TYR B 1 467 ? 30.691  -32.149 113.125 1.00 122.88 ? 446 TYR B CD2   1 
ATOM   7870  C  CE1   . TYR B 1 467 ? 33.267  -31.914 112.255 1.00 126.17 ? 446 TYR B CE1   1 
ATOM   7871  C  CE2   . TYR B 1 467 ? 31.303  -33.196 112.491 1.00 122.89 ? 446 TYR B CE2   1 
ATOM   7872  C  CZ    . TYR B 1 467 ? 32.578  -33.071 112.058 1.00 124.50 ? 446 TYR B CZ    1 
ATOM   7873  O  OH    . TYR B 1 467 ? 33.149  -34.136 111.432 1.00 124.61 ? 446 TYR B OH    1 
ATOM   7874  N  N     . ARG B 1 468 ? 31.013  -32.086 116.313 1.00 127.72 ? 447 ARG B N     1 
ATOM   7875  C  CA    . ARG B 1 468 ? 30.696  -33.447 116.744 1.00 127.61 ? 447 ARG B CA    1 
ATOM   7876  C  C     . ARG B 1 468 ? 29.991  -33.487 118.095 1.00 128.59 ? 447 ARG B C     1 
ATOM   7877  O  O     . ARG B 1 468 ? 28.932  -34.098 118.241 1.00 127.11 ? 447 ARG B O     1 
ATOM   7878  C  CB    . ARG B 1 468 ? 31.981  -34.263 116.817 1.00 129.82 ? 447 ARG B CB    1 
ATOM   7879  C  CG    . ARG B 1 468 ? 32.720  -34.301 115.524 1.00 129.70 ? 447 ARG B CG    1 
ATOM   7880  C  CD    . ARG B 1 468 ? 33.705  -35.417 115.511 1.00 138.84 ? 447 ARG B CD    1 
ATOM   7881  N  NE    . ARG B 1 468 ? 34.561  -35.292 114.349 1.00 139.62 ? 447 ARG B NE    1 
ATOM   7882  C  CZ    . ARG B 1 468 ? 35.712  -34.640 114.374 1.00 158.51 ? 447 ARG B CZ    1 
ATOM   7883  N  NH1   . ARG B 1 468 ? 36.118  -34.088 115.510 1.00 147.12 ? 447 ARG B NH1   1 
ATOM   7884  N  NH2   . ARG B 1 468 ? 36.453  -34.549 113.277 1.00 179.11 ? 447 ARG B NH2   1 
ATOM   7885  N  N     . ASP B 1 469 ? 30.595  -32.887 119.117 1.00 134.89 ? 448 ASP B N     1 
ATOM   7886  C  CA    . ASP B 1 469 ? 29.962  -32.863 120.433 1.00 137.92 ? 448 ASP B CA    1 
ATOM   7887  C  C     . ASP B 1 469 ? 28.660  -32.066 120.422 1.00 130.67 ? 448 ASP B C     1 
ATOM   7888  O  O     . ASP B 1 469 ? 27.687  -32.452 121.078 1.00 133.66 ? 448 ASP B O     1 
ATOM   7889  C  CB    . ASP B 1 469 ? 30.959  -32.325 121.458 1.00 154.47 ? 448 ASP B CB    1 
ATOM   7890  C  CG    . ASP B 1 469 ? 31.971  -33.380 121.874 1.00 167.36 ? 448 ASP B CG    1 
ATOM   7891  O  OD1   . ASP B 1 469 ? 31.707  -34.573 121.622 1.00 176.64 ? 448 ASP B OD1   1 
ATOM   7892  O  OD2   . ASP B 1 469 ? 33.056  -33.017 122.391 1.00 170.63 ? 448 ASP B OD2   1 
ATOM   7893  N  N     . ALA B 1 470 ? 28.611  -30.973 119.658 1.00 132.34 ? 449 ALA B N     1 
ATOM   7894  C  CA    . ALA B 1 470 ? 27.410  -30.137 119.640 1.00 134.40 ? 449 ALA B CA    1 
ATOM   7895  C  C     . ALA B 1 470 ? 26.230  -30.888 119.037 1.00 132.22 ? 449 ALA B C     1 
ATOM   7896  O  O     . ALA B 1 470 ? 25.086  -30.738 119.493 1.00 130.73 ? 449 ALA B O     1 
ATOM   7897  C  CB    . ALA B 1 470 ? 27.673  -28.842 118.866 1.00 135.15 ? 449 ALA B CB    1 
ATOM   7898  N  N     . ILE B 1 471 ? 26.504  -31.722 118.031 1.00 123.51 ? 450 ILE B N     1 
ATOM   7899  C  CA    . ILE B 1 471 ? 25.465  -32.481 117.347 1.00 120.93 ? 450 ILE B CA    1 
ATOM   7900  C  C     . ILE B 1 471 ? 24.980  -33.621 118.223 1.00 121.51 ? 450 ILE B C     1 
ATOM   7901  O  O     . ILE B 1 471 ? 23.788  -33.962 118.226 1.00 131.16 ? 450 ILE B O     1 
ATOM   7902  C  CB    . ILE B 1 471 ? 26.000  -32.991 116.004 1.00 119.66 ? 450 ILE B CB    1 
ATOM   7903  C  CG1   . ILE B 1 471 ? 25.902  -31.866 114.969 1.00 118.36 ? 450 ILE B CG1   1 
ATOM   7904  C  CG2   . ILE B 1 471 ? 25.338  -34.327 115.620 1.00 118.22 ? 450 ILE B CG2   1 
ATOM   7905  C  CD1   . ILE B 1 471 ? 26.651  -32.120 113.686 1.00 117.72 ? 450 ILE B CD1   1 
ATOM   7906  N  N     . ARG B 1 472 ? 25.901  -34.252 118.955 1.00 123.87 ? 451 ARG B N     1 
ATOM   7907  C  CA    . ARG B 1 472 ? 25.500  -35.258 119.926 1.00 125.00 ? 451 ARG B CA    1 
ATOM   7908  C  C     . ARG B 1 472 ? 24.698  -34.631 121.051 1.00 125.86 ? 451 ARG B C     1 
ATOM   7909  O  O     . ARG B 1 472 ? 23.893  -35.314 121.687 1.00 139.38 ? 451 ARG B O     1 
ATOM   7910  C  CB    . ARG B 1 472 ? 26.727  -35.943 120.503 1.00 127.79 ? 451 ARG B CB    1 
ATOM   7911  C  CG    . ARG B 1 472 ? 27.579  -36.585 119.465 1.00 134.78 ? 451 ARG B CG    1 
ATOM   7912  C  CD    . ARG B 1 472 ? 28.860  -37.126 120.060 1.00 133.95 ? 451 ARG B CD    1 
ATOM   7913  N  NE    . ARG B 1 472 ? 29.953  -36.884 119.125 1.00 130.44 ? 451 ARG B NE    1 
ATOM   7914  C  CZ    . ARG B 1 472 ? 31.148  -37.449 119.199 1.00 143.05 ? 451 ARG B CZ    1 
ATOM   7915  N  NH1   . ARG B 1 472 ? 31.413  -38.319 120.168 1.00 182.72 ? 451 ARG B NH1   1 
ATOM   7916  N  NH2   . ARG B 1 472 ? 32.074  -37.148 118.298 1.00 132.63 ? 451 ARG B NH2   1 
ATOM   7917  N  N     . CYS B 1 473 ? 24.924  -33.346 121.339 1.00 126.68 ? 452 CYS B N     1 
ATOM   7918  C  CA    . CYS B 1 473 ? 24.110  -32.689 122.357 1.00 139.31 ? 452 CYS B CA    1 
ATOM   7919  C  C     . CYS B 1 473 ? 22.707  -32.390 121.844 1.00 126.51 ? 452 CYS B C     1 
ATOM   7920  O  O     . CYS B 1 473 ? 21.724  -32.801 122.466 1.00 137.48 ? 452 CYS B O     1 
ATOM   7921  C  CB    . CYS B 1 473 ? 24.798  -31.427 122.890 1.00 176.85 ? 452 CYS B CB    1 
ATOM   7922  S  SG    . CYS B 1 473 ? 25.725  -31.686 124.475 1.00 195.76 ? 452 CYS B SG    1 
ATOM   7923  N  N     . ARG B 1 474 ? 22.585  -31.720 120.689 1.00 126.83 ? 453 ARG B N     1 
ATOM   7924  C  CA    . ARG B 1 474 ? 21.248  -31.459 120.153 1.00 120.42 ? 453 ARG B CA    1 
ATOM   7925  C  C     . ARG B 1 474 ? 20.491  -32.746 119.883 1.00 119.02 ? 453 ARG B C     1 
ATOM   7926  O  O     . ARG B 1 474 ? 19.262  -32.770 119.980 1.00 117.97 ? 453 ARG B O     1 
ATOM   7927  C  CB    . ARG B 1 474 ? 21.317  -30.641 118.871 1.00 118.68 ? 453 ARG B CB    1 
ATOM   7928  C  CG    . ARG B 1 474 ? 22.119  -29.407 118.986 1.00 120.14 ? 453 ARG B CG    1 
ATOM   7929  C  CD    . ARG B 1 474 ? 21.396  -28.273 119.673 1.00 134.95 ? 453 ARG B CD    1 
ATOM   7930  N  NE    . ARG B 1 474 ? 21.929  -27.025 119.138 1.00 157.72 ? 453 ARG B NE    1 
ATOM   7931  C  CZ    . ARG B 1 474 ? 23.141  -26.548 119.419 1.00 183.02 ? 453 ARG B CZ    1 
ATOM   7932  N  NH1   . ARG B 1 474 ? 23.958  -27.210 120.240 1.00 186.44 ? 453 ARG B NH1   1 
ATOM   7933  N  NH2   . ARG B 1 474 ? 23.547  -25.414 118.862 1.00 191.67 ? 453 ARG B NH2   1 
ATOM   7934  N  N     . TYR B 1 475 ? 21.194  -33.829 119.567 1.00 119.20 ? 454 TYR B N     1 
ATOM   7935  C  CA    . TYR B 1 475 ? 20.504  -35.080 119.266 1.00 118.11 ? 454 TYR B CA    1 
ATOM   7936  C  C     . TYR B 1 475 ? 19.860  -35.698 120.504 1.00 119.55 ? 454 TYR B C     1 
ATOM   7937  O  O     . TYR B 1 475 ? 18.702  -36.122 120.456 1.00 118.49 ? 454 TYR B O     1 
ATOM   7938  C  CB    . TYR B 1 475 ? 21.475  -36.056 118.643 1.00 118.28 ? 454 TYR B CB    1 
ATOM   7939  C  CG    . TYR B 1 475 ? 20.889  -37.381 118.295 1.00 117.51 ? 454 TYR B CG    1 
ATOM   7940  C  CD1   . TYR B 1 475 ? 20.611  -37.694 116.993 1.00 115.50 ? 454 TYR B CD1   1 
ATOM   7941  C  CD2   . TYR B 1 475 ? 20.655  -38.331 119.245 1.00 119.06 ? 454 TYR B CD2   1 
ATOM   7942  C  CE1   . TYR B 1 475 ? 20.103  -38.904 116.651 1.00 115.06 ? 454 TYR B CE1   1 
ATOM   7943  C  CE2   . TYR B 1 475 ? 20.151  -39.542 118.906 1.00 118.61 ? 454 TYR B CE2   1 
ATOM   7944  C  CZ    . TYR B 1 475 ? 19.885  -39.826 117.607 1.00 116.62 ? 454 TYR B CZ    1 
ATOM   7945  O  OH    . TYR B 1 475 ? 19.388  -41.044 117.238 1.00 116.40 ? 454 TYR B OH    1 
ATOM   7946  N  N     . ARG B 1 476 ? 20.614  -35.830 121.600 1.00 122.19 ? 455 ARG B N     1 
ATOM   7947  C  CA    . ARG B 1 476 ? 20.026  -36.358 122.828 1.00 123.92 ? 455 ARG B CA    1 
ATOM   7948  C  C     . ARG B 1 476 ? 18.970  -35.411 123.357 1.00 123.66 ? 455 ARG B C     1 
ATOM   7949  O  O     . ARG B 1 476 ? 17.924  -35.847 123.830 1.00 123.67 ? 455 ARG B O     1 
ATOM   7950  C  CB    . ARG B 1 476 ? 21.113  -36.630 123.888 1.00 163.42 ? 455 ARG B CB    1 
ATOM   7951  C  CG    . ARG B 1 476 ? 21.045  -35.844 125.243 1.00 179.24 ? 455 ARG B CG    1 
ATOM   7952  C  CD    . ARG B 1 476 ? 19.998  -36.389 126.250 1.00 184.66 ? 455 ARG B CD    1 
ATOM   7953  N  NE    . ARG B 1 476 ? 20.308  -36.126 127.665 1.00 180.19 ? 455 ARG B NE    1 
ATOM   7954  C  CZ    . ARG B 1 476 ? 20.025  -35.002 128.333 1.00 173.90 ? 455 ARG B CZ    1 
ATOM   7955  N  NH1   . ARG B 1 476 ? 19.411  -33.974 127.741 1.00 133.02 ? 455 ARG B NH1   1 
ATOM   7956  N  NH2   . ARG B 1 476 ? 20.355  -34.911 129.619 1.00 142.90 ? 455 ARG B NH2   1 
ATOM   7957  N  N     . ASP B 1 477 ? 19.223  -34.109 123.255 1.00 123.56 ? 456 ASP B N     1 
ATOM   7958  C  CA    . ASP B 1 477 ? 18.443  -33.063 123.919 1.00 137.66 ? 456 ASP B CA    1 
ATOM   7959  C  C     . ASP B 1 477 ? 17.092  -32.809 123.236 1.00 140.28 ? 456 ASP B C     1 
ATOM   7960  O  O     . ASP B 1 477 ? 16.049  -32.749 123.905 1.00 153.40 ? 456 ASP B O     1 
ATOM   7961  C  CB    . ASP B 1 477 ? 19.298  -31.782 123.953 1.00 150.06 ? 456 ASP B CB    1 
ATOM   7962  C  CG    . ASP B 1 477 ? 18.882  -30.803 125.026 1.00 160.39 ? 456 ASP B CG    1 
ATOM   7963  O  OD1   . ASP B 1 477 ? 17.907  -30.045 124.815 1.00 169.93 ? 456 ASP B OD1   1 
ATOM   7964  O  OD2   . ASP B 1 477 ? 19.586  -30.771 126.063 1.00 166.59 ? 456 ASP B OD2   1 
ATOM   7965  N  N     . LYS B 1 478 ? 17.094  -32.602 121.917 1.00 134.36 ? 457 LYS B N     1 
ATOM   7966  C  CA    . LYS B 1 478 ? 15.903  -32.198 121.180 1.00 117.14 ? 457 LYS B CA    1 
ATOM   7967  C  C     . LYS B 1 478 ? 15.187  -33.367 120.511 1.00 115.55 ? 457 LYS B C     1 
ATOM   7968  O  O     . LYS B 1 478 ? 14.236  -33.141 119.759 1.00 139.64 ? 457 LYS B O     1 
ATOM   7969  C  CB    . LYS B 1 478 ? 16.250  -31.106 120.160 1.00 115.95 ? 457 LYS B CB    1 
ATOM   7970  C  CG    . LYS B 1 478 ? 16.826  -29.798 120.777 1.00 117.67 ? 457 LYS B CG    1 
ATOM   7971  C  CD    . LYS B 1 478 ? 15.809  -29.073 121.657 1.00 118.53 ? 457 LYS B CD    1 
ATOM   7972  C  CE    . LYS B 1 478 ? 16.261  -27.647 121.986 1.00 125.43 ? 457 LYS B CE    1 
ATOM   7973  N  NZ    . LYS B 1 478 ? 15.386  -26.948 122.999 1.00 131.18 ? 457 LYS B NZ    1 
ATOM   7974  N  N     . PHE B 1 479 ? 15.616  -34.599 120.767 1.00 116.32 ? 458 PHE B N     1 
ATOM   7975  C  CA    . PHE B 1 479 ? 15.086  -35.774 120.080 1.00 115.12 ? 458 PHE B CA    1 
ATOM   7976  C  C     . PHE B 1 479 ? 13.568  -35.814 120.096 1.00 114.29 ? 458 PHE B C     1 
ATOM   7977  O  O     . PHE B 1 479 ? 12.922  -35.480 121.092 1.00 115.39 ? 458 PHE B O     1 
ATOM   7978  C  CB    . PHE B 1 479 ? 15.620  -37.049 120.719 1.00 116.80 ? 458 PHE B CB    1 
ATOM   7979  C  CG    . PHE B 1 479 ? 15.350  -38.292 119.932 1.00 115.90 ? 458 PHE B CG    1 
ATOM   7980  C  CD1   . PHE B 1 479 ? 16.372  -38.961 119.299 1.00 115.92 ? 458 PHE B CD1   1 
ATOM   7981  C  CD2   . PHE B 1 479 ? 14.094  -38.823 119.869 1.00 115.33 ? 458 PHE B CD2   1 
ATOM   7982  C  CE1   . PHE B 1 479 ? 16.131  -40.121 118.595 1.00 115.37 ? 458 PHE B CE1   1 
ATOM   7983  C  CE2   . PHE B 1 479 ? 13.859  -39.962 119.168 1.00 114.82 ? 458 PHE B CE2   1 
ATOM   7984  C  CZ    . PHE B 1 479 ? 14.880  -40.615 118.535 1.00 114.86 ? 458 PHE B CZ    1 
ATOM   7985  N  N     . GLY B 1 480 ? 13.004  -36.145 118.945 1.00 115.75 ? 459 GLY B N     1 
ATOM   7986  C  CA    . GLY B 1 480 ? 11.596  -36.386 118.831 1.00 116.60 ? 459 GLY B CA    1 
ATOM   7987  C  C     . GLY B 1 480 ? 10.787  -35.172 118.476 1.00 112.99 ? 459 GLY B C     1 
ATOM   7988  O  O     . GLY B 1 480 ? 9.641   -35.320 118.032 1.00 123.69 ? 459 GLY B O     1 
ATOM   7989  N  N     . LEU B 1 481 ? 11.346  -33.983 118.671 1.00 111.05 ? 460 LEU B N     1 
ATOM   7990  C  CA    . LEU B 1 481 ? 10.633  -32.754 118.365 1.00 112.13 ? 460 LEU B CA    1 
ATOM   7991  C  C     . LEU B 1 481 ? 10.344  -32.676 116.874 1.00 123.87 ? 460 LEU B C     1 
ATOM   7992  O  O     . LEU B 1 481 ? 11.154  -33.110 116.054 1.00 131.64 ? 460 LEU B O     1 
ATOM   7993  C  CB    . LEU B 1 481 ? 11.472  -31.555 118.794 1.00 111.28 ? 460 LEU B CB    1 
ATOM   7994  C  CG    . LEU B 1 481 ? 11.512  -31.272 120.295 1.00 115.25 ? 460 LEU B CG    1 
ATOM   7995  C  CD1   . LEU B 1 481 ? 12.118  -29.890 120.583 1.00 123.71 ? 460 LEU B CD1   1 
ATOM   7996  C  CD2   . LEU B 1 481 ? 10.131  -31.420 120.922 1.00 113.75 ? 460 LEU B CD2   1 
ATOM   7997  N  N     . GLN B 1 482 ? 9.176   -32.158 116.506 1.00 136.63 ? 461 GLN B N     1 
ATOM   7998  C  CA    . GLN B 1 482 ? 8.928   -31.991 115.082 1.00 145.33 ? 461 GLN B CA    1 
ATOM   7999  C  C     . GLN B 1 482 ? 9.806   -30.874 114.550 1.00 132.65 ? 461 GLN B C     1 
ATOM   8000  O  O     . GLN B 1 482 ? 9.915   -29.810 115.171 1.00 112.60 ? 461 GLN B O     1 
ATOM   8001  C  CB    . GLN B 1 482 ? 7.452   -31.722 114.761 1.00 137.85 ? 461 GLN B CB    1 
ATOM   8002  C  CG    . GLN B 1 482 ? 7.156   -31.990 113.268 1.00 144.99 ? 461 GLN B CG    1 
ATOM   8003  C  CD    . GLN B 1 482 ? 5.699   -32.264 112.965 1.00 150.30 ? 461 GLN B CD    1 
ATOM   8004  O  OE1   . GLN B 1 482 ? 4.949   -32.654 113.849 1.00 148.66 ? 461 GLN B OE1   1 
ATOM   8005  N  NE2   . GLN B 1 482 ? 5.290   -32.067 111.704 1.00 156.98 ? 461 GLN B NE2   1 
ATOM   8006  N  N     . SER B 1 483 ? 10.490  -31.165 113.446 1.00 135.94 ? 462 SER B N     1 
ATOM   8007  C  CA    . SER B 1 483 ? 11.364  -30.226 112.763 1.00 126.26 ? 462 SER B CA    1 
ATOM   8008  C  C     . SER B 1 483 ? 11.290  -30.526 111.278 1.00 116.62 ? 462 SER B C     1 
ATOM   8009  O  O     . SER B 1 483 ? 10.914  -31.639 110.878 1.00 114.66 ? 462 SER B O     1 
ATOM   8010  C  CB    . SER B 1 483 ? 12.824  -30.315 113.230 1.00 139.78 ? 462 SER B CB    1 
ATOM   8011  O  OG    . SER B 1 483 ? 13.543  -31.226 112.419 1.00 139.00 ? 462 SER B OG    1 
ATOM   8012  N  N     . PRO B 1 484 ? 11.622  -29.548 110.434 1.00 113.44 ? 463 PRO B N     1 
ATOM   8013  C  CA    . PRO B 1 484 ? 11.680  -29.802 108.983 1.00 126.30 ? 463 PRO B CA    1 
ATOM   8014  C  C     . PRO B 1 484 ? 12.837  -30.680 108.541 1.00 132.96 ? 463 PRO B C     1 
ATOM   8015  O  O     . PRO B 1 484 ? 12.697  -31.423 107.554 1.00 126.07 ? 463 PRO B O     1 
ATOM   8016  C  CB    . PRO B 1 484 ? 11.819  -28.393 108.408 1.00 123.28 ? 463 PRO B CB    1 
ATOM   8017  C  CG    . PRO B 1 484 ? 12.540  -27.638 109.494 1.00 108.47 ? 463 PRO B CG    1 
ATOM   8018  C  CD    . PRO B 1 484 ? 11.991  -28.165 110.778 1.00 104.85 ? 463 PRO B CD    1 
ATOM   8019  N  N     . PHE B 1 485 ? 14.009  -30.539 109.182 1.00 126.90 ? 464 PHE B N     1 
ATOM   8020  C  CA    . PHE B 1 485 ? 15.232  -31.146 108.677 1.00 104.22 ? 464 PHE B CA    1 
ATOM   8021  C  C     . PHE B 1 485 ? 15.715  -32.408 109.382 1.00 105.14 ? 464 PHE B C     1 
ATOM   8022  O  O     . PHE B 1 485 ? 16.586  -33.087 108.827 1.00 107.49 ? 464 PHE B O     1 
ATOM   8023  C  CB    . PHE B 1 485 ? 16.382  -30.158 108.773 1.00 104.71 ? 464 PHE B CB    1 
ATOM   8024  C  CG    . PHE B 1 485 ? 16.185  -28.915 108.001 1.00 111.00 ? 464 PHE B CG    1 
ATOM   8025  C  CD1   . PHE B 1 485 ? 16.404  -27.677 108.599 1.00 105.70 ? 464 PHE B CD1   1 
ATOM   8026  C  CD2   . PHE B 1 485 ? 15.920  -28.978 106.646 1.00 125.67 ? 464 PHE B CD2   1 
ATOM   8027  C  CE1   . PHE B 1 485 ? 16.288  -26.519 107.887 1.00 105.99 ? 464 PHE B CE1   1 
ATOM   8028  C  CE2   . PHE B 1 485 ? 15.789  -27.835 105.922 1.00 144.54 ? 464 PHE B CE2   1 
ATOM   8029  C  CZ    . PHE B 1 485 ? 15.979  -26.595 106.538 1.00 137.43 ? 464 PHE B CZ    1 
ATOM   8030  N  N     . VAL B 1 486 ? 15.167  -32.788 110.534 1.00 112.05 ? 465 VAL B N     1 
ATOM   8031  C  CA    . VAL B 1 486 ? 15.812  -33.788 111.394 1.00 113.88 ? 465 VAL B CA    1 
ATOM   8032  C  C     . VAL B 1 486 ? 14.996  -35.072 111.352 1.00 105.19 ? 465 VAL B C     1 
ATOM   8033  O  O     . VAL B 1 486 ? 13.890  -35.121 111.897 1.00 115.74 ? 465 VAL B O     1 
ATOM   8034  C  CB    . VAL B 1 486 ? 15.951  -33.300 112.843 1.00 107.91 ? 465 VAL B CB    1 
ATOM   8035  C  CG1   . VAL B 1 486 ? 16.811  -34.270 113.619 1.00 108.00 ? 465 VAL B CG1   1 
ATOM   8036  C  CG2   . VAL B 1 486 ? 16.473  -31.858 112.920 1.00 107.26 ? 465 VAL B CG2   1 
ATOM   8037  N  N     . TYR B 1 487 ? 15.545  -36.143 110.798 1.00 105.22 ? 466 TYR B N     1 
ATOM   8038  C  CA    . TYR B 1 487 ? 14.737  -37.344 110.612 1.00 105.08 ? 466 TYR B CA    1 
ATOM   8039  C  C     . TYR B 1 487 ? 15.030  -38.263 111.780 1.00 121.50 ? 466 TYR B C     1 
ATOM   8040  O  O     . TYR B 1 487 ? 15.899  -39.124 111.693 1.00 155.44 ? 466 TYR B O     1 
ATOM   8041  C  CB    . TYR B 1 487 ? 15.098  -38.008 109.281 1.00 104.63 ? 466 TYR B CB    1 
ATOM   8042  C  CG    . TYR B 1 487 ? 14.754  -37.116 108.131 1.00 113.22 ? 466 TYR B CG    1 
ATOM   8043  C  CD1   . TYR B 1 487 ? 15.447  -35.928 107.931 1.00 110.45 ? 466 TYR B CD1   1 
ATOM   8044  C  CD2   . TYR B 1 487 ? 13.688  -37.420 107.266 1.00 123.39 ? 466 TYR B CD2   1 
ATOM   8045  C  CE1   . TYR B 1 487 ? 15.103  -35.059 106.895 1.00 131.71 ? 466 TYR B CE1   1 
ATOM   8046  C  CE2   . TYR B 1 487 ? 13.339  -36.563 106.214 1.00 102.76 ? 466 TYR B CE2   1 
ATOM   8047  C  CZ    . TYR B 1 487 ? 14.053  -35.382 106.041 1.00 105.27 ? 466 TYR B CZ    1 
ATOM   8048  O  OH    . TYR B 1 487 ? 13.737  -34.511 105.035 1.00 101.96 ? 466 TYR B OH    1 
ATOM   8049  N  N     . TRP B 1 488 ? 14.196  -38.202 112.824 1.00 106.87 ? 467 TRP B N     1 
ATOM   8050  C  CA    . TRP B 1 488 ? 14.555  -38.974 114.015 1.00 108.45 ? 467 TRP B CA    1 
ATOM   8051  C  C     . TRP B 1 488 ? 14.354  -40.461 113.774 1.00 108.95 ? 467 TRP B C     1 
ATOM   8052  O  O     . TRP B 1 488 ? 15.148  -41.287 114.238 1.00 110.28 ? 467 TRP B O     1 
ATOM   8053  C  CB    . TRP B 1 488 ? 13.779  -38.518 115.254 1.00 109.18 ? 467 TRP B CB    1 
ATOM   8054  C  CG    . TRP B 1 488 ? 13.923  -37.063 115.625 1.00 109.07 ? 467 TRP B CG    1 
ATOM   8055  C  CD1   . TRP B 1 488 ? 13.008  -36.085 115.438 1.00 108.21 ? 467 TRP B CD1   1 
ATOM   8056  C  CD2   . TRP B 1 488 ? 15.053  -36.435 116.239 1.00 110.13 ? 467 TRP B CD2   1 
ATOM   8057  N  NE1   . TRP B 1 488 ? 13.480  -34.892 115.909 1.00 108.68 ? 467 TRP B NE1   1 
ATOM   8058  C  CE2   . TRP B 1 488 ? 14.742  -35.079 116.395 1.00 109.86 ? 467 TRP B CE2   1 
ATOM   8059  C  CE3   . TRP B 1 488 ? 16.295  -36.892 116.675 1.00 111.50 ? 467 TRP B CE3   1 
ATOM   8060  C  CZ2   . TRP B 1 488 ? 15.626  -34.171 116.963 1.00 135.86 ? 467 TRP B CZ2   1 
ATOM   8061  C  CZ3   . TRP B 1 488 ? 17.172  -35.993 117.245 1.00 114.36 ? 467 TRP B CZ3   1 
ATOM   8062  C  CH2   . TRP B 1 488 ? 16.836  -34.645 117.379 1.00 130.70 ? 467 TRP B CH2   1 
ATOM   8063  N  N     . GLU B 1 489 ? 13.318  -40.816 113.021 1.00 109.27 ? 468 GLU B N     1 
ATOM   8064  C  CA    . GLU B 1 489 ? 13.124  -42.208 112.642 1.00 130.00 ? 468 GLU B CA    1 
ATOM   8065  C  C     . GLU B 1 489 ? 14.371  -42.777 111.958 1.00 112.50 ? 468 GLU B C     1 
ATOM   8066  O  O     . GLU B 1 489 ? 14.716  -43.946 112.163 1.00 135.62 ? 468 GLU B O     1 
ATOM   8067  C  CB    . GLU B 1 489 ? 11.869  -42.333 111.771 1.00 173.33 ? 468 GLU B CB    1 
ATOM   8068  C  CG    . GLU B 1 489 ? 10.575  -41.795 112.439 1.00 190.94 ? 468 GLU B CG    1 
ATOM   8069  C  CD    . GLU B 1 489 ? 10.340  -40.297 112.216 1.00 214.27 ? 468 GLU B CD    1 
ATOM   8070  O  OE1   . GLU B 1 489 ? 11.224  -39.623 111.641 1.00 219.97 ? 468 GLU B OE1   1 
ATOM   8071  O  OE2   . GLU B 1 489 ? 9.264   -39.794 112.614 1.00 222.68 ? 468 GLU B OE2   1 
ATOM   8072  N  N     . LEU B 1 490 ? 15.029  -41.984 111.099 1.00 107.97 ? 469 LEU B N     1 
ATOM   8073  C  CA    . LEU B 1 490 ? 16.155  -42.505 110.322 1.00 108.26 ? 469 LEU B CA    1 
ATOM   8074  C  C     . LEU B 1 490 ? 17.472  -42.543 111.086 1.00 115.58 ? 469 LEU B C     1 
ATOM   8075  O  O     . LEU B 1 490 ? 18.288  -43.459 110.871 1.00 122.52 ? 469 LEU B O     1 
ATOM   8076  C  CB    . LEU B 1 490 ? 16.340  -41.707 109.047 1.00 106.95 ? 469 LEU B CB    1 
ATOM   8077  C  CG    . LEU B 1 490 ? 17.019  -42.642 108.061 1.00 107.38 ? 469 LEU B CG    1 
ATOM   8078  C  CD1   . LEU B 1 490 ? 16.329  -44.011 108.050 1.00 108.20 ? 469 LEU B CD1   1 
ATOM   8079  C  CD2   . LEU B 1 490 ? 16.942  -41.980 106.701 1.00 122.96 ? 469 LEU B CD2   1 
ATOM   8080  N  N     . LEU B 1 491 ? 17.687  -41.593 111.994 1.00 109.70 ? 470 LEU B N     1 
ATOM   8081  C  CA    . LEU B 1 491 ? 19.006  -41.338 112.556 1.00 110.88 ? 470 LEU B CA    1 
ATOM   8082  C  C     . LEU B 1 491 ? 19.076  -42.083 113.882 1.00 123.06 ? 470 LEU B C     1 
ATOM   8083  O  O     . LEU B 1 491 ? 18.635  -41.580 114.920 1.00 119.54 ? 470 LEU B O     1 
ATOM   8084  C  CB    . LEU B 1 491 ? 19.216  -39.833 112.738 1.00 110.33 ? 470 LEU B CB    1 
ATOM   8085  C  CG    . LEU B 1 491 ? 20.559  -39.136 113.001 1.00 111.29 ? 470 LEU B CG    1 
ATOM   8086  C  CD1   . LEU B 1 491 ? 21.585  -39.514 111.969 1.00 111.32 ? 470 LEU B CD1   1 
ATOM   8087  C  CD2   . LEU B 1 491 ? 20.411  -37.631 113.048 1.00 110.65 ? 470 LEU B CD2   1 
ATOM   8088  N  N     . GLY B 1 492 ? 19.680  -43.278 113.838 1.00 116.17 ? 471 GLY B N     1 
ATOM   8089  C  CA    . GLY B 1 492 ? 19.992  -44.022 115.037 1.00 130.43 ? 471 GLY B CA    1 
ATOM   8090  C  C     . GLY B 1 492 ? 21.367  -43.654 115.542 1.00 124.32 ? 471 GLY B C     1 
ATOM   8091  O  O     . GLY B 1 492 ? 22.138  -42.970 114.878 1.00 144.50 ? 471 GLY B O     1 
ATOM   8092  N  N     . GLU B 1 493 ? 21.694  -44.113 116.743 1.00 126.15 ? 472 GLU B N     1 
ATOM   8093  C  CA    . GLU B 1 493 ? 23.050  -43.860 117.212 1.00 133.22 ? 472 GLU B CA    1 
ATOM   8094  C  C     . GLU B 1 493 ? 24.092  -44.436 116.251 1.00 127.69 ? 472 GLU B C     1 
ATOM   8095  O  O     . GLU B 1 493 ? 25.124  -43.794 116.005 1.00 138.41 ? 472 GLU B O     1 
ATOM   8096  C  CB    . GLU B 1 493 ? 23.250  -44.405 118.618 1.00 154.85 ? 472 GLU B CB    1 
ATOM   8097  C  CG    . GLU B 1 493 ? 24.303  -43.635 119.388 1.00 160.71 ? 472 GLU B CG    1 
ATOM   8098  C  CD    . GLU B 1 493 ? 24.202  -43.837 120.874 1.00 175.21 ? 472 GLU B CD    1 
ATOM   8099  O  OE1   . GLU B 1 493 ? 23.059  -43.853 121.380 1.00 166.43 ? 472 GLU B OE1   1 
ATOM   8100  O  OE2   . GLU B 1 493 ? 25.260  -44.004 121.526 1.00 196.75 ? 472 GLU B OE2   1 
ATOM   8101  N  N     . GLU B 1 494 ? 23.816  -45.603 115.645 1.00 122.08 ? 473 GLU B N     1 
ATOM   8102  C  CA    . GLU B 1 494 ? 24.786  -46.200 114.722 1.00 130.28 ? 473 GLU B CA    1 
ATOM   8103  C  C     . GLU B 1 494 ? 25.078  -45.287 113.540 1.00 141.76 ? 473 GLU B C     1 
ATOM   8104  O  O     . GLU B 1 494 ? 26.244  -45.071 113.173 1.00 140.36 ? 473 GLU B O     1 
ATOM   8105  C  CB    . GLU B 1 494 ? 24.296  -47.556 114.206 1.00 139.93 ? 473 GLU B CB    1 
ATOM   8106  C  CG    . GLU B 1 494 ? 24.346  -48.685 115.228 1.00 177.58 ? 473 GLU B CG    1 
ATOM   8107  C  CD    . GLU B 1 494 ? 25.664  -49.462 115.162 1.00 188.71 ? 473 GLU B CD    1 
ATOM   8108  O  OE1   . GLU B 1 494 ? 26.398  -49.267 114.167 1.00 191.26 ? 473 GLU B OE1   1 
ATOM   8109  O  OE2   . GLU B 1 494 ? 25.963  -50.258 116.092 1.00 189.77 ? 473 GLU B OE2   1 
ATOM   8110  N  N     . LEU B 1 495 ? 24.031  -44.732 112.932 1.00 145.75 ? 474 LEU B N     1 
ATOM   8111  C  CA    . LEU B 1 495 ? 24.238  -43.858 111.785 1.00 120.26 ? 474 LEU B CA    1 
ATOM   8112  C  C     . LEU B 1 495 ? 24.883  -42.538 112.198 1.00 116.52 ? 474 LEU B C     1 
ATOM   8113  O  O     . LEU B 1 495 ? 25.807  -42.063 111.532 1.00 131.94 ? 474 LEU B O     1 
ATOM   8114  C  CB    . LEU B 1 495 ? 22.903  -43.637 111.074 1.00 121.29 ? 474 LEU B CB    1 
ATOM   8115  C  CG    . LEU B 1 495 ? 22.773  -42.686 109.889 1.00 121.33 ? 474 LEU B CG    1 
ATOM   8116  C  CD1   . LEU B 1 495 ? 23.655  -43.204 108.771 1.00 127.78 ? 474 LEU B CD1   1 
ATOM   8117  C  CD2   . LEU B 1 495 ? 21.319  -42.604 109.421 1.00 129.83 ? 474 LEU B CD2   1 
ATOM   8118  N  N     . LEU B 1 496 ? 24.458  -41.966 113.322 1.00 116.90 ? 475 LEU B N     1 
ATOM   8119  C  CA    . LEU B 1 496 ? 24.973  -40.666 113.738 1.00 117.17 ? 475 LEU B CA    1 
ATOM   8120  C  C     . LEU B 1 496 ? 26.465  -40.732 113.994 1.00 119.28 ? 475 LEU B C     1 
ATOM   8121  O  O     . LEU B 1 496 ? 27.255  -39.958 113.435 1.00 119.21 ? 475 LEU B O     1 
ATOM   8122  C  CB    . LEU B 1 496 ? 24.262  -40.223 115.006 1.00 117.68 ? 475 LEU B CB    1 
ATOM   8123  C  CG    . LEU B 1 496 ? 24.676  -38.899 115.629 1.00 118.35 ? 475 LEU B CG    1 
ATOM   8124  C  CD1   . LEU B 1 496 ? 24.319  -37.761 114.693 1.00 116.35 ? 475 LEU B CD1   1 
ATOM   8125  C  CD2   . LEU B 1 496 ? 24.050  -38.721 117.002 1.00 119.46 ? 475 LEU B CD2   1 
ATOM   8126  N  N     . GLU B 1 497 ? 26.878  -41.677 114.825 1.00 121.40 ? 476 GLU B N     1 
ATOM   8127  C  CA    . GLU B 1 497 ? 28.294  -41.736 115.141 1.00 139.62 ? 476 GLU B CA    1 
ATOM   8128  C  C     . GLU B 1 497 ? 29.109  -42.263 113.963 1.00 131.70 ? 476 GLU B C     1 
ATOM   8129  O  O     . GLU B 1 497 ? 30.282  -41.892 113.825 1.00 143.51 ? 476 GLU B O     1 
ATOM   8130  C  CB    . GLU B 1 497 ? 28.533  -42.579 116.407 1.00 145.00 ? 476 GLU B CB    1 
ATOM   8131  C  CG    . GLU B 1 497 ? 27.893  -42.037 117.700 1.00 134.71 ? 476 GLU B CG    1 
ATOM   8132  C  CD    . GLU B 1 497 ? 28.598  -40.806 118.275 1.00 128.37 ? 476 GLU B CD    1 
ATOM   8133  O  OE1   . GLU B 1 497 ? 29.795  -40.904 118.643 1.00 130.87 ? 476 GLU B OE1   1 
ATOM   8134  O  OE2   . GLU B 1 497 ? 27.944  -39.739 118.364 1.00 127.03 ? 476 GLU B OE2   1 
ATOM   8135  N  N     . GLN B 1 498 ? 28.530  -43.103 113.091 1.00 122.34 ? 477 GLN B N     1 
ATOM   8136  C  CA    . GLN B 1 498 ? 29.286  -43.471 111.898 1.00 122.26 ? 477 GLN B CA    1 
ATOM   8137  C  C     . GLN B 1 498 ? 29.572  -42.248 111.042 1.00 120.88 ? 477 GLN B C     1 
ATOM   8138  O  O     . GLN B 1 498 ? 30.648  -42.129 110.444 1.00 121.71 ? 477 GLN B O     1 
ATOM   8139  C  CB    . GLN B 1 498 ? 28.583  -44.559 111.092 1.00 121.32 ? 477 GLN B CB    1 
ATOM   8140  C  CG    . GLN B 1 498 ? 28.641  -45.885 111.779 1.00 123.32 ? 477 GLN B CG    1 
ATOM   8141  C  CD    . GLN B 1 498 ? 28.544  -47.057 110.847 1.00 134.61 ? 477 GLN B CD    1 
ATOM   8142  O  OE1   . GLN B 1 498 ? 28.309  -46.916 109.650 1.00 121.79 ? 477 GLN B OE1   1 
ATOM   8143  N  NE2   . GLN B 1 498 ? 28.770  -48.240 111.394 1.00 154.60 ? 477 GLN B NE2   1 
ATOM   8144  N  N     . ALA B 1 499 ? 28.598  -41.357 110.912 1.00 118.90 ? 478 ALA B N     1 
ATOM   8145  C  CA    . ALA B 1 499 ? 28.833  -40.182 110.088 1.00 117.82 ? 478 ALA B CA    1 
ATOM   8146  C  C     . ALA B 1 499 ? 29.844  -39.236 110.722 1.00 119.42 ? 478 ALA B C     1 
ATOM   8147  O  O     . ALA B 1 499 ? 30.770  -38.778 110.050 1.00 119.93 ? 478 ALA B O     1 
ATOM   8148  C  CB    . ALA B 1 499 ? 27.516  -39.464 109.806 1.00 115.57 ? 478 ALA B CB    1 
ATOM   8149  N  N     . LEU B 1 500 ? 29.714  -38.947 112.017 1.00 120.51 ? 479 LEU B N     1 
ATOM   8150  C  CA    . LEU B 1 500 ? 30.581  -37.905 112.577 1.00 122.11 ? 479 LEU B CA    1 
ATOM   8151  C  C     . LEU B 1 500 ? 32.078  -38.253 112.470 1.00 140.49 ? 479 LEU B C     1 
ATOM   8152  O  O     . LEU B 1 500 ? 32.918  -37.340 112.423 1.00 137.18 ? 479 LEU B O     1 
ATOM   8153  C  CB    . LEU B 1 500 ? 30.176  -37.569 114.020 1.00 123.29 ? 479 LEU B CB    1 
ATOM   8154  C  CG    . LEU B 1 500 ? 29.118  -36.473 114.254 1.00 121.71 ? 479 LEU B CG    1 
ATOM   8155  C  CD1   . LEU B 1 500 ? 27.920  -36.759 113.487 1.00 119.12 ? 479 LEU B CD1   1 
ATOM   8156  C  CD2   . LEU B 1 500 ? 28.700  -36.365 115.690 1.00 123.02 ? 479 LEU B CD2   1 
ATOM   8157  N  N     . ASP B 1 501 ? 32.443  -39.549 112.461 1.00 137.88 ? 480 ASP B N     1 
ATOM   8158  C  CA    . ASP B 1 501 ? 33.841  -39.932 112.244 1.00 127.64 ? 480 ASP B CA    1 
ATOM   8159  C  C     . ASP B 1 501 ? 34.204  -40.140 110.788 1.00 127.32 ? 480 ASP B C     1 
ATOM   8160  O  O     . ASP B 1 501 ? 35.393  -40.081 110.455 1.00 153.95 ? 480 ASP B O     1 
ATOM   8161  C  CB    . ASP B 1 501 ? 34.203  -41.251 112.942 1.00 129.76 ? 480 ASP B CB    1 
ATOM   8162  C  CG    . ASP B 1 501 ? 34.345  -41.107 114.414 1.00 167.05 ? 480 ASP B CG    1 
ATOM   8163  O  OD1   . ASP B 1 501 ? 34.805  -40.030 114.840 1.00 190.84 ? 480 ASP B OD1   1 
ATOM   8164  O  OD2   . ASP B 1 501 ? 34.014  -42.063 115.150 1.00 196.06 ? 480 ASP B OD2   1 
ATOM   8165  N  N     . CYS B 1 502 ? 33.228  -40.352 109.910 1.00 124.19 ? 481 CYS B N     1 
ATOM   8166  C  CA    . CYS B 1 502 ? 33.548  -40.578 108.510 1.00 123.47 ? 481 CYS B CA    1 
ATOM   8167  C  C     . CYS B 1 502 ? 33.348  -39.368 107.600 1.00 121.90 ? 481 CYS B C     1 
ATOM   8168  O  O     . CYS B 1 502 ? 33.872  -39.374 106.479 1.00 121.89 ? 481 CYS B O     1 
ATOM   8169  C  CB    . CYS B 1 502 ? 32.689  -41.731 107.998 1.00 122.26 ? 481 CYS B CB    1 
ATOM   8170  S  SG    . CYS B 1 502 ? 33.120  -43.270 108.769 1.00 134.50 ? 481 CYS B SG    1 
ATOM   8171  N  N     . LEU B 1 503 ? 32.681  -38.306 108.067 1.00 120.92 ? 482 LEU B N     1 
ATOM   8172  C  CA    . LEU B 1 503 ? 32.367  -37.184 107.205 1.00 119.53 ? 482 LEU B CA    1 
ATOM   8173  C  C     . LEU B 1 503 ? 33.295  -36.019 107.440 1.00 121.04 ? 482 LEU B C     1 
ATOM   8174  O  O     . LEU B 1 503 ? 33.257  -35.402 108.514 1.00 121.84 ? 482 LEU B O     1 
ATOM   8175  C  CB    . LEU B 1 503 ? 30.941  -36.731 107.410 1.00 117.49 ? 482 LEU B CB    1 
ATOM   8176  C  CG    . LEU B 1 503 ? 29.886  -37.696 106.921 1.00 115.85 ? 482 LEU B CG    1 
ATOM   8177  C  CD1   . LEU B 1 503 ? 28.557  -37.056 107.166 1.00 114.15 ? 482 LEU B CD1   1 
ATOM   8178  C  CD2   . LEU B 1 503 ? 30.100  -38.047 105.468 1.00 115.35 ? 482 LEU B CD2   1 
ATOM   8179  N  N     . PRO B 1 504 ? 34.044  -35.631 106.427 1.00 121.49 ? 483 PRO B N     1 
ATOM   8180  C  CA    . PRO B 1 504 ? 34.963  -34.508 106.566 1.00 123.18 ? 483 PRO B CA    1 
ATOM   8181  C  C     . PRO B 1 504 ? 34.225  -33.226 106.901 1.00 122.37 ? 483 PRO B C     1 
ATOM   8182  O  O     . PRO B 1 504 ? 33.186  -32.929 106.323 1.00 120.32 ? 483 PRO B O     1 
ATOM   8183  C  CB    . PRO B 1 504 ? 35.608  -34.430 105.182 1.00 123.37 ? 483 PRO B CB    1 
ATOM   8184  C  CG    . PRO B 1 504 ? 35.469  -35.820 104.631 1.00 122.73 ? 483 PRO B CG    1 
ATOM   8185  C  CD    . PRO B 1 504 ? 34.208  -36.350 105.159 1.00 120.97 ? 483 PRO B CD    1 
ATOM   8186  N  N     . ALA B 1 505 ? 34.800  -32.436 107.809 1.00 133.11 ? 484 ALA B N     1 
ATOM   8187  C  CA    . ALA B 1 505 ? 34.195  -31.151 108.146 1.00 124.17 ? 484 ALA B CA    1 
ATOM   8188  C  C     . ALA B 1 505 ? 34.024  -30.295 106.905 1.00 122.98 ? 484 ALA B C     1 
ATOM   8189  O  O     . ALA B 1 505 ? 32.987  -29.651 106.725 1.00 121.45 ? 484 ALA B O     1 
ATOM   8190  C  CB    . ALA B 1 505 ? 35.039  -30.413 109.178 1.00 146.03 ? 484 ALA B CB    1 
ATOM   8191  N  N     . ALA B 1 506 ? 35.012  -30.322 106.009 1.00 124.05 ? 485 ALA B N     1 
ATOM   8192  C  CA    . ALA B 1 506 ? 34.974  -29.482 104.814 1.00 158.12 ? 485 ALA B CA    1 
ATOM   8193  C  C     . ALA B 1 506 ? 33.844  -29.879 103.863 1.00 121.11 ? 485 ALA B C     1 
ATOM   8194  O  O     . ALA B 1 506 ? 33.335  -29.025 103.123 1.00 120.46 ? 485 ALA B O     1 
ATOM   8195  C  CB    . ALA B 1 506 ? 36.329  -29.534 104.109 1.00 177.89 ? 485 ALA B CB    1 
ATOM   8196  N  N     . HIS B 1 507 ? 33.498  -31.168 103.812 1.00 119.97 ? 486 HIS B N     1 
ATOM   8197  C  CA    . HIS B 1 507 ? 32.347  -31.598 103.024 1.00 117.74 ? 486 HIS B CA    1 
ATOM   8198  C  C     . HIS B 1 507 ? 31.026  -31.185 103.671 1.00 116.21 ? 486 HIS B C     1 
ATOM   8199  O  O     . HIS B 1 507 ? 30.039  -30.902 102.970 1.00 114.73 ? 486 HIS B O     1 
ATOM   8200  C  CB    . HIS B 1 507 ? 32.389  -33.105 102.811 1.00 117.31 ? 486 HIS B CB    1 
ATOM   8201  C  CG    . HIS B 1 507 ? 33.539  -33.558 101.985 1.00 118.69 ? 486 HIS B CG    1 
ATOM   8202  N  ND1   . HIS B 1 507 ? 33.703  -34.872 101.608 1.00 118.66 ? 486 HIS B ND1   1 
ATOM   8203  C  CD2   . HIS B 1 507 ? 34.568  -32.871 101.438 1.00 120.30 ? 486 HIS B CD2   1 
ATOM   8204  C  CE1   . HIS B 1 507 ? 34.794  -34.979 100.871 1.00 136.77 ? 486 HIS B CE1   1 
ATOM   8205  N  NE2   . HIS B 1 507 ? 35.336  -33.779 100.751 1.00 143.54 ? 486 HIS B NE2   1 
ATOM   8206  N  N     . LEU B 1 508 ? 30.968  -31.208 105.005 1.00 116.69 ? 487 LEU B N     1 
ATOM   8207  C  CA    . LEU B 1 508 ? 29.774  -30.738 105.702 1.00 115.55 ? 487 LEU B CA    1 
ATOM   8208  C  C     . LEU B 1 508 ? 29.558  -29.254 105.456 1.00 115.79 ? 487 LEU B C     1 
ATOM   8209  O  O     . LEU B 1 508 ? 28.430  -28.799 105.244 1.00 125.31 ? 487 LEU B O     1 
ATOM   8210  C  CB    . LEU B 1 508 ? 29.867  -31.011 107.196 1.00 116.46 ? 487 LEU B CB    1 
ATOM   8211  C  CG    . LEU B 1 508 ? 29.763  -32.467 107.622 1.00 116.18 ? 487 LEU B CG    1 
ATOM   8212  C  CD1   . LEU B 1 508 ? 29.865  -32.420 109.095 1.00 117.47 ? 487 LEU B CD1   1 
ATOM   8213  C  CD2   . LEU B 1 508 ? 28.544  -33.250 107.181 1.00 114.10 ? 487 LEU B CD2   1 
ATOM   8214  N  N     . ARG B 1 509 ? 30.629  -28.472 105.528 1.00 117.76 ? 488 ARG B N     1 
ATOM   8215  C  CA    . ARG B 1 509 ? 30.525  -27.061 105.173 1.00 118.35 ? 488 ARG B CA    1 
ATOM   8216  C  C     . ARG B 1 509 ? 30.063  -26.883 103.720 1.00 117.23 ? 488 ARG B C     1 
ATOM   8217  O  O     . ARG B 1 509 ? 29.241  -26.006 103.431 1.00 120.67 ? 488 ARG B O     1 
ATOM   8218  C  CB    . ARG B 1 509 ? 31.854  -26.354 105.472 1.00 121.01 ? 488 ARG B CB    1 
ATOM   8219  C  CG    . ARG B 1 509 ? 31.910  -24.894 105.136 1.00 122.16 ? 488 ARG B CG    1 
ATOM   8220  C  CD    . ARG B 1 509 ? 30.880  -24.150 105.912 1.00 121.68 ? 488 ARG B CD    1 
ATOM   8221  N  NE    . ARG B 1 509 ? 31.248  -22.780 106.236 1.00 123.83 ? 488 ARG B NE    1 
ATOM   8222  C  CZ    . ARG B 1 509 ? 31.788  -22.407 107.384 1.00 125.81 ? 488 ARG B CZ    1 
ATOM   8223  N  NH1   . ARG B 1 509 ? 32.079  -21.124 107.585 1.00 127.92 ? 488 ARG B NH1   1 
ATOM   8224  N  NH2   . ARG B 1 509 ? 31.983  -23.312 108.341 1.00 131.67 ? 488 ARG B NH2   1 
ATOM   8225  N  N     . ALA B 1 510 ? 30.568  -27.696 102.784 1.00 117.08 ? 489 ALA B N     1 
ATOM   8226  C  CA    . ALA B 1 510 ? 30.076  -27.564 101.413 1.00 116.22 ? 489 ALA B CA    1 
ATOM   8227  C  C     . ALA B 1 510 ? 28.578  -27.817 101.347 1.00 114.14 ? 489 ALA B C     1 
ATOM   8228  O  O     . ALA B 1 510 ? 27.815  -26.984 100.842 1.00 127.69 ? 489 ALA B O     1 
ATOM   8229  C  CB    . ALA B 1 510 ? 30.800  -28.520 100.470 1.00 116.47 ? 489 ALA B CB    1 
ATOM   8230  N  N     . TRP B 1 511 ? 28.131  -28.955 101.881 1.00 112.99 ? 490 TRP B N     1 
ATOM   8231  C  CA    . TRP B 1 511 ? 26.723  -29.312 101.762 1.00 111.19 ? 490 TRP B CA    1 
ATOM   8232  C  C     . TRP B 1 511 ? 25.839  -28.304 102.434 1.00 110.87 ? 490 TRP B C     1 
ATOM   8233  O  O     . TRP B 1 511 ? 24.734  -28.034 101.965 1.00 130.76 ? 490 TRP B O     1 
ATOM   8234  C  CB    . TRP B 1 511 ? 26.468  -30.668 102.366 1.00 110.40 ? 490 TRP B CB    1 
ATOM   8235  C  CG    . TRP B 1 511 ? 27.161  -31.602 101.622 1.00 110.73 ? 490 TRP B CG    1 
ATOM   8236  C  CD1   . TRP B 1 511 ? 27.399  -31.545 100.302 1.00 110.93 ? 490 TRP B CD1   1 
ATOM   8237  C  CD2   . TRP B 1 511 ? 27.772  -32.768 102.105 1.00 111.18 ? 490 TRP B CD2   1 
ATOM   8238  N  NE1   . TRP B 1 511 ? 28.126  -32.628 99.915  1.00 116.25 ? 490 TRP B NE1   1 
ATOM   8239  C  CE2   . TRP B 1 511 ? 28.367  -33.401 101.014 1.00 111.60 ? 490 TRP B CE2   1 
ATOM   8240  C  CE3   . TRP B 1 511 ? 27.862  -33.351 103.354 1.00 111.46 ? 490 TRP B CE3   1 
ATOM   8241  C  CZ2   . TRP B 1 511 ? 29.051  -34.578 101.129 1.00 112.28 ? 490 TRP B CZ2   1 
ATOM   8242  C  CZ3   . TRP B 1 511 ? 28.533  -34.515 103.471 1.00 112.17 ? 490 TRP B CZ3   1 
ATOM   8243  C  CH2   . TRP B 1 511 ? 29.117  -35.128 102.363 1.00 112.55 ? 490 TRP B CH2   1 
ATOM   8244  N  N     . PHE B 1 512 ? 26.261  -27.811 103.580 1.00 111.85 ? 491 PHE B N     1 
ATOM   8245  C  CA    . PHE B 1 512 ? 25.431  -26.853 104.276 1.00 111.76 ? 491 PHE B CA    1 
ATOM   8246  C  C     . PHE B 1 512 ? 25.425  -25.509 103.563 1.00 114.05 ? 491 PHE B C     1 
ATOM   8247  O  O     . PHE B 1 512 ? 24.445  -24.761 103.662 1.00 133.73 ? 491 PHE B O     1 
ATOM   8248  C  CB    . PHE B 1 512 ? 25.872  -26.743 105.724 1.00 112.84 ? 491 PHE B CB    1 
ATOM   8249  C  CG    . PHE B 1 512 ? 25.786  -28.044 106.456 1.00 112.25 ? 491 PHE B CG    1 
ATOM   8250  C  CD1   . PHE B 1 512 ? 25.025  -29.089 105.942 1.00 110.62 ? 491 PHE B CD1   1 
ATOM   8251  C  CD2   . PHE B 1 512 ? 26.431  -28.221 107.671 1.00 124.50 ? 491 PHE B CD2   1 
ATOM   8252  C  CE1   . PHE B 1 512 ? 24.943  -30.292 106.607 1.00 110.32 ? 491 PHE B CE1   1 
ATOM   8253  C  CE2   . PHE B 1 512 ? 26.343  -29.424 108.355 1.00 118.95 ? 491 PHE B CE2   1 
ATOM   8254  C  CZ    . PHE B 1 512 ? 25.593  -30.459 107.824 1.00 111.65 ? 491 PHE B CZ    1 
ATOM   8255  N  N     . GLU B 1 513 ? 26.506  -25.160 102.869 1.00 113.92 ? 492 GLU B N     1 
ATOM   8256  C  CA    . GLU B 1 513 ? 26.446  -23.929 102.093 1.00 114.86 ? 492 GLU B CA    1 
ATOM   8257  C  C     . GLU B 1 513 ? 25.481  -24.082 100.925 1.00 115.41 ? 492 GLU B C     1 
ATOM   8258  O  O     . GLU B 1 513 ? 24.688  -23.178 100.645 1.00 140.01 ? 492 GLU B O     1 
ATOM   8259  C  CB    . GLU B 1 513 ? 27.835  -23.528 101.600 1.00 131.92 ? 492 GLU B CB    1 
ATOM   8260  C  CG    . GLU B 1 513 ? 28.086  -22.036 101.693 1.00 159.50 ? 492 GLU B CG    1 
ATOM   8261  C  CD    . GLU B 1 513 ? 28.397  -21.591 103.111 1.00 176.61 ? 492 GLU B CD    1 
ATOM   8262  O  OE1   . GLU B 1 513 ? 29.448  -22.020 103.630 1.00 177.82 ? 492 GLU B OE1   1 
ATOM   8263  O  OE2   . GLU B 1 513 ? 27.598  -20.828 103.705 1.00 188.48 ? 492 GLU B OE2   1 
ATOM   8264  N  N     . ARG B 1 514 ? 25.508  -25.229 100.248 1.00 114.80 ? 493 ARG B N     1 
ATOM   8265  C  CA    . ARG B 1 514 ? 24.588  -25.427 99.134  1.00 111.74 ? 493 ARG B CA    1 
ATOM   8266  C  C     . ARG B 1 514 ? 23.156  -25.551 99.619  1.00 110.30 ? 493 ARG B C     1 
ATOM   8267  O  O     . ARG B 1 514 ? 22.229  -25.055 98.974  1.00 110.12 ? 493 ARG B O     1 
ATOM   8268  C  CB    . ARG B 1 514 ? 24.986  -26.661 98.342  1.00 118.73 ? 493 ARG B CB    1 
ATOM   8269  C  CG    . ARG B 1 514 ? 24.266  -26.772 97.050  1.00 110.99 ? 493 ARG B CG    1 
ATOM   8270  C  CD    . ARG B 1 514 ? 24.664  -28.035 96.396  1.00 111.60 ? 493 ARG B CD    1 
ATOM   8271  N  NE    . ARG B 1 514 ? 23.531  -28.640 95.723  1.00 127.52 ? 493 ARG B NE    1 
ATOM   8272  C  CZ    . ARG B 1 514 ? 23.208  -28.375 94.468  1.00 142.30 ? 493 ARG B CZ    1 
ATOM   8273  N  NH1   . ARG B 1 514 ? 23.961  -27.520 93.774  1.00 148.31 ? 493 ARG B NH1   1 
ATOM   8274  N  NH2   . ARG B 1 514 ? 22.142  -28.962 93.920  1.00 131.71 ? 493 ARG B NH2   1 
ATOM   8275  N  N     . LEU B 1 515 ? 22.962  -26.210 100.752 1.00 109.49 ? 494 LEU B N     1 
ATOM   8276  C  CA    . LEU B 1 515 ? 21.633  -26.332 101.327 1.00 108.31 ? 494 LEU B CA    1 
ATOM   8277  C  C     . LEU B 1 515 ? 21.077  -24.961 101.680 1.00 108.95 ? 494 LEU B C     1 
ATOM   8278  O  O     . LEU B 1 515 ? 19.899  -24.676 101.449 1.00 119.48 ? 494 LEU B O     1 
ATOM   8279  C  CB    . LEU B 1 515 ? 21.694  -27.198 102.583 1.00 107.78 ? 494 LEU B CB    1 
ATOM   8280  C  CG    . LEU B 1 515 ? 20.420  -27.919 102.990 1.00 106.44 ? 494 LEU B CG    1 
ATOM   8281  C  CD1   . LEU B 1 515 ? 19.923  -28.651 101.787 1.00 108.19 ? 494 LEU B CD1   1 
ATOM   8282  C  CD2   . LEU B 1 515 ? 20.605  -28.830 104.163 1.00 106.25 ? 494 LEU B CD2   1 
ATOM   8283  N  N     . LEU B 1 516 ? 21.916  -24.103 102.252 1.00 110.34 ? 495 LEU B N     1 
ATOM   8284  C  CA    . LEU B 1 516 ? 21.503  -22.763 102.647 1.00 111.32 ? 495 LEU B CA    1 
ATOM   8285  C  C     . LEU B 1 516 ? 21.272  -21.833 101.461 1.00 112.14 ? 495 LEU B C     1 
ATOM   8286  O  O     . LEU B 1 516 ? 20.659  -20.781 101.649 1.00 112.88 ? 495 LEU B O     1 
ATOM   8287  C  CB    . LEU B 1 516 ? 22.531  -22.173 103.616 1.00 125.32 ? 495 LEU B CB    1 
ATOM   8288  C  CG    . LEU B 1 516 ? 22.395  -22.434 105.127 1.00 116.37 ? 495 LEU B CG    1 
ATOM   8289  C  CD1   . LEU B 1 516 ? 23.477  -21.659 105.847 1.00 114.96 ? 495 LEU B CD1   1 
ATOM   8290  C  CD2   . LEU B 1 516 ? 21.012  -22.071 105.711 1.00 112.19 ? 495 LEU B CD2   1 
ATOM   8291  N  N     . GLU B 1 517 ? 21.824  -22.135 100.276 1.00 112.37 ? 496 GLU B N     1 
ATOM   8292  C  CA    . GLU B 1 517 ? 21.608  -21.240 99.137  1.00 113.46 ? 496 GLU B CA    1 
ATOM   8293  C  C     . GLU B 1 517 ? 20.170  -21.334 98.641  1.00 112.53 ? 496 GLU B C     1 
ATOM   8294  O  O     . GLU B 1 517 ? 19.527  -20.304 98.397  1.00 125.95 ? 496 GLU B O     1 
ATOM   8295  C  CB    . GLU B 1 517 ? 22.590  -21.519 97.979  1.00 114.24 ? 496 GLU B CB    1 
ATOM   8296  C  CG    . GLU B 1 517 ? 23.962  -20.812 98.123  1.00 142.21 ? 496 GLU B CG    1 
ATOM   8297  C  CD    . GLU B 1 517 ? 25.068  -21.331 97.185  1.00 156.34 ? 496 GLU B CD    1 
ATOM   8298  O  OE1   . GLU B 1 517 ? 24.789  -22.179 96.306  1.00 158.80 ? 496 GLU B OE1   1 
ATOM   8299  O  OE2   . GLU B 1 517 ? 26.233  -20.895 97.349  1.00 146.07 ? 496 GLU B OE2   1 
ATOM   8300  N  N     . ASP B 1 518 ? 19.630  -22.551 98.521  1.00 110.88 ? 497 ASP B N     1 
ATOM   8301  C  CA    . ASP B 1 518 ? 18.211  -22.746 98.207  1.00 125.72 ? 497 ASP B CA    1 
ATOM   8302  C  C     . ASP B 1 518 ? 17.686  -23.840 99.127  1.00 118.57 ? 497 ASP B C     1 
ATOM   8303  O  O     . ASP B 1 518 ? 17.989  -25.013 98.902  1.00 131.35 ? 497 ASP B O     1 
ATOM   8304  C  CB    . ASP B 1 518 ? 18.047  -23.149 96.729  1.00 160.42 ? 497 ASP B CB    1 
ATOM   8305  C  CG    . ASP B 1 518 ? 16.604  -23.128 96.246  1.00 182.84 ? 497 ASP B CG    1 
ATOM   8306  O  OD1   . ASP B 1 518 ? 15.697  -22.971 97.078  1.00 201.60 ? 497 ASP B OD1   1 
ATOM   8307  O  OD2   . ASP B 1 518 ? 16.386  -23.281 95.017  1.00 184.44 ? 497 ASP B OD2   1 
ATOM   8308  N  N     . ILE B 1 519 ? 16.896  -23.484 100.142 1.00 108.08 ? 498 ILE B N     1 
ATOM   8309  C  CA    . ILE B 1 519 ? 16.414  -24.513 101.070 1.00 114.33 ? 498 ILE B CA    1 
ATOM   8310  C  C     . ILE B 1 519 ? 15.360  -25.408 100.418 1.00 123.12 ? 498 ILE B C     1 
ATOM   8311  O  O     . ILE B 1 519 ? 15.454  -26.637 100.528 1.00 130.65 ? 498 ILE B O     1 
ATOM   8312  C  CB    . ILE B 1 519 ? 15.902  -23.915 102.385 1.00 106.88 ? 498 ILE B CB    1 
ATOM   8313  C  CG1   . ILE B 1 519 ? 17.036  -23.281 103.146 1.00 107.93 ? 498 ILE B CG1   1 
ATOM   8314  C  CG2   . ILE B 1 519 ? 15.414  -24.984 103.275 1.00 105.76 ? 498 ILE B CG2   1 
ATOM   8315  C  CD1   . ILE B 1 519 ? 16.621  -22.827 104.521 1.00 108.24 ? 498 ILE B CD1   1 
ATOM   8316  N  N     . PRO B 1 520 ? 14.329  -24.869 99.760  1.00 121.19 ? 499 PRO B N     1 
ATOM   8317  C  CA    . PRO B 1 520 ? 13.334  -25.772 99.159  1.00 115.05 ? 499 PRO B CA    1 
ATOM   8318  C  C     . PRO B 1 520 ? 13.840  -26.556 97.962  1.00 114.11 ? 499 PRO B C     1 
ATOM   8319  O  O     . PRO B 1 520 ? 13.468  -27.726 97.812  1.00 133.60 ? 499 PRO B O     1 
ATOM   8320  C  CB    . PRO B 1 520 ? 12.195  -24.828 98.764  1.00 136.19 ? 499 PRO B CB    1 
ATOM   8321  C  CG    . PRO B 1 520 ? 12.489  -23.531 99.433  1.00 143.07 ? 499 PRO B CG    1 
ATOM   8322  C  CD    . PRO B 1 520 ? 13.940  -23.457 99.627  1.00 137.27 ? 499 PRO B CD    1 
ATOM   8323  N  N     . GLY B 1 521 ? 14.682  -25.967 97.113  1.00 113.50 ? 500 GLY B N     1 
ATOM   8324  C  CA    . GLY B 1 521 ? 15.131  -26.657 95.913  1.00 140.86 ? 500 GLY B CA    1 
ATOM   8325  C  C     . GLY B 1 521 ? 16.352  -27.531 96.142  1.00 136.53 ? 500 GLY B C     1 
ATOM   8326  O  O     . GLY B 1 521 ? 16.623  -28.491 95.406  1.00 132.24 ? 500 GLY B O     1 
ATOM   8327  N  N     . ASN B 1 522 ? 17.127  -27.185 97.153  1.00 121.12 ? 501 ASN B N     1 
ATOM   8328  C  CA    . ASN B 1 522 ? 18.270  -27.998 97.505  1.00 111.27 ? 501 ASN B CA    1 
ATOM   8329  C  C     . ASN B 1 522 ? 18.065  -28.906 98.708  1.00 105.18 ? 501 ASN B C     1 
ATOM   8330  O  O     . ASN B 1 522 ? 19.019  -29.561 99.095  1.00 139.23 ? 501 ASN B O     1 
ATOM   8331  C  CB    . ASN B 1 522 ? 19.495  -27.111 97.683  1.00 119.24 ? 501 ASN B CB    1 
ATOM   8332  C  CG    . ASN B 1 522 ? 20.007  -26.597 96.354  1.00 127.35 ? 501 ASN B CG    1 
ATOM   8333  O  OD1   . ASN B 1 522 ? 19.724  -27.198 95.307  1.00 108.86 ? 501 ASN B OD1   1 
ATOM   8334  N  ND2   . ASN B 1 522 ? 20.688  -25.444 96.369  1.00 117.86 ? 501 ASN B ND2   1 
ATOM   8335  N  N     . ARG B 1 523 ? 16.896  -28.957 99.360  1.00 105.85 ? 502 ARG B N     1 
ATOM   8336  C  CA    . ARG B 1 523 ? 16.870  -29.985 100.403 1.00 103.76 ? 502 ARG B CA    1 
ATOM   8337  C  C     . ARG B 1 523 ? 16.486  -31.340 99.847  1.00 103.34 ? 502 ARG B C     1 
ATOM   8338  O  O     . ARG B 1 523 ? 16.290  -32.274 100.635 1.00 115.03 ? 502 ARG B O     1 
ATOM   8339  C  CB    . ARG B 1 523 ? 15.961  -29.727 101.609 1.00 121.85 ? 502 ARG B CB    1 
ATOM   8340  C  CG    . ARG B 1 523 ? 14.488  -29.731 101.363 1.00 166.24 ? 502 ARG B CG    1 
ATOM   8341  C  CD    . ARG B 1 523 ? 13.812  -29.302 102.623 1.00 164.59 ? 502 ARG B CD    1 
ATOM   8342  N  NE    . ARG B 1 523 ? 12.511  -28.725 102.348 1.00 172.25 ? 502 ARG B NE    1 
ATOM   8343  C  CZ    . ARG B 1 523 ? 11.724  -28.249 103.298 1.00 174.90 ? 502 ARG B CZ    1 
ATOM   8344  N  NH1   . ARG B 1 523 ? 12.127  -28.315 104.563 1.00 177.92 ? 502 ARG B NH1   1 
ATOM   8345  N  NH2   . ARG B 1 523 ? 10.551  -27.716 102.987 1.00 168.36 ? 502 ARG B NH2   1 
ATOM   8346  N  N     . ALA B 1 524 ? 16.276  -31.474 98.547  1.00 103.67 ? 503 ALA B N     1 
ATOM   8347  C  CA    . ALA B 1 524 ? 16.177  -32.829 98.053  1.00 103.59 ? 503 ALA B CA    1 
ATOM   8348  C  C     . ALA B 1 524 ? 17.111  -32.974 96.882  1.00 109.65 ? 503 ALA B C     1 
ATOM   8349  O  O     . ALA B 1 524 ? 17.719  -32.005 96.420  1.00 104.98 ? 503 ALA B O     1 
ATOM   8350  C  CB    . ALA B 1 524 ? 14.765  -33.234 97.661  1.00 103.44 ? 503 ALA B CB    1 
ATOM   8351  N  N     . GLY B 1 525 ? 17.162  -34.200 96.387  1.00 117.54 ? 504 GLY B N     1 
ATOM   8352  C  CA    . GLY B 1 525 ? 18.034  -34.571 95.305  1.00 107.97 ? 504 GLY B CA    1 
ATOM   8353  C  C     . GLY B 1 525 ? 19.123  -35.481 95.743  1.00 113.45 ? 504 GLY B C     1 
ATOM   8354  O  O     . GLY B 1 525 ? 19.903  -35.942 94.902  1.00 144.39 ? 504 GLY B O     1 
ATOM   8355  N  N     . LEU B 1 526 ? 19.223  -35.722 97.029  1.00 126.15 ? 505 LEU B N     1 
ATOM   8356  C  CA    . LEU B 1 526 ? 20.328  -36.506 97.527  1.00 114.99 ? 505 LEU B CA    1 
ATOM   8357  C  C     . LEU B 1 526 ? 20.100  -37.982 97.236  1.00 105.74 ? 505 LEU B C     1 
ATOM   8358  O  O     . LEU B 1 526 ? 19.010  -38.370 96.781  1.00 114.62 ? 505 LEU B O     1 
ATOM   8359  C  CB    . LEU B 1 526 ? 20.537  -36.231 99.002  1.00 105.04 ? 505 LEU B CB    1 
ATOM   8360  C  CG    . LEU B 1 526 ? 21.323  -34.925 99.161  1.00 118.12 ? 505 LEU B CG    1 
ATOM   8361  C  CD1   . LEU B 1 526 ? 21.370  -34.452 100.591 1.00 105.18 ? 505 LEU B CD1   1 
ATOM   8362  C  CD2   . LEU B 1 526 ? 22.732  -35.113 98.654  1.00 123.51 ? 505 LEU B CD2   1 
ATOM   8363  N  N     . PRO B 1 527 ? 21.172  -38.774 97.333  1.00 106.49 ? 506 PRO B N     1 
ATOM   8364  C  CA    . PRO B 1 527 ? 21.147  -40.202 96.964  1.00 108.93 ? 506 PRO B CA    1 
ATOM   8365  C  C     . PRO B 1 527 ? 20.498  -41.166 97.964  1.00 115.57 ? 506 PRO B C     1 
ATOM   8366  O  O     . PRO B 1 527 ? 20.262  -40.859 99.133  1.00 107.18 ? 506 PRO B O     1 
ATOM   8367  C  CB    . PRO B 1 527 ? 22.628  -40.532 96.809  1.00 108.25 ? 506 PRO B CB    1 
ATOM   8368  C  CG    . PRO B 1 527 ? 23.248  -39.236 96.505  1.00 108.21 ? 506 PRO B CG    1 
ATOM   8369  C  CD    . PRO B 1 527 ? 22.537  -38.238 97.303  1.00 107.13 ? 506 PRO B CD    1 
ATOM   8370  N  N     . ASP B 1 528 ? 20.233  -42.379 97.455  1.00 107.80 ? 507 ASP B N     1 
ATOM   8371  C  CA    . ASP B 1 528 ? 19.508  -43.413 98.199  1.00 107.98 ? 507 ASP B CA    1 
ATOM   8372  C  C     . ASP B 1 528 ? 20.301  -43.970 99.374  1.00 110.46 ? 507 ASP B C     1 
ATOM   8373  O  O     . ASP B 1 528 ? 19.714  -44.343 100.397 1.00 123.89 ? 507 ASP B O     1 
ATOM   8374  C  CB    . ASP B 1 528 ? 19.119  -44.579 97.268  1.00 139.04 ? 507 ASP B CB    1 
ATOM   8375  C  CG    . ASP B 1 528 ? 18.101  -44.185 96.197  1.00 172.94 ? 507 ASP B CG    1 
ATOM   8376  O  OD1   . ASP B 1 528 ? 17.209  -43.347 96.470  1.00 181.09 ? 507 ASP B OD1   1 
ATOM   8377  O  OD2   . ASP B 1 528 ? 18.177  -44.757 95.083  1.00 191.07 ? 507 ASP B OD2   1 
ATOM   8378  N  N     . LEU B 1 529 ? 21.615  -44.107 99.220  1.00 120.10 ? 508 LEU B N     1 
ATOM   8379  C  CA    . LEU B 1 529 ? 22.447  -44.892 100.122 1.00 120.93 ? 508 LEU B CA    1 
ATOM   8380  C  C     . LEU B 1 529 ? 23.682  -44.114 100.556 1.00 116.78 ? 508 LEU B C     1 
ATOM   8381  O  O     . LEU B 1 529 ? 24.153  -43.212 99.861  1.00 117.84 ? 508 LEU B O     1 
ATOM   8382  C  CB    . LEU B 1 529 ? 22.879  -46.204 99.448  1.00 111.92 ? 508 LEU B CB    1 
ATOM   8383  C  CG    . LEU B 1 529 ? 21.734  -47.085 98.963  1.00 112.20 ? 508 LEU B CG    1 
ATOM   8384  C  CD1   . LEU B 1 529 ? 22.283  -48.335 98.325  1.00 114.02 ? 508 LEU B CD1   1 
ATOM   8385  C  CD2   . LEU B 1 529 ? 20.784  -47.417 100.110 1.00 111.92 ? 508 LEU B CD2   1 
ATOM   8386  N  N     . ILE B 1 530 ? 24.226  -44.506 101.705 1.00 111.35 ? 509 ILE B N     1 
ATOM   8387  C  CA    . ILE B 1 530 ? 25.528  -44.042 102.165 1.00 112.14 ? 509 ILE B CA    1 
ATOM   8388  C  C     . ILE B 1 530 ? 26.255  -45.250 102.677 1.00 113.93 ? 509 ILE B C     1 
ATOM   8389  O  O     . ILE B 1 530 ? 25.661  -46.081 103.366 1.00 114.33 ? 509 ILE B O     1 
ATOM   8390  C  CB    . ILE B 1 530 ? 25.412  -42.995 103.285 1.00 111.51 ? 509 ILE B CB    1 
ATOM   8391  C  CG1   . ILE B 1 530 ? 24.486  -41.884 102.811 1.00 177.45 ? 509 ILE B CG1   1 
ATOM   8392  C  CG2   . ILE B 1 530 ? 26.757  -42.451 103.643 1.00 112.57 ? 509 ILE B CG2   1 
ATOM   8393  C  CD1   . ILE B 1 530 ? 24.216  -40.835 103.812 1.00 186.93 ? 509 ILE B CD1   1 
ATOM   8394  N  N     . GLN B 1 531 ? 27.524  -45.376 102.328 1.00 115.22 ? 510 GLN B N     1 
ATOM   8395  C  CA    . GLN B 1 531 ? 28.318  -46.468 102.863 1.00 119.98 ? 510 GLN B CA    1 
ATOM   8396  C  C     . GLN B 1 531 ? 29.550  -45.929 103.565 1.00 118.68 ? 510 GLN B C     1 
ATOM   8397  O  O     . GLN B 1 531 ? 30.191  -44.987 103.091 1.00 123.31 ? 510 GLN B O     1 
ATOM   8398  C  CB    . GLN B 1 531 ? 28.667  -47.490 101.784 1.00 118.35 ? 510 GLN B CB    1 
ATOM   8399  C  CG    . GLN B 1 531 ? 29.299  -47.001 100.533 1.00 118.31 ? 510 GLN B CG    1 
ATOM   8400  C  CD    . GLN B 1 531 ? 29.380  -48.150 99.544  1.00 129.02 ? 510 GLN B CD    1 
ATOM   8401  O  OE1   . GLN B 1 531 ? 29.943  -48.021 98.454  1.00 131.91 ? 510 GLN B OE1   1 
ATOM   8402  N  NE2   . GLN B 1 531 ? 28.812  -49.302 99.933  1.00 120.27 ? 510 GLN B NE2   1 
ATOM   8403  N  N     . PHE B 1 532 ? 29.857  -46.553 104.702 1.00 119.83 ? 511 PHE B N     1 
ATOM   8404  C  CA    . PHE B 1 532 ? 30.905  -46.140 105.621 1.00 123.94 ? 511 PHE B CA    1 
ATOM   8405  C  C     . PHE B 1 532 ? 31.948  -47.237 105.801 1.00 123.89 ? 511 PHE B C     1 
ATOM   8406  O  O     . PHE B 1 532 ? 31.609  -48.404 105.982 1.00 136.33 ? 511 PHE B O     1 
ATOM   8407  C  CB    . PHE B 1 532 ? 30.309  -45.805 106.983 1.00 121.08 ? 511 PHE B CB    1 
ATOM   8408  C  CG    . PHE B 1 532 ? 29.422  -44.604 106.977 1.00 118.89 ? 511 PHE B CG    1 
ATOM   8409  C  CD1   . PHE B 1 532 ? 29.885  -43.392 106.523 1.00 118.25 ? 511 PHE B CD1   1 
ATOM   8410  C  CD2   . PHE B 1 532 ? 28.164  -44.658 107.509 1.00 117.76 ? 511 PHE B CD2   1 
ATOM   8411  C  CE1   . PHE B 1 532 ? 29.087  -42.283 106.555 1.00 116.51 ? 511 PHE B CE1   1 
ATOM   8412  C  CE2   . PHE B 1 532 ? 27.370  -43.548 107.547 1.00 115.98 ? 511 PHE B CE2   1 
ATOM   8413  C  CZ    . PHE B 1 532 ? 27.831  -42.363 107.069 1.00 115.37 ? 511 PHE B CZ    1 
ATOM   8414  N  N     . TRP B 1 533 ? 33.224  -46.863 105.785 1.00 125.34 ? 512 TRP B N     1 
ATOM   8415  C  CA    . TRP B 1 533 ? 34.304  -47.788 106.107 1.00 128.15 ? 512 TRP B CA    1 
ATOM   8416  C  C     . TRP B 1 533 ? 34.984  -47.190 107.326 1.00 152.02 ? 512 TRP B C     1 
ATOM   8417  O  O     . TRP B 1 533 ? 35.923  -46.382 107.194 1.00 180.62 ? 512 TRP B O     1 
ATOM   8418  C  CB    . TRP B 1 533 ? 35.278  -47.937 104.954 1.00 129.05 ? 512 TRP B CB    1 
ATOM   8419  C  CG    . TRP B 1 533 ? 34.664  -48.425 103.707 1.00 127.89 ? 512 TRP B CG    1 
ATOM   8420  C  CD1   . TRP B 1 533 ? 34.475  -49.713 103.349 1.00 128.91 ? 512 TRP B CD1   1 
ATOM   8421  C  CD2   . TRP B 1 533 ? 34.212  -47.630 102.603 1.00 125.84 ? 512 TRP B CD2   1 
ATOM   8422  N  NE1   . TRP B 1 533 ? 33.915  -49.781 102.101 1.00 127.63 ? 512 TRP B NE1   1 
ATOM   8423  C  CE2   . TRP B 1 533 ? 33.747  -48.511 101.622 1.00 125.75 ? 512 TRP B CE2   1 
ATOM   8424  C  CE3   . TRP B 1 533 ? 34.140  -46.253 102.358 1.00 124.31 ? 512 TRP B CE3   1 
ATOM   8425  C  CZ2   . TRP B 1 533 ? 33.211  -48.066 100.420 1.00 128.01 ? 512 TRP B CZ2   1 
ATOM   8426  C  CZ3   . TRP B 1 533 ? 33.626  -45.819 101.162 1.00 122.78 ? 512 TRP B CZ3   1 
ATOM   8427  C  CH2   . TRP B 1 533 ? 33.163  -46.717 100.213 1.00 122.75 ? 512 TRP B CH2   1 
ATOM   8428  N  N     . PRO B 1 534 ? 34.496  -47.501 108.528 1.00 152.07 ? 513 PRO B N     1 
ATOM   8429  C  CA    . PRO B 1 534 ? 34.973  -46.792 109.727 1.00 141.88 ? 513 PRO B CA    1 
ATOM   8430  C  C     . PRO B 1 534 ? 36.418  -47.081 110.083 1.00 150.85 ? 513 PRO B C     1 
ATOM   8431  O  O     . PRO B 1 534 ? 37.102  -46.193 110.605 1.00 148.58 ? 513 PRO B O     1 
ATOM   8432  C  CB    . PRO B 1 534 ? 34.033  -47.303 110.829 1.00 148.14 ? 513 PRO B CB    1 
ATOM   8433  C  CG    . PRO B 1 534 ? 32.844  -47.874 110.108 1.00 148.59 ? 513 PRO B CG    1 
ATOM   8434  C  CD    . PRO B 1 534 ? 33.393  -48.425 108.825 1.00 149.73 ? 513 PRO B CD    1 
ATOM   8435  N  N     . ALA B 1 535 ? 36.908  -48.288 109.796 1.00 161.20 ? 514 ALA B N     1 
ATOM   8436  C  CA    . ALA B 1 535 ? 38.271  -48.635 110.167 1.00 168.64 ? 514 ALA B CA    1 
ATOM   8437  C  C     . ALA B 1 535 ? 39.267  -47.679 109.539 1.00 146.60 ? 514 ALA B C     1 
ATOM   8438  O  O     . ALA B 1 535 ? 40.301  -47.362 110.153 1.00 142.46 ? 514 ALA B O     1 
ATOM   8439  C  CB    . ALA B 1 535 ? 38.569  -50.065 109.738 1.00 191.74 ? 514 ALA B CB    1 
ATOM   8440  N  N     . GLN B 1 536 ? 38.974  -47.228 108.304 1.00 137.63 ? 515 GLN B N     1 
ATOM   8441  C  CA    . GLN B 1 536 ? 39.762  -46.239 107.568 1.00 139.53 ? 515 GLN B CA    1 
ATOM   8442  C  C     . GLN B 1 536 ? 39.196  -44.823 107.618 1.00 135.28 ? 515 GLN B C     1 
ATOM   8443  O  O     . GLN B 1 536 ? 39.831  -43.911 107.070 1.00 135.36 ? 515 GLN B O     1 
ATOM   8444  C  CB    . GLN B 1 536 ? 39.920  -46.659 106.102 1.00 136.88 ? 515 GLN B CB    1 
ATOM   8445  C  CG    . GLN B 1 536 ? 38.730  -47.387 105.567 1.00 134.88 ? 515 GLN B CG    1 
ATOM   8446  C  CD    . GLN B 1 536 ? 39.005  -48.845 105.375 1.00 136.77 ? 515 GLN B CD    1 
ATOM   8447  O  OE1   . GLN B 1 536 ? 38.440  -49.703 106.075 1.00 137.27 ? 515 GLN B OE1   1 
ATOM   8448  N  NE2   . GLN B 1 536 ? 39.884  -49.148 104.419 1.00 138.05 ? 515 GLN B NE2   1 
ATOM   8449  N  N     . ARG B 1 537 ? 38.050  -44.612 108.280 1.00 133.57 ? 516 ARG B N     1 
ATOM   8450  C  CA    . ARG B 1 537 ? 37.279  -43.355 108.263 1.00 131.22 ? 516 ARG B CA    1 
ATOM   8451  C  C     . ARG B 1 537 ? 37.069  -42.832 106.832 1.00 129.23 ? 516 ARG B C     1 
ATOM   8452  O  O     . ARG B 1 537 ? 37.632  -41.831 106.396 1.00 134.96 ? 516 ARG B O     1 
ATOM   8453  C  CB    . ARG B 1 537 ? 37.918  -42.277 109.142 1.00 132.65 ? 516 ARG B CB    1 
ATOM   8454  C  CG    . ARG B 1 537 ? 39.118  -42.705 109.932 1.00 136.11 ? 516 ARG B CG    1 
ATOM   8455  C  CD    . ARG B 1 537 ? 39.523  -41.613 110.856 1.00 137.43 ? 516 ARG B CD    1 
ATOM   8456  N  NE    . ARG B 1 537 ? 38.386  -41.292 111.694 1.00 140.82 ? 516 ARG B NE    1 
ATOM   8457  C  CZ    . ARG B 1 537 ? 38.424  -40.432 112.694 1.00 140.69 ? 516 ARG B CZ    1 
ATOM   8458  N  NH1   . ARG B 1 537 ? 39.554  -39.802 112.981 1.00 139.53 ? 516 ARG B NH1   1 
ATOM   8459  N  NH2   . ARG B 1 537 ? 37.328  -40.218 113.405 1.00 152.52 ? 516 ARG B NH2   1 
ATOM   8460  N  N     . ARG B 1 538 ? 36.217  -43.540 106.105 1.00 127.61 ? 517 ARG B N     1 
ATOM   8461  C  CA    . ARG B 1 538 ? 35.964  -43.194 104.719 1.00 126.00 ? 517 ARG B CA    1 
ATOM   8462  C  C     . ARG B 1 538 ? 34.467  -43.368 104.462 1.00 123.54 ? 517 ARG B C     1 
ATOM   8463  O  O     . ARG B 1 538 ? 33.776  -44.047 105.222 1.00 123.39 ? 517 ARG B O     1 
ATOM   8464  C  CB    . ARG B 1 538 ? 36.846  -44.083 103.814 1.00 127.56 ? 517 ARG B CB    1 
ATOM   8465  C  CG    . ARG B 1 538 ? 37.443  -43.463 102.563 1.00 133.67 ? 517 ARG B CG    1 
ATOM   8466  C  CD    . ARG B 1 538 ? 38.456  -44.414 101.830 1.00 153.81 ? 517 ARG B CD    1 
ATOM   8467  N  NE    . ARG B 1 538 ? 37.845  -45.526 101.066 1.00 173.00 ? 517 ARG B NE    1 
ATOM   8468  C  CZ    . ARG B 1 538 ? 37.990  -46.837 101.314 1.00 169.92 ? 517 ARG B CZ    1 
ATOM   8469  N  NH1   . ARG B 1 538 ? 38.776  -47.268 102.301 1.00 148.67 ? 517 ARG B NH1   1 
ATOM   8470  N  NH2   . ARG B 1 538 ? 37.371  -47.734 100.539 1.00 139.96 ? 517 ARG B NH2   1 
ATOM   8471  N  N     . TYR B 1 539 ? 33.955  -42.735 103.398 1.00 142.52 ? 518 TYR B N     1 
ATOM   8472  C  CA    . TYR B 1 539 ? 32.556  -42.913 102.995 1.00 119.69 ? 518 TYR B CA    1 
ATOM   8473  C  C     . TYR B 1 539 ? 32.388  -42.741 101.488 1.00 118.98 ? 518 TYR B C     1 
ATOM   8474  O  O     . TYR B 1 539 ? 33.265  -42.215 100.794 1.00 119.61 ? 518 TYR B O     1 
ATOM   8475  C  CB    . TYR B 1 539 ? 31.604  -41.928 103.678 1.00 118.06 ? 518 TYR B CB    1 
ATOM   8476  C  CG    . TYR B 1 539 ? 31.707  -40.536 103.095 1.00 117.27 ? 518 TYR B CG    1 
ATOM   8477  C  CD1   . TYR B 1 539 ? 32.685  -39.664 103.536 1.00 124.84 ? 518 TYR B CD1   1 
ATOM   8478  C  CD2   . TYR B 1 539 ? 30.870  -40.107 102.079 1.00 115.65 ? 518 TYR B CD2   1 
ATOM   8479  C  CE1   . TYR B 1 539 ? 32.806  -38.401 103.018 1.00 118.08 ? 518 TYR B CE1   1 
ATOM   8480  C  CE2   . TYR B 1 539 ? 30.987  -38.842 101.553 1.00 115.24 ? 518 TYR B CE2   1 
ATOM   8481  C  CZ    . TYR B 1 539 ? 31.962  -37.989 102.029 1.00 116.46 ? 518 TYR B CZ    1 
ATOM   8482  O  OH    . TYR B 1 539 ? 32.123  -36.715 101.524 1.00 116.36 ? 518 TYR B OH    1 
ATOM   8483  N  N     . ARG B 1 540 ? 31.242  -43.224 100.991 1.00 125.05 ? 519 ARG B N     1 
ATOM   8484  C  CA    . ARG B 1 540 ? 30.767  -42.962 99.637  1.00 116.75 ? 519 ARG B CA    1 
ATOM   8485  C  C     . ARG B 1 540 ? 29.244  -43.008 99.606  1.00 128.55 ? 519 ARG B C     1 
ATOM   8486  O  O     . ARG B 1 540 ? 28.641  -43.930 100.159 1.00 124.20 ? 519 ARG B O     1 
ATOM   8487  C  CB    . ARG B 1 540 ? 31.303  -43.987 98.632  1.00 117.94 ? 519 ARG B CB    1 
ATOM   8488  C  CG    . ARG B 1 540 ? 30.904  -43.706 97.183  1.00 135.45 ? 519 ARG B CG    1 
ATOM   8489  C  CD    . ARG B 1 540 ? 31.519  -44.684 96.211  1.00 118.99 ? 519 ARG B CD    1 
ATOM   8490  N  NE    . ARG B 1 540 ? 30.996  -46.014 96.489  1.00 121.51 ? 519 ARG B NE    1 
ATOM   8491  C  CZ    . ARG B 1 540 ? 31.007  -47.021 95.626  1.00 131.57 ? 519 ARG B CZ    1 
ATOM   8492  N  NH1   . ARG B 1 540 ? 31.518  -46.849 94.405  1.00 127.20 ? 519 ARG B NH1   1 
ATOM   8493  N  NH2   . ARG B 1 540 ? 30.507  -48.201 95.996  1.00 125.96 ? 519 ARG B NH2   1 
ATOM   8494  N  N     . MET B 1 541 ? 28.635  -42.067 98.883  1.00 125.49 ? 520 MET B N     1 
ATOM   8495  C  CA    . MET B 1 541 ? 27.192  -42.038 98.680  1.00 112.19 ? 520 MET B CA    1 
ATOM   8496  C  C     . MET B 1 541 ? 26.809  -42.715 97.374  1.00 112.46 ? 520 MET B C     1 
ATOM   8497  O  O     . MET B 1 541 ? 27.505  -42.573 96.366  1.00 113.27 ? 520 MET B O     1 
ATOM   8498  C  CB    . MET B 1 541 ? 26.657  -40.618 98.645  1.00 110.94 ? 520 MET B CB    1 
ATOM   8499  C  CG    . MET B 1 541 ? 27.168  -39.725 99.708  1.00 110.98 ? 520 MET B CG    1 
ATOM   8500  S  SD    . MET B 1 541 ? 25.972  -38.390 99.848  1.00 110.71 ? 520 MET B SD    1 
ATOM   8501  C  CE    . MET B 1 541 ? 27.032  -37.008 100.206 1.00 110.10 ? 520 MET B CE    1 
ATOM   8502  N  N     . VAL B 1 542 ? 25.718  -43.476 97.401  1.00 112.03 ? 521 VAL B N     1 
ATOM   8503  C  CA    . VAL B 1 542 ? 25.294  -44.268 96.252  1.00 112.63 ? 521 VAL B CA    1 
ATOM   8504  C  C     . VAL B 1 542 ? 23.793  -44.118 96.022  1.00 122.91 ? 521 VAL B C     1 
ATOM   8505  O  O     . VAL B 1 542 ? 22.996  -44.608 96.828  1.00 142.70 ? 521 VAL B O     1 
ATOM   8506  C  CB    . VAL B 1 542 ? 25.653  -45.745 96.446  1.00 114.09 ? 521 VAL B CB    1 
ATOM   8507  C  CG1   . VAL B 1 542 ? 25.026  -46.595 95.368  1.00 114.83 ? 521 VAL B CG1   1 
ATOM   8508  C  CG2   . VAL B 1 542 ? 27.161  -45.898 96.426  1.00 124.29 ? 521 VAL B CG2   1 
ATOM   8509  N  N     . GLU B 1 543 ? 23.411  -43.564 94.866  1.00 111.42 ? 522 GLU B N     1 
ATOM   8510  C  CA    . GLU B 1 543 ? 22.022  -43.564 94.412  1.00 110.90 ? 522 GLU B CA    1 
ATOM   8511  C  C     . GLU B 1 543 ? 21.782  -44.792 93.529  1.00 112.30 ? 522 GLU B C     1 
ATOM   8512  O  O     . GLU B 1 543 ? 22.558  -45.068 92.608  1.00 113.54 ? 522 GLU B O     1 
ATOM   8513  C  CB    . GLU B 1 543 ? 21.709  -42.275 93.639  1.00 115.28 ? 522 GLU B CB    1 
ATOM   8514  C  CG    . GLU B 1 543 ? 20.333  -42.206 92.944  1.00 113.25 ? 522 GLU B CG    1 
ATOM   8515  C  CD    . GLU B 1 543 ? 19.141  -42.109 93.893  1.00 133.75 ? 522 GLU B CD    1 
ATOM   8516  O  OE1   . GLU B 1 543 ? 19.255  -41.393 94.906  1.00 133.54 ? 522 GLU B OE1   1 
ATOM   8517  O  OE2   . GLU B 1 543 ? 18.101  -42.771 93.639  1.00 135.06 ? 522 GLU B OE2   1 
ATOM   8518  N  N     . VAL B 1 544 ? 20.720  -45.543 93.826  1.00 113.02 ? 523 VAL B N     1 
ATOM   8519  C  CA    . VAL B 1 544 ? 20.383  -46.752 93.080  1.00 131.08 ? 523 VAL B CA    1 
ATOM   8520  C  C     . VAL B 1 544 ? 19.234  -46.449 92.133  1.00 140.00 ? 523 VAL B C     1 
ATOM   8521  O  O     . VAL B 1 544 ? 18.253  -45.789 92.498  1.00 144.44 ? 523 VAL B O     1 
ATOM   8522  C  CB    . VAL B 1 544 ? 20.027  -47.919 94.017  1.00 154.53 ? 523 VAL B CB    1 
ATOM   8523  C  CG1   . VAL B 1 544 ? 19.563  -49.127 93.208  1.00 155.81 ? 523 VAL B CG1   1 
ATOM   8524  C  CG2   . VAL B 1 544 ? 21.229  -48.283 94.861  1.00 173.27 ? 523 VAL B CG2   1 
ATOM   8525  N  N     . LYS B 1 545 ? 19.352  -46.936 90.910  1.00 138.55 ? 524 LYS B N     1 
ATOM   8526  C  CA    . LYS B 1 545 ? 18.332  -46.735 89.899  1.00 131.20 ? 524 LYS B CA    1 
ATOM   8527  C  C     . LYS B 1 545 ? 17.935  -48.105 89.392  1.00 152.43 ? 524 LYS B C     1 
ATOM   8528  O  O     . LYS B 1 545 ? 18.782  -48.848 88.889  1.00 179.05 ? 524 LYS B O     1 
ATOM   8529  C  CB    . LYS B 1 545 ? 18.858  -45.853 88.766  1.00 121.24 ? 524 LYS B CB    1 
ATOM   8530  C  CG    . LYS B 1 545 ? 19.048  -44.391 89.168  1.00 114.96 ? 524 LYS B CG    1 
ATOM   8531  C  CD    . LYS B 1 545 ? 17.738  -43.764 89.634  1.00 133.19 ? 524 LYS B CD    1 
ATOM   8532  C  CE    . LYS B 1 545 ? 17.923  -42.319 90.101  1.00 144.49 ? 524 LYS B CE    1 
ATOM   8533  N  NZ    . LYS B 1 545 ? 16.654  -41.671 90.584  1.00 142.51 ? 524 LYS B NZ    1 
ATOM   8534  N  N     . GLY B 1 546 ? 16.658  -48.446 89.530  1.00 145.01 ? 525 GLY B N     1 
ATOM   8535  C  CA    . GLY B 1 546 ? 16.158  -49.657 88.932  1.00 151.22 ? 525 GLY B CA    1 
ATOM   8536  C  C     . GLY B 1 546 ? 16.220  -49.471 87.436  1.00 165.94 ? 525 GLY B C     1 
ATOM   8537  O  O     . GLY B 1 546 ? 16.523  -48.377 86.952  1.00 191.58 ? 525 GLY B O     1 
ATOM   8538  N  N     . PRO B 1 547 ? 15.945  -50.518 86.660  1.00 172.85 ? 526 PRO B N     1 
ATOM   8539  C  CA    . PRO B 1 547 ? 15.941  -50.338 85.201  1.00 167.69 ? 526 PRO B CA    1 
ATOM   8540  C  C     . PRO B 1 547 ? 14.876  -49.357 84.754  1.00 179.09 ? 526 PRO B C     1 
ATOM   8541  O  O     . PRO B 1 547 ? 14.964  -48.829 83.635  1.00 153.21 ? 526 PRO B O     1 
ATOM   8542  C  CB    . PRO B 1 547 ? 15.676  -51.752 84.665  1.00 165.99 ? 526 PRO B CB    1 
ATOM   8543  C  CG    . PRO B 1 547 ? 15.813  -52.666 85.851  1.00 163.04 ? 526 PRO B CG    1 
ATOM   8544  C  CD    . PRO B 1 547 ? 15.465  -51.849 87.047  1.00 161.61 ? 526 PRO B CD    1 
ATOM   8545  N  N     . GLY B 1 548 ? 13.893  -49.090 85.626  1.00 187.02 ? 527 GLY B N     1 
ATOM   8546  C  CA    . GLY B 1 548 ? 12.753  -48.218 85.413  1.00 180.17 ? 527 GLY B CA    1 
ATOM   8547  C  C     . GLY B 1 548 ? 12.791  -46.860 86.099  1.00 166.58 ? 527 GLY B C     1 
ATOM   8548  O  O     . GLY B 1 548 ? 11.732  -46.303 86.388  1.00 155.80 ? 527 GLY B O     1 
ATOM   8549  N  N     . ASP B 1 549 ? 13.973  -46.364 86.471  1.00 166.86 ? 528 ASP B N     1 
ATOM   8550  C  CA    . ASP B 1 549 ? 14.166  -44.965 86.854  1.00 168.48 ? 528 ASP B CA    1 
ATOM   8551  C  C     . ASP B 1 549 ? 15.487  -44.463 86.273  1.00 157.16 ? 528 ASP B C     1 
ATOM   8552  O  O     . ASP B 1 549 ? 16.458  -45.221 86.196  1.00 180.77 ? 528 ASP B O     1 
ATOM   8553  C  CB    . ASP B 1 549 ? 14.161  -44.776 88.390  1.00 169.37 ? 528 ASP B CB    1 
ATOM   8554  C  CG    . ASP B 1 549 ? 13.822  -43.334 88.821  1.00 163.14 ? 528 ASP B CG    1 
ATOM   8555  O  OD1   . ASP B 1 549 ? 13.725  -43.089 90.035  1.00 186.05 ? 528 ASP B OD1   1 
ATOM   8556  O  OD2   . ASP B 1 549 ? 13.700  -42.428 87.966  1.00 148.43 ? 528 ASP B OD2   1 
ATOM   8557  N  N     . ARG B 1 550 ? 15.522  -43.202 85.840  1.00 131.38 ? 529 ARG B N     1 
ATOM   8558  C  CA    . ARG B 1 550 ? 16.785  -42.524 85.577  1.00 130.54 ? 529 ARG B CA    1 
ATOM   8559  C  C     . ARG B 1 550 ? 16.965  -41.392 86.582  1.00 142.39 ? 529 ARG B C     1 
ATOM   8560  O  O     . ARG B 1 550 ? 16.071  -41.071 87.374  1.00 141.89 ? 529 ARG B O     1 
ATOM   8561  C  CB    . ARG B 1 550 ? 16.878  -41.986 84.142  1.00 168.22 ? 529 ARG B CB    1 
ATOM   8562  C  CG    . ARG B 1 550 ? 17.025  -43.043 83.038  1.00 204.04 ? 529 ARG B CG    1 
ATOM   8563  C  CD    . ARG B 1 550 ? 18.265  -43.936 83.206  1.00 226.49 ? 529 ARG B CD    1 
ATOM   8564  N  NE    . ARG B 1 550 ? 19.532  -43.367 82.730  1.00 238.14 ? 529 ARG B NE    1 
ATOM   8565  C  CZ    . ARG B 1 550 ? 19.986  -43.476 81.482  1.00 250.27 ? 529 ARG B CZ    1 
ATOM   8566  N  NH1   . ARG B 1 550 ? 19.276  -44.120 80.564  1.00 260.41 ? 529 ARG B NH1   1 
ATOM   8567  N  NH2   . ARG B 1 550 ? 21.156  -42.945 81.147  1.00 244.18 ? 529 ARG B NH2   1 
ATOM   8568  N  N     . LEU B 1 551 ? 18.131  -40.762 86.514  1.00 141.02 ? 530 LEU B N     1 
ATOM   8569  C  CA    . LEU B 1 551 ? 18.489  -39.742 87.489  1.00 149.72 ? 530 LEU B CA    1 
ATOM   8570  C  C     . LEU B 1 551 ? 17.723  -38.446 87.224  1.00 143.27 ? 530 LEU B C     1 
ATOM   8571  O  O     . LEU B 1 551 ? 17.781  -37.882 86.124  1.00 134.06 ? 530 LEU B O     1 
ATOM   8572  C  CB    . LEU B 1 551 ? 20.005  -39.499 87.465  1.00 137.69 ? 530 LEU B CB    1 
ATOM   8573  C  CG    . LEU B 1 551 ? 20.891  -40.456 86.627  1.00 144.62 ? 530 LEU B CG    1 
ATOM   8574  C  CD1   . LEU B 1 551 ? 20.776  -40.291 85.097  1.00 175.31 ? 530 LEU B CD1   1 
ATOM   8575  C  CD2   . LEU B 1 551 ? 22.327  -40.305 87.017  1.00 123.14 ? 530 LEU B CD2   1 
ATOM   8576  N  N     . GLN B 1 552 ? 17.022  -37.967 88.249  1.00 139.43 ? 531 GLN B N     1 
ATOM   8577  C  CA    . GLN B 1 552 ? 16.346  -36.683 88.192  1.00 112.09 ? 531 GLN B CA    1 
ATOM   8578  C  C     . GLN B 1 552 ? 17.359  -35.543 88.120  1.00 112.13 ? 531 GLN B C     1 
ATOM   8579  O  O     . GLN B 1 552 ? 18.554  -35.716 88.367  1.00 173.48 ? 531 GLN B O     1 
ATOM   8580  C  CB    . GLN B 1 552 ? 15.453  -36.484 89.408  1.00 117.41 ? 531 GLN B CB    1 
ATOM   8581  C  CG    . GLN B 1 552 ? 14.536  -37.627 89.746  1.00 123.95 ? 531 GLN B CG    1 
ATOM   8582  C  CD    . GLN B 1 552 ? 13.552  -37.214 90.835  1.00 126.84 ? 531 GLN B CD    1 
ATOM   8583  O  OE1   . GLN B 1 552 ? 13.854  -36.364 91.676  1.00 119.77 ? 531 GLN B OE1   1 
ATOM   8584  N  NE2   . GLN B 1 552 ? 12.367  -37.809 90.816  1.00 109.53 ? 531 GLN B NE2   1 
ATOM   8585  N  N     . ASP B 1 553 ? 16.859  -34.368 87.744  1.00 112.57 ? 532 ASP B N     1 
ATOM   8586  C  CA    . ASP B 1 553 ? 17.714  -33.215 87.488  1.00 113.11 ? 532 ASP B CA    1 
ATOM   8587  C  C     . ASP B 1 553 ? 18.367  -32.670 88.752  1.00 119.51 ? 532 ASP B C     1 
ATOM   8588  O  O     . ASP B 1 553 ? 19.532  -32.253 88.716  1.00 124.53 ? 532 ASP B O     1 
ATOM   8589  C  CB    . ASP B 1 553 ? 16.919  -32.145 86.764  1.00 146.34 ? 532 ASP B CB    1 
ATOM   8590  C  CG    . ASP B 1 553 ? 17.032  -32.288 85.256  1.00 189.15 ? 532 ASP B CG    1 
ATOM   8591  O  OD1   . ASP B 1 553 ? 17.533  -33.349 84.798  1.00 192.90 ? 532 ASP B OD1   1 
ATOM   8592  O  OD2   . ASP B 1 553 ? 16.639  -31.347 84.530  1.00 202.82 ? 532 ASP B OD2   1 
ATOM   8593  N  N     . ASN B 1 554 ? 17.628  -32.586 89.859  1.00 125.28 ? 533 ASN B N     1 
ATOM   8594  C  CA    . ASN B 1 554 ? 18.258  -32.125 91.099  1.00 122.20 ? 533 ASN B CA    1 
ATOM   8595  C  C     . ASN B 1 554 ? 19.324  -33.108 91.579  1.00 126.46 ? 533 ASN B C     1 
ATOM   8596  O  O     . ASN B 1 554 ? 20.375  -32.689 92.072  1.00 130.82 ? 533 ASN B O     1 
ATOM   8597  C  CB    . ASN B 1 554 ? 17.208  -31.906 92.191  1.00 133.23 ? 533 ASN B CB    1 
ATOM   8598  C  CG    . ASN B 1 554 ? 16.329  -33.142 92.433  1.00 125.61 ? 533 ASN B CG    1 
ATOM   8599  O  OD1   . ASN B 1 554 ? 16.423  -34.149 91.722  1.00 115.15 ? 533 ASN B OD1   1 
ATOM   8600  N  ND2   . ASN B 1 554 ? 15.466  -33.060 93.441  1.00 110.46 ? 533 ASN B ND2   1 
ATOM   8601  N  N     . GLN B 1 555 ? 19.053  -34.419 91.451  1.00 133.76 ? 534 GLN B N     1 
ATOM   8602  C  CA    . GLN B 1 555 ? 20.028  -35.471 91.746  1.00 115.63 ? 534 GLN B CA    1 
ATOM   8603  C  C     . GLN B 1 555 ? 21.292  -35.280 90.935  1.00 110.09 ? 534 GLN B C     1 
ATOM   8604  O  O     . GLN B 1 555 ? 22.402  -35.367 91.458  1.00 130.67 ? 534 GLN B O     1 
ATOM   8605  C  CB    . GLN B 1 555 ? 19.417  -36.834 91.428  1.00 111.97 ? 534 GLN B CB    1 
ATOM   8606  C  CG    . GLN B 1 555 ? 18.184  -37.139 92.250  1.00 126.12 ? 534 GLN B CG    1 
ATOM   8607  C  CD    . GLN B 1 555 ? 17.630  -38.538 92.017  1.00 135.00 ? 534 GLN B CD    1 
ATOM   8608  O  OE1   . GLN B 1 555 ? 17.713  -39.090 90.905  1.00 127.55 ? 534 GLN B OE1   1 
ATOM   8609  N  NE2   . GLN B 1 555 ? 17.052  -39.121 93.073  1.00 135.39 ? 534 GLN B NE2   1 
ATOM   8610  N  N     . LEU B 1 556 ? 21.125  -35.034 89.642  1.00 111.31 ? 535 LEU B N     1 
ATOM   8611  C  CA    . LEU B 1 556 ? 22.241  -34.775 88.747  1.00 112.77 ? 535 LEU B CA    1 
ATOM   8612  C  C     . LEU B 1 556 ? 23.001  -33.515 89.144  1.00 112.85 ? 535 LEU B C     1 
ATOM   8613  O  O     . LEU B 1 556 ? 24.241  -33.477 89.086  1.00 113.63 ? 535 LEU B O     1 
ATOM   8614  C  CB    . LEU B 1 556 ? 21.690  -34.619 87.344  1.00 114.20 ? 535 LEU B CB    1 
ATOM   8615  C  CG    . LEU B 1 556 ? 22.401  -35.439 86.316  1.00 132.71 ? 535 LEU B CG    1 
ATOM   8616  C  CD1   . LEU B 1 556 ? 22.267  -36.843 86.881  1.00 115.09 ? 535 LEU B CD1   1 
ATOM   8617  C  CD2   . LEU B 1 556 ? 21.655  -35.274 84.990  1.00 162.52 ? 535 LEU B CD2   1 
ATOM   8618  N  N     . ARG B 1 557 ? 22.278  -32.467 89.550  1.00 112.26 ? 536 ARG B N     1 
ATOM   8619  C  CA    . ARG B 1 557 ? 22.946  -31.256 90.013  1.00 117.03 ? 536 ARG B CA    1 
ATOM   8620  C  C     . ARG B 1 557 ? 23.787  -31.556 91.238  1.00 133.36 ? 536 ARG B C     1 
ATOM   8621  O  O     . ARG B 1 557 ? 24.902  -31.041 91.385  1.00 147.43 ? 536 ARG B O     1 
ATOM   8622  C  CB    . ARG B 1 557 ? 21.929  -30.185 90.387  1.00 124.45 ? 536 ARG B CB    1 
ATOM   8623  C  CG    . ARG B 1 557 ? 21.215  -29.528 89.262  1.00 127.36 ? 536 ARG B CG    1 
ATOM   8624  C  CD    . ARG B 1 557 ? 20.506  -28.303 89.762  1.00 128.16 ? 536 ARG B CD    1 
ATOM   8625  N  NE    . ARG B 1 557 ? 19.116  -28.383 89.395  1.00 127.36 ? 536 ARG B NE    1 
ATOM   8626  C  CZ    . ARG B 1 557 ? 18.157  -28.671 90.251  1.00 124.88 ? 536 ARG B CZ    1 
ATOM   8627  N  NH1   . ARG B 1 557 ? 18.462  -28.889 91.528  1.00 130.42 ? 536 ARG B NH1   1 
ATOM   8628  N  NH2   . ARG B 1 557 ? 16.906  -28.752 89.810  1.00 119.74 ? 536 ARG B NH2   1 
ATOM   8629  N  N     . TRP B 1 558 ? 23.243  -32.371 92.144  1.00 118.79 ? 537 TRP B N     1 
ATOM   8630  C  CA    . TRP B 1 558 ? 23.957  -32.690 93.367  1.00 109.90 ? 537 TRP B CA    1 
ATOM   8631  C  C     . TRP B 1 558 ? 25.195  -33.533 93.052  1.00 110.86 ? 537 TRP B C     1 
ATOM   8632  O  O     . TRP B 1 558 ? 26.311  -33.184 93.454  1.00 111.57 ? 537 TRP B O     1 
ATOM   8633  C  CB    . TRP B 1 558 ? 23.025  -33.391 94.390  1.00 108.49 ? 537 TRP B CB    1 
ATOM   8634  C  CG    . TRP B 1 558 ? 23.382  -32.913 95.744  1.00 108.08 ? 537 TRP B CG    1 
ATOM   8635  C  CD1   . TRP B 1 558 ? 24.527  -33.214 96.423  1.00 154.87 ? 537 TRP B CD1   1 
ATOM   8636  C  CD2   . TRP B 1 558 ? 22.660  -32.015 96.572  1.00 107.41 ? 537 TRP B CD2   1 
ATOM   8637  N  NE1   . TRP B 1 558 ? 24.567  -32.549 97.620  1.00 149.71 ? 537 TRP B NE1   1 
ATOM   8638  C  CE2   . TRP B 1 558 ? 23.431  -31.801 97.736  1.00 117.17 ? 537 TRP B CE2   1 
ATOM   8639  C  CE3   . TRP B 1 558 ? 21.457  -31.370 96.451  1.00 106.87 ? 537 TRP B CE3   1 
ATOM   8640  C  CZ2   . TRP B 1 558 ? 23.028  -30.972 98.758  1.00 107.27 ? 537 TRP B CZ2   1 
ATOM   8641  C  CZ3   . TRP B 1 558 ? 21.065  -30.551 97.454  1.00 130.38 ? 537 TRP B CZ3   1 
ATOM   8642  C  CH2   . TRP B 1 558 ? 21.842  -30.362 98.607  1.00 126.55 ? 537 TRP B CH2   1 
ATOM   8643  N  N     . LEU B 1 559 ? 25.025  -34.614 92.280  1.00 111.16 ? 538 LEU B N     1 
ATOM   8644  C  CA    . LEU B 1 559 ? 26.148  -35.481 91.932  1.00 112.24 ? 538 LEU B CA    1 
ATOM   8645  C  C     . LEU B 1 559 ? 27.290  -34.689 91.333  1.00 113.68 ? 538 LEU B C     1 
ATOM   8646  O  O     . LEU B 1 559 ? 28.462  -34.944 91.636  1.00 114.50 ? 538 LEU B O     1 
ATOM   8647  C  CB    . LEU B 1 559 ? 25.693  -36.557 90.955  1.00 112.72 ? 538 LEU B CB    1 
ATOM   8648  C  CG    . LEU B 1 559 ? 24.676  -37.465 91.597  1.00 111.60 ? 538 LEU B CG    1 
ATOM   8649  C  CD1   . LEU B 1 559 ? 24.145  -38.414 90.605  1.00 112.31 ? 538 LEU B CD1   1 
ATOM   8650  C  CD2   . LEU B 1 559 ? 25.386  -38.185 92.665  1.00 111.45 ? 538 LEU B CD2   1 
ATOM   8651  N  N     . GLN B 1 560 ? 26.975  -33.755 90.432  1.00 114.27 ? 539 GLN B N     1 
ATOM   8652  C  CA    . GLN B 1 560 ? 28.056  -32.972 89.850  1.00 117.64 ? 539 GLN B CA    1 
ATOM   8653  C  C     . GLN B 1 560 ? 28.599  -31.963 90.849  1.00 124.78 ? 539 GLN B C     1 
ATOM   8654  O  O     . GLN B 1 560 ? 29.785  -31.622 90.788  1.00 155.43 ? 539 GLN B O     1 
ATOM   8655  C  CB    . GLN B 1 560 ? 27.608  -32.334 88.542  1.00 126.90 ? 539 GLN B CB    1 
ATOM   8656  C  CG    . GLN B 1 560 ? 28.072  -33.096 87.290  1.00 133.36 ? 539 GLN B CG    1 
ATOM   8657  C  CD    . GLN B 1 560 ? 27.644  -32.367 86.035  1.00 189.14 ? 539 GLN B CD    1 
ATOM   8658  O  OE1   . GLN B 1 560 ? 27.855  -31.165 85.917  1.00 211.55 ? 539 GLN B OE1   1 
ATOM   8659  N  NE2   . GLN B 1 560 ? 26.991  -33.078 85.110  1.00 204.85 ? 539 GLN B NE2   1 
ATOM   8660  N  N     . PHE B 1 561 ? 27.759  -31.471 91.763  1.00 114.49 ? 540 PHE B N     1 
ATOM   8661  C  CA    . PHE B 1 561 ? 28.280  -30.611 92.824  1.00 130.29 ? 540 PHE B CA    1 
ATOM   8662  C  C     . PHE B 1 561 ? 29.328  -31.337 93.619  1.00 114.92 ? 540 PHE B C     1 
ATOM   8663  O  O     . PHE B 1 561 ? 30.312  -30.737 94.041  1.00 119.39 ? 540 PHE B O     1 
ATOM   8664  C  CB    . PHE B 1 561 ? 27.190  -30.163 93.789  1.00 137.01 ? 540 PHE B CB    1 
ATOM   8665  C  CG    . PHE B 1 561 ? 27.705  -29.456 95.031  1.00 113.35 ? 540 PHE B CG    1 
ATOM   8666  C  CD1   . PHE B 1 561 ? 28.052  -28.121 94.987  1.00 120.58 ? 540 PHE B CD1   1 
ATOM   8667  C  CD2   . PHE B 1 561 ? 27.738  -30.082 96.240  1.00 112.58 ? 540 PHE B CD2   1 
ATOM   8668  C  CE1   . PHE B 1 561 ? 28.448  -27.443 96.115  1.00 114.92 ? 540 PHE B CE1   1 
ATOM   8669  C  CE2   . PHE B 1 561 ? 28.145  -29.390 97.366  1.00 113.01 ? 540 PHE B CE2   1 
ATOM   8670  C  CZ    . PHE B 1 561 ? 28.501  -28.069 97.291  1.00 114.20 ? 540 PHE B CZ    1 
ATOM   8671  N  N     . CYS B 1 562 ? 29.098  -32.619 93.884  1.00 126.17 ? 541 CYS B N     1 
ATOM   8672  C  CA    . CYS B 1 562 ? 30.082  -33.418 94.601  1.00 130.25 ? 541 CYS B CA    1 
ATOM   8673  C  C     . CYS B 1 562 ? 31.304  -33.711 93.728  1.00 126.73 ? 541 CYS B C     1 
ATOM   8674  O  O     . CYS B 1 562 ? 32.448  -33.622 94.196  1.00 119.96 ? 541 CYS B O     1 
ATOM   8675  C  CB    . CYS B 1 562 ? 29.413  -34.702 95.098  1.00 125.15 ? 541 CYS B CB    1 
ATOM   8676  S  SG    . CYS B 1 562 ? 28.118  -34.370 96.363  1.00 119.72 ? 541 CYS B SG    1 
ATOM   8677  N  N     . ARG B 1 563 ? 31.092  -34.028 92.449  1.00 116.83 ? 542 ARG B N     1 
ATOM   8678  C  CA    . ARG B 1 563 ? 32.218  -34.502 91.658  1.00 118.59 ? 542 ARG B CA    1 
ATOM   8679  C  C     . ARG B 1 563 ? 33.157  -33.373 91.276  1.00 120.22 ? 542 ARG B C     1 
ATOM   8680  O  O     . ARG B 1 563 ? 34.335  -33.623 91.013  1.00 133.30 ? 542 ARG B O     1 
ATOM   8681  C  CB    . ARG B 1 563 ? 31.753  -35.244 90.418  1.00 118.84 ? 542 ARG B CB    1 
ATOM   8682  C  CG    . ARG B 1 563 ? 32.785  -36.282 90.013  1.00 120.33 ? 542 ARG B CG    1 
ATOM   8683  C  CD    . ARG B 1 563 ? 33.267  -36.131 88.594  1.00 122.09 ? 542 ARG B CD    1 
ATOM   8684  N  NE    . ARG B 1 563 ? 34.421  -36.976 88.354  1.00 123.75 ? 542 ARG B NE    1 
ATOM   8685  C  CZ    . ARG B 1 563 ? 35.639  -36.672 88.778  1.00 140.95 ? 542 ARG B CZ    1 
ATOM   8686  N  NH1   . ARG B 1 563 ? 35.837  -35.553 89.459  1.00 133.53 ? 542 ARG B NH1   1 
ATOM   8687  N  NH2   . ARG B 1 563 ? 36.652  -37.491 88.545  1.00 159.36 ? 542 ARG B NH2   1 
ATOM   8688  N  N     . GLU B 1 564 ? 32.662  -32.143 91.196  1.00 120.01 ? 543 GLU B N     1 
ATOM   8689  C  CA    . GLU B 1 564 ? 33.576  -31.023 91.043  1.00 121.74 ? 543 GLU B CA    1 
ATOM   8690  C  C     . GLU B 1 564 ? 34.413  -30.828 92.302  1.00 122.18 ? 543 GLU B C     1 
ATOM   8691  O  O     . GLU B 1 564 ? 35.596  -30.488 92.205  1.00 129.12 ? 543 GLU B O     1 
ATOM   8692  C  CB    . GLU B 1 564 ? 32.780  -29.761 90.725  1.00 142.57 ? 543 GLU B CB    1 
ATOM   8693  C  CG    . GLU B 1 564 ? 31.994  -29.850 89.414  1.00 170.31 ? 543 GLU B CG    1 
ATOM   8694  C  CD    . GLU B 1 564 ? 30.963  -28.748 89.260  1.00 186.24 ? 543 GLU B CD    1 
ATOM   8695  O  OE1   . GLU B 1 564 ? 30.717  -28.034 90.259  1.00 190.79 ? 543 GLU B OE1   1 
ATOM   8696  O  OE2   . GLU B 1 564 ? 30.403  -28.605 88.147  1.00 181.51 ? 543 GLU B OE2   1 
ATOM   8697  N  N     . ARG B 1 565 ? 33.857  -31.118 93.486  1.00 120.67 ? 544 ARG B N     1 
ATOM   8698  C  CA    . ARG B 1 565 ? 34.588  -30.962 94.743  1.00 121.27 ? 544 ARG B CA    1 
ATOM   8699  C  C     . ARG B 1 565 ? 35.372  -32.223 95.117  1.00 129.82 ? 544 ARG B C     1 
ATOM   8700  O  O     . ARG B 1 565 ? 35.875  -32.328 96.246  1.00 122.31 ? 544 ARG B O     1 
ATOM   8701  C  CB    . ARG B 1 565 ? 33.652  -30.554 95.891  1.00 119.76 ? 544 ARG B CB    1 
ATOM   8702  C  CG    . ARG B 1 565 ? 33.324  -29.057 95.968  1.00 120.07 ? 544 ARG B CG    1 
ATOM   8703  C  CD    . ARG B 1 565 ? 32.032  -28.827 95.241  1.00 118.67 ? 544 ARG B CD    1 
ATOM   8704  N  NE    . ARG B 1 565 ? 31.660  -27.457 94.908  1.00 121.11 ? 544 ARG B NE    1 
ATOM   8705  C  CZ    . ARG B 1 565 ? 31.335  -26.524 95.796  1.00 145.36 ? 544 ARG B CZ    1 
ATOM   8706  N  NH1   . ARG B 1 565 ? 31.358  -26.799 97.102  1.00 141.99 ? 544 ARG B NH1   1 
ATOM   8707  N  NH2   . ARG B 1 565 ? 30.987  -25.312 95.373  1.00 137.30 ? 544 ARG B NH2   1 
ATOM   8708  N  N     . GLU B 1 566 ? 35.424  -33.200 94.210  1.00 133.88 ? 545 GLU B N     1 
ATOM   8709  C  CA    . GLU B 1 566 ? 36.131  -34.455 94.429  1.00 146.93 ? 545 GLU B CA    1 
ATOM   8710  C  C     . GLU B 1 566 ? 35.675  -35.098 95.737  1.00 125.08 ? 545 GLU B C     1 
ATOM   8711  O  O     . GLU B 1 566 ? 36.475  -35.437 96.611  1.00 135.35 ? 545 GLU B O     1 
ATOM   8712  C  CB    . GLU B 1 566 ? 37.652  -34.232 94.385  1.00 171.79 ? 545 GLU B CB    1 
ATOM   8713  C  CG    . GLU B 1 566 ? 38.494  -35.300 93.619  1.00 181.49 ? 545 GLU B CG    1 
ATOM   8714  C  CD    . GLU B 1 566 ? 38.435  -35.211 92.077  1.00 164.28 ? 545 GLU B CD    1 
ATOM   8715  O  OE1   . GLU B 1 566 ? 38.163  -34.123 91.506  1.00 136.18 ? 545 GLU B OE1   1 
ATOM   8716  O  OE2   . GLU B 1 566 ? 38.675  -36.257 91.428  1.00 164.16 ? 545 GLU B OE2   1 
ATOM   8717  N  N     . MET B 1 567 ? 34.310  -35.202 95.892  1.00 119.43 ? 546 MET B N     1 
ATOM   8718  C  CA    . MET B 1 567 ? 33.591  -35.993 96.880  1.00 118.20 ? 546 MET B CA    1 
ATOM   8719  C  C     . MET B 1 567 ? 33.244  -37.373 96.328  1.00 121.43 ? 546 MET B C     1 
ATOM   8720  O  O     . MET B 1 567 ? 33.088  -37.550 95.116  1.00 148.05 ? 546 MET B O     1 
ATOM   8721  C  CB    . MET B 1 567 ? 32.317  -35.294 97.342  1.00 116.40 ? 546 MET B CB    1 
ATOM   8722  C  CG    . MET B 1 567 ? 32.539  -34.127 98.300  1.00 118.72 ? 546 MET B CG    1 
ATOM   8723  S  SD    . MET B 1 567 ? 31.139  -32.989 98.308  1.00 125.79 ? 546 MET B SD    1 
ATOM   8724  C  CE    . MET B 1 567 ? 31.665  -31.625 99.324  1.00 121.24 ? 546 MET B CE    1 
ATOM   8725  N  N     . PRO B 1 568 ? 33.195  -38.347 97.215  1.00 117.85 ? 547 PRO B N     1 
ATOM   8726  C  CA    . PRO B 1 568 ? 32.943  -39.746 96.832  1.00 117.95 ? 547 PRO B CA    1 
ATOM   8727  C  C     . PRO B 1 568 ? 31.493  -40.064 96.497  1.00 124.03 ? 547 PRO B C     1 
ATOM   8728  O  O     . PRO B 1 568 ? 30.707  -40.409 97.384  1.00 140.01 ? 547 PRO B O     1 
ATOM   8729  C  CB    . PRO B 1 568 ? 33.370  -40.516 98.080  1.00 118.69 ? 547 PRO B CB    1 
ATOM   8730  C  CG    . PRO B 1 568 ? 33.126  -39.549 99.175  1.00 118.02 ? 547 PRO B CG    1 
ATOM   8731  C  CD    . PRO B 1 568 ? 33.476  -38.209 98.647  1.00 118.14 ? 547 PRO B CD    1 
ATOM   8732  N  N     . VAL B 1 569 ? 31.088  -39.889 95.259  1.00 116.06 ? 548 VAL B N     1 
ATOM   8733  C  CA    . VAL B 1 569 ? 29.743  -40.267 94.873  1.00 114.84 ? 548 VAL B CA    1 
ATOM   8734  C  C     . VAL B 1 569 ? 29.809  -41.239 93.716  1.00 115.84 ? 548 VAL B C     1 
ATOM   8735  O  O     . VAL B 1 569 ? 30.725  -41.182 92.896  1.00 117.21 ? 548 VAL B O     1 
ATOM   8736  C  CB    . VAL B 1 569 ? 28.951  -39.004 94.505  1.00 114.68 ? 548 VAL B CB    1 
ATOM   8737  C  CG1   . VAL B 1 569 ? 28.730  -38.172 95.737  1.00 121.31 ? 548 VAL B CG1   1 
ATOM   8738  C  CG2   . VAL B 1 569 ? 29.733  -38.187 93.529  1.00 114.82 ? 548 VAL B CG2   1 
ATOM   8739  N  N     . ALA B 1 570 ? 28.822  -42.120 93.634  1.00 115.35 ? 549 ALA B N     1 
ATOM   8740  C  CA    . ALA B 1 570 ? 28.706  -43.000 92.483  1.00 116.41 ? 549 ALA B CA    1 
ATOM   8741  C  C     . ALA B 1 570 ? 27.253  -43.385 92.327  1.00 123.19 ? 549 ALA B C     1 
ATOM   8742  O  O     . ALA B 1 570 ? 26.534  -43.492 93.321  1.00 114.38 ? 549 ALA B O     1 
ATOM   8743  C  CB    . ALA B 1 570 ? 29.545  -44.262 92.629  1.00 117.98 ? 549 ALA B CB    1 
ATOM   8744  N  N     . VAL B 1 571 ? 26.833  -43.626 91.081  1.00 128.50 ? 550 VAL B N     1 
ATOM   8745  C  CA    . VAL B 1 571 ? 25.448  -43.976 90.769  1.00 115.75 ? 550 VAL B CA    1 
ATOM   8746  C  C     . VAL B 1 571 ? 25.390  -45.403 90.257  1.00 117.28 ? 550 VAL B C     1 
ATOM   8747  O  O     . VAL B 1 571 ? 26.062  -45.744 89.273  1.00 136.05 ? 550 VAL B O     1 
ATOM   8748  C  CB    . VAL B 1 571 ? 24.825  -43.015 89.754  1.00 115.59 ? 550 VAL B CB    1 
ATOM   8749  C  CG1   . VAL B 1 571 ? 23.354  -43.309 89.644  1.00 115.80 ? 550 VAL B CG1   1 
ATOM   8750  C  CG2   . VAL B 1 571 ? 25.004  -41.626 90.221  1.00 114.45 ? 550 VAL B CG2   1 
ATOM   8751  N  N     . CYS B 1 572 ? 24.537  -46.216 90.889  1.00 116.95 ? 551 CYS B N     1 
ATOM   8752  C  CA    . CYS B 1 572 ? 24.463  -47.646 90.615  1.00 149.44 ? 551 CYS B CA    1 
ATOM   8753  C  C     . CYS B 1 572 ? 23.248  -47.927 89.740  1.00 147.68 ? 551 CYS B C     1 
ATOM   8754  O  O     . CYS B 1 572 ? 22.100  -47.808 90.188  1.00 144.84 ? 551 CYS B O     1 
ATOM   8755  C  CB    . CYS B 1 572 ? 24.403  -48.472 91.902  1.00 159.10 ? 551 CYS B CB    1 
ATOM   8756  S  SG    . CYS B 1 572 ? 24.062  -50.251 91.628  1.00 162.01 ? 551 CYS B SG    1 
ATOM   8757  N  N     . TYR B 1 573 ? 23.522  -48.328 88.504  1.00 141.94 ? 552 TYR B N     1 
ATOM   8758  C  CA    . TYR B 1 573 ? 22.507  -48.705 87.544  1.00 145.35 ? 552 TYR B CA    1 
ATOM   8759  C  C     . TYR B 1 573 ? 22.311  -50.213 87.672  1.00 157.24 ? 552 TYR B C     1 
ATOM   8760  O  O     . TYR B 1 573 ? 23.282  -50.978 87.652  1.00 173.02 ? 552 TYR B O     1 
ATOM   8761  C  CB    . TYR B 1 573 ? 22.953  -48.326 86.130  1.00 155.08 ? 552 TYR B CB    1 
ATOM   8762  C  CG    . TYR B 1 573 ? 23.163  -46.833 85.835  1.00 158.48 ? 552 TYR B CG    1 
ATOM   8763  C  CD1   . TYR B 1 573 ? 22.239  -45.846 86.252  1.00 134.50 ? 552 TYR B CD1   1 
ATOM   8764  C  CD2   . TYR B 1 573 ? 24.279  -46.420 85.102  1.00 161.29 ? 552 TYR B CD2   1 
ATOM   8765  C  CE1   . TYR B 1 573 ? 22.444  -44.481 85.941  1.00 130.10 ? 552 TYR B CE1   1 
ATOM   8766  C  CE2   . TYR B 1 573 ? 24.492  -45.082 84.793  1.00 168.66 ? 552 TYR B CE2   1 
ATOM   8767  C  CZ    . TYR B 1 573 ? 23.587  -44.114 85.208  1.00 153.50 ? 552 TYR B CZ    1 
ATOM   8768  O  OH    . TYR B 1 573 ? 23.867  -42.800 84.868  1.00 147.06 ? 552 TYR B OH    1 
ATOM   8769  N  N     . VAL B 1 574 ? 21.066  -50.640 87.856  1.00 167.03 ? 553 VAL B N     1 
ATOM   8770  C  CA    . VAL B 1 574 ? 20.761  -52.036 88.134  1.00 166.05 ? 553 VAL B CA    1 
ATOM   8771  C  C     . VAL B 1 574 ? 20.048  -52.642 86.928  1.00 175.67 ? 553 VAL B C     1 
ATOM   8772  O  O     . VAL B 1 574 ? 19.137  -52.029 86.351  1.00 144.48 ? 553 VAL B O     1 
ATOM   8773  C  CB    . VAL B 1 574 ? 19.927  -52.175 89.421  1.00 147.35 ? 553 VAL B CB    1 
ATOM   8774  C  CG1   . VAL B 1 574 ? 19.461  -53.600 89.622  1.00 144.63 ? 553 VAL B CG1   1 
ATOM   8775  C  CG2   . VAL B 1 574 ? 20.727  -51.708 90.602  1.00 149.05 ? 553 VAL B CG2   1 
ATOM   8776  N  N     . ARG B 1 575 ? 20.531  -53.809 86.507  1.00 181.32 ? 554 ARG B N     1 
ATOM   8777  C  CA    . ARG B 1 575 ? 19.860  -54.717 85.594  1.00 190.89 ? 554 ARG B CA    1 
ATOM   8778  C  C     . ARG B 1 575 ? 19.592  -56.034 86.325  1.00 189.75 ? 554 ARG B C     1 
ATOM   8779  O  O     . ARG B 1 575 ? 20.240  -56.362 87.326  1.00 192.49 ? 554 ARG B O     1 
ATOM   8780  C  CB    . ARG B 1 575 ? 20.676  -54.936 84.299  1.00 193.70 ? 554 ARG B CB    1 
ATOM   8781  C  CG    . ARG B 1 575 ? 20.705  -53.692 83.395  1.00 186.59 ? 554 ARG B CG    1 
ATOM   8782  C  CD    . ARG B 1 575 ? 21.302  -53.919 81.995  1.00 188.44 ? 554 ARG B CD    1 
ATOM   8783  N  NE    . ARG B 1 575 ? 22.442  -54.838 81.943  1.00 199.74 ? 554 ARG B NE    1 
ATOM   8784  C  CZ    . ARG B 1 575 ? 23.092  -55.172 80.822  1.00 211.03 ? 554 ARG B CZ    1 
ATOM   8785  N  NH1   . ARG B 1 575 ? 24.114  -56.019 80.860  1.00 214.46 ? 554 ARG B NH1   1 
ATOM   8786  N  NH2   . ARG B 1 575 ? 22.752  -54.629 79.658  1.00 208.33 ? 554 ARG B NH2   1 
ATOM   8787  N  N     . TRP B 1 576 ? 18.609  -56.777 85.820  1.00 192.58 ? 555 TRP B N     1 
ATOM   8788  C  CA    . TRP B 1 576 ? 18.117  -58.025 86.395  1.00 212.27 ? 555 TRP B CA    1 
ATOM   8789  C  C     . TRP B 1 576 ? 18.540  -59.256 85.591  1.00 226.69 ? 555 TRP B C     1 
ATOM   8790  O  O     . TRP B 1 576 ? 18.838  -59.168 84.397  1.00 229.35 ? 555 TRP B O     1 
ATOM   8791  C  CB    . TRP B 1 576 ? 16.587  -57.995 86.510  1.00 207.87 ? 555 TRP B CB    1 
ATOM   8792  C  CG    . TRP B 1 576 ? 16.070  -56.931 87.420  1.00 215.25 ? 555 TRP B CG    1 
ATOM   8793  C  CD1   . TRP B 1 576 ? 15.349  -55.828 87.063  1.00 220.24 ? 555 TRP B CD1   1 
ATOM   8794  C  CD2   . TRP B 1 576 ? 16.188  -56.889 88.847  1.00 220.45 ? 555 TRP B CD2   1 
ATOM   8795  N  NE1   . TRP B 1 576 ? 15.037  -55.084 88.177  1.00 228.34 ? 555 TRP B NE1   1 
ATOM   8796  C  CE2   . TRP B 1 576 ? 15.538  -55.715 89.287  1.00 225.34 ? 555 TRP B CE2   1 
ATOM   8797  C  CE3   . TRP B 1 576 ? 16.788  -57.723 89.793  1.00 219.87 ? 555 TRP B CE3   1 
ATOM   8798  C  CZ2   . TRP B 1 576 ? 15.473  -55.354 90.634  1.00 217.63 ? 555 TRP B CZ2   1 
ATOM   8799  C  CZ3   . TRP B 1 576 ? 16.724  -57.363 91.128  1.00 220.50 ? 555 TRP B CZ3   1 
ATOM   8800  C  CH2   . TRP B 1 576 ? 16.071  -56.187 91.536  1.00 215.93 ? 555 TRP B CH2   1 
ATOM   8801  N  N     . HIS B 1 577 ? 18.600  -60.406 86.276  1.00 241.35 ? 556 HIS B N     1 
ATOM   8802  C  CA    . HIS B 1 577 ? 18.890  -61.704 85.662  1.00 250.00 ? 556 HIS B CA    1 
ATOM   8803  C  C     . HIS B 1 577 ? 17.660  -62.603 85.789  1.00 267.40 ? 556 HIS B C     1 
ATOM   8804  O  O     . HIS B 1 577 ? 17.357  -63.100 86.881  1.00 276.93 ? 556 HIS B O     1 
ATOM   8805  C  CB    . HIS B 1 577 ? 20.104  -62.364 86.317  1.00 233.59 ? 556 HIS B CB    1 
ATOM   8806  C  CG    . HIS B 1 577 ? 20.510  -63.652 85.667  1.00 231.07 ? 556 HIS B CG    1 
ATOM   8807  N  ND1   . HIS B 1 577 ? 21.479  -63.728 84.688  1.00 230.21 ? 556 HIS B ND1   1 
ATOM   8808  C  CD2   . HIS B 1 577 ? 20.066  -64.918 85.856  1.00 232.19 ? 556 HIS B CD2   1 
ATOM   8809  C  CE1   . HIS B 1 577 ? 21.616  -64.985 84.304  1.00 232.11 ? 556 HIS B CE1   1 
ATOM   8810  N  NE2   . HIS B 1 577 ? 20.772  -65.727 84.998  1.00 239.51 ? 556 HIS B NE2   1 
ATOM   8811  N  N     . VAL B 1 578 ? 16.978  -62.842 84.663  1.00 274.56 ? 557 VAL B N     1 
ATOM   8812  C  CA    . VAL B 1 578 ? 15.715  -63.580 84.620  1.00 247.30 ? 557 VAL B CA    1 
ATOM   8813  C  C     . VAL B 1 578 ? 15.984  -64.947 84.003  1.00 243.72 ? 557 VAL B C     1 
ATOM   8814  O  O     . VAL B 1 578 ? 16.353  -65.049 82.827  1.00 244.14 ? 557 VAL B O     1 
ATOM   8815  C  CB    . VAL B 1 578 ? 14.619  -62.820 83.846  1.00 227.54 ? 557 VAL B CB    1 
ATOM   8816  C  CG1   . VAL B 1 578 ? 15.160  -62.214 82.550  1.00 216.41 ? 557 VAL B CG1   1 
ATOM   8817  C  CG2   . VAL B 1 578 ? 13.437  -63.734 83.549  1.00 218.02 ? 557 VAL B CG2   1 
ATOM   8818  N  N     . ASP B 1 579 ? 15.806  -66.002 84.795  1.00 226.52 ? 558 ASP B N     1 
ATOM   8819  C  CA    . ASP B 1 579 ? 15.858  -67.370 84.286  1.00 244.65 ? 558 ASP B CA    1 
ATOM   8820  C  C     . ASP B 1 579 ? 14.429  -67.796 83.941  1.00 244.88 ? 558 ASP B C     1 
ATOM   8821  O  O     . ASP B 1 579 ? 13.574  -67.891 84.828  1.00 251.01 ? 558 ASP B O     1 
ATOM   8822  C  CB    . ASP B 1 579 ? 16.499  -68.310 85.311  1.00 236.46 ? 558 ASP B CB    1 
ATOM   8823  C  CG    . ASP B 1 579 ? 17.773  -68.996 84.788  1.00 233.47 ? 558 ASP B CG    1 
ATOM   8824  O  OD1   . ASP B 1 579 ? 17.945  -69.141 83.555  1.00 222.51 ? 558 ASP B OD1   1 
ATOM   8825  O  OD2   . ASP B 1 579 ? 18.607  -69.408 85.625  1.00 234.48 ? 558 ASP B OD2   1 
ATOM   8826  N  N     . ASP B 1 580 ? 14.165  -68.034 82.655  1.00 251.50 ? 559 ASP B N     1 
ATOM   8827  C  CA    . ASP B 1 580 ? 12.830  -68.433 82.186  1.00 218.41 ? 559 ASP B CA    1 
ATOM   8828  C  C     . ASP B 1 580 ? 12.893  -69.241 80.879  1.00 212.20 ? 559 ASP B C     1 
ATOM   8829  O  O     . ASP B 1 580 ? 12.299  -70.319 80.756  1.00 193.29 ? 559 ASP B O     1 
ATOM   8830  C  CB    . ASP B 1 580 ? 11.944  -67.200 82.000  1.00 209.50 ? 559 ASP B CB    1 
ATOM   8831  N  N     . GLU C 1 39  ? 13.329  39.212  113.681 1.00 158.60 ? 18  GLU C N     1 
ATOM   8832  C  CA    . GLU C 1 39  ? 12.592  37.994  113.347 1.00 181.53 ? 18  GLU C CA    1 
ATOM   8833  C  C     . GLU C 1 39  ? 13.252  36.707  113.849 1.00 182.27 ? 18  GLU C C     1 
ATOM   8834  O  O     . GLU C 1 39  ? 13.593  35.851  113.029 1.00 143.91 ? 18  GLU C O     1 
ATOM   8835  C  CB    . GLU C 1 39  ? 12.430  37.903  111.832 1.00 190.15 ? 18  GLU C CB    1 
ATOM   8836  C  CG    . GLU C 1 39  ? 12.831  39.174  111.113 1.00 184.34 ? 18  GLU C CG    1 
ATOM   8837  C  CD    . GLU C 1 39  ? 13.802  38.920  109.986 1.00 176.03 ? 18  GLU C CD    1 
ATOM   8838  O  OE1   . GLU C 1 39  ? 14.755  38.129  110.183 1.00 163.56 ? 18  GLU C OE1   1 
ATOM   8839  O  OE2   . GLU C 1 39  ? 13.604  39.515  108.905 1.00 163.77 ? 18  GLU C OE2   1 
ATOM   8840  N  N     . PRO C 1 40  ? 13.329  36.533  115.179 1.00 189.43 ? 19  PRO C N     1 
ATOM   8841  C  CA    . PRO C 1 40  ? 14.044  35.372  115.741 1.00 189.96 ? 19  PRO C CA    1 
ATOM   8842  C  C     . PRO C 1 40  ? 13.285  34.074  115.608 1.00 187.86 ? 19  PRO C C     1 
ATOM   8843  O  O     . PRO C 1 40  ? 13.863  33.014  115.884 1.00 177.32 ? 19  PRO C O     1 
ATOM   8844  C  CB    . PRO C 1 40  ? 14.223  35.748  117.214 1.00 189.99 ? 19  PRO C CB    1 
ATOM   8845  C  CG    . PRO C 1 40  ? 13.000  36.542  117.509 1.00 202.25 ? 19  PRO C CG    1 
ATOM   8846  C  CD    . PRO C 1 40  ? 12.595  37.263  116.227 1.00 201.28 ? 19  PRO C CD    1 
ATOM   8847  N  N     . PHE C 1 41  ? 11.984  34.135  115.346 1.00 197.33 ? 20  PHE C N     1 
ATOM   8848  C  CA    . PHE C 1 41  ? 11.130  32.965  115.204 1.00 199.05 ? 20  PHE C CA    1 
ATOM   8849  C  C     . PHE C 1 41  ? 10.852  32.582  113.750 1.00 176.27 ? 20  PHE C C     1 
ATOM   8850  O  O     . PHE C 1 41  ? 9.971   31.747  113.504 1.00 163.90 ? 20  PHE C O     1 
ATOM   8851  C  CB    . PHE C 1 41  ? 9.838   33.175  115.985 1.00 206.77 ? 20  PHE C CB    1 
ATOM   8852  C  CG    . PHE C 1 41  ? 9.962   32.813  117.424 1.00 200.32 ? 20  PHE C CG    1 
ATOM   8853  C  CD1   . PHE C 1 41  ? 10.181  31.493  117.793 1.00 196.08 ? 20  PHE C CD1   1 
ATOM   8854  C  CD2   . PHE C 1 41  ? 9.944   33.786  118.396 1.00 217.05 ? 20  PHE C CD2   1 
ATOM   8855  C  CE1   . PHE C 1 41  ? 10.309  31.146  119.111 1.00 208.11 ? 20  PHE C CE1   1 
ATOM   8856  C  CE2   . PHE C 1 41  ? 10.085  33.450  119.723 1.00 235.94 ? 20  PHE C CE2   1 
ATOM   8857  C  CZ    . PHE C 1 41  ? 10.262  32.128  120.082 1.00 227.78 ? 20  PHE C CZ    1 
ATOM   8858  N  N     . TYR C 1 42  ? 11.571  33.188  112.793 1.00 173.79 ? 21  TYR C N     1 
ATOM   8859  C  CA    . TYR C 1 42  ? 11.323  32.988  111.362 1.00 193.78 ? 21  TYR C CA    1 
ATOM   8860  C  C     . TYR C 1 42  ? 11.126  31.512  110.978 1.00 172.65 ? 21  TYR C C     1 
ATOM   8861  O  O     . TYR C 1 42  ? 10.460  31.213  109.981 1.00 141.28 ? 21  TYR C O     1 
ATOM   8862  C  CB    . TYR C 1 42  ? 12.495  33.544  110.548 1.00 195.10 ? 21  TYR C CB    1 
ATOM   8863  C  CG    . TYR C 1 42  ? 13.705  32.673  110.726 1.00 191.30 ? 21  TYR C CG    1 
ATOM   8864  C  CD1   . TYR C 1 42  ? 14.535  32.824  111.820 1.00 193.15 ? 21  TYR C CD1   1 
ATOM   8865  C  CD2   . TYR C 1 42  ? 13.968  31.632  109.844 1.00 186.62 ? 21  TYR C CD2   1 
ATOM   8866  C  CE1   . TYR C 1 42  ? 15.611  31.991  112.004 1.00 187.18 ? 21  TYR C CE1   1 
ATOM   8867  C  CE2   . TYR C 1 42  ? 15.025  30.795  110.037 1.00 177.43 ? 21  TYR C CE2   1 
ATOM   8868  C  CZ    . TYR C 1 42  ? 15.848  30.987  111.105 1.00 174.42 ? 21  TYR C CZ    1 
ATOM   8869  O  OH    . TYR C 1 42  ? 16.907  30.151  111.271 1.00 161.92 ? 21  TYR C OH    1 
ATOM   8870  N  N     . TYR C 1 43  ? 11.810  30.585  111.655 1.00 176.77 ? 22  TYR C N     1 
ATOM   8871  C  CA    . TYR C 1 43  ? 11.700  29.177  111.276 1.00 178.39 ? 22  TYR C CA    1 
ATOM   8872  C  C     . TYR C 1 43  ? 10.316  28.617  111.574 1.00 187.69 ? 22  TYR C C     1 
ATOM   8873  O  O     . TYR C 1 43  ? 9.833   27.739  110.854 1.00 192.95 ? 22  TYR C O     1 
ATOM   8874  C  CB    . TYR C 1 43  ? 12.775  28.344  111.977 1.00 182.50 ? 22  TYR C CB    1 
ATOM   8875  C  CG    . TYR C 1 43  ? 12.709  28.362  113.489 1.00 189.67 ? 22  TYR C CG    1 
ATOM   8876  C  CD1   . TYR C 1 43  ? 13.465  29.271  114.210 1.00 207.28 ? 22  TYR C CD1   1 
ATOM   8877  C  CD2   . TYR C 1 43  ? 11.909  27.476  114.195 1.00 179.07 ? 22  TYR C CD2   1 
ATOM   8878  C  CE1   . TYR C 1 43  ? 13.432  29.307  115.586 1.00 202.53 ? 22  TYR C CE1   1 
ATOM   8879  C  CE2   . TYR C 1 43  ? 11.870  27.504  115.580 1.00 183.67 ? 22  TYR C CE2   1 
ATOM   8880  C  CZ    . TYR C 1 43  ? 12.639  28.427  116.269 1.00 190.25 ? 22  TYR C CZ    1 
ATOM   8881  O  OH    . TYR C 1 43  ? 12.628  28.495  117.645 1.00 187.45 ? 22  TYR C OH    1 
ATOM   8882  N  N     . LEU C 1 44  ? 9.679   29.079  112.650 1.00 197.36 ? 23  LEU C N     1 
ATOM   8883  C  CA    . LEU C 1 44  ? 8.328   28.620  112.957 1.00 192.97 ? 23  LEU C CA    1 
ATOM   8884  C  C     . LEU C 1 44  ? 7.272   29.337  112.114 1.00 202.81 ? 23  LEU C C     1 
ATOM   8885  O  O     . LEU C 1 44  ? 6.305   28.708  111.667 1.00 181.54 ? 23  LEU C O     1 
ATOM   8886  C  CB    . LEU C 1 44  ? 8.061   28.805  114.450 1.00 182.61 ? 23  LEU C CB    1 
ATOM   8887  C  CG    . LEU C 1 44  ? 6.733   28.363  115.058 1.00 192.00 ? 23  LEU C CG    1 
ATOM   8888  C  CD1   . LEU C 1 44  ? 6.480   26.905  114.772 1.00 181.94 ? 23  LEU C CD1   1 
ATOM   8889  C  CD2   . LEU C 1 44  ? 6.758   28.611  116.566 1.00 207.02 ? 23  LEU C CD2   1 
ATOM   8890  N  N     . HIS C 1 45  ? 7.437   30.651  111.907 1.00 211.71 ? 24  HIS C N     1 
ATOM   8891  C  CA    . HIS C 1 45  ? 6.543   31.430  111.044 1.00 208.06 ? 24  HIS C CA    1 
ATOM   8892  C  C     . HIS C 1 45  ? 6.528   30.900  109.612 1.00 191.42 ? 24  HIS C C     1 
ATOM   8893  O  O     . HIS C 1 45  ? 5.473   30.522  109.088 1.00 151.31 ? 24  HIS C O     1 
ATOM   8894  C  CB    . HIS C 1 45  ? 6.984   32.892  111.052 1.00 201.17 ? 24  HIS C CB    1 
ATOM   8895  C  CG    . HIS C 1 45  ? 7.054   33.484  112.420 1.00 191.22 ? 24  HIS C CG    1 
ATOM   8896  N  ND1   . HIS C 1 45  ? 6.319   32.995  113.477 1.00 176.18 ? 24  HIS C ND1   1 
ATOM   8897  C  CD2   . HIS C 1 45  ? 7.821   34.481  112.921 1.00 194.06 ? 24  HIS C CD2   1 
ATOM   8898  C  CE1   . HIS C 1 45  ? 6.603   33.691  114.563 1.00 204.67 ? 24  HIS C CE1   1 
ATOM   8899  N  NE2   . HIS C 1 45  ? 7.512   34.598  114.253 1.00 206.39 ? 24  HIS C NE2   1 
ATOM   8900  N  N     . ASN C 1 46  ? 7.709   30.837  108.972 1.00 209.83 ? 25  ASN C N     1 
ATOM   8901  C  CA    . ASN C 1 46  ? 7.812   30.305  107.613 1.00 193.86 ? 25  ASN C CA    1 
ATOM   8902  C  C     . ASN C 1 46  ? 7.388   28.854  107.560 1.00 171.82 ? 25  ASN C C     1 
ATOM   8903  O  O     . ASN C 1 46  ? 7.082   28.357  106.475 1.00 157.24 ? 25  ASN C O     1 
ATOM   8904  C  CB    . ASN C 1 46  ? 9.226   30.426  107.014 1.00 182.71 ? 25  ASN C CB    1 
ATOM   8905  C  CG    . ASN C 1 46  ? 9.617   31.854  106.664 1.00 181.07 ? 25  ASN C CG    1 
ATOM   8906  O  OD1   . ASN C 1 46  ? 10.750  32.283  106.921 1.00 175.80 ? 25  ASN C OD1   1 
ATOM   8907  N  ND2   . ASN C 1 46  ? 8.697   32.580  106.025 1.00 171.38 ? 25  ASN C ND2   1 
ATOM   8908  N  N     . PHE C 1 47  ? 7.478   28.136  108.679 1.00 183.07 ? 26  PHE C N     1 
ATOM   8909  C  CA    . PHE C 1 47  ? 6.991   26.766  108.686 1.00 189.47 ? 26  PHE C CA    1 
ATOM   8910  C  C     . PHE C 1 47  ? 5.466   26.671  108.752 1.00 187.24 ? 26  PHE C C     1 
ATOM   8911  O  O     . PHE C 1 47  ? 4.874   25.820  108.076 1.00 183.22 ? 26  PHE C O     1 
ATOM   8912  C  CB    . PHE C 1 47  ? 7.584   25.956  109.824 1.00 189.54 ? 26  PHE C CB    1 
ATOM   8913  C  CG    . PHE C 1 47  ? 7.101   24.563  109.793 1.00 189.74 ? 26  PHE C CG    1 
ATOM   8914  C  CD1   . PHE C 1 47  ? 6.124   24.132  110.663 1.00 175.17 ? 26  PHE C CD1   1 
ATOM   8915  C  CD2   . PHE C 1 47  ? 7.547   23.706  108.803 1.00 185.84 ? 26  PHE C CD2   1 
ATOM   8916  C  CE1   . PHE C 1 47  ? 5.645   22.850  110.586 1.00 159.10 ? 26  PHE C CE1   1 
ATOM   8917  C  CE2   . PHE C 1 47  ? 7.069   22.426  108.718 1.00 173.61 ? 26  PHE C CE2   1 
ATOM   8918  C  CZ    . PHE C 1 47  ? 6.116   21.994  109.618 1.00 156.90 ? 26  PHE C CZ    1 
ATOM   8919  N  N     . ARG C 1 48  ? 4.808   27.472  109.598 1.00 177.40 ? 27  ARG C N     1 
ATOM   8920  C  CA    . ARG C 1 48  ? 3.346   27.449  109.598 1.00 188.12 ? 27  ARG C CA    1 
ATOM   8921  C  C     . ARG C 1 48  ? 2.784   27.734  108.206 1.00 200.51 ? 27  ARG C C     1 
ATOM   8922  O  O     . ARG C 1 48  ? 1.731   27.195  107.838 1.00 190.16 ? 27  ARG C O     1 
ATOM   8923  C  CB    . ARG C 1 48  ? 2.779   28.449  110.615 1.00 194.23 ? 27  ARG C CB    1 
ATOM   8924  C  CG    . ARG C 1 48  ? 3.149   28.201  112.073 1.00 194.01 ? 27  ARG C CG    1 
ATOM   8925  C  CD    . ARG C 1 48  ? 2.143   28.866  113.003 1.00 187.12 ? 27  ARG C CD    1 
ATOM   8926  N  NE    . ARG C 1 48  ? 2.697   29.076  114.337 1.00 201.22 ? 27  ARG C NE    1 
ATOM   8927  C  CZ    . ARG C 1 48  ? 3.341   30.176  114.716 1.00 217.20 ? 27  ARG C CZ    1 
ATOM   8928  N  NH1   . ARG C 1 48  ? 3.525   31.170  113.855 1.00 222.64 ? 27  ARG C NH1   1 
ATOM   8929  N  NH2   . ARG C 1 48  ? 3.809   30.281  115.955 1.00 223.15 ? 27  ARG C NH2   1 
ATOM   8930  N  N     . ALA C 1 49  ? 3.481   28.564  107.421 1.00 191.69 ? 28  ALA C N     1 
ATOM   8931  C  CA    . ALA C 1 49  ? 3.075   28.838  106.045 1.00 184.45 ? 28  ALA C CA    1 
ATOM   8932  C  C     . ALA C 1 49  ? 2.959   27.552  105.231 1.00 195.07 ? 28  ALA C C     1 
ATOM   8933  O  O     . ALA C 1 49  ? 1.976   27.361  104.506 1.00 217.34 ? 28  ALA C O     1 
ATOM   8934  C  CB    . ALA C 1 49  ? 4.057   29.813  105.393 1.00 176.04 ? 28  ALA C CB    1 
ATOM   8935  N  N     . VAL C 1 50  ? 3.946   26.653  105.340 1.00 194.53 ? 29  VAL C N     1 
ATOM   8936  C  CA    . VAL C 1 50  ? 3.914   25.390  104.594 1.00 200.45 ? 29  VAL C CA    1 
ATOM   8937  C  C     . VAL C 1 50  ? 2.755   24.508  105.050 1.00 200.25 ? 29  VAL C C     1 
ATOM   8938  O  O     . VAL C 1 50  ? 2.179   23.754  104.254 1.00 201.76 ? 29  VAL C O     1 
ATOM   8939  C  CB    . VAL C 1 50  ? 5.259   24.648  104.739 1.00 202.41 ? 29  VAL C CB    1 
ATOM   8940  C  CG1   . VAL C 1 50  ? 5.107   23.159  104.415 1.00 199.18 ? 29  VAL C CG1   1 
ATOM   8941  C  CG2   . VAL C 1 50  ? 6.297   25.264  103.838 1.00 199.56 ? 29  VAL C CG2   1 
ATOM   8942  N  N     . LEU C 1 51  ? 2.396   24.576  106.329 1.00 209.67 ? 30  LEU C N     1 
ATOM   8943  C  CA    . LEU C 1 51  ? 1.263   23.801  106.811 1.00 182.85 ? 30  LEU C CA    1 
ATOM   8944  C  C     . LEU C 1 51  ? -0.042  24.252  106.160 1.00 204.48 ? 30  LEU C C     1 
ATOM   8945  O  O     . LEU C 1 51  ? -0.808  23.426  105.646 1.00 195.86 ? 30  LEU C O     1 
ATOM   8946  C  CB    . LEU C 1 51  ? 1.205   23.925  108.329 1.00 175.29 ? 30  LEU C CB    1 
ATOM   8947  C  CG    . LEU C 1 51  ? 2.409   23.221  108.945 1.00 147.00 ? 30  LEU C CG    1 
ATOM   8948  C  CD1   . LEU C 1 51  ? 2.279   23.169  110.435 1.00 149.80 ? 30  LEU C CD1   1 
ATOM   8949  C  CD2   . LEU C 1 51  ? 2.518   21.821  108.365 1.00 145.81 ? 30  LEU C CD2   1 
ATOM   8950  N  N     . ALA C 1 52  ? -0.274  25.570  106.104 1.00 204.46 ? 31  ALA C N     1 
ATOM   8951  C  CA    . ALA C 1 52  ? -1.499  26.098  105.500 1.00 201.36 ? 31  ALA C CA    1 
ATOM   8952  C  C     . ALA C 1 52  ? -1.610  25.693  104.039 1.00 188.89 ? 31  ALA C C     1 
ATOM   8953  O  O     . ALA C 1 52  ? -2.679  25.276  103.577 1.00 188.46 ? 31  ALA C O     1 
ATOM   8954  C  CB    . ALA C 1 52  ? -1.551  27.621  105.632 1.00 185.31 ? 31  ALA C CB    1 
ATOM   8955  N  N     . TRP C 1 53  ? -0.516  25.851  103.290 1.00 189.03 ? 32  TRP C N     1 
ATOM   8956  C  CA    . TRP C 1 53  ? -0.497  25.494  101.874 1.00 196.35 ? 32  TRP C CA    1 
ATOM   8957  C  C     . TRP C 1 53  ? -0.875  24.028  101.642 1.00 209.09 ? 32  TRP C C     1 
ATOM   8958  O  O     . TRP C 1 53  ? -1.759  23.731  100.831 1.00 215.54 ? 32  TRP C O     1 
ATOM   8959  C  CB    . TRP C 1 53  ? 0.878   25.830  101.283 1.00 181.36 ? 32  TRP C CB    1 
ATOM   8960  C  CG    . TRP C 1 53  ? 0.976   25.600  99.808  1.00 185.64 ? 32  TRP C CG    1 
ATOM   8961  C  CD1   . TRP C 1 53  ? 1.313   24.431  99.185  1.00 193.66 ? 32  TRP C CD1   1 
ATOM   8962  C  CD2   . TRP C 1 53  ? 0.633   26.527  98.764  1.00 189.21 ? 32  TRP C CD2   1 
ATOM   8963  N  NE1   . TRP C 1 53  ? 1.255   24.588  97.820  1.00 206.91 ? 32  TRP C NE1   1 
ATOM   8964  C  CE2   . TRP C 1 53  ? 0.831   25.861  97.536  1.00 203.85 ? 32  TRP C CE2   1 
ATOM   8965  C  CE3   . TRP C 1 53  ? 0.192   27.857  98.749  1.00 171.56 ? 32  TRP C CE3   1 
ATOM   8966  C  CZ2   . TRP C 1 53  ? 0.606   26.481  96.306  1.00 203.58 ? 32  TRP C CZ2   1 
ATOM   8967  C  CZ3   . TRP C 1 53  ? -0.028  28.471  97.526  1.00 172.61 ? 32  TRP C CZ3   1 
ATOM   8968  C  CH2   . TRP C 1 53  ? 0.177   27.781  96.322  1.00 190.99 ? 32  TRP C CH2   1 
ATOM   8969  N  N     . ILE C 1 54  ? -0.238  23.096  102.358 1.00 201.37 ? 33  ILE C N     1 
ATOM   8970  C  CA    . ILE C 1 54  ? -0.595  21.686  102.189 1.00 205.48 ? 33  ILE C CA    1 
ATOM   8971  C  C     . ILE C 1 54  ? -2.018  21.434  102.676 1.00 189.14 ? 33  ILE C C     1 
ATOM   8972  O  O     . ILE C 1 54  ? -2.704  20.522  102.186 1.00 172.81 ? 33  ILE C O     1 
ATOM   8973  C  CB    . ILE C 1 54  ? 0.446   20.782  102.887 1.00 225.09 ? 33  ILE C CB    1 
ATOM   8974  C  CG1   . ILE C 1 54  ? 1.724   20.695  102.042 1.00 221.82 ? 33  ILE C CG1   1 
ATOM   8975  C  CG2   . ILE C 1 54  ? -0.102  19.379  103.139 1.00 233.07 ? 33  ILE C CG2   1 
ATOM   8976  C  CD1   . ILE C 1 54  ? 2.946   20.206  102.804 1.00 219.07 ? 33  ILE C CD1   1 
ATOM   8977  N  N     . GLY C 1 55  ? -2.496  22.243  103.622 1.00 202.42 ? 34  GLY C N     1 
ATOM   8978  C  CA    . GLY C 1 55  ? -3.865  22.089  104.084 1.00 208.16 ? 34  GLY C CA    1 
ATOM   8979  C  C     . GLY C 1 55  ? -4.897  22.391  103.013 1.00 199.21 ? 34  GLY C C     1 
ATOM   8980  O  O     . GLY C 1 55  ? -5.856  21.637  102.832 1.00 185.05 ? 34  GLY C O     1 
ATOM   8981  N  N     . GLU C 1 56  ? -4.730  23.513  102.311 1.00 201.84 ? 35  GLU C N     1 
ATOM   8982  C  CA    . GLU C 1 56  ? -5.691  23.963  101.306 1.00 208.07 ? 35  GLU C CA    1 
ATOM   8983  C  C     . GLU C 1 56  ? -5.478  23.353  99.912  1.00 193.68 ? 35  GLU C C     1 
ATOM   8984  O  O     . GLU C 1 56  ? -6.457  23.037  99.222  1.00 191.76 ? 35  GLU C O     1 
ATOM   8985  C  CB    . GLU C 1 56  ? -5.691  25.499  101.281 1.00 197.73 ? 35  GLU C CB    1 
ATOM   8986  C  CG    . GLU C 1 56  ? -4.424  26.172  100.804 1.00 181.53 ? 35  GLU C CG    1 
ATOM   8987  C  CD    . GLU C 1 56  ? -4.487  27.687  100.942 1.00 177.01 ? 35  GLU C CD    1 
ATOM   8988  O  OE1   . GLU C 1 56  ? -5.304  28.191  101.747 1.00 164.21 ? 35  GLU C OE1   1 
ATOM   8989  O  OE2   . GLU C 1 56  ? -3.736  28.377  100.224 1.00 187.77 ? 35  GLU C OE2   1 
ATOM   8990  N  N     . ARG C 1 57  ? -4.228  23.240  99.449  1.00 199.34 ? 36  ARG C N     1 
ATOM   8991  C  CA    . ARG C 1 57  ? -3.957  22.764  98.092  1.00 197.64 ? 36  ARG C CA    1 
ATOM   8992  C  C     . ARG C 1 57  ? -3.965  21.236  97.990  1.00 201.98 ? 36  ARG C C     1 
ATOM   8993  O  O     . ARG C 1 57  ? -4.545  20.675  97.053  1.00 192.02 ? 36  ARG C O     1 
ATOM   8994  C  CB    . ARG C 1 57  ? -2.603  23.317  97.637  1.00 206.61 ? 36  ARG C CB    1 
ATOM   8995  C  CG    . ARG C 1 57  ? -2.476  24.830  97.828  1.00 212.72 ? 36  ARG C CG    1 
ATOM   8996  C  CD    . ARG C 1 57  ? -3.342  25.652  96.894  1.00 207.47 ? 36  ARG C CD    1 
ATOM   8997  N  NE    . ARG C 1 57  ? -2.565  26.111  95.748  1.00 194.02 ? 36  ARG C NE    1 
ATOM   8998  C  CZ    . ARG C 1 57  ? -2.128  25.351  94.750  1.00 195.81 ? 36  ARG C CZ    1 
ATOM   8999  N  NH1   . ARG C 1 57  ? -2.383  24.052  94.703  1.00 184.32 ? 36  ARG C NH1   1 
ATOM   9000  N  NH2   . ARG C 1 57  ? -1.420  25.909  93.782  1.00 205.53 ? 36  ARG C NH2   1 
ATOM   9001  N  N     . TYR C 1 58  ? -3.317  20.552  98.941  1.00 196.47 ? 37  TYR C N     1 
ATOM   9002  C  CA    . TYR C 1 58  ? -3.139  19.100  98.949  1.00 214.99 ? 37  TYR C CA    1 
ATOM   9003  C  C     . TYR C 1 58  ? -4.104  18.354  99.877  1.00 208.34 ? 37  TYR C C     1 
ATOM   9004  O  O     . TYR C 1 58  ? -3.865  17.177  100.173 1.00 191.86 ? 37  TYR C O     1 
ATOM   9005  C  CB    . TYR C 1 58  ? -1.687  18.755  99.299  1.00 230.85 ? 37  TYR C CB    1 
ATOM   9006  C  CG    . TYR C 1 58  ? -0.702  19.118  98.201  1.00 233.05 ? 37  TYR C CG    1 
ATOM   9007  C  CD1   . TYR C 1 58  ? -0.087  20.369  98.183  1.00 231.70 ? 37  TYR C CD1   1 
ATOM   9008  C  CD2   . TYR C 1 58  ? -0.396  18.224  97.181  1.00 230.79 ? 37  TYR C CD2   1 
ATOM   9009  C  CE1   . TYR C 1 58  ? 0.801   20.721  97.189  1.00 224.72 ? 37  TYR C CE1   1 
ATOM   9010  C  CE2   . TYR C 1 58  ? 0.502   18.569  96.179  1.00 229.64 ? 37  TYR C CE2   1 
ATOM   9011  C  CZ    . TYR C 1 58  ? 1.093   19.820  96.191  1.00 223.85 ? 37  TYR C CZ    1 
ATOM   9012  O  OH    . TYR C 1 58  ? 1.978   20.189  95.205  1.00 210.53 ? 37  TYR C OH    1 
ATOM   9013  N  N     . ALA C 1 59  ? -5.122  19.032  100.417 1.00 213.40 ? 38  ALA C N     1 
ATOM   9014  C  CA    . ALA C 1 59  ? -6.086  18.383  101.306 1.00 219.91 ? 38  ALA C CA    1 
ATOM   9015  C  C     . ALA C 1 59  ? -6.573  17.050  100.745 1.00 228.76 ? 38  ALA C C     1 
ATOM   9016  O  O     . ALA C 1 59  ? -6.597  16.038  101.455 1.00 234.66 ? 38  ALA C O     1 
ATOM   9017  C  CB    . ALA C 1 59  ? -7.277  19.308  101.556 1.00 220.96 ? 38  ALA C CB    1 
ATOM   9018  N  N     . ASP C 1 60  ? -6.972  17.034  99.464  1.00 223.12 ? 39  ASP C N     1 
ATOM   9019  C  CA    . ASP C 1 60  ? -7.560  15.843  98.851  1.00 227.05 ? 39  ASP C CA    1 
ATOM   9020  C  C     . ASP C 1 60  ? -6.569  14.695  98.677  1.00 217.61 ? 39  ASP C C     1 
ATOM   9021  O  O     . ASP C 1 60  ? -7.000  13.570  98.404  1.00 203.78 ? 39  ASP C O     1 
ATOM   9022  C  CB    . ASP C 1 60  ? -8.184  16.187  97.492  1.00 239.71 ? 39  ASP C CB    1 
ATOM   9023  C  CG    . ASP C 1 60  ? -7.217  16.890  96.553  1.00 253.91 ? 39  ASP C CG    1 
ATOM   9024  O  OD1   . ASP C 1 60  ? -7.528  16.980  95.345  1.00 261.81 ? 39  ASP C OD1   1 
ATOM   9025  O  OD2   . ASP C 1 60  ? -6.139  17.327  97.008  1.00 259.96 ? 39  ASP C OD2   1 
ATOM   9026  N  N     . LEU C 1 61  ? -5.267  14.935  98.826  1.00 242.24 ? 40  LEU C N     1 
ATOM   9027  C  CA    . LEU C 1 61  ? -4.281  13.864  98.738  1.00 238.39 ? 40  LEU C CA    1 
ATOM   9028  C  C     . LEU C 1 61  ? -4.015  13.228  100.087 1.00 231.43 ? 40  LEU C C     1 
ATOM   9029  O  O     . LEU C 1 61  ? -3.368  12.174  100.154 1.00 226.77 ? 40  LEU C O     1 
ATOM   9030  C  CB    . LEU C 1 61  ? -2.957  14.383  98.173  1.00 226.68 ? 40  LEU C CB    1 
ATOM   9031  C  CG    . LEU C 1 61  ? -2.932  14.577  96.667  1.00 207.23 ? 40  LEU C CG    1 
ATOM   9032  C  CD1   . LEU C 1 61  ? -1.510  14.806  96.207  1.00 200.77 ? 40  LEU C CD1   1 
ATOM   9033  C  CD2   . LEU C 1 61  ? -3.523  13.334  96.069  1.00 193.43 ? 40  LEU C CD2   1 
ATOM   9034  N  N     . LEU C 1 62  ? -4.499  13.853  101.152 1.00 242.07 ? 41  LEU C N     1 
ATOM   9035  C  CA    . LEU C 1 62  ? -4.271  13.373  102.495 1.00 221.44 ? 41  LEU C CA    1 
ATOM   9036  C  C     . LEU C 1 62  ? -5.206  12.209  102.804 1.00 227.13 ? 41  LEU C C     1 
ATOM   9037  O  O     . LEU C 1 62  ? -6.318  12.118  102.277 1.00 214.57 ? 41  LEU C O     1 
ATOM   9038  C  CB    . LEU C 1 62  ? -4.483  14.527  103.470 1.00 213.23 ? 41  LEU C CB    1 
ATOM   9039  C  CG    . LEU C 1 62  ? -3.540  15.712  103.258 1.00 194.39 ? 41  LEU C CG    1 
ATOM   9040  C  CD1   . LEU C 1 62  ? -3.962  16.864  104.125 1.00 188.14 ? 41  LEU C CD1   1 
ATOM   9041  C  CD2   . LEU C 1 62  ? -2.121  15.317  103.588 1.00 188.87 ? 41  LEU C CD2   1 
ATOM   9042  N  N     . ASP C 1 63  ? -4.744  11.324  103.676 1.00 226.94 ? 42  ASP C N     1 
ATOM   9043  C  CA    . ASP C 1 63  ? -5.477  10.152  104.135 1.00 236.50 ? 42  ASP C CA    1 
ATOM   9044  C  C     . ASP C 1 63  ? -5.766  10.313  105.634 1.00 227.36 ? 42  ASP C C     1 
ATOM   9045  O  O     . ASP C 1 63  ? -5.556  11.388  106.207 1.00 219.00 ? 42  ASP C O     1 
ATOM   9046  C  CB    . ASP C 1 63  ? -4.737  8.854   103.732 1.00 230.76 ? 42  ASP C CB    1 
ATOM   9047  C  CG    . ASP C 1 63  ? -3.506  8.548   104.580 1.00 224.61 ? 42  ASP C CG    1 
ATOM   9048  O  OD1   . ASP C 1 63  ? -3.050  9.416   105.348 1.00 231.61 ? 42  ASP C OD1   1 
ATOM   9049  O  OD2   . ASP C 1 63  ? -2.971  7.424   104.452 1.00 203.06 ? 42  ASP C OD2   1 
ATOM   9050  N  N     . ASP C 1 64  ? -6.295  9.258   106.260 1.00 239.72 ? 43  ASP C N     1 
ATOM   9051  C  CA    . ASP C 1 64  ? -6.701  9.349   107.664 1.00 218.22 ? 43  ASP C CA    1 
ATOM   9052  C  C     . ASP C 1 64  ? -5.536  9.723   108.574 1.00 211.48 ? 43  ASP C C     1 
ATOM   9053  O  O     . ASP C 1 64  ? -5.676  10.611  109.421 1.00 192.06 ? 43  ASP C O     1 
ATOM   9054  C  CB    . ASP C 1 64  ? -7.338  8.035   108.116 1.00 214.75 ? 43  ASP C CB    1 
ATOM   9055  C  CG    . ASP C 1 64  ? -8.849  8.051   107.995 1.00 214.71 ? 43  ASP C CG    1 
ATOM   9056  O  OD1   . ASP C 1 64  ? -9.503  7.168   108.586 1.00 208.50 ? 43  ASP C OD1   1 
ATOM   9057  O  OD2   . ASP C 1 64  ? -9.387  8.940   107.304 1.00 238.00 ? 43  ASP C OD2   1 
ATOM   9058  N  N     . GLN C 1 65  ? -4.400  9.016   108.461 1.00 219.16 ? 44  GLN C N     1 
ATOM   9059  C  CA    . GLN C 1 65  ? -3.227  9.334   109.286 1.00 227.55 ? 44  GLN C CA    1 
ATOM   9060  C  C     . GLN C 1 65  ? -2.774  10.783  109.125 1.00 237.08 ? 44  GLN C C     1 
ATOM   9061  O  O     . GLN C 1 65  ? -2.393  11.427  110.105 1.00 206.67 ? 44  GLN C O     1 
ATOM   9062  C  CB    . GLN C 1 65  ? -2.054  8.402   108.966 1.00 223.35 ? 44  GLN C CB    1 
ATOM   9063  C  CG    . GLN C 1 65  ? -1.797  7.300   109.980 1.00 230.41 ? 44  GLN C CG    1 
ATOM   9064  C  CD    . GLN C 1 65  ? -2.921  6.287   110.047 1.00 252.03 ? 44  GLN C CD    1 
ATOM   9065  O  OE1   . GLN C 1 65  ? -3.671  6.107   109.086 1.00 266.96 ? 44  GLN C OE1   1 
ATOM   9066  N  NE2   . GLN C 1 65  ? -3.034  5.603   111.183 1.00 242.91 ? 44  GLN C NE2   1 
ATOM   9067  N  N     . GLU C 1 66  ? -2.748  11.299  107.895 1.00 247.19 ? 45  GLU C N     1 
ATOM   9068  C  CA    . GLU C 1 66  ? -2.178  12.628  107.683 1.00 237.89 ? 45  GLU C CA    1 
ATOM   9069  C  C     . GLU C 1 66  ? -3.095  13.724  108.231 1.00 237.60 ? 45  GLU C C     1 
ATOM   9070  O  O     . GLU C 1 66  ? -2.697  14.484  109.121 1.00 235.68 ? 45  GLU C O     1 
ATOM   9071  C  CB    . GLU C 1 66  ? -1.881  12.835  106.194 1.00 212.22 ? 45  GLU C CB    1 
ATOM   9072  C  CG    . GLU C 1 66  ? -0.772  11.916  105.672 1.00 201.33 ? 45  GLU C CG    1 
ATOM   9073  C  CD    . GLU C 1 66  ? -1.110  11.293  104.323 1.00 202.36 ? 45  GLU C CD    1 
ATOM   9074  O  OE1   . GLU C 1 66  ? -1.839  11.939  103.548 1.00 204.42 ? 45  GLU C OE1   1 
ATOM   9075  O  OE2   . GLU C 1 66  ? -0.681  10.150  104.042 1.00 201.05 ? 45  GLU C OE2   1 
ATOM   9076  N  N     . ARG C 1 67  ? -4.355  13.774  107.764 1.00 257.15 ? 46  ARG C N     1 
ATOM   9077  C  CA    . ARG C 1 67  ? -5.250  14.868  108.153 1.00 221.29 ? 46  ARG C CA    1 
ATOM   9078  C  C     . ARG C 1 67  ? -5.453  14.921  109.656 1.00 213.55 ? 46  ARG C C     1 
ATOM   9079  O  O     . ARG C 1 67  ? -5.343  15.991  110.264 1.00 188.16 ? 46  ARG C O     1 
ATOM   9080  C  CB    . ARG C 1 67  ? -6.620  14.712  107.486 1.00 201.31 ? 46  ARG C CB    1 
ATOM   9081  C  CG    . ARG C 1 67  ? -6.675  14.998  106.014 1.00 182.26 ? 46  ARG C CG    1 
ATOM   9082  C  CD    . ARG C 1 67  ? -8.091  14.867  105.486 1.00 185.85 ? 46  ARG C CD    1 
ATOM   9083  N  NE    . ARG C 1 67  ? -8.626  13.514  105.613 1.00 195.28 ? 46  ARG C NE    1 
ATOM   9084  C  CZ    . ARG C 1 67  ? -9.799  13.126  105.115 1.00 224.31 ? 46  ARG C CZ    1 
ATOM   9085  N  NH1   . ARG C 1 67  ? -10.211 11.876  105.272 1.00 226.88 ? 46  ARG C NH1   1 
ATOM   9086  N  NH2   . ARG C 1 67  ? -10.564 13.988  104.457 1.00 233.11 ? 46  ARG C NH2   1 
ATOM   9087  N  N     . ALA C 1 68  ? -5.675  13.759  110.281 1.00 212.74 ? 47  ALA C N     1 
ATOM   9088  C  CA    . ALA C 1 68  ? -5.854  13.701  111.729 1.00 242.97 ? 47  ALA C CA    1 
ATOM   9089  C  C     . ALA C 1 68  ? -4.587  14.096  112.473 1.00 242.12 ? 47  ALA C C     1 
ATOM   9090  O  O     . ALA C 1 68  ? -4.664  14.661  113.572 1.00 245.50 ? 47  ALA C O     1 
ATOM   9091  C  CB    . ALA C 1 68  ? -6.316  12.305  112.147 1.00 251.62 ? 47  ALA C CB    1 
ATOM   9092  N  N     . PHE C 1 69  ? -3.417  13.803  111.904 1.00 254.43 ? 48  PHE C N     1 
ATOM   9093  C  CA    . PHE C 1 69  ? -2.188  14.294  112.508 1.00 240.19 ? 48  PHE C CA    1 
ATOM   9094  C  C     . PHE C 1 69  ? -2.155  15.823  112.445 1.00 225.13 ? 48  PHE C C     1 
ATOM   9095  O  O     . PHE C 1 69  ? -1.763  16.481  113.415 1.00 229.19 ? 48  PHE C O     1 
ATOM   9096  C  CB    . PHE C 1 69  ? -0.965  13.650  111.830 1.00 237.86 ? 48  PHE C CB    1 
ATOM   9097  C  CG    . PHE C 1 69  ? -0.363  12.460  112.592 1.00 231.07 ? 48  PHE C CG    1 
ATOM   9098  C  CD1   . PHE C 1 69  ? 0.615   12.653  113.556 1.00 214.18 ? 48  PHE C CD1   1 
ATOM   9099  C  CD2   . PHE C 1 69  ? -0.752  11.152  112.315 1.00 231.72 ? 48  PHE C CD2   1 
ATOM   9100  C  CE1   . PHE C 1 69  ? 1.170   11.571  114.233 1.00 209.34 ? 48  PHE C CE1   1 
ATOM   9101  C  CE2   . PHE C 1 69  ? -0.202  10.072  112.992 1.00 226.85 ? 48  PHE C CE2   1 
ATOM   9102  C  CZ    . PHE C 1 69  ? 0.759   10.284  113.953 1.00 216.10 ? 48  PHE C CZ    1 
ATOM   9103  N  N     . ILE C 1 70  ? -2.601  16.403  111.316 1.00 233.95 ? 49  ILE C N     1 
ATOM   9104  C  CA    . ILE C 1 70  ? -2.531  17.853  111.097 1.00 200.60 ? 49  ILE C CA    1 
ATOM   9105  C  C     . ILE C 1 70  ? -3.290  18.625  112.173 1.00 215.14 ? 49  ILE C C     1 
ATOM   9106  O  O     . ILE C 1 70  ? -2.869  19.716  112.577 1.00 223.18 ? 49  ILE C O     1 
ATOM   9107  C  CB    . ILE C 1 70  ? -3.041  18.216  109.689 1.00 197.18 ? 49  ILE C CB    1 
ATOM   9108  C  CG1   . ILE C 1 70  ? -2.202  17.493  108.627 1.00 208.64 ? 49  ILE C CG1   1 
ATOM   9109  C  CG2   . ILE C 1 70  ? -2.951  19.722  109.482 1.00 174.54 ? 49  ILE C CG2   1 
ATOM   9110  C  CD1   . ILE C 1 70  ? -2.510  17.842  107.173 1.00 192.01 ? 49  ILE C CD1   1 
ATOM   9111  N  N     . ALA C 1 71  ? -4.419  18.091  112.649 1.00 210.70 ? 50  ALA C N     1 
ATOM   9112  C  CA    . ALA C 1 71  ? -5.183  18.786  113.684 1.00 200.34 ? 50  ALA C CA    1 
ATOM   9113  C  C     . ALA C 1 71  ? -4.350  18.979  114.946 1.00 227.14 ? 50  ALA C C     1 
ATOM   9114  O  O     . ALA C 1 71  ? -4.295  20.080  115.509 1.00 200.57 ? 50  ALA C O     1 
ATOM   9115  C  CB    . ALA C 1 71  ? -6.463  18.011  114.005 1.00 205.70 ? 50  ALA C CB    1 
ATOM   9116  N  N     . ALA C 1 72  ? -3.669  17.914  115.381 1.00 218.30 ? 51  ALA C N     1 
ATOM   9117  C  CA    . ALA C 1 72  ? -2.935  17.903  116.646 1.00 234.35 ? 51  ALA C CA    1 
ATOM   9118  C  C     . ALA C 1 72  ? -1.742  18.850  116.654 1.00 230.29 ? 51  ALA C C     1 
ATOM   9119  O  O     . ALA C 1 72  ? -1.342  19.325  117.723 1.00 228.64 ? 51  ALA C O     1 
ATOM   9120  C  CB    . ALA C 1 72  ? -2.470  16.484  116.966 1.00 235.93 ? 51  ALA C CB    1 
ATOM   9121  N  N     . PHE C 1 73  ? -1.125  19.084  115.495 1.00 245.44 ? 52  PHE C N     1 
ATOM   9122  C  CA    . PHE C 1 73  ? 0.078   19.911  115.440 1.00 242.21 ? 52  PHE C CA    1 
ATOM   9123  C  C     . PHE C 1 73  ? -0.191  21.329  115.941 1.00 220.33 ? 52  PHE C C     1 
ATOM   9124  O  O     . PHE C 1 73  ? 0.569   21.866  116.759 1.00 213.50 ? 52  PHE C O     1 
ATOM   9125  C  CB    . PHE C 1 73  ? 0.612   19.975  114.003 1.00 249.57 ? 52  PHE C CB    1 
ATOM   9126  C  CG    . PHE C 1 73  ? 0.777   18.630  113.316 1.00 243.59 ? 52  PHE C CG    1 
ATOM   9127  C  CD1   . PHE C 1 73  ? 1.060   17.479  114.029 1.00 241.20 ? 52  PHE C CD1   1 
ATOM   9128  C  CD2   . PHE C 1 73  ? 0.681   18.539  111.933 1.00 212.63 ? 52  PHE C CD2   1 
ATOM   9129  C  CE1   . PHE C 1 73  ? 1.220   16.260  113.381 1.00 220.33 ? 52  PHE C CE1   1 
ATOM   9130  C  CE2   . PHE C 1 73  ? 0.843   17.328  111.287 1.00 183.79 ? 52  PHE C CE2   1 
ATOM   9131  C  CZ    . PHE C 1 73  ? 1.118   16.194  112.009 1.00 188.91 ? 52  PHE C CZ    1 
ATOM   9132  N  N     . ALA C 1 74  ? -1.280  21.947  115.459 1.00 228.10 ? 53  ALA C N     1 
ATOM   9133  C  CA    . ALA C 1 74  ? -1.584  23.344  115.766 1.00 207.36 ? 53  ALA C CA    1 
ATOM   9134  C  C     . ALA C 1 74  ? -1.824  23.562  117.252 1.00 232.00 ? 53  ALA C C     1 
ATOM   9135  O  O     . ALA C 1 74  ? -1.640  24.680  117.748 1.00 207.96 ? 53  ALA C O     1 
ATOM   9136  C  CB    . ALA C 1 74  ? -2.805  23.812  114.967 1.00 188.09 ? 53  ALA C CB    1 
ATOM   9137  N  N     . GLU C 1 75  ? -2.187  22.501  117.974 1.00 235.15 ? 54  GLU C N     1 
ATOM   9138  C  CA    . GLU C 1 75  ? -2.505  22.560  119.393 1.00 227.65 ? 54  GLU C CA    1 
ATOM   9139  C  C     . GLU C 1 75  ? -1.265  22.665  120.267 1.00 227.36 ? 54  GLU C C     1 
ATOM   9140  O  O     . GLU C 1 75  ? -1.398  22.923  121.466 1.00 233.31 ? 54  GLU C O     1 
ATOM   9141  C  CB    . GLU C 1 75  ? -3.265  21.292  119.811 1.00 218.54 ? 54  GLU C CB    1 
ATOM   9142  C  CG    . GLU C 1 75  ? -4.565  20.981  119.073 1.00 218.86 ? 54  GLU C CG    1 
ATOM   9143  C  CD    . GLU C 1 75  ? -5.666  21.988  119.311 1.00 227.99 ? 54  GLU C CD    1 
ATOM   9144  O  OE1   . GLU C 1 75  ? -5.952  22.296  120.488 1.00 229.38 ? 54  GLU C OE1   1 
ATOM   9145  O  OE2   . GLU C 1 75  ? -6.269  22.448  118.319 1.00 235.92 ? 54  GLU C OE2   1 
ATOM   9146  N  N     . LEU C 1 76  ? -0.073  22.500  119.706 1.00 231.73 ? 55  LEU C N     1 
ATOM   9147  C  CA    . LEU C 1 76  ? 1.118   22.464  120.535 1.00 230.18 ? 55  LEU C CA    1 
ATOM   9148  C  C     . LEU C 1 76  ? 1.429   23.842  121.117 1.00 235.19 ? 55  LEU C C     1 
ATOM   9149  O  O     . LEU C 1 76  ? 1.142   24.869  120.497 1.00 237.34 ? 55  LEU C O     1 
ATOM   9150  C  CB    . LEU C 1 76  ? 2.299   21.955  119.722 1.00 214.48 ? 55  LEU C CB    1 
ATOM   9151  C  CG    . LEU C 1 76  ? 2.170   20.456  119.467 1.00 215.49 ? 55  LEU C CG    1 
ATOM   9152  C  CD1   . LEU C 1 76  ? 3.120   20.016  118.376 1.00 203.08 ? 55  LEU C CD1   1 
ATOM   9153  C  CD2   . LEU C 1 76  ? 2.425   19.697  120.765 1.00 206.83 ? 55  LEU C CD2   1 
ATOM   9154  N  N     . PRO C 1 77  ? 2.025   23.881  122.311 1.00 229.62 ? 56  PRO C N     1 
ATOM   9155  C  CA    . PRO C 1 77  ? 2.455   25.157  122.900 1.00 222.57 ? 56  PRO C CA    1 
ATOM   9156  C  C     . PRO C 1 77  ? 3.452   25.881  122.014 1.00 227.01 ? 56  PRO C C     1 
ATOM   9157  O  O     . PRO C 1 77  ? 4.105   25.286  121.156 1.00 239.59 ? 56  PRO C O     1 
ATOM   9158  C  CB    . PRO C 1 77  ? 3.107   24.735  124.219 1.00 214.07 ? 56  PRO C CB    1 
ATOM   9159  C  CG    . PRO C 1 77  ? 2.482   23.414  124.548 1.00 223.29 ? 56  PRO C CG    1 
ATOM   9160  C  CD    . PRO C 1 77  ? 2.173   22.748  123.243 1.00 225.27 ? 56  PRO C CD    1 
ATOM   9161  N  N     . GLU C 1 78  ? 3.568   27.193  122.237 1.00 243.07 ? 57  GLU C N     1 
ATOM   9162  C  CA    . GLU C 1 78  ? 4.488   27.991  121.431 1.00 234.71 ? 57  GLU C CA    1 
ATOM   9163  C  C     . GLU C 1 78  ? 5.936   27.576  121.667 1.00 241.41 ? 57  GLU C C     1 
ATOM   9164  O  O     . GLU C 1 78  ? 6.725   27.469  120.719 1.00 165.23 ? 57  GLU C O     1 
ATOM   9165  C  CB    . GLU C 1 78  ? 4.303   29.473  121.747 1.00 243.01 ? 57  GLU C CB    1 
ATOM   9166  C  CG    . GLU C 1 78  ? 3.002   30.065  121.255 1.00 236.09 ? 57  GLU C CG    1 
ATOM   9167  C  CD    . GLU C 1 78  ? 3.210   31.048  120.127 1.00 234.58 ? 57  GLU C CD    1 
ATOM   9168  O  OE1   . GLU C 1 78  ? 4.201   30.893  119.377 1.00 222.24 ? 57  GLU C OE1   1 
ATOM   9169  O  OE2   . GLU C 1 78  ? 2.406   31.994  120.013 1.00 241.26 ? 57  GLU C OE2   1 
ATOM   9170  N  N     . ALA C 1 79  ? 6.301   27.347  122.931 1.00 235.67 ? 58  ALA C N     1 
ATOM   9171  C  CA    . ALA C 1 79  ? 7.646   26.884  123.248 1.00 237.35 ? 58  ALA C CA    1 
ATOM   9172  C  C     . ALA C 1 79  ? 7.889   25.489  122.689 1.00 231.42 ? 58  ALA C C     1 
ATOM   9173  O  O     . ALA C 1 79  ? 8.951   25.217  122.116 1.00 211.02 ? 58  ALA C O     1 
ATOM   9174  C  CB    . ALA C 1 79  ? 7.868   26.902  124.761 1.00 244.07 ? 58  ALA C CB    1 
ATOM   9175  N  N     . SER C 1 80  ? 6.901   24.598  122.836 1.00 236.02 ? 59  SER C N     1 
ATOM   9176  C  CA    . SER C 1 80  ? 7.084   23.200  122.461 1.00 226.38 ? 59  SER C CA    1 
ATOM   9177  C  C     . SER C 1 80  ? 7.101   23.021  120.949 1.00 224.49 ? 59  SER C C     1 
ATOM   9178  O  O     . SER C 1 80  ? 7.923   22.259  120.426 1.00 222.92 ? 59  SER C O     1 
ATOM   9179  C  CB    . SER C 1 80  ? 5.982   22.345  123.089 1.00 222.91 ? 59  SER C CB    1 
ATOM   9180  O  OG    . SER C 1 80  ? 5.989   22.460  124.503 1.00 222.00 ? 59  SER C OG    1 
ATOM   9181  N  N     . GLN C 1 81  ? 6.172   23.674  120.235 1.00 248.60 ? 60  GLN C N     1 
ATOM   9182  C  CA    . GLN C 1 81  ? 6.200   23.671  118.770 1.00 235.78 ? 60  GLN C CA    1 
ATOM   9183  C  C     . GLN C 1 81  ? 7.437   24.373  118.221 1.00 208.31 ? 60  GLN C C     1 
ATOM   9184  O  O     . GLN C 1 81  ? 7.873   24.074  117.102 1.00 154.39 ? 60  GLN C O     1 
ATOM   9185  C  CB    . GLN C 1 81  ? 4.931   24.297  118.193 1.00 234.71 ? 60  GLN C CB    1 
ATOM   9186  C  CG    . GLN C 1 81  ? 4.972   25.795  118.055 1.00 229.42 ? 60  GLN C CG    1 
ATOM   9187  C  CD    . GLN C 1 81  ? 3.687   26.332  117.494 1.00 221.77 ? 60  GLN C CD    1 
ATOM   9188  O  OE1   . GLN C 1 81  ? 3.491   27.545  117.403 1.00 224.91 ? 60  GLN C OE1   1 
ATOM   9189  N  NE2   . GLN C 1 81  ? 2.794   25.426  117.111 1.00 210.16 ? 60  GLN C NE2   1 
ATOM   9190  N  N     . ALA C 1 82  ? 7.963   25.362  118.949 1.00 208.29 ? 61  ALA C N     1 
ATOM   9191  C  CA    . ALA C 1 82  ? 9.203   25.993  118.518 1.00 211.82 ? 61  ALA C CA    1 
ATOM   9192  C  C     . ALA C 1 82  ? 10.366  25.011  118.615 1.00 218.37 ? 61  ALA C C     1 
ATOM   9193  O  O     . ALA C 1 82  ? 11.222  24.959  117.724 1.00 209.98 ? 61  ALA C O     1 
ATOM   9194  C  CB    . ALA C 1 82  ? 9.476   27.248  119.349 1.00 214.25 ? 61  ALA C CB    1 
ATOM   9195  N  N     . LEU C 1 83  ? 10.402  24.216  119.689 1.00 226.40 ? 62  LEU C N     1 
ATOM   9196  C  CA    . LEU C 1 83  ? 11.429  23.188  119.836 1.00 212.52 ? 62  LEU C CA    1 
ATOM   9197  C  C     . LEU C 1 83  ? 11.375  22.153  118.719 1.00 207.31 ? 62  LEU C C     1 
ATOM   9198  O  O     . LEU C 1 83  ? 12.416  21.763  118.179 1.00 213.31 ? 62  LEU C O     1 
ATOM   9199  C  CB    . LEU C 1 83  ? 11.286  22.499  121.185 1.00 193.42 ? 62  LEU C CB    1 
ATOM   9200  C  CG    . LEU C 1 83  ? 12.316  21.390  121.329 1.00 189.23 ? 62  LEU C CG    1 
ATOM   9201  C  CD1   . LEU C 1 83  ? 13.741  21.898  121.123 1.00 173.34 ? 62  LEU C CD1   1 
ATOM   9202  C  CD2   . LEU C 1 83  ? 12.144  20.744  122.687 1.00 211.72 ? 62  LEU C CD2   1 
ATOM   9203  N  N     . LEU C 1 84  ? 10.174  21.678  118.380 1.00 222.44 ? 63  LEU C N     1 
ATOM   9204  C  CA    . LEU C 1 84  ? 10.035  20.641  117.358 1.00 199.82 ? 63  LEU C CA    1 
ATOM   9205  C  C     . LEU C 1 84  ? 10.614  21.059  116.016 1.00 182.17 ? 63  LEU C C     1 
ATOM   9206  O  O     . LEU C 1 84  ? 11.184  20.227  115.300 1.00 157.46 ? 63  LEU C O     1 
ATOM   9207  C  CB    . LEU C 1 84  ? 8.572   20.241  117.199 1.00 191.15 ? 63  LEU C CB    1 
ATOM   9208  C  CG    . LEU C 1 84  ? 8.383   18.980  116.350 1.00 173.01 ? 63  LEU C CG    1 
ATOM   9209  C  CD1   . LEU C 1 84  ? 9.295   17.846  116.790 1.00 180.36 ? 63  LEU C CD1   1 
ATOM   9210  C  CD2   . LEU C 1 84  ? 6.925   18.543  116.411 1.00 159.91 ? 63  LEU C CD2   1 
ATOM   9211  N  N     . VAL C 1 85  ? 10.461  22.332  115.643 1.00 191.68 ? 64  VAL C N     1 
ATOM   9212  C  CA    . VAL C 1 85  ? 10.881  22.755  114.308 1.00 191.15 ? 64  VAL C CA    1 
ATOM   9213  C  C     . VAL C 1 85  ? 12.393  22.638  114.153 1.00 204.15 ? 64  VAL C C     1 
ATOM   9214  O  O     . VAL C 1 85  ? 12.888  22.248  113.089 1.00 230.10 ? 64  VAL C O     1 
ATOM   9215  C  CB    . VAL C 1 85  ? 10.390  24.189  114.012 1.00 178.46 ? 64  VAL C CB    1 
ATOM   9216  C  CG1   . VAL C 1 85  ? 10.843  24.648  112.642 1.00 144.95 ? 64  VAL C CG1   1 
ATOM   9217  C  CG2   . VAL C 1 85  ? 8.886   24.268  114.091 1.00 191.43 ? 64  VAL C CG2   1 
ATOM   9218  N  N     . ARG C 1 86  ? 13.153  22.943  115.206 1.00 194.46 ? 65  ARG C N     1 
ATOM   9219  C  CA    . ARG C 1 86  ? 14.607  22.805  115.130 1.00 194.56 ? 65  ARG C CA    1 
ATOM   9220  C  C     . ARG C 1 86  ? 15.027  21.358  114.863 1.00 211.21 ? 65  ARG C C     1 
ATOM   9221  O  O     . ARG C 1 86  ? 15.902  21.099  114.025 1.00 207.04 ? 65  ARG C O     1 
ATOM   9222  C  CB    . ARG C 1 86  ? 15.259  23.334  116.409 1.00 196.44 ? 65  ARG C CB    1 
ATOM   9223  C  CG    . ARG C 1 86  ? 15.111  24.832  116.591 1.00 183.55 ? 65  ARG C CG    1 
ATOM   9224  C  CD    . ARG C 1 86  ? 15.576  25.569  115.371 1.00 158.99 ? 65  ARG C CD    1 
ATOM   9225  N  NE    . ARG C 1 86  ? 15.807  26.978  115.646 1.00 161.75 ? 65  ARG C NE    1 
ATOM   9226  C  CZ    . ARG C 1 86  ? 16.382  27.810  114.784 1.00 193.11 ? 65  ARG C CZ    1 
ATOM   9227  N  NH1   . ARG C 1 86  ? 16.781  27.373  113.592 1.00 196.53 ? 65  ARG C NH1   1 
ATOM   9228  N  NH2   . ARG C 1 86  ? 16.554  29.084  115.109 1.00 199.91 ? 65  ARG C NH2   1 
ATOM   9229  N  N     . MET C 1 87  ? 14.413  20.399  115.569 1.00 199.26 ? 66  MET C N     1 
ATOM   9230  C  CA    . MET C 1 87  ? 14.814  18.999  115.430 1.00 197.25 ? 66  MET C CA    1 
ATOM   9231  C  C     . MET C 1 87  ? 14.500  18.463  114.040 1.00 195.76 ? 66  MET C C     1 
ATOM   9232  O  O     . MET C 1 87  ? 15.314  17.752  113.436 1.00 192.07 ? 66  MET C O     1 
ATOM   9233  C  CB    . MET C 1 87  ? 14.091  18.139  116.472 1.00 188.56 ? 66  MET C CB    1 
ATOM   9234  C  CG    . MET C 1 87  ? 14.343  18.478  117.929 1.00 195.26 ? 66  MET C CG    1 
ATOM   9235  S  SD    . MET C 1 87  ? 13.248  17.525  119.006 1.00 205.27 ? 66  MET C SD    1 
ATOM   9236  C  CE    . MET C 1 87  ? 13.661  18.210  120.608 1.00 208.07 ? 66  MET C CE    1 
ATOM   9237  N  N     . VAL C 1 88  ? 13.317  18.787  113.522 1.00 205.04 ? 67  VAL C N     1 
ATOM   9238  C  CA    . VAL C 1 88  ? 12.918  18.306  112.206 1.00 186.80 ? 67  VAL C CA    1 
ATOM   9239  C  C     . VAL C 1 88  ? 13.738  18.962  111.102 1.00 176.60 ? 67  VAL C C     1 
ATOM   9240  O  O     . VAL C 1 88  ? 13.927  18.373  110.033 1.00 180.45 ? 67  VAL C O     1 
ATOM   9241  C  CB    . VAL C 1 88  ? 11.408  18.503  112.009 1.00 180.35 ? 67  VAL C CB    1 
ATOM   9242  C  CG1   . VAL C 1 88  ? 10.974  17.874  110.699 1.00 149.82 ? 67  VAL C CG1   1 
ATOM   9243  C  CG2   . VAL C 1 88  ? 10.646  17.912  113.196 1.00 179.00 ? 67  VAL C CG2   1 
ATOM   9244  N  N     . MET C 1 89  ? 14.221  20.188  111.315 1.00 171.70 ? 68  MET C N     1 
ATOM   9245  C  CA    . MET C 1 89  ? 14.984  20.819  110.248 1.00 161.08 ? 68  MET C CA    1 
ATOM   9246  C  C     . MET C 1 89  ? 16.376  20.230  110.114 1.00 163.92 ? 68  MET C C     1 
ATOM   9247  O  O     . MET C 1 89  ? 17.050  20.501  109.117 1.00 174.71 ? 68  MET C O     1 
ATOM   9248  C  CB    . MET C 1 89  ? 15.090  22.335  110.441 1.00 165.52 ? 68  MET C CB    1 
ATOM   9249  C  CG    . MET C 1 89  ? 13.811  23.111  110.144 1.00 175.73 ? 68  MET C CG    1 
ATOM   9250  S  SD    . MET C 1 89  ? 13.977  24.919  110.207 1.00 186.64 ? 68  MET C SD    1 
ATOM   9251  C  CE    . MET C 1 89  ? 15.298  25.125  111.403 1.00 195.81 ? 68  MET C CE    1 
ATOM   9252  N  N     . ARG C 1 90  ? 16.841  19.464  111.086 1.00 156.00 ? 69  ARG C N     1 
ATOM   9253  C  CA    . ARG C 1 90  ? 18.030  18.663  110.870 1.00 167.94 ? 69  ARG C CA    1 
ATOM   9254  C  C     . ARG C 1 90  ? 17.579  17.248  110.525 1.00 179.64 ? 69  ARG C C     1 
ATOM   9255  O  O     . ARG C 1 90  ? 16.643  16.718  111.132 1.00 144.95 ? 69  ARG C O     1 
ATOM   9256  C  CB    . ARG C 1 90  ? 18.939  18.669  112.095 1.00 191.38 ? 69  ARG C CB    1 
ATOM   9257  C  CG    . ARG C 1 90  ? 19.704  17.370  112.309 1.00 204.67 ? 69  ARG C CG    1 
ATOM   9258  C  CD    . ARG C 1 90  ? 20.767  17.121  111.259 1.00 179.40 ? 69  ARG C CD    1 
ATOM   9259  N  NE    . ARG C 1 90  ? 20.936  15.696  111.050 1.00 169.65 ? 69  ARG C NE    1 
ATOM   9260  C  CZ    . ARG C 1 90  ? 21.340  15.158  109.908 1.00 187.02 ? 69  ARG C CZ    1 
ATOM   9261  N  NH1   . ARG C 1 90  ? 21.627  15.939  108.873 1.00 188.26 ? 69  ARG C NH1   1 
ATOM   9262  N  NH2   . ARG C 1 90  ? 21.447  13.838  109.801 1.00 184.15 ? 69  ARG C NH2   1 
ATOM   9263  N  N     . LYS C 1 91  ? 18.270  16.635  109.559 1.00 198.68 ? 70  LYS C N     1 
ATOM   9264  C  CA    . LYS C 1 91  ? 17.781  15.411  108.926 1.00 214.40 ? 70  LYS C CA    1 
ATOM   9265  C  C     . LYS C 1 91  ? 17.696  14.252  109.920 1.00 203.15 ? 70  LYS C C     1 
ATOM   9266  O  O     . LYS C 1 91  ? 16.751  13.454  109.871 1.00 206.14 ? 70  LYS C O     1 
ATOM   9267  C  CB    . LYS C 1 91  ? 18.659  15.058  107.715 1.00 209.82 ? 70  LYS C CB    1 
ATOM   9268  C  CG    . LYS C 1 91  ? 19.042  16.265  106.839 1.00 175.86 ? 70  LYS C CG    1 
ATOM   9269  C  CD    . LYS C 1 91  ? 18.652  16.085  105.390 1.00 157.06 ? 70  LYS C CD    1 
ATOM   9270  C  CE    . LYS C 1 91  ? 17.255  16.608  105.116 1.00 154.85 ? 70  LYS C CE    1 
ATOM   9271  N  NZ    . LYS C 1 91  ? 17.004  16.615  103.639 1.00 160.54 ? 70  LYS C NZ    1 
ATOM   9272  N  N     . GLY C 1 92  ? 18.675  14.133  110.814 1.00 195.90 ? 71  GLY C N     1 
ATOM   9273  C  CA    . GLY C 1 92  ? 18.764  12.970  111.672 1.00 201.06 ? 71  GLY C CA    1 
ATOM   9274  C  C     . GLY C 1 92  ? 17.620  12.866  112.666 1.00 200.84 ? 71  GLY C C     1 
ATOM   9275  O  O     . GLY C 1 92  ? 16.821  13.782  112.867 1.00 210.84 ? 71  GLY C O     1 
ATOM   9276  N  N     . THR C 1 93  ? 17.528  11.693  113.284 1.00 196.21 ? 72  THR C N     1 
ATOM   9277  C  CA    . THR C 1 93  ? 16.625  11.464  114.399 1.00 200.59 ? 72  THR C CA    1 
ATOM   9278  C  C     . THR C 1 93  ? 17.275  11.476  115.787 1.00 228.94 ? 72  THR C C     1 
ATOM   9279  O  O     . THR C 1 93  ? 16.567  11.242  116.771 1.00 224.96 ? 72  THR C O     1 
ATOM   9280  C  CB    . THR C 1 93  ? 15.861  10.168  114.161 1.00 198.84 ? 72  THR C CB    1 
ATOM   9281  O  OG1   . THR C 1 93  ? 16.770  9.148   113.737 1.00 208.98 ? 72  THR C OG1   1 
ATOM   9282  C  CG2   . THR C 1 93  ? 14.854  10.391  113.058 1.00 182.45 ? 72  THR C CG2   1 
ATOM   9283  N  N     . LEU C 1 94  ? 18.584  11.718  115.913 1.00 220.76 ? 73  LEU C N     1 
ATOM   9284  C  CA    . LEU C 1 94  ? 19.229  11.670  117.225 1.00 218.61 ? 73  LEU C CA    1 
ATOM   9285  C  C     . LEU C 1 94  ? 19.847  13.009  117.596 1.00 214.91 ? 73  LEU C C     1 
ATOM   9286  O  O     . LEU C 1 94  ? 20.559  13.617  116.790 1.00 190.27 ? 73  LEU C O     1 
ATOM   9287  C  CB    . LEU C 1 94  ? 20.322  10.601  117.292 1.00 207.36 ? 73  LEU C CB    1 
ATOM   9288  C  CG    . LEU C 1 94  ? 19.903  9.139   117.296 1.00 209.74 ? 73  LEU C CG    1 
ATOM   9289  C  CD1   . LEU C 1 94  ? 21.112  8.253   117.034 1.00 201.74 ? 73  LEU C CD1   1 
ATOM   9290  C  CD2   . LEU C 1 94  ? 19.232  8.786   118.617 1.00 211.73 ? 73  LEU C CD2   1 
ATOM   9291  N  N     . PHE C 1 95  ? 19.610  13.425  118.845 1.00 219.42 ? 74  PHE C N     1 
ATOM   9292  C  CA    . PHE C 1 95  ? 20.085  14.692  119.384 1.00 230.96 ? 74  PHE C CA    1 
ATOM   9293  C  C     . PHE C 1 95  ? 20.356  14.538  120.875 1.00 247.59 ? 74  PHE C C     1 
ATOM   9294  O  O     . PHE C 1 95  ? 19.579  13.893  121.588 1.00 252.67 ? 74  PHE C O     1 
ATOM   9295  C  CB    . PHE C 1 95  ? 19.063  15.814  119.171 1.00 215.30 ? 74  PHE C CB    1 
ATOM   9296  C  CG    . PHE C 1 95  ? 18.602  15.947  117.756 1.00 207.73 ? 74  PHE C CG    1 
ATOM   9297  C  CD1   . PHE C 1 95  ? 17.376  15.438  117.364 1.00 207.30 ? 74  PHE C CD1   1 
ATOM   9298  C  CD2   . PHE C 1 95  ? 19.385  16.591  116.818 1.00 194.06 ? 74  PHE C CD2   1 
ATOM   9299  C  CE1   . PHE C 1 95  ? 16.945  15.564  116.057 1.00 197.61 ? 74  PHE C CE1   1 
ATOM   9300  C  CE2   . PHE C 1 95  ? 18.964  16.714  115.515 1.00 176.96 ? 74  PHE C CE2   1 
ATOM   9301  C  CZ    . PHE C 1 95  ? 17.742  16.203  115.131 1.00 176.70 ? 74  PHE C CZ    1 
ATOM   9302  N  N     . ARG C 1 96  ? 21.456  15.137  121.340 1.00 254.17 ? 75  ARG C N     1 
ATOM   9303  C  CA    . ARG C 1 96  ? 21.686  15.300  122.770 1.00 235.49 ? 75  ARG C CA    1 
ATOM   9304  C  C     . ARG C 1 96  ? 20.875  16.480  123.274 1.00 219.21 ? 75  ARG C C     1 
ATOM   9305  O  O     . ARG C 1 96  ? 20.887  17.553  122.659 1.00 199.29 ? 75  ARG C O     1 
ATOM   9306  C  CB    . ARG C 1 96  ? 23.159  15.549  123.060 1.00 220.71 ? 75  ARG C CB    1 
ATOM   9307  C  CG    . ARG C 1 96  ? 24.057  14.509  122.479 1.00 212.84 ? 75  ARG C CG    1 
ATOM   9308  C  CD    . ARG C 1 96  ? 25.464  14.950  122.621 1.00 200.64 ? 75  ARG C CD    1 
ATOM   9309  N  NE    . ARG C 1 96  ? 25.683  15.295  124.013 1.00 203.95 ? 75  ARG C NE    1 
ATOM   9310  C  CZ    . ARG C 1 96  ? 26.546  14.656  124.781 1.00 214.93 ? 75  ARG C CZ    1 
ATOM   9311  N  NH1   . ARG C 1 96  ? 27.243  13.643  124.277 1.00 206.86 ? 75  ARG C NH1   1 
ATOM   9312  N  NH2   . ARG C 1 96  ? 26.702  15.018  126.044 1.00 229.36 ? 75  ARG C NH2   1 
ATOM   9313  N  N     . GLU C 1 97  ? 20.216  16.300  124.424 1.00 229.68 ? 76  GLU C N     1 
ATOM   9314  C  CA    . GLU C 1 97  ? 19.460  17.397  125.016 1.00 219.54 ? 76  GLU C CA    1 
ATOM   9315  C  C     . GLU C 1 97  ? 20.346  18.618  125.166 1.00 223.41 ? 76  GLU C C     1 
ATOM   9316  O  O     . GLU C 1 97  ? 19.851  19.754  125.219 1.00 211.66 ? 76  GLU C O     1 
ATOM   9317  C  CB    . GLU C 1 97  ? 18.886  16.985  126.367 1.00 185.14 ? 76  GLU C CB    1 
ATOM   9318  C  CG    . GLU C 1 97  ? 17.774  17.877  126.876 1.00 168.00 ? 76  GLU C CG    1 
ATOM   9319  C  CD    . GLU C 1 97  ? 17.496  17.630  128.333 1.00 191.25 ? 76  GLU C CD    1 
ATOM   9320  O  OE1   . GLU C 1 97  ? 18.476  17.523  129.098 1.00 207.58 ? 76  GLU C OE1   1 
ATOM   9321  O  OE2   . GLU C 1 97  ? 16.320  17.484  128.713 1.00 200.50 ? 76  GLU C OE2   1 
ATOM   9322  N  N     . GLY C 1 98  ? 21.660  18.395  125.254 1.00 205.34 ? 77  GLY C N     1 
ATOM   9323  C  CA    . GLY C 1 98  ? 22.571  19.502  125.444 1.00 216.65 ? 77  GLY C CA    1 
ATOM   9324  C  C     . GLY C 1 98  ? 22.720  20.360  124.205 1.00 207.09 ? 77  GLY C C     1 
ATOM   9325  O  O     . GLY C 1 98  ? 22.782  21.588  124.299 1.00 230.76 ? 77  GLY C O     1 
ATOM   9326  N  N     . LYS C 1 99  ? 22.730  19.739  123.027 1.00 187.70 ? 78  LYS C N     1 
ATOM   9327  C  CA    . LYS C 1 99  ? 22.951  20.525  121.822 1.00 165.51 ? 78  LYS C CA    1 
ATOM   9328  C  C     . LYS C 1 99  ? 21.692  21.225  121.340 1.00 188.39 ? 78  LYS C C     1 
ATOM   9329  O  O     . LYS C 1 99  ? 21.764  22.014  120.391 1.00 176.79 ? 78  LYS C O     1 
ATOM   9330  C  CB    . LYS C 1 99  ? 23.514  19.631  120.724 1.00 153.55 ? 78  LYS C CB    1 
ATOM   9331  C  CG    . LYS C 1 99  ? 24.817  19.012  121.129 1.00 158.05 ? 78  LYS C CG    1 
ATOM   9332  C  CD    . LYS C 1 99  ? 25.322  18.033  120.114 1.00 166.95 ? 78  LYS C CD    1 
ATOM   9333  C  CE    . LYS C 1 99  ? 26.693  17.533  120.515 1.00 161.64 ? 78  LYS C CE    1 
ATOM   9334  N  NZ    . LYS C 1 99  ? 26.989  16.218  119.886 1.00 168.24 ? 78  LYS C NZ    1 
ATOM   9335  N  N     . LEU C 1 100 ? 20.563  20.997  122.009 1.00 195.20 ? 79  LEU C N     1 
ATOM   9336  C  CA    . LEU C 1 100 ? 19.265  21.538  121.630 1.00 207.59 ? 79  LEU C CA    1 
ATOM   9337  C  C     . LEU C 1 100 ? 18.889  22.826  122.376 1.00 213.86 ? 79  LEU C C     1 
ATOM   9338  O  O     . LEU C 1 100 ? 17.716  23.215  122.356 1.00 205.77 ? 79  LEU C O     1 
ATOM   9339  C  CB    . LEU C 1 100 ? 18.182  20.473  121.828 1.00 196.34 ? 79  LEU C CB    1 
ATOM   9340  C  CG    . LEU C 1 100 ? 18.259  19.258  120.890 1.00 184.43 ? 79  LEU C CG    1 
ATOM   9341  C  CD1   . LEU C 1 100 ? 17.179  18.220  121.190 1.00 183.04 ? 79  LEU C CD1   1 
ATOM   9342  C  CD2   . LEU C 1 100 ? 18.218  19.678  119.440 1.00 178.02 ? 79  LEU C CD2   1 
ATOM   9343  N  N     . ALA C 1 101 ? 19.824  23.456  123.087 1.00 224.91 ? 80  ALA C N     1 
ATOM   9344  C  CA    . ALA C 1 101 ? 19.528  24.730  123.740 1.00 215.40 ? 80  ALA C CA    1 
ATOM   9345  C  C     . ALA C 1 101 ? 19.305  25.818  122.691 1.00 184.16 ? 80  ALA C C     1 
ATOM   9346  O  O     . ALA C 1 101 ? 20.132  26.012  121.794 1.00 165.31 ? 80  ALA C O     1 
ATOM   9347  C  CB    . ALA C 1 101 ? 20.658  25.128  124.693 1.00 218.87 ? 80  ALA C CB    1 
ATOM   9348  N  N     . TYR C 1 102 ? 18.179  26.521  122.796 1.00 171.07 ? 81  TYR C N     1 
ATOM   9349  C  CA    . TYR C 1 102 ? 17.875  27.625  121.896 1.00 180.30 ? 81  TYR C CA    1 
ATOM   9350  C  C     . TYR C 1 102 ? 17.249  28.752  122.698 1.00 180.01 ? 81  TYR C C     1 
ATOM   9351  O  O     . TYR C 1 102 ? 16.468  28.506  123.622 1.00 192.82 ? 81  TYR C O     1 
ATOM   9352  C  CB    . TYR C 1 102 ? 16.916  27.225  120.773 1.00 206.32 ? 81  TYR C CB    1 
ATOM   9353  C  CG    . TYR C 1 102 ? 17.460  26.195  119.809 1.00 228.42 ? 81  TYR C CG    1 
ATOM   9354  C  CD1   . TYR C 1 102 ? 17.029  24.876  119.870 1.00 236.73 ? 81  TYR C CD1   1 
ATOM   9355  C  CD2   . TYR C 1 102 ? 18.375  26.539  118.817 1.00 221.78 ? 81  TYR C CD2   1 
ATOM   9356  C  CE1   . TYR C 1 102 ? 17.508  23.917  118.989 1.00 218.42 ? 81  TYR C CE1   1 
ATOM   9357  C  CE2   . TYR C 1 102 ? 18.863  25.580  117.928 1.00 205.66 ? 81  TYR C CE2   1 
ATOM   9358  C  CZ    . TYR C 1 102 ? 18.418  24.273  118.022 1.00 189.25 ? 81  TYR C CZ    1 
ATOM   9359  O  OH    . TYR C 1 102 ? 18.875  23.306  117.163 1.00 153.89 ? 81  TYR C OH    1 
ATOM   9360  N  N     . ALA C 1 103 ? 17.602  29.989  122.348 1.00 173.43 ? 82  ALA C N     1 
ATOM   9361  C  CA    . ALA C 1 103 ? 17.121  31.125  123.125 1.00 191.96 ? 82  ALA C CA    1 
ATOM   9362  C  C     . ALA C 1 103 ? 15.630  31.373  122.910 1.00 198.43 ? 82  ALA C C     1 
ATOM   9363  O  O     . ALA C 1 103 ? 14.903  31.681  123.867 1.00 213.49 ? 82  ALA C O     1 
ATOM   9364  C  CB    . ALA C 1 103 ? 17.931  32.374  122.772 1.00 178.33 ? 82  ALA C CB    1 
ATOM   9365  N  N     . GLU C 1 104 ? 15.152  31.241  121.665 1.00 204.88 ? 83  GLU C N     1 
ATOM   9366  C  CA    . GLU C 1 104 ? 13.746  31.535  121.390 1.00 204.25 ? 83  GLU C CA    1 
ATOM   9367  C  C     . GLU C 1 104 ? 12.800  30.554  122.082 1.00 208.00 ? 83  GLU C C     1 
ATOM   9368  O  O     . GLU C 1 104 ? 11.651  30.899  122.368 1.00 193.30 ? 83  GLU C O     1 
ATOM   9369  C  CB    . GLU C 1 104 ? 13.468  31.570  119.880 1.00 205.49 ? 83  GLU C CB    1 
ATOM   9370  C  CG    . GLU C 1 104 ? 14.563  32.119  118.979 1.00 210.79 ? 83  GLU C CG    1 
ATOM   9371  C  CD    . GLU C 1 104 ? 15.493  31.043  118.461 1.00 210.92 ? 83  GLU C CD    1 
ATOM   9372  O  OE1   . GLU C 1 104 ? 15.006  29.959  118.076 1.00 202.08 ? 83  GLU C OE1   1 
ATOM   9373  O  OE2   . GLU C 1 104 ? 16.716  31.278  118.450 1.00 209.57 ? 83  GLU C OE2   1 
ATOM   9374  N  N     . ILE C 1 105 ? 13.251  29.331  122.358 1.00 209.25 ? 84  ILE C N     1 
ATOM   9375  C  CA    . ILE C 1 105 ? 12.367  28.330  122.947 1.00 213.76 ? 84  ILE C CA    1 
ATOM   9376  C  C     . ILE C 1 105 ? 12.476  28.249  124.456 1.00 209.58 ? 84  ILE C C     1 
ATOM   9377  O  O     . ILE C 1 105 ? 11.682  27.530  125.082 1.00 205.62 ? 84  ILE C O     1 
ATOM   9378  C  CB    . ILE C 1 105 ? 12.687  26.927  122.399 1.00 210.32 ? 84  ILE C CB    1 
ATOM   9379  C  CG1   . ILE C 1 105 ? 13.988  26.414  123.029 1.00 206.04 ? 84  ILE C CG1   1 
ATOM   9380  C  CG2   . ILE C 1 105 ? 12.820  26.966  120.895 1.00 211.08 ? 84  ILE C CG2   1 
ATOM   9381  C  CD1   . ILE C 1 105 ? 14.511  25.158  122.415 1.00 198.25 ? 84  ILE C CD1   1 
ATOM   9382  N  N     . GLY C 1 106 ? 13.383  29.003  125.069 1.00 208.52 ? 85  GLY C N     1 
ATOM   9383  C  CA    . GLY C 1 106 ? 13.635  28.817  126.485 1.00 220.39 ? 85  GLY C CA    1 
ATOM   9384  C  C     . GLY C 1 106 ? 14.327  27.504  126.820 1.00 230.06 ? 85  GLY C C     1 
ATOM   9385  O  O     . GLY C 1 106 ? 15.511  27.322  126.512 1.00 212.65 ? 85  GLY C O     1 
ATOM   9386  N  N     . ASP C 1 107 ? 13.597  26.603  127.486 1.00 225.04 ? 86  ASP C N     1 
ATOM   9387  C  CA    . ASP C 1 107 ? 14.124  25.344  128.011 1.00 234.94 ? 86  ASP C CA    1 
ATOM   9388  C  C     . ASP C 1 107 ? 13.934  24.176  127.044 1.00 231.63 ? 86  ASP C C     1 
ATOM   9389  O  O     . ASP C 1 107 ? 12.857  24.006  126.462 1.00 238.30 ? 86  ASP C O     1 
ATOM   9390  C  CB    . ASP C 1 107 ? 13.444  25.014  129.342 1.00 229.13 ? 86  ASP C CB    1 
ATOM   9391  C  CG    . ASP C 1 107 ? 14.193  23.961  130.145 1.00 225.27 ? 86  ASP C CG    1 
ATOM   9392  O  OD1   . ASP C 1 107 ? 14.090  23.994  131.395 1.00 238.51 ? 86  ASP C OD1   1 
ATOM   9393  O  OD2   . ASP C 1 107 ? 14.879  23.107  129.540 1.00 197.78 ? 86  ASP C OD2   1 
ATOM   9394  N  N     . THR C 1 108 ? 14.996  23.379  126.874 1.00 247.54 ? 87  THR C N     1 
ATOM   9395  C  CA    . THR C 1 108 ? 14.930  22.190  126.027 1.00 219.94 ? 87  THR C CA    1 
ATOM   9396  C  C     . THR C 1 108 ? 14.129  21.061  126.684 1.00 214.73 ? 87  THR C C     1 
ATOM   9397  O  O     . THR C 1 108 ? 13.275  20.439  126.039 1.00 197.62 ? 87  THR C O     1 
ATOM   9398  C  CB    . THR C 1 108 ? 16.350  21.720  125.688 1.00 208.69 ? 87  THR C CB    1 
ATOM   9399  O  OG1   . THR C 1 108 ? 17.098  22.797  125.101 1.00 206.40 ? 87  THR C OG1   1 
ATOM   9400  C  CG2   . THR C 1 108 ? 16.314  20.543  124.743 1.00 194.29 ? 87  THR C CG2   1 
ATOM   9401  N  N     . ARG C 1 109 ? 14.390  20.780  127.969 1.00 206.03 ? 88  ARG C N     1 
ATOM   9402  C  CA    . ARG C 1 109 ? 13.713  19.676  128.658 1.00 207.88 ? 88  ARG C CA    1 
ATOM   9403  C  C     . ARG C 1 109 ? 12.238  19.973  128.909 1.00 214.64 ? 88  ARG C C     1 
ATOM   9404  O  O     . ARG C 1 109 ? 11.408  19.057  128.901 1.00 217.37 ? 88  ARG C O     1 
ATOM   9405  C  CB    . ARG C 1 109 ? 14.411  19.371  129.985 1.00 215.19 ? 88  ARG C CB    1 
ATOM   9406  C  CG    . ARG C 1 109 ? 14.079  18.003  130.610 1.00 216.30 ? 88  ARG C CG    1 
ATOM   9407  C  CD    . ARG C 1 109 ? 14.888  17.769  131.901 1.00 226.15 ? 88  ARG C CD    1 
ATOM   9408  N  NE    . ARG C 1 109 ? 16.341  17.832  131.716 1.00 226.96 ? 88  ARG C NE    1 
ATOM   9409  C  CZ    . ARG C 1 109 ? 17.227  17.868  132.713 1.00 225.44 ? 88  ARG C CZ    1 
ATOM   9410  N  NH1   . ARG C 1 109 ? 16.824  17.859  133.980 1.00 199.82 ? 88  ARG C NH1   1 
ATOM   9411  N  NH2   . ARG C 1 109 ? 18.526  17.928  132.445 1.00 232.34 ? 88  ARG C NH2   1 
ATOM   9412  N  N     . ALA C 1 110 ? 11.904  21.236  129.193 1.00 224.94 ? 89  ALA C N     1 
ATOM   9413  C  CA    . ALA C 1 110 ? 10.514  21.621  129.434 1.00 207.73 ? 89  ALA C CA    1 
ATOM   9414  C  C     . ALA C 1 110 ? 9.675   21.552  128.165 1.00 204.64 ? 89  ALA C C     1 
ATOM   9415  O  O     . ALA C 1 110 ? 8.559   21.020  128.180 1.00 189.96 ? 89  ALA C O     1 
ATOM   9416  C  CB    . ALA C 1 110 ? 10.456  23.026  130.032 1.00 192.54 ? 89  ALA C CB    1 
ATOM   9417  N  N     . ALA C 1 111 ? 10.179  22.127  127.067 1.00 207.29 ? 90  ALA C N     1 
ATOM   9418  C  CA    . ALA C 1 111 ? 9.442   22.136  125.806 1.00 212.50 ? 90  ALA C CA    1 
ATOM   9419  C  C     . ALA C 1 111 ? 9.280   20.734  125.222 1.00 217.93 ? 90  ALA C C     1 
ATOM   9420  O  O     . ALA C 1 111 ? 8.301   20.471  124.513 1.00 212.71 ? 90  ALA C O     1 
ATOM   9421  C  CB    . ALA C 1 111 ? 10.131  23.056  124.799 1.00 212.17 ? 90  ALA C CB    1 
ATOM   9422  N  N     . VAL C 1 112 ? 10.224  19.827  125.503 1.00 227.14 ? 91  VAL C N     1 
ATOM   9423  C  CA    . VAL C 1 112 ? 10.200  18.489  124.908 1.00 224.05 ? 91  VAL C CA    1 
ATOM   9424  C  C     . VAL C 1 112 ? 9.178   17.577  125.567 1.00 229.08 ? 91  VAL C C     1 
ATOM   9425  O  O     . VAL C 1 112 ? 8.891   16.493  125.041 1.00 218.72 ? 91  VAL C O     1 
ATOM   9426  C  CB    . VAL C 1 112 ? 11.584  17.815  125.009 1.00 211.11 ? 91  VAL C CB    1 
ATOM   9427  C  CG1   . VAL C 1 112 ? 11.781  17.243  126.395 1.00 202.45 ? 91  VAL C CG1   1 
ATOM   9428  C  CG2   . VAL C 1 112 ? 11.746  16.719  123.956 1.00 214.04 ? 91  VAL C CG2   1 
ATOM   9429  N  N     . GLN C 1 113 ? 8.630   17.982  126.716 1.00 223.95 ? 92  GLN C N     1 
ATOM   9430  C  CA    . GLN C 1 113 ? 7.679   17.126  127.423 1.00 221.79 ? 92  GLN C CA    1 
ATOM   9431  C  C     . GLN C 1 113 ? 6.354   16.971  126.680 1.00 237.77 ? 92  GLN C C     1 
ATOM   9432  O  O     . GLN C 1 113 ? 5.935   15.820  126.463 1.00 248.77 ? 92  GLN C O     1 
ATOM   9433  C  CB    . GLN C 1 113 ? 7.509   17.627  128.860 1.00 201.91 ? 92  GLN C CB    1 
ATOM   9434  C  CG    . GLN C 1 113 ? 8.782   17.487  129.702 1.00 203.16 ? 92  GLN C CG    1 
ATOM   9435  C  CD    . GLN C 1 113 ? 8.610   17.955  131.146 1.00 225.02 ? 92  GLN C CD    1 
ATOM   9436  O  OE1   . GLN C 1 113 ? 8.720   19.145  131.434 1.00 235.74 ? 92  GLN C OE1   1 
ATOM   9437  N  NE2   . GLN C 1 113 ? 8.349   17.018  132.058 1.00 219.70 ? 92  GLN C NE2   1 
ATOM   9438  N  N     . PRO C 1 114 ? 5.642   18.035  126.271 1.00 234.99 ? 93  PRO C N     1 
ATOM   9439  C  CA    . PRO C 1 114 ? 4.366   17.816  125.558 1.00 235.22 ? 93  PRO C CA    1 
ATOM   9440  C  C     . PRO C 1 114 ? 4.526   17.052  124.254 1.00 241.09 ? 93  PRO C C     1 
ATOM   9441  O  O     . PRO C 1 114 ? 3.538   16.501  123.749 1.00 235.11 ? 93  PRO C O     1 
ATOM   9442  C  CB    . PRO C 1 114 ? 3.838   19.239  125.307 1.00 220.08 ? 93  PRO C CB    1 
ATOM   9443  C  CG    . PRO C 1 114 ? 4.561   20.101  126.256 1.00 217.57 ? 93  PRO C CG    1 
ATOM   9444  C  CD    . PRO C 1 114 ? 5.914   19.474  126.437 1.00 226.03 ? 93  PRO C CD    1 
ATOM   9445  N  N     . LEU C 1 115 ? 5.738   17.022  123.688 1.00 242.24 ? 94  LEU C N     1 
ATOM   9446  C  CA    . LEU C 1 115 ? 6.020   16.223  122.501 1.00 242.14 ? 94  LEU C CA    1 
ATOM   9447  C  C     . LEU C 1 115 ? 6.235   14.743  122.825 1.00 238.87 ? 94  LEU C C     1 
ATOM   9448  O  O     . LEU C 1 115 ? 5.776   13.876  122.072 1.00 227.87 ? 94  LEU C O     1 
ATOM   9449  C  CB    . LEU C 1 115 ? 7.248   16.793  121.782 1.00 240.10 ? 94  LEU C CB    1 
ATOM   9450  C  CG    . LEU C 1 115 ? 7.213   18.271  121.376 1.00 227.80 ? 94  LEU C CG    1 
ATOM   9451  C  CD1   . LEU C 1 115 ? 8.492   18.682  120.642 1.00 196.46 ? 94  LEU C CD1   1 
ATOM   9452  C  CD2   . LEU C 1 115 ? 5.983   18.568  120.541 1.00 224.14 ? 94  LEU C CD2   1 
ATOM   9453  N  N     . LEU C 1 116 ? 6.915   14.429  123.936 1.00 237.79 ? 95  LEU C N     1 
ATOM   9454  C  CA    . LEU C 1 116 ? 7.101   13.028  124.317 1.00 234.22 ? 95  LEU C CA    1 
ATOM   9455  C  C     . LEU C 1 116 ? 5.769   12.354  124.640 1.00 247.51 ? 95  LEU C C     1 
ATOM   9456  O  O     . LEU C 1 116 ? 5.607   11.151  124.401 1.00 261.15 ? 95  LEU C O     1 
ATOM   9457  C  CB    . LEU C 1 116 ? 8.067   12.922  125.502 1.00 227.20 ? 95  LEU C CB    1 
ATOM   9458  C  CG    . LEU C 1 116 ? 8.322   11.539  126.119 1.00 239.35 ? 95  LEU C CG    1 
ATOM   9459  C  CD1   . LEU C 1 116 ? 9.295   10.722  125.301 1.00 229.29 ? 95  LEU C CD1   1 
ATOM   9460  C  CD2   . LEU C 1 116 ? 8.813   11.649  127.558 1.00 247.54 ? 95  LEU C CD2   1 
ATOM   9461  N  N     . ALA C 1 117 ? 4.806   13.115  125.177 1.00 253.22 ? 96  ALA C N     1 
ATOM   9462  C  CA    . ALA C 1 117 ? 3.505   12.559  125.545 1.00 242.16 ? 96  ALA C CA    1 
ATOM   9463  C  C     . ALA C 1 117 ? 2.669   12.194  124.322 1.00 236.20 ? 96  ALA C C     1 
ATOM   9464  O  O     . ALA C 1 117 ? 1.871   11.250  124.381 1.00 217.29 ? 96  ALA C O     1 
ATOM   9465  C  CB    . ALA C 1 117 ? 2.753   13.545  126.437 1.00 243.76 ? 96  ALA C CB    1 
ATOM   9466  N  N     . LEU C 1 118 ? 2.811   12.945  123.222 1.00 248.99 ? 97  LEU C N     1 
ATOM   9467  C  CA    . LEU C 1 118 ? 2.138   12.665  121.953 1.00 247.44 ? 97  LEU C CA    1 
ATOM   9468  C  C     . LEU C 1 118 ? 2.831   11.581  121.123 1.00 248.23 ? 97  LEU C C     1 
ATOM   9469  O  O     . LEU C 1 118 ? 2.340   11.244  120.040 1.00 232.22 ? 97  LEU C O     1 
ATOM   9470  C  CB    . LEU C 1 118 ? 2.007   13.958  121.132 1.00 224.49 ? 97  LEU C CB    1 
ATOM   9471  C  CG    . LEU C 1 118 ? 0.956   14.982  121.586 1.00 209.20 ? 97  LEU C CG    1 
ATOM   9472  C  CD1   . LEU C 1 118 ? 1.435   16.395  121.357 1.00 199.68 ? 97  LEU C CD1   1 
ATOM   9473  C  CD2   . LEU C 1 118 ? -0.351  14.774  120.860 1.00 203.59 ? 97  LEU C CD2   1 
ATOM   9474  N  N     . GLY C 1 119 ? 3.953   11.040  121.597 1.00 241.70 ? 98  GLY C N     1 
ATOM   9475  C  CA    . GLY C 1 119 ? 4.742   10.058  120.875 1.00 242.62 ? 98  GLY C CA    1 
ATOM   9476  C  C     . GLY C 1 119 ? 5.511   10.571  119.680 1.00 239.69 ? 98  GLY C C     1 
ATOM   9477  O  O     . GLY C 1 119 ? 6.120   9.768   118.963 1.00 241.75 ? 98  GLY C O     1 
ATOM   9478  N  N     . TRP C 1 120 ? 5.501   11.883  119.439 1.00 240.95 ? 99  TRP C N     1 
ATOM   9479  C  CA    . TRP C 1 120 ? 6.256   12.481  118.343 1.00 224.08 ? 99  TRP C CA    1 
ATOM   9480  C  C     . TRP C 1 120 ? 7.740   12.631  118.666 1.00 234.53 ? 99  TRP C C     1 
ATOM   9481  O  O     . TRP C 1 120 ? 8.555   12.738  117.744 1.00 217.19 ? 99  TRP C O     1 
ATOM   9482  C  CB    . TRP C 1 120 ? 5.646   13.838  117.984 1.00 217.44 ? 99  TRP C CB    1 
ATOM   9483  C  CG    . TRP C 1 120 ? 4.238   13.720  117.498 1.00 220.90 ? 99  TRP C CG    1 
ATOM   9484  C  CD1   . TRP C 1 120 ? 3.585   12.568  117.170 1.00 234.00 ? 99  TRP C CD1   1 
ATOM   9485  C  CD2   . TRP C 1 120 ? 3.276   14.778  117.368 1.00 226.16 ? 99  TRP C CD2   1 
ATOM   9486  N  NE1   . TRP C 1 120 ? 2.290   12.845  116.805 1.00 247.49 ? 99  TRP C NE1   1 
ATOM   9487  C  CE2   . TRP C 1 120 ? 2.073   14.193  116.921 1.00 239.80 ? 99  TRP C CE2   1 
ATOM   9488  C  CE3   . TRP C 1 120 ? 3.319   16.162  117.568 1.00 220.82 ? 99  TRP C CE3   1 
ATOM   9489  C  CZ2   . TRP C 1 120 ? 0.926   14.945  116.671 1.00 237.13 ? 99  TRP C CZ2   1 
ATOM   9490  C  CZ3   . TRP C 1 120 ? 2.175   16.904  117.320 1.00 220.34 ? 99  TRP C CZ3   1 
ATOM   9491  C  CH2   . TRP C 1 120 ? 0.996   16.292  116.889 1.00 228.17 ? 99  TRP C CH2   1 
ATOM   9492  N  N     . VAL C 1 121 ? 8.110   12.641  119.944 1.00 230.17 ? 100 VAL C N     1 
ATOM   9493  C  CA    . VAL C 1 121 ? 9.507   12.653  120.368 1.00 243.06 ? 100 VAL C CA    1 
ATOM   9494  C  C     . VAL C 1 121 ? 9.692   11.534  121.382 1.00 250.52 ? 100 VAL C C     1 
ATOM   9495  O  O     . VAL C 1 121 ? 8.991   11.488  122.401 1.00 255.42 ? 100 VAL C O     1 
ATOM   9496  C  CB    . VAL C 1 121 ? 9.923   14.010  120.965 1.00 239.41 ? 100 VAL C CB    1 
ATOM   9497  C  CG1   . VAL C 1 121 ? 11.254  13.895  121.688 1.00 245.06 ? 100 VAL C CG1   1 
ATOM   9498  C  CG2   . VAL C 1 121 ? 10.023  15.073  119.871 1.00 218.41 ? 100 VAL C CG2   1 
ATOM   9499  N  N     . ASP C 1 122 ? 10.623  10.630  121.092 1.00 255.26 ? 101 ASP C N     1 
ATOM   9500  C  CA    . ASP C 1 122 ? 10.952  9.500   121.949 1.00 240.64 ? 101 ASP C CA    1 
ATOM   9501  C  C     . ASP C 1 122 ? 12.136  9.854   122.847 1.00 228.76 ? 101 ASP C C     1 
ATOM   9502  O  O     . ASP C 1 122 ? 13.128  10.414  122.381 1.00 229.91 ? 101 ASP C O     1 
ATOM   9503  C  CB    . ASP C 1 122 ? 11.275  8.293   121.064 1.00 240.14 ? 101 ASP C CB    1 
ATOM   9504  C  CG    . ASP C 1 122 ? 10.601  7.027   121.519 1.00 237.72 ? 101 ASP C CG    1 
ATOM   9505  O  OD1   . ASP C 1 122 ? 10.067  7.002   122.647 1.00 237.28 ? 101 ASP C OD1   1 
ATOM   9506  O  OD2   . ASP C 1 122 ? 10.592  6.066   120.715 1.00 236.74 ? 101 ASP C OD2   1 
ATOM   9507  N  N     . ALA C 1 123 ? 12.043  9.516   124.127 1.00 238.92 ? 102 ALA C N     1 
ATOM   9508  C  CA    . ALA C 1 123 ? 13.221  9.440   124.977 1.00 204.36 ? 102 ALA C CA    1 
ATOM   9509  C  C     . ALA C 1 123 ? 13.616  7.984   125.198 1.00 213.15 ? 102 ALA C C     1 
ATOM   9510  O  O     . ALA C 1 123 ? 12.911  7.057   124.793 1.00 199.63 ? 102 ALA C O     1 
ATOM   9511  C  CB    . ALA C 1 123 ? 12.962  10.139  126.314 1.00 190.96 ? 102 ALA C CB    1 
ATOM   9512  N  N     . GLN C 1 124 ? 14.764  7.796   125.858 1.00 205.09 ? 103 GLN C N     1 
ATOM   9513  C  CA    . GLN C 1 124 ? 15.421  6.501   126.045 1.00 225.00 ? 103 GLN C CA    1 
ATOM   9514  C  C     . GLN C 1 124 ? 15.185  5.551   124.873 1.00 226.55 ? 103 GLN C C     1 
ATOM   9515  O  O     . GLN C 1 124 ? 14.633  4.458   125.056 1.00 232.13 ? 103 GLN C O     1 
ATOM   9516  C  CB    . GLN C 1 124 ? 14.949  5.854   127.349 1.00 232.51 ? 103 GLN C CB    1 
ATOM   9517  C  CG    . GLN C 1 124 ? 15.154  6.725   128.580 1.00 229.06 ? 103 GLN C CG    1 
ATOM   9518  C  CD    . GLN C 1 124 ? 15.760  5.958   129.728 1.00 228.94 ? 103 GLN C CD    1 
ATOM   9519  O  OE1   . GLN C 1 124 ? 16.194  4.821   129.561 1.00 238.40 ? 103 GLN C OE1   1 
ATOM   9520  N  NE2   . GLN C 1 124 ? 15.794  6.574   130.903 1.00 227.08 ? 103 GLN C NE2   1 
ATOM   9521  N  N     . PRO C 1 125 ? 15.579  5.925   123.668 1.00 223.32 ? 104 PRO C N     1 
ATOM   9522  C  CA    . PRO C 1 125 ? 15.378  5.039   122.515 1.00 220.27 ? 104 PRO C CA    1 
ATOM   9523  C  C     . PRO C 1 125 ? 16.299  3.830   122.493 1.00 233.96 ? 104 PRO C C     1 
ATOM   9524  O  O     . PRO C 1 125 ? 17.088  3.626   123.418 1.00 245.44 ? 104 PRO C O     1 
ATOM   9525  C  CB    . PRO C 1 125 ? 15.665  5.969   121.337 1.00 212.39 ? 104 PRO C CB    1 
ATOM   9526  C  CG    . PRO C 1 125 ? 16.763  6.836   121.873 1.00 207.93 ? 104 PRO C CG    1 
ATOM   9527  C  CD    . PRO C 1 125 ? 16.415  7.087   123.319 1.00 213.61 ? 104 PRO C CD    1 
ATOM   9528  N  N     . THR C 1 126 ? 16.187  3.012   121.450 1.00 236.24 ? 105 THR C N     1 
ATOM   9529  C  CA    . THR C 1 126 ? 17.053  1.856   121.248 1.00 231.95 ? 105 THR C CA    1 
ATOM   9530  C  C     . THR C 1 126 ? 18.131  2.218   120.231 1.00 201.37 ? 105 THR C C     1 
ATOM   9531  O  O     . THR C 1 126 ? 17.811  2.601   119.105 1.00 191.58 ? 105 THR C O     1 
ATOM   9532  C  CB    . THR C 1 126 ? 16.235  0.657   120.768 1.00 231.99 ? 105 THR C CB    1 
ATOM   9533  O  OG1   . THR C 1 126 ? 15.191  0.390   121.715 1.00 248.91 ? 105 THR C OG1   1 
ATOM   9534  C  CG2   . THR C 1 126 ? 17.116  -0.573  120.603 1.00 217.31 ? 105 THR C CG2   1 
ATOM   9535  N  N     . LEU C 1 127 ? 19.399  2.087   120.621 1.00 196.85 ? 106 LEU C N     1 
ATOM   9536  C  CA    . LEU C 1 127 ? 20.531  2.473   119.782 1.00 218.92 ? 106 LEU C CA    1 
ATOM   9537  C  C     . LEU C 1 127 ? 21.487  1.308   119.558 1.00 242.79 ? 106 LEU C C     1 
ATOM   9538  O  O     . LEU C 1 127 ? 21.931  0.677   120.522 1.00 263.08 ? 106 LEU C O     1 
ATOM   9539  C  CB    . LEU C 1 127 ? 21.297  3.653   120.389 1.00 213.27 ? 106 LEU C CB    1 
ATOM   9540  C  CG    . LEU C 1 127 ? 20.563  4.982   120.575 1.00 202.46 ? 106 LEU C CG    1 
ATOM   9541  C  CD1   . LEU C 1 127 ? 19.901  5.089   121.944 1.00 182.13 ? 106 LEU C CD1   1 
ATOM   9542  C  CD2   . LEU C 1 127 ? 21.526  6.141   120.320 1.00 201.26 ? 106 LEU C CD2   1 
ATOM   9543  N  N     . GLU C 1 128 ? 21.792  1.015   118.292 1.00 236.42 ? 107 GLU C N     1 
ATOM   9544  C  CA    . GLU C 1 128 ? 22.888  0.102   117.997 1.00 229.68 ? 107 GLU C CA    1 
ATOM   9545  C  C     . GLU C 1 128 ? 24.238  0.760   118.292 1.00 235.67 ? 107 GLU C C     1 
ATOM   9546  O  O     . GLU C 1 128 ? 24.351  1.982   118.441 1.00 215.98 ? 107 GLU C O     1 
ATOM   9547  C  CB    . GLU C 1 128 ? 22.863  -0.374  116.544 1.00 214.00 ? 107 GLU C CB    1 
ATOM   9548  C  CG    . GLU C 1 128 ? 23.699  -1.635  116.370 1.00 220.47 ? 107 GLU C CG    1 
ATOM   9549  C  CD    . GLU C 1 128 ? 23.872  -2.055  114.949 1.00 230.32 ? 107 GLU C CD    1 
ATOM   9550  O  OE1   . GLU C 1 128 ? 23.016  -1.703  114.117 1.00 236.90 ? 107 GLU C OE1   1 
ATOM   9551  O  OE2   . GLU C 1 128 ? 24.875  -2.741  114.671 1.00 238.08 ? 107 GLU C OE2   1 
ATOM   9552  N  N     . LEU C 1 129 ? 25.266  -0.087  118.418 1.00 238.48 ? 108 LEU C N     1 
ATOM   9553  C  CA    . LEU C 1 129 ? 26.614  0.383   118.720 1.00 233.36 ? 108 LEU C CA    1 
ATOM   9554  C  C     . LEU C 1 129 ? 27.076  1.412   117.694 1.00 209.34 ? 108 LEU C C     1 
ATOM   9555  O  O     . LEU C 1 129 ? 27.768  2.378   118.038 1.00 207.41 ? 108 LEU C O     1 
ATOM   9556  C  CB    . LEU C 1 129 ? 27.574  -0.802  118.768 1.00 245.90 ? 108 LEU C CB    1 
ATOM   9557  C  CG    . LEU C 1 129 ? 29.019  -0.443  119.079 1.00 249.29 ? 108 LEU C CG    1 
ATOM   9558  C  CD1   . LEU C 1 129 ? 29.079  0.222   120.446 1.00 253.54 ? 108 LEU C CD1   1 
ATOM   9559  C  CD2   . LEU C 1 129 ? 29.871  -1.683  119.049 1.00 258.41 ? 108 LEU C CD2   1 
ATOM   9560  N  N     . ALA C 1 130 ? 26.750  1.188   116.417 1.00 219.26 ? 109 ALA C N     1 
ATOM   9561  C  CA    . ALA C 1 130 ? 27.107  2.144   115.371 1.00 203.88 ? 109 ALA C CA    1 
ATOM   9562  C  C     . ALA C 1 130 ? 26.398  3.489   115.571 1.00 219.33 ? 109 ALA C C     1 
ATOM   9563  O  O     . ALA C 1 130 ? 26.898  4.530   115.123 1.00 138.92 ? 109 ALA C O     1 
ATOM   9564  C  CB    . ALA C 1 130 ? 26.788  1.550   114.000 1.00 188.31 ? 109 ALA C CB    1 
ATOM   9565  N  N     . GLN C 1 131 ? 25.188  3.470   116.151 1.00 228.19 ? 110 GLN C N     1 
ATOM   9566  C  CA    . GLN C 1 131 ? 24.441  4.699   116.436 1.00 230.08 ? 110 GLN C CA    1 
ATOM   9567  C  C     . GLN C 1 131 ? 25.044  5.464   117.612 1.00 226.69 ? 110 GLN C C     1 
ATOM   9568  O  O     . GLN C 1 131 ? 25.037  6.700   117.625 1.00 232.56 ? 110 GLN C O     1 
ATOM   9569  C  CB    . GLN C 1 131 ? 22.966  4.371   116.693 1.00 225.18 ? 110 GLN C CB    1 
ATOM   9570  C  CG    . GLN C 1 131 ? 22.194  4.025   115.415 1.00 213.34 ? 110 GLN C CG    1 
ATOM   9571  C  CD    . GLN C 1 131 ? 20.776  3.519   115.658 1.00 196.84 ? 110 GLN C CD    1 
ATOM   9572  O  OE1   . GLN C 1 131 ? 20.444  3.038   116.733 1.00 191.56 ? 110 GLN C OE1   1 
ATOM   9573  N  NE2   . GLN C 1 131 ? 19.937  3.630   114.642 1.00 203.56 ? 110 GLN C NE2   1 
ATOM   9574  N  N     . LEU C 1 132 ? 25.531  4.743   118.626 1.00 227.53 ? 111 LEU C N     1 
ATOM   9575  C  CA    . LEU C 1 132 ? 26.207  5.378   119.753 1.00 213.85 ? 111 LEU C CA    1 
ATOM   9576  C  C     . LEU C 1 132 ? 27.418  6.201   119.328 1.00 224.63 ? 111 LEU C C     1 
ATOM   9577  O  O     . LEU C 1 132 ? 27.746  7.203   119.973 1.00 231.58 ? 111 LEU C O     1 
ATOM   9578  C  CB    . LEU C 1 132 ? 26.677  4.316   120.744 1.00 208.25 ? 111 LEU C CB    1 
ATOM   9579  C  CG    . LEU C 1 132 ? 27.243  4.865   122.062 1.00 190.78 ? 111 LEU C CG    1 
ATOM   9580  C  CD1   . LEU C 1 132 ? 26.168  5.447   122.981 1.00 179.69 ? 111 LEU C CD1   1 
ATOM   9581  C  CD2   . LEU C 1 132 ? 28.122  3.840   122.768 1.00 174.50 ? 111 LEU C CD2   1 
ATOM   9582  N  N     . PHE C 1 133 ? 28.104  5.793   118.265 1.00 208.48 ? 112 PHE C N     1 
ATOM   9583  C  CA    . PHE C 1 133 ? 29.333  6.468   117.867 1.00 220.03 ? 112 PHE C CA    1 
ATOM   9584  C  C     . PHE C 1 133 ? 29.118  7.873   117.311 1.00 215.61 ? 112 PHE C C     1 
ATOM   9585  O  O     . PHE C 1 133 ? 30.080  8.646   117.247 1.00 212.45 ? 112 PHE C O     1 
ATOM   9586  C  CB    . PHE C 1 133 ? 30.065  5.602   116.850 1.00 219.88 ? 112 PHE C CB    1 
ATOM   9587  C  CG    . PHE C 1 133 ? 31.046  4.661   117.473 1.00 213.35 ? 112 PHE C CG    1 
ATOM   9588  C  CD1   . PHE C 1 133 ? 30.638  3.796   118.471 1.00 188.22 ? 112 PHE C CD1   1 
ATOM   9589  C  CD2   . PHE C 1 133 ? 32.370  4.632   117.057 1.00 205.34 ? 112 PHE C CD2   1 
ATOM   9590  C  CE1   . PHE C 1 133 ? 31.527  2.930   119.043 1.00 188.49 ? 112 PHE C CE1   1 
ATOM   9591  C  CE2   . PHE C 1 133 ? 33.268  3.764   117.631 1.00 192.62 ? 112 PHE C CE2   1 
ATOM   9592  C  CZ    . PHE C 1 133 ? 32.845  2.907   118.621 1.00 192.63 ? 112 PHE C CZ    1 
ATOM   9593  N  N     . GLY C 1 134 ? 27.900  8.227   116.914 1.00 222.66 ? 113 GLY C N     1 
ATOM   9594  C  CA    . GLY C 1 134 ? 27.626  9.579   116.463 1.00 216.41 ? 113 GLY C CA    1 
ATOM   9595  C  C     . GLY C 1 134 ? 27.462  10.577  117.593 1.00 207.69 ? 113 GLY C C     1 
ATOM   9596  O  O     . GLY C 1 134 ? 27.932  11.716  117.514 1.00 217.69 ? 113 GLY C O     1 
ATOM   9597  N  N     . LEU C 1 135 ? 26.762  10.167  118.643 1.00 200.76 ? 114 LEU C N     1 
ATOM   9598  C  CA    . LEU C 1 135 ? 26.397  11.101  119.700 1.00 214.30 ? 114 LEU C CA    1 
ATOM   9599  C  C     . LEU C 1 135 ? 27.589  11.489  120.578 1.00 251.47 ? 114 LEU C C     1 
ATOM   9600  O  O     . LEU C 1 135 ? 27.631  12.612  121.098 1.00 265.02 ? 114 LEU C O     1 
ATOM   9601  C  CB    . LEU C 1 135 ? 25.269  10.505  120.533 1.00 194.60 ? 114 LEU C CB    1 
ATOM   9602  C  CG    . LEU C 1 135 ? 23.949  10.527  119.770 1.00 167.64 ? 114 LEU C CG    1 
ATOM   9603  C  CD1   . LEU C 1 135 ? 23.010  9.454   120.260 1.00 160.76 ? 114 LEU C CD1   1 
ATOM   9604  C  CD2   . LEU C 1 135 ? 23.331  11.890  119.943 1.00 174.91 ? 114 LEU C CD2   1 
ATOM   9605  N  N     . LEU C 1 136 ? 28.535  10.566  120.800 1.00 247.16 ? 115 LEU C N     1 
ATOM   9606  C  CA    . LEU C 1 136 ? 29.602  10.719  121.788 1.00 223.63 ? 115 LEU C CA    1 
ATOM   9607  C  C     . LEU C 1 136 ? 30.970  11.050  121.182 1.00 239.79 ? 115 LEU C C     1 
ATOM   9608  O  O     . LEU C 1 136 ? 31.293  10.647  120.059 1.00 215.50 ? 115 LEU C O     1 
ATOM   9609  C  CB    . LEU C 1 136 ? 29.718  9.453   122.629 1.00 205.21 ? 115 LEU C CB    1 
ATOM   9610  C  CG    . LEU C 1 136 ? 28.422  9.105   123.343 1.00 205.28 ? 115 LEU C CG    1 
ATOM   9611  C  CD1   . LEU C 1 136 ? 28.670  8.032   124.398 1.00 222.93 ? 115 LEU C CD1   1 
ATOM   9612  C  CD2   . LEU C 1 136 ? 27.813  10.359  123.947 1.00 204.36 ? 115 LEU C CD2   1 
ATOM   9613  N  N     . LYS C 1 137 ? 31.795  11.743  121.982 1.00 229.63 ? 116 LYS C N     1 
ATOM   9614  C  CA    . LYS C 1 137 ? 33.186  12.040  121.639 1.00 246.98 ? 116 LYS C CA    1 
ATOM   9615  C  C     . LYS C 1 137 ? 34.019  10.757  121.609 1.00 256.70 ? 116 LYS C C     1 
ATOM   9616  O  O     . LYS C 1 137 ? 33.630  9.716   122.149 1.00 283.18 ? 116 LYS C O     1 
ATOM   9617  C  CB    . LYS C 1 137 ? 33.837  12.997  122.662 1.00 244.84 ? 116 LYS C CB    1 
ATOM   9618  C  CG    . LYS C 1 137 ? 33.399  14.479  122.687 1.00 236.51 ? 116 LYS C CG    1 
ATOM   9619  C  CD    . LYS C 1 137 ? 34.013  15.227  123.904 1.00 219.25 ? 116 LYS C CD    1 
ATOM   9620  C  CE    . LYS C 1 137 ? 34.081  16.761  123.724 1.00 202.35 ? 116 LYS C CE    1 
ATOM   9621  N  NZ    . LYS C 1 137 ? 35.219  17.282  122.903 1.00 189.60 ? 116 LYS C NZ    1 
ATOM   9622  N  N     . LYS C 1 138 ? 35.180  10.835  120.949 1.00 267.18 ? 117 LYS C N     1 
ATOM   9623  C  CA    . LYS C 1 138 ? 36.143  9.740   121.039 1.00 231.19 ? 117 LYS C CA    1 
ATOM   9624  C  C     . LYS C 1 138 ? 36.735  9.645   122.445 1.00 230.02 ? 117 LYS C C     1 
ATOM   9625  O  O     . LYS C 1 138 ? 37.077  8.546   122.898 1.00 205.64 ? 117 LYS C O     1 
ATOM   9626  C  CB    . LYS C 1 138 ? 37.232  9.911   119.983 1.00 182.69 ? 117 LYS C CB    1 
ATOM   9627  C  CG    . LYS C 1 138 ? 38.204  8.763   119.889 1.00 167.08 ? 117 LYS C CG    1 
ATOM   9628  C  CD    . LYS C 1 138 ? 38.855  8.763   118.528 1.00 173.39 ? 117 LYS C CD    1 
ATOM   9629  C  CE    . LYS C 1 138 ? 40.171  8.013   118.523 1.00 170.25 ? 117 LYS C CE    1 
ATOM   9630  N  NZ    . LYS C 1 138 ? 40.851  8.113   117.194 1.00 153.29 ? 117 LYS C NZ    1 
ATOM   9631  N  N     . ASP C 1 139 ? 36.861  10.782  123.143 1.00 219.98 ? 118 ASP C N     1 
ATOM   9632  C  CA    . ASP C 1 139 ? 37.240  10.757  124.555 1.00 244.72 ? 118 ASP C CA    1 
ATOM   9633  C  C     . ASP C 1 139 ? 36.229  9.950   125.365 1.00 265.71 ? 118 ASP C C     1 
ATOM   9634  O  O     . ASP C 1 139 ? 36.604  9.024   126.093 1.00 282.71 ? 118 ASP C O     1 
ATOM   9635  C  CB    . ASP C 1 139 ? 37.380  12.186  125.113 1.00 239.19 ? 118 ASP C CB    1 
ATOM   9636  C  CG    . ASP C 1 139 ? 37.901  12.222  126.578 1.00 234.25 ? 118 ASP C CG    1 
ATOM   9637  O  OD1   . ASP C 1 139 ? 37.674  13.231  127.286 1.00 214.69 ? 118 ASP C OD1   1 
ATOM   9638  O  OD2   . ASP C 1 139 ? 38.542  11.249  127.031 1.00 234.66 ? 118 ASP C OD2   1 
ATOM   9639  N  N     . GLU C 1 140 ? 34.936  10.290  125.254 1.00 261.98 ? 119 GLU C N     1 
ATOM   9640  C  CA    . GLU C 1 140 ? 33.910  9.593   126.035 1.00 265.45 ? 119 GLU C CA    1 
ATOM   9641  C  C     . GLU C 1 140 ? 33.845  8.109   125.695 1.00 252.74 ? 119 GLU C C     1 
ATOM   9642  O  O     . GLU C 1 140 ? 33.579  7.279   126.573 1.00 266.81 ? 119 GLU C O     1 
ATOM   9643  C  CB    . GLU C 1 140 ? 32.532  10.225  125.830 1.00 258.24 ? 119 GLU C CB    1 
ATOM   9644  C  CG    . GLU C 1 140 ? 32.466  11.727  125.941 1.00 247.17 ? 119 GLU C CG    1 
ATOM   9645  C  CD    . GLU C 1 140 ? 31.050  12.227  125.799 1.00 230.03 ? 119 GLU C CD    1 
ATOM   9646  O  OE1   . GLU C 1 140 ? 30.251  12.004  126.738 1.00 224.36 ? 119 GLU C OE1   1 
ATOM   9647  O  OE2   . GLU C 1 140 ? 30.736  12.816  124.740 1.00 212.78 ? 119 GLU C OE2   1 
ATOM   9648  N  N     . LEU C 1 141 ? 34.002  7.760   124.415 1.00 265.11 ? 120 LEU C N     1 
ATOM   9649  C  CA    . LEU C 1 141 ? 33.932  6.351   124.042 1.00 246.57 ? 120 LEU C CA    1 
ATOM   9650  C  C     . LEU C 1 141 ? 35.158  5.582   124.540 1.00 261.79 ? 120 LEU C C     1 
ATOM   9651  O  O     . LEU C 1 141 ? 35.020  4.470   125.062 1.00 277.67 ? 120 LEU C O     1 
ATOM   9652  C  CB    . LEU C 1 141 ? 33.735  6.205   122.526 1.00 222.77 ? 120 LEU C CB    1 
ATOM   9653  C  CG    . LEU C 1 141 ? 32.290  6.458   122.039 1.00 205.03 ? 120 LEU C CG    1 
ATOM   9654  C  CD1   . LEU C 1 141 ? 32.158  6.501   120.526 1.00 176.75 ? 120 LEU C CD1   1 
ATOM   9655  C  CD2   . LEU C 1 141 ? 31.318  5.444   122.618 1.00 208.48 ? 120 LEU C CD2   1 
ATOM   9656  N  N     . SER C 1 142 ? 36.361  6.156   124.404 1.00 250.13 ? 121 SER C N     1 
ATOM   9657  C  CA    . SER C 1 142 ? 37.574  5.475   124.871 1.00 250.33 ? 121 SER C CA    1 
ATOM   9658  C  C     . SER C 1 142 ? 37.521  5.169   126.369 1.00 276.00 ? 121 SER C C     1 
ATOM   9659  O  O     . SER C 1 142 ? 37.825  4.047   126.795 1.00 284.19 ? 121 SER C O     1 
ATOM   9660  C  CB    . SER C 1 142 ? 38.813  6.306   124.541 1.00 224.82 ? 121 SER C CB    1 
ATOM   9661  O  OG    . SER C 1 142 ? 39.991  5.550   124.768 1.00 207.10 ? 121 SER C OG    1 
ATOM   9662  N  N     . GLN C 1 143 ? 37.152  6.163   127.186 1.00 277.47 ? 122 GLN C N     1 
ATOM   9663  C  CA    . GLN C 1 143 ? 37.018  5.968   128.630 1.00 270.36 ? 122 GLN C CA    1 
ATOM   9664  C  C     . GLN C 1 143 ? 35.861  5.023   128.963 1.00 265.47 ? 122 GLN C C     1 
ATOM   9665  O  O     . GLN C 1 143 ? 35.862  4.398   130.031 1.00 262.23 ? 122 GLN C O     1 
ATOM   9666  C  CB    . GLN C 1 143 ? 36.832  7.324   129.330 1.00 255.05 ? 122 GLN C CB    1 
ATOM   9667  C  CG    . GLN C 1 143 ? 38.043  8.274   129.251 1.00 233.97 ? 122 GLN C CG    1 
ATOM   9668  C  CD    . GLN C 1 143 ? 38.110  9.274   130.400 1.00 237.72 ? 122 GLN C CD    1 
ATOM   9669  O  OE1   . GLN C 1 143 ? 37.085  9.755   130.884 1.00 249.71 ? 122 GLN C OE1   1 
ATOM   9670  N  NE2   . GLN C 1 143 ? 39.320  9.622   130.810 1.00 231.43 ? 122 GLN C NE2   1 
ATOM   9671  N  N     . LEU C 1 144 ? 34.893  4.898   128.050 1.00 265.84 ? 123 LEU C N     1 
ATOM   9672  C  CA    . LEU C 1 144 ? 33.695  4.087   128.265 1.00 261.78 ? 123 LEU C CA    1 
ATOM   9673  C  C     . LEU C 1 144 ? 34.000  2.601   128.389 1.00 305.20 ? 123 LEU C C     1 
ATOM   9674  O  O     . LEU C 1 144 ? 33.507  1.935   129.306 1.00 306.69 ? 123 LEU C O     1 
ATOM   9675  C  CB    . LEU C 1 144 ? 32.729  4.290   127.100 1.00 250.44 ? 123 LEU C CB    1 
ATOM   9676  C  CG    . LEU C 1 144 ? 31.384  3.569   127.135 1.00 239.22 ? 123 LEU C CG    1 
ATOM   9677  C  CD1   . LEU C 1 144 ? 30.695  3.800   128.444 1.00 220.41 ? 123 LEU C CD1   1 
ATOM   9678  C  CD2   . LEU C 1 144 ? 30.521  4.009   125.969 1.00 243.75 ? 123 LEU C CD2   1 
ATOM   9679  N  N     . PHE C 1 145 ? 34.802  2.061   127.471 1.00 278.96 ? 124 PHE C N     1 
ATOM   9680  C  CA    . PHE C 1 145 ? 35.051  0.625   127.365 1.00 291.24 ? 124 PHE C CA    1 
ATOM   9681  C  C     . PHE C 1 145 ? 36.286  0.125   128.131 1.00 298.35 ? 124 PHE C C     1 
ATOM   9682  O  O     . PHE C 1 145 ? 36.815  -0.935  127.772 1.00 316.33 ? 124 PHE C O     1 
ATOM   9683  C  CB    . PHE C 1 145 ? 35.095  0.172   125.895 1.00 276.85 ? 124 PHE C CB    1 
ATOM   9684  C  CG    . PHE C 1 145 ? 36.135  0.843   125.058 1.00 263.77 ? 124 PHE C CG    1 
ATOM   9685  C  CD1   . PHE C 1 145 ? 37.469  0.481   125.145 1.00 259.94 ? 124 PHE C CD1   1 
ATOM   9686  C  CD2   . PHE C 1 145 ? 35.771  1.798   124.139 1.00 264.53 ? 124 PHE C CD2   1 
ATOM   9687  C  CE1   . PHE C 1 145 ? 38.423  1.096   124.358 1.00 255.92 ? 124 PHE C CE1   1 
ATOM   9688  C  CE2   . PHE C 1 145 ? 36.721  2.417   123.349 1.00 263.23 ? 124 PHE C CE2   1 
ATOM   9689  C  CZ    . PHE C 1 145 ? 38.048  2.064   123.458 1.00 256.72 ? 124 PHE C CZ    1 
ATOM   9690  N  N     . ARG C 1 146 ? 36.783  0.868   129.132 1.00 300.74 ? 125 ARG C N     1 
ATOM   9691  C  CA    . ARG C 1 146 ? 38.009  0.494   129.847 1.00 279.01 ? 125 ARG C CA    1 
ATOM   9692  C  C     . ARG C 1 146 ? 38.062  -1.009  130.159 1.00 292.51 ? 125 ARG C C     1 
ATOM   9693  O  O     . ARG C 1 146 ? 39.155  -1.586  130.181 1.00 309.13 ? 125 ARG C O     1 
ATOM   9694  C  CB    . ARG C 1 146 ? 38.167  1.314   131.149 1.00 265.97 ? 125 ARG C CB    1 
ATOM   9695  C  CG    . ARG C 1 146 ? 37.621  0.641   132.430 1.00 255.11 ? 125 ARG C CG    1 
ATOM   9696  C  CD    . ARG C 1 146 ? 38.310  1.109   133.732 1.00 238.46 ? 125 ARG C CD    1 
ATOM   9697  N  NE    . ARG C 1 146 ? 39.099  0.052   134.374 1.00 227.42 ? 125 ARG C NE    1 
ATOM   9698  C  CZ    . ARG C 1 146 ? 39.568  0.114   135.620 1.00 214.52 ? 125 ARG C CZ    1 
ATOM   9699  N  NH1   . ARG C 1 146 ? 39.316  1.183   136.360 1.00 205.81 ? 125 ARG C NH1   1 
ATOM   9700  N  NH2   . ARG C 1 146 ? 40.283  -0.890  136.129 1.00 209.25 ? 125 ARG C NH2   1 
ATOM   9701  N  N     . ASP C 1 147 ? 36.907  -1.655  130.397 1.00 297.29 ? 126 ASP C N     1 
ATOM   9702  C  CA    . ASP C 1 147 ? 36.878  -3.112  130.558 1.00 275.63 ? 126 ASP C CA    1 
ATOM   9703  C  C     . ASP C 1 147 ? 37.220  -3.809  129.246 1.00 290.01 ? 126 ASP C C     1 
ATOM   9704  O  O     . ASP C 1 147 ? 38.104  -4.672  129.197 1.00 304.81 ? 126 ASP C O     1 
ATOM   9705  C  CB    . ASP C 1 147 ? 35.504  -3.575  131.045 1.00 248.76 ? 126 ASP C CB    1 
ATOM   9706  C  CG    . ASP C 1 147 ? 35.423  -3.678  132.538 1.00 248.12 ? 126 ASP C CG    1 
ATOM   9707  O  OD1   . ASP C 1 147 ? 36.389  -3.285  133.222 1.00 253.25 ? 126 ASP C OD1   1 
ATOM   9708  O  OD2   . ASP C 1 147 ? 34.394  -4.187  133.024 1.00 246.81 ? 126 ASP C OD2   1 
ATOM   9709  N  N     . HIS C 1 148 ? 36.514  -3.448  128.179 1.00 280.55 ? 127 HIS C N     1 
ATOM   9710  C  CA    . HIS C 1 148 ? 36.557  -4.093  126.874 1.00 272.44 ? 127 HIS C CA    1 
ATOM   9711  C  C     . HIS C 1 148 ? 37.685  -3.540  125.999 1.00 282.57 ? 127 HIS C C     1 
ATOM   9712  O  O     . HIS C 1 148 ? 37.702  -3.799  124.792 1.00 286.11 ? 127 HIS C O     1 
ATOM   9713  C  CB    . HIS C 1 148 ? 35.190  -3.961  126.192 1.00 252.08 ? 127 HIS C CB    1 
ATOM   9714  C  CG    . HIS C 1 148 ? 34.091  -4.656  126.936 1.00 252.30 ? 127 HIS C CG    1 
ATOM   9715  N  ND1   . HIS C 1 148 ? 33.595  -5.886  126.558 1.00 253.08 ? 127 HIS C ND1   1 
ATOM   9716  C  CD2   . HIS C 1 148 ? 33.416  -4.307  128.056 1.00 258.90 ? 127 HIS C CD2   1 
ATOM   9717  C  CE1   . HIS C 1 148 ? 32.650  -6.256  127.405 1.00 259.39 ? 127 HIS C CE1   1 
ATOM   9718  N  NE2   . HIS C 1 148 ? 32.523  -5.316  128.324 1.00 263.75 ? 127 HIS C NE2   1 
ATOM   9719  N  N     . LEU C 1 149 ? 38.623  -2.801  126.611 1.00 288.39 ? 128 LEU C N     1 
ATOM   9720  C  CA    . LEU C 1 149 ? 39.748  -2.112  125.966 1.00 274.90 ? 128 LEU C CA    1 
ATOM   9721  C  C     . LEU C 1 149 ? 40.463  -2.955  124.909 1.00 258.41 ? 128 LEU C C     1 
ATOM   9722  O  O     . LEU C 1 149 ? 40.653  -4.164  125.060 1.00 252.33 ? 128 LEU C O     1 
ATOM   9723  C  CB    . LEU C 1 149 ? 40.747  -1.675  127.065 1.00 261.86 ? 128 LEU C CB    1 
ATOM   9724  C  CG    . LEU C 1 149 ? 41.566  -0.372  127.086 1.00 237.97 ? 128 LEU C CG    1 
ATOM   9725  C  CD1   . LEU C 1 149 ? 40.829  0.774   127.807 1.00 221.10 ? 128 LEU C CD1   1 
ATOM   9726  C  CD2   . LEU C 1 149 ? 42.906  -0.649  127.769 1.00 231.71 ? 128 LEU C CD2   1 
ATOM   9727  N  N     . GLY C 1 150 ? 40.838  -2.288  123.823 1.00 236.03 ? 129 GLY C N     1 
ATOM   9728  C  CA    . GLY C 1 150 ? 41.707  -2.812  122.791 1.00 231.10 ? 129 GLY C CA    1 
ATOM   9729  C  C     . GLY C 1 150 ? 43.112  -2.246  122.866 1.00 244.06 ? 129 GLY C C     1 
ATOM   9730  O  O     . GLY C 1 150 ? 43.596  -1.858  123.936 1.00 273.96 ? 129 GLY C O     1 
ATOM   9731  N  N     . ARG C 1 151 ? 43.786  -2.186  121.715 1.00 226.97 ? 130 ARG C N     1 
ATOM   9732  C  CA    . ARG C 1 151 ? 45.248  -2.108  121.757 1.00 230.38 ? 130 ARG C CA    1 
ATOM   9733  C  C     . ARG C 1 151 ? 45.798  -0.732  122.152 1.00 258.10 ? 130 ARG C C     1 
ATOM   9734  O  O     . ARG C 1 151 ? 46.259  -0.534  123.278 1.00 256.95 ? 130 ARG C O     1 
ATOM   9735  C  CB    . ARG C 1 151 ? 45.800  -2.549  120.397 1.00 198.97 ? 130 ARG C CB    1 
ATOM   9736  N  N     . ALA C 1 152 ? 45.763  0.239   121.245 1.00 246.11 ? 131 ALA C N     1 
ATOM   9737  C  CA    . ALA C 1 152 ? 46.182  1.610   121.542 1.00 241.78 ? 131 ALA C CA    1 
ATOM   9738  C  C     . ALA C 1 152 ? 45.265  2.538   120.755 1.00 256.09 ? 131 ALA C C     1 
ATOM   9739  O  O     . ALA C 1 152 ? 44.253  2.111   120.188 1.00 269.22 ? 131 ALA C O     1 
ATOM   9740  C  CB    . ALA C 1 152 ? 47.670  1.820   121.235 1.00 221.64 ? 131 ALA C CB    1 
ATOM   9741  N  N     . ASN C 1 153 ? 45.641  3.808   120.645 1.00 260.77 ? 132 ASN C N     1 
ATOM   9742  C  CA    . ASN C 1 153 ? 44.832  4.730   119.858 1.00 233.59 ? 132 ASN C CA    1 
ATOM   9743  C  C     . ASN C 1 153 ? 44.996  4.473   118.363 1.00 232.92 ? 132 ASN C C     1 
ATOM   9744  O  O     . ASN C 1 153 ? 46.092  4.178   117.874 1.00 221.18 ? 132 ASN C O     1 
ATOM   9745  C  CB    . ASN C 1 153 ? 45.162  6.198   120.199 1.00 213.83 ? 132 ASN C CB    1 
ATOM   9746  C  CG    . ASN C 1 153 ? 46.518  6.664   119.675 1.00 190.33 ? 132 ASN C CG    1 
ATOM   9747  O  OD1   . ASN C 1 153 ? 47.517  5.946   119.748 1.00 213.48 ? 132 ASN C OD1   1 
ATOM   9748  N  ND2   . ASN C 1 153 ? 46.550  7.888   119.147 1.00 143.42 ? 132 ASN C ND2   1 
ATOM   9749  N  N     . LEU C 1 154 ? 43.864  4.512   117.662 1.00 223.28 ? 133 LEU C N     1 
ATOM   9750  C  CA    . LEU C 1 154 ? 43.732  4.169   116.251 1.00 230.90 ? 133 LEU C CA    1 
ATOM   9751  C  C     . LEU C 1 154 ? 42.482  4.893   115.751 1.00 232.25 ? 133 LEU C C     1 
ATOM   9752  O  O     . LEU C 1 154 ? 41.865  5.666   116.493 1.00 239.50 ? 133 LEU C O     1 
ATOM   9753  C  CB    . LEU C 1 154 ? 43.654  2.653   116.034 1.00 224.25 ? 133 LEU C CB    1 
ATOM   9754  C  CG    . LEU C 1 154 ? 44.350  2.174   114.749 1.00 206.51 ? 133 LEU C CG    1 
ATOM   9755  C  CD1   . LEU C 1 154 ? 45.850  1.920   114.976 1.00 210.04 ? 133 LEU C CD1   1 
ATOM   9756  C  CD2   . LEU C 1 154 ? 43.662  0.956   114.153 1.00 180.75 ? 133 LEU C CD2   1 
ATOM   9757  N  N     . ARG C 1 155 ? 42.106  4.656   114.490 1.00 223.17 ? 134 ARG C N     1 
ATOM   9758  C  CA    . ARG C 1 155 ? 41.078  5.506   113.895 1.00 208.47 ? 134 ARG C CA    1 
ATOM   9759  C  C     . ARG C 1 155 ? 39.713  5.144   114.482 1.00 212.74 ? 134 ARG C C     1 
ATOM   9760  O  O     . ARG C 1 155 ? 39.569  4.148   115.192 1.00 223.49 ? 134 ARG C O     1 
ATOM   9761  C  CB    . ARG C 1 155 ? 41.068  5.338   112.370 1.00 180.45 ? 134 ARG C CB    1 
ATOM   9762  C  CG    . ARG C 1 155 ? 42.173  6.081   111.607 1.00 178.78 ? 134 ARG C CG    1 
ATOM   9763  C  CD    . ARG C 1 155 ? 41.880  6.217   110.104 1.00 168.91 ? 134 ARG C CD    1 
ATOM   9764  N  NE    . ARG C 1 155 ? 40.746  7.090   109.810 1.00 187.81 ? 134 ARG C NE    1 
ATOM   9765  C  CZ    . ARG C 1 155 ? 40.367  7.445   108.583 1.00 201.41 ? 134 ARG C CZ    1 
ATOM   9766  N  NH1   . ARG C 1 155 ? 41.041  7.009   107.531 1.00 213.29 ? 134 ARG C NH1   1 
ATOM   9767  N  NH2   . ARG C 1 155 ? 39.322  8.246   108.401 1.00 202.37 ? 134 ARG C NH2   1 
ATOM   9768  N  N     . LYS C 1 156 ? 38.689  5.952   114.161 1.00 212.57 ? 135 LYS C N     1 
ATOM   9769  C  CA    . LYS C 1 156 ? 37.372  5.734   114.768 1.00 216.82 ? 135 LYS C CA    1 
ATOM   9770  C  C     . LYS C 1 156 ? 36.572  4.644   114.062 1.00 228.46 ? 135 LYS C C     1 
ATOM   9771  O  O     . LYS C 1 156 ? 35.857  3.884   114.725 1.00 230.12 ? 135 LYS C O     1 
ATOM   9772  C  CB    . LYS C 1 156 ? 36.548  7.020   114.830 1.00 194.80 ? 135 LYS C CB    1 
ATOM   9773  C  CG    . LYS C 1 156 ? 35.385  6.916   115.809 1.00 191.72 ? 135 LYS C CG    1 
ATOM   9774  C  CD    . LYS C 1 156 ? 34.603  8.210   115.940 1.00 191.73 ? 135 LYS C CD    1 
ATOM   9775  C  CE    . LYS C 1 156 ? 33.409  8.013   116.870 1.00 183.42 ? 135 LYS C CE    1 
ATOM   9776  N  NZ    . LYS C 1 156 ? 32.672  9.266   117.221 1.00 164.70 ? 135 LYS C NZ    1 
ATOM   9777  N  N     . ASP C 1 157 ? 36.612  4.590   112.722 1.00 238.78 ? 136 ASP C N     1 
ATOM   9778  C  CA    . ASP C 1 157 ? 35.940  3.489   112.031 1.00 218.97 ? 136 ASP C CA    1 
ATOM   9779  C  C     . ASP C 1 157 ? 36.541  2.158   112.448 1.00 202.13 ? 136 ASP C C     1 
ATOM   9780  O  O     . ASP C 1 157 ? 35.847  1.137   112.455 1.00 191.37 ? 136 ASP C O     1 
ATOM   9781  C  CB    . ASP C 1 157 ? 36.000  3.649   110.503 1.00 191.92 ? 136 ASP C CB    1 
ATOM   9782  C  CG    . ASP C 1 157 ? 37.395  3.935   109.979 1.00 190.50 ? 136 ASP C CG    1 
ATOM   9783  O  OD1   . ASP C 1 157 ? 37.600  3.745   108.761 1.00 178.43 ? 136 ASP C OD1   1 
ATOM   9784  O  OD2   . ASP C 1 157 ? 38.280  4.338   110.755 1.00 207.71 ? 136 ASP C OD2   1 
ATOM   9785  N  N     . ALA C 1 158 ? 37.818  2.161   112.834 1.00 199.12 ? 137 ALA C N     1 
ATOM   9786  C  CA    . ALA C 1 158 ? 38.464  0.944   113.295 1.00 204.50 ? 137 ALA C CA    1 
ATOM   9787  C  C     . ALA C 1 158 ? 38.065  0.632   114.733 1.00 236.89 ? 137 ALA C C     1 
ATOM   9788  O  O     . ALA C 1 158 ? 37.841  -0.534  115.072 1.00 261.75 ? 137 ALA C O     1 
ATOM   9789  C  CB    . ALA C 1 158 ? 39.982  1.079   113.169 1.00 195.17 ? 137 ALA C CB    1 
ATOM   9790  N  N     . LEU C 1 159 ? 37.974  1.655   115.593 1.00 230.82 ? 138 LEU C N     1 
ATOM   9791  C  CA    . LEU C 1 159 ? 37.456  1.447   116.946 1.00 217.17 ? 138 LEU C CA    1 
ATOM   9792  C  C     . LEU C 1 159 ? 36.038  0.874   116.908 1.00 218.15 ? 138 LEU C C     1 
ATOM   9793  O  O     . LEU C 1 159 ? 35.707  -0.032  117.681 1.00 222.63 ? 138 LEU C O     1 
ATOM   9794  C  CB    . LEU C 1 159 ? 37.535  2.748   117.749 1.00 220.56 ? 138 LEU C CB    1 
ATOM   9795  C  CG    . LEU C 1 159 ? 38.985  3.203   118.018 1.00 222.84 ? 138 LEU C CG    1 
ATOM   9796  C  CD1   . LEU C 1 159 ? 39.058  4.522   118.786 1.00 226.33 ? 138 LEU C CD1   1 
ATOM   9797  C  CD2   . LEU C 1 159 ? 39.819  2.124   118.714 1.00 222.37 ? 138 LEU C CD2   1 
ATOM   9798  N  N     . LEU C 1 160 ? 35.168  1.433   116.059 1.00 221.08 ? 139 LEU C N     1 
ATOM   9799  C  CA    . LEU C 1 160 ? 33.860  0.819   115.812 1.00 223.48 ? 139 LEU C CA    1 
ATOM   9800  C  C     . LEU C 1 160 ? 34.000  -0.562  115.183 1.00 236.71 ? 139 LEU C C     1 
ATOM   9801  O  O     . LEU C 1 160 ? 33.232  -1.480  115.498 1.00 234.21 ? 139 LEU C O     1 
ATOM   9802  C  CB    . LEU C 1 160 ? 32.991  1.711   114.921 1.00 216.53 ? 139 LEU C CB    1 
ATOM   9803  C  CG    . LEU C 1 160 ? 31.520  1.268   114.791 1.00 193.67 ? 139 LEU C CG    1 
ATOM   9804  C  CD1   . LEU C 1 160 ? 30.762  1.388   116.098 1.00 197.90 ? 139 LEU C CD1   1 
ATOM   9805  C  CD2   . LEU C 1 160 ? 30.780  2.036   113.681 1.00 136.50 ? 139 LEU C CD2   1 
ATOM   9806  N  N     . GLU C 1 161 ? 34.964  -0.716  114.269 1.00 227.97 ? 140 GLU C N     1 
ATOM   9807  C  CA    . GLU C 1 161 ? 35.135  -1.967  113.530 1.00 234.65 ? 140 GLU C CA    1 
ATOM   9808  C  C     . GLU C 1 161 ? 35.399  -3.156  114.456 1.00 226.89 ? 140 GLU C C     1 
ATOM   9809  O  O     . GLU C 1 161 ? 34.728  -4.191  114.360 1.00 215.97 ? 140 GLU C O     1 
ATOM   9810  C  CB    . GLU C 1 161 ? 36.271  -1.801  112.519 1.00 239.48 ? 140 GLU C CB    1 
ATOM   9811  C  CG    . GLU C 1 161 ? 36.014  -2.410  111.150 1.00 247.64 ? 140 GLU C CG    1 
ATOM   9812  C  CD    . GLU C 1 161 ? 36.463  -3.846  111.051 1.00 265.34 ? 140 GLU C CD    1 
ATOM   9813  O  OE1   . GLU C 1 161 ? 37.090  -4.341  112.014 1.00 269.54 ? 140 GLU C OE1   1 
ATOM   9814  O  OE2   . GLU C 1 161 ? 36.194  -4.476  110.005 1.00 270.81 ? 140 GLU C OE2   1 
ATOM   9815  N  N     . ARG C 1 162 ? 36.362  -3.031  115.372 1.00 229.02 ? 141 ARG C N     1 
ATOM   9816  C  CA    . ARG C 1 162 ? 36.645  -4.163  116.250 1.00 227.98 ? 141 ARG C CA    1 
ATOM   9817  C  C     . ARG C 1 162 ? 35.544  -4.376  117.286 1.00 260.61 ? 141 ARG C C     1 
ATOM   9818  O  O     . ARG C 1 162 ? 35.392  -5.499  117.785 1.00 263.67 ? 141 ARG C O     1 
ATOM   9819  C  CB    . ARG C 1 162 ? 38.004  -3.974  116.966 1.00 212.30 ? 141 ARG C CB    1 
ATOM   9820  C  CG    . ARG C 1 162 ? 39.059  -5.088  116.740 1.00 196.21 ? 141 ARG C CG    1 
ATOM   9821  C  CD    . ARG C 1 162 ? 39.629  -5.720  118.037 1.00 205.65 ? 141 ARG C CD    1 
ATOM   9822  N  NE    . ARG C 1 162 ? 40.592  -4.874  118.750 1.00 211.94 ? 141 ARG C NE    1 
ATOM   9823  C  CZ    . ARG C 1 162 ? 41.550  -5.336  119.559 1.00 217.96 ? 141 ARG C CZ    1 
ATOM   9824  N  NH1   . ARG C 1 162 ? 41.679  -6.645  119.762 1.00 202.96 ? 141 ARG C NH1   1 
ATOM   9825  N  NH2   . ARG C 1 162 ? 42.380  -4.490  120.168 1.00 205.40 ? 141 ARG C NH2   1 
ATOM   9826  N  N     . LEU C 1 163 ? 34.743  -3.343  117.586 1.00 242.83 ? 142 LEU C N     1 
ATOM   9827  C  CA    . LEU C 1 163 ? 33.733  -3.443  118.638 1.00 257.92 ? 142 LEU C CA    1 
ATOM   9828  C  C     . LEU C 1 163 ? 32.363  -3.909  118.158 1.00 268.15 ? 142 LEU C C     1 
ATOM   9829  O  O     . LEU C 1 163 ? 31.567  -4.365  118.990 1.00 288.99 ? 142 LEU C O     1 
ATOM   9830  C  CB    . LEU C 1 163 ? 33.547  -2.081  119.332 1.00 224.68 ? 142 LEU C CB    1 
ATOM   9831  C  CG    . LEU C 1 163 ? 34.147  -1.729  120.704 1.00 203.82 ? 142 LEU C CG    1 
ATOM   9832  C  CD1   . LEU C 1 163 ? 34.065  -0.237  120.924 1.00 188.73 ? 142 LEU C CD1   1 
ATOM   9833  C  CD2   . LEU C 1 163 ? 33.445  -2.458  121.840 1.00 206.22 ? 142 LEU C CD2   1 
ATOM   9834  N  N     . GLN C 1 164 ? 32.087  -3.858  116.850 1.00 268.85 ? 143 GLN C N     1 
ATOM   9835  C  CA    . GLN C 1 164 ? 30.729  -4.190  116.397 1.00 239.22 ? 143 GLN C CA    1 
ATOM   9836  C  C     . GLN C 1 164 ? 30.436  -5.666  116.556 1.00 252.42 ? 143 GLN C C     1 
ATOM   9837  O  O     . GLN C 1 164 ? 29.319  -6.001  117.018 1.00 253.64 ? 143 GLN C O     1 
ATOM   9838  C  CB    . GLN C 1 164 ? 30.536  -3.678  114.967 1.00 210.41 ? 143 GLN C CB    1 
ATOM   9839  C  CG    . GLN C 1 164 ? 29.106  -3.688  114.468 1.00 203.85 ? 143 GLN C CG    1 
ATOM   9840  C  CD    . GLN C 1 164 ? 28.817  -2.508  113.539 1.00 212.10 ? 143 GLN C CD    1 
ATOM   9841  O  OE1   . GLN C 1 164 ? 29.153  -1.363  113.848 1.00 203.99 ? 143 GLN C OE1   1 
ATOM   9842  N  NE2   . GLN C 1 164 ? 28.214  -2.789  112.387 1.00 210.74 ? 143 GLN C NE2   1 
ATOM   9843  N  N     . PRO C 1 165 ? 31.308  -6.619  116.192 1.00 255.39 ? 144 PRO C N     1 
ATOM   9844  C  CA    . PRO C 1 165 ? 31.033  -8.032  116.494 1.00 247.95 ? 144 PRO C CA    1 
ATOM   9845  C  C     . PRO C 1 165 ? 30.894  -8.334  117.980 1.00 247.43 ? 144 PRO C C     1 
ATOM   9846  O  O     . PRO C 1 165 ? 30.223  -9.310  118.336 1.00 230.93 ? 144 PRO C O     1 
ATOM   9847  C  CB    . PRO C 1 165 ? 32.228  -8.776  115.883 1.00 245.44 ? 144 PRO C CB    1 
ATOM   9848  C  CG    . PRO C 1 165 ? 33.252  -7.741  115.619 1.00 246.09 ? 144 PRO C CG    1 
ATOM   9849  C  CD    . PRO C 1 165 ? 32.489  -6.498  115.310 1.00 253.08 ? 144 PRO C CD    1 
ATOM   9850  N  N     . LEU C 1 166 ? 31.524  -7.541  118.859 1.00 237.66 ? 145 LEU C N     1 
ATOM   9851  C  CA    . LEU C 1 166 ? 31.442  -7.799  120.296 1.00 259.70 ? 145 LEU C CA    1 
ATOM   9852  C  C     . LEU C 1 166 ? 30.121  -7.305  120.883 1.00 283.07 ? 145 LEU C C     1 
ATOM   9853  O  O     . LEU C 1 166 ? 29.538  -7.970  121.748 1.00 284.52 ? 145 LEU C O     1 
ATOM   9854  C  CB    . LEU C 1 166 ? 32.629  -7.160  121.021 1.00 260.10 ? 145 LEU C CB    1 
ATOM   9855  C  CG    . LEU C 1 166 ? 32.735  -7.444  122.528 1.00 276.62 ? 145 LEU C CG    1 
ATOM   9856  C  CD1   . LEU C 1 166 ? 33.028  -8.920  122.831 1.00 277.77 ? 145 LEU C CD1   1 
ATOM   9857  C  CD2   . LEU C 1 166 ? 33.777  -6.544  123.176 1.00 280.15 ? 145 LEU C CD2   1 
ATOM   9858  N  N     . PHE C 1 167 ? 29.637  -6.143  120.438 1.00 262.03 ? 146 PHE C N     1 
ATOM   9859  C  CA    . PHE C 1 167 ? 28.357  -5.579  120.871 1.00 282.31 ? 146 PHE C CA    1 
ATOM   9860  C  C     . PHE C 1 167 ? 27.428  -5.444  119.666 1.00 288.63 ? 146 PHE C C     1 
ATOM   9861  O  O     . PHE C 1 167 ? 27.129  -4.325  119.224 1.00 302.69 ? 146 PHE C O     1 
ATOM   9862  C  CB    . PHE C 1 167 ? 28.503  -4.218  121.553 1.00 272.96 ? 146 PHE C CB    1 
ATOM   9863  C  CG    . PHE C 1 167 ? 29.249  -4.240  122.860 1.00 268.39 ? 146 PHE C CG    1 
ATOM   9864  C  CD1   . PHE C 1 167 ? 28.547  -4.281  124.059 1.00 263.45 ? 146 PHE C CD1   1 
ATOM   9865  C  CD2   . PHE C 1 167 ? 30.632  -4.165  122.900 1.00 262.33 ? 146 PHE C CD2   1 
ATOM   9866  C  CE1   . PHE C 1 167 ? 29.211  -4.275  125.270 1.00 260.20 ? 146 PHE C CE1   1 
ATOM   9867  C  CE2   . PHE C 1 167 ? 31.305  -4.160  124.112 1.00 258.49 ? 146 PHE C CE2   1 
ATOM   9868  C  CZ    . PHE C 1 167 ? 30.592  -4.216  125.299 1.00 259.90 ? 146 PHE C CZ    1 
ATOM   9869  N  N     . PRO C 1 168 ? 26.962  -6.562  119.097 1.00 293.85 ? 147 PRO C N     1 
ATOM   9870  C  CA    . PRO C 1 168 ? 26.001  -6.441  117.986 1.00 264.99 ? 147 PRO C CA    1 
ATOM   9871  C  C     . PRO C 1 168 ? 24.641  -5.929  118.438 1.00 241.58 ? 147 PRO C C     1 
ATOM   9872  O  O     . PRO C 1 168 ? 23.995  -5.167  117.702 1.00 221.27 ? 147 PRO C O     1 
ATOM   9873  C  CB    . PRO C 1 168 ? 25.935  -7.868  117.413 1.00 261.29 ? 147 PRO C CB    1 
ATOM   9874  C  CG    . PRO C 1 168 ? 26.810  -8.734  118.311 1.00 268.06 ? 147 PRO C CG    1 
ATOM   9875  C  CD    . PRO C 1 168 ? 27.107  -7.956  119.548 1.00 277.16 ? 147 PRO C CD    1 
ATOM   9876  N  N     . GLU C 1 169 ? 24.192  -6.338  119.629 1.00 250.38 ? 148 GLU C N     1 
ATOM   9877  C  CA    . GLU C 1 169 ? 22.856  -6.014  120.115 1.00 237.89 ? 148 GLU C CA    1 
ATOM   9878  C  C     . GLU C 1 169 ? 22.705  -4.514  120.368 1.00 241.51 ? 148 GLU C C     1 
ATOM   9879  O  O     . GLU C 1 169 ? 23.672  -3.803  120.646 1.00 236.52 ? 148 GLU C O     1 
ATOM   9880  C  CB    . GLU C 1 169 ? 22.549  -6.809  121.390 1.00 246.53 ? 148 GLU C CB    1 
ATOM   9881  C  CG    . GLU C 1 169 ? 23.392  -6.440  122.620 1.00 256.91 ? 148 GLU C CG    1 
ATOM   9882  C  CD    . GLU C 1 169 ? 23.168  -7.383  123.809 1.00 273.95 ? 148 GLU C CD    1 
ATOM   9883  O  OE1   . GLU C 1 169 ? 22.398  -8.356  123.671 1.00 271.13 ? 148 GLU C OE1   1 
ATOM   9884  O  OE2   . GLU C 1 169 ? 23.769  -7.155  124.885 1.00 277.34 ? 148 GLU C OE2   1 
ATOM   9885  N  N     . ALA C 1 170 ? 21.469  -4.036  120.258 1.00 229.71 ? 149 ALA C N     1 
ATOM   9886  C  CA    . ALA C 1 170 ? 21.086  -2.664  120.574 1.00 233.78 ? 149 ALA C CA    1 
ATOM   9887  C  C     . ALA C 1 170 ? 20.504  -2.551  121.980 1.00 265.22 ? 149 ALA C C     1 
ATOM   9888  O  O     . ALA C 1 170 ? 19.807  -3.448  122.457 1.00 272.65 ? 149 ALA C O     1 
ATOM   9889  C  CB    . ALA C 1 170 ? 20.070  -2.134  119.556 1.00 223.56 ? 149 ALA C CB    1 
ATOM   9890  N  N     . ARG C 1 171 ? 20.792  -1.423  122.633 1.00 254.64 ? 150 ARG C N     1 
ATOM   9891  C  CA    . ARG C 1 171 ? 20.413  -1.165  124.022 1.00 259.62 ? 150 ARG C CA    1 
ATOM   9892  C  C     . ARG C 1 171 ? 19.938  0.280   124.154 1.00 248.87 ? 150 ARG C C     1 
ATOM   9893  O  O     . ARG C 1 171 ? 20.303  1.142   123.351 1.00 271.39 ? 150 ARG C O     1 
ATOM   9894  C  CB    . ARG C 1 171 ? 21.614  -1.414  124.953 1.00 258.72 ? 150 ARG C CB    1 
ATOM   9895  C  CG    . ARG C 1 171 ? 22.273  -2.777  124.741 1.00 256.10 ? 150 ARG C CG    1 
ATOM   9896  C  CD    . ARG C 1 171 ? 23.727  -2.796  125.205 1.00 250.39 ? 150 ARG C CD    1 
ATOM   9897  N  NE    . ARG C 1 171 ? 24.253  -4.154  125.302 1.00 250.48 ? 150 ARG C NE    1 
ATOM   9898  C  CZ    . ARG C 1 171 ? 25.381  -4.478  125.925 1.00 251.70 ? 150 ARG C CZ    1 
ATOM   9899  N  NH1   . ARG C 1 171 ? 26.118  -3.535  126.497 1.00 247.31 ? 150 ARG C NH1   1 
ATOM   9900  N  NH2   . ARG C 1 171 ? 25.774  -5.744  125.974 1.00 256.66 ? 150 ARG C NH2   1 
ATOM   9901  N  N     . ARG C 1 172 ? 19.107  0.549   125.161 1.00 245.05 ? 151 ARG C N     1 
ATOM   9902  C  CA    . ARG C 1 172 ? 18.785  1.933   125.502 1.00 217.97 ? 151 ARG C CA    1 
ATOM   9903  C  C     . ARG C 1 172 ? 19.990  2.682   126.067 1.00 228.39 ? 151 ARG C C     1 
ATOM   9904  O  O     . ARG C 1 172 ? 20.996  2.089   126.460 1.00 233.43 ? 151 ARG C O     1 
ATOM   9905  C  CB    . ARG C 1 172 ? 17.627  2.017   126.485 1.00 205.27 ? 151 ARG C CB    1 
ATOM   9906  C  CG    . ARG C 1 172 ? 16.307  1.553   125.941 1.00 198.05 ? 151 ARG C CG    1 
ATOM   9907  C  CD    . ARG C 1 172 ? 15.301  1.660   127.055 1.00 212.46 ? 151 ARG C CD    1 
ATOM   9908  N  NE    . ARG C 1 172 ? 13.925  1.799   126.595 1.00 221.00 ? 151 ARG C NE    1 
ATOM   9909  C  CZ    . ARG C 1 172 ? 12.890  1.951   127.418 1.00 231.89 ? 151 ARG C CZ    1 
ATOM   9910  N  NH1   . ARG C 1 172 ? 13.086  1.981   128.730 1.00 247.19 ? 151 ARG C NH1   1 
ATOM   9911  N  NH2   . ARG C 1 172 ? 11.662  2.076   126.937 1.00 229.49 ? 151 ARG C NH2   1 
ATOM   9912  N  N     . LEU C 1 173 ? 19.893  4.019   126.055 1.00 233.51 ? 152 LEU C N     1 
ATOM   9913  C  CA    . LEU C 1 173 ? 20.951  4.833   126.650 1.00 230.23 ? 152 LEU C CA    1 
ATOM   9914  C  C     . LEU C 1 173 ? 21.133  4.468   128.120 1.00 231.52 ? 152 LEU C C     1 
ATOM   9915  O  O     . LEU C 1 173 ? 22.263  4.421   128.628 1.00 215.88 ? 152 LEU C O     1 
ATOM   9916  C  CB    . LEU C 1 173 ? 20.624  6.324   126.492 1.00 219.42 ? 152 LEU C CB    1 
ATOM   9917  C  CG    . LEU C 1 173 ? 21.630  7.370   126.997 1.00 193.04 ? 152 LEU C CG    1 
ATOM   9918  C  CD1   . LEU C 1 173 ? 22.842  7.417   126.095 1.00 180.34 ? 152 LEU C CD1   1 
ATOM   9919  C  CD2   . LEU C 1 173 ? 21.007  8.760   127.122 1.00 174.89 ? 152 LEU C CD2   1 
ATOM   9920  N  N     . ALA C 1 174 ? 20.025  4.174   128.813 1.00 220.87 ? 153 ALA C N     1 
ATOM   9921  C  CA    . ALA C 1 174 ? 20.115  3.621   130.159 1.00 242.05 ? 153 ALA C CA    1 
ATOM   9922  C  C     . ALA C 1 174 ? 20.683  2.211   130.126 1.00 240.60 ? 153 ALA C C     1 
ATOM   9923  O  O     . ALA C 1 174 ? 21.243  1.744   131.120 1.00 247.64 ? 153 ALA C O     1 
ATOM   9924  C  CB    . ALA C 1 174 ? 18.745  3.628   130.838 1.00 252.81 ? 153 ALA C CB    1 
ATOM   9925  N  N     . GLU C 1 175 ? 20.482  1.500   129.022 1.00 241.65 ? 154 GLU C N     1 
ATOM   9926  C  CA    . GLU C 1 175 ? 20.964  0.138   128.844 1.00 233.49 ? 154 GLU C CA    1 
ATOM   9927  C  C     . GLU C 1 175 ? 22.366  0.049   128.233 1.00 248.55 ? 154 GLU C C     1 
ATOM   9928  O  O     . GLU C 1 175 ? 22.868  -1.067  128.065 1.00 251.88 ? 154 GLU C O     1 
ATOM   9929  C  CB    . GLU C 1 175 ? 19.968  -0.645  127.982 1.00 221.56 ? 154 GLU C CB    1 
ATOM   9930  C  CG    . GLU C 1 175 ? 18.634  -0.882  128.662 1.00 207.84 ? 154 GLU C CG    1 
ATOM   9931  C  CD    . GLU C 1 175 ? 18.348  -2.349  128.869 1.00 203.10 ? 154 GLU C CD    1 
ATOM   9932  O  OE1   . GLU C 1 175 ? 18.787  -3.159  128.023 1.00 209.17 ? 154 GLU C OE1   1 
ATOM   9933  O  OE2   . GLU C 1 175 ? 17.694  -2.691  129.878 1.00 199.79 ? 154 GLU C OE2   1 
ATOM   9934  N  N     . TRP C 1 176 ? 23.008  1.169   127.862 1.00 242.76 ? 155 TRP C N     1 
ATOM   9935  C  CA    . TRP C 1 176 ? 24.390  1.102   127.354 1.00 233.19 ? 155 TRP C CA    1 
ATOM   9936  C  C     . TRP C 1 176 ? 25.456  1.308   128.426 1.00 241.35 ? 155 TRP C C     1 
ATOM   9937  O  O     . TRP C 1 176 ? 26.249  0.401   128.688 1.00 254.30 ? 155 TRP C O     1 
ATOM   9938  C  CB    . TRP C 1 176 ? 24.615  2.089   126.211 1.00 227.67 ? 155 TRP C CB    1 
ATOM   9939  C  CG    . TRP C 1 176 ? 24.191  1.574   124.881 1.00 241.56 ? 155 TRP C CG    1 
ATOM   9940  C  CD1   . TRP C 1 176 ? 23.097  1.950   124.174 1.00 246.62 ? 155 TRP C CD1   1 
ATOM   9941  C  CD2   . TRP C 1 176 ? 24.860  0.573   124.089 1.00 248.58 ? 155 TRP C CD2   1 
ATOM   9942  N  NE1   . TRP C 1 176 ? 23.039  1.258   122.984 1.00 250.76 ? 155 TRP C NE1   1 
ATOM   9943  C  CE2   . TRP C 1 176 ? 24.109  0.406   122.909 1.00 244.34 ? 155 TRP C CE2   1 
ATOM   9944  C  CE3   . TRP C 1 176 ? 26.019  -0.191  124.262 1.00 253.74 ? 155 TRP C CE3   1 
ATOM   9945  C  CZ2   . TRP C 1 176 ? 24.477  -0.497  121.906 1.00 226.42 ? 155 TRP C CZ2   1 
ATOM   9946  C  CZ3   . TRP C 1 176 ? 26.383  -1.086  123.260 1.00 244.13 ? 155 TRP C CZ3   1 
ATOM   9947  C  CH2   . TRP C 1 176 ? 25.613  -1.228  122.100 1.00 224.04 ? 155 TRP C CH2   1 
ATOM   9948  N  N     . GLN C 1 177 ? 25.539  2.509   129.009 1.00 231.35 ? 156 GLN C N     1 
ATOM   9949  C  CA    . GLN C 1 177 ? 26.293  2.633   130.250 1.00 266.07 ? 156 GLN C CA    1 
ATOM   9950  C  C     . GLN C 1 177 ? 25.460  2.987   131.484 1.00 279.13 ? 156 GLN C C     1 
ATOM   9951  O  O     . GLN C 1 177 ? 25.992  2.935   132.604 1.00 292.63 ? 156 GLN C O     1 
ATOM   9952  C  CB    . GLN C 1 177 ? 27.432  3.651   130.083 1.00 260.36 ? 156 GLN C CB    1 
ATOM   9953  C  CG    . GLN C 1 177 ? 28.611  3.367   131.022 1.00 274.98 ? 156 GLN C CG    1 
ATOM   9954  C  CD    . GLN C 1 177 ? 29.109  1.934   130.939 1.00 275.36 ? 156 GLN C CD    1 
ATOM   9955  O  OE1   . GLN C 1 177 ? 29.171  1.350   129.857 1.00 282.89 ? 156 GLN C OE1   1 
ATOM   9956  N  NE2   . GLN C 1 177 ? 29.463  1.359   132.088 1.00 259.18 ? 156 GLN C NE2   1 
ATOM   9957  N  N     . ALA C 1 178 ? 24.180  3.327   131.314 1.00 280.34 ? 157 ALA C N     1 
ATOM   9958  C  CA    . ALA C 1 178 ? 23.259  3.787   132.358 1.00 259.14 ? 157 ALA C CA    1 
ATOM   9959  C  C     . ALA C 1 178 ? 23.644  5.136   132.966 1.00 270.97 ? 157 ALA C C     1 
ATOM   9960  O  O     . ALA C 1 178 ? 22.785  5.824   133.527 1.00 241.79 ? 157 ALA C O     1 
ATOM   9961  C  CB    . ALA C 1 178 ? 23.138  2.737   133.471 1.00 254.09 ? 157 ALA C CB    1 
ATOM   9962  N  N     . ASP C 1 179 ? 24.917  5.528   132.857 1.00 269.27 ? 158 ASP C N     1 
ATOM   9963  C  CA    . ASP C 1 179 ? 25.424  6.816   133.313 1.00 288.22 ? 158 ASP C CA    1 
ATOM   9964  C  C     . ASP C 1 179 ? 25.581  7.739   132.086 1.00 298.07 ? 158 ASP C C     1 
ATOM   9965  O  O     . ASP C 1 179 ? 25.076  7.432   130.997 1.00 308.99 ? 158 ASP C O     1 
ATOM   9966  C  CB    . ASP C 1 179 ? 26.675  6.617   134.201 1.00 280.47 ? 158 ASP C CB    1 
ATOM   9967  C  CG    . ASP C 1 179 ? 27.954  6.336   133.427 1.00 277.80 ? 158 ASP C CG    1 
ATOM   9968  O  OD1   . ASP C 1 179 ? 29.046  6.523   134.006 1.00 261.42 ? 158 ASP C OD1   1 
ATOM   9969  O  OD2   . ASP C 1 179 ? 27.883  5.914   132.263 1.00 286.24 ? 158 ASP C OD2   1 
ATOM   9970  N  N     . PHE C 1 180 ? 26.287  8.868   132.260 1.00 311.95 ? 159 PHE C N     1 
ATOM   9971  C  CA    . PHE C 1 180 ? 26.545  9.977   131.325 1.00 275.00 ? 159 PHE C CA    1 
ATOM   9972  C  C     . PHE C 1 180 ? 25.504  11.098  131.436 1.00 262.93 ? 159 PHE C C     1 
ATOM   9973  O  O     . PHE C 1 180 ? 25.716  12.171  130.871 1.00 250.94 ? 159 PHE C O     1 
ATOM   9974  C  CB    . PHE C 1 180 ? 26.635  9.536   129.848 1.00 263.49 ? 159 PHE C CB    1 
ATOM   9975  C  CG    . PHE C 1 180 ? 27.897  8.785   129.486 1.00 258.43 ? 159 PHE C CG    1 
ATOM   9976  C  CD1   . PHE C 1 180 ? 28.903  9.412   128.762 1.00 247.20 ? 159 PHE C CD1   1 
ATOM   9977  C  CD2   . PHE C 1 180 ? 28.055  7.450   129.825 1.00 254.65 ? 159 PHE C CD2   1 
ATOM   9978  C  CE1   . PHE C 1 180 ? 30.053  8.734   128.408 1.00 240.19 ? 159 PHE C CE1   1 
ATOM   9979  C  CE2   . PHE C 1 180 ? 29.203  6.764   129.482 1.00 257.17 ? 159 PHE C CE2   1 
ATOM   9980  C  CZ    . PHE C 1 180 ? 30.205  7.408   128.769 1.00 254.35 ? 159 PHE C CZ    1 
ATOM   9981  N  N     . ALA C 1 181 ? 24.412  10.892  132.178 1.00 258.44 ? 160 ALA C N     1 
ATOM   9982  C  CA    . ALA C 1 181 ? 23.256  11.789  132.231 1.00 259.11 ? 160 ALA C CA    1 
ATOM   9983  C  C     . ALA C 1 181 ? 22.773  12.175  130.835 1.00 262.64 ? 160 ALA C C     1 
ATOM   9984  O  O     . ALA C 1 181 ? 22.797  11.342  129.921 1.00 271.19 ? 160 ALA C O     1 
ATOM   9985  C  CB    . ALA C 1 181 ? 23.587  13.035  133.058 1.00 241.79 ? 160 ALA C CB    1 
ATOM   9986  N  N     . GLU C 1 182 ? 22.357  13.442  130.659 1.00 259.71 ? 161 GLU C N     1 
ATOM   9987  C  CA    . GLU C 1 182 ? 21.947  14.019  129.379 1.00 247.28 ? 161 GLU C CA    1 
ATOM   9988  C  C     . GLU C 1 182 ? 21.067  13.057  128.578 1.00 233.42 ? 161 GLU C C     1 
ATOM   9989  O  O     . GLU C 1 182 ? 21.586  12.328  127.722 1.00 226.95 ? 161 GLU C O     1 
ATOM   9990  C  CB    . GLU C 1 182 ? 23.175  14.442  128.563 1.00 250.98 ? 161 GLU C CB    1 
ATOM   9991  C  CG    . GLU C 1 182 ? 24.019  15.531  129.243 1.00 249.49 ? 161 GLU C CG    1 
ATOM   9992  C  CD    . GLU C 1 182 ? 25.008  16.227  128.310 1.00 237.22 ? 161 GLU C CD    1 
ATOM   9993  O  OE1   . GLU C 1 182 ? 24.948  16.006  127.078 1.00 234.88 ? 161 GLU C OE1   1 
ATOM   9994  O  OE2   . GLU C 1 182 ? 25.870  16.975  128.825 1.00 221.13 ? 161 GLU C OE2   1 
ATOM   9995  N  N     . PRO C 1 183 ? 19.760  12.977  128.851 1.00 234.06 ? 162 PRO C N     1 
ATOM   9996  C  CA    . PRO C 1 183 ? 18.903  12.087  128.056 1.00 225.86 ? 162 PRO C CA    1 
ATOM   9997  C  C     . PRO C 1 183 ? 18.991  12.427  126.578 1.00 220.86 ? 162 PRO C C     1 
ATOM   9998  O  O     . PRO C 1 183 ? 19.244  13.571  126.196 1.00 219.91 ? 162 PRO C O     1 
ATOM   9999  C  CB    . PRO C 1 183 ? 17.493  12.355  128.599 1.00 242.76 ? 162 PRO C CB    1 
ATOM   10000 C  CG    . PRO C 1 183 ? 17.669  13.198  129.824 1.00 251.26 ? 162 PRO C CG    1 
ATOM   10001 C  CD    . PRO C 1 183 ? 18.972  13.914  129.665 1.00 245.95 ? 162 PRO C CD    1 
ATOM   10002 N  N     . VAL C 1 184 ? 18.723  11.425  125.744 1.00 223.79 ? 163 VAL C N     1 
ATOM   10003 C  CA    . VAL C 1 184 ? 18.733  11.580  124.294 1.00 227.05 ? 163 VAL C CA    1 
ATOM   10004 C  C     . VAL C 1 184 ? 17.337  11.328  123.749 1.00 239.00 ? 163 VAL C C     1 
ATOM   10005 O  O     . VAL C 1 184 ? 16.656  10.374  124.145 1.00 238.22 ? 163 VAL C O     1 
ATOM   10006 C  CB    . VAL C 1 184 ? 19.757  10.637  123.623 1.00 220.64 ? 163 VAL C CB    1 
ATOM   10007 C  CG1   . VAL C 1 184 ? 19.448  10.445  122.137 1.00 196.91 ? 163 VAL C CG1   1 
ATOM   10008 C  CG2   . VAL C 1 184 ? 21.165  11.174  123.795 1.00 220.59 ? 163 VAL C CG2   1 
ATOM   10009 N  N     . TYR C 1 185 ? 16.928  12.194  122.832 1.00 226.80 ? 164 TYR C N     1 
ATOM   10010 C  CA    . TYR C 1 185 ? 15.624  12.163  122.200 1.00 233.14 ? 164 TYR C CA    1 
ATOM   10011 C  C     . TYR C 1 185 ? 15.769  11.652  120.774 1.00 224.75 ? 164 TYR C C     1 
ATOM   10012 O  O     . TYR C 1 185 ? 16.773  11.921  120.105 1.00 231.55 ? 164 TYR C O     1 
ATOM   10013 C  CB    . TYR C 1 185 ? 14.987  13.557  122.189 1.00 224.87 ? 164 TYR C CB    1 
ATOM   10014 C  CG    . TYR C 1 185 ? 14.798  14.157  123.558 1.00 216.85 ? 164 TYR C CG    1 
ATOM   10015 C  CD1   . TYR C 1 185 ? 13.819  13.675  124.415 1.00 225.12 ? 164 TYR C CD1   1 
ATOM   10016 C  CD2   . TYR C 1 185 ? 15.614  15.193  123.998 1.00 206.34 ? 164 TYR C CD2   1 
ATOM   10017 C  CE1   . TYR C 1 185 ? 13.647  14.214  125.663 1.00 242.91 ? 164 TYR C CE1   1 
ATOM   10018 C  CE2   . TYR C 1 185 ? 15.453  15.739  125.245 1.00 223.67 ? 164 TYR C CE2   1 
ATOM   10019 C  CZ    . TYR C 1 185 ? 14.467  15.243  126.079 1.00 251.17 ? 164 TYR C CZ    1 
ATOM   10020 O  OH    . TYR C 1 185 ? 14.294  15.777  127.338 1.00 273.44 ? 164 TYR C OH    1 
ATOM   10021 N  N     . GLU C 1 186 ? 14.781  10.882  120.334 1.00 233.66 ? 165 GLU C N     1 
ATOM   10022 C  CA    . GLU C 1 186 ? 14.691  10.395  118.967 1.00 213.93 ? 165 GLU C CA    1 
ATOM   10023 C  C     . GLU C 1 186 ? 13.457  10.980  118.303 1.00 222.31 ? 165 GLU C C     1 
ATOM   10024 O  O     . GLU C 1 186 ? 12.372  10.971  118.893 1.00 210.73 ? 165 GLU C O     1 
ATOM   10025 C  CB    . GLU C 1 186 ? 14.603  8.876   118.879 1.00 224.38 ? 165 GLU C CB    1 
ATOM   10026 C  CG    . GLU C 1 186 ? 14.470  8.431   117.431 1.00 218.19 ? 165 GLU C CG    1 
ATOM   10027 C  CD    . GLU C 1 186 ? 14.149  6.962   117.272 1.00 227.41 ? 165 GLU C CD    1 
ATOM   10028 O  OE1   . GLU C 1 186 ? 13.125  6.504   117.843 1.00 214.85 ? 165 GLU C OE1   1 
ATOM   10029 O  OE2   . GLU C 1 186 ? 14.906  6.279   116.551 1.00 228.92 ? 165 GLU C OE2   1 
ATOM   10030 N  N     . LEU C 1 187 ? 13.624  11.526  117.101 1.00 212.83 ? 166 LEU C N     1 
ATOM   10031 C  CA    . LEU C 1 187 ? 12.467  11.944  116.319 1.00 230.18 ? 166 LEU C CA    1 
ATOM   10032 C  C     . LEU C 1 187 ? 11.835  10.709  115.688 1.00 247.43 ? 166 LEU C C     1 
ATOM   10033 O  O     . LEU C 1 187 ? 12.449  10.052  114.841 1.00 247.94 ? 166 LEU C O     1 
ATOM   10034 C  CB    . LEU C 1 187 ? 12.872  12.937  115.232 1.00 214.75 ? 166 LEU C CB    1 
ATOM   10035 C  CG    . LEU C 1 187 ? 13.097  14.396  115.617 1.00 216.18 ? 166 LEU C CG    1 
ATOM   10036 C  CD1   . LEU C 1 187 ? 13.481  15.180  114.377 1.00 212.47 ? 166 LEU C CD1   1 
ATOM   10037 C  CD2   . LEU C 1 187 ? 11.859  14.990  116.285 1.00 217.26 ? 166 LEU C CD2   1 
ATOM   10038 N  N     . ARG C 1 188 ? 10.603  10.402  116.090 1.00 262.09 ? 167 ARG C N     1 
ATOM   10039 C  CA    . ARG C 1 188 ? 9.928   9.174   115.691 1.00 251.81 ? 167 ARG C CA    1 
ATOM   10040 C  C     . ARG C 1 188 ? 8.950   9.404   114.534 1.00 249.38 ? 167 ARG C C     1 
ATOM   10041 O  O     . ARG C 1 188 ? 8.408   8.437   113.983 1.00 255.48 ? 167 ARG C O     1 
ATOM   10042 C  CB    . ARG C 1 188 ? 9.207   8.601   116.932 1.00 239.82 ? 167 ARG C CB    1 
ATOM   10043 C  CG    . ARG C 1 188 ? 8.682   7.182   116.869 1.00 226.37 ? 167 ARG C CG    1 
ATOM   10044 C  CD    . ARG C 1 188 ? 9.775   6.145   116.752 1.00 216.00 ? 167 ARG C CD    1 
ATOM   10045 N  NE    . ARG C 1 188 ? 9.172   4.829   116.569 1.00 221.15 ? 167 ARG C NE    1 
ATOM   10046 C  CZ    . ARG C 1 188 ? 8.670   4.387   115.418 1.00 216.12 ? 167 ARG C CZ    1 
ATOM   10047 N  NH1   . ARG C 1 188 ? 8.130   3.175   115.354 1.00 216.35 ? 167 ARG C NH1   1 
ATOM   10048 N  NH2   . ARG C 1 188 ? 8.708   5.151   114.329 1.00 201.38 ? 167 ARG C NH2   1 
ATOM   10049 N  N     . CYS C 1 189 ? 8.751   10.665  114.136 1.00 239.10 ? 168 CYS C N     1 
ATOM   10050 C  CA    . CYS C 1 189 ? 7.801   11.083  113.109 1.00 232.00 ? 168 CYS C CA    1 
ATOM   10051 C  C     . CYS C 1 189 ? 8.414   11.438  111.747 1.00 225.63 ? 168 CYS C C     1 
ATOM   10052 O  O     . CYS C 1 189 ? 7.684   11.944  110.887 1.00 226.51 ? 168 CYS C O     1 
ATOM   10053 C  CB    . CYS C 1 189 ? 6.984   12.265  113.627 1.00 230.44 ? 168 CYS C CB    1 
ATOM   10054 S  SG    . CYS C 1 189 ? 8.001   13.567  114.347 1.00 229.01 ? 168 CYS C SG    1 
ATOM   10055 N  N     . MET C 1 190 ? 9.719   11.220  111.522 1.00 223.69 ? 169 MET C N     1 
ATOM   10056 C  CA    . MET C 1 190 ? 10.357  11.777  110.321 1.00 207.65 ? 169 MET C CA    1 
ATOM   10057 C  C     . MET C 1 190 ? 9.694   11.324  109.017 1.00 203.30 ? 169 MET C C     1 
ATOM   10058 O  O     . MET C 1 190 ? 9.909   11.963  107.983 1.00 197.99 ? 169 MET C O     1 
ATOM   10059 C  CB    . MET C 1 190 ? 11.856  11.441  110.274 1.00 199.95 ? 169 MET C CB    1 
ATOM   10060 C  CG    . MET C 1 190 ? 12.829  12.510  110.859 1.00 195.96 ? 169 MET C CG    1 
ATOM   10061 S  SD    . MET C 1 190 ? 12.940  14.122  110.019 1.00 173.60 ? 169 MET C SD    1 
ATOM   10062 C  CE    . MET C 1 190 ? 13.864  13.677  108.543 1.00 166.86 ? 169 MET C CE    1 
ATOM   10063 N  N     . ALA C 1 191 ? 8.934   10.220  109.027 1.00 202.20 ? 170 ALA C N     1 
ATOM   10064 C  CA    . ALA C 1 191 ? 8.285   9.730   107.806 1.00 212.61 ? 170 ALA C CA    1 
ATOM   10065 C  C     . ALA C 1 191 ? 7.189   10.678  107.314 1.00 202.03 ? 170 ALA C C     1 
ATOM   10066 O  O     . ALA C 1 191 ? 7.122   10.992  106.119 1.00 197.85 ? 170 ALA C O     1 
ATOM   10067 C  CB    . ALA C 1 191 ? 7.718   8.327   108.035 1.00 221.15 ? 170 ALA C CB    1 
ATOM   10068 N  N     . LEU C 1 192 ? 6.286   11.105  108.208 1.00 209.51 ? 171 LEU C N     1 
ATOM   10069 C  CA    . LEU C 1 192 ? 5.294   12.117  107.840 1.00 192.53 ? 171 LEU C CA    1 
ATOM   10070 C  C     . LEU C 1 192 ? 5.962   13.446  107.511 1.00 190.11 ? 171 LEU C C     1 
ATOM   10071 O  O     . LEU C 1 192 ? 5.399   14.262  106.771 1.00 157.62 ? 171 LEU C O     1 
ATOM   10072 C  CB    . LEU C 1 192 ? 4.266   12.309  108.963 1.00 182.45 ? 171 LEU C CB    1 
ATOM   10073 C  CG    . LEU C 1 192 ? 3.266   11.217  109.362 1.00 202.64 ? 171 LEU C CG    1 
ATOM   10074 C  CD1   . LEU C 1 192 ? 2.543   11.589  110.669 1.00 202.60 ? 171 LEU C CD1   1 
ATOM   10075 C  CD2   . LEU C 1 192 ? 2.253   10.973  108.241 1.00 177.51 ? 171 LEU C CD2   1 
ATOM   10076 N  N     . CYS C 1 193 ? 7.149   13.684  108.079 1.00 195.77 ? 172 CYS C N     1 
ATOM   10077 C  CA    . CYS C 1 193 ? 7.896   14.917  107.842 1.00 196.75 ? 172 CYS C CA    1 
ATOM   10078 C  C     . CYS C 1 193 ? 8.341   15.013  106.394 1.00 190.31 ? 172 CYS C C     1 
ATOM   10079 O  O     . CYS C 1 193 ? 8.253   16.074  105.762 1.00 177.69 ? 172 CYS C O     1 
ATOM   10080 C  CB    . CYS C 1 193 ? 9.150   14.928  108.716 1.00 195.42 ? 172 CYS C CB    1 
ATOM   10081 S  SG    . CYS C 1 193 ? 8.922   15.129  110.468 1.00 208.86 ? 172 CYS C SG    1 
ATOM   10082 N  N     . ASP C 1 194 ? 8.877   13.909  105.880 1.00 203.49 ? 173 ASP C N     1 
ATOM   10083 C  CA    . ASP C 1 194 ? 9.351   13.833  104.507 1.00 199.01 ? 173 ASP C CA    1 
ATOM   10084 C  C     . ASP C 1 194 ? 8.204   13.919  103.503 1.00 199.46 ? 173 ASP C C     1 
ATOM   10085 O  O     . ASP C 1 194 ? 8.365   14.493  102.420 1.00 206.69 ? 173 ASP C O     1 
ATOM   10086 C  CB    . ASP C 1 194 ? 10.149  12.538  104.343 1.00 184.17 ? 173 ASP C CB    1 
ATOM   10087 C  CG    . ASP C 1 194 ? 11.481  12.580  105.084 1.00 166.84 ? 173 ASP C CG    1 
ATOM   10088 O  OD1   . ASP C 1 194 ? 11.876  13.667  105.565 1.00 153.60 ? 173 ASP C OD1   1 
ATOM   10089 O  OD2   . ASP C 1 194 ? 12.116  11.509  105.212 1.00 159.34 ? 173 ASP C OD2   1 
ATOM   10090 N  N     . ARG C 1 195 ? 7.045   13.345  103.830 1.00 196.24 ? 174 ARG C N     1 
ATOM   10091 C  CA    . ARG C 1 195 ? 5.932   13.407  102.888 1.00 191.03 ? 174 ARG C CA    1 
ATOM   10092 C  C     . ARG C 1 195 ? 5.441   14.847  102.689 1.00 172.31 ? 174 ARG C C     1 
ATOM   10093 O  O     . ARG C 1 195 ? 5.026   15.197  101.582 1.00 180.62 ? 174 ARG C O     1 
ATOM   10094 C  CB    . ARG C 1 195 ? 4.821   12.421  103.312 1.00 187.88 ? 174 ARG C CB    1 
ATOM   10095 C  CG    . ARG C 1 195 ? 3.628   12.312  102.342 1.00 165.72 ? 174 ARG C CG    1 
ATOM   10096 C  CD    . ARG C 1 195 ? 2.570   11.275  102.751 1.00 166.64 ? 174 ARG C CD    1 
ATOM   10097 N  NE    . ARG C 1 195 ? 2.873   10.570  103.996 1.00 198.09 ? 174 ARG C NE    1 
ATOM   10098 C  CZ    . ARG C 1 195 ? 2.273   9.446   104.388 1.00 225.28 ? 174 ARG C CZ    1 
ATOM   10099 N  NH1   . ARG C 1 195 ? 1.333   8.890   103.628 1.00 231.63 ? 174 ARG C NH1   1 
ATOM   10100 N  NH2   . ARG C 1 195 ? 2.604   8.879   105.547 1.00 220.39 ? 174 ARG C NH2   1 
ATOM   10101 N  N     . LEU C 1 196 ? 5.463   15.697  103.722 1.00 176.41 ? 175 LEU C N     1 
ATOM   10102 C  CA    . LEU C 1 196 ? 5.036   17.084  103.508 1.00 173.97 ? 175 LEU C CA    1 
ATOM   10103 C  C     . LEU C 1 196 ? 6.074   17.903  102.743 1.00 162.69 ? 175 LEU C C     1 
ATOM   10104 O  O     . LEU C 1 196 ? 5.719   18.705  101.869 1.00 168.57 ? 175 LEU C O     1 
ATOM   10105 C  CB    . LEU C 1 196 ? 4.711   17.790  104.824 1.00 185.83 ? 175 LEU C CB    1 
ATOM   10106 C  CG    . LEU C 1 196 ? 3.534   17.345  105.681 1.00 172.65 ? 175 LEU C CG    1 
ATOM   10107 C  CD1   . LEU C 1 196 ? 3.447   18.274  106.872 1.00 147.91 ? 175 LEU C CD1   1 
ATOM   10108 C  CD2   . LEU C 1 196 ? 2.229   17.336  104.891 1.00 176.20 ? 175 LEU C CD2   1 
ATOM   10109 N  N     . ARG C 1 197 ? 7.349   17.793  103.124 1.00 152.78 ? 176 ARG C N     1 
ATOM   10110 C  CA    . ARG C 1 197 ? 8.404   18.436  102.347 1.00 160.82 ? 176 ARG C CA    1 
ATOM   10111 C  C     . ARG C 1 197 ? 8.301   18.029  100.882 1.00 183.44 ? 176 ARG C C     1 
ATOM   10112 O  O     . ARG C 1 197 ? 8.404   18.872  99.987  1.00 181.05 ? 176 ARG C O     1 
ATOM   10113 C  CB    . ARG C 1 197 ? 9.780   18.071  102.929 1.00 164.09 ? 176 ARG C CB    1 
ATOM   10114 C  CG    . ARG C 1 197 ? 10.952  18.933  102.456 1.00 156.59 ? 176 ARG C CG    1 
ATOM   10115 C  CD    . ARG C 1 197 ? 12.190  18.749  103.342 1.00 147.40 ? 176 ARG C CD    1 
ATOM   10116 N  NE    . ARG C 1 197 ? 12.681  17.377  103.370 1.00 156.17 ? 176 ARG C NE    1 
ATOM   10117 C  CZ    . ARG C 1 197 ? 13.549  16.887  102.490 1.00 159.43 ? 176 ARG C CZ    1 
ATOM   10118 N  NH1   . ARG C 1 197 ? 14.020  17.659  101.523 1.00 14