data_5Y9F
# 
_entry.id   5Y9F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5Y9F         
WWPDB D_1300004881 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5Y9F 
_pdbx_database_status.recvd_initial_deposition_date   2017-08-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, S.W.' 1 ? 
'Li, Z.H.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            MBio 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2150-7511 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Crystal Structures of Two Immune Complexes Identify Determinants for Viral Infectivity and Type-Specific Neutralization of Human Papillomavirus.
;
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1128/mBio.00787-17 
_citation.pdbx_database_id_PubMed   28951471 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, Z.'         1  
primary 'Wang, D.'       2  
primary 'Gu, Y.'         3  
primary 'Song, S.'       4  
primary 'He, M.'         5  
primary 'Shi, J.'        6  
primary 'Liu, X.'        7  
primary 'Wei, S.'        8  
primary 'Li, J.'         9  
primary 'Yu, H.'         10 
primary 'Zheng, Q.'      11 
primary 'Yan, X.'        12 
primary 'Baker, T.S.'    13 
primary 'Zhang, J.'      14 
primary 'McLellan, J.S.' 15 
primary 'Li, S.'         16 
primary 'Xia, N.'        17 
# 
_cell.entry_id           5Y9F 
_cell.length_a           116.265 
_cell.length_b           417.233 
_cell.length_c           134.942 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.02 
_cell.angle_gamma        90.00 
_cell.Z_PDB              20 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5Y9F 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Major capsid protein L1'                        55962.355 10 ? C175S 'UNP RESIDUES 10-508' ? 
2 polymer nat 'light chains of Fab fragment of antibody 28F10' 24133.754 10 ? ?     ?                     ? 
3 polymer nat 'heavy chain of Fab fragment of antibody 28F10'  23904.793 10 ? ?     ?                     ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MKVYLPPPSVAKVVSTDEYVTRTSIFYHAGSSRLLTVGHPYFKVPKGGNGRQDVPKVSAYQYRVFRVKLPDPNKFGLPDN
TVYDPNSQRLVWACVGVEIGRGQPLGVGLSGHPLYNKLDDTENSHVASAVDTKDTRDNVSVDYKQTQLCIIGCVPAIGEH
WTKGTASKPTTVVQGDCPPLELINTPIEDGDMVDTGYGAMDFKLLQDNKSEVPLDICQSICKYPDYLQMSADAYGDSMFF
CLRREQVFARHFWNRSGTMGDQLPESLYIKGTDIRANPGSYLYSPSPSGSVVTSDSQLFNKPYWLHKAQGLNNGICWHNQ
LFLTVVDTTRSTNLSVCASTTSSIPNVYTPTSFKEYARHVEEFDLQFIFQLCKITLTTEVMSYIHNMNTTILEDWNFGVT
PPPTASLVDTYRFVQSAAVTCQKDTAPPVKQDPYDKLKFWPVDLKERFSADLDQFPLGRKFLLQLGARPKPTIGPRKRAA
PAPTSTPSPKRVKRRKSSRK
;
;MKVYLPPPSVAKVVSTDEYVTRTSIFYHAGSSRLLTVGHPYFKVPKGGNGRQDVPKVSAYQYRVFRVKLPDPNKFGLPDN
TVYDPNSQRLVWACVGVEIGRGQPLGVGLSGHPLYNKLDDTENSHVASAVDTKDTRDNVSVDYKQTQLCIIGCVPAIGEH
WTKGTASKPTTVVQGDCPPLELINTPIEDGDMVDTGYGAMDFKLLQDNKSEVPLDICQSICKYPDYLQMSADAYGDSMFF
CLRREQVFARHFWNRSGTMGDQLPESLYIKGTDIRANPGSYLYSPSPSGSVVTSDSQLFNKPYWLHKAQGLNNGICWHNQ
LFLTVVDTTRSTNLSVCASTTSSIPNVYTPTSFKEYARHVEEFDLQFIFQLCKITLTTEVMSYIHNMNTTILEDWNFGVT
PPPTASLVDTYRFVQSAAVTCQKDTAPPVKQDPYDKLKFWPVDLKERFSADLDQFPLGRKFLLQLGARPKPTIGPRKRAA
PAPTSTPSPKRVKRRKSSRK
;
A,B,C,D,E,F,G,H,I,J ? 
2 'polypeptide(L)' no no 
;DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKSGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYFCSQSTHVPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKSGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYFCSQSTHVPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
K,O,Q,S,M,c,W,Y,a,U ? 
3 'polypeptide(L)' no no 
;DVKLVESGGGLVKPGGSLKLSCAASGFPFSDYTMSWIRQTPEKRLEWVASISSGGTYTYYPDTVKGRFTISRDNAKNTLY
LQMSSLKSEDTAMFYCTRASPYYDYDEGYMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPV
TLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIVPA
;
;DVKLVESGGGLVKPGGSLKLSCAASGFPFSDYTMSWIRQTPEKRLEWVASISSGGTYTYYPDTVKGRFTISRDNAKNTLY
LQMSSLKSEDTAMFYCTRASPYYDYDEGYMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPV
TLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIVPA
;
L,P,R,T,N,d,V,X,Z,b ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   TYR n 
1 5   LEU n 
1 6   PRO n 
1 7   PRO n 
1 8   PRO n 
1 9   SER n 
1 10  VAL n 
1 11  ALA n 
1 12  LYS n 
1 13  VAL n 
1 14  VAL n 
1 15  SER n 
1 16  THR n 
1 17  ASP n 
1 18  GLU n 
1 19  TYR n 
1 20  VAL n 
1 21  THR n 
1 22  ARG n 
1 23  THR n 
1 24  SER n 
1 25  ILE n 
1 26  PHE n 
1 27  TYR n 
1 28  HIS n 
1 29  ALA n 
1 30  GLY n 
1 31  SER n 
1 32  SER n 
1 33  ARG n 
1 34  LEU n 
1 35  LEU n 
1 36  THR n 
1 37  VAL n 
1 38  GLY n 
1 39  HIS n 
1 40  PRO n 
1 41  TYR n 
1 42  PHE n 
1 43  LYS n 
1 44  VAL n 
1 45  PRO n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  ASN n 
1 50  GLY n 
1 51  ARG n 
1 52  GLN n 
1 53  ASP n 
1 54  VAL n 
1 55  PRO n 
1 56  LYS n 
1 57  VAL n 
1 58  SER n 
1 59  ALA n 
1 60  TYR n 
1 61  GLN n 
1 62  TYR n 
1 63  ARG n 
1 64  VAL n 
1 65  PHE n 
1 66  ARG n 
1 67  VAL n 
1 68  LYS n 
1 69  LEU n 
1 70  PRO n 
1 71  ASP n 
1 72  PRO n 
1 73  ASN n 
1 74  LYS n 
1 75  PHE n 
1 76  GLY n 
1 77  LEU n 
1 78  PRO n 
1 79  ASP n 
1 80  ASN n 
1 81  THR n 
1 82  VAL n 
1 83  TYR n 
1 84  ASP n 
1 85  PRO n 
1 86  ASN n 
1 87  SER n 
1 88  GLN n 
1 89  ARG n 
1 90  LEU n 
1 91  VAL n 
1 92  TRP n 
1 93  ALA n 
1 94  CYS n 
1 95  VAL n 
1 96  GLY n 
1 97  VAL n 
1 98  GLU n 
1 99  ILE n 
1 100 GLY n 
1 101 ARG n 
1 102 GLY n 
1 103 GLN n 
1 104 PRO n 
1 105 LEU n 
1 106 GLY n 
1 107 VAL n 
1 108 GLY n 
1 109 LEU n 
1 110 SER n 
1 111 GLY n 
1 112 HIS n 
1 113 PRO n 
1 114 LEU n 
1 115 TYR n 
1 116 ASN n 
1 117 LYS n 
1 118 LEU n 
1 119 ASP n 
1 120 ASP n 
1 121 THR n 
1 122 GLU n 
1 123 ASN n 
1 124 SER n 
1 125 HIS n 
1 126 VAL n 
1 127 ALA n 
1 128 SER n 
1 129 ALA n 
1 130 VAL n 
1 131 ASP n 
1 132 THR n 
1 133 LYS n 
1 134 ASP n 
1 135 THR n 
1 136 ARG n 
1 137 ASP n 
1 138 ASN n 
1 139 VAL n 
1 140 SER n 
1 141 VAL n 
1 142 ASP n 
1 143 TYR n 
1 144 LYS n 
1 145 GLN n 
1 146 THR n 
1 147 GLN n 
1 148 LEU n 
1 149 CYS n 
1 150 ILE n 
1 151 ILE n 
1 152 GLY n 
1 153 CYS n 
1 154 VAL n 
1 155 PRO n 
1 156 ALA n 
1 157 ILE n 
1 158 GLY n 
1 159 GLU n 
1 160 HIS n 
1 161 TRP n 
1 162 THR n 
1 163 LYS n 
1 164 GLY n 
1 165 THR n 
1 166 ALA n 
1 167 SER n 
1 168 LYS n 
1 169 PRO n 
1 170 THR n 
1 171 THR n 
1 172 VAL n 
1 173 VAL n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 CYS n 
1 178 PRO n 
1 179 PRO n 
1 180 LEU n 
1 181 GLU n 
1 182 LEU n 
1 183 ILE n 
1 184 ASN n 
1 185 THR n 
1 186 PRO n 
1 187 ILE n 
1 188 GLU n 
1 189 ASP n 
1 190 GLY n 
1 191 ASP n 
1 192 MET n 
1 193 VAL n 
1 194 ASP n 
1 195 THR n 
1 196 GLY n 
1 197 TYR n 
1 198 GLY n 
1 199 ALA n 
1 200 MET n 
1 201 ASP n 
1 202 PHE n 
1 203 LYS n 
1 204 LEU n 
1 205 LEU n 
1 206 GLN n 
1 207 ASP n 
1 208 ASN n 
1 209 LYS n 
1 210 SER n 
1 211 GLU n 
1 212 VAL n 
1 213 PRO n 
1 214 LEU n 
1 215 ASP n 
1 216 ILE n 
1 217 CYS n 
1 218 GLN n 
1 219 SER n 
1 220 ILE n 
1 221 CYS n 
1 222 LYS n 
1 223 TYR n 
1 224 PRO n 
1 225 ASP n 
1 226 TYR n 
1 227 LEU n 
1 228 GLN n 
1 229 MET n 
1 230 SER n 
1 231 ALA n 
1 232 ASP n 
1 233 ALA n 
1 234 TYR n 
1 235 GLY n 
1 236 ASP n 
1 237 SER n 
1 238 MET n 
1 239 PHE n 
1 240 PHE n 
1 241 CYS n 
1 242 LEU n 
1 243 ARG n 
1 244 ARG n 
1 245 GLU n 
1 246 GLN n 
1 247 VAL n 
1 248 PHE n 
1 249 ALA n 
1 250 ARG n 
1 251 HIS n 
1 252 PHE n 
1 253 TRP n 
1 254 ASN n 
1 255 ARG n 
1 256 SER n 
1 257 GLY n 
1 258 THR n 
1 259 MET n 
1 260 GLY n 
1 261 ASP n 
1 262 GLN n 
1 263 LEU n 
1 264 PRO n 
1 265 GLU n 
1 266 SER n 
1 267 LEU n 
1 268 TYR n 
1 269 ILE n 
1 270 LYS n 
1 271 GLY n 
1 272 THR n 
1 273 ASP n 
1 274 ILE n 
1 275 ARG n 
1 276 ALA n 
1 277 ASN n 
1 278 PRO n 
1 279 GLY n 
1 280 SER n 
1 281 TYR n 
1 282 LEU n 
1 283 TYR n 
1 284 SER n 
1 285 PRO n 
1 286 SER n 
1 287 PRO n 
1 288 SER n 
1 289 GLY n 
1 290 SER n 
1 291 VAL n 
1 292 VAL n 
1 293 THR n 
1 294 SER n 
1 295 ASP n 
1 296 SER n 
1 297 GLN n 
1 298 LEU n 
1 299 PHE n 
1 300 ASN n 
1 301 LYS n 
1 302 PRO n 
1 303 TYR n 
1 304 TRP n 
1 305 LEU n 
1 306 HIS n 
1 307 LYS n 
1 308 ALA n 
1 309 GLN n 
1 310 GLY n 
1 311 LEU n 
1 312 ASN n 
1 313 ASN n 
1 314 GLY n 
1 315 ILE n 
1 316 CYS n 
1 317 TRP n 
1 318 HIS n 
1 319 ASN n 
1 320 GLN n 
1 321 LEU n 
1 322 PHE n 
1 323 LEU n 
1 324 THR n 
1 325 VAL n 
1 326 VAL n 
1 327 ASP n 
1 328 THR n 
1 329 THR n 
1 330 ARG n 
1 331 SER n 
1 332 THR n 
1 333 ASN n 
1 334 LEU n 
1 335 SER n 
1 336 VAL n 
1 337 CYS n 
1 338 ALA n 
1 339 SER n 
1 340 THR n 
1 341 THR n 
1 342 SER n 
1 343 SER n 
1 344 ILE n 
1 345 PRO n 
1 346 ASN n 
1 347 VAL n 
1 348 TYR n 
1 349 THR n 
1 350 PRO n 
1 351 THR n 
1 352 SER n 
1 353 PHE n 
1 354 LYS n 
1 355 GLU n 
1 356 TYR n 
1 357 ALA n 
1 358 ARG n 
1 359 HIS n 
1 360 VAL n 
1 361 GLU n 
1 362 GLU n 
1 363 PHE n 
1 364 ASP n 
1 365 LEU n 
1 366 GLN n 
1 367 PHE n 
1 368 ILE n 
1 369 PHE n 
1 370 GLN n 
1 371 LEU n 
1 372 CYS n 
1 373 LYS n 
1 374 ILE n 
1 375 THR n 
1 376 LEU n 
1 377 THR n 
1 378 THR n 
1 379 GLU n 
1 380 VAL n 
1 381 MET n 
1 382 SER n 
1 383 TYR n 
1 384 ILE n 
1 385 HIS n 
1 386 ASN n 
1 387 MET n 
1 388 ASN n 
1 389 THR n 
1 390 THR n 
1 391 ILE n 
1 392 LEU n 
1 393 GLU n 
1 394 ASP n 
1 395 TRP n 
1 396 ASN n 
1 397 PHE n 
1 398 GLY n 
1 399 VAL n 
1 400 THR n 
1 401 PRO n 
1 402 PRO n 
1 403 PRO n 
1 404 THR n 
1 405 ALA n 
1 406 SER n 
1 407 LEU n 
1 408 VAL n 
1 409 ASP n 
1 410 THR n 
1 411 TYR n 
1 412 ARG n 
1 413 PHE n 
1 414 VAL n 
1 415 GLN n 
1 416 SER n 
1 417 ALA n 
1 418 ALA n 
1 419 VAL n 
1 420 THR n 
1 421 CYS n 
1 422 GLN n 
1 423 LYS n 
1 424 ASP n 
1 425 THR n 
1 426 ALA n 
1 427 PRO n 
1 428 PRO n 
1 429 VAL n 
1 430 LYS n 
1 431 GLN n 
1 432 ASP n 
1 433 PRO n 
1 434 TYR n 
1 435 ASP n 
1 436 LYS n 
1 437 LEU n 
1 438 LYS n 
1 439 PHE n 
1 440 TRP n 
1 441 PRO n 
1 442 VAL n 
1 443 ASP n 
1 444 LEU n 
1 445 LYS n 
1 446 GLU n 
1 447 ARG n 
1 448 PHE n 
1 449 SER n 
1 450 ALA n 
1 451 ASP n 
1 452 LEU n 
1 453 ASP n 
1 454 GLN n 
1 455 PHE n 
1 456 PRO n 
1 457 LEU n 
1 458 GLY n 
1 459 ARG n 
1 460 LYS n 
1 461 PHE n 
1 462 LEU n 
1 463 LEU n 
1 464 GLN n 
1 465 LEU n 
1 466 GLY n 
1 467 ALA n 
1 468 ARG n 
1 469 PRO n 
1 470 LYS n 
1 471 PRO n 
1 472 THR n 
1 473 ILE n 
1 474 GLY n 
1 475 PRO n 
1 476 ARG n 
1 477 LYS n 
1 478 ARG n 
1 479 ALA n 
1 480 ALA n 
1 481 PRO n 
1 482 ALA n 
1 483 PRO n 
1 484 THR n 
1 485 SER n 
1 486 THR n 
1 487 PRO n 
1 488 SER n 
1 489 PRO n 
1 490 LYS n 
1 491 ARG n 
1 492 VAL n 
1 493 LYS n 
1 494 ARG n 
1 495 ARG n 
1 496 LYS n 
1 497 SER n 
1 498 SER n 
1 499 ARG n 
1 500 LYS n 
2 1   ASP n 
2 2   VAL n 
2 3   VAL n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   THR n 
2 8   PRO n 
2 9   LEU n 
2 10  SER n 
2 11  LEU n 
2 12  PRO n 
2 13  VAL n 
2 14  SER n 
2 15  LEU n 
2 16  GLY n 
2 17  ASP n 
2 18  GLN n 
2 19  ALA n 
2 20  SER n 
2 21  ILE n 
2 22  SER n 
2 23  CYS n 
2 24  ARG n 
2 25  SER n 
2 26  SER n 
2 27  GLN n 
2 28  SER n 
2 29  LEU n 
2 30  VAL n 
2 31  HIS n 
2 32  SER n 
2 33  ASN n 
2 34  GLY n 
2 35  ASN n 
2 36  THR n 
2 37  TYR n 
2 38  LEU n 
2 39  HIS n 
2 40  TRP n 
2 41  TYR n 
2 42  LEU n 
2 43  GLN n 
2 44  LYS n 
2 45  SER n 
2 46  GLY n 
2 47  GLN n 
2 48  SER n 
2 49  PRO n 
2 50  LYS n 
2 51  LEU n 
2 52  LEU n 
2 53  ILE n 
2 54  TYR n 
2 55  LYS n 
2 56  VAL n 
2 57  SER n 
2 58  ASN n 
2 59  ARG n 
2 60  PHE n 
2 61  SER n 
2 62  GLY n 
2 63  VAL n 
2 64  PRO n 
2 65  ASP n 
2 66  ARG n 
2 67  PHE n 
2 68  SER n 
2 69  GLY n 
2 70  SER n 
2 71  GLY n 
2 72  SER n 
2 73  GLY n 
2 74  THR n 
2 75  ASP n 
2 76  PHE n 
2 77  THR n 
2 78  LEU n 
2 79  LYS n 
2 80  ILE n 
2 81  SER n 
2 82  ARG n 
2 83  VAL n 
2 84  GLU n 
2 85  ALA n 
2 86  GLU n 
2 87  ASP n 
2 88  LEU n 
2 89  GLY n 
2 90  VAL n 
2 91  TYR n 
2 92  PHE n 
2 93  CYS n 
2 94  SER n 
2 95  GLN n 
2 96  SER n 
2 97  THR n 
2 98  HIS n 
2 99  VAL n 
2 100 PRO n 
2 101 PHE n 
2 102 THR n 
2 103 PHE n 
2 104 GLY n 
2 105 ALA n 
2 106 GLY n 
2 107 THR n 
2 108 LYS n 
2 109 LEU n 
2 110 GLU n 
2 111 LEU n 
2 112 LYS n 
2 113 ARG n 
2 114 ALA n 
2 115 ASP n 
2 116 ALA n 
2 117 ALA n 
2 118 PRO n 
2 119 THR n 
2 120 VAL n 
2 121 SER n 
2 122 ILE n 
2 123 PHE n 
2 124 PRO n 
2 125 PRO n 
2 126 SER n 
2 127 SER n 
2 128 GLU n 
2 129 GLN n 
2 130 LEU n 
2 131 THR n 
2 132 SER n 
2 133 GLY n 
2 134 GLY n 
2 135 ALA n 
2 136 SER n 
2 137 VAL n 
2 138 VAL n 
2 139 CYS n 
2 140 PHE n 
2 141 LEU n 
2 142 ASN n 
2 143 ASN n 
2 144 PHE n 
2 145 TYR n 
2 146 PRO n 
2 147 LYS n 
2 148 ASP n 
2 149 ILE n 
2 150 ASN n 
2 151 VAL n 
2 152 LYS n 
2 153 TRP n 
2 154 LYS n 
2 155 ILE n 
2 156 ASP n 
2 157 GLY n 
2 158 SER n 
2 159 GLU n 
2 160 ARG n 
2 161 GLN n 
2 162 ASN n 
2 163 GLY n 
2 164 VAL n 
2 165 LEU n 
2 166 ASN n 
2 167 SER n 
2 168 TRP n 
2 169 THR n 
2 170 ASP n 
2 171 GLN n 
2 172 ASP n 
2 173 SER n 
2 174 LYS n 
2 175 ASP n 
2 176 SER n 
2 177 THR n 
2 178 TYR n 
2 179 SER n 
2 180 MET n 
2 181 SER n 
2 182 SER n 
2 183 THR n 
2 184 LEU n 
2 185 THR n 
2 186 LEU n 
2 187 THR n 
2 188 LYS n 
2 189 ASP n 
2 190 GLU n 
2 191 TYR n 
2 192 GLU n 
2 193 ARG n 
2 194 HIS n 
2 195 ASN n 
2 196 SER n 
2 197 TYR n 
2 198 THR n 
2 199 CYS n 
2 200 GLU n 
2 201 ALA n 
2 202 THR n 
2 203 HIS n 
2 204 LYS n 
2 205 THR n 
2 206 SER n 
2 207 THR n 
2 208 SER n 
2 209 PRO n 
2 210 ILE n 
2 211 VAL n 
2 212 LYS n 
2 213 SER n 
2 214 PHE n 
2 215 ASN n 
2 216 ARG n 
2 217 ASN n 
2 218 GLU n 
2 219 CYS n 
3 1   ASP n 
3 2   VAL n 
3 3   LYS n 
3 4   LEU n 
3 5   VAL n 
3 6   GLU n 
3 7   SER n 
3 8   GLY n 
3 9   GLY n 
3 10  GLY n 
3 11  LEU n 
3 12  VAL n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  GLY n 
3 17  SER n 
3 18  LEU n 
3 19  LYS n 
3 20  LEU n 
3 21  SER n 
3 22  CYS n 
3 23  ALA n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  PHE n 
3 28  PRO n 
3 29  PHE n 
3 30  SER n 
3 31  ASP n 
3 32  TYR n 
3 33  THR n 
3 34  MET n 
3 35  SER n 
3 36  TRP n 
3 37  ILE n 
3 38  ARG n 
3 39  GLN n 
3 40  THR n 
3 41  PRO n 
3 42  GLU n 
3 43  LYS n 
3 44  ARG n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  VAL n 
3 49  ALA n 
3 50  SER n 
3 51  ILE n 
3 52  SER n 
3 53  SER n 
3 54  GLY n 
3 55  GLY n 
3 56  THR n 
3 57  TYR n 
3 58  THR n 
3 59  TYR n 
3 60  TYR n 
3 61  PRO n 
3 62  ASP n 
3 63  THR n 
3 64  VAL n 
3 65  LYS n 
3 66  GLY n 
3 67  ARG n 
3 68  PHE n 
3 69  THR n 
3 70  ILE n 
3 71  SER n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  ALA n 
3 76  LYS n 
3 77  ASN n 
3 78  THR n 
3 79  LEU n 
3 80  TYR n 
3 81  LEU n 
3 82  GLN n 
3 83  MET n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  LYS n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  THR n 
3 92  ALA n 
3 93  MET n 
3 94  PHE n 
3 95  TYR n 
3 96  CYS n 
3 97  THR n 
3 98  ARG n 
3 99  ALA n 
3 100 SER n 
3 101 PRO n 
3 102 TYR n 
3 103 TYR n 
3 104 ASP n 
3 105 TYR n 
3 106 ASP n 
3 107 GLU n 
3 108 GLY n 
3 109 TYR n 
3 110 MET n 
3 111 ASP n 
3 112 TYR n 
3 113 TRP n 
3 114 GLY n 
3 115 GLN n 
3 116 GLY n 
3 117 THR n 
3 118 SER n 
3 119 VAL n 
3 120 THR n 
3 121 VAL n 
3 122 SER n 
3 123 SER n 
3 124 ALA n 
3 125 LYS n 
3 126 THR n 
3 127 THR n 
3 128 ALA n 
3 129 PRO n 
3 130 SER n 
3 131 VAL n 
3 132 TYR n 
3 133 PRO n 
3 134 LEU n 
3 135 ALA n 
3 136 PRO n 
3 137 VAL n 
3 138 CYS n 
3 139 GLY n 
3 140 GLY n 
3 141 THR n 
3 142 THR n 
3 143 GLY n 
3 144 SER n 
3 145 SER n 
3 146 VAL n 
3 147 THR n 
3 148 LEU n 
3 149 GLY n 
3 150 CYS n 
3 151 LEU n 
3 152 VAL n 
3 153 LYS n 
3 154 GLY n 
3 155 TYR n 
3 156 PHE n 
3 157 PRO n 
3 158 GLU n 
3 159 PRO n 
3 160 VAL n 
3 161 THR n 
3 162 LEU n 
3 163 THR n 
3 164 TRP n 
3 165 ASN n 
3 166 SER n 
3 167 GLY n 
3 168 SER n 
3 169 LEU n 
3 170 SER n 
3 171 SER n 
3 172 GLY n 
3 173 VAL n 
3 174 HIS n 
3 175 THR n 
3 176 PHE n 
3 177 PRO n 
3 178 ALA n 
3 179 LEU n 
3 180 LEU n 
3 181 GLN n 
3 182 SER n 
3 183 GLY n 
3 184 LEU n 
3 185 TYR n 
3 186 THR n 
3 187 LEU n 
3 188 SER n 
3 189 SER n 
3 190 SER n 
3 191 VAL n 
3 192 THR n 
3 193 VAL n 
3 194 THR n 
3 195 SER n 
3 196 ASN n 
3 197 THR n 
3 198 TRP n 
3 199 PRO n 
3 200 SER n 
3 201 GLN n 
3 202 THR n 
3 203 ILE n 
3 204 THR n 
3 205 CYS n 
3 206 ASN n 
3 207 VAL n 
3 208 ALA n 
3 209 HIS n 
3 210 PRO n 
3 211 ALA n 
3 212 SER n 
3 213 SER n 
3 214 THR n 
3 215 LYS n 
3 216 VAL n 
3 217 ASP n 
3 218 LYS n 
3 219 LYS n 
3 220 ILE n 
3 221 VAL n 
3 222 PRO n 
3 223 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   500 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ORF putative L1, L1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human papillomavirus type 59' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     37115 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2 1 sample 1 219 ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 1 223 ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q81971_HPV59 Q81971 ? 1 
;KVYLPPPSVAKVVSTDEYVTRTSIFYHAGSSRLLTVGHPYFKVPKGGNGRQDVPKVSAYQYRVFRVKLPDPNKFGLPDNT
VYDPNSQRLVWACVGVEIGRGQPLGVGLSGHPLYNKLDDTENSHVASAVDTKDTRDNVSVDYKQTQLCIIGCVPAIGEHW
TKGTACKPTTVVQGDCPPLELINTPIEDGDMVDTGYGAMDFKLLQDNKSEVPLDICQSICKYPDYLQMSADAYGDSMFFC
LRREQVFARHFWNRSGTMGDQLPESLYIKGTDIRANPGSYLYSPSPSGSVVTSDSQLFNKPYWLHKAQGLNNGICWHNQL
FLTVVDTTRSTNLSVCASTTSSIPNVYTPTSFKEYARHVEEFDLQFIFQLCKITLTTEVMSYIHNMNTTILEDWNFGVTP
PPTASLVDTYRFVQSAAVTCQKDTAPPVKQDPYDKLKFWPVDLKERFSADLDQFPLGRKFLLQLGARPKPTIGPRKRAAP
APTSTPSPKRVKRRKSSRK
;
10 
2 PDB 5Y9F         5Y9F   ? 2 ? 1  
3 PDB 5Y9F         5Y9F   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5Y9F A 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
2  1 5Y9F B 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
3  1 5Y9F C 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
4  1 5Y9F D 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
5  1 5Y9F E 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
6  1 5Y9F F 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
7  1 5Y9F G 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
8  1 5Y9F H 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
9  1 5Y9F I 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
10 1 5Y9F J 2 ? 500 ? Q81971 10 ? 508 ? 10 508 
11 2 5Y9F K 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
12 3 5Y9F L 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
13 2 5Y9F O 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
14 3 5Y9F P 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
15 2 5Y9F Q 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
16 3 5Y9F R 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
17 2 5Y9F S 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
18 3 5Y9F T 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
19 2 5Y9F M 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
20 3 5Y9F N 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
21 2 5Y9F c 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
22 3 5Y9F d 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
23 3 5Y9F V 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
24 2 5Y9F W 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
25 3 5Y9F X 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
26 2 5Y9F Y 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
27 3 5Y9F Z 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
28 2 5Y9F a 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
29 3 5Y9F b 1 ? 223 ? 5Y9F   1  ? 223 ? 1  223 
30 2 5Y9F U 1 ? 219 ? 5Y9F   1  ? 219 ? 1  219 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5Y9F MET A 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   1  
1  5Y9F SER A 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 2  
2  5Y9F MET B 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   3  
2  5Y9F SER B 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 4  
3  5Y9F MET C 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   5  
3  5Y9F SER C 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 6  
4  5Y9F MET D 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   7  
4  5Y9F SER D 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 8  
5  5Y9F MET E 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   9  
5  5Y9F SER E 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 10 
6  5Y9F MET F 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   11 
6  5Y9F SER F 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 12 
7  5Y9F MET G 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   13 
7  5Y9F SER G 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 14 
8  5Y9F MET H 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   15 
8  5Y9F SER H 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 16 
9  5Y9F MET I 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   17 
9  5Y9F SER I 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 18 
10 5Y9F MET J 1   ? UNP Q81971 ?   ?   'initiating methionine' 9   19 
10 5Y9F SER J 167 ? UNP Q81971 CYS 175 'engineered mutation'   175 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5Y9F 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.94 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.21 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2% tacsimate, 0.1 M sodium citrate, pH 5.5, 17% (w/v) PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-09-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5Y9F 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.35 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       161106 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5Y9F 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     161016 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.528 
_refine.ls_d_res_high                            3.350 
_refine.ls_percent_reflns_obs                    94.05 
_refine.ls_R_factor_obs                          0.2316 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2300 
_refine.ls_R_factor_R_free                       0.2612 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.99 
_refine.ls_number_reflns_R_free                  8042 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.45 
_refine.pdbx_overall_phase_error                 27.03 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        66832 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               66832 
_refine_hist.d_res_high                       3.350 
_refine_hist.d_res_low                        36.528 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 68573 'X-RAY DIFFRACTION' ? 
f_angle_d          0.649  ? ? 93356 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.110 ? ? 40741 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.045  ? ? 10376 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 11946 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.3496  3.3876  4444 0.3262 81.00 0.3636 . . 214 . . . . 
'X-RAY DIFFRACTION' . 3.3876  3.4275  5109 0.3037 94.00 0.3220 . . 281 . . . . 
'X-RAY DIFFRACTION' . 3.4275  3.4692  5087 0.2981 94.00 0.3403 . . 259 . . . . 
'X-RAY DIFFRACTION' . 3.4692  3.5131  5142 0.2973 94.00 0.3290 . . 257 . . . . 
'X-RAY DIFFRACTION' . 3.5131  3.5593  5129 0.2888 95.00 0.3424 . . 244 . . . . 
'X-RAY DIFFRACTION' . 3.5593  3.6080  5088 0.2919 94.00 0.3458 . . 251 . . . . 
'X-RAY DIFFRACTION' . 3.6080  3.6595  5129 0.2846 94.00 0.3105 . . 278 . . . . 
'X-RAY DIFFRACTION' . 3.6595  3.7141  5121 0.2810 95.00 0.3017 . . 221 . . . . 
'X-RAY DIFFRACTION' . 3.7141  3.7721  5189 0.2672 94.00 0.3209 . . 242 . . . . 
'X-RAY DIFFRACTION' . 3.7721  3.8339  5138 0.2681 95.00 0.3012 . . 262 . . . . 
'X-RAY DIFFRACTION' . 3.8339  3.8999  5089 0.2586 94.00 0.2925 . . 272 . . . . 
'X-RAY DIFFRACTION' . 3.8999  3.9707  5133 0.2586 94.00 0.2798 . . 259 . . . . 
'X-RAY DIFFRACTION' . 3.9707  4.0470  5121 0.2430 95.00 0.2964 . . 251 . . . . 
'X-RAY DIFFRACTION' . 4.0470  4.1295  5117 0.2396 94.00 0.2660 . . 275 . . . . 
'X-RAY DIFFRACTION' . 4.1295  4.2192  5102 0.2340 94.00 0.2633 . . 276 . . . . 
'X-RAY DIFFRACTION' . 4.2192  4.3172  5133 0.2236 95.00 0.2417 . . 252 . . . . 
'X-RAY DIFFRACTION' . 4.3172  4.4249  5078 0.2218 95.00 0.2553 . . 276 . . . . 
'X-RAY DIFFRACTION' . 4.4249  4.5444  5126 0.2188 95.00 0.2572 . . 274 . . . . 
'X-RAY DIFFRACTION' . 4.5444  4.6778  5123 0.2055 94.00 0.2392 . . 294 . . . . 
'X-RAY DIFFRACTION' . 4.6778  4.8285  5147 0.1914 95.00 0.2056 . . 281 . . . . 
'X-RAY DIFFRACTION' . 4.8285  5.0007  5091 0.1953 94.00 0.2284 . . 270 . . . . 
'X-RAY DIFFRACTION' . 5.0007  5.2003  5124 0.1997 95.00 0.2321 . . 281 . . . . 
'X-RAY DIFFRACTION' . 5.2003  5.4363  5131 0.2054 94.00 0.2270 . . 270 . . . . 
'X-RAY DIFFRACTION' . 5.4363  5.7219  5124 0.2138 94.00 0.2521 . . 261 . . . . 
'X-RAY DIFFRACTION' . 5.7219  6.0788  5091 0.2312 95.00 0.2448 . . 319 . . . . 
'X-RAY DIFFRACTION' . 6.0788  6.5457  5123 0.2326 94.00 0.2773 . . 258 . . . . 
'X-RAY DIFFRACTION' . 6.5457  7.1999  5126 0.2224 94.00 0.2713 . . 269 . . . . 
'X-RAY DIFFRACTION' . 7.1999  8.2313  5123 0.2148 95.00 0.2551 . . 288 . . . . 
'X-RAY DIFFRACTION' . 8.2313  10.3316 5176 0.1780 95.00 0.2117 . . 299 . . . . 
'X-RAY DIFFRACTION' . 10.3316 36.5305 5120 0.2026 94.00 0.2329 . . 308 . . . . 
# 
_struct.entry_id                     5Y9F 
_struct.title                        'Crystal structure of HPV59 pentamer in complex with the Fab fragment of antibody 28F10' 
_struct.pdbx_descriptor              
'Major capsid protein L1, light chains of Fab fragment of antibody 28F10, heavy chain of Fab fragment of antibody 28F10' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5Y9F 
_struct_keywords.text            'capsid protein, immune complex, STRUCTURAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN/IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 2 ? 
CA N N 3 ? 
DA N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A  15  ? TYR A  19  ? SER A 23  TYR A 27  5 ? 5 
HELX_P HELX_P2   AA2 ASP A  201 ? GLN A  206 ? ASP A 209 GLN A 214 1 ? 6 
HELX_P HELX_P3   AA3 ASP A  225 ? ALA A  231 ? ASP A 233 ALA A 239 1 ? 7 
HELX_P HELX_P4   AA4 PRO A  264 ? TYR A  268 ? PRO A 272 TYR A 276 5 ? 5 
HELX_P HELX_P5   AA5 ASP A  295 ? GLN A  297 ? ASP A 303 GLN A 305 5 ? 3 
HELX_P HELX_P6   AA6 THR A  349 ? THR A  351 ? THR A 357 THR A 359 5 ? 3 
HELX_P HELX_P7   AA7 MET A  381 ? ASN A  388 ? MET A 389 ASN A 396 1 ? 8 
HELX_P HELX_P8   AA8 ASN A  388 ? TRP A  395 ? ASN A 396 TRP A 403 1 ? 8 
HELX_P HELX_P9   AA9 ASP A  451 ? GLN A  454 ? ASP A 459 GLN A 462 5 ? 4 
HELX_P HELX_P10  AB1 PHE A  455 ? LEU A  463 ? PHE A 463 LEU A 471 1 ? 9 
HELX_P HELX_P11  AB2 SER B  15  ? TYR B  19  ? SER B 23  TYR B 27  5 ? 5 
HELX_P HELX_P12  AB3 ASP B  201 ? GLN B  206 ? ASP B 209 GLN B 214 1 ? 6 
HELX_P HELX_P13  AB4 ASP B  225 ? ALA B  231 ? ASP B 233 ALA B 239 1 ? 7 
HELX_P HELX_P14  AB5 PRO B  264 ? TYR B  268 ? PRO B 272 TYR B 276 5 ? 5 
HELX_P HELX_P15  AB6 ASP B  295 ? GLN B  297 ? ASP B 303 GLN B 305 5 ? 3 
HELX_P HELX_P16  AB7 THR B  349 ? THR B  351 ? THR B 357 THR B 359 5 ? 3 
HELX_P HELX_P17  AB8 MET B  381 ? ASN B  388 ? MET B 389 ASN B 396 1 ? 8 
HELX_P HELX_P18  AB9 ASN B  388 ? TRP B  395 ? ASN B 396 TRP B 403 1 ? 8 
HELX_P HELX_P19  AC1 ASP B  451 ? GLN B  454 ? ASP B 459 GLN B 462 5 ? 4 
HELX_P HELX_P20  AC2 PHE B  455 ? LEU B  463 ? PHE B 463 LEU B 471 1 ? 9 
HELX_P HELX_P21  AC3 SER C  15  ? TYR C  19  ? SER C 23  TYR C 27  5 ? 5 
HELX_P HELX_P22  AC4 ASP C  201 ? GLN C  206 ? ASP C 209 GLN C 214 1 ? 6 
HELX_P HELX_P23  AC5 ASP C  225 ? ALA C  231 ? ASP C 233 ALA C 239 1 ? 7 
HELX_P HELX_P24  AC6 PRO C  264 ? TYR C  268 ? PRO C 272 TYR C 276 5 ? 5 
HELX_P HELX_P25  AC7 ASP C  295 ? GLN C  297 ? ASP C 303 GLN C 305 5 ? 3 
HELX_P HELX_P26  AC8 CYS C  316 ? HIS C  318 ? CYS C 324 HIS C 326 5 ? 3 
HELX_P HELX_P27  AC9 THR C  349 ? THR C  351 ? THR C 357 THR C 359 5 ? 3 
HELX_P HELX_P28  AD1 MET C  381 ? ASN C  388 ? MET C 389 ASN C 396 1 ? 8 
HELX_P HELX_P29  AD2 ASN C  388 ? TRP C  395 ? ASN C 396 TRP C 403 1 ? 8 
HELX_P HELX_P30  AD3 ASP C  451 ? GLN C  454 ? ASP C 459 GLN C 462 5 ? 4 
HELX_P HELX_P31  AD4 PHE C  455 ? LEU C  463 ? PHE C 463 LEU C 471 1 ? 9 
HELX_P HELX_P32  AD5 SER D  15  ? TYR D  19  ? SER D 23  TYR D 27  5 ? 5 
HELX_P HELX_P33  AD6 ASP D  201 ? GLN D  206 ? ASP D 209 GLN D 214 1 ? 6 
HELX_P HELX_P34  AD7 ASP D  225 ? ALA D  231 ? ASP D 233 ALA D 239 1 ? 7 
HELX_P HELX_P35  AD8 PRO D  264 ? TYR D  268 ? PRO D 272 TYR D 276 5 ? 5 
HELX_P HELX_P36  AD9 ASP D  295 ? GLN D  297 ? ASP D 303 GLN D 305 5 ? 3 
HELX_P HELX_P37  AE1 THR D  349 ? THR D  351 ? THR D 357 THR D 359 5 ? 3 
HELX_P HELX_P38  AE2 MET D  381 ? ASN D  388 ? MET D 389 ASN D 396 1 ? 8 
HELX_P HELX_P39  AE3 ASN D  388 ? TRP D  395 ? ASN D 396 TRP D 403 1 ? 8 
HELX_P HELX_P40  AE4 ASP D  451 ? GLN D  454 ? ASP D 459 GLN D 462 5 ? 4 
HELX_P HELX_P41  AE5 PHE D  455 ? LEU D  463 ? PHE D 463 LEU D 471 1 ? 9 
HELX_P HELX_P42  AE6 SER E  15  ? TYR E  19  ? SER E 23  TYR E 27  5 ? 5 
HELX_P HELX_P43  AE7 ASP E  201 ? GLN E  206 ? ASP E 209 GLN E 214 1 ? 6 
HELX_P HELX_P44  AE8 ASP E  225 ? ALA E  231 ? ASP E 233 ALA E 239 1 ? 7 
HELX_P HELX_P45  AE9 PRO E  264 ? TYR E  268 ? PRO E 272 TYR E 276 5 ? 5 
HELX_P HELX_P46  AF1 ASP E  295 ? GLN E  297 ? ASP E 303 GLN E 305 5 ? 3 
HELX_P HELX_P47  AF2 THR E  349 ? THR E  351 ? THR E 357 THR E 359 5 ? 3 
HELX_P HELX_P48  AF3 MET E  381 ? ASN E  388 ? MET E 389 ASN E 396 1 ? 8 
HELX_P HELX_P49  AF4 ASN E  388 ? TRP E  395 ? ASN E 396 TRP E 403 1 ? 8 
HELX_P HELX_P50  AF5 ASP E  451 ? GLN E  454 ? ASP E 459 GLN E 462 5 ? 4 
HELX_P HELX_P51  AF6 PHE E  455 ? LEU E  463 ? PHE E 463 LEU E 471 1 ? 9 
HELX_P HELX_P52  AF7 SER F  15  ? TYR F  19  ? SER F 23  TYR F 27  5 ? 5 
HELX_P HELX_P53  AF8 ASP F  201 ? GLN F  206 ? ASP F 209 GLN F 214 1 ? 6 
HELX_P HELX_P54  AF9 ASP F  225 ? ALA F  231 ? ASP F 233 ALA F 239 1 ? 7 
HELX_P HELX_P55  AG1 PRO F  264 ? TYR F  268 ? PRO F 272 TYR F 276 5 ? 5 
HELX_P HELX_P56  AG2 ASP F  295 ? GLN F  297 ? ASP F 303 GLN F 305 5 ? 3 
HELX_P HELX_P57  AG3 THR F  349 ? THR F  351 ? THR F 357 THR F 359 5 ? 3 
HELX_P HELX_P58  AG4 MET F  381 ? ASN F  388 ? MET F 389 ASN F 396 1 ? 8 
HELX_P HELX_P59  AG5 ASN F  388 ? TRP F  395 ? ASN F 396 TRP F 403 1 ? 8 
HELX_P HELX_P60  AG6 ASP F  451 ? GLN F  454 ? ASP F 459 GLN F 462 5 ? 4 
HELX_P HELX_P61  AG7 PHE F  455 ? LEU F  463 ? PHE F 463 LEU F 471 1 ? 9 
HELX_P HELX_P62  AG8 SER G  15  ? TYR G  19  ? SER G 23  TYR G 27  5 ? 5 
HELX_P HELX_P63  AG9 ASP G  201 ? GLN G  206 ? ASP G 209 GLN G 214 1 ? 6 
HELX_P HELX_P64  AH1 ASP G  225 ? ALA G  231 ? ASP G 233 ALA G 239 1 ? 7 
HELX_P HELX_P65  AH2 PRO G  264 ? TYR G  268 ? PRO G 272 TYR G 276 5 ? 5 
HELX_P HELX_P66  AH3 ASP G  295 ? GLN G  297 ? ASP G 303 GLN G 305 5 ? 3 
HELX_P HELX_P67  AH4 THR G  349 ? THR G  351 ? THR G 357 THR G 359 5 ? 3 
HELX_P HELX_P68  AH5 MET G  381 ? ASN G  388 ? MET G 389 ASN G 396 1 ? 8 
HELX_P HELX_P69  AH6 ASN G  388 ? TRP G  395 ? ASN G 396 TRP G 403 1 ? 8 
HELX_P HELX_P70  AH7 ASP G  451 ? GLN G  454 ? ASP G 459 GLN G 462 5 ? 4 
HELX_P HELX_P71  AH8 PHE G  455 ? LEU G  463 ? PHE G 463 LEU G 471 1 ? 9 
HELX_P HELX_P72  AH9 SER H  15  ? TYR H  19  ? SER H 23  TYR H 27  5 ? 5 
HELX_P HELX_P73  AI1 ASP H  201 ? GLN H  206 ? ASP H 209 GLN H 214 1 ? 6 
HELX_P HELX_P74  AI2 ASP H  225 ? ALA H  231 ? ASP H 233 ALA H 239 1 ? 7 
HELX_P HELX_P75  AI3 PRO H  264 ? TYR H  268 ? PRO H 272 TYR H 276 5 ? 5 
HELX_P HELX_P76  AI4 ASP H  295 ? GLN H  297 ? ASP H 303 GLN H 305 5 ? 3 
HELX_P HELX_P77  AI5 THR H  349 ? THR H  351 ? THR H 357 THR H 359 5 ? 3 
HELX_P HELX_P78  AI6 MET H  381 ? ASN H  388 ? MET H 389 ASN H 396 1 ? 8 
HELX_P HELX_P79  AI7 ASN H  388 ? TRP H  395 ? ASN H 396 TRP H 403 1 ? 8 
HELX_P HELX_P80  AI8 ASP H  451 ? GLN H  454 ? ASP H 459 GLN H 462 5 ? 4 
HELX_P HELX_P81  AI9 PHE H  455 ? LEU H  463 ? PHE H 463 LEU H 471 1 ? 9 
HELX_P HELX_P82  AJ1 SER I  15  ? TYR I  19  ? SER I 23  TYR I 27  5 ? 5 
HELX_P HELX_P83  AJ2 ASP I  201 ? GLN I  206 ? ASP I 209 GLN I 214 1 ? 6 
HELX_P HELX_P84  AJ3 ASP I  225 ? ALA I  231 ? ASP I 233 ALA I 239 1 ? 7 
HELX_P HELX_P85  AJ4 PRO I  264 ? TYR I  268 ? PRO I 272 TYR I 276 5 ? 5 
HELX_P HELX_P86  AJ5 ASP I  295 ? GLN I  297 ? ASP I 303 GLN I 305 5 ? 3 
HELX_P HELX_P87  AJ6 THR I  349 ? THR I  351 ? THR I 357 THR I 359 5 ? 3 
HELX_P HELX_P88  AJ7 MET I  381 ? ASN I  388 ? MET I 389 ASN I 396 1 ? 8 
HELX_P HELX_P89  AJ8 ASN I  388 ? TRP I  395 ? ASN I 396 TRP I 403 1 ? 8 
HELX_P HELX_P90  AJ9 ASP I  451 ? GLN I  454 ? ASP I 459 GLN I 462 5 ? 4 
HELX_P HELX_P91  AK1 PHE I  455 ? LEU I  463 ? PHE I 463 LEU I 471 1 ? 9 
HELX_P HELX_P92  AK2 SER J  15  ? TYR J  19  ? SER J 23  TYR J 27  5 ? 5 
HELX_P HELX_P93  AK3 ASP J  201 ? GLN J  206 ? ASP J 209 GLN J 214 1 ? 6 
HELX_P HELX_P94  AK4 ASP J  225 ? ALA J  231 ? ASP J 233 ALA J 239 1 ? 7 
HELX_P HELX_P95  AK5 PRO J  264 ? TYR J  268 ? PRO J 272 TYR J 276 5 ? 5 
HELX_P HELX_P96  AK6 ASP J  295 ? GLN J  297 ? ASP J 303 GLN J 305 5 ? 3 
HELX_P HELX_P97  AK7 THR J  349 ? THR J  351 ? THR J 357 THR J 359 5 ? 3 
HELX_P HELX_P98  AK8 MET J  381 ? ASN J  388 ? MET J 389 ASN J 396 1 ? 8 
HELX_P HELX_P99  AK9 ASN J  388 ? TRP J  395 ? ASN J 396 TRP J 403 1 ? 8 
HELX_P HELX_P100 AL1 ASP J  451 ? GLN J  454 ? ASP J 459 GLN J 462 5 ? 4 
HELX_P HELX_P101 AL2 PHE J  455 ? LEU J  463 ? PHE J 463 LEU J 471 1 ? 9 
HELX_P HELX_P102 AL3 GLU K  84  ? LEU K  88  ? GLU K 84  LEU K 88  5 ? 5 
HELX_P HELX_P103 AL4 SER K  126 ? THR K  131 ? SER K 126 THR K 131 1 ? 6 
HELX_P HELX_P104 AL5 LYS K  188 ? ARG K  193 ? LYS K 188 ARG K 193 1 ? 6 
HELX_P HELX_P105 AL6 PRO L  28  ? SER L  30  ? PRO L 28  SER L 30  5 ? 3 
HELX_P HELX_P106 AL7 PRO L  61  ? LYS L  65  ? PRO L 61  LYS L 65  5 ? 5 
HELX_P HELX_P107 AL8 LYS L  87  ? THR L  91  ? LYS L 87  THR L 91  5 ? 5 
HELX_P HELX_P108 AL9 GLU M  84  ? LEU M  88  ? GLU O 84  LEU O 88  5 ? 5 
HELX_P HELX_P109 AM1 SER M  126 ? SER M  132 ? SER O 126 SER O 132 1 ? 7 
HELX_P HELX_P110 AM2 LYS M  188 ? ARG M  193 ? LYS O 188 ARG O 193 1 ? 6 
HELX_P HELX_P111 AM3 PRO N  28  ? SER N  30  ? PRO P 28  SER P 30  5 ? 3 
HELX_P HELX_P112 AM4 LYS N  87  ? THR N  91  ? LYS P 87  THR P 91  5 ? 5 
HELX_P HELX_P113 AM5 GLU O  84  ? LEU O  88  ? GLU Q 84  LEU Q 88  5 ? 5 
HELX_P HELX_P114 AM6 SER O  126 ? GLY O  133 ? SER Q 126 GLY Q 133 1 ? 8 
HELX_P HELX_P115 AM7 LYS O  188 ? ARG O  193 ? LYS Q 188 ARG Q 193 1 ? 6 
HELX_P HELX_P116 AM8 PRO P  28  ? SER P  30  ? PRO R 28  SER R 30  5 ? 3 
HELX_P HELX_P117 AM9 PRO P  61  ? LYS P  65  ? PRO R 61  LYS R 65  5 ? 5 
HELX_P HELX_P118 AN1 LYS P  87  ? THR P  91  ? LYS R 87  THR R 91  5 ? 5 
HELX_P HELX_P119 AN2 GLU Q  84  ? LEU Q  88  ? GLU S 84  LEU S 88  5 ? 5 
HELX_P HELX_P120 AN3 GLU Q  128 ? SER Q  132 ? GLU S 128 SER S 132 5 ? 5 
HELX_P HELX_P121 AN4 LYS Q  188 ? ARG Q  193 ? LYS S 188 ARG S 193 1 ? 6 
HELX_P HELX_P122 AN5 PRO R  28  ? SER R  30  ? PRO T 28  SER T 30  5 ? 3 
HELX_P HELX_P123 AN6 PRO R  61  ? LYS R  65  ? PRO T 61  LYS T 65  5 ? 5 
HELX_P HELX_P124 AN7 LYS R  87  ? THR R  91  ? LYS T 87  THR T 91  5 ? 5 
HELX_P HELX_P125 AN8 GLU S  84  ? LEU S  88  ? GLU M 84  LEU M 88  5 ? 5 
HELX_P HELX_P126 AN9 SER S  126 ? SER S  132 ? SER M 126 SER M 132 1 ? 7 
HELX_P HELX_P127 AO1 LYS S  188 ? ARG S  193 ? LYS M 188 ARG M 193 1 ? 6 
HELX_P HELX_P128 AO2 PRO T  28  ? SER T  30  ? PRO N 28  SER N 30  5 ? 3 
HELX_P HELX_P129 AO3 LYS T  87  ? THR T  91  ? LYS N 87  THR N 91  5 ? 5 
HELX_P HELX_P130 AO4 GLU U  84  ? LEU U  88  ? GLU c 84  LEU c 88  5 ? 5 
HELX_P HELX_P131 AO5 SER U  126 ? THR U  131 ? SER c 126 THR c 131 1 ? 6 
HELX_P HELX_P132 AO6 LYS U  188 ? ARG U  193 ? LYS c 188 ARG c 193 1 ? 6 
HELX_P HELX_P133 AO7 PRO V  28  ? SER V  30  ? PRO d 28  SER d 30  5 ? 3 
HELX_P HELX_P134 AO8 PRO V  61  ? LYS V  65  ? PRO d 61  LYS d 65  5 ? 5 
HELX_P HELX_P135 AO9 LYS V  87  ? THR V  91  ? LYS d 87  THR d 91  5 ? 5 
HELX_P HELX_P136 AP1 PRO W  28  ? SER W  30  ? PRO V 28  SER V 30  5 ? 3 
HELX_P HELX_P137 AP2 PRO W  61  ? LYS W  65  ? PRO V 61  LYS V 65  5 ? 5 
HELX_P HELX_P138 AP3 LYS W  87  ? THR W  91  ? LYS V 87  THR V 91  5 ? 5 
HELX_P HELX_P139 AP4 PRO W  210 ? SER W  213 ? PRO V 210 SER V 213 5 ? 4 
HELX_P HELX_P140 AP5 GLU X  84  ? LEU X  88  ? GLU W 84  LEU W 88  5 ? 5 
HELX_P HELX_P141 AP6 SER X  126 ? SER X  132 ? SER W 126 SER W 132 1 ? 7 
HELX_P HELX_P142 AP7 LYS X  188 ? ARG X  193 ? LYS W 188 ARG W 193 1 ? 6 
HELX_P HELX_P143 AP8 PRO Y  28  ? SER Y  30  ? PRO X 28  SER X 30  5 ? 3 
HELX_P HELX_P144 AP9 PRO Y  61  ? LYS Y  65  ? PRO X 61  LYS X 65  5 ? 5 
HELX_P HELX_P145 AQ1 LYS Y  87  ? THR Y  91  ? LYS X 87  THR X 91  5 ? 5 
HELX_P HELX_P146 AQ2 GLU Z  84  ? LEU Z  88  ? GLU Y 84  LEU Y 88  5 ? 5 
HELX_P HELX_P147 AQ3 SER Z  126 ? THR Z  131 ? SER Y 126 THR Y 131 1 ? 6 
HELX_P HELX_P148 AQ4 LYS Z  188 ? ARG Z  193 ? LYS Y 188 ARG Y 193 1 ? 6 
HELX_P HELX_P149 AQ5 PRO AA 28  ? SER AA 30  ? PRO Z 28  SER Z 30  5 ? 3 
HELX_P HELX_P150 AQ6 PRO AA 61  ? LYS AA 65  ? PRO Z 61  LYS Z 65  5 ? 5 
HELX_P HELX_P151 AQ7 LYS AA 87  ? THR AA 91  ? LYS Z 87  THR Z 91  5 ? 5 
HELX_P HELX_P152 AQ8 GLU BA 84  ? LEU BA 88  ? GLU a 84  LEU a 88  5 ? 5 
HELX_P HELX_P153 AQ9 SER BA 126 ? THR BA 131 ? SER a 126 THR a 131 1 ? 6 
HELX_P HELX_P154 AR1 LYS BA 188 ? ARG BA 193 ? LYS a 188 ARG a 193 1 ? 6 
HELX_P HELX_P155 AR2 PRO CA 28  ? SER CA 30  ? PRO b 28  SER b 30  5 ? 3 
HELX_P HELX_P156 AR3 PRO CA 61  ? LYS CA 65  ? PRO b 61  LYS b 65  5 ? 5 
HELX_P HELX_P157 AR4 LYS CA 87  ? THR CA 91  ? LYS b 87  THR b 91  5 ? 5 
HELX_P HELX_P158 AR5 GLU DA 84  ? LEU DA 88  ? GLU U 84  LEU U 88  5 ? 5 
HELX_P HELX_P159 AR6 SER DA 126 ? THR DA 131 ? SER U 126 THR U 131 1 ? 6 
HELX_P HELX_P160 AR7 LYS DA 188 ? ARG DA 193 ? LYS U 188 ARG U 193 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? K  CYS 23  SG ? ? ? 1_555 K  CYS 93  SG ? ? K CYS 23  K CYS 93  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf2  disulf ? ? K  CYS 139 SG ? ? ? 1_555 K  CYS 199 SG ? ? K CYS 139 K CYS 199 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf3  disulf ? ? L  CYS 22  SG ? ? ? 1_555 L  CYS 96  SG ? ? L CYS 22  L CYS 96  1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4  disulf ? ? L  CYS 150 SG ? ? ? 1_555 L  CYS 205 SG ? ? L CYS 150 L CYS 205 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf5  disulf ? ? M  CYS 23  SG ? ? ? 1_555 M  CYS 93  SG ? ? O CYS 23  O CYS 93  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf6  disulf ? ? M  CYS 139 SG ? ? ? 1_555 M  CYS 199 SG ? ? O CYS 139 O CYS 199 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf7  disulf ? ? N  CYS 22  SG ? ? ? 1_555 N  CYS 96  SG ? ? P CYS 22  P CYS 96  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf8  disulf ? ? N  CYS 150 SG ? ? ? 1_555 N  CYS 205 SG ? ? P CYS 150 P CYS 205 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf9  disulf ? ? O  CYS 23  SG ? ? ? 1_555 O  CYS 93  SG ? ? Q CYS 23  Q CYS 93  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf10 disulf ? ? O  CYS 139 SG ? ? ? 1_555 O  CYS 199 SG ? ? Q CYS 139 Q CYS 199 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf11 disulf ? ? P  CYS 22  SG ? ? ? 1_555 P  CYS 96  SG ? ? R CYS 22  R CYS 96  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf12 disulf ? ? P  CYS 150 SG ? ? ? 1_555 P  CYS 205 SG ? ? R CYS 150 R CYS 205 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf13 disulf ? ? Q  CYS 23  SG ? ? ? 1_555 Q  CYS 93  SG ? ? S CYS 23  S CYS 93  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf14 disulf ? ? Q  CYS 139 SG ? ? ? 1_555 Q  CYS 199 SG ? ? S CYS 139 S CYS 199 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf15 disulf ? ? R  CYS 22  SG ? ? ? 1_555 R  CYS 96  SG ? ? T CYS 22  T CYS 96  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf16 disulf ? ? R  CYS 150 SG ? ? ? 1_555 R  CYS 205 SG ? ? T CYS 150 T CYS 205 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf17 disulf ? ? S  CYS 23  SG ? ? ? 1_555 S  CYS 93  SG ? ? M CYS 23  M CYS 93  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf18 disulf ? ? S  CYS 139 SG ? ? ? 1_555 S  CYS 199 SG ? ? M CYS 139 M CYS 199 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf19 disulf ? ? T  CYS 22  SG ? ? ? 1_555 T  CYS 96  SG ? ? N CYS 22  N CYS 96  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf20 disulf ? ? T  CYS 150 SG ? ? ? 1_555 T  CYS 205 SG ? ? N CYS 150 N CYS 205 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf21 disulf ? ? U  CYS 23  SG ? ? ? 1_555 U  CYS 93  SG ? ? c CYS 23  c CYS 93  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf22 disulf ? ? U  CYS 139 SG ? ? ? 1_555 U  CYS 199 SG ? ? c CYS 139 c CYS 199 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf23 disulf ? ? V  CYS 22  SG ? ? ? 1_555 V  CYS 96  SG ? ? d CYS 22  d CYS 96  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf24 disulf ? ? V  CYS 150 SG ? ? ? 1_555 V  CYS 205 SG ? ? d CYS 150 d CYS 205 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf25 disulf ? ? W  CYS 22  SG ? ? ? 1_555 W  CYS 96  SG ? ? V CYS 22  V CYS 96  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf26 disulf ? ? W  CYS 150 SG ? ? ? 1_555 W  CYS 205 SG ? ? V CYS 150 V CYS 205 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf27 disulf ? ? X  CYS 23  SG ? ? ? 1_555 X  CYS 93  SG ? ? W CYS 23  W CYS 93  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf28 disulf ? ? X  CYS 139 SG ? ? ? 1_555 X  CYS 199 SG ? ? W CYS 139 W CYS 199 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf29 disulf ? ? X  CYS 219 SG ? ? ? 1_555 Y  CYS 138 SG ? ? W CYS 219 X CYS 138 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf30 disulf ? ? Y  CYS 22  SG ? ? ? 1_555 Y  CYS 96  SG ? ? X CYS 22  X CYS 96  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf31 disulf ? ? Y  CYS 150 SG ? ? ? 1_555 Y  CYS 205 SG ? ? X CYS 150 X CYS 205 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf32 disulf ? ? Z  CYS 23  SG ? ? ? 1_555 Z  CYS 93  SG ? ? Y CYS 23  Y CYS 93  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf33 disulf ? ? Z  CYS 139 SG ? ? ? 1_555 Z  CYS 199 SG ? ? Y CYS 139 Y CYS 199 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf34 disulf ? ? AA CYS 22  SG ? ? ? 1_555 AA CYS 96  SG ? ? Z CYS 22  Z CYS 96  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf35 disulf ? ? AA CYS 150 SG ? ? ? 1_555 AA CYS 205 SG ? ? Z CYS 150 Z CYS 205 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf36 disulf ? ? BA CYS 23  SG ? ? ? 1_555 BA CYS 93  SG ? ? a CYS 23  a CYS 93  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf37 disulf ? ? BA CYS 139 SG ? ? ? 1_555 BA CYS 199 SG ? ? a CYS 139 a CYS 199 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf38 disulf ? ? CA CYS 22  SG ? ? ? 1_555 CA CYS 96  SG ? ? b CYS 22  b CYS 96  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf39 disulf ? ? CA CYS 150 SG ? ? ? 1_555 CA CYS 205 SG ? ? b CYS 150 b CYS 205 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf40 disulf ? ? DA CYS 23  SG ? ? ? 1_555 DA CYS 93  SG ? ? U CYS 23  U CYS 93  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf41 disulf ? ? DA CYS 139 SG ? ? ? 1_555 DA CYS 199 SG ? ? U CYS 139 U CYS 199 1_555 ? ? ? ? ? ? ? 2.038 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   GLY 48  A  . ? GLY 56  A ASN 49  A  ? ASN 57  A 1 1.86   
2   GLY 50  A  . ? GLY 58  A ARG 51  A  ? ARG 59  A 1 -0.48  
3   GLY 48  B  . ? GLY 56  B ASN 49  B  ? ASN 57  B 1 1.53   
4   GLY 50  B  . ? GLY 58  B ARG 51  B  ? ARG 59  B 1 0.11   
5   GLY 48  C  . ? GLY 56  C ASN 49  C  ? ASN 57  C 1 1.48   
6   GLY 50  C  . ? GLY 58  C ARG 51  C  ? ARG 59  C 1 -0.51  
7   GLY 48  D  . ? GLY 56  D ASN 49  D  ? ASN 57  D 1 1.85   
8   GLY 50  D  . ? GLY 58  D ARG 51  D  ? ARG 59  D 1 0.57   
9   GLY 48  E  . ? GLY 56  E ASN 49  E  ? ASN 57  E 1 1.72   
10  GLY 50  E  . ? GLY 58  E ARG 51  E  ? ARG 59  E 1 -0.61  
11  GLY 48  F  . ? GLY 56  F ASN 49  F  ? ASN 57  F 1 1.73   
12  GLY 50  F  . ? GLY 58  F ARG 51  F  ? ARG 59  F 1 -0.22  
13  GLY 48  G  . ? GLY 56  G ASN 49  G  ? ASN 57  G 1 1.49   
14  GLY 50  G  . ? GLY 58  G ARG 51  G  ? ARG 59  G 1 -0.06  
15  GLY 48  H  . ? GLY 56  H ASN 49  H  ? ASN 57  H 1 1.76   
16  GLY 50  H  . ? GLY 58  H ARG 51  H  ? ARG 59  H 1 -0.06  
17  GLY 48  I  . ? GLY 56  I ASN 49  I  ? ASN 57  I 1 1.60   
18  GLY 50  I  . ? GLY 58  I ARG 51  I  ? ARG 59  I 1 2.28   
19  GLY 48  J  . ? GLY 56  J ASN 49  J  ? ASN 57  J 1 1.86   
20  GLY 50  J  . ? GLY 58  J ARG 51  J  ? ARG 59  J 1 -0.16  
21  THR 7   K  . ? THR 7   K PRO 8   K  ? PRO 8   K 1 -4.64  
22  VAL 99  K  . ? VAL 99  K PRO 100 K  ? PRO 100 K 1 3.01   
23  GLY 104 K  . ? GLY 104 K ALA 105 K  ? ALA 105 K 1 -5.83  
24  TYR 145 K  . ? TYR 145 K PRO 146 K  ? PRO 146 K 1 3.08   
25  ILE 155 K  . ? ILE 155 K ASP 156 K  ? ASP 156 K 1 1.88   
26  ASP 156 K  . ? ASP 156 K GLY 157 K  ? GLY 157 K 1 -1.32  
27  SER 206 K  . ? SER 206 K THR 207 K  ? THR 207 K 1 -4.99  
28  GLY 8   L  . ? GLY 8   L GLY 9   L  ? GLY 9   L 1 -15.44 
29  SER 144 L  . ? SER 144 L SER 145 L  ? SER 145 L 1 -3.32  
30  PHE 156 L  . ? PHE 156 L PRO 157 L  ? PRO 157 L 1 -6.21  
31  GLU 158 L  . ? GLU 158 L PRO 159 L  ? PRO 159 L 1 -2.00  
32  TRP 198 L  . ? TRP 198 L PRO 199 L  ? PRO 199 L 1 3.25   
33  THR 7   M  . ? THR 7   O PRO 8   M  ? PRO 8   O 1 -4.09  
34  LYS 44  M  . ? LYS 44  O SER 45  M  ? SER 45  O 1 -13.24 
35  VAL 99  M  . ? VAL 99  O PRO 100 M  ? PRO 100 O 1 2.87   
36  GLY 104 M  . ? GLY 104 O ALA 105 M  ? ALA 105 O 1 -5.32  
37  TYR 145 M  . ? TYR 145 O PRO 146 M  ? PRO 146 O 1 4.12   
38  ILE 155 M  . ? ILE 155 O ASP 156 M  ? ASP 156 O 1 -0.73  
39  ASP 156 M  . ? ASP 156 O GLY 157 M  ? GLY 157 O 1 -0.31  
40  SER 206 M  . ? SER 206 O THR 207 M  ? THR 207 O 1 -4.55  
41  GLY 8   N  . ? GLY 8   P GLY 9   N  ? GLY 9   P 1 -13.48 
42  SER 144 N  . ? SER 144 P SER 145 N  ? SER 145 P 1 -4.09  
43  PHE 156 N  . ? PHE 156 P PRO 157 N  ? PRO 157 P 1 -5.28  
44  GLU 158 N  . ? GLU 158 P PRO 159 N  ? PRO 159 P 1 -1.51  
45  TRP 198 N  . ? TRP 198 P PRO 199 N  ? PRO 199 P 1 2.83   
46  THR 7   O  . ? THR 7   Q PRO 8   O  ? PRO 8   Q 1 -4.19  
47  LYS 44  O  . ? LYS 44  Q SER 45  O  ? SER 45  Q 1 -13.19 
48  VAL 99  O  . ? VAL 99  Q PRO 100 O  ? PRO 100 Q 1 1.77   
49  GLY 104 O  . ? GLY 104 Q ALA 105 O  ? ALA 105 Q 1 -6.31  
50  TYR 145 O  . ? TYR 145 Q PRO 146 O  ? PRO 146 Q 1 3.28   
51  ILE 155 O  . ? ILE 155 Q ASP 156 O  ? ASP 156 Q 1 0.09   
52  ASP 156 O  . ? ASP 156 Q GLY 157 O  ? GLY 157 Q 1 -0.70  
53  SER 206 O  . ? SER 206 Q THR 207 O  ? THR 207 Q 1 -3.33  
54  SER 144 P  . ? SER 144 R SER 145 P  ? SER 145 R 1 -4.86  
55  PHE 156 P  . ? PHE 156 R PRO 157 P  ? PRO 157 R 1 -6.12  
56  GLU 158 P  . ? GLU 158 R PRO 159 P  ? PRO 159 R 1 -1.25  
57  TRP 198 P  . ? TRP 198 R PRO 199 P  ? PRO 199 R 1 2.01   
58  THR 7   Q  . ? THR 7   S PRO 8   Q  ? PRO 8   S 1 -3.50  
59  VAL 99  Q  . ? VAL 99  S PRO 100 Q  ? PRO 100 S 1 1.99   
60  GLY 104 Q  . ? GLY 104 S ALA 105 Q  ? ALA 105 S 1 -6.11  
61  TYR 145 Q  . ? TYR 145 S PRO 146 Q  ? PRO 146 S 1 3.61   
62  ILE 155 Q  . ? ILE 155 S ASP 156 Q  ? ASP 156 S 1 -0.30  
63  ASP 156 Q  . ? ASP 156 S GLY 157 Q  ? GLY 157 S 1 0.26   
64  SER 206 Q  . ? SER 206 S THR 207 Q  ? THR 207 S 1 -3.40  
65  GLY 8   R  . ? GLY 8   T GLY 9   R  ? GLY 9   T 1 -2.27  
66  SER 144 R  . ? SER 144 T SER 145 R  ? SER 145 T 1 -3.41  
67  PHE 156 R  . ? PHE 156 T PRO 157 R  ? PRO 157 T 1 -5.42  
68  GLU 158 R  . ? GLU 158 T PRO 159 R  ? PRO 159 T 1 -2.82  
69  TRP 198 R  . ? TRP 198 T PRO 199 R  ? PRO 199 T 1 2.12   
70  THR 7   S  . ? THR 7   M PRO 8   S  ? PRO 8   M 1 -4.42  
71  VAL 99  S  . ? VAL 99  M PRO 100 S  ? PRO 100 M 1 2.19   
72  GLY 104 S  . ? GLY 104 M ALA 105 S  ? ALA 105 M 1 -6.21  
73  TYR 145 S  . ? TYR 145 M PRO 146 S  ? PRO 146 M 1 3.31   
74  ILE 155 S  . ? ILE 155 M ASP 156 S  ? ASP 156 M 1 0.06   
75  ASP 156 S  . ? ASP 156 M GLY 157 S  ? GLY 157 M 1 -1.37  
76  SER 206 S  . ? SER 206 M THR 207 S  ? THR 207 M 1 -3.91  
77  GLY 8   T  . ? GLY 8   N GLY 9   T  ? GLY 9   N 1 -28.09 
78  SER 144 T  . ? SER 144 N SER 145 T  ? SER 145 N 1 -3.26  
79  PHE 156 T  . ? PHE 156 N PRO 157 T  ? PRO 157 N 1 -4.83  
80  GLU 158 T  . ? GLU 158 N PRO 159 T  ? PRO 159 N 1 -4.43  
81  TRP 198 T  . ? TRP 198 N PRO 199 T  ? PRO 199 N 1 1.87   
82  THR 7   U  . ? THR 7   c PRO 8   U  ? PRO 8   c 1 -4.47  
83  VAL 99  U  . ? VAL 99  c PRO 100 U  ? PRO 100 c 1 2.20   
84  GLY 104 U  . ? GLY 104 c ALA 105 U  ? ALA 105 c 1 -5.74  
85  TYR 145 U  . ? TYR 145 c PRO 146 U  ? PRO 146 c 1 3.83   
86  ILE 155 U  . ? ILE 155 c ASP 156 U  ? ASP 156 c 1 -0.18  
87  ASP 156 U  . ? ASP 156 c GLY 157 U  ? GLY 157 c 1 0.69   
88  SER 206 U  . ? SER 206 c THR 207 U  ? THR 207 c 1 -4.21  
89  GLY 8   V  . ? GLY 8   d GLY 9   V  ? GLY 9   d 1 -6.51  
90  SER 144 V  . ? SER 144 d SER 145 V  ? SER 145 d 1 -3.02  
91  PHE 156 V  . ? PHE 156 d PRO 157 V  ? PRO 157 d 1 -4.68  
92  GLU 158 V  . ? GLU 158 d PRO 159 V  ? PRO 159 d 1 -3.34  
93  TRP 198 V  . ? TRP 198 d PRO 199 V  ? PRO 199 d 1 1.75   
94  GLY 8   W  . ? GLY 8   V GLY 9   W  ? GLY 9   V 1 -27.45 
95  SER 144 W  . ? SER 144 V SER 145 W  ? SER 145 V 1 -3.65  
96  PHE 156 W  . ? PHE 156 V PRO 157 W  ? PRO 157 V 1 -4.78  
97  GLU 158 W  . ? GLU 158 V PRO 159 W  ? PRO 159 V 1 -3.53  
98  TRP 198 W  . ? TRP 198 V PRO 199 W  ? PRO 199 V 1 2.83   
99  THR 7   X  . ? THR 7   W PRO 8   X  ? PRO 8   W 1 -3.23  
100 VAL 99  X  . ? VAL 99  W PRO 100 X  ? PRO 100 W 1 2.10   
101 GLY 104 X  . ? GLY 104 W ALA 105 X  ? ALA 105 W 1 -6.23  
102 TYR 145 X  . ? TYR 145 W PRO 146 X  ? PRO 146 W 1 4.67   
103 ILE 155 X  . ? ILE 155 W ASP 156 X  ? ASP 156 W 1 1.47   
104 ASP 156 X  . ? ASP 156 W GLY 157 X  ? GLY 157 W 1 -0.07  
105 SER 206 X  . ? SER 206 W THR 207 X  ? THR 207 W 1 -1.76  
106 GLY 8   Y  . ? GLY 8   X GLY 9   Y  ? GLY 9   X 1 -27.17 
107 SER 144 Y  . ? SER 144 X SER 145 Y  ? SER 145 X 1 -4.07  
108 PHE 156 Y  . ? PHE 156 X PRO 157 Y  ? PRO 157 X 1 -5.89  
109 GLU 158 Y  . ? GLU 158 X PRO 159 Y  ? PRO 159 X 1 -2.25  
110 TRP 198 Y  . ? TRP 198 X PRO 199 Y  ? PRO 199 X 1 2.41   
111 THR 7   Z  . ? THR 7   Y PRO 8   Z  ? PRO 8   Y 1 -3.94  
112 VAL 99  Z  . ? VAL 99  Y PRO 100 Z  ? PRO 100 Y 1 1.74   
113 GLY 104 Z  . ? GLY 104 Y ALA 105 Z  ? ALA 105 Y 1 -5.77  
114 TYR 145 Z  . ? TYR 145 Y PRO 146 Z  ? PRO 146 Y 1 4.28   
115 ILE 155 Z  . ? ILE 155 Y ASP 156 Z  ? ASP 156 Y 1 0.75   
116 ASP 156 Z  . ? ASP 156 Y GLY 157 Z  ? GLY 157 Y 1 -0.03  
117 SER 206 Z  . ? SER 206 Y THR 207 Z  ? THR 207 Y 1 -4.19  
118 GLY 8   AA . ? GLY 8   Z GLY 9   AA ? GLY 9   Z 1 -28.67 
119 SER 144 AA . ? SER 144 Z SER 145 AA ? SER 145 Z 1 -3.91  
120 PHE 156 AA . ? PHE 156 Z PRO 157 AA ? PRO 157 Z 1 -5.38  
121 GLU 158 AA . ? GLU 158 Z PRO 159 AA ? PRO 159 Z 1 -3.07  
122 TRP 198 AA . ? TRP 198 Z PRO 199 AA ? PRO 199 Z 1 1.75   
123 THR 7   BA . ? THR 7   a PRO 8   BA ? PRO 8   a 1 -3.89  
124 VAL 99  BA . ? VAL 99  a PRO 100 BA ? PRO 100 a 1 1.92   
125 GLY 104 BA . ? GLY 104 a ALA 105 BA ? ALA 105 a 1 -5.46  
126 TYR 145 BA . ? TYR 145 a PRO 146 BA ? PRO 146 a 1 3.62   
127 ILE 155 BA . ? ILE 155 a ASP 156 BA ? ASP 156 a 1 0.18   
128 ASP 156 BA . ? ASP 156 a GLY 157 BA ? GLY 157 a 1 -0.32  
129 SER 206 BA . ? SER 206 a THR 207 BA ? THR 207 a 1 -6.44  
130 GLY 8   CA . ? GLY 8   b GLY 9   CA ? GLY 9   b 1 -26.76 
131 SER 144 CA . ? SER 144 b SER 145 CA ? SER 145 b 1 -3.44  
132 PHE 156 CA . ? PHE 156 b PRO 157 CA ? PRO 157 b 1 -5.44  
133 GLU 158 CA . ? GLU 158 b PRO 159 CA ? PRO 159 b 1 -1.96  
134 TRP 198 CA . ? TRP 198 b PRO 199 CA ? PRO 199 b 1 2.27   
135 THR 7   DA . ? THR 7   U PRO 8   DA ? PRO 8   U 1 -4.53  
136 LYS 44  DA . ? LYS 44  U SER 45  DA ? SER 45  U 1 4.02   
137 VAL 99  DA . ? VAL 99  U PRO 100 DA ? PRO 100 U 1 1.09   
138 GLY 104 DA . ? GLY 104 U ALA 105 DA ? ALA 105 U 1 -5.89  
139 TYR 145 DA . ? TYR 145 U PRO 146 DA ? PRO 146 U 1 4.13   
140 ILE 155 DA . ? ILE 155 U ASP 156 DA ? ASP 156 U 1 -0.92  
141 ASP 156 DA . ? ASP 156 U GLY 157 DA ? GLY 157 U 1 -0.36  
142 SER 206 DA . ? SER 206 U THR 207 DA ? THR 207 U 1 -8.98  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 6 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 3 ? 
AB2 ? 3 ? 
AB3 ? 6 ? 
AB4 ? 6 ? 
AB5 ? 3 ? 
AB6 ? 2 ? 
AB7 ? 4 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
AC1 ? 3 ? 
AC2 ? 4 ? 
AC3 ? 4 ? 
AC4 ? 3 ? 
AC5 ? 2 ? 
AC6 ? 4 ? 
AC7 ? 3 ? 
AC8 ? 6 ? 
AC9 ? 4 ? 
AD1 ? 3 ? 
AD2 ? 4 ? 
AD3 ? 2 ? 
AD4 ? 4 ? 
AD5 ? 3 ? 
AD6 ? 6 ? 
AD7 ? 2 ? 
AD8 ? 4 ? 
AD9 ? 4 ? 
AE1 ? 3 ? 
AE2 ? 4 ? 
AE3 ? 6 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 4 ? 
AE7 ? 4 ? 
AE8 ? 4 ? 
AE9 ? 3 ? 
AF1 ? 3 ? 
AF2 ? 6 ? 
AF3 ? 6 ? 
AF4 ? 3 ? 
AF5 ? 2 ? 
AF6 ? 4 ? 
AF7 ? 4 ? 
AF8 ? 4 ? 
AF9 ? 3 ? 
AG1 ? 6 ? 
AG2 ? 3 ? 
AG3 ? 2 ? 
AG4 ? 4 ? 
AG5 ? 4 ? 
AG6 ? 4 ? 
AG7 ? 3 ? 
AG8 ? 6 ? 
AG9 ? 3 ? 
AH1 ? 2 ? 
AH2 ? 4 ? 
AH3 ? 4 ? 
AH4 ? 4 ? 
AH5 ? 3 ? 
AH6 ? 2 ? 
AH7 ? 4 ? 
AH8 ? 4 ? 
AH9 ? 6 ? 
AI1 ? 4 ? 
AI2 ? 4 ? 
AI3 ? 4 ? 
AI4 ? 5 ? 
AI5 ? 5 ? 
AI6 ? 4 ? 
AI7 ? 4 ? 
AI8 ? 3 ? 
AI9 ? 4 ? 
AJ1 ? 6 ? 
AJ2 ? 4 ? 
AJ3 ? 4 ? 
AJ4 ? 4 ? 
AJ5 ? 5 ? 
AJ6 ? 5 ? 
AJ7 ? 4 ? 
AJ8 ? 4 ? 
AJ9 ? 3 ? 
AK1 ? 4 ? 
AK2 ? 6 ? 
AK3 ? 4 ? 
AK4 ? 4 ? 
AK5 ? 4 ? 
AK6 ? 6 ? 
AK7 ? 4 ? 
AK8 ? 4 ? 
AK9 ? 3 ? 
AL1 ? 4 ? 
AL2 ? 6 ? 
AL3 ? 4 ? 
AL4 ? 4 ? 
AL5 ? 4 ? 
AL6 ? 5 ? 
AL7 ? 4 ? 
AL8 ? 4 ? 
AL9 ? 3 ? 
AM1 ? 4 ? 
AM2 ? 6 ? 
AM3 ? 4 ? 
AM4 ? 4 ? 
AM5 ? 4 ? 
AM6 ? 5 ? 
AM7 ? 5 ? 
AM8 ? 4 ? 
AM9 ? 4 ? 
AN1 ? 3 ? 
AN2 ? 4 ? 
AN3 ? 6 ? 
AN4 ? 4 ? 
AN5 ? 4 ? 
AN6 ? 4 ? 
AN7 ? 5 ? 
AN8 ? 5 ? 
AN9 ? 4 ? 
AO1 ? 4 ? 
AO2 ? 3 ? 
AO3 ? 4 ? 
AO4 ? 5 ? 
AO5 ? 4 ? 
AO6 ? 4 ? 
AO7 ? 3 ? 
AO8 ? 4 ? 
AO9 ? 6 ? 
AP1 ? 4 ? 
AP2 ? 4 ? 
AP3 ? 4 ? 
AP4 ? 6 ? 
AP5 ? 4 ? 
AP6 ? 4 ? 
AP7 ? 3 ? 
AP8 ? 4 ? 
AP9 ? 2 ? 
AQ1 ? 5 ? 
AQ2 ? 4 ? 
AQ3 ? 4 ? 
AQ4 ? 4 ? 
AQ5 ? 5 ? 
AQ6 ? 4 ? 
AQ7 ? 3 ? 
AQ8 ? 4 ? 
AQ9 ? 6 ? 
AR1 ? 4 ? 
AR2 ? 4 ? 
AR3 ? 4 ? 
AR4 ? 5 ? 
AR5 ? 5 ? 
AR6 ? 4 ? 
AR7 ? 4 ? 
AR8 ? 3 ? 
AR9 ? 4 ? 
AS1 ? 6 ? 
AS2 ? 4 ? 
AS3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB4 5 6 ? parallel      
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB8 1 2 ? parallel      
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? parallel      
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC8 5 6 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? parallel      
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? parallel      
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD6 4 5 ? anti-parallel 
AD6 5 6 ? parallel      
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? parallel      
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE3 4 5 ? anti-parallel 
AE3 5 6 ? parallel      
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? parallel      
AE7 1 2 ? parallel      
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF2 5 6 ? parallel      
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF3 4 5 ? anti-parallel 
AF3 5 6 ? parallel      
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF6 3 4 ? parallel      
AF7 1 2 ? parallel      
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG1 4 5 ? anti-parallel 
AG1 5 6 ? parallel      
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG4 3 4 ? parallel      
AG5 1 2 ? parallel      
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG7 2 3 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG8 2 3 ? anti-parallel 
AG8 3 4 ? anti-parallel 
AG8 4 5 ? anti-parallel 
AG8 5 6 ? parallel      
AG9 1 2 ? anti-parallel 
AG9 2 3 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH2 3 4 ? parallel      
AH3 1 2 ? parallel      
AH3 2 3 ? anti-parallel 
AH3 3 4 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? anti-parallel 
AH4 3 4 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH7 3 4 ? parallel      
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? anti-parallel 
AH9 1 2 ? parallel      
AH9 2 3 ? anti-parallel 
AH9 3 4 ? anti-parallel 
AH9 4 5 ? anti-parallel 
AH9 5 6 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI1 3 4 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI3 2 3 ? anti-parallel 
AI3 3 4 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI4 2 3 ? anti-parallel 
AI4 3 4 ? anti-parallel 
AI4 4 5 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI7 3 4 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI8 2 3 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AJ1 1 2 ? parallel      
AJ1 2 3 ? anti-parallel 
AJ1 3 4 ? anti-parallel 
AJ1 4 5 ? anti-parallel 
AJ1 5 6 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ2 3 4 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
AJ3 2 3 ? anti-parallel 
AJ3 3 4 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ4 3 4 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ5 2 3 ? anti-parallel 
AJ5 3 4 ? anti-parallel 
AJ5 4 5 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ6 4 5 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ8 2 3 ? anti-parallel 
AJ8 3 4 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK1 3 4 ? anti-parallel 
AK2 1 2 ? parallel      
AK2 2 3 ? anti-parallel 
AK2 3 4 ? anti-parallel 
AK2 4 5 ? anti-parallel 
AK2 5 6 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK3 3 4 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK4 2 3 ? anti-parallel 
AK4 3 4 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK5 2 3 ? anti-parallel 
AK5 3 4 ? anti-parallel 
AK6 1 2 ? parallel      
AK6 2 3 ? anti-parallel 
AK6 3 4 ? anti-parallel 
AK6 4 5 ? anti-parallel 
AK6 5 6 ? anti-parallel 
AK7 1 2 ? anti-parallel 
AK7 2 3 ? anti-parallel 
AK7 3 4 ? anti-parallel 
AK8 1 2 ? anti-parallel 
AK8 2 3 ? anti-parallel 
AK8 3 4 ? anti-parallel 
AK9 1 2 ? anti-parallel 
AK9 2 3 ? anti-parallel 
AL1 1 2 ? anti-parallel 
AL1 2 3 ? anti-parallel 
AL1 3 4 ? anti-parallel 
AL2 1 2 ? parallel      
AL2 2 3 ? anti-parallel 
AL2 3 4 ? anti-parallel 
AL2 4 5 ? anti-parallel 
AL2 5 6 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL3 2 3 ? anti-parallel 
AL3 3 4 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL4 2 3 ? anti-parallel 
AL4 3 4 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL5 2 3 ? anti-parallel 
AL5 3 4 ? anti-parallel 
AL6 1 2 ? anti-parallel 
AL6 2 3 ? anti-parallel 
AL6 3 4 ? anti-parallel 
AL6 4 5 ? anti-parallel 
AL7 1 2 ? anti-parallel 
AL7 2 3 ? anti-parallel 
AL7 3 4 ? anti-parallel 
AL8 1 2 ? anti-parallel 
AL8 2 3 ? anti-parallel 
AL8 3 4 ? anti-parallel 
AL9 1 2 ? anti-parallel 
AL9 2 3 ? anti-parallel 
AM1 1 2 ? anti-parallel 
AM1 2 3 ? anti-parallel 
AM1 3 4 ? anti-parallel 
AM2 1 2 ? parallel      
AM2 2 3 ? anti-parallel 
AM2 3 4 ? anti-parallel 
AM2 4 5 ? anti-parallel 
AM2 5 6 ? anti-parallel 
AM3 1 2 ? anti-parallel 
AM3 2 3 ? anti-parallel 
AM3 3 4 ? anti-parallel 
AM4 1 2 ? anti-parallel 
AM4 2 3 ? anti-parallel 
AM4 3 4 ? anti-parallel 
AM5 1 2 ? anti-parallel 
AM5 2 3 ? anti-parallel 
AM5 3 4 ? anti-parallel 
AM6 1 2 ? anti-parallel 
AM6 2 3 ? anti-parallel 
AM6 3 4 ? anti-parallel 
AM6 4 5 ? anti-parallel 
AM7 1 2 ? anti-parallel 
AM7 2 3 ? anti-parallel 
AM7 3 4 ? anti-parallel 
AM7 4 5 ? anti-parallel 
AM8 1 2 ? anti-parallel 
AM8 2 3 ? anti-parallel 
AM8 3 4 ? anti-parallel 
AM9 1 2 ? anti-parallel 
AM9 2 3 ? anti-parallel 
AM9 3 4 ? anti-parallel 
AN1 1 2 ? anti-parallel 
AN1 2 3 ? anti-parallel 
AN2 1 2 ? anti-parallel 
AN2 2 3 ? anti-parallel 
AN2 3 4 ? anti-parallel 
AN3 1 2 ? parallel      
AN3 2 3 ? anti-parallel 
AN3 3 4 ? anti-parallel 
AN3 4 5 ? anti-parallel 
AN3 5 6 ? anti-parallel 
AN4 1 2 ? anti-parallel 
AN4 2 3 ? anti-parallel 
AN4 3 4 ? anti-parallel 
AN5 1 2 ? anti-parallel 
AN5 2 3 ? anti-parallel 
AN5 3 4 ? anti-parallel 
AN6 1 2 ? anti-parallel 
AN6 2 3 ? anti-parallel 
AN6 3 4 ? anti-parallel 
AN7 1 2 ? anti-parallel 
AN7 2 3 ? anti-parallel 
AN7 3 4 ? anti-parallel 
AN7 4 5 ? anti-parallel 
AN8 1 2 ? anti-parallel 
AN8 2 3 ? anti-parallel 
AN8 3 4 ? anti-parallel 
AN8 4 5 ? anti-parallel 
AN9 1 2 ? anti-parallel 
AN9 2 3 ? anti-parallel 
AN9 3 4 ? anti-parallel 
AO1 1 2 ? anti-parallel 
AO1 2 3 ? anti-parallel 
AO1 3 4 ? anti-parallel 
AO2 1 2 ? anti-parallel 
AO2 2 3 ? anti-parallel 
AO3 1 2 ? anti-parallel 
AO3 2 3 ? anti-parallel 
AO3 3 4 ? anti-parallel 
AO4 1 2 ? anti-parallel 
AO4 2 3 ? anti-parallel 
AO4 3 4 ? anti-parallel 
AO4 4 5 ? anti-parallel 
AO5 1 2 ? anti-parallel 
AO5 2 3 ? anti-parallel 
AO5 3 4 ? anti-parallel 
AO6 1 2 ? anti-parallel 
AO6 2 3 ? anti-parallel 
AO6 3 4 ? anti-parallel 
AO7 1 2 ? anti-parallel 
AO7 2 3 ? anti-parallel 
AO8 1 2 ? anti-parallel 
AO8 2 3 ? anti-parallel 
AO8 3 4 ? anti-parallel 
AO9 1 2 ? parallel      
AO9 2 3 ? anti-parallel 
AO9 3 4 ? anti-parallel 
AO9 4 5 ? anti-parallel 
AO9 5 6 ? anti-parallel 
AP1 1 2 ? anti-parallel 
AP1 2 3 ? anti-parallel 
AP1 3 4 ? anti-parallel 
AP2 1 2 ? anti-parallel 
AP2 2 3 ? anti-parallel 
AP2 3 4 ? anti-parallel 
AP3 1 2 ? anti-parallel 
AP3 2 3 ? anti-parallel 
AP3 3 4 ? anti-parallel 
AP4 1 2 ? parallel      
AP4 2 3 ? anti-parallel 
AP4 3 4 ? anti-parallel 
AP4 4 5 ? anti-parallel 
AP4 5 6 ? anti-parallel 
AP5 1 2 ? anti-parallel 
AP5 2 3 ? anti-parallel 
AP5 3 4 ? anti-parallel 
AP6 1 2 ? anti-parallel 
AP6 2 3 ? anti-parallel 
AP6 3 4 ? anti-parallel 
AP7 1 2 ? anti-parallel 
AP7 2 3 ? anti-parallel 
AP8 1 2 ? anti-parallel 
AP8 2 3 ? anti-parallel 
AP8 3 4 ? anti-parallel 
AP9 1 2 ? parallel      
AQ1 1 2 ? anti-parallel 
AQ1 2 3 ? anti-parallel 
AQ1 3 4 ? anti-parallel 
AQ1 4 5 ? anti-parallel 
AQ2 1 2 ? anti-parallel 
AQ2 2 3 ? anti-parallel 
AQ2 3 4 ? anti-parallel 
AQ3 1 2 ? anti-parallel 
AQ3 2 3 ? anti-parallel 
AQ3 3 4 ? anti-parallel 
AQ4 1 2 ? anti-parallel 
AQ4 2 3 ? anti-parallel 
AQ4 3 4 ? anti-parallel 
AQ5 1 2 ? anti-parallel 
AQ5 2 3 ? anti-parallel 
AQ5 3 4 ? anti-parallel 
AQ5 4 5 ? anti-parallel 
AQ6 1 2 ? anti-parallel 
AQ6 2 3 ? anti-parallel 
AQ6 3 4 ? anti-parallel 
AQ7 1 2 ? anti-parallel 
AQ7 2 3 ? anti-parallel 
AQ8 1 2 ? anti-parallel 
AQ8 2 3 ? anti-parallel 
AQ8 3 4 ? anti-parallel 
AQ9 1 2 ? parallel      
AQ9 2 3 ? anti-parallel 
AQ9 3 4 ? anti-parallel 
AQ9 4 5 ? anti-parallel 
AQ9 5 6 ? anti-parallel 
AR1 1 2 ? anti-parallel 
AR1 2 3 ? anti-parallel 
AR1 3 4 ? anti-parallel 
AR2 1 2 ? anti-parallel 
AR2 2 3 ? anti-parallel 
AR2 3 4 ? anti-parallel 
AR3 1 2 ? anti-parallel 
AR3 2 3 ? anti-parallel 
AR3 3 4 ? anti-parallel 
AR4 1 2 ? anti-parallel 
AR4 2 3 ? anti-parallel 
AR4 3 4 ? anti-parallel 
AR4 4 5 ? anti-parallel 
AR5 1 2 ? anti-parallel 
AR5 2 3 ? anti-parallel 
AR5 3 4 ? anti-parallel 
AR5 4 5 ? anti-parallel 
AR6 1 2 ? anti-parallel 
AR6 2 3 ? anti-parallel 
AR6 3 4 ? anti-parallel 
AR7 1 2 ? anti-parallel 
AR7 2 3 ? anti-parallel 
AR7 3 4 ? anti-parallel 
AR8 1 2 ? anti-parallel 
AR8 2 3 ? anti-parallel 
AR9 1 2 ? anti-parallel 
AR9 2 3 ? anti-parallel 
AR9 3 4 ? anti-parallel 
AS1 1 2 ? parallel      
AS1 2 3 ? anti-parallel 
AS1 3 4 ? anti-parallel 
AS1 4 5 ? anti-parallel 
AS1 5 6 ? anti-parallel 
AS2 1 2 ? anti-parallel 
AS2 2 3 ? anti-parallel 
AS2 3 4 ? anti-parallel 
AS3 1 2 ? anti-parallel 
AS3 2 3 ? anti-parallel 
AS3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A  21  ? GLY A  30  ? THR A 29  GLY A 38  
AA1 2 PHE A  353 ? THR A  375 ? PHE A 361 THR A 383 
AA1 3 GLN A  88  ? ARG A  101 ? GLN A 96  ARG A 109 
AA1 4 ILE A  315 ? CYS A  316 ? ILE A 323 CYS A 324 
AA2 1 LEU A  34  ? GLY A  38  ? LEU A 42  GLY A 46  
AA2 2 PHE A  353 ? THR A  375 ? PHE A 361 THR A 383 
AA2 3 THR C  258 ? MET C  259 ? THR C 266 MET C 267 
AA3 1 LEU A  334 ? SER A  339 ? LEU A 342 SER A 347 
AA3 2 PHE A  353 ? THR A  375 ? PHE A 361 THR A 383 
AA3 3 GLN A  88  ? ARG A  101 ? GLN A 96  ARG A 109 
AA3 4 PRO A  302 ? TRP A  304 ? PRO A 310 TRP A 312 
AA4 1 TYR A  283 ? SER A  288 ? TYR A 291 SER A 296 
AA4 2 PHE A  240 ? ASN A  254 ? PHE A 248 ASN A 262 
AA4 3 GLN A  145 ? GLY A  152 ? GLN A 153 GLY A 160 
AA4 4 GLN A  320 ? ASP A  327 ? GLN A 328 ASP A 335 
AA4 5 ARG A  63  ? LYS A  68  ? ARG A 71  LYS A 76  
AA4 6 TRP A  440 ? ASP A  443 ? TRP A 448 ASP A 451 
AA5 1 TYR A  283 ? SER A  288 ? TYR A 291 SER A 296 
AA5 2 PHE A  240 ? ASN A  254 ? PHE A 248 ASN A 262 
AA5 3 VAL B  292 ? THR B  293 ? VAL B 300 THR B 301 
AA6 1 SER A  110 ? TYR A  115 ? SER A 118 TYR A 123 
AA6 2 ASP A  137 ? VAL A  141 ? ASP A 145 VAL A 149 
AA7 1 LEU A  180 ? PRO A  186 ? LEU A 188 PRO A 194 
AA7 2 ILE A  157 ? LYS A  163 ? ILE A 165 LYS A 171 
AA7 3 CYS A  221 ? PRO A  224 ? CYS A 229 PRO A 232 
AA7 4 MET A  192 ? VAL A  193 ? MET A 200 VAL A 201 
AA8 1 THR A  258 ? MET A  259 ? THR A 266 MET A 267 
AA8 2 PHE B  353 ? THR B  375 ? PHE B 361 THR B 383 
AA8 3 GLN B  88  ? ARG B  101 ? GLN B 96  ARG B 109 
AA8 4 PRO B  302 ? TRP B  304 ? PRO B 310 TRP B 312 
AA9 1 THR B  21  ? GLY B  30  ? THR B 29  GLY B 38  
AA9 2 PHE B  353 ? THR B  375 ? PHE B 361 THR B 383 
AA9 3 GLN B  88  ? ARG B  101 ? GLN B 96  ARG B 109 
AA9 4 ILE B  315 ? CYS B  316 ? ILE B 323 CYS B 324 
AB1 1 LEU B  334 ? SER B  339 ? LEU B 342 SER B 347 
AB1 2 PHE B  353 ? THR B  375 ? PHE B 361 THR B 383 
AB1 3 LEU B  34  ? GLY B  38  ? LEU B 42  GLY B 46  
AB2 1 VAL A  292 ? THR A  293 ? VAL A 300 THR A 301 
AB2 2 PHE C  240 ? ASN C  254 ? PHE C 248 ASN C 262 
AB2 3 TYR C  283 ? SER C  288 ? TYR C 291 SER C 296 
AB3 1 VAL A  292 ? THR A  293 ? VAL A 300 THR A 301 
AB3 2 PHE C  240 ? ASN C  254 ? PHE C 248 ASN C 262 
AB3 3 GLN C  145 ? GLY C  152 ? GLN C 153 GLY C 160 
AB3 4 GLN C  320 ? ASP C  327 ? GLN C 328 ASP C 335 
AB3 5 ARG C  63  ? LYS C  68  ? ARG C 71  LYS C 76  
AB3 6 TRP C  440 ? ASP C  443 ? TRP C 448 ASP C 451 
AB4 1 TYR B  283 ? SER B  288 ? TYR B 291 SER B 296 
AB4 2 PHE B  240 ? ASN B  254 ? PHE B 248 ASN B 262 
AB4 3 GLN B  145 ? GLY B  152 ? GLN B 153 GLY B 160 
AB4 4 GLN B  320 ? ASP B  327 ? GLN B 328 ASP B 335 
AB4 5 ARG B  63  ? LYS B  68  ? ARG B 71  LYS B 76  
AB4 6 TRP B  440 ? ASP B  443 ? TRP B 448 ASP B 451 
AB5 1 TYR B  283 ? SER B  288 ? TYR B 291 SER B 296 
AB5 2 PHE B  240 ? ASN B  254 ? PHE B 248 ASN B 262 
AB5 3 VAL E  292 ? THR E  293 ? VAL E 300 THR E 301 
AB6 1 SER B  110 ? TYR B  115 ? SER B 118 TYR B 123 
AB6 2 ASP B  137 ? VAL B  141 ? ASP B 145 VAL B 149 
AB7 1 LEU B  180 ? PRO B  186 ? LEU B 188 PRO B 194 
AB7 2 ILE B  157 ? LYS B  163 ? ILE B 165 LYS B 171 
AB7 3 CYS B  221 ? PRO B  224 ? CYS B 229 PRO B 232 
AB7 4 MET B  192 ? VAL B  193 ? MET B 200 VAL B 201 
AB8 1 THR B  258 ? MET B  259 ? THR B 266 MET B 267 
AB8 2 PHE E  353 ? THR E  375 ? PHE E 361 THR E 383 
AB8 3 GLN E  88  ? ARG E  101 ? GLN E 96  ARG E 109 
AB8 4 PRO E  302 ? TRP E  304 ? PRO E 310 TRP E 312 
AB9 1 THR E  21  ? GLY E  30  ? THR E 29  GLY E 38  
AB9 2 PHE E  353 ? THR E  375 ? PHE E 361 THR E 383 
AB9 3 GLN E  88  ? ARG E  101 ? GLN E 96  ARG E 109 
AB9 4 ILE E  315 ? CYS E  316 ? ILE E 323 CYS E 324 
AC1 1 LEU E  334 ? SER E  339 ? LEU E 342 SER E 347 
AC1 2 PHE E  353 ? THR E  375 ? PHE E 361 THR E 383 
AC1 3 LEU E  34  ? GLY E  38  ? LEU E 42  GLY E 46  
AC2 1 THR C  21  ? GLY C  30  ? THR C 29  GLY C 38  
AC2 2 PHE C  353 ? THR C  375 ? PHE C 361 THR C 383 
AC2 3 GLN C  88  ? ARG C  101 ? GLN C 96  ARG C 109 
AC2 4 PRO C  302 ? TRP C  304 ? PRO C 310 TRP C 312 
AC3 1 PHE C  448 ? SER C  449 ? PHE C 456 SER C 457 
AC3 2 THR C  21  ? GLY C  30  ? THR C 29  GLY C 38  
AC3 3 PHE C  353 ? THR C  375 ? PHE C 361 THR C 383 
AC3 4 THR D  258 ? MET D  259 ? THR D 266 MET D 267 
AC4 1 LEU C  334 ? SER C  339 ? LEU C 342 SER C 347 
AC4 2 PHE C  353 ? THR C  375 ? PHE C 361 THR C 383 
AC4 3 LEU C  34  ? GLY C  38  ? LEU C 42  GLY C 46  
AC5 1 SER C  110 ? TYR C  115 ? SER C 118 TYR C 123 
AC5 2 ASP C  137 ? VAL C  141 ? ASP C 145 VAL C 149 
AC6 1 LEU C  180 ? PRO C  186 ? LEU C 188 PRO C 194 
AC6 2 ILE C  157 ? LYS C  163 ? ILE C 165 LYS C 171 
AC6 3 CYS C  221 ? PRO C  224 ? CYS C 229 PRO C 232 
AC6 4 MET C  192 ? VAL C  193 ? MET C 200 VAL C 201 
AC7 1 VAL C  292 ? THR C  293 ? VAL C 300 THR C 301 
AC7 2 PHE D  240 ? ASN D  254 ? PHE D 248 ASN D 262 
AC7 3 TYR D  283 ? SER D  288 ? TYR D 291 SER D 296 
AC8 1 VAL C  292 ? THR C  293 ? VAL C 300 THR C 301 
AC8 2 PHE D  240 ? ASN D  254 ? PHE D 248 ASN D 262 
AC8 3 GLN D  145 ? GLY D  152 ? GLN D 153 GLY D 160 
AC8 4 GLN D  320 ? ASP D  327 ? GLN D 328 ASP D 335 
AC8 5 ARG D  63  ? LYS D  68  ? ARG D 71  LYS D 76  
AC8 6 TRP D  440 ? ASP D  443 ? TRP D 448 ASP D 451 
AC9 1 THR D  21  ? GLY D  30  ? THR D 29  GLY D 38  
AC9 2 PHE D  353 ? THR D  375 ? PHE D 361 THR D 383 
AC9 3 GLN D  88  ? ARG D  101 ? GLN D 96  ARG D 109 
AC9 4 ILE D  315 ? CYS D  316 ? ILE D 323 CYS D 324 
AD1 1 LEU D  34  ? GLY D  38  ? LEU D 42  GLY D 46  
AD1 2 PHE D  353 ? THR D  375 ? PHE D 361 THR D 383 
AD1 3 THR E  258 ? MET E  259 ? THR E 266 MET E 267 
AD2 1 LEU D  334 ? SER D  339 ? LEU D 342 SER D 347 
AD2 2 PHE D  353 ? THR D  375 ? PHE D 361 THR D 383 
AD2 3 GLN D  88  ? ARG D  101 ? GLN D 96  ARG D 109 
AD2 4 PRO D  302 ? TRP D  304 ? PRO D 310 TRP D 312 
AD3 1 SER D  110 ? TYR D  115 ? SER D 118 TYR D 123 
AD3 2 ASP D  137 ? VAL D  141 ? ASP D 145 VAL D 149 
AD4 1 LEU D  180 ? PRO D  186 ? LEU D 188 PRO D 194 
AD4 2 ILE D  157 ? LYS D  163 ? ILE D 165 LYS D 171 
AD4 3 CYS D  221 ? PRO D  224 ? CYS D 229 PRO D 232 
AD4 4 MET D  192 ? VAL D  193 ? MET D 200 VAL D 201 
AD5 1 VAL D  292 ? THR D  293 ? VAL D 300 THR D 301 
AD5 2 PHE E  240 ? ASN E  254 ? PHE E 248 ASN E 262 
AD5 3 TYR E  283 ? SER E  288 ? TYR E 291 SER E 296 
AD6 1 VAL D  292 ? THR D  293 ? VAL D 300 THR D 301 
AD6 2 PHE E  240 ? ASN E  254 ? PHE E 248 ASN E 262 
AD6 3 GLN E  145 ? GLY E  152 ? GLN E 153 GLY E 160 
AD6 4 GLN E  320 ? ASP E  327 ? GLN E 328 ASP E 335 
AD6 5 ARG E  63  ? LYS E  68  ? ARG E 71  LYS E 76  
AD6 6 TRP E  440 ? ASP E  443 ? TRP E 448 ASP E 451 
AD7 1 SER E  110 ? TYR E  115 ? SER E 118 TYR E 123 
AD7 2 ASP E  137 ? VAL E  141 ? ASP E 145 VAL E 149 
AD8 1 LEU E  180 ? PRO E  186 ? LEU E 188 PRO E 194 
AD8 2 ILE E  157 ? LYS E  163 ? ILE E 165 LYS E 171 
AD8 3 CYS E  221 ? PRO E  224 ? CYS E 229 PRO E 232 
AD8 4 MET E  192 ? VAL E  193 ? MET E 200 VAL E 201 
AD9 1 THR F  21  ? GLY F  30  ? THR F 29  GLY F 38  
AD9 2 PHE F  353 ? THR F  375 ? PHE F 361 THR F 383 
AD9 3 GLN F  88  ? ARG F  101 ? GLN F 96  ARG F 109 
AD9 4 ILE F  315 ? CYS F  316 ? ILE F 323 CYS F 324 
AE1 1 LEU F  34  ? GLY F  38  ? LEU F 42  GLY F 46  
AE1 2 PHE F  353 ? THR F  375 ? PHE F 361 THR F 383 
AE1 3 THR J  258 ? MET J  259 ? THR J 266 MET J 267 
AE2 1 LEU F  334 ? SER F  339 ? LEU F 342 SER F 347 
AE2 2 PHE F  353 ? THR F  375 ? PHE F 361 THR F 383 
AE2 3 GLN F  88  ? ARG F  101 ? GLN F 96  ARG F 109 
AE2 4 PRO F  302 ? TRP F  304 ? PRO F 310 TRP F 312 
AE3 1 TYR F  283 ? SER F  288 ? TYR F 291 SER F 296 
AE3 2 PHE F  240 ? ASN F  254 ? PHE F 248 ASN F 262 
AE3 3 GLN F  145 ? GLY F  152 ? GLN F 153 GLY F 160 
AE3 4 GLN F  320 ? ASP F  327 ? GLN F 328 ASP F 335 
AE3 5 ARG F  63  ? LYS F  68  ? ARG F 71  LYS F 76  
AE3 6 TRP F  440 ? ASP F  443 ? TRP F 448 ASP F 451 
AE4 1 TYR F  283 ? SER F  288 ? TYR F 291 SER F 296 
AE4 2 PHE F  240 ? ASN F  254 ? PHE F 248 ASN F 262 
AE4 3 VAL G  292 ? THR G  293 ? VAL G 300 THR G 301 
AE5 1 SER F  110 ? TYR F  115 ? SER F 118 TYR F 123 
AE5 2 ASP F  137 ? VAL F  141 ? ASP F 145 VAL F 149 
AE6 1 LEU F  180 ? PRO F  186 ? LEU F 188 PRO F 194 
AE6 2 ILE F  157 ? LYS F  163 ? ILE F 165 LYS F 171 
AE6 3 CYS F  221 ? PRO F  224 ? CYS F 229 PRO F 232 
AE6 4 MET F  192 ? VAL F  193 ? MET F 200 VAL F 201 
AE7 1 THR F  258 ? MET F  259 ? THR F 266 MET F 267 
AE7 2 PHE G  353 ? THR G  375 ? PHE G 361 THR G 383 
AE7 3 GLN G  88  ? ARG G  101 ? GLN G 96  ARG G 109 
AE7 4 PRO G  302 ? TRP G  304 ? PRO G 310 TRP G 312 
AE8 1 THR G  21  ? GLY G  30  ? THR G 29  GLY G 38  
AE8 2 PHE G  353 ? THR G  375 ? PHE G 361 THR G 383 
AE8 3 GLN G  88  ? ARG G  101 ? GLN G 96  ARG G 109 
AE8 4 ILE G  315 ? CYS G  316 ? ILE G 323 CYS G 324 
AE9 1 LEU G  334 ? SER G  339 ? LEU G 342 SER G 347 
AE9 2 PHE G  353 ? THR G  375 ? PHE G 361 THR G 383 
AE9 3 LEU G  34  ? GLY G  38  ? LEU G 42  GLY G 46  
AF1 1 VAL F  292 ? THR F  293 ? VAL F 300 THR F 301 
AF1 2 PHE J  240 ? ASN J  254 ? PHE J 248 ASN J 262 
AF1 3 TYR J  283 ? SER J  288 ? TYR J 291 SER J 296 
AF2 1 VAL F  292 ? THR F  293 ? VAL F 300 THR F 301 
AF2 2 PHE J  240 ? ASN J  254 ? PHE J 248 ASN J 262 
AF2 3 GLN J  145 ? GLY J  152 ? GLN J 153 GLY J 160 
AF2 4 GLN J  320 ? ASP J  327 ? GLN J 328 ASP J 335 
AF2 5 ARG J  63  ? LYS J  68  ? ARG J 71  LYS J 76  
AF2 6 TRP J  440 ? ASP J  443 ? TRP J 448 ASP J 451 
AF3 1 TYR G  283 ? SER G  288 ? TYR G 291 SER G 296 
AF3 2 PHE G  240 ? ASN G  254 ? PHE G 248 ASN G 262 
AF3 3 GLN G  145 ? GLY G  152 ? GLN G 153 GLY G 160 
AF3 4 GLN G  320 ? ASP G  327 ? GLN G 328 ASP G 335 
AF3 5 ARG G  63  ? LYS G  68  ? ARG G 71  LYS G 76  
AF3 6 TRP G  440 ? ASP G  443 ? TRP G 448 ASP G 451 
AF4 1 TYR G  283 ? SER G  288 ? TYR G 291 SER G 296 
AF4 2 PHE G  240 ? ASN G  254 ? PHE G 248 ASN G 262 
AF4 3 VAL H  292 ? THR H  293 ? VAL H 300 THR H 301 
AF5 1 SER G  110 ? TYR G  115 ? SER G 118 TYR G 123 
AF5 2 ASP G  137 ? VAL G  141 ? ASP G 145 VAL G 149 
AF6 1 LEU G  180 ? PRO G  186 ? LEU G 188 PRO G 194 
AF6 2 ILE G  157 ? LYS G  163 ? ILE G 165 LYS G 171 
AF6 3 CYS G  221 ? PRO G  224 ? CYS G 229 PRO G 232 
AF6 4 MET G  192 ? VAL G  193 ? MET G 200 VAL G 201 
AF7 1 THR G  258 ? MET G  259 ? THR G 266 MET G 267 
AF7 2 PHE H  353 ? THR H  375 ? PHE H 361 THR H 383 
AF7 3 GLN H  88  ? ARG H  101 ? GLN H 96  ARG H 109 
AF7 4 PRO H  302 ? TRP H  304 ? PRO H 310 TRP H 312 
AF8 1 THR H  21  ? GLY H  30  ? THR H 29  GLY H 38  
AF8 2 PHE H  353 ? THR H  375 ? PHE H 361 THR H 383 
AF8 3 GLN H  88  ? ARG H  101 ? GLN H 96  ARG H 109 
AF8 4 ILE H  315 ? CYS H  316 ? ILE H 323 CYS H 324 
AF9 1 LEU H  334 ? SER H  339 ? LEU H 342 SER H 347 
AF9 2 PHE H  353 ? THR H  375 ? PHE H 361 THR H 383 
AF9 3 LEU H  34  ? GLY H  38  ? LEU H 42  GLY H 46  
AG1 1 TYR H  283 ? SER H  288 ? TYR H 291 SER H 296 
AG1 2 PHE H  240 ? ASN H  254 ? PHE H 248 ASN H 262 
AG1 3 GLN H  145 ? GLY H  152 ? GLN H 153 GLY H 160 
AG1 4 GLN H  320 ? ASP H  327 ? GLN H 328 ASP H 335 
AG1 5 ARG H  63  ? LYS H  68  ? ARG H 71  LYS H 76  
AG1 6 TRP H  440 ? ASP H  443 ? TRP H 448 ASP H 451 
AG2 1 TYR H  283 ? SER H  288 ? TYR H 291 SER H 296 
AG2 2 PHE H  240 ? ASN H  254 ? PHE H 248 ASN H 262 
AG2 3 VAL I  292 ? THR I  293 ? VAL I 300 THR I 301 
AG3 1 SER H  110 ? TYR H  115 ? SER H 118 TYR H 123 
AG3 2 ASP H  137 ? VAL H  141 ? ASP H 145 VAL H 149 
AG4 1 LEU H  180 ? PRO H  186 ? LEU H 188 PRO H 194 
AG4 2 ILE H  157 ? LYS H  163 ? ILE H 165 LYS H 171 
AG4 3 CYS H  221 ? PRO H  224 ? CYS H 229 PRO H 232 
AG4 4 MET H  192 ? VAL H  193 ? MET H 200 VAL H 201 
AG5 1 THR H  258 ? MET H  259 ? THR H 266 MET H 267 
AG5 2 PHE I  353 ? THR I  375 ? PHE I 361 THR I 383 
AG5 3 GLN I  88  ? ARG I  101 ? GLN I 96  ARG I 109 
AG5 4 PRO I  302 ? TRP I  304 ? PRO I 310 TRP I 312 
AG6 1 THR I  21  ? GLY I  30  ? THR I 29  GLY I 38  
AG6 2 PHE I  353 ? THR I  375 ? PHE I 361 THR I 383 
AG6 3 GLN I  88  ? ARG I  101 ? GLN I 96  ARG I 109 
AG6 4 ILE I  315 ? CYS I  316 ? ILE I 323 CYS I 324 
AG7 1 LEU I  334 ? SER I  339 ? LEU I 342 SER I 347 
AG7 2 PHE I  353 ? THR I  375 ? PHE I 361 THR I 383 
AG7 3 LEU I  34  ? GLY I  38  ? LEU I 42  GLY I 46  
AG8 1 TYR I  283 ? SER I  288 ? TYR I 291 SER I 296 
AG8 2 PHE I  240 ? ASN I  254 ? PHE I 248 ASN I 262 
AG8 3 GLN I  145 ? GLY I  152 ? GLN I 153 GLY I 160 
AG8 4 GLN I  320 ? ASP I  327 ? GLN I 328 ASP I 335 
AG8 5 ARG I  63  ? LYS I  68  ? ARG I 71  LYS I 76  
AG8 6 TRP I  440 ? ASP I  443 ? TRP I 448 ASP I 451 
AG9 1 TYR I  283 ? SER I  288 ? TYR I 291 SER I 296 
AG9 2 PHE I  240 ? ASN I  254 ? PHE I 248 ASN I 262 
AG9 3 VAL J  292 ? THR J  293 ? VAL J 300 THR J 301 
AH1 1 SER I  110 ? TYR I  115 ? SER I 118 TYR I 123 
AH1 2 ASP I  137 ? VAL I  141 ? ASP I 145 VAL I 149 
AH2 1 LEU I  180 ? PRO I  186 ? LEU I 188 PRO I 194 
AH2 2 ILE I  157 ? LYS I  163 ? ILE I 165 LYS I 171 
AH2 3 CYS I  221 ? PRO I  224 ? CYS I 229 PRO I 232 
AH2 4 MET I  192 ? VAL I  193 ? MET I 200 VAL I 201 
AH3 1 THR I  258 ? MET I  259 ? THR I 266 MET I 267 
AH3 2 PHE J  353 ? THR J  375 ? PHE J 361 THR J 383 
AH3 3 GLN J  88  ? ARG J  101 ? GLN J 96  ARG J 109 
AH3 4 PRO J  302 ? TRP J  304 ? PRO J 310 TRP J 312 
AH4 1 THR J  21  ? GLY J  30  ? THR J 29  GLY J 38  
AH4 2 PHE J  353 ? THR J  375 ? PHE J 361 THR J 383 
AH4 3 GLN J  88  ? ARG J  101 ? GLN J 96  ARG J 109 
AH4 4 ILE J  315 ? CYS J  316 ? ILE J 323 CYS J 324 
AH5 1 LEU J  334 ? SER J  339 ? LEU J 342 SER J 347 
AH5 2 PHE J  353 ? THR J  375 ? PHE J 361 THR J 383 
AH5 3 LEU J  34  ? GLY J  38  ? LEU J 42  GLY J 46  
AH6 1 SER J  110 ? TYR J  115 ? SER J 118 TYR J 123 
AH6 2 ASP J  137 ? VAL J  141 ? ASP J 145 VAL J 149 
AH7 1 LEU J  180 ? PRO J  186 ? LEU J 188 PRO J 194 
AH7 2 ILE J  157 ? LYS J  163 ? ILE J 165 LYS J 171 
AH7 3 CYS J  221 ? PRO J  224 ? CYS J 229 PRO J 232 
AH7 4 MET J  192 ? VAL J  193 ? MET J 200 VAL J 201 
AH8 1 MET K  4   ? THR K  7   ? MET K 4   THR K 7   
AH8 2 ALA K  19  ? SER K  25  ? ALA K 19  SER K 25  
AH8 3 ASP K  75  ? ILE K  80  ? ASP K 75  ILE K 80  
AH8 4 PHE K  67  ? SER K  72  ? PHE K 67  SER K 72  
AH9 1 SER K  10  ? VAL K  13  ? SER K 10  VAL K 13  
AH9 2 THR K  102 ? LEU K  111 ? THR K 102 LEU K 111 
AH9 3 VAL K  90  ? GLN K  95  ? VAL K 90  GLN K 95  
AH9 4 LEU K  38  ? GLN K  43  ? LEU K 38  GLN K 43  
AH9 5 LYS K  50  ? TYR K  54  ? LYS K 50  TYR K 54  
AH9 6 ASN K  58  ? ARG K  59  ? ASN K 58  ARG K 59  
AI1 1 THR K  119 ? PHE K  123 ? THR K 119 PHE K 123 
AI1 2 GLY K  134 ? PHE K  144 ? GLY K 134 PHE K 144 
AI1 3 TYR K  178 ? THR K  187 ? TYR K 178 THR K 187 
AI1 4 VAL K  164 ? TRP K  168 ? VAL K 164 TRP K 168 
AI2 1 SER K  158 ? GLU K  159 ? SER K 158 GLU K 159 
AI2 2 ILE K  149 ? ILE K  155 ? ILE K 149 ILE K 155 
AI2 3 TYR K  197 ? HIS K  203 ? TYR K 197 HIS K 203 
AI2 4 ILE K  210 ? PHE K  214 ? ILE K 210 PHE K 214 
AI3 1 LYS L  3   ? SER L  7   ? LYS L 3   SER L 7   
AI3 2 LEU L  18  ? SER L  25  ? LEU L 18  SER L 25  
AI3 3 THR L  78  ? MET L  83  ? THR L 78  MET L 83  
AI3 4 PHE L  68  ? ASP L  73  ? PHE L 68  ASP L 73  
AI4 1 THR L  58  ? TYR L  59  ? THR L 58  TYR L 59  
AI4 2 LEU L  45  ? ILE L  51  ? LEU L 45  ILE L 51  
AI4 3 TYR L  32  ? GLN L  39  ? TYR L 32  GLN L 39  
AI4 4 ALA L  92  ? PRO L  101 ? ALA L 92  PRO L 101 
AI4 5 TYR L  112 ? TRP L  113 ? TYR L 112 TRP L 113 
AI5 1 THR L  58  ? TYR L  59  ? THR L 58  TYR L 59  
AI5 2 LEU L  45  ? ILE L  51  ? LEU L 45  ILE L 51  
AI5 3 TYR L  32  ? GLN L  39  ? TYR L 32  GLN L 39  
AI5 4 ALA L  92  ? PRO L  101 ? ALA L 92  PRO L 101 
AI5 5 THR L  117 ? VAL L  119 ? THR L 117 VAL L 119 
AI6 1 SER L  130 ? LEU L  134 ? SER L 130 LEU L 134 
AI6 2 VAL L  146 ? TYR L  155 ? VAL L 146 TYR L 155 
AI6 3 LEU L  184 ? VAL L  193 ? LEU L 184 VAL L 193 
AI6 4 VAL L  173 ? THR L  175 ? VAL L 173 THR L 175 
AI7 1 SER L  130 ? LEU L  134 ? SER L 130 LEU L 134 
AI7 2 VAL L  146 ? TYR L  155 ? VAL L 146 TYR L 155 
AI7 3 LEU L  184 ? VAL L  193 ? LEU L 184 VAL L 193 
AI7 4 LEU L  179 ? GLN L  181 ? LEU L 179 GLN L 181 
AI8 1 THR L  163 ? TRP L  164 ? THR L 163 TRP L 164 
AI8 2 THR L  204 ? HIS L  209 ? THR L 204 HIS L 209 
AI8 3 THR L  214 ? LYS L  219 ? THR L 214 LYS L 219 
AI9 1 MET M  4   ? THR M  7   ? MET O 4   THR O 7   
AI9 2 ALA M  19  ? SER M  25  ? ALA O 19  SER O 25  
AI9 3 ASP M  75  ? ILE M  80  ? ASP O 75  ILE O 80  
AI9 4 PHE M  67  ? SER M  72  ? PHE O 67  SER O 72  
AJ1 1 SER M  10  ? VAL M  13  ? SER O 10  VAL O 13  
AJ1 2 THR M  102 ? LEU M  111 ? THR O 102 LEU O 111 
AJ1 3 VAL M  90  ? GLN M  95  ? VAL O 90  GLN O 95  
AJ1 4 LEU M  38  ? GLN M  43  ? LEU O 38  GLN O 43  
AJ1 5 LYS M  50  ? TYR M  54  ? LYS O 50  TYR O 54  
AJ1 6 ASN M  58  ? ARG M  59  ? ASN O 58  ARG O 59  
AJ2 1 THR M  119 ? PHE M  123 ? THR O 119 PHE O 123 
AJ2 2 GLY M  134 ? PHE M  144 ? GLY O 134 PHE O 144 
AJ2 3 TYR M  178 ? THR M  187 ? TYR O 178 THR O 187 
AJ2 4 VAL M  164 ? TRP M  168 ? VAL O 164 TRP O 168 
AJ3 1 SER M  158 ? GLU M  159 ? SER O 158 GLU O 159 
AJ3 2 ILE M  149 ? ILE M  155 ? ILE O 149 ILE O 155 
AJ3 3 TYR M  197 ? HIS M  203 ? TYR O 197 HIS O 203 
AJ3 4 ILE M  210 ? PHE M  214 ? ILE O 210 PHE O 214 
AJ4 1 LYS N  3   ? SER N  7   ? LYS P 3   SER P 7   
AJ4 2 LEU N  18  ? SER N  25  ? LEU P 18  SER P 25  
AJ4 3 THR N  78  ? MET N  83  ? THR P 78  MET P 83  
AJ4 4 THR N  69  ? ASP N  73  ? THR P 69  ASP P 73  
AJ5 1 THR N  58  ? TYR N  59  ? THR P 58  TYR P 59  
AJ5 2 LEU N  45  ? ILE N  51  ? LEU P 45  ILE P 51  
AJ5 3 TYR N  32  ? GLN N  39  ? TYR P 32  GLN P 39  
AJ5 4 ALA N  92  ? PRO N  101 ? ALA P 92  PRO P 101 
AJ5 5 TYR N  112 ? TRP N  113 ? TYR P 112 TRP P 113 
AJ6 1 THR N  58  ? TYR N  59  ? THR P 58  TYR P 59  
AJ6 2 LEU N  45  ? ILE N  51  ? LEU P 45  ILE P 51  
AJ6 3 TYR N  32  ? GLN N  39  ? TYR P 32  GLN P 39  
AJ6 4 ALA N  92  ? PRO N  101 ? ALA P 92  PRO P 101 
AJ6 5 THR N  117 ? VAL N  119 ? THR P 117 VAL P 119 
AJ7 1 SER N  130 ? LEU N  134 ? SER P 130 LEU P 134 
AJ7 2 VAL N  146 ? TYR N  155 ? VAL P 146 TYR P 155 
AJ7 3 LEU N  184 ? VAL N  193 ? LEU P 184 VAL P 193 
AJ7 4 VAL N  173 ? THR N  175 ? VAL P 173 THR P 175 
AJ8 1 SER N  130 ? LEU N  134 ? SER P 130 LEU P 134 
AJ8 2 VAL N  146 ? TYR N  155 ? VAL P 146 TYR P 155 
AJ8 3 LEU N  184 ? VAL N  193 ? LEU P 184 VAL P 193 
AJ8 4 LEU N  179 ? GLN N  181 ? LEU P 179 GLN P 181 
AJ9 1 THR N  163 ? TRP N  164 ? THR P 163 TRP P 164 
AJ9 2 THR N  204 ? HIS N  209 ? THR P 204 HIS P 209 
AJ9 3 THR N  214 ? LYS N  219 ? THR P 214 LYS P 219 
AK1 1 MET O  4   ? THR O  7   ? MET Q 4   THR Q 7   
AK1 2 ALA O  19  ? SER O  25  ? ALA Q 19  SER Q 25  
AK1 3 ASP O  75  ? ILE O  80  ? ASP Q 75  ILE Q 80  
AK1 4 PHE O  67  ? SER O  72  ? PHE Q 67  SER Q 72  
AK2 1 SER O  10  ? VAL O  13  ? SER Q 10  VAL Q 13  
AK2 2 THR O  102 ? LEU O  111 ? THR Q 102 LEU Q 111 
AK2 3 VAL O  90  ? GLN O  95  ? VAL Q 90  GLN Q 95  
AK2 4 LEU O  38  ? GLN O  43  ? LEU Q 38  GLN Q 43  
AK2 5 LYS O  50  ? TYR O  54  ? LYS Q 50  TYR Q 54  
AK2 6 ASN O  58  ? ARG O  59  ? ASN Q 58  ARG Q 59  
AK3 1 THR O  119 ? PHE O  123 ? THR Q 119 PHE Q 123 
AK3 2 GLY O  134 ? PHE O  144 ? GLY Q 134 PHE Q 144 
AK3 3 TYR O  178 ? THR O  187 ? TYR Q 178 THR Q 187 
AK3 4 VAL O  164 ? TRP O  168 ? VAL Q 164 TRP Q 168 
AK4 1 SER O  158 ? GLU O  159 ? SER Q 158 GLU Q 159 
AK4 2 ILE O  149 ? ILE O  155 ? ILE Q 149 ILE Q 155 
AK4 3 SER O  196 ? HIS O  203 ? SER Q 196 HIS Q 203 
AK4 4 ILE O  210 ? ASN O  215 ? ILE Q 210 ASN Q 215 
AK5 1 LYS P  3   ? SER P  7   ? LYS R 3   SER R 7   
AK5 2 LEU P  18  ? SER P  25  ? LEU R 18  SER R 25  
AK5 3 THR P  78  ? MET P  83  ? THR R 78  MET R 83  
AK5 4 PHE P  68  ? ASP P  73  ? PHE R 68  ASP R 73  
AK6 1 LEU P  11  ? VAL P  12  ? LEU R 11  VAL R 12  
AK6 2 THR P  117 ? VAL P  121 ? THR R 117 VAL R 121 
AK6 3 ALA P  92  ? PRO P  101 ? ALA R 92  PRO R 101 
AK6 4 TYR P  32  ? GLN P  39  ? TYR R 32  GLN R 39  
AK6 5 LEU P  45  ? ILE P  51  ? LEU R 45  ILE R 51  
AK6 6 THR P  58  ? TYR P  59  ? THR R 58  TYR R 59  
AK7 1 SER P  130 ? LEU P  134 ? SER R 130 LEU R 134 
AK7 2 VAL P  146 ? TYR P  155 ? VAL R 146 TYR R 155 
AK7 3 LEU P  184 ? VAL P  193 ? LEU R 184 VAL R 193 
AK7 4 VAL P  173 ? THR P  175 ? VAL R 173 THR R 175 
AK8 1 SER P  130 ? LEU P  134 ? SER R 130 LEU R 134 
AK8 2 VAL P  146 ? TYR P  155 ? VAL R 146 TYR R 155 
AK8 3 LEU P  184 ? VAL P  193 ? LEU R 184 VAL R 193 
AK8 4 LEU P  179 ? GLN P  181 ? LEU R 179 GLN R 181 
AK9 1 THR P  163 ? TRP P  164 ? THR R 163 TRP R 164 
AK9 2 THR P  204 ? HIS P  209 ? THR R 204 HIS R 209 
AK9 3 THR P  214 ? LYS P  219 ? THR R 214 LYS R 219 
AL1 1 MET Q  4   ? THR Q  7   ? MET S 4   THR S 7   
AL1 2 ALA Q  19  ? SER Q  25  ? ALA S 19  SER S 25  
AL1 3 ASP Q  75  ? ILE Q  80  ? ASP S 75  ILE S 80  
AL1 4 PHE Q  67  ? SER Q  72  ? PHE S 67  SER S 72  
AL2 1 SER Q  10  ? VAL Q  13  ? SER S 10  VAL S 13  
AL2 2 THR Q  102 ? LEU Q  111 ? THR S 102 LEU S 111 
AL2 3 VAL Q  90  ? GLN Q  95  ? VAL S 90  GLN S 95  
AL2 4 LEU Q  38  ? GLN Q  43  ? LEU S 38  GLN S 43  
AL2 5 LYS Q  50  ? TYR Q  54  ? LYS S 50  TYR S 54  
AL2 6 ASN Q  58  ? ARG Q  59  ? ASN S 58  ARG S 59  
AL3 1 THR Q  119 ? PHE Q  123 ? THR S 119 PHE S 123 
AL3 2 GLY Q  134 ? PHE Q  144 ? GLY S 134 PHE S 144 
AL3 3 TYR Q  178 ? THR Q  187 ? TYR S 178 THR S 187 
AL3 4 VAL Q  164 ? TRP Q  168 ? VAL S 164 TRP S 168 
AL4 1 SER Q  158 ? GLU Q  159 ? SER S 158 GLU S 159 
AL4 2 ILE Q  149 ? ILE Q  155 ? ILE S 149 ILE S 155 
AL4 3 TYR Q  197 ? HIS Q  203 ? TYR S 197 HIS S 203 
AL4 4 ILE Q  210 ? PHE Q  214 ? ILE S 210 PHE S 214 
AL5 1 LYS R  3   ? SER R  7   ? LYS T 3   SER T 7   
AL5 2 LEU R  18  ? SER R  25  ? LEU T 18  SER T 25  
AL5 3 THR R  78  ? MET R  83  ? THR T 78  MET T 83  
AL5 4 THR R  69  ? ASP R  73  ? THR T 69  ASP T 73  
AL6 1 THR R  58  ? TYR R  59  ? THR T 58  TYR T 59  
AL6 2 LEU R  45  ? ILE R  51  ? LEU T 45  ILE T 51  
AL6 3 TYR R  32  ? GLN R  39  ? TYR T 32  GLN T 39  
AL6 4 ALA R  92  ? PRO R  101 ? ALA T 92  PRO T 101 
AL6 5 THR R  117 ? VAL R  119 ? THR T 117 VAL T 119 
AL7 1 SER R  130 ? LEU R  134 ? SER T 130 LEU T 134 
AL7 2 VAL R  146 ? TYR R  155 ? VAL T 146 TYR T 155 
AL7 3 LEU R  184 ? VAL R  193 ? LEU T 184 VAL T 193 
AL7 4 VAL R  173 ? THR R  175 ? VAL T 173 THR T 175 
AL8 1 SER R  130 ? LEU R  134 ? SER T 130 LEU T 134 
AL8 2 VAL R  146 ? TYR R  155 ? VAL T 146 TYR T 155 
AL8 3 LEU R  184 ? VAL R  193 ? LEU T 184 VAL T 193 
AL8 4 LEU R  179 ? GLN R  181 ? LEU T 179 GLN T 181 
AL9 1 THR R  161 ? TRP R  164 ? THR T 161 TRP T 164 
AL9 2 THR R  204 ? HIS R  209 ? THR T 204 HIS T 209 
AL9 3 THR R  214 ? LYS R  219 ? THR T 214 LYS T 219 
AM1 1 MET S  4   ? THR S  7   ? MET M 4   THR M 7   
AM1 2 ALA S  19  ? SER S  25  ? ALA M 19  SER M 25  
AM1 3 ASP S  75  ? ILE S  80  ? ASP M 75  ILE M 80  
AM1 4 PHE S  67  ? SER S  72  ? PHE M 67  SER M 72  
AM2 1 SER S  10  ? VAL S  13  ? SER M 10  VAL M 13  
AM2 2 THR S  102 ? LEU S  111 ? THR M 102 LEU M 111 
AM2 3 VAL S  90  ? GLN S  95  ? VAL M 90  GLN M 95  
AM2 4 LEU S  38  ? GLN S  43  ? LEU M 38  GLN M 43  
AM2 5 LYS S  50  ? TYR S  54  ? LYS M 50  TYR M 54  
AM2 6 ASN S  58  ? ARG S  59  ? ASN M 58  ARG M 59  
AM3 1 THR S  119 ? PHE S  123 ? THR M 119 PHE M 123 
AM3 2 GLY S  134 ? PHE S  144 ? GLY M 134 PHE M 144 
AM3 3 TYR S  178 ? THR S  187 ? TYR M 178 THR M 187 
AM3 4 VAL S  164 ? TRP S  168 ? VAL M 164 TRP M 168 
AM4 1 SER S  158 ? GLU S  159 ? SER M 158 GLU M 159 
AM4 2 ILE S  149 ? ILE S  155 ? ILE M 149 ILE M 155 
AM4 3 TYR S  197 ? HIS S  203 ? TYR M 197 HIS M 203 
AM4 4 ILE S  210 ? PHE S  214 ? ILE M 210 PHE M 214 
AM5 1 LYS T  3   ? SER T  7   ? LYS N 3   SER N 7   
AM5 2 LEU T  18  ? SER T  25  ? LEU N 18  SER N 25  
AM5 3 THR T  78  ? MET T  83  ? THR N 78  MET N 83  
AM5 4 THR T  69  ? ASP T  73  ? THR N 69  ASP N 73  
AM6 1 THR T  58  ? TYR T  59  ? THR N 58  TYR N 59  
AM6 2 LEU T  45  ? ILE T  51  ? LEU N 45  ILE N 51  
AM6 3 TYR T  32  ? GLN T  39  ? TYR N 32  GLN N 39  
AM6 4 ALA T  92  ? PRO T  101 ? ALA N 92  PRO N 101 
AM6 5 TYR T  112 ? TRP T  113 ? TYR N 112 TRP N 113 
AM7 1 THR T  58  ? TYR T  59  ? THR N 58  TYR N 59  
AM7 2 LEU T  45  ? ILE T  51  ? LEU N 45  ILE N 51  
AM7 3 TYR T  32  ? GLN T  39  ? TYR N 32  GLN N 39  
AM7 4 ALA T  92  ? PRO T  101 ? ALA N 92  PRO N 101 
AM7 5 THR T  117 ? VAL T  119 ? THR N 117 VAL N 119 
AM8 1 SER T  130 ? LEU T  134 ? SER N 130 LEU N 134 
AM8 2 VAL T  146 ? TYR T  155 ? VAL N 146 TYR N 155 
AM8 3 LEU T  184 ? VAL T  193 ? LEU N 184 VAL N 193 
AM8 4 VAL T  173 ? THR T  175 ? VAL N 173 THR N 175 
AM9 1 SER T  130 ? LEU T  134 ? SER N 130 LEU N 134 
AM9 2 VAL T  146 ? TYR T  155 ? VAL N 146 TYR N 155 
AM9 3 LEU T  184 ? VAL T  193 ? LEU N 184 VAL N 193 
AM9 4 LEU T  179 ? GLN T  181 ? LEU N 179 GLN N 181 
AN1 1 THR T  161 ? TRP T  164 ? THR N 161 TRP N 164 
AN1 2 THR T  204 ? HIS T  209 ? THR N 204 HIS N 209 
AN1 3 THR T  214 ? LYS T  219 ? THR N 214 LYS N 219 
AN2 1 MET U  4   ? THR U  7   ? MET c 4   THR c 7   
AN2 2 ALA U  19  ? SER U  25  ? ALA c 19  SER c 25  
AN2 3 ASP U  75  ? ILE U  80  ? ASP c 75  ILE c 80  
AN2 4 PHE U  67  ? SER U  72  ? PHE c 67  SER c 72  
AN3 1 SER U  10  ? VAL U  13  ? SER c 10  VAL c 13  
AN3 2 THR U  102 ? LEU U  111 ? THR c 102 LEU c 111 
AN3 3 VAL U  90  ? GLN U  95  ? VAL c 90  GLN c 95  
AN3 4 LEU U  38  ? GLN U  43  ? LEU c 38  GLN c 43  
AN3 5 LYS U  50  ? TYR U  54  ? LYS c 50  TYR c 54  
AN3 6 ASN U  58  ? ARG U  59  ? ASN c 58  ARG c 59  
AN4 1 THR U  119 ? PHE U  123 ? THR c 119 PHE c 123 
AN4 2 GLY U  134 ? PHE U  144 ? GLY c 134 PHE c 144 
AN4 3 TYR U  178 ? THR U  187 ? TYR c 178 THR c 187 
AN4 4 VAL U  164 ? THR U  169 ? VAL c 164 THR c 169 
AN5 1 SER U  158 ? GLU U  159 ? SER c 158 GLU c 159 
AN5 2 ILE U  149 ? ILE U  155 ? ILE c 149 ILE c 155 
AN5 3 TYR U  197 ? HIS U  203 ? TYR c 197 HIS c 203 
AN5 4 ILE U  210 ? PHE U  214 ? ILE c 210 PHE c 214 
AN6 1 LYS V  3   ? SER V  7   ? LYS d 3   SER d 7   
AN6 2 LEU V  18  ? SER V  25  ? LEU d 18  SER d 25  
AN6 3 THR V  78  ? MET V  83  ? THR d 78  MET d 83  
AN6 4 THR V  69  ? ASP V  73  ? THR d 69  ASP d 73  
AN7 1 THR V  58  ? TYR V  59  ? THR d 58  TYR d 59  
AN7 2 LEU V  45  ? ILE V  51  ? LEU d 45  ILE d 51  
AN7 3 TYR V  32  ? GLN V  39  ? TYR d 32  GLN d 39  
AN7 4 ALA V  92  ? PRO V  101 ? ALA d 92  PRO d 101 
AN7 5 TYR V  112 ? TRP V  113 ? TYR d 112 TRP d 113 
AN8 1 THR V  58  ? TYR V  59  ? THR d 58  TYR d 59  
AN8 2 LEU V  45  ? ILE V  51  ? LEU d 45  ILE d 51  
AN8 3 TYR V  32  ? GLN V  39  ? TYR d 32  GLN d 39  
AN8 4 ALA V  92  ? PRO V  101 ? ALA d 92  PRO d 101 
AN8 5 THR V  117 ? VAL V  119 ? THR d 117 VAL d 119 
AN9 1 SER V  130 ? LEU V  134 ? SER d 130 LEU d 134 
AN9 2 VAL V  146 ? TYR V  155 ? VAL d 146 TYR d 155 
AN9 3 LEU V  184 ? VAL V  193 ? LEU d 184 VAL d 193 
AN9 4 VAL V  173 ? THR V  175 ? VAL d 173 THR d 175 
AO1 1 SER V  130 ? LEU V  134 ? SER d 130 LEU d 134 
AO1 2 VAL V  146 ? TYR V  155 ? VAL d 146 TYR d 155 
AO1 3 LEU V  184 ? VAL V  193 ? LEU d 184 VAL d 193 
AO1 4 LEU V  179 ? GLN V  181 ? LEU d 179 GLN d 181 
AO2 1 THR V  161 ? TRP V  164 ? THR d 161 TRP d 164 
AO2 2 THR V  204 ? HIS V  209 ? THR d 204 HIS d 209 
AO2 3 THR V  214 ? LYS V  219 ? THR d 214 LYS d 219 
AO3 1 LYS W  3   ? SER W  7   ? LYS V 3   SER V 7   
AO3 2 LEU W  18  ? SER W  25  ? LEU V 18  SER V 25  
AO3 3 THR W  78  ? MET W  83  ? THR V 78  MET V 83  
AO3 4 THR W  69  ? ASP W  73  ? THR V 69  ASP V 73  
AO4 1 THR W  58  ? TYR W  59  ? THR V 58  TYR V 59  
AO4 2 LEU W  45  ? ILE W  51  ? LEU V 45  ILE V 51  
AO4 3 TYR W  32  ? GLN W  39  ? TYR V 32  GLN V 39  
AO4 4 ALA W  92  ? PRO W  101 ? ALA V 92  PRO V 101 
AO4 5 THR W  117 ? VAL W  119 ? THR V 117 VAL V 119 
AO5 1 SER W  130 ? LEU W  134 ? SER V 130 LEU V 134 
AO5 2 VAL W  146 ? TYR W  155 ? VAL V 146 TYR V 155 
AO5 3 LEU W  184 ? VAL W  193 ? LEU V 184 VAL V 193 
AO5 4 VAL W  173 ? THR W  175 ? VAL V 173 THR V 175 
AO6 1 SER W  130 ? LEU W  134 ? SER V 130 LEU V 134 
AO6 2 VAL W  146 ? TYR W  155 ? VAL V 146 TYR V 155 
AO6 3 LEU W  184 ? VAL W  193 ? LEU V 184 VAL V 193 
AO6 4 LEU W  179 ? GLN W  181 ? LEU V 179 GLN V 181 
AO7 1 THR W  163 ? TRP W  164 ? THR V 163 TRP V 164 
AO7 2 THR W  204 ? HIS W  209 ? THR V 204 HIS V 209 
AO7 3 THR W  214 ? LYS W  219 ? THR V 214 LYS V 219 
AO8 1 MET X  4   ? THR X  7   ? MET W 4   THR W 7   
AO8 2 ALA X  19  ? SER X  25  ? ALA W 19  SER W 25  
AO8 3 ASP X  75  ? ILE X  80  ? ASP W 75  ILE W 80  
AO8 4 PHE X  67  ? SER X  72  ? PHE W 67  SER W 72  
AO9 1 SER X  10  ? VAL X  13  ? SER W 10  VAL W 13  
AO9 2 THR X  102 ? LEU X  111 ? THR W 102 LEU W 111 
AO9 3 VAL X  90  ? GLN X  95  ? VAL W 90  GLN W 95  
AO9 4 LEU X  38  ? GLN X  43  ? LEU W 38  GLN W 43  
AO9 5 LYS X  50  ? TYR X  54  ? LYS W 50  TYR W 54  
AO9 6 ASN X  58  ? ARG X  59  ? ASN W 58  ARG W 59  
AP1 1 THR X  119 ? PHE X  123 ? THR W 119 PHE W 123 
AP1 2 GLY X  134 ? PHE X  144 ? GLY W 134 PHE W 144 
AP1 3 TYR X  178 ? THR X  187 ? TYR W 178 THR W 187 
AP1 4 VAL X  164 ? TRP X  168 ? VAL W 164 TRP W 168 
AP2 1 SER X  158 ? GLU X  159 ? SER W 158 GLU W 159 
AP2 2 ILE X  149 ? ILE X  155 ? ILE W 149 ILE W 155 
AP2 3 SER X  196 ? HIS X  203 ? SER W 196 HIS W 203 
AP2 4 ILE X  210 ? ASN X  215 ? ILE W 210 ASN W 215 
AP3 1 LYS Y  3   ? SER Y  7   ? LYS X 3   SER X 7   
AP3 2 LEU Y  18  ? SER Y  25  ? LEU X 18  SER X 25  
AP3 3 THR Y  78  ? MET Y  83  ? THR X 78  MET X 83  
AP3 4 PHE Y  68  ? ASP Y  73  ? PHE X 68  ASP X 73  
AP4 1 LEU Y  11  ? VAL Y  12  ? LEU X 11  VAL X 12  
AP4 2 THR Y  117 ? VAL Y  121 ? THR X 117 VAL X 121 
AP4 3 ALA Y  92  ? PRO Y  101 ? ALA X 92  PRO X 101 
AP4 4 TYR Y  32  ? GLN Y  39  ? TYR X 32  GLN X 39  
AP4 5 LEU Y  45  ? ILE Y  51  ? LEU X 45  ILE X 51  
AP4 6 THR Y  58  ? TYR Y  59  ? THR X 58  TYR X 59  
AP5 1 SER Y  130 ? LEU Y  134 ? SER X 130 LEU X 134 
AP5 2 VAL Y  146 ? TYR Y  155 ? VAL X 146 TYR X 155 
AP5 3 LEU Y  184 ? VAL Y  193 ? LEU X 184 VAL X 193 
AP5 4 VAL Y  173 ? THR Y  175 ? VAL X 173 THR X 175 
AP6 1 SER Y  130 ? LEU Y  134 ? SER X 130 LEU X 134 
AP6 2 VAL Y  146 ? TYR Y  155 ? VAL X 146 TYR X 155 
AP6 3 LEU Y  184 ? VAL Y  193 ? LEU X 184 VAL X 193 
AP6 4 LEU Y  179 ? GLN Y  181 ? LEU X 179 GLN X 181 
AP7 1 THR Y  163 ? TRP Y  164 ? THR X 163 TRP X 164 
AP7 2 THR Y  204 ? HIS Y  209 ? THR X 204 HIS X 209 
AP7 3 THR Y  214 ? LYS Y  219 ? THR X 214 LYS X 219 
AP8 1 MET Z  4   ? THR Z  7   ? MET Y 4   THR Y 7   
AP8 2 ALA Z  19  ? SER Z  25  ? ALA Y 19  SER Y 25  
AP8 3 ASP Z  75  ? ILE Z  80  ? ASP Y 75  ILE Y 80  
AP8 4 PHE Z  67  ? SER Z  72  ? PHE Y 67  SER Y 72  
AP9 1 SER Z  10  ? VAL Z  13  ? SER Y 10  VAL Y 13  
AP9 2 LYS Z  108 ? LEU Z  111 ? LYS Y 108 LEU Y 111 
AQ1 1 ASN Z  58  ? ARG Z  59  ? ASN Y 58  ARG Y 59  
AQ1 2 LYS Z  50  ? TYR Z  54  ? LYS Y 50  TYR Y 54  
AQ1 3 LEU Z  38  ? GLN Z  43  ? LEU Y 38  GLN Y 43  
AQ1 4 VAL Z  90  ? GLN Z  95  ? VAL Y 90  GLN Y 95  
AQ1 5 THR Z  102 ? GLY Z  104 ? THR Y 102 GLY Y 104 
AQ2 1 THR Z  119 ? PHE Z  123 ? THR Y 119 PHE Y 123 
AQ2 2 GLY Z  134 ? PHE Z  144 ? GLY Y 134 PHE Y 144 
AQ2 3 TYR Z  178 ? THR Z  187 ? TYR Y 178 THR Y 187 
AQ2 4 VAL Z  164 ? TRP Z  168 ? VAL Y 164 TRP Y 168 
AQ3 1 SER Z  158 ? GLU Z  159 ? SER Y 158 GLU Y 159 
AQ3 2 ILE Z  149 ? ILE Z  155 ? ILE Y 149 ILE Y 155 
AQ3 3 TYR Z  197 ? HIS Z  203 ? TYR Y 197 HIS Y 203 
AQ3 4 ILE Z  210 ? PHE Z  214 ? ILE Y 210 PHE Y 214 
AQ4 1 LYS AA 3   ? SER AA 7   ? LYS Z 3   SER Z 7   
AQ4 2 LEU AA 18  ? SER AA 25  ? LEU Z 18  SER Z 25  
AQ4 3 THR AA 78  ? MET AA 83  ? THR Z 78  MET Z 83  
AQ4 4 THR AA 69  ? ASP AA 73  ? THR Z 69  ASP Z 73  
AQ5 1 THR AA 58  ? TYR AA 59  ? THR Z 58  TYR Z 59  
AQ5 2 LEU AA 45  ? ILE AA 51  ? LEU Z 45  ILE Z 51  
AQ5 3 TYR AA 32  ? GLN AA 39  ? TYR Z 32  GLN Z 39  
AQ5 4 ALA AA 92  ? PRO AA 101 ? ALA Z 92  PRO Z 101 
AQ5 5 THR AA 117 ? VAL AA 119 ? THR Z 117 VAL Z 119 
AQ6 1 SER AA 130 ? LEU AA 134 ? SER Z 130 LEU Z 134 
AQ6 2 VAL AA 146 ? TYR AA 155 ? VAL Z 146 TYR Z 155 
AQ6 3 LEU AA 184 ? VAL AA 193 ? LEU Z 184 VAL Z 193 
AQ6 4 VAL AA 173 ? GLN AA 181 ? VAL Z 173 GLN Z 181 
AQ7 1 THR AA 163 ? TRP AA 164 ? THR Z 163 TRP Z 164 
AQ7 2 THR AA 204 ? HIS AA 209 ? THR Z 204 HIS Z 209 
AQ7 3 THR AA 214 ? LYS AA 219 ? THR Z 214 LYS Z 219 
AQ8 1 MET BA 4   ? THR BA 7   ? MET a 4   THR a 7   
AQ8 2 ALA BA 19  ? SER BA 25  ? ALA a 19  SER a 25  
AQ8 3 ASP BA 75  ? ILE BA 80  ? ASP a 75  ILE a 80  
AQ8 4 PHE BA 67  ? SER BA 72  ? PHE a 67  SER a 72  
AQ9 1 SER BA 10  ? VAL BA 13  ? SER a 10  VAL a 13  
AQ9 2 THR BA 102 ? LEU BA 111 ? THR a 102 LEU a 111 
AQ9 3 VAL BA 90  ? GLN BA 95  ? VAL a 90  GLN a 95  
AQ9 4 LEU BA 38  ? GLN BA 43  ? LEU a 38  GLN a 43  
AQ9 5 LYS BA 50  ? TYR BA 54  ? LYS a 50  TYR a 54  
AQ9 6 ASN BA 58  ? ARG BA 59  ? ASN a 58  ARG a 59  
AR1 1 THR BA 119 ? PHE BA 123 ? THR a 119 PHE a 123 
AR1 2 GLY BA 134 ? PHE BA 144 ? GLY a 134 PHE a 144 
AR1 3 TYR BA 178 ? THR BA 187 ? TYR a 178 THR a 187 
AR1 4 VAL BA 164 ? TRP BA 168 ? VAL a 164 TRP a 168 
AR2 1 SER BA 158 ? GLU BA 159 ? SER a 158 GLU a 159 
AR2 2 ILE BA 149 ? ILE BA 155 ? ILE a 149 ILE a 155 
AR2 3 TYR BA 197 ? HIS BA 203 ? TYR a 197 HIS a 203 
AR2 4 ILE BA 210 ? PHE BA 214 ? ILE a 210 PHE a 214 
AR3 1 LYS CA 3   ? SER CA 7   ? LYS b 3   SER b 7   
AR3 2 LEU CA 18  ? SER CA 25  ? LEU b 18  SER b 25  
AR3 3 THR CA 78  ? MET CA 83  ? THR b 78  MET b 83  
AR3 4 PHE CA 68  ? ASP CA 73  ? PHE b 68  ASP b 73  
AR4 1 THR CA 58  ? TYR CA 59  ? THR b 58  TYR b 59  
AR4 2 LEU CA 45  ? ILE CA 51  ? LEU b 45  ILE b 51  
AR4 3 TYR CA 32  ? GLN CA 39  ? TYR b 32  GLN b 39  
AR4 4 ALA CA 92  ? PRO CA 101 ? ALA b 92  PRO b 101 
AR4 5 TYR CA 112 ? TRP CA 113 ? TYR b 112 TRP b 113 
AR5 1 THR CA 58  ? TYR CA 59  ? THR b 58  TYR b 59  
AR5 2 LEU CA 45  ? ILE CA 51  ? LEU b 45  ILE b 51  
AR5 3 TYR CA 32  ? GLN CA 39  ? TYR b 32  GLN b 39  
AR5 4 ALA CA 92  ? PRO CA 101 ? ALA b 92  PRO b 101 
AR5 5 THR CA 117 ? VAL CA 119 ? THR b 117 VAL b 119 
AR6 1 SER CA 130 ? LEU CA 134 ? SER b 130 LEU b 134 
AR6 2 VAL CA 146 ? TYR CA 155 ? VAL b 146 TYR b 155 
AR6 3 LEU CA 184 ? VAL CA 193 ? LEU b 184 VAL b 193 
AR6 4 VAL CA 173 ? THR CA 175 ? VAL b 173 THR b 175 
AR7 1 SER CA 130 ? LEU CA 134 ? SER b 130 LEU b 134 
AR7 2 VAL CA 146 ? TYR CA 155 ? VAL b 146 TYR b 155 
AR7 3 LEU CA 184 ? VAL CA 193 ? LEU b 184 VAL b 193 
AR7 4 LEU CA 179 ? GLN CA 181 ? LEU b 179 GLN b 181 
AR8 1 THR CA 163 ? TRP CA 164 ? THR b 163 TRP b 164 
AR8 2 THR CA 204 ? HIS CA 209 ? THR b 204 HIS b 209 
AR8 3 THR CA 214 ? LYS CA 219 ? THR b 214 LYS b 219 
AR9 1 MET DA 4   ? THR DA 7   ? MET U 4   THR U 7   
AR9 2 ALA DA 19  ? SER DA 25  ? ALA U 19  SER U 25  
AR9 3 ASP DA 75  ? ILE DA 80  ? ASP U 75  ILE U 80  
AR9 4 PHE DA 67  ? SER DA 72  ? PHE U 67  SER U 72  
AS1 1 SER DA 10  ? VAL DA 13  ? SER U 10  VAL U 13  
AS1 2 THR DA 102 ? LEU DA 111 ? THR U 102 LEU U 111 
AS1 3 VAL DA 90  ? GLN DA 95  ? VAL U 90  GLN U 95  
AS1 4 LEU DA 38  ? GLN DA 43  ? LEU U 38  GLN U 43  
AS1 5 LYS DA 50  ? TYR DA 54  ? LYS U 50  TYR U 54  
AS1 6 ASN DA 58  ? ARG DA 59  ? ASN U 58  ARG U 59  
AS2 1 THR DA 119 ? PHE DA 123 ? THR U 119 PHE U 123 
AS2 2 GLY DA 134 ? PHE DA 144 ? GLY U 134 PHE U 144 
AS2 3 TYR DA 178 ? THR DA 187 ? TYR U 178 THR U 187 
AS2 4 VAL DA 164 ? TRP DA 168 ? VAL U 164 TRP U 168 
AS3 1 SER DA 158 ? GLU DA 159 ? SER U 158 GLU U 159 
AS3 2 ILE DA 149 ? ILE DA 155 ? ILE U 149 ILE U 155 
AS3 3 TYR DA 197 ? HIS DA 203 ? TYR U 197 HIS U 203 
AS3 4 ILE DA 210 ? PHE DA 214 ? ILE U 210 PHE U 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A  29  ? N ALA A 37  O PHE A  367 ? O PHE A 375 
AA1 2 3 O GLN A  370 ? O GLN A 378 N ALA A  93  ? N ALA A 101 
AA1 3 4 N TRP A  92  ? N TRP A 100 O CYS A  316 ? O CYS A 324 
AA2 1 2 N LEU A  34  ? N LEU A 42  O PHE A  363 ? O PHE A 371 
AA2 2 3 N GLU A  355 ? N GLU A 363 O THR C  258 ? O THR C 266 
AA3 1 2 N ALA A  338 ? N ALA A 346 O LYS A  354 ? O LYS A 362 
AA3 2 3 O GLN A  370 ? O GLN A 378 N ALA A  93  ? N ALA A 101 
AA3 3 4 N VAL A  97  ? N VAL A 105 O TYR A  303 ? O TYR A 311 
AA4 1 2 O SER A  286 ? O SER A 294 N HIS A  251 ? N HIS A 259 
AA4 2 3 O GLN A  246 ? O GLN A 254 N GLN A  145 ? N GLN A 153 
AA4 3 4 N ILE A  150 ? N ILE A 158 O THR A  324 ? O THR A 332 
AA4 4 5 O LEU A  321 ? O LEU A 329 N VAL A  67  ? N VAL A 75  
AA4 5 6 N VAL A  64  ? N VAL A 72  O TRP A  440 ? O TRP A 448 
AA5 1 2 O SER A  286 ? O SER A 294 N HIS A  251 ? N HIS A 259 
AA5 2 3 N VAL A  247 ? N VAL A 255 O VAL B  292 ? O VAL B 300 
AA6 1 2 N SER A  110 ? N SER A 118 O VAL A  141 ? O VAL A 149 
AA7 1 2 O THR A  185 ? O THR A 193 N GLY A  158 ? N GLY A 166 
AA7 2 3 N GLU A  159 ? N GLU A 167 O TYR A  223 ? O TYR A 231 
AA7 3 4 O LYS A  222 ? O LYS A 230 N MET A  192 ? N MET A 200 
AA8 1 2 N THR A  258 ? N THR A 266 O GLU B  355 ? O GLU B 363 
AA8 2 3 O GLN B  370 ? O GLN B 378 N ALA B  93  ? N ALA B 101 
AA8 3 4 N VAL B  97  ? N VAL B 105 O TYR B  303 ? O TYR B 311 
AA9 1 2 N THR B  21  ? N THR B 29  O LYS B  373 ? O LYS B 381 
AA9 2 3 O GLN B  370 ? O GLN B 378 N ALA B  93  ? N ALA B 101 
AA9 3 4 N TRP B  92  ? N TRP B 100 O CYS B  316 ? O CYS B 324 
AB1 1 2 N ALA B  338 ? N ALA B 346 O LYS B  354 ? O LYS B 362 
AB1 2 3 O PHE B  363 ? O PHE B 371 N LEU B  34  ? N LEU B 42  
AB2 1 2 N VAL A  292 ? N VAL A 300 O VAL C  247 ? O VAL C 255 
AB2 2 3 N ARG C  250 ? N ARG C 258 O SER C  286 ? O SER C 294 
AB3 1 2 N VAL A  292 ? N VAL A 300 O VAL C  247 ? O VAL C 255 
AB3 2 3 O GLN C  246 ? O GLN C 254 N GLN C  145 ? N GLN C 153 
AB3 3 4 N ILE C  150 ? N ILE C 158 O THR C  324 ? O THR C 332 
AB3 4 5 O LEU C  321 ? O LEU C 329 N VAL C  67  ? N VAL C 75  
AB3 5 6 N VAL C  64  ? N VAL C 72  O TRP C  440 ? O TRP C 448 
AB4 1 2 O SER B  286 ? O SER B 294 N ARG B  250 ? N ARG B 258 
AB4 2 3 O GLN B  246 ? O GLN B 254 N GLN B  145 ? N GLN B 153 
AB4 3 4 N ILE B  150 ? N ILE B 158 O THR B  324 ? O THR B 332 
AB4 4 5 O LEU B  321 ? O LEU B 329 N VAL B  67  ? N VAL B 75  
AB4 5 6 N VAL B  64  ? N VAL B 72  O TRP B  440 ? O TRP B 448 
AB5 1 2 O SER B  286 ? O SER B 294 N ARG B  250 ? N ARG B 258 
AB5 2 3 N VAL B  247 ? N VAL B 255 O VAL E  292 ? O VAL E 300 
AB6 1 2 N SER B  110 ? N SER B 118 O VAL B  141 ? O VAL B 149 
AB7 1 2 O THR B  185 ? O THR B 193 N GLY B  158 ? N GLY B 166 
AB7 2 3 N GLU B  159 ? N GLU B 167 O TYR B  223 ? O TYR B 231 
AB7 3 4 O LYS B  222 ? O LYS B 230 N MET B  192 ? N MET B 200 
AB8 1 2 N THR B  258 ? N THR B 266 O GLU E  355 ? O GLU E 363 
AB8 2 3 O ILE E  368 ? O ILE E 376 N VAL E  95  ? N VAL E 103 
AB8 3 4 N VAL E  97  ? N VAL E 105 O TYR E  303 ? O TYR E 311 
AB9 1 2 N THR E  21  ? N THR E 29  O LYS E  373 ? O LYS E 381 
AB9 2 3 O ILE E  368 ? O ILE E 376 N VAL E  95  ? N VAL E 103 
AB9 3 4 N TRP E  92  ? N TRP E 100 O CYS E  316 ? O CYS E 324 
AC1 1 2 N ALA E  338 ? N ALA E 346 O LYS E  354 ? O LYS E 362 
AC1 2 3 O PHE E  363 ? O PHE E 371 N LEU E  34  ? N LEU E 42  
AC2 1 2 N THR C  21  ? N THR C 29  O LYS C  373 ? O LYS C 381 
AC2 2 3 O GLN C  370 ? O GLN C 378 N ALA C  93  ? N ALA C 101 
AC2 3 4 N VAL C  97  ? N VAL C 105 O TYR C  303 ? O TYR C 311 
AC3 1 2 O SER C  449 ? O SER C 457 N HIS C  28  ? N HIS C 36  
AC3 2 3 N THR C  21  ? N THR C 29  O LYS C  373 ? O LYS C 381 
AC3 3 4 N GLU C  355 ? N GLU C 363 O THR D  258 ? O THR D 266 
AC4 1 2 N ALA C  338 ? N ALA C 346 O LYS C  354 ? O LYS C 362 
AC4 2 3 O PHE C  363 ? O PHE C 371 N LEU C  34  ? N LEU C 42  
AC5 1 2 N SER C  110 ? N SER C 118 O VAL C  141 ? O VAL C 149 
AC6 1 2 O THR C  185 ? O THR C 193 N GLY C  158 ? N GLY C 166 
AC6 2 3 N GLU C  159 ? N GLU C 167 O TYR C  223 ? O TYR C 231 
AC6 3 4 O LYS C  222 ? O LYS C 230 N MET C  192 ? N MET C 200 
AC7 1 2 N VAL C  292 ? N VAL C 300 O VAL D  247 ? O VAL D 255 
AC7 2 3 N ARG D  250 ? N ARG D 258 O SER D  286 ? O SER D 294 
AC8 1 2 N VAL C  292 ? N VAL C 300 O VAL D  247 ? O VAL D 255 
AC8 2 3 O GLN D  246 ? O GLN D 254 N GLN D  145 ? N GLN D 153 
AC8 3 4 N ILE D  150 ? N ILE D 158 O THR D  324 ? O THR D 332 
AC8 4 5 O LEU D  321 ? O LEU D 329 N VAL D  67  ? N VAL D 75  
AC8 5 6 N VAL D  64  ? N VAL D 72  O TRP D  440 ? O TRP D 448 
AC9 1 2 N THR D  21  ? N THR D 29  O LYS D  373 ? O LYS D 381 
AC9 2 3 O GLN D  370 ? O GLN D 378 N ALA D  93  ? N ALA D 101 
AC9 3 4 N TRP D  92  ? N TRP D 100 O CYS D  316 ? O CYS D 324 
AD1 1 2 N LEU D  34  ? N LEU D 42  O PHE D  363 ? O PHE D 371 
AD1 2 3 N GLU D  355 ? N GLU D 363 O THR E  258 ? O THR E 266 
AD2 1 2 N ALA D  338 ? N ALA D 346 O LYS D  354 ? O LYS D 362 
AD2 2 3 O GLN D  370 ? O GLN D 378 N ALA D  93  ? N ALA D 101 
AD2 3 4 N VAL D  97  ? N VAL D 105 O TYR D  303 ? O TYR D 311 
AD3 1 2 N SER D  110 ? N SER D 118 O VAL D  141 ? O VAL D 149 
AD4 1 2 O THR D  185 ? O THR D 193 N GLY D  158 ? N GLY D 166 
AD4 2 3 N GLU D  159 ? N GLU D 167 O TYR D  223 ? O TYR D 231 
AD4 3 4 O LYS D  222 ? O LYS D 230 N MET D  192 ? N MET D 200 
AD5 1 2 N VAL D  292 ? N VAL D 300 O VAL E  247 ? O VAL E 255 
AD5 2 3 N ARG E  250 ? N ARG E 258 O SER E  286 ? O SER E 294 
AD6 1 2 N VAL D  292 ? N VAL D 300 O VAL E  247 ? O VAL E 255 
AD6 2 3 O GLN E  246 ? O GLN E 254 N GLN E  145 ? N GLN E 153 
AD6 3 4 N ILE E  150 ? N ILE E 158 O THR E  324 ? O THR E 332 
AD6 4 5 O LEU E  321 ? O LEU E 329 N VAL E  67  ? N VAL E 75  
AD6 5 6 N VAL E  64  ? N VAL E 72  O TRP E  440 ? O TRP E 448 
AD7 1 2 N SER E  110 ? N SER E 118 O VAL E  141 ? O VAL E 149 
AD8 1 2 O THR E  185 ? O THR E 193 N GLY E  158 ? N GLY E 166 
AD8 2 3 N GLU E  159 ? N GLU E 167 O TYR E  223 ? O TYR E 231 
AD8 3 4 O LYS E  222 ? O LYS E 230 N MET E  192 ? N MET E 200 
AD9 1 2 N THR F  21  ? N THR F 29  O LYS F  373 ? O LYS F 381 
AD9 2 3 O GLN F  370 ? O GLN F 378 N ALA F  93  ? N ALA F 101 
AD9 3 4 N TRP F  92  ? N TRP F 100 O CYS F  316 ? O CYS F 324 
AE1 1 2 N LEU F  34  ? N LEU F 42  O PHE F  363 ? O PHE F 371 
AE1 2 3 N GLU F  355 ? N GLU F 363 O THR J  258 ? O THR J 266 
AE2 1 2 N ALA F  338 ? N ALA F 346 O LYS F  354 ? O LYS F 362 
AE2 2 3 O GLN F  370 ? O GLN F 378 N ALA F  93  ? N ALA F 101 
AE2 3 4 N VAL F  97  ? N VAL F 105 O TYR F  303 ? O TYR F 311 
AE3 1 2 O SER F  286 ? O SER F 294 N ARG F  250 ? N ARG F 258 
AE3 2 3 O GLN F  246 ? O GLN F 254 N GLN F  145 ? N GLN F 153 
AE3 3 4 N ILE F  150 ? N ILE F 158 O THR F  324 ? O THR F 332 
AE3 4 5 O LEU F  321 ? O LEU F 329 N VAL F  67  ? N VAL F 75  
AE3 5 6 N VAL F  64  ? N VAL F 72  O TRP F  440 ? O TRP F 448 
AE4 1 2 O SER F  286 ? O SER F 294 N ARG F  250 ? N ARG F 258 
AE4 2 3 N VAL F  247 ? N VAL F 255 O VAL G  292 ? O VAL G 300 
AE5 1 2 N SER F  110 ? N SER F 118 O VAL F  141 ? O VAL F 149 
AE6 1 2 O THR F  185 ? O THR F 193 N GLY F  158 ? N GLY F 166 
AE6 2 3 N GLU F  159 ? N GLU F 167 O TYR F  223 ? O TYR F 231 
AE6 3 4 O LYS F  222 ? O LYS F 230 N MET F  192 ? N MET F 200 
AE7 1 2 N THR F  258 ? N THR F 266 O GLU G  355 ? O GLU G 363 
AE7 2 3 O GLN G  370 ? O GLN G 378 N ALA G  93  ? N ALA G 101 
AE7 3 4 N VAL G  97  ? N VAL G 105 O TYR G  303 ? O TYR G 311 
AE8 1 2 N TYR G  27  ? N TYR G 35  O PHE G  369 ? O PHE G 377 
AE8 2 3 O GLN G  370 ? O GLN G 378 N ALA G  93  ? N ALA G 101 
AE8 3 4 N TRP G  92  ? N TRP G 100 O CYS G  316 ? O CYS G 324 
AE9 1 2 N ALA G  338 ? N ALA G 346 O LYS G  354 ? O LYS G 362 
AE9 2 3 O PHE G  363 ? O PHE G 371 N LEU G  34  ? N LEU G 42  
AF1 1 2 N VAL F  292 ? N VAL F 300 O VAL J  247 ? O VAL J 255 
AF1 2 3 N ARG J  250 ? N ARG J 258 O SER J  286 ? O SER J 294 
AF2 1 2 N VAL F  292 ? N VAL F 300 O VAL J  247 ? O VAL J 255 
AF2 2 3 O GLN J  246 ? O GLN J 254 N GLN J  145 ? N GLN J 153 
AF2 3 4 N ILE J  150 ? N ILE J 158 O THR J  324 ? O THR J 332 
AF2 4 5 O LEU J  321 ? O LEU J 329 N VAL J  67  ? N VAL J 75  
AF2 5 6 N VAL J  64  ? N VAL J 72  O TRP J  440 ? O TRP J 448 
AF3 1 2 O SER G  286 ? O SER G 294 N ARG G  250 ? N ARG G 258 
AF3 2 3 O GLN G  246 ? O GLN G 254 N GLN G  145 ? N GLN G 153 
AF3 3 4 N ILE G  150 ? N ILE G 158 O THR G  324 ? O THR G 332 
AF3 4 5 O LEU G  321 ? O LEU G 329 N VAL G  67  ? N VAL G 75  
AF3 5 6 N VAL G  64  ? N VAL G 72  O TRP G  440 ? O TRP G 448 
AF4 1 2 O SER G  286 ? O SER G 294 N ARG G  250 ? N ARG G 258 
AF4 2 3 N VAL G  247 ? N VAL G 255 O VAL H  292 ? O VAL H 300 
AF5 1 2 N SER G  110 ? N SER G 118 O VAL G  141 ? O VAL G 149 
AF6 1 2 O THR G  185 ? O THR G 193 N GLY G  158 ? N GLY G 166 
AF6 2 3 N GLU G  159 ? N GLU G 167 O TYR G  223 ? O TYR G 231 
AF6 3 4 O LYS G  222 ? O LYS G 230 N MET G  192 ? N MET G 200 
AF7 1 2 N THR G  258 ? N THR G 266 O GLU H  355 ? O GLU H 363 
AF7 2 3 O GLN H  370 ? O GLN H 378 N ALA H  93  ? N ALA H 101 
AF7 3 4 N VAL H  97  ? N VAL H 105 O TYR H  303 ? O TYR H 311 
AF8 1 2 N THR H  21  ? N THR H 29  O LYS H  373 ? O LYS H 381 
AF8 2 3 O GLN H  370 ? O GLN H 378 N ALA H  93  ? N ALA H 101 
AF8 3 4 N TRP H  92  ? N TRP H 100 O CYS H  316 ? O CYS H 324 
AF9 1 2 N ALA H  338 ? N ALA H 346 O LYS H  354 ? O LYS H 362 
AF9 2 3 O PHE H  363 ? O PHE H 371 N LEU H  34  ? N LEU H 42  
AG1 1 2 O SER H  286 ? O SER H 294 N ARG H  250 ? N ARG H 258 
AG1 2 3 O GLN H  246 ? O GLN H 254 N GLN H  145 ? N GLN H 153 
AG1 3 4 N ILE H  150 ? N ILE H 158 O THR H  324 ? O THR H 332 
AG1 4 5 O LEU H  321 ? O LEU H 329 N VAL H  67  ? N VAL H 75  
AG1 5 6 N VAL H  64  ? N VAL H 72  O TRP H  440 ? O TRP H 448 
AG2 1 2 O SER H  286 ? O SER H 294 N ARG H  250 ? N ARG H 258 
AG2 2 3 N VAL H  247 ? N VAL H 255 O VAL I  292 ? O VAL I 300 
AG3 1 2 N SER H  110 ? N SER H 118 O VAL H  141 ? O VAL H 149 
AG4 1 2 O THR H  185 ? O THR H 193 N GLY H  158 ? N GLY H 166 
AG4 2 3 N GLU H  159 ? N GLU H 167 O TYR H  223 ? O TYR H 231 
AG4 3 4 O LYS H  222 ? O LYS H 230 N MET H  192 ? N MET H 200 
AG5 1 2 N THR H  258 ? N THR H 266 O GLU I  355 ? O GLU I 363 
AG5 2 3 O GLN I  370 ? O GLN I 378 N ALA I  93  ? N ALA I 101 
AG5 3 4 N VAL I  97  ? N VAL I 105 O TYR I  303 ? O TYR I 311 
AG6 1 2 N ALA I  29  ? N ALA I 37  O PHE I  367 ? O PHE I 375 
AG6 2 3 O GLN I  370 ? O GLN I 378 N ALA I  93  ? N ALA I 101 
AG6 3 4 N TRP I  92  ? N TRP I 100 O CYS I  316 ? O CYS I 324 
AG7 1 2 N ALA I  338 ? N ALA I 346 O LYS I  354 ? O LYS I 362 
AG7 2 3 O HIS I  359 ? O HIS I 367 N GLY I  38  ? N GLY I 46  
AG8 1 2 O SER I  286 ? O SER I 294 N ARG I  250 ? N ARG I 258 
AG8 2 3 O GLN I  246 ? O GLN I 254 N GLN I  145 ? N GLN I 153 
AG8 3 4 N ILE I  150 ? N ILE I 158 O THR I  324 ? O THR I 332 
AG8 4 5 O LEU I  321 ? O LEU I 329 N VAL I  67  ? N VAL I 75  
AG8 5 6 N VAL I  64  ? N VAL I 72  O TRP I  440 ? O TRP I 448 
AG9 1 2 O SER I  286 ? O SER I 294 N ARG I  250 ? N ARG I 258 
AG9 2 3 N VAL I  247 ? N VAL I 255 O VAL J  292 ? O VAL J 300 
AH1 1 2 N SER I  110 ? N SER I 118 O VAL I  141 ? O VAL I 149 
AH2 1 2 O THR I  185 ? O THR I 193 N GLY I  158 ? N GLY I 166 
AH2 2 3 N GLU I  159 ? N GLU I 167 O TYR I  223 ? O TYR I 231 
AH2 3 4 O LYS I  222 ? O LYS I 230 N MET I  192 ? N MET I 200 
AH3 1 2 N THR I  258 ? N THR I 266 O GLU J  355 ? O GLU J 363 
AH3 2 3 O GLN J  370 ? O GLN J 378 N ALA J  93  ? N ALA J 101 
AH3 3 4 N VAL J  97  ? N VAL J 105 O TYR J  303 ? O TYR J 311 
AH4 1 2 N ALA J  29  ? N ALA J 37  O PHE J  367 ? O PHE J 375 
AH4 2 3 O GLN J  370 ? O GLN J 378 N ALA J  93  ? N ALA J 101 
AH4 3 4 N TRP J  92  ? N TRP J 100 O CYS J  316 ? O CYS J 324 
AH5 1 2 N ALA J  338 ? N ALA J 346 O LYS J  354 ? O LYS J 362 
AH5 2 3 O PHE J  363 ? O PHE J 371 N LEU J  34  ? N LEU J 42  
AH6 1 2 N SER J  110 ? N SER J 118 O VAL J  141 ? O VAL J 149 
AH7 1 2 O THR J  185 ? O THR J 193 N GLY J  158 ? N GLY J 166 
AH7 2 3 N GLU J  159 ? N GLU J 167 O TYR J  223 ? O TYR J 231 
AH7 3 4 O LYS J  222 ? O LYS J 230 N MET J  192 ? N MET J 200 
AH8 1 2 N THR K  7   ? N THR K 7   O SER K  22  ? O SER K 22  
AH8 2 3 N CYS K  23  ? N CYS K 23  O PHE K  76  ? O PHE K 76  
AH8 3 4 O LYS K  79  ? O LYS K 79  N SER K  68  ? N SER K 68  
AH9 1 2 N LEU K  11  ? N LEU K 11  O LYS K  108 ? O LYS K 108 
AH9 2 3 O THR K  102 ? O THR K 102 N GLN K  95  ? N GLN K 95  
AH9 3 4 O VAL K  90  ? O VAL K 90  N GLN K  43  ? N GLN K 43  
AH9 4 5 N LEU K  42  ? N LEU K 42  O LYS K  50  ? O LYS K 50  
AH9 5 6 N TYR K  54  ? N TYR K 54  O ASN K  58  ? O ASN K 58  
AI1 1 2 N THR K  119 ? N THR K 119 O ASN K  142 ? O ASN K 142 
AI1 2 3 N LEU K  141 ? N LEU K 141 O MET K  180 ? O MET K 180 
AI1 3 4 O SER K  181 ? O SER K 181 N SER K  167 ? N SER K 167 
AI2 1 2 O SER K  158 ? O SER K 158 N ILE K  155 ? N ILE K 155 
AI2 2 3 N LYS K  154 ? N LYS K 154 O THR K  198 ? O THR K 198 
AI2 3 4 N TYR K  197 ? N TYR K 197 O PHE K  214 ? O PHE K 214 
AI3 1 2 N SER L  7   ? N SER L 7   O SER L  21  ? O SER L 21  
AI3 2 3 N LEU L  18  ? N LEU L 18  O MET L  83  ? O MET L 83  
AI3 3 4 O TYR L  80  ? O TYR L 80  N SER L  71  ? N SER L 71  
AI4 1 2 O TYR L  59  ? O TYR L 59  N SER L  50  ? N SER L 50  
AI4 2 3 O GLU L  46  ? O GLU L 46  N ARG L  38  ? N ARG L 38  
AI4 3 4 N SER L  35  ? N SER L 35  O THR L  97  ? O THR L 97  
AI4 4 5 N ARG L  98  ? N ARG L 98  O TYR L  112 ? O TYR L 112 
AI5 1 2 O TYR L  59  ? O TYR L 59  N SER L  50  ? N SER L 50  
AI5 2 3 O GLU L  46  ? O GLU L 46  N ARG L  38  ? N ARG L 38  
AI5 3 4 N SER L  35  ? N SER L 35  O THR L  97  ? O THR L 97  
AI5 4 5 N ALA L  92  ? N ALA L 92  O VAL L  119 ? O VAL L 119 
AI6 1 2 N SER L  130 ? N SER L 130 O LYS L  153 ? O LYS L 153 
AI6 2 3 N VAL L  152 ? N VAL L 152 O LEU L  187 ? O LEU L 187 
AI6 3 4 O SER L  190 ? O SER L 190 N HIS L  174 ? N HIS L 174 
AI7 1 2 N SER L  130 ? N SER L 130 O LYS L  153 ? O LYS L 153 
AI7 2 3 N VAL L  152 ? N VAL L 152 O LEU L  187 ? O LEU L 187 
AI7 3 4 O LEU L  184 ? O LEU L 184 N GLN L  181 ? N GLN L 181 
AI8 1 2 N THR L  163 ? N THR L 163 O ASN L  206 ? O ASN L 206 
AI8 2 3 N VAL L  207 ? N VAL L 207 O VAL L  216 ? O VAL L 216 
AI9 1 2 N THR M  7   ? N THR O 7   O SER M  22  ? O SER O 22  
AI9 2 3 N ALA M  19  ? N ALA O 19  O ILE M  80  ? O ILE O 80  
AI9 3 4 O LYS M  79  ? O LYS O 79  N SER M  68  ? N SER O 68  
AJ1 1 2 N VAL M  13  ? N VAL O 13  O GLU M  110 ? O GLU O 110 
AJ1 2 3 O THR M  107 ? O THR O 107 N TYR M  91  ? N TYR O 91  
AJ1 3 4 O VAL M  90  ? O VAL O 90  N GLN M  43  ? N GLN O 43  
AJ1 4 5 N LEU M  42  ? N LEU O 42  O LYS M  50  ? O LYS O 50  
AJ1 5 6 N TYR M  54  ? N TYR O 54  O ASN M  58  ? O ASN O 58  
AJ2 1 2 N THR M  119 ? N THR O 119 O ASN M  142 ? O ASN O 142 
AJ2 2 3 N ALA M  135 ? N ALA O 135 O LEU M  186 ? O LEU O 186 
AJ2 3 4 O THR M  183 ? O THR O 183 N LEU M  165 ? N LEU O 165 
AJ3 1 2 O SER M  158 ? O SER O 158 N ILE M  155 ? N ILE O 155 
AJ3 2 3 N LYS M  152 ? N LYS O 152 O GLU M  200 ? O GLU O 200 
AJ3 3 4 N ALA M  201 ? N ALA O 201 O ILE M  210 ? O ILE O 210 
AJ4 1 2 N SER N  7   ? N SER P 7   O SER N  21  ? O SER P 21  
AJ4 2 3 N LEU N  18  ? N LEU P 18  O MET N  83  ? O MET P 83  
AJ4 3 4 O TYR N  80  ? O TYR P 80  N SER N  71  ? N SER P 71  
AJ5 1 2 O TYR N  59  ? O TYR P 59  N SER N  50  ? N SER P 50  
AJ5 2 3 O GLU N  46  ? O GLU P 46  N ARG N  38  ? N ARG P 38  
AJ5 3 4 N THR N  33  ? N THR P 33  O ALA N  99  ? O ALA P 99  
AJ5 4 5 N ARG N  98  ? N ARG P 98  O TYR N  112 ? O TYR P 112 
AJ6 1 2 O TYR N  59  ? O TYR P 59  N SER N  50  ? N SER P 50  
AJ6 2 3 O GLU N  46  ? O GLU P 46  N ARG N  38  ? N ARG P 38  
AJ6 3 4 N THR N  33  ? N THR P 33  O ALA N  99  ? O ALA P 99  
AJ6 4 5 N ALA N  92  ? N ALA P 92  O VAL N  119 ? O VAL P 119 
AJ7 1 2 N SER N  130 ? N SER P 130 O LYS N  153 ? O LYS P 153 
AJ7 2 3 N LEU N  148 ? N LEU P 148 O VAL N  191 ? O VAL P 191 
AJ7 3 4 O SER N  190 ? O SER P 190 N HIS N  174 ? N HIS P 174 
AJ8 1 2 N SER N  130 ? N SER P 130 O LYS N  153 ? O LYS P 153 
AJ8 2 3 N LEU N  148 ? N LEU P 148 O VAL N  191 ? O VAL P 191 
AJ8 3 4 O LEU N  184 ? O LEU P 184 N GLN N  181 ? N GLN P 181 
AJ9 1 2 N THR N  163 ? N THR P 163 O ASN N  206 ? O ASN P 206 
AJ9 2 3 N CYS N  205 ? N CYS P 205 O LYS N  218 ? O LYS P 218 
AK1 1 2 N THR O  7   ? N THR Q 7   O SER O  22  ? O SER Q 22  
AK1 2 3 N CYS O  23  ? N CYS Q 23  O PHE O  76  ? O PHE Q 76  
AK1 3 4 O LYS O  79  ? O LYS Q 79  N SER O  68  ? N SER Q 68  
AK2 1 2 N LEU O  11  ? N LEU Q 11  O LYS O  108 ? O LYS Q 108 
AK2 2 3 O THR O  107 ? O THR Q 107 N TYR O  91  ? N TYR Q 91  
AK2 3 4 O VAL O  90  ? O VAL Q 90  N GLN O  43  ? N GLN Q 43  
AK2 4 5 N TRP O  40  ? N TRP Q 40  O ILE O  53  ? O ILE Q 53  
AK2 5 6 N TYR O  54  ? N TYR Q 54  O ASN O  58  ? O ASN Q 58  
AK3 1 2 N SER O  121 ? N SER Q 121 O PHE O  140 ? O PHE Q 140 
AK3 2 3 N VAL O  137 ? N VAL Q 137 O LEU O  184 ? O LEU Q 184 
AK3 3 4 O SER O  181 ? O SER Q 181 N SER O  167 ? N SER Q 167 
AK4 1 2 O SER O  158 ? O SER Q 158 N ILE O  155 ? N ILE Q 155 
AK4 2 3 N ASN O  150 ? N ASN Q 150 O THR O  202 ? O THR Q 202 
AK4 3 4 N ALA O  201 ? N ALA Q 201 O ILE O  210 ? O ILE Q 210 
AK5 1 2 N VAL P  5   ? N VAL R 5   O ALA P  23  ? O ALA R 23  
AK5 2 3 N LEU P  18  ? N LEU R 18  O MET P  83  ? O MET R 83  
AK5 3 4 O TYR P  80  ? O TYR R 80  N SER P  71  ? N SER R 71  
AK6 1 2 N VAL P  12  ? N VAL R 12  O THR P  120 ? O THR R 120 
AK6 2 3 O VAL P  119 ? O VAL R 119 N ALA P  92  ? N ALA R 92  
AK6 3 4 O ALA P  99  ? O ALA R 99  N THR P  33  ? N THR R 33  
AK6 4 5 N ARG P  38  ? N ARG R 38  O GLU P  46  ? O GLU R 46  
AK6 5 6 N SER P  50  ? N SER R 50  O TYR P  59  ? O TYR R 59  
AK7 1 2 N SER P  130 ? N SER R 130 O LYS P  153 ? O LYS R 153 
AK7 2 3 N TYR P  155 ? N TYR R 155 O TYR P  185 ? O TYR R 185 
AK7 3 4 O SER P  190 ? O SER R 190 N HIS P  174 ? N HIS R 174 
AK8 1 2 N SER P  130 ? N SER R 130 O LYS P  153 ? O LYS R 153 
AK8 2 3 N TYR P  155 ? N TYR R 155 O TYR P  185 ? O TYR R 185 
AK8 3 4 O LEU P  184 ? O LEU R 184 N GLN P  181 ? N GLN R 181 
AK9 1 2 N THR P  163 ? N THR R 163 O ASN P  206 ? O ASN R 206 
AK9 2 3 N HIS P  209 ? N HIS R 209 O THR P  214 ? O THR R 214 
AL1 1 2 N THR Q  7   ? N THR S 7   O SER Q  22  ? O SER S 22  
AL1 2 3 N CYS Q  23  ? N CYS S 23  O PHE Q  76  ? O PHE S 76  
AL1 3 4 O LYS Q  79  ? O LYS S 79  N SER Q  68  ? N SER S 68  
AL2 1 2 N LEU Q  11  ? N LEU S 11  O LYS Q  108 ? O LYS S 108 
AL2 2 3 O THR Q  102 ? O THR S 102 N GLN Q  95  ? N GLN S 95  
AL2 3 4 O PHE Q  92  ? O PHE S 92  N TYR Q  41  ? N TYR S 41  
AL2 4 5 N TRP Q  40  ? N TRP S 40  O ILE Q  53  ? O ILE S 53  
AL2 5 6 N TYR Q  54  ? N TYR S 54  O ASN Q  58  ? O ASN S 58  
AL3 1 2 N SER Q  121 ? N SER S 121 O PHE Q  140 ? O PHE S 140 
AL3 2 3 N ALA Q  135 ? N ALA S 135 O LEU Q  186 ? O LEU S 186 
AL3 3 4 O THR Q  183 ? O THR S 183 N LEU Q  165 ? N LEU S 165 
AL4 1 2 O SER Q  158 ? O SER S 158 N ILE Q  155 ? N ILE S 155 
AL4 2 3 N LYS Q  152 ? N LYS S 152 O GLU Q  200 ? O GLU S 200 
AL4 3 4 N ALA Q  201 ? N ALA S 201 O ILE Q  210 ? O ILE S 210 
AL5 1 2 N VAL R  5   ? N VAL T 5   O ALA R  23  ? O ALA T 23  
AL5 2 3 N LEU R  18  ? N LEU T 18  O MET R  83  ? O MET T 83  
AL5 3 4 O TYR R  80  ? O TYR T 80  N SER R  71  ? N SER T 71  
AL6 1 2 O TYR R  59  ? O TYR T 59  N SER R  50  ? N SER T 50  
AL6 2 3 O GLU R  46  ? O GLU T 46  N ARG R  38  ? N ARG T 38  
AL6 3 4 N THR R  33  ? N THR T 33  O ALA R  99  ? O ALA T 99  
AL6 4 5 N ALA R  92  ? N ALA T 92  O VAL R  119 ? O VAL T 119 
AL7 1 2 N SER R  130 ? N SER T 130 O LYS R  153 ? O LYS T 153 
AL7 2 3 N VAL R  152 ? N VAL T 152 O LEU R  187 ? O LEU T 187 
AL7 3 4 O SER R  190 ? O SER T 190 N HIS R  174 ? N HIS T 174 
AL8 1 2 N SER R  130 ? N SER T 130 O LYS R  153 ? O LYS T 153 
AL8 2 3 N VAL R  152 ? N VAL T 152 O LEU R  187 ? O LEU T 187 
AL8 3 4 O LEU R  184 ? O LEU T 184 N GLN R  181 ? N GLN T 181 
AL9 1 2 N THR R  163 ? N THR T 163 O ASN R  206 ? O ASN T 206 
AL9 2 3 N HIS R  209 ? N HIS T 209 O THR R  214 ? O THR T 214 
AM1 1 2 N THR S  5   ? N THR M 5   O ARG S  24  ? O ARG M 24  
AM1 2 3 N CYS S  23  ? N CYS M 23  O PHE S  76  ? O PHE M 76  
AM1 3 4 O LYS S  79  ? O LYS M 79  N SER S  68  ? N SER M 68  
AM2 1 2 N VAL S  13  ? N VAL M 13  O GLU S  110 ? O GLU M 110 
AM2 2 3 O THR S  107 ? O THR M 107 N TYR S  91  ? N TYR M 91  
AM2 3 4 O VAL S  90  ? O VAL M 90  N GLN S  43  ? N GLN M 43  
AM2 4 5 N TRP S  40  ? N TRP M 40  O ILE S  53  ? O ILE M 53  
AM2 5 6 N TYR S  54  ? N TYR M 54  O ASN S  58  ? O ASN M 58  
AM3 1 2 N THR S  119 ? N THR M 119 O ASN S  142 ? O ASN M 142 
AM3 2 3 N ALA S  135 ? N ALA M 135 O LEU S  186 ? O LEU M 186 
AM3 3 4 O SER S  181 ? O SER M 181 N SER S  167 ? N SER M 167 
AM4 1 2 O SER S  158 ? O SER M 158 N ILE S  155 ? N ILE M 155 
AM4 2 3 N LYS S  152 ? N LYS M 152 O GLU S  200 ? O GLU M 200 
AM4 3 4 N ALA S  201 ? N ALA M 201 O ILE S  210 ? O ILE M 210 
AM5 1 2 N VAL T  5   ? N VAL N 5   O ALA T  23  ? O ALA N 23  
AM5 2 3 N LEU T  18  ? N LEU N 18  O MET T  83  ? O MET N 83  
AM5 3 4 O TYR T  80  ? O TYR N 80  N SER T  71  ? N SER N 71  
AM6 1 2 O TYR T  59  ? O TYR N 59  N SER T  50  ? N SER N 50  
AM6 2 3 O GLU T  46  ? O GLU N 46  N ARG T  38  ? N ARG N 38  
AM6 3 4 N THR T  33  ? N THR N 33  O ALA T  99  ? O ALA N 99  
AM6 4 5 N ARG T  98  ? N ARG N 98  O TYR T  112 ? O TYR N 112 
AM7 1 2 O TYR T  59  ? O TYR N 59  N SER T  50  ? N SER N 50  
AM7 2 3 O GLU T  46  ? O GLU N 46  N ARG T  38  ? N ARG N 38  
AM7 3 4 N THR T  33  ? N THR N 33  O ALA T  99  ? O ALA N 99  
AM7 4 5 N ALA T  92  ? N ALA N 92  O VAL T  119 ? O VAL N 119 
AM8 1 2 N SER T  130 ? N SER N 130 O LYS T  153 ? O LYS N 153 
AM8 2 3 N VAL T  152 ? N VAL N 152 O LEU T  187 ? O LEU N 187 
AM8 3 4 O SER T  190 ? O SER N 190 N HIS T  174 ? N HIS N 174 
AM9 1 2 N SER T  130 ? N SER N 130 O LYS T  153 ? O LYS N 153 
AM9 2 3 N VAL T  152 ? N VAL N 152 O LEU T  187 ? O LEU N 187 
AM9 3 4 O LEU T  184 ? O LEU N 184 N GLN T  181 ? N GLN N 181 
AN1 1 2 N THR T  163 ? N THR N 163 O ASN T  206 ? O ASN N 206 
AN1 2 3 N VAL T  207 ? N VAL N 207 O VAL T  216 ? O VAL N 216 
AN2 1 2 N THR U  7   ? N THR c 7   O SER U  22  ? O SER c 22  
AN2 2 3 N CYS U  23  ? N CYS c 23  O PHE U  76  ? O PHE c 76  
AN2 3 4 O LYS U  79  ? O LYS c 79  N SER U  68  ? N SER c 68  
AN3 1 2 N LEU U  11  ? N LEU c 11  O LYS U  108 ? O LYS c 108 
AN3 2 3 O THR U  107 ? O THR c 107 N TYR U  91  ? N TYR c 91  
AN3 3 4 O VAL U  90  ? O VAL c 90  N GLN U  43  ? N GLN c 43  
AN3 4 5 N LEU U  42  ? N LEU c 42  O LYS U  50  ? O LYS c 50  
AN3 5 6 N TYR U  54  ? N TYR c 54  O ASN U  58  ? O ASN c 58  
AN4 1 2 N THR U  119 ? N THR c 119 O ASN U  142 ? O ASN c 142 
AN4 2 3 N ALA U  135 ? N ALA c 135 O LEU U  186 ? O LEU c 186 
AN4 3 4 O THR U  183 ? O THR c 183 N LEU U  165 ? N LEU c 165 
AN5 1 2 O SER U  158 ? O SER c 158 N ILE U  155 ? N ILE c 155 
AN5 2 3 N LYS U  154 ? N LYS c 154 O THR U  198 ? O THR c 198 
AN5 3 4 N TYR U  197 ? N TYR c 197 O PHE U  214 ? O PHE c 214 
AN6 1 2 N VAL V  5   ? N VAL d 5   O ALA V  23  ? O ALA d 23  
AN6 2 3 N LEU V  18  ? N LEU d 18  O MET V  83  ? O MET d 83  
AN6 3 4 O TYR V  80  ? O TYR d 80  N SER V  71  ? N SER d 71  
AN7 1 2 O TYR V  59  ? O TYR d 59  N SER V  50  ? N SER d 50  
AN7 2 3 O GLU V  46  ? O GLU d 46  N ARG V  38  ? N ARG d 38  
AN7 3 4 N THR V  33  ? N THR d 33  O ALA V  99  ? O ALA d 99  
AN7 4 5 N ARG V  98  ? N ARG d 98  O TYR V  112 ? O TYR d 112 
AN8 1 2 O TYR V  59  ? O TYR d 59  N SER V  50  ? N SER d 50  
AN8 2 3 O GLU V  46  ? O GLU d 46  N ARG V  38  ? N ARG d 38  
AN8 3 4 N THR V  33  ? N THR d 33  O ALA V  99  ? O ALA d 99  
AN8 4 5 N ALA V  92  ? N ALA d 92  O VAL V  119 ? O VAL d 119 
AN9 1 2 N SER V  130 ? N SER d 130 O LYS V  153 ? O LYS d 153 
AN9 2 3 N TYR V  155 ? N TYR d 155 O TYR V  185 ? O TYR d 185 
AN9 3 4 O SER V  190 ? O SER d 190 N HIS V  174 ? N HIS d 174 
AO1 1 2 N SER V  130 ? N SER d 130 O LYS V  153 ? O LYS d 153 
AO1 2 3 N TYR V  155 ? N TYR d 155 O TYR V  185 ? O TYR d 185 
AO1 3 4 O LEU V  184 ? O LEU d 184 N GLN V  181 ? N GLN d 181 
AO2 1 2 N THR V  163 ? N THR d 163 O ASN V  206 ? O ASN d 206 
AO2 2 3 N VAL V  207 ? N VAL d 207 O VAL V  216 ? O VAL d 216 
AO3 1 2 N VAL W  5   ? N VAL V 5   O ALA W  23  ? O ALA V 23  
AO3 2 3 N LEU W  18  ? N LEU V 18  O MET W  83  ? O MET V 83  
AO3 3 4 O TYR W  80  ? O TYR V 80  N SER W  71  ? N SER V 71  
AO4 1 2 O TYR W  59  ? O TYR V 59  N SER W  50  ? N SER V 50  
AO4 2 3 O GLU W  46  ? O GLU V 46  N ARG W  38  ? N ARG V 38  
AO4 3 4 N ILE W  37  ? N ILE V 37  O TYR W  95  ? O TYR V 95  
AO4 4 5 N ALA W  92  ? N ALA V 92  O VAL W  119 ? O VAL V 119 
AO5 1 2 N LEU W  134 ? N LEU V 134 O GLY W  149 ? O GLY V 149 
AO5 2 3 N VAL W  152 ? N VAL V 152 O LEU W  187 ? O LEU V 187 
AO5 3 4 O SER W  190 ? O SER V 190 N HIS W  174 ? N HIS V 174 
AO6 1 2 N LEU W  134 ? N LEU V 134 O GLY W  149 ? O GLY V 149 
AO6 2 3 N VAL W  152 ? N VAL V 152 O LEU W  187 ? O LEU V 187 
AO6 3 4 O LEU W  184 ? O LEU V 184 N GLN W  181 ? N GLN V 181 
AO7 1 2 N THR W  163 ? N THR V 163 O ASN W  206 ? O ASN V 206 
AO7 2 3 N VAL W  207 ? N VAL V 207 O VAL W  216 ? O VAL V 216 
AO8 1 2 N THR X  7   ? N THR W 7   O SER X  22  ? O SER W 22  
AO8 2 3 N CYS X  23  ? N CYS W 23  O PHE X  76  ? O PHE W 76  
AO8 3 4 O LYS X  79  ? O LYS W 79  N SER X  68  ? N SER W 68  
AO9 1 2 N LEU X  11  ? N LEU W 11  O LYS X  108 ? O LYS W 108 
AO9 2 3 O THR X  107 ? O THR W 107 N TYR X  91  ? N TYR W 91  
AO9 3 4 O SER X  94  ? O SER W 94  N HIS X  39  ? N HIS W 39  
AO9 4 5 N TRP X  40  ? N TRP W 40  O ILE X  53  ? O ILE W 53  
AO9 5 6 N TYR X  54  ? N TYR W 54  O ASN X  58  ? O ASN W 58  
AP1 1 2 N SER X  121 ? N SER W 121 O PHE X  140 ? O PHE W 140 
AP1 2 3 N ALA X  135 ? N ALA W 135 O LEU X  186 ? O LEU W 186 
AP1 3 4 O THR X  183 ? O THR W 183 N LEU X  165 ? N LEU W 165 
AP2 1 2 O SER X  158 ? O SER W 158 N ILE X  155 ? N ILE W 155 
AP2 2 3 N ASN X  150 ? N ASN W 150 O THR X  202 ? O THR W 202 
AP2 3 4 N ALA X  201 ? N ALA W 201 O ILE X  210 ? O ILE W 210 
AP3 1 2 N SER Y  7   ? N SER X 7   O SER Y  21  ? O SER X 21  
AP3 2 3 N LEU Y  18  ? N LEU X 18  O MET Y  83  ? O MET X 83  
AP3 3 4 O TYR Y  80  ? O TYR X 80  N SER Y  71  ? N SER X 71  
AP4 1 2 N VAL Y  12  ? N VAL X 12  O THR Y  120 ? O THR X 120 
AP4 2 3 O VAL Y  119 ? O VAL X 119 N ALA Y  92  ? N ALA X 92  
AP4 3 4 O TYR Y  95  ? O TYR X 95  N ILE Y  37  ? N ILE X 37  
AP4 4 5 N ARG Y  38  ? N ARG X 38  O GLU Y  46  ? O GLU X 46  
AP4 5 6 N SER Y  50  ? N SER X 50  O TYR Y  59  ? O TYR X 59  
AP5 1 2 N SER Y  130 ? N SER X 130 O LYS Y  153 ? O LYS X 153 
AP5 2 3 N VAL Y  152 ? N VAL X 152 O LEU Y  187 ? O LEU X 187 
AP5 3 4 O SER Y  190 ? O SER X 190 N HIS Y  174 ? N HIS X 174 
AP6 1 2 N SER Y  130 ? N SER X 130 O LYS Y  153 ? O LYS X 153 
AP6 2 3 N VAL Y  152 ? N VAL X 152 O LEU Y  187 ? O LEU X 187 
AP6 3 4 O LEU Y  184 ? O LEU X 184 N GLN Y  181 ? N GLN X 181 
AP7 1 2 N THR Y  163 ? N THR X 163 O ASN Y  206 ? O ASN X 206 
AP7 2 3 N VAL Y  207 ? N VAL X 207 O VAL Y  216 ? O VAL X 216 
AP8 1 2 N THR Z  7   ? N THR Y 7   O SER Z  22  ? O SER Y 22  
AP8 2 3 N CYS Z  23  ? N CYS Y 23  O PHE Z  76  ? O PHE Y 76  
AP8 3 4 O LYS Z  79  ? O LYS Y 79  N SER Z  68  ? N SER Y 68  
AP9 1 2 N LEU Z  11  ? N LEU Y 11  O LYS Z  108 ? O LYS Y 108 
AQ1 1 2 O ASN Z  58  ? O ASN Y 58  N TYR Z  54  ? N TYR Y 54  
AQ1 2 3 O LYS Z  50  ? O LYS Y 50  N LEU Z  42  ? N LEU Y 42  
AQ1 3 4 N GLN Z  43  ? N GLN Y 43  O VAL Z  90  ? O VAL Y 90  
AQ1 4 5 N GLN Z  95  ? N GLN Y 95  O THR Z  102 ? O THR Y 102 
AQ2 1 2 N THR Z  119 ? N THR Y 119 O ASN Z  142 ? O ASN Y 142 
AQ2 2 3 N ALA Z  135 ? N ALA Y 135 O LEU Z  186 ? O LEU Y 186 
AQ2 3 4 O SER Z  181 ? O SER Y 181 N SER Z  167 ? N SER Y 167 
AQ3 1 2 O SER Z  158 ? O SER Y 158 N ILE Z  155 ? N ILE Y 155 
AQ3 2 3 N ASN Z  150 ? N ASN Y 150 O THR Z  202 ? O THR Y 202 
AQ3 3 4 N ALA Z  201 ? N ALA Y 201 O ILE Z  210 ? O ILE Y 210 
AQ4 1 2 N VAL AA 5   ? N VAL Z 5   O ALA AA 23  ? O ALA Z 23  
AQ4 2 3 N LEU AA 18  ? N LEU Z 18  O MET AA 83  ? O MET Z 83  
AQ4 3 4 O TYR AA 80  ? O TYR Z 80  N SER AA 71  ? N SER Z 71  
AQ5 1 2 O TYR AA 59  ? O TYR Z 59  N SER AA 50  ? N SER Z 50  
AQ5 2 3 O GLU AA 46  ? O GLU Z 46  N ARG AA 38  ? N ARG Z 38  
AQ5 3 4 N THR AA 33  ? N THR Z 33  O ALA AA 99  ? O ALA Z 99  
AQ5 4 5 N ALA AA 92  ? N ALA Z 92  O VAL AA 119 ? O VAL Z 119 
AQ6 1 2 N SER AA 130 ? N SER Z 130 O LYS AA 153 ? O LYS Z 153 
AQ6 2 3 N VAL AA 152 ? N VAL Z 152 O LEU AA 187 ? O LEU Z 187 
AQ6 3 4 O SER AA 190 ? O SER Z 190 N HIS AA 174 ? N HIS Z 174 
AQ7 1 2 N THR AA 163 ? N THR Z 163 O ASN AA 206 ? O ASN Z 206 
AQ7 2 3 N VAL AA 207 ? N VAL Z 207 O VAL AA 216 ? O VAL Z 216 
AQ8 1 2 N THR BA 5   ? N THR a 5   O ARG BA 24  ? O ARG a 24  
AQ8 2 3 N CYS BA 23  ? N CYS a 23  O PHE BA 76  ? O PHE a 76  
AQ8 3 4 O LYS BA 79  ? O LYS a 79  N SER BA 68  ? N SER a 68  
AQ9 1 2 N LEU BA 11  ? N LEU a 11  O LYS BA 108 ? O LYS a 108 
AQ9 2 3 O THR BA 102 ? O THR a 102 N GLN BA 95  ? N GLN a 95  
AQ9 3 4 O VAL BA 90  ? O VAL a 90  N GLN BA 43  ? N GLN a 43  
AQ9 4 5 N LEU BA 42  ? N LEU a 42  O LYS BA 50  ? O LYS a 50  
AQ9 5 6 N TYR BA 54  ? N TYR a 54  O ASN BA 58  ? O ASN a 58  
AR1 1 2 N SER BA 121 ? N SER a 121 O PHE BA 140 ? O PHE a 140 
AR1 2 3 N VAL BA 137 ? N VAL a 137 O LEU BA 184 ? O LEU a 184 
AR1 3 4 O THR BA 183 ? O THR a 183 N LEU BA 165 ? N LEU a 165 
AR2 1 2 O SER BA 158 ? O SER a 158 N ILE BA 155 ? N ILE a 155 
AR2 2 3 N LYS BA 152 ? N LYS a 152 O GLU BA 200 ? O GLU a 200 
AR2 3 4 N TYR BA 197 ? N TYR a 197 O PHE BA 214 ? O PHE a 214 
AR3 1 2 N VAL CA 5   ? N VAL b 5   O ALA CA 23  ? O ALA b 23  
AR3 2 3 N LEU CA 18  ? N LEU b 18  O MET CA 83  ? O MET b 83  
AR3 3 4 O TYR CA 80  ? O TYR b 80  N SER CA 71  ? N SER b 71  
AR4 1 2 O TYR CA 59  ? O TYR b 59  N SER CA 50  ? N SER b 50  
AR4 2 3 O GLU CA 46  ? O GLU b 46  N ARG CA 38  ? N ARG b 38  
AR4 3 4 N SER CA 35  ? N SER b 35  O THR CA 97  ? O THR b 97  
AR4 4 5 N ARG CA 98  ? N ARG b 98  O TYR CA 112 ? O TYR b 112 
AR5 1 2 O TYR CA 59  ? O TYR b 59  N SER CA 50  ? N SER b 50  
AR5 2 3 O GLU CA 46  ? O GLU b 46  N ARG CA 38  ? N ARG b 38  
AR5 3 4 N SER CA 35  ? N SER b 35  O THR CA 97  ? O THR b 97  
AR5 4 5 N ALA CA 92  ? N ALA b 92  O VAL CA 119 ? O VAL b 119 
AR6 1 2 N LEU CA 134 ? N LEU b 134 O GLY CA 149 ? O GLY b 149 
AR6 2 3 N VAL CA 152 ? N VAL b 152 O LEU CA 187 ? O LEU b 187 
AR6 3 4 O SER CA 190 ? O SER b 190 N HIS CA 174 ? N HIS b 174 
AR7 1 2 N LEU CA 134 ? N LEU b 134 O GLY CA 149 ? O GLY b 149 
AR7 2 3 N VAL CA 152 ? N VAL b 152 O LEU CA 187 ? O LEU b 187 
AR7 3 4 O LEU CA 184 ? O LEU b 184 N GLN CA 181 ? N GLN b 181 
AR8 1 2 N THR CA 163 ? N THR b 163 O ASN CA 206 ? O ASN b 206 
AR8 2 3 N VAL CA 207 ? N VAL b 207 O VAL CA 216 ? O VAL b 216 
AR9 1 2 N THR DA 7   ? N THR U 7   O SER DA 22  ? O SER U 22  
AR9 2 3 N CYS DA 23  ? N CYS U 23  O PHE DA 76  ? O PHE U 76  
AR9 3 4 O LYS DA 79  ? O LYS U 79  N SER DA 68  ? N SER U 68  
AS1 1 2 N VAL DA 13  ? N VAL U 13  O GLU DA 110 ? O GLU U 110 
AS1 2 3 O THR DA 107 ? O THR U 107 N TYR DA 91  ? N TYR U 91  
AS1 3 4 O VAL DA 90  ? O VAL U 90  N GLN DA 43  ? N GLN U 43  
AS1 4 5 N LEU DA 42  ? N LEU U 42  O LYS DA 50  ? O LYS U 50  
AS1 5 6 N TYR DA 54  ? N TYR U 54  O ASN DA 58  ? O ASN U 58  
AS2 1 2 N SER DA 121 ? N SER U 121 O PHE DA 140 ? O PHE U 140 
AS2 2 3 N ALA DA 135 ? N ALA U 135 O LEU DA 186 ? O LEU U 186 
AS2 3 4 O THR DA 183 ? O THR U 183 N LEU DA 165 ? N LEU U 165 
AS3 1 2 O SER DA 158 ? O SER U 158 N ILE DA 155 ? N ILE U 155 
AS3 2 3 N LYS DA 152 ? N LYS U 152 O GLU DA 200 ? O GLU U 200 
AS3 3 4 N TYR DA 197 ? N TYR U 197 O PHE DA 214 ? O PHE U 214 
# 
_atom_sites.entry_id                    5Y9F 
_atom_sites.fract_transf_matrix[1][1]   0.008601 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003305 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002397 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007939 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . LYS A  1 12  ? 146.483 125.781  40.578  1.00 75.40  ?  20  LYS A N   1 
ATOM 2     C CA  . LYS A  1 12  ? 145.037 125.612  40.502  1.00 72.47  ?  20  LYS A CA  1 
ATOM 3     C C   . LYS A  1 12  ? 144.452 126.311  39.278  1.00 69.38  ?  20  LYS A C   1 
ATOM 4     O O   . LYS A  1 12  ? 144.670 127.505  39.070  1.00 71.52  ?  20  LYS A O   1 
ATOM 5     C CB  . LYS A  1 12  ? 144.367 126.144  41.771  1.00 77.48  ?  20  LYS A CB  1 
ATOM 6     C CG  . LYS A  1 12  ? 142.847 126.048  41.755  1.00 77.30  ?  20  LYS A CG  1 
ATOM 7     C CD  . LYS A  1 12  ? 142.246 126.444  43.097  1.00 81.99  ?  20  LYS A CD  1 
ATOM 8     C CE  . LYS A  1 12  ? 140.725 126.386  43.061  1.00 78.18  ?  20  LYS A CE  1 
ATOM 9     N NZ  . LYS A  1 12  ? 140.119 126.764  44.368  1.00 81.00  1  20  LYS A NZ  1 
ATOM 10    N N   . VAL A  1 13  ? 143.707 125.561  38.473  1.00 71.82  ?  21  VAL A N   1 
ATOM 11    C CA  . VAL A  1 13  ? 143.098 126.105  37.266  1.00 68.02  ?  21  VAL A CA  1 
ATOM 12    C C   . VAL A  1 13  ? 141.800 126.806  37.646  1.00 68.62  ?  21  VAL A C   1 
ATOM 13    O O   . VAL A  1 13  ? 141.076 126.363  38.547  1.00 70.98  ?  21  VAL A O   1 
ATOM 14    C CB  . VAL A  1 13  ? 142.876 124.989  36.226  1.00 67.91  ?  21  VAL A CB  1 
ATOM 15    C CG1 . VAL A  1 13  ? 142.004 123.879  36.793  1.00 67.40  ?  21  VAL A CG1 1 
ATOM 16    C CG2 . VAL A  1 13  ? 142.283 125.547  34.943  1.00 65.58  ?  21  VAL A CG2 1 
ATOM 17    N N   . VAL A  1 14  ? 141.505 127.915  36.970  1.00 68.14  ?  22  VAL A N   1 
ATOM 18    C CA  . VAL A  1 14  ? 140.393 128.787  37.329  1.00 68.27  ?  22  VAL A CA  1 
ATOM 19    C C   . VAL A  1 14  ? 139.395 128.828  36.181  1.00 68.47  ?  22  VAL A C   1 
ATOM 20    O O   . VAL A  1 14  ? 139.780 128.812  35.007  1.00 67.76  ?  22  VAL A O   1 
ATOM 21    C CB  . VAL A  1 14  ? 140.890 130.208  37.673  1.00 66.99  ?  22  VAL A CB  1 
ATOM 22    C CG1 . VAL A  1 14  ? 139.734 131.096  38.115  1.00 67.71  ?  22  VAL A CG1 1 
ATOM 23    C CG2 . VAL A  1 14  ? 141.966 130.147  38.745  1.00 69.80  ?  22  VAL A CG2 1 
ATOM 24    N N   . SER A  1 15  ? 138.109 128.873  36.530  1.00 66.95  ?  23  SER A N   1 
ATOM 25    C CA  . SER A  1 15  ? 137.052 128.976  35.534  1.00 64.47  ?  23  SER A CA  1 
ATOM 26    C C   . SER A  1 15  ? 137.205 130.245  34.705  1.00 68.89  ?  23  SER A C   1 
ATOM 27    O O   . SER A  1 15  ? 137.617 131.293  35.211  1.00 79.57  ?  23  SER A O   1 
ATOM 28    C CB  . SER A  1 15  ? 135.685 128.961  36.219  1.00 66.85  ?  23  SER A CB  1 
ATOM 29    O OG  . SER A  1 15  ? 134.660 129.363  35.328  1.00 66.77  ?  23  SER A OG  1 
ATOM 30    N N   . THR A  1 16  ? 136.869 130.145  33.417  1.00 64.45  ?  24  THR A N   1 
ATOM 31    C CA  . THR A  1 16  ? 136.977 131.299  32.533  1.00 64.61  ?  24  THR A CA  1 
ATOM 32    C C   . THR A  1 16  ? 135.914 132.349  32.815  1.00 67.44  ?  24  THR A C   1 
ATOM 33    O O   . THR A  1 16  ? 136.050 133.488  32.356  1.00 72.04  ?  24  THR A O   1 
ATOM 34    C CB  . THR A  1 16  ? 136.881 130.865  31.072  1.00 67.16  ?  24  THR A CB  1 
ATOM 35    O OG1 . THR A  1 16  ? 135.613 130.237  30.842  1.00 64.28  ?  24  THR A OG1 1 
ATOM 36    C CG2 . THR A  1 16  ? 138.002 129.900  30.730  1.00 67.02  ?  24  THR A CG2 1 
ATOM 37    N N   . ASP A  1 17  ? 134.866 132.001  33.558  1.00 64.03  ?  25  ASP A N   1 
ATOM 38    C CA  . ASP A  1 17  ? 133.856 132.990  33.910  1.00 66.15  ?  25  ASP A CA  1 
ATOM 39    C C   . ASP A  1 17  ? 134.329 133.970  34.975  1.00 73.25  ?  25  ASP A C   1 
ATOM 40    O O   . ASP A  1 17  ? 133.581 134.894  35.314  1.00 78.73  ?  25  ASP A O   1 
ATOM 41    C CB  . ASP A  1 17  ? 132.581 132.286  34.377  1.00 65.20  ?  25  ASP A CB  1 
ATOM 42    C CG  . ASP A  1 17  ? 132.058 131.295  33.357  1.00 68.41  ?  25  ASP A CG  1 
ATOM 43    O OD1 . ASP A  1 17  ? 132.371 131.460  32.158  1.00 67.15  ?  25  ASP A OD1 1 
ATOM 44    O OD2 . ASP A  1 17  ? 131.333 130.357  33.749  1.00 60.48  -1 25  ASP A OD2 1 
ATOM 45    N N   . GLU A  1 18  ? 135.540 133.800  35.505  1.00 71.81  ?  26  GLU A N   1 
ATOM 46    C CA  . GLU A  1 18  ? 136.067 134.697  36.523  1.00 74.79  ?  26  GLU A CA  1 
ATOM 47    C C   . GLU A  1 18  ? 137.080 135.699  35.986  1.00 75.85  ?  26  GLU A C   1 
ATOM 48    O O   . GLU A  1 18  ? 137.359 136.693  36.666  1.00 78.48  ?  26  GLU A O   1 
ATOM 49    C CB  . GLU A  1 18  ? 136.709 133.894  37.661  1.00 80.00  ?  26  GLU A CB  1 
ATOM 50    C CG  . GLU A  1 18  ? 135.755 132.929  38.347  1.00 86.11  ?  26  GLU A CG  1 
ATOM 51    C CD  . GLU A  1 18  ? 136.320 132.365  39.637  1.00 95.30  ?  26  GLU A CD  1 
ATOM 52    O OE1 . GLU A  1 18  ? 137.011 133.112  40.361  1.00 99.78  ?  26  GLU A OE1 1 
ATOM 53    O OE2 . GLU A  1 18  ? 136.073 131.174  39.927  1.00 97.58  -1 26  GLU A OE2 1 
ATOM 54    N N   . TYR A  1 19  ? 137.642 135.466  34.797  1.00 73.38  ?  27  TYR A N   1 
ATOM 55    C CA  . TYR A  1 19  ? 138.613 136.389  34.222  1.00 75.37  ?  27  TYR A CA  1 
ATOM 56    C C   . TYR A  1 19  ? 138.333 136.716  32.759  1.00 72.48  ?  27  TYR A C   1 
ATOM 57    O O   . TYR A  1 19  ? 139.198 137.298  32.093  1.00 73.51  ?  27  TYR A O   1 
ATOM 58    C CB  . TYR A  1 19  ? 140.038 135.838  34.374  1.00 81.26  ?  27  TYR A CB  1 
ATOM 59    C CG  . TYR A  1 19  ? 140.302 134.538  33.643  1.00 79.93  ?  27  TYR A CG  1 
ATOM 60    C CD1 . TYR A  1 19  ? 140.011 133.315  34.235  1.00 78.29  ?  27  TYR A CD1 1 
ATOM 61    C CD2 . TYR A  1 19  ? 140.863 134.532  32.370  1.00 74.61  ?  27  TYR A CD2 1 
ATOM 62    C CE1 . TYR A  1 19  ? 140.257 132.123  33.575  1.00 73.19  ?  27  TYR A CE1 1 
ATOM 63    C CE2 . TYR A  1 19  ? 141.112 133.345  31.703  1.00 70.81  ?  27  TYR A CE2 1 
ATOM 64    C CZ  . TYR A  1 19  ? 140.807 132.144  32.311  1.00 69.77  ?  27  TYR A CZ  1 
ATOM 65    O OH  . TYR A  1 19  ? 141.053 130.959  31.655  1.00 66.22  ?  27  TYR A OH  1 
ATOM 66    N N   . VAL A  1 20  ? 137.158 136.365  32.241  1.00 77.80  ?  28  VAL A N   1 
ATOM 67    C CA  . VAL A  1 20  ? 136.763 136.692  30.872  1.00 74.83  ?  28  VAL A CA  1 
ATOM 68    C C   . VAL A  1 20  ? 135.347 137.253  30.937  1.00 76.47  ?  28  VAL A C   1 
ATOM 69    O O   . VAL A  1 20  ? 134.373 136.493  30.988  1.00 77.74  ?  28  VAL A O   1 
ATOM 70    C CB  . VAL A  1 20  ? 136.835 135.487  29.929  1.00 69.86  ?  28  VAL A CB  1 
ATOM 71    C CG1 . VAL A  1 20  ? 136.454 135.906  28.517  1.00 68.70  ?  28  VAL A CG1 1 
ATOM 72    C CG2 . VAL A  1 20  ? 138.229 134.877  29.943  1.00 69.73  ?  28  VAL A CG2 1 
ATOM 73    N N   . THR A  1 21  ? 135.228 138.578  30.942  1.00 74.98  ?  29  THR A N   1 
ATOM 74    C CA  . THR A  1 21  ? 133.924 139.223  30.949  1.00 75.89  ?  29  THR A CA  1 
ATOM 75    C C   . THR A  1 21  ? 133.344 139.255  29.541  1.00 74.17  ?  29  THR A C   1 
ATOM 76    O O   . THR A  1 21  ? 134.060 139.484  28.563  1.00 75.46  ?  29  THR A O   1 
ATOM 77    C CB  . THR A  1 21  ? 134.026 140.643  31.505  1.00 69.80  ?  29  THR A CB  1 
ATOM 78    O OG1 . THR A  1 21  ? 135.018 141.373  30.774  1.00 70.58  ?  29  THR A OG1 1 
ATOM 79    C CG2 . THR A  1 21  ? 134.409 140.607  32.977  1.00 71.67  ?  29  THR A CG2 1 
ATOM 80    N N   . ARG A  1 22  ? 132.039 139.028  29.445  1.00 74.44  ?  30  ARG A N   1 
ATOM 81    C CA  . ARG A  1 22  ? 131.356 138.922  28.167  1.00 70.93  ?  30  ARG A CA  1 
ATOM 82    C C   . ARG A  1 22  ? 130.615 140.212  27.838  1.00 77.78  ?  30  ARG A C   1 
ATOM 83    O O   . ARG A  1 22  ? 130.253 140.996  28.720  1.00 88.16  ?  30  ARG A O   1 
ATOM 84    C CB  . ARG A  1 22  ? 130.382 137.742  28.177  1.00 77.62  ?  30  ARG A CB  1 
ATOM 85    C CG  . ARG A  1 22  ? 131.067 136.394  28.314  1.00 75.12  ?  30  ARG A CG  1 
ATOM 86    C CD  . ARG A  1 22  ? 130.063 135.260  28.389  1.00 72.12  ?  30  ARG A CD  1 
ATOM 87    N NE  . ARG A  1 22  ? 130.726 133.974  28.577  1.00 70.36  ?  30  ARG A NE  1 
ATOM 88    C CZ  . ARG A  1 22  ? 131.081 133.169  27.581  1.00 71.35  ?  30  ARG A CZ  1 
ATOM 89    N NH1 . ARG A  1 22  ? 130.834 133.519  26.326  1.00 69.63  1  30  ARG A NH1 1 
ATOM 90    N NH2 . ARG A  1 22  ? 131.682 132.016  27.838  1.00 75.20  ?  30  ARG A NH2 1 
ATOM 91    N N   . THR A  1 23  ? 130.392 140.423  26.545  1.00 73.12  ?  31  THR A N   1 
ATOM 92    C CA  . THR A  1 23  ? 129.707 141.602  26.038  1.00 77.48  ?  31  THR A CA  1 
ATOM 93    C C   . THR A  1 23  ? 128.433 141.181  25.316  1.00 78.94  ?  31  THR A C   1 
ATOM 94    O O   . THR A  1 23  ? 128.152 139.993  25.141  1.00 74.73  ?  31  THR A O   1 
ATOM 95    C CB  . THR A  1 23  ? 130.611 142.409  25.096  1.00 71.31  ?  31  THR A CB  1 
ATOM 96    O OG1 . THR A  1 23  ? 130.735 141.725  23.843  1.00 69.11  ?  31  THR A OG1 1 
ATOM 97    C CG2 . THR A  1 23  ? 131.992 142.579  25.706  1.00 72.19  ?  31  THR A CG2 1 
ATOM 98    N N   . SER A  1 24  ? 127.657 142.178  24.896  1.00 80.60  ?  32  SER A N   1 
ATOM 99    C CA  . SER A  1 24  ? 126.440 141.950  24.130  1.00 81.29  ?  32  SER A CA  1 
ATOM 100   C C   . SER A  1 24  ? 126.687 141.916  22.626  1.00 73.31  ?  32  SER A C   1 
ATOM 101   O O   . SER A  1 24  ? 125.726 141.852  21.853  1.00 70.84  ?  32  SER A O   1 
ATOM 102   C CB  . SER A  1 24  ? 125.400 143.024  24.461  1.00 84.64  ?  32  SER A CB  1 
ATOM 103   O OG  . SER A  1 24  ? 125.906 144.321  24.198  1.00 90.60  ?  32  SER A OG  1 
ATOM 104   N N   . ILE A  1 25  ? 127.943 141.958  22.197  1.00 75.28  ?  33  ILE A N   1 
ATOM 105   C CA  . ILE A  1 25  ? 128.274 141.884  20.779  1.00 73.90  ?  33  ILE A CA  1 
ATOM 106   C C   . ILE A  1 25  ? 128.217 140.427  20.334  1.00 71.94  ?  33  ILE A C   1 
ATOM 107   O O   . ILE A  1 25  ? 128.985 139.589  20.818  1.00 70.60  ?  33  ILE A O   1 
ATOM 108   C CB  . ILE A  1 25  ? 129.657 142.491  20.503  1.00 66.13  ?  33  ILE A CB  1 
ATOM 109   C CG1 . ILE A  1 25  ? 129.753 143.891  21.108  1.00 69.25  ?  33  ILE A CG1 1 
ATOM 110   C CG2 . ILE A  1 25  ? 129.932 142.533  19.011  1.00 65.57  ?  33  ILE A CG2 1 
ATOM 111   C CD1 . ILE A  1 25  ? 128.917 144.922  20.384  1.00 71.23  ?  33  ILE A CD1 1 
ATOM 112   N N   . PHE A  1 26  ? 127.308 140.123  19.412  1.00 72.87  ?  34  PHE A N   1 
ATOM 113   C CA  . PHE A  1 26  ? 127.154 138.780  18.872  1.00 68.25  ?  34  PHE A CA  1 
ATOM 114   C C   . PHE A  1 26  ? 127.289 138.819  17.357  1.00 67.80  ?  34  PHE A C   1 
ATOM 115   O O   . PHE A  1 26  ? 126.797 139.745  16.704  1.00 72.43  ?  34  PHE A O   1 
ATOM 116   C CB  . PHE A  1 26  ? 125.802 138.171  19.254  1.00 68.82  ?  34  PHE A CB  1 
ATOM 117   C CG  . PHE A  1 26  ? 125.662 137.865  20.716  1.00 67.65  ?  34  PHE A CG  1 
ATOM 118   C CD1 . PHE A  1 26  ? 126.264 136.744  21.262  1.00 66.06  ?  34  PHE A CD1 1 
ATOM 119   C CD2 . PHE A  1 26  ? 124.926 138.694  21.543  1.00 69.86  ?  34  PHE A CD2 1 
ATOM 120   C CE1 . PHE A  1 26  ? 126.132 136.455  22.606  1.00 65.57  ?  34  PHE A CE1 1 
ATOM 121   C CE2 . PHE A  1 26  ? 124.794 138.411  22.889  1.00 69.69  ?  34  PHE A CE2 1 
ATOM 122   C CZ  . PHE A  1 26  ? 125.398 137.290  23.421  1.00 66.92  ?  34  PHE A CZ  1 
ATOM 123   N N   . TYR A  1 27  ? 127.943 137.799  16.804  1.00 66.91  ?  35  TYR A N   1 
ATOM 124   C CA  . TYR A  1 27  ? 128.130 137.666  15.368  1.00 66.32  ?  35  TYR A CA  1 
ATOM 125   C C   . TYR A  1 27  ? 127.700 136.279  14.913  1.00 64.01  ?  35  TYR A C   1 
ATOM 126   O O   . TYR A  1 27  ? 127.805 135.299  15.656  1.00 62.53  ?  35  TYR A O   1 
ATOM 127   C CB  . TYR A  1 27  ? 129.592 137.906  14.941  1.00 66.01  ?  35  TYR A CB  1 
ATOM 128   C CG  . TYR A  1 27  ? 129.986 139.361  14.798  1.00 68.53  ?  35  TYR A CG  1 
ATOM 129   C CD1 . TYR A  1 27  ? 130.642 139.808  13.658  1.00 71.36  ?  35  TYR A CD1 1 
ATOM 130   C CD2 . TYR A  1 27  ? 129.671 140.293  15.776  1.00 70.48  ?  35  TYR A CD2 1 
ATOM 131   C CE1 . TYR A  1 27  ? 130.995 141.135  13.511  1.00 76.49  ?  35  TYR A CE1 1 
ATOM 132   C CE2 . TYR A  1 27  ? 130.020 141.621  15.638  1.00 72.98  ?  35  TYR A CE2 1 
ATOM 133   C CZ  . TYR A  1 27  ? 130.681 142.037  14.504  1.00 77.53  ?  35  TYR A CZ  1 
ATOM 134   O OH  . TYR A  1 27  ? 131.028 143.360  14.365  1.00 84.80  ?  35  TYR A OH  1 
ATOM 135   N N   . HIS A  1 28  ? 127.213 136.212  13.678  1.00 67.03  ?  36  HIS A N   1 
ATOM 136   C CA  . HIS A  1 28  ? 126.894 134.953  13.021  1.00 63.35  ?  36  HIS A CA  1 
ATOM 137   C C   . HIS A  1 28  ? 127.995 134.605  12.031  1.00 62.39  ?  36  HIS A C   1 
ATOM 138   O O   . HIS A  1 28  ? 128.421 135.456  11.242  1.00 65.54  ?  36  HIS A O   1 
ATOM 139   C CB  . HIS A  1 28  ? 125.548 135.032  12.300  1.00 67.10  ?  36  HIS A CB  1 
ATOM 140   C CG  . HIS A  1 28  ? 125.285 133.875  11.386  1.00 67.36  ?  36  HIS A CG  1 
ATOM 141   N ND1 . HIS A  1 28  ? 125.754 133.829  10.091  1.00 70.23  ?  36  HIS A ND1 1 
ATOM 142   C CD2 . HIS A  1 28  ? 124.608 132.719  11.582  1.00 67.33  ?  36  HIS A CD2 1 
ATOM 143   C CE1 . HIS A  1 28  ? 125.373 132.697  9.527   1.00 70.72  ?  36  HIS A CE1 1 
ATOM 144   N NE2 . HIS A  1 28  ? 124.676 132.005  10.410  1.00 68.01  ?  36  HIS A NE2 1 
ATOM 145   N N   . ALA A  1 29  ? 128.445 133.356  12.073  1.00 66.66  ?  37  ALA A N   1 
ATOM 146   C CA  . ALA A  1 29  ? 129.452 132.845  11.159  1.00 64.32  ?  37  ALA A CA  1 
ATOM 147   C C   . ALA A  1 29  ? 128.964 131.529  10.578  1.00 64.89  ?  37  ALA A C   1 
ATOM 148   O O   . ALA A  1 29  ? 128.422 130.687  11.301  1.00 59.75  ?  37  ALA A O   1 
ATOM 149   C CB  . ALA A  1 29  ? 130.796 132.645  11.863  1.00 61.52  ?  37  ALA A CB  1 
ATOM 150   N N   . GLY A  1 30  ? 129.157 131.354  9.275   1.00 68.45  ?  38  GLY A N   1 
ATOM 151   C CA  . GLY A  1 30  ? 128.690 130.149  8.623   1.00 67.57  ?  38  GLY A CA  1 
ATOM 152   C C   . GLY A  1 30  ? 129.376 129.833  7.312   1.00 68.86  ?  38  GLY A C   1 
ATOM 153   O O   . GLY A  1 30  ? 129.565 130.713  6.466   1.00 72.64  ?  38  GLY A O   1 
ATOM 154   N N   . SER A  1 31  ? 129.764 128.573  7.144   1.00 68.84  ?  39  SER A N   1 
ATOM 155   C CA  . SER A  1 31  ? 130.259 128.100  5.863   1.00 64.92  ?  39  SER A CA  1 
ATOM 156   C C   . SER A  1 31  ? 129.111 127.950  4.874   1.00 70.20  ?  39  SER A C   1 
ATOM 157   O O   . SER A  1 31  ? 127.944 127.803  5.248   1.00 79.40  ?  39  SER A O   1 
ATOM 158   C CB  . SER A  1 31  ? 130.956 126.750  6.014   1.00 57.40  ?  39  SER A CB  1 
ATOM 159   O OG  . SER A  1 31  ? 132.167 126.878  6.724   1.00 62.27  ?  39  SER A OG  1 
ATOM 160   N N   . SER A  1 32  ? 129.453 127.986  3.593   1.00 68.11  ?  40  SER A N   1 
ATOM 161   C CA  . SER A  1 32  ? 128.498 127.604  2.565   1.00 68.95  ?  40  SER A CA  1 
ATOM 162   C C   . SER A  1 32  ? 128.340 126.086  2.632   1.00 63.62  ?  40  SER A C   1 
ATOM 163   O O   . SER A  1 32  ? 128.816 125.423  3.560   1.00 57.54  ?  40  SER A O   1 
ATOM 164   C CB  . SER A  1 32  ? 128.960 128.092  1.195   1.00 76.07  ?  40  SER A CB  1 
ATOM 165   O OG  . SER A  1 32  ? 130.270 127.635  0.902   1.00 74.90  ?  40  SER A OG  1 
ATOM 166   N N   . ARG A  1 33  ? 127.663 125.507  1.649   1.00 67.62  ?  41  ARG A N   1 
ATOM 167   C CA  . ARG A  1 33  ? 127.561 124.057  1.611   1.00 62.98  ?  41  ARG A CA  1 
ATOM 168   C C   . ARG A  1 33  ? 128.937 123.450  1.362   1.00 58.61  ?  41  ARG A C   1 
ATOM 169   O O   . ARG A  1 33  ? 129.648 123.849  0.435   1.00 60.08  ?  41  ARG A O   1 
ATOM 170   C CB  . ARG A  1 33  ? 126.566 123.602  0.544   1.00 62.94  ?  41  ARG A CB  1 
ATOM 171   C CG  . ARG A  1 33  ? 126.893 124.008  -0.886  1.00 69.32  ?  41  ARG A CG  1 
ATOM 172   C CD  . ARG A  1 33  ? 126.200 123.091  -1.890  1.00 70.58  ?  41  ARG A CD  1 
ATOM 173   N NE  . ARG A  1 33  ? 124.742 123.136  -1.783  1.00 70.21  ?  41  ARG A NE  1 
ATOM 174   C CZ  . ARG A  1 33  ? 124.019 122.321  -1.021  1.00 63.76  ?  41  ARG A CZ  1 
ATOM 175   N NH1 . ARG A  1 33  ? 124.618 121.393  -0.287  1.00 58.36  1  41  ARG A NH1 1 
ATOM 176   N NH2 . ARG A  1 33  ? 122.699 122.437  -0.987  1.00 65.19  ?  41  ARG A NH2 1 
ATOM 177   N N   . LEU A  1 34  ? 129.332 122.519  2.223   1.00 56.01  ?  42  LEU A N   1 
ATOM 178   C CA  . LEU A  1 34  ? 130.562 121.762  2.044   1.00 54.78  ?  42  LEU A CA  1 
ATOM 179   C C   . LEU A  1 34  ? 130.182 120.355  1.616   1.00 56.97  ?  42  LEU A C   1 
ATOM 180   O O   . LEU A  1 34  ? 129.276 119.757  2.195   1.00 57.48  ?  42  LEU A O   1 
ATOM 181   C CB  . LEU A  1 34  ? 131.382 121.723  3.334   1.00 49.24  ?  42  LEU A CB  1 
ATOM 182   C CG  . LEU A  1 34  ? 131.715 123.075  3.958   1.00 55.70  ?  42  LEU A CG  1 
ATOM 183   C CD1 . LEU A  1 34  ? 132.217 122.891  5.382   1.00 58.88  ?  42  LEU A CD1 1 
ATOM 184   C CD2 . LEU A  1 34  ? 132.740 123.809  3.108   1.00 61.78  ?  42  LEU A CD2 1 
ATOM 185   N N   . LEU A  1 35  ? 130.839 119.835  0.587   1.00 53.76  ?  43  LEU A N   1 
ATOM 186   C CA  . LEU A  1 35  ? 130.529 118.476  0.172   1.00 49.03  ?  43  LEU A CA  1 
ATOM 187   C C   . LEU A  1 35  ? 131.787 117.804  -0.348  1.00 47.07  ?  43  LEU A C   1 
ATOM 188   O O   . LEU A  1 35  ? 132.702 118.463  -0.849  1.00 48.38  ?  43  LEU A O   1 
ATOM 189   C CB  . LEU A  1 35  ? 129.402 118.444  -0.872  1.00 47.95  ?  43  LEU A CB  1 
ATOM 190   C CG  . LEU A  1 35  ? 129.431 119.362  -2.094  1.00 49.33  ?  43  LEU A CG  1 
ATOM 191   C CD1 . LEU A  1 35  ? 130.312 118.802  -3.204  1.00 49.48  ?  43  LEU A CD1 1 
ATOM 192   C CD2 . LEU A  1 35  ? 128.016 119.606  -2.594  1.00 50.37  ?  43  LEU A CD2 1 
ATOM 193   N N   . THR A  1 36  ? 131.822 116.482  -0.208  1.00 45.74  ?  44  THR A N   1 
ATOM 194   C CA  . THR A  1 36  ? 132.932 115.685  -0.706  1.00 45.81  ?  44  THR A CA  1 
ATOM 195   C C   . THR A  1 36  ? 132.400 114.346  -1.191  1.00 48.95  ?  44  THR A C   1 
ATOM 196   O O   . THR A  1 36  ? 131.582 113.717  -0.513  1.00 56.44  ?  44  THR A O   1 
ATOM 197   C CB  . THR A  1 36  ? 134.003 115.482  0.373   1.00 50.97  ?  44  THR A CB  1 
ATOM 198   O OG1 . THR A  1 36  ? 134.964 114.520  -0.078  1.00 56.93  ?  44  THR A OG1 1 
ATOM 199   C CG2 . THR A  1 36  ? 133.376 115.008  1.680   1.00 46.38  ?  44  THR A CG2 1 
ATOM 200   N N   . VAL A  1 37  ? 132.851 113.930  -2.372  1.00 49.00  ?  45  VAL A N   1 
ATOM 201   C CA  . VAL A  1 37  ? 132.494 112.641  -2.945  1.00 48.81  ?  45  VAL A CA  1 
ATOM 202   C C   . VAL A  1 37  ? 133.773 111.825  -3.072  1.00 48.80  ?  45  VAL A C   1 
ATOM 203   O O   . VAL A  1 37  ? 134.881 112.367  -3.114  1.00 50.35  ?  45  VAL A O   1 
ATOM 204   C CB  . VAL A  1 37  ? 131.788 112.775  -4.313  1.00 44.61  ?  45  VAL A CB  1 
ATOM 205   C CG1 . VAL A  1 37  ? 130.741 113.877  -4.267  1.00 44.78  ?  45  VAL A CG1 1 
ATOM 206   C CG2 . VAL A  1 37  ? 132.797 113.037  -5.420  1.00 44.73  ?  45  VAL A CG2 1 
ATOM 207   N N   . GLY A  1 38  ? 133.617 110.510  -3.115  1.00 48.31  ?  46  GLY A N   1 
ATOM 208   C CA  . GLY A  1 38  ? 134.780 109.660  -3.276  1.00 48.28  ?  46  GLY A CA  1 
ATOM 209   C C   . GLY A  1 38  ? 134.425 108.195  -3.211  1.00 48.35  ?  46  GLY A C   1 
ATOM 210   O O   . GLY A  1 38  ? 133.267 107.815  -3.380  1.00 48.46  ?  46  GLY A O   1 
ATOM 211   N N   . HIS A  1 39  ? 135.445 107.370  -2.986  1.00 52.98  ?  47  HIS A N   1 
ATOM 212   C CA  . HIS A  1 39  ? 135.120 105.954  -2.865  1.00 53.14  ?  47  HIS A CA  1 
ATOM 213   C C   . HIS A  1 39  ? 134.884 105.593  -1.401  1.00 51.57  ?  47  HIS A C   1 
ATOM 214   O O   . HIS A  1 39  ? 135.616 106.056  -0.522  1.00 51.46  ?  47  HIS A O   1 
ATOM 215   C CB  . HIS A  1 39  ? 136.238 105.087  -3.433  1.00 54.58  ?  47  HIS A CB  1 
ATOM 216   C CG  . HIS A  1 39  ? 135.833 103.666  -3.671  1.00 53.40  ?  47  HIS A CG  1 
ATOM 217   N ND1 . HIS A  1 39  ? 135.922 102.694  -2.699  1.00 52.37  ?  47  HIS A ND1 1 
ATOM 218   C CD2 . HIS A  1 39  ? 135.327 103.056  -4.769  1.00 55.94  ?  47  HIS A CD2 1 
ATOM 219   C CE1 . HIS A  1 39  ? 135.492 101.545  -3.189  1.00 55.35  ?  47  HIS A CE1 1 
ATOM 220   N NE2 . HIS A  1 39  ? 135.125 101.737  -4.443  1.00 57.86  ?  47  HIS A NE2 1 
ATOM 221   N N   . PRO A  1 40  ? 133.872 104.772  -1.113  1.00 50.91  ?  48  PRO A N   1 
ATOM 222   C CA  . PRO A  1 40  ? 133.527 104.504  0.291   1.00 47.91  ?  48  PRO A CA  1 
ATOM 223   C C   . PRO A  1 40  ? 134.497 103.584  1.010   1.00 49.82  ?  48  PRO A C   1 
ATOM 224   O O   . PRO A  1 40  ? 134.490 103.567  2.247   1.00 54.27  ?  48  PRO A O   1 
ATOM 225   C CB  . PRO A  1 40  ? 132.136 103.868  0.192   1.00 48.62  ?  48  PRO A CB  1 
ATOM 226   C CG  . PRO A  1 40  ? 132.131 103.215  -1.147  1.00 51.48  ?  48  PRO A CG  1 
ATOM 227   C CD  . PRO A  1 40  ? 132.939 104.115  -2.045  1.00 52.42  ?  48  PRO A CD  1 
ATOM 228   N N   . TYR A  1 41  ? 135.327 102.825  0.299   1.00 47.94  ?  49  TYR A N   1 
ATOM 229   C CA  . TYR A  1 41  ? 136.151 101.801  0.932   1.00 48.38  ?  49  TYR A CA  1 
ATOM 230   C C   . TYR A  1 41  ? 137.635 102.132  0.967   1.00 48.56  ?  49  TYR A C   1 
ATOM 231   O O   . TYR A  1 41  ? 138.305 101.816  1.953   1.00 48.73  ?  49  TYR A O   1 
ATOM 232   C CB  . TYR A  1 41  ? 135.962 100.455  0.221   1.00 45.81  ?  49  TYR A CB  1 
ATOM 233   C CG  . TYR A  1 41  ? 134.534 99.955   0.163   1.00 45.93  ?  49  TYR A CG  1 
ATOM 234   C CD1 . TYR A  1 41  ? 133.598 100.330  1.119   1.00 45.79  ?  49  TYR A CD1 1 
ATOM 235   C CD2 . TYR A  1 41  ? 134.123 99.104   -0.855  1.00 46.24  ?  49  TYR A CD2 1 
ATOM 236   C CE1 . TYR A  1 41  ? 132.294 99.873   1.062   1.00 45.93  ?  49  TYR A CE1 1 
ATOM 237   C CE2 . TYR A  1 41  ? 132.824 98.642   -0.920  1.00 46.41  ?  49  TYR A CE2 1 
ATOM 238   C CZ  . TYR A  1 41  ? 131.914 99.029   0.039   1.00 46.25  ?  49  TYR A CZ  1 
ATOM 239   O OH  . TYR A  1 41  ? 130.621 98.568   -0.029  1.00 46.45  ?  49  TYR A OH  1 
ATOM 240   N N   . PHE A  1 42  ? 138.170 102.759  -0.078  1.00 52.53  ?  50  PHE A N   1 
ATOM 241   C CA  . PHE A  1 42  ? 139.609 102.961  -0.189  1.00 54.26  ?  50  PHE A CA  1 
ATOM 242   C C   . PHE A  1 42  ? 139.892 104.032  -1.230  1.00 56.67  ?  50  PHE A C   1 
ATOM 243   O O   . PHE A  1 42  ? 139.080 104.287  -2.123  1.00 56.83  ?  50  PHE A O   1 
ATOM 244   C CB  . PHE A  1 42  ? 140.324 101.659  -0.567  1.00 50.22  ?  50  PHE A CB  1 
ATOM 245   C CG  . PHE A  1 42  ? 139.639 100.896  -1.666  1.00 51.60  ?  50  PHE A CG  1 
ATOM 246   C CD1 . PHE A  1 42  ? 139.741 101.305  -2.986  1.00 52.38  ?  50  PHE A CD1 1 
ATOM 247   C CD2 . PHE A  1 42  ? 138.896 99.764   -1.379  1.00 52.76  ?  50  PHE A CD2 1 
ATOM 248   C CE1 . PHE A  1 42  ? 139.106 100.605  -3.994  1.00 53.74  ?  50  PHE A CE1 1 
ATOM 249   C CE2 . PHE A  1 42  ? 138.261 99.059   -2.382  1.00 52.78  ?  50  PHE A CE2 1 
ATOM 250   C CZ  . PHE A  1 42  ? 138.368 99.479   -3.692  1.00 53.73  ?  50  PHE A CZ  1 
ATOM 251   N N   . LYS A  1 43  ? 141.061 104.657  -1.103  1.00 58.36  ?  51  LYS A N   1 
ATOM 252   C CA  . LYS A  1 43  ? 141.530 105.569  -2.136  1.00 57.18  ?  51  LYS A CA  1 
ATOM 253   C C   . LYS A  1 43  ? 141.825 104.789  -3.410  1.00 59.93  ?  51  LYS A C   1 
ATOM 254   O O   . LYS A  1 43  ? 142.556 103.794  -3.385  1.00 60.32  ?  51  LYS A O   1 
ATOM 255   C CB  . LYS A  1 43  ? 142.778 106.319  -1.675  1.00 59.63  ?  51  LYS A CB  1 
ATOM 256   C CG  . LYS A  1 43  ? 143.343 107.247  -2.739  1.00 60.84  ?  51  LYS A CG  1 
ATOM 257   C CD  . LYS A  1 43  ? 144.778 107.658  -2.446  1.00 70.89  ?  51  LYS A CD  1 
ATOM 258   C CE  . LYS A  1 43  ? 144.882 108.467  -1.164  1.00 76.27  ?  51  LYS A CE  1 
ATOM 259   N NZ  . LYS A  1 43  ? 146.282 108.910  -0.912  1.00 79.37  1  51  LYS A NZ  1 
ATOM 260   N N   . VAL A  1 44  ? 141.256 105.239  -4.524  1.00 64.57  ?  52  VAL A N   1 
ATOM 261   C CA  . VAL A  1 44  ? 141.436 104.567  -5.808  1.00 64.03  ?  52  VAL A CA  1 
ATOM 262   C C   . VAL A  1 44  ? 142.386 105.392  -6.665  1.00 68.43  ?  52  VAL A C   1 
ATOM 263   O O   . VAL A  1 44  ? 141.978 106.417  -7.229  1.00 71.57  ?  52  VAL A O   1 
ATOM 264   C CB  . VAL A  1 44  ? 140.093 104.364  -6.525  1.00 60.94  ?  52  VAL A CB  1 
ATOM 265   C CG1 . VAL A  1 44  ? 140.283 103.514  -7.771  1.00 67.13  ?  52  VAL A CG1 1 
ATOM 266   C CG2 . VAL A  1 44  ? 139.076 103.740  -5.583  1.00 60.19  ?  52  VAL A CG2 1 
ATOM 267   N N   . PRO A  1 45  ? 143.648 104.988  -6.797  1.00 74.07  ?  53  PRO A N   1 
ATOM 268   C CA  . PRO A  1 45  ? 144.582 105.755  -7.628  1.00 76.21  ?  53  PRO A CA  1 
ATOM 269   C C   . PRO A  1 45  ? 144.343 105.516  -9.109  1.00 75.21  ?  53  PRO A C   1 
ATOM 270   O O   . PRO A  1 45  ? 144.141 104.384  -9.555  1.00 79.93  ?  53  PRO A O   1 
ATOM 271   C CB  . PRO A  1 45  ? 145.958 105.226  -7.198  1.00 78.08  ?  53  PRO A CB  1 
ATOM 272   C CG  . PRO A  1 45  ? 145.714 104.447  -5.928  1.00 77.41  ?  53  PRO A CG  1 
ATOM 273   C CD  . PRO A  1 45  ? 144.327 103.916  -6.055  1.00 75.35  ?  53  PRO A CD  1 
ATOM 274   N N   . LYS A  1 46  ? 144.368 106.605  -9.873  1.00 78.46  ?  54  LYS A N   1 
ATOM 275   C CA  . LYS A  1 46  ? 144.292 106.552  -11.327 1.00 89.86  ?  54  LYS A CA  1 
ATOM 276   C C   . LYS A  1 46  ? 145.469 107.326  -11.900 1.00 95.60  ?  54  LYS A C   1 
ATOM 277   O O   . LYS A  1 46  ? 145.623 108.519  -11.622 1.00 97.89  ?  54  LYS A O   1 
ATOM 278   C CB  . LYS A  1 46  ? 142.968 107.126  -11.839 1.00 92.90  ?  54  LYS A CB  1 
ATOM 279   C CG  . LYS A  1 46  ? 142.973 107.423  -13.329 1.00 103.57 ?  54  LYS A CG  1 
ATOM 280   C CD  . LYS A  1 46  ? 141.581 107.749  -13.843 1.00 106.63 ?  54  LYS A CD  1 
ATOM 281   C CE  . LYS A  1 46  ? 141.645 108.383  -15.224 1.00 109.32 ?  54  LYS A CE  1 
ATOM 282   N NZ  . LYS A  1 46  ? 142.506 107.606  -16.161 1.00 108.27 1  54  LYS A NZ  1 
ATOM 283   N N   . GLY A  1 47  ? 146.296 106.647  -12.692 1.00 98.92  ?  55  GLY A N   1 
ATOM 284   C CA  . GLY A  1 47  ? 147.471 107.263  -13.276 1.00 103.74 ?  55  GLY A CA  1 
ATOM 285   C C   . GLY A  1 47  ? 147.145 108.416  -14.203 1.00 108.28 ?  55  GLY A C   1 
ATOM 286   O O   . GLY A  1 47  ? 146.453 108.237  -15.210 1.00 111.94 ?  55  GLY A O   1 
ATOM 287   N N   . GLY A  1 48  ? 147.641 109.605  -13.873 1.00 106.96 ?  56  GLY A N   1 
ATOM 288   C CA  . GLY A  1 48  ? 147.401 110.780  -14.687 1.00 111.56 ?  56  GLY A CA  1 
ATOM 289   C C   . GLY A  1 48  ? 148.642 111.260  -15.415 1.00 121.15 ?  56  GLY A C   1 
ATOM 290   O O   . GLY A  1 48  ? 149.422 110.413  -15.860 1.00 126.77 ?  56  GLY A O   1 
ATOM 291   N N   . ASN A  1 49  ? 148.877 112.573  -15.561 1.00 124.00 ?  57  ASN A N   1 
ATOM 292   C CA  . ASN A  1 49  ? 148.071 113.701  -15.054 1.00 124.26 ?  57  ASN A CA  1 
ATOM 293   C C   . ASN A  1 49  ? 147.785 113.602  -13.556 1.00 122.23 ?  57  ASN A C   1 
ATOM 294   O O   . ASN A  1 49  ? 146.649 113.771  -13.113 1.00 123.29 ?  57  ASN A O   1 
ATOM 295   C CB  . ASN A  1 49  ? 146.759 113.834  -15.840 1.00 123.84 ?  57  ASN A CB  1 
ATOM 296   C CG  . ASN A  1 49  ? 146.110 115.196  -15.669 1.00 125.65 ?  57  ASN A CG  1 
ATOM 297   O OD1 . ASN A  1 49  ? 146.699 116.108  -15.088 1.00 125.50 ?  57  ASN A OD1 1 
ATOM 298   N ND2 . ASN A  1 49  ? 144.889 115.338  -16.171 1.00 126.24 ?  57  ASN A ND2 1 
ATOM 299   N N   . GLY A  1 50  ? 148.831 113.314  -12.788 1.00 123.96 ?  58  GLY A N   1 
ATOM 300   C CA  . GLY A  1 50  ? 148.694 113.115  -11.361 1.00 123.17 ?  58  GLY A CA  1 
ATOM 301   C C   . GLY A  1 50  ? 148.238 114.338  -10.591 1.00 123.22 ?  58  GLY A C   1 
ATOM 302   O O   . GLY A  1 50  ? 148.924 115.364  -10.597 1.00 125.54 ?  58  GLY A O   1 
ATOM 303   N N   . ARG A  1 51  ? 147.087 114.251  -9.924  1.00 121.42 ?  59  ARG A N   1 
ATOM 304   C CA  . ARG A  1 51  ? 146.255 113.048  -9.913  1.00 113.83 ?  59  ARG A CA  1 
ATOM 305   C C   . ARG A  1 51  ? 144.776 113.408  -10.053 1.00 107.43 ?  59  ARG A C   1 
ATOM 306   O O   . ARG A  1 51  ? 144.312 114.386  -9.468  1.00 104.76 ?  59  ARG A O   1 
ATOM 307   C CB  . ARG A  1 51  ? 146.463 112.237  -8.625  1.00 108.75 ?  59  ARG A CB  1 
ATOM 308   C CG  . ARG A  1 51  ? 147.797 111.506  -8.527  1.00 110.87 ?  59  ARG A CG  1 
ATOM 309   C CD  . ARG A  1 51  ? 147.795 110.461  -7.425  1.00 109.03 ?  59  ARG A CD  1 
ATOM 310   N NE  . ARG A  1 51  ? 148.916 109.533  -7.554  1.00 109.70 ?  59  ARG A NE  1 
ATOM 311   C CZ  . ARG A  1 51  ? 148.947 108.509  -8.401  1.00 108.26 ?  59  ARG A CZ  1 
ATOM 312   N NH1 . ARG A  1 51  ? 147.916 108.274  -9.201  1.00 105.93 1  59  ARG A NH1 1 
ATOM 313   N NH2 . ARG A  1 51  ? 150.010 107.718  -8.450  1.00 109.95 ?  59  ARG A NH2 1 
ATOM 314   N N   . GLN A  1 52  ? 144.040 112.617  -10.832 1.00 106.66 ?  60  GLN A N   1 
ATOM 315   C CA  . GLN A  1 52  ? 142.579 112.678  -10.857 1.00 99.44  ?  60  GLN A CA  1 
ATOM 316   C C   . GLN A  1 52  ? 141.966 111.536  -10.061 1.00 90.26  ?  60  GLN A C   1 
ATOM 317   O O   . GLN A  1 52  ? 140.913 111.002  -10.422 1.00 86.24  ?  60  GLN A O   1 
ATOM 318   C CB  . GLN A  1 52  ? 142.054 112.665  -12.290 1.00 104.12 ?  60  GLN A CB  1 
ATOM 319   C CG  . GLN A  1 52  ? 142.941 113.344  -13.314 1.00 108.50 ?  60  GLN A CG  1 
ATOM 320   C CD  . GLN A  1 52  ? 143.701 112.345  -14.161 1.00 113.18 ?  60  GLN A CD  1 
ATOM 321   O OE1 . GLN A  1 52  ? 144.183 111.328  -13.662 1.00 111.58 ?  60  GLN A OE1 1 
ATOM 322   N NE2 . GLN A  1 52  ? 143.788 112.616  -15.458 1.00 118.48 ?  60  GLN A NE2 1 
ATOM 323   N N   . ASP A  1 53  ? 142.617 111.139  -8.972  1.00 83.70  ?  61  ASP A N   1 
ATOM 324   C CA  . ASP A  1 53  ? 142.135 110.038  -8.158  1.00 83.43  ?  61  ASP A CA  1 
ATOM 325   C C   . ASP A  1 53  ? 140.913 110.460  -7.350  1.00 80.93  ?  61  ASP A C   1 
ATOM 326   O O   . ASP A  1 53  ? 140.692 111.643  -7.076  1.00 85.47  ?  61  ASP A O   1 
ATOM 327   C CB  . ASP A  1 53  ? 143.231 109.560  -7.207  1.00 88.11  ?  61  ASP A CB  1 
ATOM 328   C CG  . ASP A  1 53  ? 144.528 109.257  -7.920  1.00 96.29  ?  61  ASP A CG  1 
ATOM 329   O OD1 . ASP A  1 53  ? 144.655 109.626  -9.107  1.00 100.02 ?  61  ASP A OD1 1 
ATOM 330   O OD2 . ASP A  1 53  ? 145.425 108.658  -7.292  1.00 100.66 -1 61  ASP A OD2 1 
ATOM 331   N N   . VAL A  1 54  ? 140.117 109.474  -6.967  1.00 69.40  ?  62  VAL A N   1 
ATOM 332   C CA  . VAL A  1 54  ? 138.999 109.672  -6.049  1.00 66.67  ?  62  VAL A CA  1 
ATOM 333   C C   . VAL A  1 54  ? 139.477 109.312  -4.647  1.00 63.86  ?  62  VAL A C   1 
ATOM 334   O O   . VAL A  1 54  ? 140.193 108.312  -4.489  1.00 66.62  ?  62  VAL A O   1 
ATOM 335   C CB  . VAL A  1 54  ? 137.763 108.844  -6.452  1.00 61.52  ?  62  VAL A CB  1 
ATOM 336   C CG1 . VAL A  1 54  ? 137.397 109.123  -7.901  1.00 70.05  ?  62  VAL A CG1 1 
ATOM 337   C CG2 . VAL A  1 54  ? 137.995 107.355  -6.253  1.00 58.09  ?  62  VAL A CG2 1 
ATOM 338   N N   . PRO A  1 55  ? 139.169 110.111  -3.635  1.00 57.68  ?  63  PRO A N   1 
ATOM 339   C CA  . PRO A  1 55  ? 139.634 109.820  -2.279  1.00 56.22  ?  63  PRO A CA  1 
ATOM 340   C C   . PRO A  1 55  ? 138.679 108.887  -1.544  1.00 54.70  ?  63  PRO A C   1 
ATOM 341   O O   . PRO A  1 55  ? 137.593 108.552  -2.022  1.00 55.10  ?  63  PRO A O   1 
ATOM 342   C CB  . PRO A  1 55  ? 139.658 111.206  -1.625  1.00 53.62  ?  63  PRO A CB  1 
ATOM 343   C CG  . PRO A  1 55  ? 138.543 111.929  -2.300  1.00 53.71  ?  63  PRO A CG  1 
ATOM 344   C CD  . PRO A  1 55  ? 138.512 111.426  -3.724  1.00 54.45  ?  63  PRO A CD  1 
ATOM 345   N N   . LYS A  1 56  ? 139.116 108.464  -0.362  1.00 50.46  ?  64  LYS A N   1 
ATOM 346   C CA  . LYS A  1 56  ? 138.291 107.635  0.508   1.00 49.81  ?  64  LYS A CA  1 
ATOM 347   C C   . LYS A  1 56  ? 137.320 108.536  1.260   1.00 52.64  ?  64  LYS A C   1 
ATOM 348   O O   . LYS A  1 56  ? 137.723 109.285  2.157   1.00 56.33  ?  64  LYS A O   1 
ATOM 349   C CB  . LYS A  1 56  ? 139.165 106.837  1.470   1.00 49.99  ?  64  LYS A CB  1 
ATOM 350   C CG  . LYS A  1 56  ? 138.402 105.848  2.334   1.00 50.32  ?  64  LYS A CG  1 
ATOM 351   C CD  . LYS A  1 56  ? 139.334 105.165  3.320   1.00 53.28  ?  64  LYS A CD  1 
ATOM 352   C CE  . LYS A  1 56  ? 138.597 104.162  4.187   1.00 54.11  ?  64  LYS A CE  1 
ATOM 353   N NZ  . LYS A  1 56  ? 139.510 103.537  5.182   1.00 57.35  1  64  LYS A NZ  1 
ATOM 354   N N   . VAL A  1 57  ? 136.043 108.470  0.898   1.00 47.54  ?  65  VAL A N   1 
ATOM 355   C CA  . VAL A  1 57  ? 134.994 109.253  1.540   1.00 47.16  ?  65  VAL A CA  1 
ATOM 356   C C   . VAL A  1 57  ? 133.974 108.253  2.065   1.00 46.98  ?  65  VAL A C   1 
ATOM 357   O O   . VAL A  1 57  ? 133.085 107.811  1.328   1.00 47.24  ?  65  VAL A O   1 
ATOM 358   C CB  . VAL A  1 57  ? 134.350 110.263  0.584   1.00 46.79  ?  65  VAL A CB  1 
ATOM 359   C CG1 . VAL A  1 57  ? 133.252 111.039  1.294   1.00 46.76  ?  65  VAL A CG1 1 
ATOM 360   C CG2 . VAL A  1 57  ? 135.400 111.207  0.031   1.00 46.81  ?  65  VAL A CG2 1 
ATOM 361   N N   . SER A  1 58  ? 134.096 107.890  3.338   1.00 48.15  ?  66  SER A N   1 
ATOM 362   C CA  . SER A  1 58  ? 133.209 106.928  3.970   1.00 48.14  ?  66  SER A CA  1 
ATOM 363   C C   . SER A  1 58  ? 132.349 107.623  5.016   1.00 47.85  ?  66  SER A C   1 
ATOM 364   O O   . SER A  1 58  ? 132.795 108.553  5.693   1.00 47.66  ?  66  SER A O   1 
ATOM 365   C CB  . SER A  1 58  ? 134.005 105.791  4.619   1.00 52.51  ?  66  SER A CB  1 
ATOM 366   O OG  . SER A  1 58  ? 133.167 104.687  4.916   1.00 52.68  ?  66  SER A OG  1 
ATOM 367   N N   . ALA A  1 59  ? 131.107 107.150  5.151   1.00 50.05  ?  67  ALA A N   1 
ATOM 368   C CA  . ALA A  1 59  ? 130.216 107.678  6.177   1.00 53.75  ?  67  ALA A CA  1 
ATOM 369   C C   . ALA A  1 59  ? 130.685 107.344  7.585   1.00 54.50  ?  67  ALA A C   1 
ATOM 370   O O   . ALA A  1 59  ? 130.204 107.952  8.547   1.00 58.31  ?  67  ALA A O   1 
ATOM 371   C CB  . ALA A  1 59  ? 128.798 107.149  5.966   1.00 55.96  ?  67  ALA A CB  1 
ATOM 372   N N   . TYR A  1 60  ? 131.608 106.396  7.729   1.00 52.16  ?  68  TYR A N   1 
ATOM 373   C CA  . TYR A  1 60  ? 132.174 106.031  9.024   1.00 51.51  ?  68  TYR A CA  1 
ATOM 374   C C   . TYR A  1 60  ? 133.538 106.672  9.236   1.00 50.12  ?  68  TYR A C   1 
ATOM 375   O O   . TYR A  1 60  ? 134.439 106.077  9.834   1.00 50.42  ?  68  TYR A O   1 
ATOM 376   C CB  . TYR A  1 60  ? 132.243 104.513  9.153   1.00 49.53  ?  68  TYR A CB  1 
ATOM 377   C CG  . TYR A  1 60  ? 130.902 103.865  8.895   1.00 47.55  ?  68  TYR A CG  1 
ATOM 378   C CD1 . TYR A  1 60  ? 129.957 103.765  9.903   1.00 47.39  ?  68  TYR A CD1 1 
ATOM 379   C CD2 . TYR A  1 60  ? 130.568 103.386  7.636   1.00 47.53  ?  68  TYR A CD2 1 
ATOM 380   C CE1 . TYR A  1 60  ? 128.722 103.194  9.672   1.00 47.45  ?  68  TYR A CE1 1 
ATOM 381   C CE2 . TYR A  1 60  ? 129.335 102.808  7.395   1.00 47.36  ?  68  TYR A CE2 1 
ATOM 382   C CZ  . TYR A  1 60  ? 128.416 102.714  8.417   1.00 48.11  ?  68  TYR A CZ  1 
ATOM 383   O OH  . TYR A  1 60  ? 127.187 102.139  8.184   1.00 51.95  ?  68  TYR A OH  1 
ATOM 384   N N   . GLN A  1 61  ? 133.702 107.896  8.739   1.00 46.95  ?  69  GLN A N   1 
ATOM 385   C CA  . GLN A  1 61  ? 134.914 108.681  8.918   1.00 46.95  ?  69  GLN A CA  1 
ATOM 386   C C   . GLN A  1 61  ? 134.648 109.851  9.853   1.00 46.92  ?  69  GLN A C   1 
ATOM 387   O O   . GLN A  1 61  ? 133.571 110.454  9.819   1.00 46.85  ?  69  GLN A O   1 
ATOM 388   C CB  . GLN A  1 61  ? 135.432 109.225  7.584   1.00 48.34  ?  69  GLN A CB  1 
ATOM 389   C CG  . GLN A  1 61  ? 136.363 108.306  6.825   1.00 49.85  ?  69  GLN A CG  1 
ATOM 390   C CD  . GLN A  1 61  ? 136.811 108.914  5.512   1.00 52.59  ?  69  GLN A CD  1 
ATOM 391   O OE1 . GLN A  1 61  ? 136.110 109.740  4.927   1.00 53.30  ?  69  GLN A OE1 1 
ATOM 392   N NE2 . GLN A  1 61  ? 137.992 108.521  5.048   1.00 56.36  ?  69  GLN A NE2 1 
ATOM 393   N N   . TYR A  1 62  ? 135.638 110.175  10.678  1.00 46.64  ?  70  TYR A N   1 
ATOM 394   C CA  . TYR A  1 62  ? 135.568 111.387  11.481  1.00 47.09  ?  70  TYR A CA  1 
ATOM 395   C C   . TYR A  1 62  ? 135.703 112.601  10.570  1.00 48.28  ?  70  TYR A C   1 
ATOM 396   O O   . TYR A  1 62  ? 136.596 112.652  9.719   1.00 49.29  ?  70  TYR A O   1 
ATOM 397   C CB  . TYR A  1 62  ? 136.677 111.398  12.531  1.00 47.82  ?  70  TYR A CB  1 
ATOM 398   C CG  . TYR A  1 62  ? 136.420 110.533  13.744  1.00 48.24  ?  70  TYR A CG  1 
ATOM 399   C CD1 . TYR A  1 62  ? 135.737 111.028  14.848  1.00 48.48  ?  70  TYR A CD1 1 
ATOM 400   C CD2 . TYR A  1 62  ? 136.883 109.226  13.794  1.00 52.39  ?  70  TYR A CD2 1 
ATOM 401   C CE1 . TYR A  1 62  ? 135.510 110.238  15.961  1.00 49.04  ?  70  TYR A CE1 1 
ATOM 402   C CE2 . TYR A  1 62  ? 136.663 108.432  14.900  1.00 53.93  ?  70  TYR A CE2 1 
ATOM 403   C CZ  . TYR A  1 62  ? 135.976 108.940  15.980  1.00 49.40  ?  70  TYR A CZ  1 
ATOM 404   O OH  . TYR A  1 62  ? 135.759 108.141  17.079  1.00 50.17  ?  70  TYR A OH  1 
ATOM 405   N N   . ARG A  1 63  ? 134.817 113.575  10.741  1.00 48.18  ?  71  ARG A N   1 
ATOM 406   C CA  . ARG A  1 63  ? 134.915 114.855  10.047  1.00 48.76  ?  71  ARG A CA  1 
ATOM 407   C C   . ARG A  1 63  ? 135.372 115.893  11.063  1.00 51.81  ?  71  ARG A C   1 
ATOM 408   O O   . ARG A  1 63  ? 134.611 116.263  11.962  1.00 54.35  ?  71  ARG A O   1 
ATOM 409   C CB  . ARG A  1 63  ? 133.586 115.248  9.408   1.00 47.21  ?  71  ARG A CB  1 
ATOM 410   C CG  . ARG A  1 63  ? 133.128 114.332  8.289   1.00 46.46  ?  71  ARG A CG  1 
ATOM 411   C CD  . ARG A  1 63  ? 133.671 114.790  6.947   1.00 51.74  ?  71  ARG A CD  1 
ATOM 412   N NE  . ARG A  1 63  ? 135.022 114.297  6.694   1.00 53.01  ?  71  ARG A NE  1 
ATOM 413   C CZ  . ARG A  1 63  ? 135.295 113.107  6.168   1.00 51.59  ?  71  ARG A CZ  1 
ATOM 414   N NH1 . ARG A  1 63  ? 134.308 112.284  5.833   1.00 46.39  1  71  ARG A NH1 1 
ATOM 415   N NH2 . ARG A  1 63  ? 136.555 112.740  5.971   1.00 48.01  ?  71  ARG A NH2 1 
ATOM 416   N N   . VAL A  1 64  ? 136.612 116.351  10.932  1.00 44.69  ?  72  VAL A N   1 
ATOM 417   C CA  . VAL A  1 64  ? 137.209 117.280  11.884  1.00 45.45  ?  72  VAL A CA  1 
ATOM 418   C C   . VAL A  1 64  ? 137.486 118.575  11.134  1.00 45.93  ?  72  VAL A C   1 
ATOM 419   O O   . VAL A  1 64  ? 138.436 118.663  10.347  1.00 61.81  ?  72  VAL A O   1 
ATOM 420   C CB  . VAL A  1 64  ? 138.481 116.719  12.526  1.00 49.70  ?  72  VAL A CB  1 
ATOM 421   C CG1 . VAL A  1 64  ? 138.960 117.640  13.637  1.00 51.03  ?  72  VAL A CG1 1 
ATOM 422   C CG2 . VAL A  1 64  ? 138.223 115.321  13.066  1.00 51.24  ?  72  VAL A CG2 1 
ATOM 423   N N   . PHE A  1 65  ? 136.648 119.581  11.369  1.00 48.32  ?  73  PHE A N   1 
ATOM 424   C CA  . PHE A  1 65  ? 136.788 120.889  10.746  1.00 48.69  ?  73  PHE A CA  1 
ATOM 425   C C   . PHE A  1 65  ? 137.643 121.788  11.629  1.00 49.72  ?  73  PHE A C   1 
ATOM 426   O O   . PHE A  1 65  ? 137.386 121.914  12.833  1.00 50.02  ?  73  PHE A O   1 
ATOM 427   C CB  . PHE A  1 65  ? 135.420 121.537  10.529  1.00 47.94  ?  73  PHE A CB  1 
ATOM 428   C CG  . PHE A  1 65  ? 134.464 120.701  9.730   1.00 47.15  ?  73  PHE A CG  1 
ATOM 429   C CD1 . PHE A  1 65  ? 133.667 119.753  10.348  1.00 46.53  ?  73  PHE A CD1 1 
ATOM 430   C CD2 . PHE A  1 65  ? 134.345 120.879  8.362   1.00 47.22  ?  73  PHE A CD2 1 
ATOM 431   C CE1 . PHE A  1 65  ? 132.780 118.989  9.616   1.00 45.98  ?  73  PHE A CE1 1 
ATOM 432   C CE2 . PHE A  1 65  ? 133.458 120.118  7.624   1.00 46.68  ?  73  PHE A CE2 1 
ATOM 433   C CZ  . PHE A  1 65  ? 132.675 119.171  8.253   1.00 46.05  ?  73  PHE A CZ  1 
ATOM 434   N N   . ARG A  1 66  ? 138.655 122.409  11.026  1.00 52.84  ?  74  ARG A N   1 
ATOM 435   C CA  . ARG A  1 66  ? 139.451 123.443  11.683  1.00 54.09  ?  74  ARG A CA  1 
ATOM 436   C C   . ARG A  1 66  ? 138.896 124.790  11.238  1.00 54.90  ?  74  ARG A C   1 
ATOM 437   O O   . ARG A  1 66  ? 139.187 125.264  10.137  1.00 58.63  ?  74  ARG A O   1 
ATOM 438   C CB  . ARG A  1 66  ? 140.932 123.305  11.351  1.00 61.67  ?  74  ARG A CB  1 
ATOM 439   C CG  . ARG A  1 66  ? 141.791 124.389  11.983  1.00 68.56  ?  74  ARG A CG  1 
ATOM 440   C CD  . ARG A  1 66  ? 143.269 124.050  11.910  1.00 72.75  ?  74  ARG A CD  1 
ATOM 441   N NE  . ARG A  1 66  ? 144.068 124.943  12.744  1.00 75.58  ?  74  ARG A NE  1 
ATOM 442   C CZ  . ARG A  1 66  ? 145.366 124.784  12.978  1.00 78.84  ?  74  ARG A CZ  1 
ATOM 443   N NH1 . ARG A  1 66  ? 146.018 123.761  12.441  1.00 77.46  1  74  ARG A NH1 1 
ATOM 444   N NH2 . ARG A  1 66  ? 146.013 125.645  13.752  1.00 83.20  ?  74  ARG A NH2 1 
ATOM 445   N N   . VAL A  1 67  ? 138.087 125.396  12.100  1.00 55.21  ?  75  VAL A N   1 
ATOM 446   C CA  . VAL A  1 67  ? 137.423 126.660  11.810  1.00 56.14  ?  75  VAL A CA  1 
ATOM 447   C C   . VAL A  1 67  ? 138.312 127.794  12.307  1.00 58.84  ?  75  VAL A C   1 
ATOM 448   O O   . VAL A  1 67  ? 138.498 127.969  13.512  1.00 59.52  ?  75  VAL A O   1 
ATOM 449   C CB  . VAL A  1 67  ? 136.036 126.719  12.461  1.00 57.03  ?  75  VAL A CB  1 
ATOM 450   C CG1 . VAL A  1 67  ? 135.343 128.017  12.109  1.00 58.82  ?  75  VAL A CG1 1 
ATOM 451   C CG2 . VAL A  1 67  ? 135.197 125.525  12.034  1.00 60.37  ?  75  VAL A CG2 1 
ATOM 452   N N   . LYS A  1 68  ? 138.851 128.575  11.380  1.00 57.74  ?  76  LYS A N   1 
ATOM 453   C CA  . LYS A  1 68  ? 139.658 129.734  11.725  1.00 59.47  ?  76  LYS A CA  1 
ATOM 454   C C   . LYS A  1 68  ? 138.768 130.969  11.781  1.00 60.65  ?  76  LYS A C   1 
ATOM 455   O O   . LYS A  1 68  ? 138.012 131.243  10.843  1.00 60.63  ?  76  LYS A O   1 
ATOM 456   C CB  . LYS A  1 68  ? 140.795 129.923  10.721  1.00 64.90  ?  76  LYS A CB  1 
ATOM 457   C CG  . LYS A  1 68  ? 141.968 128.982  10.963  1.00 69.89  ?  76  LYS A CG  1 
ATOM 458   C CD  . LYS A  1 68  ? 143.092 129.199  9.964   1.00 77.97  ?  76  LYS A CD  1 
ATOM 459   C CE  . LYS A  1 68  ? 144.164 128.127  10.108  1.00 78.71  ?  76  LYS A CE  1 
ATOM 460   N NZ  . LYS A  1 68  ? 145.343 128.391  9.237   1.00 78.30  1  76  LYS A NZ  1 
ATOM 461   N N   . LEU A  1 69  ? 138.848 131.691  12.883  1.00 62.73  ?  77  LEU A N   1 
ATOM 462   C CA  . LEU A  1 69  ? 138.070 132.886  13.152  1.00 65.33  ?  77  LEU A CA  1 
ATOM 463   C C   . LEU A  1 69  ? 138.924 134.135  12.968  1.00 72.35  ?  77  LEU A C   1 
ATOM 464   O O   . LEU A  1 69  ? 140.147 134.091  13.140  1.00 74.39  ?  77  LEU A O   1 
ATOM 465   C CB  . LEU A  1 69  ? 137.521 132.850  14.582  1.00 65.49  ?  77  LEU A CB  1 
ATOM 466   C CG  . LEU A  1 69  ? 136.734 131.591  14.949  1.00 61.78  ?  77  LEU A CG  1 
ATOM 467   C CD1 . LEU A  1 69  ? 136.243 131.658  16.386  1.00 62.14  ?  77  LEU A CD1 1 
ATOM 468   C CD2 . LEU A  1 69  ? 135.572 131.395  13.989  1.00 61.58  ?  77  LEU A CD2 1 
ATOM 469   N N   . PRO A  1 70  ? 138.315 135.266  12.614  1.00 69.69  ?  78  PRO A N   1 
ATOM 470   C CA  . PRO A  1 70  ? 139.089 136.504  12.489  1.00 71.15  ?  78  PRO A CA  1 
ATOM 471   C C   . PRO A  1 70  ? 139.558 136.996  13.846  1.00 72.33  ?  78  PRO A C   1 
ATOM 472   O O   . PRO A  1 70  ? 138.880 136.829  14.863  1.00 70.74  ?  78  PRO A O   1 
ATOM 473   C CB  . PRO A  1 70  ? 138.093 137.481  11.855  1.00 66.38  ?  78  PRO A CB  1 
ATOM 474   C CG  . PRO A  1 70  ? 136.762 136.975  12.281  1.00 66.05  ?  78  PRO A CG  1 
ATOM 475   C CD  . PRO A  1 70  ? 136.888 135.477  12.323  1.00 65.26  ?  78  PRO A CD  1 
ATOM 476   N N   . ASP A  1 71  ? 140.743 137.596  13.854  1.00 76.68  ?  79  ASP A N   1 
ATOM 477   C CA  . ASP A  1 71  ? 141.305 138.138  15.083  1.00 82.02  ?  79  ASP A CA  1 
ATOM 478   C C   . ASP A  1 71  ? 140.430 139.278  15.588  1.00 84.05  ?  79  ASP A C   1 
ATOM 479   O O   . ASP A  1 71  ? 140.316 140.310  14.909  1.00 86.42  ?  79  ASP A O   1 
ATOM 480   C CB  . ASP A  1 71  ? 142.734 138.627  14.847  1.00 81.43  ?  79  ASP A CB  1 
ATOM 481   C CG  . ASP A  1 71  ? 143.503 138.857  16.143  1.00 85.70  ?  79  ASP A CG  1 
ATOM 482   O OD1 . ASP A  1 71  ? 142.871 139.049  17.203  1.00 85.91  ?  79  ASP A OD1 1 
ATOM 483   O OD2 . ASP A  1 71  ? 144.752 138.850  16.097  1.00 88.83  -1 79  ASP A OD2 1 
ATOM 484   N N   . PRO A  1 72  ? 139.789 139.137  16.751  1.00 77.70  ?  80  PRO A N   1 
ATOM 485   C CA  . PRO A  1 72  ? 138.943 140.227  17.256  1.00 79.49  ?  80  PRO A CA  1 
ATOM 486   C C   . PRO A  1 72  ? 139.727 141.467  17.646  1.00 83.75  ?  80  PRO A C   1 
ATOM 487   O O   . PRO A  1 72  ? 139.159 142.566  17.640  1.00 86.64  ?  80  PRO A O   1 
ATOM 488   C CB  . PRO A  1 72  ? 138.247 139.597  18.469  1.00 78.01  ?  80  PRO A CB  1 
ATOM 489   C CG  . PRO A  1 72  ? 139.184 138.527  18.917  1.00 75.61  ?  80  PRO A CG  1 
ATOM 490   C CD  . PRO A  1 72  ? 139.814 137.983  17.667  1.00 74.47  ?  80  PRO A CD  1 
ATOM 491   N N   . ASN A  1 73  ? 141.011 141.329  17.986  1.00 77.26  ?  81  ASN A N   1 
ATOM 492   C CA  . ASN A  1 73  ? 141.829 142.505  18.259  1.00 86.83  ?  81  ASN A CA  1 
ATOM 493   C C   . ASN A  1 73  ? 142.192 143.228  16.969  1.00 94.43  ?  81  ASN A C   1 
ATOM 494   O O   . ASN A  1 73  ? 142.192 144.464  16.921  1.00 103.26 ?  81  ASN A O   1 
ATOM 495   C CB  . ASN A  1 73  ? 143.089 142.102  19.025  1.00 85.52  ?  81  ASN A CB  1 
ATOM 496   C CG  . ASN A  1 73  ? 142.786 141.241  20.236  1.00 80.10  ?  81  ASN A CG  1 
ATOM 497   O OD1 . ASN A  1 73  ? 142.477 141.749  21.314  1.00 80.39  ?  81  ASN A OD1 1 
ATOM 498   N ND2 . ASN A  1 73  ? 142.877 139.929  20.064  1.00 76.08  ?  81  ASN A ND2 1 
ATOM 499   N N   . LYS A  1 74  ? 142.507 142.475  15.913  1.00 93.33  ?  82  LYS A N   1 
ATOM 500   C CA  . LYS A  1 74  ? 142.729 143.065  14.599  1.00 96.22  ?  82  LYS A CA  1 
ATOM 501   C C   . LYS A  1 74  ? 141.426 143.449  13.909  1.00 98.60  ?  82  LYS A C   1 
ATOM 502   O O   . LYS A  1 74  ? 141.457 144.211  12.936  1.00 104.14 ?  82  LYS A O   1 
ATOM 503   C CB  . LYS A  1 74  ? 143.526 142.101  13.716  1.00 99.29  ?  82  LYS A CB  1 
ATOM 504   C CG  . LYS A  1 74  ? 144.197 142.763  12.521  1.00 105.26 ?  82  LYS A CG  1 
ATOM 505   C CD  . LYS A  1 74  ? 145.326 143.683  12.961  1.00 112.83 ?  82  LYS A CD  1 
ATOM 506   C CE  . LYS A  1 74  ? 146.152 144.156  11.775  1.00 117.01 ?  82  LYS A CE  1 
ATOM 507   N NZ  . LYS A  1 74  ? 145.325 144.900  10.784  1.00 119.52 1  82  LYS A NZ  1 
ATOM 508   N N   . PHE A  1 75  ? 140.292 142.940  14.388  1.00 100.60 ?  83  PHE A N   1 
ATOM 509   C CA  . PHE A  1 75  ? 138.999 143.300  13.819  1.00 102.86 ?  83  PHE A CA  1 
ATOM 510   C C   . PHE A  1 75  ? 138.764 144.798  13.964  1.00 115.95 ?  83  PHE A C   1 
ATOM 511   O O   . PHE A  1 75  ? 138.858 145.350  15.064  1.00 123.98 ?  83  PHE A O   1 
ATOM 512   C CB  . PHE A  1 75  ? 137.883 142.519  14.517  1.00 106.42 ?  83  PHE A CB  1 
ATOM 513   C CG  . PHE A  1 75  ? 136.783 142.070  13.597  1.00 103.77 ?  83  PHE A CG  1 
ATOM 514   C CD1 . PHE A  1 75  ? 136.993 141.976  12.232  1.00 99.85  ?  83  PHE A CD1 1 
ATOM 515   C CD2 . PHE A  1 75  ? 135.534 141.742  14.102  1.00 103.73 ?  83  PHE A CD2 1 
ATOM 516   C CE1 . PHE A  1 75  ? 135.979 141.558  11.388  1.00 94.54  ?  83  PHE A CE1 1 
ATOM 517   C CE2 . PHE A  1 75  ? 134.517 141.326  13.263  1.00 98.96  ?  83  PHE A CE2 1 
ATOM 518   C CZ  . PHE A  1 75  ? 134.739 141.235  11.904  1.00 93.47  ?  83  PHE A CZ  1 
ATOM 519   N N   . GLY A  1 76  ? 138.454 145.454  12.850  1.00 123.35 ?  84  GLY A N   1 
ATOM 520   C CA  . GLY A  1 76  ? 138.310 146.896  12.848  1.00 131.26 ?  84  GLY A CA  1 
ATOM 521   C C   . GLY A  1 76  ? 136.867 147.347  12.789  1.00 134.88 ?  84  GLY A C   1 
ATOM 522   O O   . GLY A  1 76  ? 136.577 148.500  12.455  1.00 138.75 ?  84  GLY A O   1 
ATOM 523   N N   . LEU A  1 77  ? 135.952 146.438  13.111  1.00 130.41 ?  85  LEU A N   1 
ATOM 524   C CA  . LEU A  1 77  ? 134.525 146.735  13.104  1.00 134.94 ?  85  LEU A CA  1 
ATOM 525   C C   . LEU A  1 77  ? 134.054 147.310  14.442  1.00 146.14 ?  85  LEU A C   1 
ATOM 526   O O   . LEU A  1 77  ? 133.311 148.300  14.441  1.00 151.06 ?  85  LEU A O   1 
ATOM 527   C CB  . LEU A  1 77  ? 133.715 145.486  12.735  1.00 129.04 ?  85  LEU A CB  1 
ATOM 528   C CG  . LEU A  1 77  ? 133.532 145.172  11.245  1.00 120.24 ?  85  LEU A CG  1 
ATOM 529   C CD1 . LEU A  1 77  ? 132.900 146.352  10.521  1.00 123.67 ?  85  LEU A CD1 1 
ATOM 530   C CD2 . LEU A  1 77  ? 134.845 144.778  10.583  1.00 114.38 ?  85  LEU A CD2 1 
ATOM 531   N N   . PRO A  1 78  ? 134.435 146.746  15.595  1.00 144.84 ?  86  PRO A N   1 
ATOM 532   C CA  . PRO A  1 78  ? 134.025 147.364  16.862  1.00 147.12 ?  86  PRO A CA  1 
ATOM 533   C C   . PRO A  1 78  ? 134.780 148.655  17.143  1.00 152.41 ?  86  PRO A C   1 
ATOM 534   O O   . PRO A  1 78  ? 135.950 148.815  16.787  1.00 153.43 ?  86  PRO A O   1 
ATOM 535   C CB  . PRO A  1 78  ? 134.356 146.291  17.905  1.00 133.26 ?  86  PRO A CB  1 
ATOM 536   C CG  . PRO A  1 78  ? 135.450 145.510  17.295  1.00 135.22 ?  86  PRO A CG  1 
ATOM 537   C CD  . PRO A  1 78  ? 135.134 145.467  15.831  1.00 130.36 ?  86  PRO A CD  1 
ATOM 538   N N   . ASP A  1 79  ? 134.084 149.581  17.799  1.00 156.56 ?  87  ASP A N   1 
ATOM 539   C CA  . ASP A  1 79  ? 134.642 150.869  18.181  1.00 151.68 ?  87  ASP A CA  1 
ATOM 540   C C   . ASP A  1 79  ? 135.402 150.755  19.500  1.00 143.91 ?  87  ASP A C   1 
ATOM 541   O O   . ASP A  1 79  ? 135.241 149.797  20.260  1.00 135.79 ?  87  ASP A O   1 
ATOM 542   C CB  . ASP A  1 79  ? 133.538 151.921  18.301  1.00 151.11 ?  87  ASP A CB  1 
ATOM 543   C CG  . ASP A  1 79  ? 132.390 151.465  19.184  1.00 145.79 ?  87  ASP A CG  1 
ATOM 544   O OD1 . ASP A  1 79  ? 132.176 150.240  19.300  1.00 142.90 ?  87  ASP A OD1 1 
ATOM 545   O OD2 . ASP A  1 79  ? 131.701 152.333  19.760  1.00 144.18 -1 87  ASP A OD2 1 
ATOM 546   N N   . ASN A  1 80  ? 136.243 151.756  19.770  1.00 141.50 ?  88  ASN A N   1 
ATOM 547   C CA  . ASN A  1 80  ? 137.038 151.747  21.002  1.00 143.56 ?  88  ASN A CA  1 
ATOM 548   C C   . ASN A  1 80  ? 136.196 151.922  22.269  1.00 143.75 ?  88  ASN A C   1 
ATOM 549   O O   . ASN A  1 80  ? 136.781 152.038  23.355  1.00 146.01 ?  88  ASN A O   1 
ATOM 550   C CB  . ASN A  1 80  ? 138.110 152.838  20.948  1.00 146.60 ?  88  ASN A CB  1 
ATOM 551   C CG  . ASN A  1 80  ? 139.226 152.511  19.978  1.00 144.83 ?  88  ASN A CG  1 
ATOM 552   O OD1 . ASN A  1 80  ? 139.554 153.309  19.101  1.00 148.91 ?  88  ASN A OD1 1 
ATOM 553   N ND2 . ASN A  1 80  ? 139.818 151.332  20.133  1.00 139.44 ?  88  ASN A ND2 1 
ATOM 554   N N   . THR A  1 81  ? 134.865 151.948  22.184  1.00 141.61 ?  89  THR A N   1 
ATOM 555   C CA  . THR A  1 81  ? 134.046 151.987  23.388  1.00 142.41 ?  89  THR A CA  1 
ATOM 556   C C   . THR A  1 81  ? 133.891 150.603  24.006  1.00 133.06 ?  89  THR A C   1 
ATOM 557   O O   . THR A  1 81  ? 133.675 150.488  25.218  1.00 134.73 ?  89  THR A O   1 
ATOM 558   C CB  . THR A  1 81  ? 132.671 152.581  23.071  1.00 143.89 ?  89  THR A CB  1 
ATOM 559   O OG1 . THR A  1 81  ? 132.833 153.776  22.297  1.00 151.32 ?  89  THR A OG1 1 
ATOM 560   C CG2 . THR A  1 81  ? 131.920 152.922  24.353  1.00 146.29 ?  89  THR A CG2 1 
ATOM 561   N N   . VAL A  1 82  ? 134.014 149.545  23.200  1.00 124.76 ?  90  VAL A N   1 
ATOM 562   C CA  . VAL A  1 82  ? 133.840 148.199  23.735  1.00 116.16 ?  90  VAL A CA  1 
ATOM 563   C C   . VAL A  1 82  ? 135.048 147.782  24.565  1.00 113.34 ?  90  VAL A C   1 
ATOM 564   O O   . VAL A  1 82  ? 134.908 147.016  25.524  1.00 112.22 ?  90  VAL A O   1 
ATOM 565   C CB  . VAL A  1 82  ? 133.558 147.195  22.600  1.00 118.93 ?  90  VAL A CB  1 
ATOM 566   C CG1 . VAL A  1 82  ? 132.340 147.631  21.798  1.00 117.84 ?  90  VAL A CG1 1 
ATOM 567   C CG2 . VAL A  1 82  ? 134.772 147.030  21.697  1.00 117.13 ?  90  VAL A CG2 1 
ATOM 568   N N   . TYR A  1 83  ? 136.238 148.281  24.234  1.00 108.12 ?  91  TYR A N   1 
ATOM 569   C CA  . TYR A  1 83  ? 137.440 147.916  24.970  1.00 108.45 ?  91  TYR A CA  1 
ATOM 570   C C   . TYR A  1 83  ? 138.544 148.915  24.663  1.00 117.78 ?  91  TYR A C   1 
ATOM 571   O O   . TYR A  1 83  ? 138.475 149.671  23.690  1.00 123.28 ?  91  TYR A O   1 
ATOM 572   C CB  . TYR A  1 83  ? 137.898 146.492  24.634  1.00 101.07 ?  91  TYR A CB  1 
ATOM 573   C CG  . TYR A  1 83  ? 138.950 146.403  23.546  1.00 99.26  ?  91  TYR A CG  1 
ATOM 574   C CD1 . TYR A  1 83  ? 140.264 146.066  23.849  1.00 100.43 ?  91  TYR A CD1 1 
ATOM 575   C CD2 . TYR A  1 83  ? 138.627 146.644  22.215  1.00 97.84  ?  91  TYR A CD2 1 
ATOM 576   C CE1 . TYR A  1 83  ? 141.227 145.974  22.860  1.00 101.08 ?  91  TYR A CE1 1 
ATOM 577   C CE2 . TYR A  1 83  ? 139.585 146.556  21.218  1.00 97.94  ?  91  TYR A CE2 1 
ATOM 578   C CZ  . TYR A  1 83  ? 140.883 146.221  21.547  1.00 98.83  ?  91  TYR A CZ  1 
ATOM 579   O OH  . TYR A  1 83  ? 141.839 146.132  20.559  1.00 95.19  ?  91  TYR A OH  1 
ATOM 580   N N   . ASP A  1 84  ? 139.568 148.902  25.513  1.00 107.05 ?  92  ASP A N   1 
ATOM 581   C CA  . ASP A  1 84  ? 140.750 149.727  25.360  1.00 111.65 ?  92  ASP A CA  1 
ATOM 582   C C   . ASP A  1 84  ? 141.974 148.840  25.174  1.00 107.80 ?  92  ASP A C   1 
ATOM 583   O O   . ASP A  1 84  ? 142.203 147.932  25.985  1.00 105.36 ?  92  ASP A O   1 
ATOM 584   C CB  . ASP A  1 84  ? 140.942 150.634  26.582  1.00 110.74 ?  92  ASP A CB  1 
ATOM 585   C CG  . ASP A  1 84  ? 141.006 149.853  27.877  1.00 109.85 ?  92  ASP A CG  1 
ATOM 586   O OD1 . ASP A  1 84  ? 140.344 148.797  27.966  1.00 103.54 ?  92  ASP A OD1 1 
ATOM 587   O OD2 . ASP A  1 84  ? 141.728 150.283  28.798  1.00 116.96 -1 92  ASP A OD2 1 
ATOM 588   N N   . PRO A  1 85  ? 142.775 149.056  24.131  1.00 104.37 ?  93  PRO A N   1 
ATOM 589   C CA  . PRO A  1 85  ? 143.936 148.184  23.906  1.00 102.36 ?  93  PRO A CA  1 
ATOM 590   C C   . PRO A  1 85  ? 145.095 148.469  24.850  1.00 106.53 ?  93  PRO A C   1 
ATOM 591   O O   . PRO A  1 85  ? 146.259 148.272  24.485  1.00 107.30 ?  93  PRO A O   1 
ATOM 592   C CB  . PRO A  1 85  ? 144.315 148.483  22.450  1.00 105.15 ?  93  PRO A CB  1 
ATOM 593   C CG  . PRO A  1 85  ? 143.853 149.885  22.234  1.00 109.90 ?  93  PRO A CG  1 
ATOM 594   C CD  . PRO A  1 85  ? 142.598 150.040  23.050  1.00 109.51 ?  93  PRO A CD  1 
ATOM 595   N N   . ASN A  1 86  ? 144.795 148.930  26.063  1.00 99.65  ?  94  ASN A N   1 
ATOM 596   C CA  . ASN A  1 86  ? 145.811 149.213  27.069  1.00 108.11 ?  94  ASN A CA  1 
ATOM 597   C C   . ASN A  1 86  ? 145.932 148.103  28.106  1.00 100.50 ?  94  ASN A C   1 
ATOM 598   O O   . ASN A  1 86  ? 147.044 147.682  28.437  1.00 101.72 ?  94  ASN A O   1 
ATOM 599   C CB  . ASN A  1 86  ? 145.508 150.545  27.764  1.00 113.41 ?  94  ASN A CB  1 
ATOM 600   C CG  . ASN A  1 86  ? 145.475 151.711  26.796  1.00 120.99 ?  94  ASN A CG  1 
ATOM 601   O OD1 . ASN A  1 86  ? 146.178 151.715  25.785  1.00 119.68 ?  94  ASN A OD1 1 
ATOM 602   N ND2 . ASN A  1 86  ? 144.655 152.711  27.101  1.00 126.86 ?  94  ASN A ND2 1 
ATOM 603   N N   . SER A  1 87  ? 144.804 147.625  28.635  1.00 102.91 ?  95  SER A N   1 
ATOM 604   C CA  . SER A  1 87  ? 144.804 146.538  29.605  1.00 97.93  ?  95  SER A CA  1 
ATOM 605   C C   . SER A  1 87  ? 143.798 145.444  29.265  1.00 91.19  ?  95  SER A C   1 
ATOM 606   O O   . SER A  1 87  ? 143.574 144.550  30.090  1.00 90.37  ?  95  SER A O   1 
ATOM 607   C CB  . SER A  1 87  ? 144.529 147.073  31.016  1.00 95.62  ?  95  SER A CB  1 
ATOM 608   O OG  . SER A  1 87  ? 145.468 148.070  31.379  1.00 97.19  ?  95  SER A OG  1 
ATOM 609   N N   . GLN A  1 88  ? 143.190 145.483  28.082  1.00 92.23  ?  96  GLN A N   1 
ATOM 610   C CA  . GLN A  1 88  ? 142.190 144.503  27.689  1.00 86.87  ?  96  GLN A CA  1 
ATOM 611   C C   . GLN A  1 88  ? 142.496 143.969  26.298  1.00 83.12  ?  96  GLN A C   1 
ATOM 612   O O   . GLN A  1 88  ? 143.012 144.686  25.436  1.00 85.25  ?  96  GLN A O   1 
ATOM 613   C CB  . GLN A  1 88  ? 140.775 145.098  27.704  1.00 88.27  ?  96  GLN A CB  1 
ATOM 614   C CG  . GLN A  1 88  ? 140.259 145.467  29.082  1.00 90.24  ?  96  GLN A CG  1 
ATOM 615   C CD  . GLN A  1 88  ? 138.843 146.005  29.040  1.00 91.76  ?  96  GLN A CD  1 
ATOM 616   O OE1 . GLN A  1 88  ? 138.432 146.622  28.057  1.00 92.78  ?  96  GLN A OE1 1 
ATOM 617   N NE2 . GLN A  1 88  ? 138.087 145.768  30.105  1.00 93.63  ?  96  GLN A NE2 1 
ATOM 618   N N   . ARG A  1 89  ? 142.165 142.697  26.088  1.00 80.92  ?  97  ARG A N   1 
ATOM 619   C CA  . ARG A  1 89  ? 142.300 142.053  24.793  1.00 78.61  ?  97  ARG A CA  1 
ATOM 620   C C   . ARG A  1 89  ? 141.030 141.264  24.504  1.00 76.05  ?  97  ARG A C   1 
ATOM 621   O O   . ARG A  1 89  ? 140.301 140.869  25.418  1.00 75.68  ?  97  ARG A O   1 
ATOM 622   C CB  . ARG A  1 89  ? 143.520 141.123  24.745  1.00 81.80  ?  97  ARG A CB  1 
ATOM 623   C CG  . ARG A  1 89  ? 144.858 141.842  24.803  1.00 86.76  ?  97  ARG A CG  1 
ATOM 624   C CD  . ARG A  1 89  ? 145.090 142.740  23.602  1.00 90.80  ?  97  ARG A CD  1 
ATOM 625   N NE  . ARG A  1 89  ? 146.208 143.651  23.832  1.00 99.97  ?  97  ARG A NE  1 
ATOM 626   C CZ  . ARG A  1 89  ? 146.529 144.662  23.032  1.00 109.10 ?  97  ARG A CZ  1 
ATOM 627   N NH1 . ARG A  1 89  ? 145.814 144.899  21.941  1.00 112.31 1  97  ARG A NH1 1 
ATOM 628   N NH2 . ARG A  1 89  ? 147.564 145.439  23.324  1.00 113.78 ?  97  ARG A NH2 1 
ATOM 629   N N   . LEU A  1 90  ? 140.766 141.044  23.222  1.00 75.55  ?  98  LEU A N   1 
ATOM 630   C CA  . LEU A  1 90  ? 139.532 140.404  22.790  1.00 76.00  ?  98  LEU A CA  1 
ATOM 631   C C   . LEU A  1 90  ? 139.762 138.939  22.439  1.00 75.10  ?  98  LEU A C   1 
ATOM 632   O O   . LEU A  1 90  ? 140.859 138.536  22.043  1.00 76.52  ?  98  LEU A O   1 
ATOM 633   C CB  . LEU A  1 90  ? 138.925 141.134  21.588  1.00 71.97  ?  98  LEU A CB  1 
ATOM 634   C CG  . LEU A  1 90  ? 137.969 142.305  21.840  1.00 73.96  ?  98  LEU A CG  1 
ATOM 635   C CD1 . LEU A  1 90  ? 138.398 143.139  23.029  1.00 76.59  ?  98  LEU A CD1 1 
ATOM 636   C CD2 . LEU A  1 90  ? 137.844 143.168  20.593  1.00 74.84  ?  98  LEU A CD2 1 
ATOM 637   N N   . VAL A  1 91  ? 138.706 138.146  22.593  1.00 66.46  ?  99  VAL A N   1 
ATOM 638   C CA  . VAL A  1 91  ? 138.732 136.731  22.244  1.00 63.94  ?  99  VAL A CA  1 
ATOM 639   C C   . VAL A  1 91  ? 137.301 136.300  21.959  1.00 62.43  ?  99  VAL A C   1 
ATOM 640   O O   . VAL A  1 91  ? 136.359 136.761  22.609  1.00 63.26  ?  99  VAL A O   1 
ATOM 641   C CB  . VAL A  1 91  ? 139.388 135.886  23.363  1.00 69.28  ?  99  VAL A CB  1 
ATOM 642   C CG1 . VAL A  1 91  ? 138.592 135.987  24.658  1.00 69.48  ?  99  VAL A CG1 1 
ATOM 643   C CG2 . VAL A  1 91  ? 139.546 134.437  22.923  1.00 67.07  ?  99  VAL A CG2 1 
ATOM 644   N N   . TRP A  1 92  ? 137.141 135.426  20.970  1.00 66.45  ?  100 TRP A N   1 
ATOM 645   C CA  . TRP A  1 92  ? 135.818 134.947  20.593  1.00 65.46  ?  100 TRP A CA  1 
ATOM 646   C C   . TRP A  1 92  ? 135.363 133.831  21.524  1.00 64.86  ?  100 TRP A C   1 
ATOM 647   O O   . TRP A  1 92  ? 136.161 132.992  21.953  1.00 67.46  ?  100 TRP A O   1 
ATOM 648   C CB  . TRP A  1 92  ? 135.820 134.453  19.147  1.00 61.48  ?  100 TRP A CB  1 
ATOM 649   C CG  . TRP A  1 92  ? 135.964 135.549  18.141  1.00 62.67  ?  100 TRP A CG  1 
ATOM 650   C CD1 . TRP A  1 92  ? 137.018 135.756  17.302  1.00 66.89  ?  100 TRP A CD1 1 
ATOM 651   C CD2 . TRP A  1 92  ? 135.025 136.596  17.872  1.00 63.97  ?  100 TRP A CD2 1 
ATOM 652   N NE1 . TRP A  1 92  ? 136.793 136.865  16.524  1.00 69.03  ?  100 TRP A NE1 1 
ATOM 653   C CE2 . TRP A  1 92  ? 135.575 137.399  16.855  1.00 66.71  ?  100 TRP A CE2 1 
ATOM 654   C CE3 . TRP A  1 92  ? 133.771 136.931  18.392  1.00 64.71  ?  100 TRP A CE3 1 
ATOM 655   C CZ2 . TRP A  1 92  ? 134.916 138.516  16.348  1.00 68.45  ?  100 TRP A CZ2 1 
ATOM 656   C CZ3 . TRP A  1 92  ? 133.119 138.041  17.887  1.00 67.54  ?  100 TRP A CZ3 1 
ATOM 657   C CH2 . TRP A  1 92  ? 133.692 138.819  16.875  1.00 69.41  ?  100 TRP A CH2 1 
ATOM 658   N N   . ALA A  1 93  ? 134.070 133.826  21.835  1.00 64.80  ?  101 ALA A N   1 
ATOM 659   C CA  . ALA A  1 93  ? 133.462 132.794  22.663  1.00 65.97  ?  101 ALA A CA  1 
ATOM 660   C C   . ALA A  1 93  ? 132.298 132.170  21.910  1.00 61.37  ?  101 ALA A C   1 
ATOM 661   O O   . ALA A  1 93  ? 131.406 132.883  21.438  1.00 61.92  ?  101 ALA A O   1 
ATOM 662   C CB  . ALA A  1 93  ? 132.985 133.363  24.001  1.00 68.11  ?  101 ALA A CB  1 
ATOM 663   N N   . CYS A  1 94  ? 132.309 130.844  21.802  1.00 63.69  ?  102 CYS A N   1 
ATOM 664   C CA  . CYS A  1 94  ? 131.276 130.130  21.066  1.00 61.14  ?  102 CYS A CA  1 
ATOM 665   C C   . CYS A  1 94  ? 130.004 130.032  21.898  1.00 62.68  ?  102 CYS A C   1 
ATOM 666   O O   . CYS A  1 94  ? 130.048 129.652  23.072  1.00 63.84  ?  102 CYS A O   1 
ATOM 667   C CB  . CYS A  1 94  ? 131.766 128.736  20.685  1.00 66.05  ?  102 CYS A CB  1 
ATOM 668   S SG  . CYS A  1 94  ? 130.566 127.773  19.751  1.00 67.21  ?  102 CYS A SG  1 
ATOM 669   N N   . VAL A  1 95  ? 128.868 130.373  21.286  1.00 62.50  ?  103 VAL A N   1 
ATOM 670   C CA  . VAL A  1 95  ? 127.575 130.373  21.962  1.00 62.41  ?  103 VAL A CA  1 
ATOM 671   C C   . VAL A  1 95  ? 126.596 129.409  21.298  1.00 63.50  ?  103 VAL A C   1 
ATOM 672   O O   . VAL A  1 95  ? 125.928 128.621  21.978  1.00 66.03  ?  103 VAL A O   1 
ATOM 673   C CB  . VAL A  1 95  ? 126.980 131.797  22.028  1.00 59.48  ?  103 VAL A CB  1 
ATOM 674   C CG1 . VAL A  1 95  ? 125.504 131.745  22.381  1.00 62.96  ?  103 VAL A CG1 1 
ATOM 675   C CG2 . VAL A  1 95  ? 127.745 132.642  23.033  1.00 60.43  ?  103 VAL A CG2 1 
ATOM 676   N N   . GLY A  1 96  ? 126.508 129.444  19.975  1.00 60.22  ?  104 GLY A N   1 
ATOM 677   C CA  . GLY A  1 96  ? 125.573 128.602  19.256  1.00 58.83  ?  104 GLY A CA  1 
ATOM 678   C C   . GLY A  1 96  ? 126.247 127.851  18.128  1.00 58.15  ?  104 GLY A C   1 
ATOM 679   O O   . GLY A  1 96  ? 127.183 128.339  17.499  1.00 63.01  ?  104 GLY A O   1 
ATOM 680   N N   . VAL A  1 97  ? 125.746 126.641  17.880  1.00 52.35  ?  105 VAL A N   1 
ATOM 681   C CA  . VAL A  1 97  ? 126.257 125.766  16.831  1.00 51.68  ?  105 VAL A CA  1 
ATOM 682   C C   . VAL A  1 97  ? 125.084 125.020  16.210  1.00 51.49  ?  105 VAL A C   1 
ATOM 683   O O   . VAL A  1 97  ? 124.240 124.476  16.929  1.00 51.45  ?  105 VAL A O   1 
ATOM 684   C CB  . VAL A  1 97  ? 127.298 124.762  17.367  1.00 55.47  ?  105 VAL A CB  1 
ATOM 685   C CG1 . VAL A  1 97  ? 127.665 123.750  16.295  1.00 54.14  ?  105 VAL A CG1 1 
ATOM 686   C CG2 . VAL A  1 97  ? 128.543 125.481  17.846  1.00 56.10  ?  105 VAL A CG2 1 
ATOM 687   N N   . GLU A  1 98  ? 125.028 125.000  14.878  1.00 53.87  ?  106 GLU A N   1 
ATOM 688   C CA  . GLU A  1 98  ? 124.095 124.154  14.141  1.00 53.35  ?  106 GLU A CA  1 
ATOM 689   C C   . GLU A  1 98  ? 124.851 123.461  13.018  1.00 52.27  ?  106 GLU A C   1 
ATOM 690   O O   . GLU A  1 98  ? 125.401 124.127  12.135  1.00 54.58  ?  106 GLU A O   1 
ATOM 691   C CB  . GLU A  1 98  ? 122.921 124.959  13.578  1.00 54.66  ?  106 GLU A CB  1 
ATOM 692   C CG  . GLU A  1 98  ? 121.848 124.088  12.931  1.00 61.39  ?  106 GLU A CG  1 
ATOM 693   C CD  . GLU A  1 98  ? 120.652 124.884  12.439  1.00 76.85  ?  106 GLU A CD  1 
ATOM 694   O OE1 . GLU A  1 98  ? 120.375 125.964  13.006  1.00 80.43  ?  106 GLU A OE1 1 
ATOM 695   O OE2 . GLU A  1 98  ? 119.990 124.430  11.481  1.00 83.84  -1 106 GLU A OE2 1 
ATOM 696   N N   . ILE A  1 99  ? 124.873 122.133  13.052  1.00 53.51  ?  107 ILE A N   1 
ATOM 697   C CA  . ILE A  1 99  ? 125.563 121.320  12.057  1.00 49.58  ?  107 ILE A CA  1 
ATOM 698   C C   . ILE A  1 99  ? 124.528 120.825  11.057  1.00 49.41  ?  107 ILE A C   1 
ATOM 699   O O   . ILE A  1 99  ? 123.635 120.045  11.406  1.00 48.78  ?  107 ILE A O   1 
ATOM 700   C CB  . ILE A  1 99  ? 126.308 120.146  12.704  1.00 51.04  ?  107 ILE A CB  1 
ATOM 701   C CG1 . ILE A  1 99  ? 127.353 120.656  13.694  1.00 52.13  ?  107 ILE A CG1 1 
ATOM 702   C CG2 . ILE A  1 99  ? 126.953 119.274  11.638  1.00 49.50  ?  107 ILE A CG2 1 
ATOM 703   C CD1 . ILE A  1 99  ? 128.040 119.552  14.446  1.00 53.41  ?  107 ILE A CD1 1 
ATOM 704   N N   . GLY A  1 100 ? 124.650 121.270  9.808   1.00 51.66  ?  108 GLY A N   1 
ATOM 705   C CA  . GLY A  1 100 ? 123.719 120.878  8.768   1.00 52.86  ?  108 GLY A CA  1 
ATOM 706   C C   . GLY A  1 100 ? 124.191 119.629  8.052   1.00 52.68  ?  108 GLY A C   1 
ATOM 707   O O   . GLY A  1 100 ? 125.368 119.508  7.707   1.00 58.52  ?  108 GLY A O   1 
ATOM 708   N N   . ARG A  1 101 ? 123.276 118.682  7.866   1.00 49.25  ?  109 ARG A N   1 
ATOM 709   C CA  . ARG A  1 101 ? 123.523 117.488  7.070   1.00 48.61  ?  109 ARG A CA  1 
ATOM 710   C C   . ARG A  1 101 ? 122.590 117.490  5.867   1.00 49.45  ?  109 ARG A C   1 
ATOM 711   O O   . ARG A  1 101 ? 121.403 117.811  5.992   1.00 50.36  ?  109 ARG A O   1 
ATOM 712   C CB  . ARG A  1 101 ? 123.335 116.215  7.901   1.00 50.74  ?  109 ARG A CB  1 
ATOM 713   C CG  . ARG A  1 101 ? 124.384 116.025  8.985   1.00 49.13  ?  109 ARG A CG  1 
ATOM 714   C CD  . ARG A  1 101 ? 125.764 115.811  8.381   1.00 51.61  ?  109 ARG A CD  1 
ATOM 715   N NE  . ARG A  1 101 ? 126.016 114.403  8.081   1.00 54.98  ?  109 ARG A NE  1 
ATOM 716   C CZ  . ARG A  1 101 ? 126.115 113.903  6.853   1.00 58.34  ?  109 ARG A CZ  1 
ATOM 717   N NH1 . ARG A  1 101 ? 125.977 114.693  5.797   1.00 57.80  1  109 ARG A NH1 1 
ATOM 718   N NH2 . ARG A  1 101 ? 126.346 112.609  6.679   1.00 61.52  ?  109 ARG A NH2 1 
ATOM 719   N N   . GLY A  1 102 ? 123.126 117.127  4.702   1.00 46.81  ?  110 GLY A N   1 
ATOM 720   C CA  . GLY A  1 102 ? 122.417 117.339  3.455   1.00 48.63  ?  110 GLY A CA  1 
ATOM 721   C C   . GLY A  1 102 ? 121.714 116.141  2.851   1.00 48.41  ?  110 GLY A C   1 
ATOM 722   O O   . GLY A  1 102 ? 120.519 116.211  2.549   1.00 59.11  ?  110 GLY A O   1 
ATOM 723   N N   . GLN A  1 103 ? 122.436 115.043  2.655   1.00 45.34  ?  111 GLN A N   1 
ATOM 724   C CA  . GLN A  1 103 ? 121.889 113.915  1.922   1.00 45.46  ?  111 GLN A CA  1 
ATOM 725   C C   . GLN A  1 103 ? 120.751 113.251  2.698   1.00 45.54  ?  111 GLN A C   1 
ATOM 726   O O   . GLN A  1 103 ? 120.613 113.447  3.907   1.00 45.41  ?  111 GLN A O   1 
ATOM 727   C CB  . GLN A  1 103 ? 122.994 112.907  1.621   1.00 48.86  ?  111 GLN A CB  1 
ATOM 728   C CG  . GLN A  1 103 ? 124.100 113.459  0.736   1.00 49.28  ?  111 GLN A CG  1 
ATOM 729   C CD  . GLN A  1 103 ? 123.592 113.885  -0.630  1.00 51.32  ?  111 GLN A CD  1 
ATOM 730   O OE1 . GLN A  1 103 ? 123.528 113.079  -1.557  1.00 54.30  ?  111 GLN A OE1 1 
ATOM 731   N NE2 . GLN A  1 103 ? 123.237 115.158  -0.763  1.00 53.06  ?  111 GLN A NE2 1 
ATOM 732   N N   . PRO A  1 104 ? 119.903 112.482  2.017   1.00 48.06  ?  112 PRO A N   1 
ATOM 733   C CA  . PRO A  1 104 ? 118.823 111.781  2.718   1.00 48.48  ?  112 PRO A CA  1 
ATOM 734   C C   . PRO A  1 104 ? 119.353 110.634  3.567   1.00 47.49  ?  112 PRO A C   1 
ATOM 735   O O   . PRO A  1 104 ? 120.467 110.139  3.380   1.00 46.66  ?  112 PRO A O   1 
ATOM 736   C CB  . PRO A  1 104 ? 117.937 111.262  1.581   1.00 48.71  ?  112 PRO A CB  1 
ATOM 737   C CG  . PRO A  1 104 ? 118.844 111.180  0.405   1.00 48.56  ?  112 PRO A CG  1 
ATOM 738   C CD  . PRO A  1 104 ? 119.785 112.339  0.555   1.00 47.89  ?  112 PRO A CD  1 
ATOM 739   N N   . LEU A  1 105 ? 118.522 110.214  4.517   1.00 42.64  ?  113 LEU A N   1 
ATOM 740   C CA  . LEU A  1 105 ? 118.886 109.109  5.393   1.00 42.46  ?  113 LEU A CA  1 
ATOM 741   C C   . LEU A  1 105 ? 118.902 107.799  4.617   1.00 42.60  ?  113 LEU A C   1 
ATOM 742   O O   . LEU A  1 105 ? 117.986 107.511  3.841   1.00 42.94  ?  113 LEU A O   1 
ATOM 743   C CB  . LEU A  1 105 ? 117.909 109.012  6.562   1.00 44.97  ?  113 LEU A CB  1 
ATOM 744   C CG  . LEU A  1 105 ? 117.823 110.214  7.495   1.00 44.86  ?  113 LEU A CG  1 
ATOM 745   C CD1 . LEU A  1 105 ? 116.909 109.904  8.671   1.00 45.47  ?  113 LEU A CD1 1 
ATOM 746   C CD2 . LEU A  1 105 ? 119.212 110.615  7.971   1.00 43.68  ?  113 LEU A CD2 1 
ATOM 747   N N   . GLY A  1 106 ? 119.944 107.004  4.835   1.00 49.91  ?  114 GLY A N   1 
ATOM 748   C CA  . GLY A  1 106 ? 120.065 105.720  4.175   1.00 53.07  ?  114 GLY A CA  1 
ATOM 749   C C   . GLY A  1 106 ? 121.073 104.855  4.892   1.00 51.71  ?  114 GLY A C   1 
ATOM 750   O O   . GLY A  1 106 ? 121.886 105.339  5.686   1.00 47.72  ?  114 GLY A O   1 
ATOM 751   N N   . VAL A  1 107 ? 121.016 103.560  4.598   1.00 51.79  ?  115 VAL A N   1 
ATOM 752   C CA  . VAL A  1 107 ? 121.941 102.586  5.161   1.00 49.88  ?  115 VAL A CA  1 
ATOM 753   C C   . VAL A  1 107 ? 122.801 102.038  4.034   1.00 54.31  ?  115 VAL A C   1 
ATOM 754   O O   . VAL A  1 107 ? 122.299 101.732  2.946   1.00 57.48  ?  115 VAL A O   1 
ATOM 755   C CB  . VAL A  1 107 ? 121.200 101.451  5.894   1.00 51.36  ?  115 VAL A CB  1 
ATOM 756   C CG1 . VAL A  1 107 ? 122.188 100.590  6.665   1.00 51.40  ?  115 VAL A CG1 1 
ATOM 757   C CG2 . VAL A  1 107 ? 120.144 102.026  6.825   1.00 51.39  ?  115 VAL A CG2 1 
ATOM 758   N N   . GLY A  1 108 ? 124.096 101.918  4.295   1.00 55.28  ?  116 GLY A N   1 
ATOM 759   C CA  . GLY A  1 108 ? 125.033 101.456  3.292   1.00 56.90  ?  116 GLY A CA  1 
ATOM 760   C C   . GLY A  1 108 ? 125.875 100.315  3.820   1.00 60.01  ?  116 GLY A C   1 
ATOM 761   O O   . GLY A  1 108 ? 126.100 100.182  5.023   1.00 66.03  ?  116 GLY A O   1 
ATOM 762   N N   . LEU A  1 109 ? 126.340 99.485   2.893   1.00 54.61  ?  117 LEU A N   1 
ATOM 763   C CA  . LEU A  1 109 ? 127.084 98.285   3.236   1.00 50.60  ?  117 LEU A CA  1 
ATOM 764   C C   . LEU A  1 109 ? 128.583 98.501   3.080   1.00 49.09  ?  117 LEU A C   1 
ATOM 765   O O   . LEU A  1 109 ? 129.037 99.307   2.265   1.00 48.11  ?  117 LEU A O   1 
ATOM 766   C CB  . LEU A  1 109 ? 126.648 97.109   2.364   1.00 46.55  ?  117 LEU A CB  1 
ATOM 767   C CG  . LEU A  1 109 ? 125.159 96.787   2.426   1.00 46.79  ?  117 LEU A CG  1 
ATOM 768   C CD1 . LEU A  1 109 ? 124.837 95.573   1.571   1.00 48.15  ?  117 LEU A CD1 1 
ATOM 769   C CD2 . LEU A  1 109 ? 124.734 96.577   3.867   1.00 47.52  ?  117 LEU A CD2 1 
ATOM 770   N N   . SER A  1 110 ? 129.344 97.768   3.888   1.00 45.50  ?  118 SER A N   1 
ATOM 771   C CA  . SER A  1 110 ? 130.790 97.663   3.758   1.00 46.95  ?  118 SER A CA  1 
ATOM 772   C C   . SER A  1 110 ? 131.152 96.191   3.866   1.00 50.36  ?  118 SER A C   1 
ATOM 773   O O   . SER A  1 110 ? 130.669 95.496   4.766   1.00 55.92  ?  118 SER A O   1 
ATOM 774   C CB  . SER A  1 110 ? 131.510 98.476   4.835   1.00 53.45  ?  118 SER A CB  1 
ATOM 775   O OG  . SER A  1 110 ? 130.999 99.796   4.897   1.00 58.72  ?  118 SER A OG  1 
ATOM 776   N N   . GLY A  1 111 ? 131.987 95.715   2.950   1.00 46.52  ?  119 GLY A N   1 
ATOM 777   C CA  . GLY A  1 111 ? 132.277 94.299   2.916   1.00 47.84  ?  119 GLY A CA  1 
ATOM 778   C C   . GLY A  1 111 ? 133.689 93.932   2.522   1.00 48.60  ?  119 GLY A C   1 
ATOM 779   O O   . GLY A  1 111 ? 134.584 94.782   2.465   1.00 48.15  ?  119 GLY A O   1 
ATOM 780   N N   . HIS A  1 112 ? 133.885 92.649   2.246   1.00 46.93  ?  120 HIS A N   1 
ATOM 781   C CA  . HIS A  1 112 ? 135.164 92.058   1.891   1.00 47.84  ?  120 HIS A CA  1 
ATOM 782   C C   . HIS A  1 112 ? 134.902 90.778   1.109   1.00 50.42  ?  120 HIS A C   1 
ATOM 783   O O   . HIS A  1 112 ? 134.116 89.926   1.550   1.00 56.44  ?  120 HIS A O   1 
ATOM 784   C CB  . HIS A  1 112 ? 135.995 91.772   3.143   1.00 48.56  ?  120 HIS A CB  1 
ATOM 785   C CG  . HIS A  1 112 ? 137.463 91.649   2.880   1.00 50.30  ?  120 HIS A CG  1 
ATOM 786   N ND1 . HIS A  1 112 ? 137.987 90.734   1.993   1.00 53.04  ?  120 HIS A ND1 1 
ATOM 787   C CD2 . HIS A  1 112 ? 138.520 92.318   3.398   1.00 51.06  ?  120 HIS A CD2 1 
ATOM 788   C CE1 . HIS A  1 112 ? 139.303 90.849   1.970   1.00 54.49  ?  120 HIS A CE1 1 
ATOM 789   N NE2 . HIS A  1 112 ? 139.652 91.804   2.814   1.00 52.84  ?  120 HIS A NE2 1 
ATOM 790   N N   . PRO A  1 113 ? 135.518 90.618   -0.065  1.00 48.70  ?  121 PRO A N   1 
ATOM 791   C CA  . PRO A  1 113 ? 135.325 89.371   -0.819  1.00 49.32  ?  121 PRO A CA  1 
ATOM 792   C C   . PRO A  1 113 ? 135.936 88.165   -0.133  1.00 49.90  ?  121 PRO A C   1 
ATOM 793   O O   . PRO A  1 113 ? 135.432 87.048   -0.298  1.00 50.48  ?  121 PRO A O   1 
ATOM 794   C CB  . PRO A  1 113 ? 136.004 89.663   -2.165  1.00 49.36  ?  121 PRO A CB  1 
ATOM 795   C CG  . PRO A  1 113 ? 136.097 91.157   -2.237  1.00 47.56  ?  121 PRO A CG  1 
ATOM 796   C CD  . PRO A  1 113 ? 136.290 91.610   -0.827  1.00 46.86  ?  121 PRO A CD  1 
ATOM 797   N N   . LEU A  1 114 ? 137.011 88.354   0.630   1.00 52.85  ?  122 LEU A N   1 
ATOM 798   C CA  . LEU A  1 114 ? 137.657 87.249   1.325   1.00 55.85  ?  122 LEU A CA  1 
ATOM 799   C C   . LEU A  1 114 ? 137.548 87.430   2.834   1.00 55.40  ?  122 LEU A C   1 
ATOM 800   O O   . LEU A  1 114 ? 138.563 87.499   3.534   1.00 56.55  ?  122 LEU A O   1 
ATOM 801   C CB  . LEU A  1 114 ? 139.120 87.135   0.896   1.00 53.81  ?  122 LEU A CB  1 
ATOM 802   C CG  . LEU A  1 114 ? 139.355 87.086   -0.616  1.00 53.89  ?  122 LEU A CG  1 
ATOM 803   C CD1 . LEU A  1 114 ? 140.836 86.943   -0.930  1.00 54.83  ?  122 LEU A CD1 1 
ATOM 804   C CD2 . LEU A  1 114 ? 138.559 85.956   -1.252  1.00 55.35  ?  122 LEU A CD2 1 
ATOM 805   N N   . TYR A  1 115 ? 136.319 87.517   3.337   1.00 49.70  ?  123 TYR A N   1 
ATOM 806   C CA  . TYR A  1 115 ? 136.074 87.651   4.766   1.00 49.64  ?  123 TYR A CA  1 
ATOM 807   C C   . TYR A  1 115 ? 136.283 86.313   5.463   1.00 50.42  ?  123 TYR A C   1 
ATOM 808   O O   . TYR A  1 115 ? 135.918 85.257   4.936   1.00 50.97  ?  123 TYR A O   1 
ATOM 809   C CB  . TYR A  1 115 ? 134.652 88.160   5.008   1.00 49.88  ?  123 TYR A CB  1 
ATOM 810   C CG  . TYR A  1 115 ? 134.326 88.536   6.441   1.00 49.45  ?  123 TYR A CG  1 
ATOM 811   C CD1 . TYR A  1 115 ? 134.405 89.856   6.869   1.00 47.70  ?  123 TYR A CD1 1 
ATOM 812   C CD2 . TYR A  1 115 ? 133.913 87.576   7.357   1.00 50.95  ?  123 TYR A CD2 1 
ATOM 813   C CE1 . TYR A  1 115 ? 134.098 90.206   8.172   1.00 47.44  ?  123 TYR A CE1 1 
ATOM 814   C CE2 . TYR A  1 115 ? 133.606 87.917   8.660   1.00 50.72  ?  123 TYR A CE2 1 
ATOM 815   C CZ  . TYR A  1 115 ? 133.698 89.234   9.064   1.00 48.95  ?  123 TYR A CZ  1 
ATOM 816   O OH  . TYR A  1 115 ? 133.390 89.575   10.365  1.00 48.85  ?  123 TYR A OH  1 
ATOM 817   N N   . ASN A  1 116 ? 136.880 86.361   6.655   1.00 52.83  ?  124 ASN A N   1 
ATOM 818   C CA  . ASN A  1 116 ? 137.197 85.154   7.419   1.00 56.33  ?  124 ASN A CA  1 
ATOM 819   C C   . ASN A  1 116 ? 135.939 84.680   8.142   1.00 58.31  ?  124 ASN A C   1 
ATOM 820   O O   . ASN A  1 116 ? 135.710 84.951   9.324   1.00 55.75  ?  124 ASN A O   1 
ATOM 821   C CB  . ASN A  1 116 ? 138.337 85.412   8.395   1.00 55.17  ?  124 ASN A CB  1 
ATOM 822   C CG  . ASN A  1 116 ? 138.731 84.169   9.169   1.00 57.82  ?  124 ASN A CG  1 
ATOM 823   O OD1 . ASN A  1 116 ? 138.421 83.047   8.766   1.00 59.51  ?  124 ASN A OD1 1 
ATOM 824   N ND2 . ASN A  1 116 ? 139.415 84.363   10.291  1.00 59.74  ?  124 ASN A ND2 1 
ATOM 825   N N   . LYS A  1 117 ? 135.106 83.956   7.399   1.00 61.16  ?  125 LYS A N   1 
ATOM 826   C CA  . LYS A  1 117 ? 133.877 83.363   7.915   1.00 60.78  ?  125 LYS A CA  1 
ATOM 827   C C   . LYS A  1 117 ? 133.978 81.853   7.738   1.00 65.58  ?  125 LYS A C   1 
ATOM 828   O O   . LYS A  1 117 ? 133.922 81.351   6.610   1.00 68.37  ?  125 LYS A O   1 
ATOM 829   C CB  . LYS A  1 117 ? 132.657 83.929   7.191   1.00 57.43  ?  125 LYS A CB  1 
ATOM 830   C CG  . LYS A  1 117 ? 131.357 83.195   7.460   1.00 57.11  ?  125 LYS A CG  1 
ATOM 831   C CD  . LYS A  1 117 ? 130.253 83.728   6.565   1.00 55.03  ?  125 LYS A CD  1 
ATOM 832   C CE  . LYS A  1 117 ? 129.244 82.646   6.230   1.00 59.95  ?  125 LYS A CE  1 
ATOM 833   N NZ  . LYS A  1 117 ? 128.395 83.031   5.068   1.00 62.36  1  125 LYS A NZ  1 
ATOM 834   N N   . LEU A  1 118 ? 134.127 81.132   8.849   1.00 65.12  ?  126 LEU A N   1 
ATOM 835   C CA  . LEU A  1 118 ? 134.255 79.669   8.805   1.00 67.82  ?  126 LEU A CA  1 
ATOM 836   C C   . LEU A  1 118 ? 132.882 79.005   8.835   1.00 70.99  ?  126 LEU A C   1 
ATOM 837   O O   . LEU A  1 118 ? 132.407 78.495   7.816   1.00 77.53  ?  126 LEU A O   1 
ATOM 838   C CB  . LEU A  1 118 ? 135.134 79.174   9.955   1.00 65.94  ?  126 LEU A CB  1 
ATOM 839   C CG  . LEU A  1 118 ? 135.301 77.655   10.016  1.00 71.13  ?  126 LEU A CG  1 
ATOM 840   C CD1 . LEU A  1 118 ? 135.910 77.137   8.725   1.00 71.76  ?  126 LEU A CD1 1 
ATOM 841   C CD2 . LEU A  1 118 ? 136.147 77.252   11.211  1.00 79.74  ?  126 LEU A CD2 1 
ATOM 842   N N   . ASP A  1 119 ? 132.239 79.001   10.002  1.00 63.02  ?  127 ASP A N   1 
ATOM 843   C CA  . ASP A  1 119 ? 130.961 78.333   10.192  1.00 64.34  ?  127 ASP A CA  1 
ATOM 844   C C   . ASP A  1 119 ? 129.943 79.303   10.771  1.00 62.50  ?  127 ASP A C   1 
ATOM 845   O O   . ASP A  1 119 ? 130.286 80.213   11.530  1.00 61.03  ?  127 ASP A O   1 
ATOM 846   C CB  . ASP A  1 119 ? 131.087 77.125   11.133  1.00 74.54  ?  127 ASP A CB  1 
ATOM 847   C CG  . ASP A  1 119 ? 131.770 75.942   10.483  1.00 84.38  ?  127 ASP A CG  1 
ATOM 848   O OD1 . ASP A  1 119 ? 131.732 75.841   9.239   1.00 89.18  ?  127 ASP A OD1 1 
ATOM 849   O OD2 . ASP A  1 119 ? 132.340 75.110   11.220  1.00 88.39  -1 127 ASP A OD2 1 
ATOM 850   N N   . ASP A  1 120 ? 128.683 79.100   10.390  1.00 66.68  ?  128 ASP A N   1 
ATOM 851   C CA  . ASP A  1 120 ? 127.565 79.805   11.004  1.00 64.25  ?  128 ASP A CA  1 
ATOM 852   C C   . ASP A  1 120 ? 127.229 79.126   12.328  1.00 64.17  ?  128 ASP A C   1 
ATOM 853   O O   . ASP A  1 120 ? 126.859 77.948   12.349  1.00 66.70  ?  128 ASP A O   1 
ATOM 854   C CB  . ASP A  1 120 ? 126.364 79.811   10.057  1.00 71.51  ?  128 ASP A CB  1 
ATOM 855   C CG  . ASP A  1 120 ? 125.201 80.648   10.574  1.00 70.25  ?  128 ASP A CG  1 
ATOM 856   O OD1 . ASP A  1 120 ? 124.806 80.493   11.748  1.00 73.32  ?  128 ASP A OD1 1 
ATOM 857   O OD2 . ASP A  1 120 ? 124.672 81.465   9.790   1.00 68.02  -1 128 ASP A OD2 1 
ATOM 858   N N   . THR A  1 121 ? 127.362 79.861   13.431  1.00 59.93  ?  129 THR A N   1 
ATOM 859   C CA  . THR A  1 121 ? 127.122 79.325   14.764  1.00 61.89  ?  129 THR A CA  1 
ATOM 860   C C   . THR A  1 121 ? 125.780 79.757   15.346  1.00 61.56  ?  129 THR A C   1 
ATOM 861   O O   . THR A  1 121 ? 125.523 79.519   16.531  1.00 62.95  ?  129 THR A O   1 
ATOM 862   C CB  . THR A  1 121 ? 128.255 79.742   15.705  1.00 58.13  ?  129 THR A CB  1 
ATOM 863   O OG1 . THR A  1 121 ? 128.344 81.172   15.743  1.00 55.28  ?  129 THR A OG1 1 
ATOM 864   C CG2 . THR A  1 121 ? 129.582 79.172   15.222  1.00 59.01  ?  129 THR A CG2 1 
ATOM 865   N N   . GLU A  1 122 ? 124.924 80.373   14.541  1.00 64.42  ?  130 GLU A N   1 
ATOM 866   C CA  . GLU A  1 122 ? 123.633 80.904   14.983  1.00 63.82  ?  130 GLU A CA  1 
ATOM 867   C C   . GLU A  1 122 ? 122.492 79.983   14.557  1.00 71.72  ?  130 GLU A C   1 
ATOM 868   O O   . GLU A  1 122 ? 121.537 80.412   13.903  1.00 79.31  ?  130 GLU A O   1 
ATOM 869   C CB  . GLU A  1 122 ? 123.431 82.322   14.457  1.00 62.64  ?  130 GLU A CB  1 
ATOM 870   C CG  . GLU A  1 122 ? 122.217 83.040   15.044  1.00 62.63  ?  130 GLU A CG  1 
ATOM 871   C CD  . GLU A  1 122 ? 121.737 84.188   14.184  1.00 57.98  ?  130 GLU A CD  1 
ATOM 872   O OE1 . GLU A  1 122 ? 120.844 84.928   14.643  1.00 57.35  ?  130 GLU A OE1 1 
ATOM 873   O OE2 . GLU A  1 122 ? 122.241 84.347   13.050  1.00 59.62  -1 130 GLU A OE2 1 
ATOM 874   N N   . ASN A  1 123 ? 122.651 78.684   14.827  1.00 69.36  ?  131 ASN A N   1 
ATOM 875   C CA  . ASN A  1 123 ? 121.622 77.670   14.601  1.00 75.85  ?  131 ASN A CA  1 
ATOM 876   C C   . ASN A  1 123 ? 121.590 77.292   13.123  1.00 80.59  ?  131 ASN A C   1 
ATOM 877   O O   . ASN A  1 123 ? 120.540 77.334   12.475  1.00 84.06  ?  131 ASN A O   1 
ATOM 878   C CB  . ASN A  1 123 ? 120.249 78.149   15.105  1.00 66.01  ?  131 ASN A CB  1 
ATOM 879   C CG  . ASN A  1 123 ? 119.150 77.109   14.925  1.00 70.78  ?  131 ASN A CG  1 
ATOM 880   O OD1 . ASN A  1 123 ? 119.339 75.923   15.190  1.00 78.67  ?  131 ASN A OD1 1 
ATOM 881   N ND2 . ASN A  1 123 ? 117.991 77.561   14.444  1.00 68.14  ?  131 ASN A ND2 1 
ATOM 882   N N   . SER A  1 124 ? 122.760 76.972   12.577  1.00 88.61  ?  132 SER A N   1 
ATOM 883   C CA  . SER A  1 124 ? 122.902 76.559   11.186  1.00 89.99  ?  132 SER A CA  1 
ATOM 884   C C   . SER A  1 124 ? 122.706 75.051   11.080  1.00 99.05  ?  132 SER A C   1 
ATOM 885   O O   . SER A  1 124 ? 123.462 74.280   11.680  1.00 100.34 ?  132 SER A O   1 
ATOM 886   C CB  . SER A  1 124 ? 124.271 76.958   10.636  1.00 97.03  ?  132 SER A CB  1 
ATOM 887   O OG  . SER A  1 124 ? 124.380 76.657   9.254   1.00 92.71  ?  132 SER A OG  1 
ATOM 888   N N   . HIS A  1 125 ? 121.693 74.631   10.322  1.00 105.15 ?  133 HIS A N   1 
ATOM 889   C CA  . HIS A  1 125 ? 121.505 73.224   9.989   1.00 121.59 ?  133 HIS A CA  1 
ATOM 890   C C   . HIS A  1 125 ? 121.766 72.952   8.511   1.00 130.90 ?  133 HIS A C   1 
ATOM 891   O O   . HIS A  1 125 ? 121.376 71.899   7.993   1.00 139.34 ?  133 HIS A O   1 
ATOM 892   C CB  . HIS A  1 125 ? 120.106 72.755   10.391  1.00 127.15 ?  133 HIS A CB  1 
ATOM 893   C CG  . HIS A  1 125 ? 119.958 71.263   10.432  1.00 138.92 ?  133 HIS A CG  1 
ATOM 894   N ND1 . HIS A  1 125 ? 121.001 70.420   10.748  1.00 142.57 ?  133 HIS A ND1 1 
ATOM 895   C CD2 . HIS A  1 125 ? 118.888 70.466   10.198  1.00 143.70 ?  133 HIS A CD2 1 
ATOM 896   C CE1 . HIS A  1 125 ? 120.582 69.167   10.705  1.00 148.12 ?  133 HIS A CE1 1 
ATOM 897   N NE2 . HIS A  1 125 ? 119.303 69.168   10.373  1.00 148.73 ?  133 HIS A NE2 1 
ATOM 898   N N   . VAL A  1 126 ? 122.421 73.885   7.820   1.00 134.87 ?  134 VAL A N   1 
ATOM 899   C CA  . VAL A  1 126 ? 122.693 73.711   6.397   1.00 135.39 ?  134 VAL A CA  1 
ATOM 900   C C   . VAL A  1 126 ? 123.763 72.646   6.193   1.00 138.93 ?  134 VAL A C   1 
ATOM 901   O O   . VAL A  1 126 ? 123.511 71.591   5.600   1.00 144.37 ?  134 VAL A O   1 
ATOM 902   C CB  . VAL A  1 126 ? 123.105 75.051   5.762   1.00 141.06 ?  134 VAL A CB  1 
ATOM 903   C CG1 . VAL A  1 126 ? 123.231 74.914   4.252   1.00 140.82 ?  134 VAL A CG1 1 
ATOM 904   C CG2 . VAL A  1 126 ? 122.107 76.143   6.127   1.00 141.16 ?  134 VAL A CG2 1 
ATOM 905   N N   . ALA A  1 127 ? 124.964 72.898   6.698   1.00 137.48 ?  135 ALA A N   1 
ATOM 906   C CA  . ALA A  1 127 ? 126.094 71.982   6.566   1.00 133.86 ?  135 ALA A CA  1 
ATOM 907   C C   . ALA A  1 127 ? 127.192 72.460   7.509   1.00 128.48 ?  135 ALA A C   1 
ATOM 908   O O   . ALA A  1 127 ? 126.982 73.365   8.326   1.00 126.23 ?  135 ALA A O   1 
ATOM 909   C CB  . ALA A  1 127 ? 126.581 71.900   5.117   1.00 141.98 ?  135 ALA A CB  1 
ATOM 910   N N   . SER A  1 128 ? 128.367 71.844   7.401   1.00 121.60 ?  136 SER A N   1 
ATOM 911   C CA  . SER A  1 128 ? 129.543 72.249   8.155   1.00 115.17 ?  136 SER A CA  1 
ATOM 912   C C   . SER A  1 128 ? 130.736 72.297   7.212   1.00 113.03 ?  136 SER A C   1 
ATOM 913   O O   . SER A  1 128 ? 130.934 71.387   6.401   1.00 117.17 ?  136 SER A O   1 
ATOM 914   C CB  . SER A  1 128 ? 129.824 71.287   9.316   1.00 117.90 ?  136 SER A CB  1 
ATOM 915   O OG  . SER A  1 128 ? 131.008 71.651   10.003  1.00 119.38 ?  136 SER A OG  1 
ATOM 916   N N   . ALA A  1 129 ? 131.525 73.362   7.322   1.00 110.46 ?  137 ALA A N   1 
ATOM 917   C CA  . ALA A  1 129 ? 132.621 73.607   6.394   1.00 109.81 ?  137 ALA A CA  1 
ATOM 918   C C   . ALA A  1 129 ? 133.916 72.979   6.891   1.00 117.77 ?  137 ALA A C   1 
ATOM 919   O O   . ALA A  1 129 ? 134.184 72.939   8.096   1.00 118.21 ?  137 ALA A O   1 
ATOM 920   C CB  . ALA A  1 129 ? 132.819 75.109   6.184   1.00 98.65  ?  137 ALA A CB  1 
ATOM 921   N N   . VAL A  1 130 ? 134.715 72.485   5.950   1.00 118.01 ?  138 VAL A N   1 
ATOM 922   C CA  . VAL A  1 130 ? 136.032 71.941   6.257   1.00 125.44 ?  138 VAL A CA  1 
ATOM 923   C C   . VAL A  1 130 ? 137.039 73.083   6.294   1.00 124.82 ?  138 VAL A C   1 
ATOM 924   O O   . VAL A  1 130 ? 136.997 73.996   5.461   1.00 123.02 ?  138 VAL A O   1 
ATOM 925   C CB  . VAL A  1 130 ? 136.428 70.870   5.226   1.00 127.08 ?  138 VAL A CB  1 
ATOM 926   C CG1 . VAL A  1 130 ? 137.804 70.297   5.542   1.00 128.61 ?  138 VAL A CG1 1 
ATOM 927   C CG2 . VAL A  1 130 ? 135.381 69.766   5.183   1.00 131.60 ?  138 VAL A CG2 1 
ATOM 928   N N   . ASP A  1 131 ? 137.957 73.033   7.260   1.00 123.51 ?  139 ASP A N   1 
ATOM 929   C CA  . ASP A  1 131 ? 138.888 74.134   7.471   1.00 125.86 ?  139 ASP A CA  1 
ATOM 930   C C   . ASP A  1 131 ? 140.074 74.094   6.514   1.00 128.35 ?  139 ASP A C   1 
ATOM 931   O O   . ASP A  1 131 ? 140.763 75.108   6.362   1.00 129.07 ?  139 ASP A O   1 
ATOM 932   C CB  . ASP A  1 131 ? 139.385 74.127   8.922   1.00 120.93 ?  139 ASP A CB  1 
ATOM 933   C CG  . ASP A  1 131 ? 140.310 75.293   9.234   1.00 119.51 ?  139 ASP A CG  1 
ATOM 934   O OD1 . ASP A  1 131 ? 139.804 76.412   9.468   1.00 112.91 ?  139 ASP A OD1 1 
ATOM 935   O OD2 . ASP A  1 131 ? 141.542 75.088   9.244   1.00 123.50 -1 139 ASP A OD2 1 
ATOM 936   N N   . THR A  1 132 ? 140.315 72.953   5.863   1.00 131.36 ?  140 THR A N   1 
ATOM 937   C CA  . THR A  1 132 ? 141.521 72.774   5.057   1.00 133.52 ?  140 THR A CA  1 
ATOM 938   C C   . THR A  1 132 ? 141.631 73.831   3.963   1.00 127.83 ?  140 THR A C   1 
ATOM 939   O O   . THR A  1 132 ? 142.604 74.591   3.910   1.00 128.64 ?  140 THR A O   1 
ATOM 940   C CB  . THR A  1 132 ? 141.540 71.369   4.449   1.00 141.63 ?  140 THR A CB  1 
ATOM 941   O OG1 . THR A  1 132 ? 141.554 70.392   5.497   1.00 149.54 ?  140 THR A OG1 1 
ATOM 942   C CG2 . THR A  1 132 ? 142.774 71.186   3.573   1.00 141.54 ?  140 THR A CG2 1 
ATOM 943   N N   . LYS A  1 133 ? 140.639 73.896   3.078   1.00 128.43 ?  141 LYS A N   1 
ATOM 944   C CA  . LYS A  1 133 ? 140.738 74.728   1.886   1.00 119.60 ?  141 LYS A CA  1 
ATOM 945   C C   . LYS A  1 133 ? 140.534 76.197   2.264   1.00 109.46 ?  141 LYS A C   1 
ATOM 946   O O   . LYS A  1 133 ? 140.412 76.553   3.439   1.00 106.17 ?  141 LYS A O   1 
ATOM 947   C CB  . LYS A  1 133 ? 139.725 74.264   0.841   1.00 119.04 ?  141 LYS A CB  1 
ATOM 948   C CG  . LYS A  1 133 ? 139.689 72.754   0.627   1.00 116.72 ?  141 LYS A CG  1 
ATOM 949   C CD  . LYS A  1 133 ? 141.032 72.199   0.183   1.00 112.35 ?  141 LYS A CD  1 
ATOM 950   C CE  . LYS A  1 133 ? 141.413 72.699   -1.198  1.00 107.36 ?  141 LYS A CE  1 
ATOM 951   N NZ  . LYS A  1 133 ? 142.686 72.087   -1.669  1.00 111.08 1  141 LYS A NZ  1 
ATOM 952   N N   . ASP A  1 134 ? 140.497 77.075   1.262   1.00 99.78  ?  142 ASP A N   1 
ATOM 953   C CA  . ASP A  1 134 ? 140.307 78.508   1.491   1.00 93.30  ?  142 ASP A CA  1 
ATOM 954   C C   . ASP A  1 134 ? 138.837 78.746   1.806   1.00 87.67  ?  142 ASP A C   1 
ATOM 955   O O   . ASP A  1 134 ? 138.013 78.967   0.917   1.00 86.97  ?  142 ASP A O   1 
ATOM 956   C CB  . ASP A  1 134 ? 140.765 79.317   0.284   1.00 93.95  ?  142 ASP A CB  1 
ATOM 957   C CG  . ASP A  1 134 ? 140.593 80.814   0.483   1.00 86.95  ?  142 ASP A CG  1 
ATOM 958   O OD1 . ASP A  1 134 ? 140.586 81.265   1.648   1.00 84.06  ?  142 ASP A OD1 1 
ATOM 959   O OD2 . ASP A  1 134 ? 140.470 81.540   -0.527  1.00 82.71  -1 142 ASP A OD2 1 
ATOM 960   N N   . THR A  1 135 ? 138.503 78.692   3.093   1.00 78.83  ?  143 THR A N   1 
ATOM 961   C CA  . THR A  1 135 ? 137.124 78.871   3.547   1.00 77.94  ?  143 THR A CA  1 
ATOM 962   C C   . THR A  1 135 ? 136.853 80.330   3.923   1.00 74.96  ?  143 THR A C   1 
ATOM 963   O O   . THR A  1 135 ? 136.529 80.668   5.061   1.00 74.36  ?  143 THR A O   1 
ATOM 964   C CB  . THR A  1 135 ? 136.831 77.929   4.711   1.00 86.32  ?  143 THR A CB  1 
ATOM 965   O OG1 . THR A  1 135 ? 135.624 78.337   5.369   1.00 91.29  ?  143 THR A OG1 1 
ATOM 966   C CG2 . THR A  1 135 ? 137.990 77.923   5.704   1.00 80.56  ?  143 THR A CG2 1 
ATOM 967   N N   . ARG A  1 136 ? 136.989 81.206   2.930   1.00 71.30  ?  144 ARG A N   1 
ATOM 968   C CA  . ARG A  1 136 ? 136.736 82.631   3.098   1.00 69.26  ?  144 ARG A CA  1 
ATOM 969   C C   . ARG A  1 136 ? 135.619 83.038   2.149   1.00 66.91  ?  144 ARG A C   1 
ATOM 970   O O   . ARG A  1 136 ? 135.759 82.907   0.928   1.00 64.05  ?  144 ARG A O   1 
ATOM 971   C CB  . ARG A  1 136 ? 137.998 83.458   2.847   1.00 63.65  ?  144 ARG A CB  1 
ATOM 972   C CG  . ARG A  1 136 ? 139.006 83.395   3.985   1.00 63.22  ?  144 ARG A CG  1 
ATOM 973   C CD  . ARG A  1 136 ? 140.126 84.402   3.795   1.00 60.36  ?  144 ARG A CD  1 
ATOM 974   N NE  . ARG A  1 136 ? 140.846 84.192   2.544   1.00 62.42  ?  144 ARG A NE  1 
ATOM 975   C CZ  . ARG A  1 136 ? 141.940 84.859   2.194   1.00 63.60  ?  144 ARG A CZ  1 
ATOM 976   N NH1 . ARG A  1 136 ? 142.443 85.780   3.005   1.00 63.18  1  144 ARG A NH1 1 
ATOM 977   N NH2 . ARG A  1 136 ? 142.534 84.602   1.035   1.00 61.31  ?  144 ARG A NH2 1 
ATOM 978   N N   . ASP A  1 137 ? 134.519 83.530   2.709   1.00 68.24  ?  145 ASP A N   1 
ATOM 979   C CA  . ASP A  1 137 ? 133.332 83.889   1.949   1.00 69.56  ?  145 ASP A CA  1 
ATOM 980   C C   . ASP A  1 137 ? 133.292 85.390   1.679   1.00 60.79  ?  145 ASP A C   1 
ATOM 981   O O   . ASP A  1 137 ? 133.916 86.190   2.379   1.00 56.46  ?  145 ASP A O   1 
ATOM 982   C CB  . ASP A  1 137 ? 132.067 83.453   2.697   1.00 74.01  ?  145 ASP A CB  1 
ATOM 983   C CG  . ASP A  1 137 ? 130.958 83.008   1.762   1.00 84.54  ?  145 ASP A CG  1 
ATOM 984   O OD1 . ASP A  1 137 ? 131.271 82.571   0.634   1.00 89.99  ?  145 ASP A OD1 1 
ATOM 985   O OD2 . ASP A  1 137 ? 129.774 83.091   2.156   1.00 86.32  -1 145 ASP A OD2 1 
ATOM 986   N N   . ASN A  1 138 ? 132.544 85.760   0.640   1.00 63.35  ?  146 ASN A N   1 
ATOM 987   C CA  . ASN A  1 138 ? 132.315 87.161   0.302   1.00 56.87  ?  146 ASN A CA  1 
ATOM 988   C C   . ASN A  1 138 ? 131.209 87.691   1.204   1.00 54.91  ?  146 ASN A C   1 
ATOM 989   O O   . ASN A  1 138 ? 130.042 87.317   1.049   1.00 57.63  ?  146 ASN A O   1 
ATOM 990   C CB  . ASN A  1 138 ? 131.941 87.303   -1.172  1.00 57.09  ?  146 ASN A CB  1 
ATOM 991   C CG  . ASN A  1 138 ? 131.963 88.746   -1.650  1.00 54.09  ?  146 ASN A CG  1 
ATOM 992   O OD1 . ASN A  1 138 ? 131.784 89.677   -0.868  1.00 51.88  ?  146 ASN A OD1 1 
ATOM 993   N ND2 . ASN A  1 138 ? 132.180 88.934   -2.947  1.00 54.48  ?  146 ASN A ND2 1 
ATOM 994   N N   . VAL A  1 139 ? 131.569 88.560   2.146   1.00 52.39  ?  147 VAL A N   1 
ATOM 995   C CA  . VAL A  1 139 ? 130.665 88.979   3.211   1.00 51.73  ?  147 VAL A CA  1 
ATOM 996   C C   . VAL A  1 139 ? 130.586 90.497   3.233   1.00 49.74  ?  147 VAL A C   1 
ATOM 997   O O   . VAL A  1 139 ? 131.616 91.176   3.184   1.00 51.16  ?  147 VAL A O   1 
ATOM 998   C CB  . VAL A  1 139 ? 131.124 88.445   4.582   1.00 47.91  ?  147 VAL A CB  1 
ATOM 999   C CG1 . VAL A  1 139 ? 130.521 89.261   5.713   1.00 47.51  ?  147 VAL A CG1 1 
ATOM 1000  C CG2 . VAL A  1 139 ? 130.760 86.976   4.729   1.00 48.68  ?  147 VAL A CG2 1 
ATOM 1001  N N   . SER A  1 140 ? 129.368 91.027   3.305   1.00 49.77  ?  148 SER A N   1 
ATOM 1002  C CA  . SER A  1 140 ? 129.133 92.445   3.536   1.00 48.11  ?  148 SER A CA  1 
ATOM 1003  C C   . SER A  1 140 ? 128.370 92.612   4.844   1.00 47.94  ?  148 SER A C   1 
ATOM 1004  O O   . SER A  1 140 ? 127.832 91.653   5.403   1.00 49.15  ?  148 SER A O   1 
ATOM 1005  C CB  . SER A  1 140 ? 128.362 93.087   2.375   1.00 52.53  ?  148 SER A CB  1 
ATOM 1006  O OG  . SER A  1 140 ? 127.009 92.674   2.365   1.00 52.47  ?  148 SER A OG  1 
ATOM 1007  N N   . VAL A  1 141 ? 128.332 93.848   5.340   1.00 47.67  ?  149 VAL A N   1 
ATOM 1008  C CA  . VAL A  1 141 ? 127.718 94.123   6.633   1.00 47.58  ?  149 VAL A CA  1 
ATOM 1009  C C   . VAL A  1 141 ? 127.396 95.606   6.710   1.00 47.06  ?  149 VAL A C   1 
ATOM 1010  O O   . VAL A  1 141 ? 128.098 96.439   6.131   1.00 46.75  ?  149 VAL A O   1 
ATOM 1011  C CB  . VAL A  1 141 ? 128.645 93.673   7.793   1.00 49.15  ?  149 VAL A CB  1 
ATOM 1012  C CG1 . VAL A  1 141 ? 129.855 94.587   7.909   1.00 48.07  ?  149 VAL A CG1 1 
ATOM 1013  C CG2 . VAL A  1 141 ? 127.881 93.625   9.100   1.00 53.22  ?  149 VAL A CG2 1 
ATOM 1014  N N   . ASP A  1 142 ? 126.310 95.933   7.407   1.00 50.08  ?  150 ASP A N   1 
ATOM 1015  C CA  . ASP A  1 142 ? 125.996 97.315   7.743   1.00 50.95  ?  150 ASP A CA  1 
ATOM 1016  C C   . ASP A  1 142 ? 126.542 97.610   9.134   1.00 53.07  ?  150 ASP A C   1 
ATOM 1017  O O   . ASP A  1 142 ? 126.258 96.881   10.090  1.00 62.78  ?  150 ASP A O   1 
ATOM 1018  C CB  . ASP A  1 142 ? 124.488 97.575   7.672   1.00 52.99  ?  150 ASP A CB  1 
ATOM 1019  C CG  . ASP A  1 142 ? 123.705 96.827   8.740   1.00 61.48  ?  150 ASP A CG  1 
ATOM 1020  O OD1 . ASP A  1 142 ? 123.969 95.620   8.937   1.00 65.59  ?  150 ASP A OD1 1 
ATOM 1021  O OD2 . ASP A  1 142 ? 122.826 97.444   9.382   1.00 62.53  -1 150 ASP A OD2 1 
ATOM 1022  N N   . TYR A  1 143 ? 127.346 98.662   9.241   1.00 48.08  ?  151 TYR A N   1 
ATOM 1023  C CA  . TYR A  1 143 ? 128.076 98.896   10.474  1.00 48.00  ?  151 TYR A CA  1 
ATOM 1024  C C   . TYR A  1 143 ? 127.149 99.381   11.586  1.00 48.09  ?  151 TYR A C   1 
ATOM 1025  O O   . TYR A  1 143 ? 125.956 99.635   11.391  1.00 48.13  ?  151 TYR A O   1 
ATOM 1026  C CB  . TYR A  1 143 ? 129.192 99.917   10.260  1.00 50.51  ?  151 TYR A CB  1 
ATOM 1027  C CG  . TYR A  1 143 ? 130.446 99.389   9.603   1.00 48.99  ?  151 TYR A CG  1 
ATOM 1028  C CD1 . TYR A  1 143 ? 130.889 98.096   9.839   1.00 50.88  ?  151 TYR A CD1 1 
ATOM 1029  C CD2 . TYR A  1 143 ? 131.205 100.200  8.772   1.00 49.42  ?  151 TYR A CD2 1 
ATOM 1030  C CE1 . TYR A  1 143 ? 132.046 97.622   9.249   1.00 51.80  ?  151 TYR A CE1 1 
ATOM 1031  C CE2 . TYR A  1 143 ? 132.361 99.737   8.179   1.00 49.68  ?  151 TYR A CE2 1 
ATOM 1032  C CZ  . TYR A  1 143 ? 132.778 98.448   8.419   1.00 52.62  ?  151 TYR A CZ  1 
ATOM 1033  O OH  . TYR A  1 143 ? 133.931 97.989   7.825   1.00 58.01  ?  151 TYR A OH  1 
ATOM 1034  N N   . LYS A  1 144 ? 127.732 99.490   12.776  1.00 48.62  ?  152 LYS A N   1 
ATOM 1035  C CA  . LYS A  1 144 ? 127.065 100.098  13.917  1.00 49.90  ?  152 LYS A CA  1 
ATOM 1036  C C   . LYS A  1 144 ? 126.704 101.548  13.616  1.00 49.73  ?  152 LYS A C   1 
ATOM 1037  O O   . LYS A  1 144 ? 127.446 102.259  12.932  1.00 51.22  ?  152 LYS A O   1 
ATOM 1038  C CB  . LYS A  1 144 ? 127.989 100.014  15.133  1.00 50.00  ?  152 LYS A CB  1 
ATOM 1039  C CG  . LYS A  1 144 ? 127.829 101.102  16.171  1.00 46.25  ?  152 LYS A CG  1 
ATOM 1040  C CD  . LYS A  1 144 ? 128.879 100.928  17.251  1.00 47.54  ?  152 LYS A CD  1 
ATOM 1041  C CE  . LYS A  1 144 ? 128.873 102.085  18.222  1.00 55.27  ?  152 LYS A CE  1 
ATOM 1042  N NZ  . LYS A  1 144 ? 129.950 101.949  19.242  1.00 62.44  1  152 LYS A NZ  1 
ATOM 1043  N N   . GLN A  1 145 ? 125.554 101.987  14.126  1.00 48.14  ?  153 GLN A N   1 
ATOM 1044  C CA  . GLN A  1 145 ? 125.087 103.350  13.899  1.00 45.29  ?  153 GLN A CA  1 
ATOM 1045  C C   . GLN A  1 145 ? 125.674 104.275  14.958  1.00 45.09  ?  153 GLN A C   1 
ATOM 1046  O O   . GLN A  1 145 ? 125.597 103.985  16.156  1.00 45.79  ?  153 GLN A O   1 
ATOM 1047  C CB  . GLN A  1 145 ? 123.559 103.412  13.922  1.00 49.48  ?  153 GLN A CB  1 
ATOM 1048  C CG  . GLN A  1 145 ? 123.001 104.807  13.693  1.00 49.77  ?  153 GLN A CG  1 
ATOM 1049  C CD  . GLN A  1 145 ? 121.509 104.892  13.951  1.00 52.85  ?  153 GLN A CD  1 
ATOM 1050  O OE1 . GLN A  1 145 ? 121.025 105.852  14.554  1.00 57.77  ?  153 GLN A OE1 1 
ATOM 1051  N NE2 . GLN A  1 145 ? 120.769 103.890  13.486  1.00 50.35  ?  153 GLN A NE2 1 
ATOM 1052  N N   . THR A  1 146 ? 126.277 105.379  14.515  1.00 43.55  ?  154 THR A N   1 
ATOM 1053  C CA  . THR A  1 146 ? 126.958 106.301  15.417  1.00 43.46  ?  154 THR A CA  1 
ATOM 1054  C C   . THR A  1 146 ? 126.721 107.741  14.987  1.00 42.94  ?  154 THR A C   1 
ATOM 1055  O O   . THR A  1 146 ? 126.942 108.090  13.825  1.00 42.39  ?  154 THR A O   1 
ATOM 1056  C CB  . THR A  1 146 ? 128.467 106.021  15.462  1.00 46.63  ?  154 THR A CB  1 
ATOM 1057  O OG1 . THR A  1 146 ? 128.695 104.636  15.752  1.00 52.35  ?  154 THR A OG1 1 
ATOM 1058  C CG2 . THR A  1 146 ? 129.139 106.878  16.528  1.00 45.59  ?  154 THR A CG2 1 
ATOM 1059  N N   . GLN A  1 147 ? 126.264 108.567  15.927  1.00 45.95  ?  155 GLN A N   1 
ATOM 1060  C CA  . GLN A  1 147 ? 126.196 110.014  15.751  1.00 45.86  ?  155 GLN A CA  1 
ATOM 1061  C C   . GLN A  1 147 ? 126.937 110.659  16.910  1.00 45.93  ?  155 GLN A C   1 
ATOM 1062  O O   . GLN A  1 147 ? 126.574 110.443  18.070  1.00 46.46  ?  155 GLN A O   1 
ATOM 1063  C CB  . GLN A  1 147 ? 124.749 110.515  15.713  1.00 46.97  ?  155 GLN A CB  1 
ATOM 1064  C CG  . GLN A  1 147 ? 123.869 109.893  14.652  1.00 46.89  ?  155 GLN A CG  1 
ATOM 1065  C CD  . GLN A  1 147 ? 122.449 110.423  14.711  1.00 47.59  ?  155 GLN A CD  1 
ATOM 1066  O OE1 . GLN A  1 147 ? 122.173 111.539  14.273  1.00 47.50  ?  155 GLN A OE1 1 
ATOM 1067  N NE2 . GLN A  1 147 ? 121.540 109.622  15.258  1.00 52.17  ?  155 GLN A NE2 1 
ATOM 1068  N N   . LEU A  1 148 ? 127.961 111.455  16.611  1.00 45.96  ?  156 LEU A N   1 
ATOM 1069  C CA  . LEU A  1 148 ? 128.678 112.128  17.684  1.00 48.34  ?  156 LEU A CA  1 
ATOM 1070  C C   . LEU A  1 148 ? 129.127 113.503  17.216  1.00 50.61  ?  156 LEU A C   1 
ATOM 1071  O O   . LEU A  1 148 ? 129.318 113.741  16.021  1.00 52.11  ?  156 LEU A O   1 
ATOM 1072  C CB  . LEU A  1 148 ? 129.874 111.301  18.179  1.00 50.82  ?  156 LEU A CB  1 
ATOM 1073  C CG  . LEU A  1 148 ? 131.174 111.246  17.376  1.00 49.77  ?  156 LEU A CG  1 
ATOM 1074  C CD1 . LEU A  1 148 ? 132.160 112.305  17.854  1.00 49.05  ?  156 LEU A CD1 1 
ATOM 1075  C CD2 . LEU A  1 148 ? 131.789 109.856  17.466  1.00 49.93  ?  156 LEU A CD2 1 
ATOM 1076  N N   . CYS A  1 149 ? 129.301 114.400  18.184  1.00 52.77  ?  157 CYS A N   1 
ATOM 1077  C CA  . CYS A  1 149 ? 129.672 115.783  17.923  1.00 51.76  ?  157 CYS A CA  1 
ATOM 1078  C C   . CYS A  1 149 ? 130.446 116.320  19.117  1.00 54.59  ?  157 CYS A C   1 
ATOM 1079  O O   . CYS A  1 149 ? 129.977 116.225  20.254  1.00 56.23  ?  157 CYS A O   1 
ATOM 1080  C CB  . CYS A  1 149 ? 128.435 116.645  17.663  1.00 57.42  ?  157 CYS A CB  1 
ATOM 1081  S SG  . CYS A  1 149 ? 128.771 118.412  17.695  1.00 65.94  ?  157 CYS A SG  1 
ATOM 1082  N N   . ILE A  1 150 ? 131.621 116.884  18.851  1.00 50.48  ?  158 ILE A N   1 
ATOM 1083  C CA  . ILE A  1 150 ? 132.500 117.426  19.881  1.00 51.45  ?  158 ILE A CA  1 
ATOM 1084  C C   . ILE A  1 150 ? 133.012 118.772  19.390  1.00 51.73  ?  158 ILE A C   1 
ATOM 1085  O O   . ILE A  1 150 ? 133.516 118.874  18.267  1.00 51.18  ?  158 ILE A O   1 
ATOM 1086  C CB  . ILE A  1 150 ? 133.681 116.484  20.185  1.00 51.42  ?  158 ILE A CB  1 
ATOM 1087  C CG1 . ILE A  1 150 ? 133.185 115.155  20.755  1.00 51.42  ?  158 ILE A CG1 1 
ATOM 1088  C CG2 . ILE A  1 150 ? 134.656 117.139  21.150  1.00 52.61  ?  158 ILE A CG2 1 
ATOM 1089  C CD1 . ILE A  1 150 ? 134.299 114.191  21.096  1.00 51.84  ?  158 ILE A CD1 1 
ATOM 1090  N N   . ILE A  1 151 ? 132.877 119.804  20.219  1.00 52.18  ?  159 ILE A N   1 
ATOM 1091  C CA  . ILE A  1 151 ? 133.319 121.150  19.871  1.00 53.09  ?  159 ILE A CA  1 
ATOM 1092  C C   . ILE A  1 151 ? 134.370 121.591  20.878  1.00 56.15  ?  159 ILE A C   1 
ATOM 1093  O O   . ILE A  1 151 ? 134.174 121.443  22.091  1.00 56.49  ?  159 ILE A O   1 
ATOM 1094  C CB  . ILE A  1 151 ? 132.143 122.140  19.831  1.00 55.68  ?  159 ILE A CB  1 
ATOM 1095  C CG1 . ILE A  1 151 ? 130.976 121.529  19.055  1.00 62.42  ?  159 ILE A CG1 1 
ATOM 1096  C CG2 . ILE A  1 151 ? 132.575 123.452  19.195  1.00 55.15  ?  159 ILE A CG2 1 
ATOM 1097  C CD1 . ILE A  1 151 ? 129.722 122.364  19.076  1.00 70.42  ?  159 ILE A CD1 1 
ATOM 1098  N N   . GLY A  1 152 ? 135.476 122.135  20.380  1.00 51.85  ?  160 GLY A N   1 
ATOM 1099  C CA  . GLY A  1 152 ? 136.525 122.606  21.255  1.00 52.27  ?  160 GLY A CA  1 
ATOM 1100  C C   . GLY A  1 152 ? 137.379 123.658  20.583  1.00 52.47  ?  160 GLY A C   1 
ATOM 1101  O O   . GLY A  1 152 ? 137.027 124.191  19.531  1.00 52.33  ?  160 GLY A O   1 
ATOM 1102  N N   . CYS A  1 153 ? 138.494 123.985  21.236  1.00 52.21  ?  161 CYS A N   1 
ATOM 1103  C CA  . CYS A  1 153 ? 139.550 124.782  20.625  1.00 64.01  ?  161 CYS A CA  1 
ATOM 1104  C C   . CYS A  1 153 ? 140.840 123.991  20.477  1.00 66.55  ?  161 CYS A C   1 
ATOM 1105  O O   . CYS A  1 153 ? 141.849 124.545  20.025  1.00 72.02  ?  161 CYS A O   1 
ATOM 1106  C CB  . CYS A  1 153 ? 139.817 126.055  21.441  1.00 64.37  ?  161 CYS A CB  1 
ATOM 1107  S SG  . CYS A  1 153 ? 140.240 125.771  23.172  1.00 67.75  ?  161 CYS A SG  1 
ATOM 1108  N N   . VAL A  1 154 ? 140.827 122.714  20.844  1.00 69.01  ?  162 VAL A N   1 
ATOM 1109  C CA  . VAL A  1 154 ? 141.960 121.801  20.740  1.00 64.33  ?  162 VAL A CA  1 
ATOM 1110  C C   . VAL A  1 154 ? 141.413 120.535  20.092  1.00 62.53  ?  162 VAL A C   1 
ATOM 1111  O O   . VAL A  1 154 ? 140.278 120.141  20.398  1.00 57.42  ?  162 VAL A O   1 
ATOM 1112  C CB  . VAL A  1 154 ? 142.580 121.536  22.124  1.00 60.95  ?  162 VAL A CB  1 
ATOM 1113  C CG1 . VAL A  1 154 ? 143.504 120.325  22.108  1.00 61.05  ?  162 VAL A CG1 1 
ATOM 1114  C CG2 . VAL A  1 154 ? 143.322 122.770  22.614  1.00 62.73  ?  162 VAL A CG2 1 
ATOM 1115  N N   . PRO A  1 155 ? 142.142 119.888  19.179  1.00 66.02  ?  163 PRO A N   1 
ATOM 1116  C CA  . PRO A  1 155 ? 141.598 118.688  18.534  1.00 62.14  ?  163 PRO A CA  1 
ATOM 1117  C C   . PRO A  1 155 ? 141.215 117.641  19.568  1.00 59.73  ?  163 PRO A C   1 
ATOM 1118  O O   . PRO A  1 155 ? 141.880 117.482  20.594  1.00 53.94  ?  163 PRO A O   1 
ATOM 1119  C CB  . PRO A  1 155 ? 142.747 118.209  17.637  1.00 58.06  ?  163 PRO A CB  1 
ATOM 1120  C CG  . PRO A  1 155 ? 143.966 118.890  18.161  1.00 59.64  ?  163 PRO A CG  1 
ATOM 1121  C CD  . PRO A  1 155 ? 143.497 120.199  18.695  1.00 60.50  ?  163 PRO A CD  1 
ATOM 1122  N N   . ALA A  1 156 ? 140.112 116.946  19.301  1.00 55.34  ?  164 ALA A N   1 
ATOM 1123  C CA  . ALA A  1 156 ? 139.598 115.977  20.255  1.00 49.55  ?  164 ALA A CA  1 
ATOM 1124  C C   . ALA A  1 156 ? 140.578 114.823  20.418  1.00 55.28  ?  164 ALA A C   1 
ATOM 1125  O O   . ALA A  1 156 ? 141.361 114.508  19.517  1.00 56.95  ?  164 ALA A O   1 
ATOM 1126  C CB  . ALA A  1 156 ? 138.236 115.452  19.804  1.00 46.34  ?  164 ALA A CB  1 
ATOM 1127  N N   . ILE A  1 157 ? 140.529 114.189  21.584  1.00 53.70  ?  165 ILE A N   1 
ATOM 1128  C CA  . ILE A  1 157 ? 141.423 113.088  21.918  1.00 55.85  ?  165 ILE A CA  1 
ATOM 1129  C C   . ILE A  1 157 ? 140.648 111.786  21.792  1.00 62.50  ?  165 ILE A C   1 
ATOM 1130  O O   . ILE A  1 157 ? 139.575 111.630  22.389  1.00 68.06  ?  165 ILE A O   1 
ATOM 1131  C CB  . ILE A  1 157 ? 142.014 113.249  23.330  1.00 55.52  ?  165 ILE A CB  1 
ATOM 1132  C CG1 . ILE A  1 157 ? 143.224 114.188  23.311  1.00 57.20  ?  165 ILE A CG1 1 
ATOM 1133  C CG2 . ILE A  1 157 ? 142.411 111.898  23.905  1.00 57.74  ?  165 ILE A CG2 1 
ATOM 1134  C CD1 . ILE A  1 157 ? 142.882 115.658  23.176  1.00 61.39  ?  165 ILE A CD1 1 
ATOM 1135  N N   . GLY A  1 158 ? 141.183 110.858  21.008  1.00 52.92  ?  166 GLY A N   1 
ATOM 1136  C CA  . GLY A  1 158 ? 140.565 109.559  20.868  1.00 52.83  ?  166 GLY A CA  1 
ATOM 1137  C C   . GLY A  1 158 ? 141.463 108.449  21.367  1.00 53.28  ?  166 GLY A C   1 
ATOM 1138  O O   . GLY A  1 158 ? 142.678 108.631  21.484  1.00 53.72  ?  166 GLY A O   1 
ATOM 1139  N N   . GLU A  1 159 ? 140.877 107.295  21.663  1.00 59.41  ?  167 GLU A N   1 
ATOM 1140  C CA  . GLU A  1 159 ? 141.615 106.147  22.160  1.00 60.57  ?  167 GLU A CA  1 
ATOM 1141  C C   . GLU A  1 159 ? 141.476 104.997  21.175  1.00 56.83  ?  167 GLU A C   1 
ATOM 1142  O O   . GLU A  1 159 ? 140.453 104.860  20.497  1.00 55.76  ?  167 GLU A O   1 
ATOM 1143  C CB  . GLU A  1 159 ? 141.114 105.720  23.548  1.00 59.42  ?  167 GLU A CB  1 
ATOM 1144  C CG  . GLU A  1 159 ? 139.673 105.223  23.567  1.00 63.75  ?  167 GLU A CG  1 
ATOM 1145  C CD  . GLU A  1 159 ? 139.166 104.932  24.972  1.00 68.60  ?  167 GLU A CD  1 
ATOM 1146  O OE1 . GLU A  1 159 ? 137.952 105.101  25.216  1.00 62.55  ?  167 GLU A OE1 1 
ATOM 1147  O OE2 . GLU A  1 159 ? 139.982 104.544  25.835  1.00 75.75  -1 167 GLU A OE2 1 
ATOM 1148  N N   . HIS A  1 160 ? 142.514 104.169  21.104  1.00 53.67  ?  168 HIS A N   1 
ATOM 1149  C CA  . HIS A  1 160 ? 142.454 102.961  20.292  1.00 53.01  ?  168 HIS A CA  1 
ATOM 1150  C C   . HIS A  1 160 ? 143.543 102.008  20.752  1.00 58.02  ?  168 HIS A C   1 
ATOM 1151  O O   . HIS A  1 160 ? 144.551 102.420  21.331  1.00 62.54  ?  168 HIS A O   1 
ATOM 1152  C CB  . HIS A  1 160 ? 142.608 103.276  18.801  1.00 54.15  ?  168 HIS A CB  1 
ATOM 1153  C CG  . HIS A  1 160 ? 144.016 103.575  18.391  1.00 56.76  ?  168 HIS A CG  1 
ATOM 1154  N ND1 . HIS A  1 160 ? 144.564 104.836  18.481  1.00 58.45  ?  168 HIS A ND1 1 
ATOM 1155  C CD2 . HIS A  1 160 ? 144.990 102.776  17.894  1.00 59.86  ?  168 HIS A CD2 1 
ATOM 1156  C CE1 . HIS A  1 160 ? 145.814 104.802  18.055  1.00 60.73  ?  168 HIS A CE1 1 
ATOM 1157  N NE2 . HIS A  1 160 ? 146.097 103.564  17.693  1.00 62.02  ?  168 HIS A NE2 1 
ATOM 1158  N N   . TRP A  1 161 ? 143.332 100.727  20.475  1.00 53.64  ?  169 TRP A N   1 
ATOM 1159  C CA  . TRP A  1 161 ? 144.273 99.689   20.869  1.00 64.02  ?  169 TRP A CA  1 
ATOM 1160  C C   . TRP A  1 161 ? 145.249 99.412   19.735  1.00 60.36  ?  169 TRP A C   1 
ATOM 1161  O O   . TRP A  1 161 ? 144.848 99.296   18.573  1.00 59.92  ?  169 TRP A O   1 
ATOM 1162  C CB  . TRP A  1 161 ? 143.523 98.419   21.267  1.00 58.54  ?  169 TRP A CB  1 
ATOM 1163  C CG  . TRP A  1 161 ? 142.813 98.574   22.575  1.00 58.30  ?  169 TRP A CG  1 
ATOM 1164  C CD1 . TRP A  1 161 ? 141.502 98.901   22.765  1.00 53.47  ?  169 TRP A CD1 1 
ATOM 1165  C CD2 . TRP A  1 161 ? 143.382 98.429   23.880  1.00 58.17  ?  169 TRP A CD2 1 
ATOM 1166  N NE1 . TRP A  1 161 ? 141.219 98.961   24.107  1.00 54.77  ?  169 TRP A NE1 1 
ATOM 1167  C CE2 . TRP A  1 161 ? 142.358 98.675   24.813  1.00 56.88  ?  169 TRP A CE2 1 
ATOM 1168  C CE3 . TRP A  1 161 ? 144.659 98.110   24.350  1.00 62.70  ?  169 TRP A CE3 1 
ATOM 1169  C CZ2 . TRP A  1 161 ? 142.571 98.616   26.188  1.00 59.38  ?  169 TRP A CZ2 1 
ATOM 1170  C CZ3 . TRP A  1 161 ? 144.867 98.049   25.716  1.00 68.07  ?  169 TRP A CZ3 1 
ATOM 1171  C CH2 . TRP A  1 161 ? 143.829 98.300   26.617  1.00 65.63  ?  169 TRP A CH2 1 
ATOM 1172  N N   . THR A  1 162 ? 146.531 99.317   20.072  1.00 56.08  ?  170 THR A N   1 
ATOM 1173  C CA  . THR A  1 162 ? 147.573 99.073   19.090  1.00 62.48  ?  170 THR A CA  1 
ATOM 1174  C C   . THR A  1 162 ? 148.498 97.980   19.603  1.00 72.06  ?  170 THR A C   1 
ATOM 1175  O O   . THR A  1 162 ? 148.480 97.621   20.785  1.00 77.87  ?  170 THR A O   1 
ATOM 1176  C CB  . THR A  1 162 ? 148.371 100.348  18.787  1.00 64.44  ?  170 THR A CB  1 
ATOM 1177  O OG1 . THR A  1 162 ? 149.041 100.207  17.529  1.00 67.10  ?  170 THR A OG1 1 
ATOM 1178  C CG2 . THR A  1 162 ? 149.402 100.596  19.874  1.00 68.97  ?  170 THR A CG2 1 
ATOM 1179  N N   . LYS A  1 163 ? 149.310 97.443   18.691  1.00 70.72  ?  171 LYS A N   1 
ATOM 1180  C CA  . LYS A  1 163 ? 150.332 96.476   19.067  1.00 73.23  ?  171 LYS A CA  1 
ATOM 1181  C C   . LYS A  1 163 ? 151.342 97.126   20.001  1.00 75.58  ?  171 LYS A C   1 
ATOM 1182  O O   . LYS A  1 163 ? 152.221 97.871   19.555  1.00 71.34  ?  171 LYS A O   1 
ATOM 1183  C CB  . LYS A  1 163 ? 151.034 95.906   17.832  1.00 69.83  ?  171 LYS A CB  1 
ATOM 1184  C CG  . LYS A  1 163 ? 152.130 94.901   18.166  1.00 77.26  ?  171 LYS A CG  1 
ATOM 1185  C CD  . LYS A  1 163 ? 152.897 94.458   16.928  1.00 83.11  ?  171 LYS A CD  1 
ATOM 1186  C CE  . LYS A  1 163 ? 152.133 93.402   16.146  1.00 84.42  ?  171 LYS A CE  1 
ATOM 1187  N NZ  . LYS A  1 163 ? 152.896 92.935   14.953  1.00 82.58  1  171 LYS A NZ  1 
ATOM 1188  N N   . GLY A  1 164 ? 151.209 96.865   21.297  1.00 80.30  ?  172 GLY A N   1 
ATOM 1189  C CA  . GLY A  1 164 ? 152.104 97.469   22.261  1.00 85.07  ?  172 GLY A CA  1 
ATOM 1190  C C   . GLY A  1 164 ? 153.527 96.974   22.098  1.00 88.64  ?  172 GLY A C   1 
ATOM 1191  O O   . GLY A  1 164 ? 153.782 95.888   21.575  1.00 87.18  ?  172 GLY A O   1 
ATOM 1192  N N   . THR A  1 165 ? 154.469 97.801   22.546  1.00 95.66  ?  173 THR A N   1 
ATOM 1193  C CA  . THR A  1 165 ? 155.871 97.412   22.552  1.00 104.05 ?  173 THR A CA  1 
ATOM 1194  C C   . THR A  1 165 ? 156.066 96.121   23.340  1.00 112.10 ?  173 THR A C   1 
ATOM 1195  O O   . THR A  1 165 ? 155.264 95.774   24.213  1.00 113.72 ?  173 THR A O   1 
ATOM 1196  C CB  . THR A  1 165 ? 156.731 98.528   23.149  1.00 104.16 ?  173 THR A CB  1 
ATOM 1197  O OG1 . THR A  1 165 ? 156.220 98.890   24.438  1.00 104.62 ?  173 THR A OG1 1 
ATOM 1198  C CG2 . THR A  1 165 ? 156.715 99.750   22.246  1.00 101.94 ?  173 THR A CG2 1 
ATOM 1199  N N   . ALA A  1 166 ? 157.132 95.396   22.999  1.00 112.30 ?  174 ALA A N   1 
ATOM 1200  C CA  . ALA A  1 166 ? 157.451 94.139   23.666  1.00 120.77 ?  174 ALA A CA  1 
ATOM 1201  C C   . ALA A  1 166 ? 157.428 94.309   25.180  1.00 129.84 ?  174 ALA A C   1 
ATOM 1202  O O   . ALA A  1 166 ? 157.918 95.306   25.715  1.00 134.18 ?  174 ALA A O   1 
ATOM 1203  C CB  . ALA A  1 166 ? 158.822 93.633   23.211  1.00 125.71 ?  174 ALA A CB  1 
ATOM 1204  N N   . SER A  1 167 ? 156.830 93.328   25.864  1.00 130.31 ?  175 SER A N   1 
ATOM 1205  C CA  . SER A  1 167 ? 156.624 93.432   27.307  1.00 139.82 ?  175 SER A CA  1 
ATOM 1206  C C   . SER A  1 167 ? 157.939 93.680   28.036  1.00 147.79 ?  175 SER A C   1 
ATOM 1207  O O   . SER A  1 167 ? 158.070 94.645   28.797  1.00 152.97 ?  175 SER A O   1 
ATOM 1208  C CB  . SER A  1 167 ? 155.949 92.163   27.829  1.00 138.87 ?  175 SER A CB  1 
ATOM 1209  O OG  . SER A  1 167 ? 155.688 92.258   29.218  1.00 143.73 ?  175 SER A OG  1 
ATOM 1210  N N   . LYS A  1 168 ? 158.924 92.816   27.816  1.00 146.10 ?  176 LYS A N   1 
ATOM 1211  C CA  . LYS A  1 168 ? 160.245 92.967   28.411  1.00 151.55 ?  176 LYS A CA  1 
ATOM 1212  C C   . LYS A  1 168 ? 161.283 92.850   27.301  1.00 151.75 ?  176 LYS A C   1 
ATOM 1213  O O   . LYS A  1 168 ? 160.916 92.584   26.148  1.00 149.83 ?  176 LYS A O   1 
ATOM 1214  C CB  . LYS A  1 168 ? 160.477 91.908   29.494  1.00 145.44 ?  176 LYS A CB  1 
ATOM 1215  C CG  . LYS A  1 168 ? 159.215 91.391   30.165  1.00 142.87 ?  176 LYS A CG  1 
ATOM 1216  C CD  . LYS A  1 168 ? 159.532 90.247   31.116  1.00 145.59 ?  176 LYS A CD  1 
ATOM 1217  C CE  . LYS A  1 168 ? 158.274 89.496   31.520  1.00 140.92 ?  176 LYS A CE  1 
ATOM 1218  N NZ  . LYS A  1 168 ? 157.290 90.385   32.196  1.00 135.28 1  176 LYS A NZ  1 
ATOM 1219  N N   . PRO A  1 169 ? 162.582 93.037   27.586  1.00 152.43 ?  177 PRO A N   1 
ATOM 1220  C CA  . PRO A  1 169 ? 163.601 92.595   26.623  1.00 148.71 ?  177 PRO A CA  1 
ATOM 1221  C C   . PRO A  1 169 ? 163.600 91.081   26.478  1.00 145.63 ?  177 PRO A C   1 
ATOM 1222  O O   . PRO A  1 169 ? 164.596 90.411   26.771  1.00 145.24 ?  177 PRO A O   1 
ATOM 1223  C CB  . PRO A  1 169 ? 164.915 93.114   27.226  1.00 148.27 ?  177 PRO A CB  1 
ATOM 1224  C CG  . PRO A  1 169 ? 164.603 93.410   28.659  1.00 151.78 ?  177 PRO A CG  1 
ATOM 1225  C CD  . PRO A  1 169 ? 163.170 93.835   28.675  1.00 149.89 ?  177 PRO A CD  1 
ATOM 1226  N N   . THR A  1 170 ? 162.473 90.540   26.021  1.00 139.38 ?  178 THR A N   1 
ATOM 1227  C CA  . THR A  1 170 ? 162.214 89.108   25.993  1.00 140.55 ?  178 THR A CA  1 
ATOM 1228  C C   . THR A  1 170 ? 161.990 88.673   24.554  1.00 136.30 ?  178 THR A C   1 
ATOM 1229  O O   . THR A  1 170 ? 161.226 89.310   23.820  1.00 132.71 ?  178 THR A O   1 
ATOM 1230  C CB  . THR A  1 170 ? 160.988 88.758   26.847  1.00 137.86 ?  178 THR A CB  1 
ATOM 1231  O OG1 . THR A  1 170 ? 161.303 88.926   28.235  1.00 143.09 ?  178 THR A OG1 1 
ATOM 1232  C CG2 . THR A  1 170 ? 160.545 87.320   26.603  1.00 137.88 ?  178 THR A CG2 1 
ATOM 1233  N N   . THR A  1 171 ? 162.658 87.595   24.151  1.00 129.71 ?  179 THR A N   1 
ATOM 1234  C CA  . THR A  1 171 ? 162.425 87.000   22.840  1.00 126.46 ?  179 THR A CA  1 
ATOM 1235  C C   . THR A  1 171 ? 161.153 86.162   22.904  1.00 123.65 ?  179 THR A C   1 
ATOM 1236  O O   . THR A  1 171 ? 161.108 85.134   23.590  1.00 125.24 ?  179 THR A O   1 
ATOM 1237  C CB  . THR A  1 171 ? 163.622 86.157   22.411  1.00 124.15 ?  179 THR A CB  1 
ATOM 1238  O OG1 . THR A  1 171 ? 163.850 85.119   23.372  1.00 131.63 ?  179 THR A OG1 1 
ATOM 1239  C CG2 . THR A  1 171 ? 164.870 87.023   22.302  1.00 125.04 ?  179 THR A CG2 1 
ATOM 1240  N N   . VAL A  1 172 ? 160.117 86.604   22.198  1.00 111.48 ?  180 VAL A N   1 
ATOM 1241  C CA  . VAL A  1 172 ? 158.835 85.914   22.159  1.00 104.94 ?  180 VAL A CA  1 
ATOM 1242  C C   . VAL A  1 172 ? 158.714 85.209   20.814  1.00 102.73 ?  180 VAL A C   1 
ATOM 1243  O O   . VAL A  1 172 ? 159.219 85.685   19.791  1.00 103.40 ?  180 VAL A O   1 
ATOM 1244  C CB  . VAL A  1 172 ? 157.657 86.884   22.403  1.00 99.34  ?  180 VAL A CB  1 
ATOM 1245  C CG1 . VAL A  1 172 ? 157.521 87.877   21.257  1.00 90.37  ?  180 VAL A CG1 1 
ATOM 1246  C CG2 . VAL A  1 172 ? 156.358 86.118   22.625  1.00 100.01 ?  180 VAL A CG2 1 
ATOM 1247  N N   . VAL A  1 173 ? 158.052 84.052   20.824  1.00 90.59  ?  181 VAL A N   1 
ATOM 1248  C CA  . VAL A  1 173 ? 157.936 83.247   19.616  1.00 90.34  ?  181 VAL A CA  1 
ATOM 1249  C C   . VAL A  1 173 ? 157.034 83.945   18.604  1.00 86.09  ?  181 VAL A C   1 
ATOM 1250  O O   . VAL A  1 173 ? 156.077 84.646   18.961  1.00 83.54  ?  181 VAL A O   1 
ATOM 1251  C CB  . VAL A  1 173 ? 157.402 81.844   19.959  1.00 86.24  ?  181 VAL A CB  1 
ATOM 1252  C CG1 . VAL A  1 173 ? 157.595 80.892   18.787  1.00 87.08  ?  181 VAL A CG1 1 
ATOM 1253  C CG2 . VAL A  1 173 ? 158.085 81.309   21.207  1.00 90.32  ?  181 VAL A CG2 1 
ATOM 1254  N N   . GLN A  1 174 ? 157.351 83.762   17.324  1.00 84.36  ?  182 GLN A N   1 
ATOM 1255  C CA  . GLN A  1 174 ? 156.509 84.291   16.262  1.00 81.91  ?  182 GLN A CA  1 
ATOM 1256  C C   . GLN A  1 174 ? 155.178 83.552   16.231  1.00 82.85  ?  182 GLN A C   1 
ATOM 1257  O O   . GLN A  1 174 ? 155.126 82.323   16.335  1.00 84.86  ?  182 GLN A O   1 
ATOM 1258  C CB  . GLN A  1 174 ? 157.210 84.174   14.910  1.00 92.43  ?  182 GLN A CB  1 
ATOM 1259  C CG  . GLN A  1 174 ? 156.382 84.693   13.747  1.00 88.42  ?  182 GLN A CG  1 
ATOM 1260  C CD  . GLN A  1 174 ? 156.053 86.167   13.881  1.00 87.43  ?  182 GLN A CD  1 
ATOM 1261  O OE1 . GLN A  1 174 ? 156.911 86.977   14.235  1.00 85.99  ?  182 GLN A OE1 1 
ATOM 1262  N NE2 . GLN A  1 174 ? 154.803 86.522   13.606  1.00 87.19  ?  182 GLN A NE2 1 
ATOM 1263  N N   . GLY A  1 175 ? 154.095 84.311   16.086  1.00 81.33  ?  183 GLY A N   1 
ATOM 1264  C CA  . GLY A  1 175 ? 152.756 83.771   16.129  1.00 79.02  ?  183 GLY A CA  1 
ATOM 1265  C C   . GLY A  1 175 ? 152.061 83.930   17.462  1.00 76.03  ?  183 GLY A C   1 
ATOM 1266  O O   . GLY A  1 175 ? 150.854 83.675   17.547  1.00 75.78  ?  183 GLY A O   1 
ATOM 1267  N N   . ASP A  1 176 ? 152.785 84.335   18.502  1.00 76.24  ?  184 ASP A N   1 
ATOM 1268  C CA  . ASP A  1 176 ? 152.165 84.614   19.785  1.00 75.22  ?  184 ASP A CA  1 
ATOM 1269  C C   . ASP A  1 176 ? 151.366 85.912   19.712  1.00 69.47  ?  184 ASP A C   1 
ATOM 1270  O O   . ASP A  1 176 ? 151.561 86.747   18.824  1.00 73.16  ?  184 ASP A O   1 
ATOM 1271  C CB  . ASP A  1 176 ? 153.222 84.700   20.886  1.00 77.36  ?  184 ASP A CB  1 
ATOM 1272  C CG  . ASP A  1 176 ? 153.899 83.369   21.147  1.00 87.28  ?  184 ASP A CG  1 
ATOM 1273  O OD1 . ASP A  1 176 ? 153.740 82.447   20.318  1.00 91.54  ?  184 ASP A OD1 1 
ATOM 1274  O OD2 . ASP A  1 176 ? 154.592 83.245   22.179  1.00 90.15  -1 184 ASP A OD2 1 
ATOM 1275  N N   . CYS A  1 177 ? 150.455 86.075   20.659  1.00 64.55  ?  185 CYS A N   1 
ATOM 1276  C CA  . CYS A  1 177 ? 149.620 87.268   20.691  1.00 63.05  ?  185 CYS A CA  1 
ATOM 1277  C C   . CYS A  1 177 ? 150.436 88.464   21.163  1.00 63.69  ?  185 CYS A C   1 
ATOM 1278  O O   . CYS A  1 177 ? 151.025 88.411   22.251  1.00 64.44  ?  185 CYS A O   1 
ATOM 1279  C CB  . CYS A  1 177 ? 148.419 87.055   21.605  1.00 67.42  ?  185 CYS A CB  1 
ATOM 1280  S SG  . CYS A  1 177 ? 147.241 88.425   21.602  1.00 65.53  ?  185 CYS A SG  1 
ATOM 1281  N N   . PRO A  1 178 ? 150.510 89.544   20.392  1.00 66.48  ?  186 PRO A N   1 
ATOM 1282  C CA  . PRO A  1 178 ? 151.275 90.716   20.823  1.00 68.09  ?  186 PRO A CA  1 
ATOM 1283  C C   . PRO A  1 178 ? 150.570 91.433   21.960  1.00 70.10  ?  186 PRO A C   1 
ATOM 1284  O O   . PRO A  1 178 ? 149.351 91.285   22.137  1.00 73.02  ?  186 PRO A O   1 
ATOM 1285  C CB  . PRO A  1 178 ? 151.324 91.586   19.560  1.00 66.39  ?  186 PRO A CB  1 
ATOM 1286  C CG  . PRO A  1 178 ? 150.085 91.213   18.815  1.00 64.92  ?  186 PRO A CG  1 
ATOM 1287  C CD  . PRO A  1 178 ? 149.883 89.743   19.073  1.00 65.00  ?  186 PRO A CD  1 
ATOM 1288  N N   . PRO A  1 179 ? 151.298 92.213   22.756  1.00 76.73  ?  187 PRO A N   1 
ATOM 1289  C CA  . PRO A  1 179 ? 150.643 92.979   23.823  1.00 74.08  ?  187 PRO A CA  1 
ATOM 1290  C C   . PRO A  1 179 ? 149.771 94.082   23.247  1.00 70.88  ?  187 PRO A C   1 
ATOM 1291  O O   . PRO A  1 179 ? 150.118 94.716   22.248  1.00 70.91  ?  187 PRO A O   1 
ATOM 1292  C CB  . PRO A  1 179 ? 151.817 93.556   24.627  1.00 73.65  ?  187 PRO A CB  1 
ATOM 1293  C CG  . PRO A  1 179 ? 153.027 92.786   24.185  1.00 79.37  ?  187 PRO A CG  1 
ATOM 1294  C CD  . PRO A  1 179 ? 152.760 92.376   22.774  1.00 78.76  ?  187 PRO A CD  1 
ATOM 1295  N N   . LEU A  1 180 ? 148.627 94.304   23.887  1.00 64.33  ?  188 LEU A N   1 
ATOM 1296  C CA  . LEU A  1 180 ? 147.691 95.342   23.477  1.00 63.12  ?  188 LEU A CA  1 
ATOM 1297  C C   . LEU A  1 180 ? 147.918 96.578   24.335  1.00 63.43  ?  188 LEU A C   1 
ATOM 1298  O O   . LEU A  1 180 ? 147.931 96.489   25.567  1.00 63.60  ?  188 LEU A O   1 
ATOM 1299  C CB  . LEU A  1 180 ? 146.246 94.859   23.612  1.00 58.03  ?  188 LEU A CB  1 
ATOM 1300  C CG  . LEU A  1 180 ? 145.879 93.583   22.852  1.00 57.99  ?  188 LEU A CG  1 
ATOM 1301  C CD1 . LEU A  1 180 ? 144.394 93.297   22.978  1.00 57.35  ?  188 LEU A CD1 1 
ATOM 1302  C CD2 . LEU A  1 180 ? 146.281 93.692   21.392  1.00 58.22  ?  188 LEU A CD2 1 
ATOM 1303  N N   . GLU A  1 181 ? 148.091 97.726   23.685  1.00 65.06  ?  189 GLU A N   1 
ATOM 1304  C CA  . GLU A  1 181 ? 148.350 98.981   24.378  1.00 64.87  ?  189 GLU A CA  1 
ATOM 1305  C C   . GLU A  1 181 ? 147.314 100.012  23.959  1.00 65.07  ?  189 GLU A C   1 
ATOM 1306  O O   . GLU A  1 181 ? 147.106 100.239  22.762  1.00 66.28  ?  189 GLU A O   1 
ATOM 1307  C CB  . GLU A  1 181 ? 149.763 99.491   24.080  1.00 66.88  ?  189 GLU A CB  1 
ATOM 1308  C CG  . GLU A  1 181 ? 150.110 100.812  24.742  1.00 74.74  ?  189 GLU A CG  1 
ATOM 1309  C CD  . GLU A  1 181 ? 151.533 101.253  24.447  1.00 85.16  ?  189 GLU A CD  1 
ATOM 1310  O OE1 . GLU A  1 181 ? 152.292 100.459  23.851  1.00 91.44  ?  189 GLU A OE1 1 
ATOM 1311  O OE2 . GLU A  1 181 ? 151.892 102.392  24.813  1.00 86.54  -1 189 GLU A OE2 1 
ATOM 1312  N N   . LEU A  1 182 ? 146.668 100.630  24.945  1.00 63.75  ?  190 LEU A N   1 
ATOM 1313  C CA  . LEU A  1 182 ? 145.713 101.695  24.676  1.00 61.48  ?  190 LEU A CA  1 
ATOM 1314  C C   . LEU A  1 182 ? 146.463 103.000  24.444  1.00 62.50  ?  190 LEU A C   1 
ATOM 1315  O O   . LEU A  1 182 ? 147.381 103.340  25.197  1.00 63.73  ?  190 LEU A O   1 
ATOM 1316  C CB  . LEU A  1 182 ? 144.730 101.833  25.838  1.00 61.75  ?  190 LEU A CB  1 
ATOM 1317  C CG  . LEU A  1 182 ? 143.513 102.731  25.613  1.00 62.05  ?  190 LEU A CG  1 
ATOM 1318  C CD1 . LEU A  1 182 ? 142.650 102.182  24.487  1.00 60.75  ?  190 LEU A CD1 1 
ATOM 1319  C CD2 . LEU A  1 182 ? 142.705 102.863  26.895  1.00 59.06  ?  190 LEU A CD2 1 
ATOM 1320  N N   . ILE A  1 183 ? 146.071 103.729  23.403  1.00 59.64  ?  191 ILE A N   1 
ATOM 1321  C CA  . ILE A  1 183 ? 146.795 104.914  22.959  1.00 64.99  ?  191 ILE A CA  1 
ATOM 1322  C C   . ILE A  1 183 ? 145.804 106.033  22.668  1.00 63.91  ?  191 ILE A C   1 
ATOM 1323  O O   . ILE A  1 183 ? 144.762 105.811  22.039  1.00 63.89  ?  191 ILE A O   1 
ATOM 1324  C CB  . ILE A  1 183 ? 147.667 104.603  21.722  1.00 58.77  ?  191 ILE A CB  1 
ATOM 1325  C CG1 . ILE A  1 183 ? 148.969 103.924  22.154  1.00 60.19  ?  191 ILE A CG1 1 
ATOM 1326  C CG2 . ILE A  1 183 ? 147.948 105.862  20.913  1.00 59.34  ?  191 ILE A CG2 1 
ATOM 1327  C CD1 . ILE A  1 183 ? 150.038 103.904  21.083  1.00 61.42  ?  191 ILE A CD1 1 
ATOM 1328  N N   . ASN A  1 184 ? 146.134 107.236  23.136  1.00 59.00  ?  192 ASN A N   1 
ATOM 1329  C CA  . ASN A  1 184 ? 145.392 108.448  22.822  1.00 58.48  ?  192 ASN A CA  1 
ATOM 1330  C C   . ASN A  1 184 ? 146.077 109.182  21.677  1.00 58.41  ?  192 ASN A C   1 
ATOM 1331  O O   . ASN A  1 184 ? 147.303 109.332  21.675  1.00 61.02  ?  192 ASN A O   1 
ATOM 1332  C CB  . ASN A  1 184 ? 145.299 109.363  24.044  1.00 64.63  ?  192 ASN A CB  1 
ATOM 1333  C CG  . ASN A  1 184 ? 144.361 108.826  25.103  1.00 61.29  ?  192 ASN A CG  1 
ATOM 1334  O OD1 . ASN A  1 184 ? 144.724 108.725  26.274  1.00 63.82  ?  192 ASN A OD1 1 
ATOM 1335  N ND2 . ASN A  1 184 ? 143.142 108.486  24.698  1.00 58.72  ?  192 ASN A ND2 1 
ATOM 1336  N N   . THR A  1 185 ? 145.285 109.638  20.712  1.00 55.01  ?  193 THR A N   1 
ATOM 1337  C CA  . THR A  1 185 ? 145.780 110.372  19.558  1.00 57.55  ?  193 THR A CA  1 
ATOM 1338  C C   . THR A  1 185 ? 144.773 111.448  19.185  1.00 60.54  ?  193 THR A C   1 
ATOM 1339  O O   . THR A  1 185 ? 143.569 111.278  19.408  1.00 63.41  ?  193 THR A O   1 
ATOM 1340  C CB  . THR A  1 185 ? 146.015 109.452  18.349  1.00 56.13  ?  193 THR A CB  1 
ATOM 1341  O OG1 . THR A  1 185 ? 144.947 108.501  18.253  1.00 56.59  ?  193 THR A OG1 1 
ATOM 1342  C CG2 . THR A  1 185 ? 147.339 108.719  18.477  1.00 60.26  ?  193 THR A CG2 1 
ATOM 1343  N N   . PRO A  1 186 ? 145.236 112.565  18.625  1.00 62.55  ?  194 PRO A N   1 
ATOM 1344  C CA  . PRO A  1 186 ? 144.294 113.578  18.135  1.00 60.28  ?  194 PRO A CA  1 
ATOM 1345  C C   . PRO A  1 186 ? 143.496 113.053  16.953  1.00 59.37  ?  194 PRO A C   1 
ATOM 1346  O O   . PRO A  1 186 ? 144.035 112.417  16.045  1.00 59.27  ?  194 PRO A O   1 
ATOM 1347  C CB  . PRO A  1 186 ? 145.203 114.744  17.731  1.00 57.88  ?  194 PRO A CB  1 
ATOM 1348  C CG  . PRO A  1 186 ? 146.528 114.110  17.465  1.00 61.19  ?  194 PRO A CG  1 
ATOM 1349  C CD  . PRO A  1 186 ? 146.637 112.979  18.442  1.00 61.77  ?  194 PRO A CD  1 
ATOM 1350  N N   . ILE A  1 187 ? 142.194 113.321  16.978  1.00 54.25  ?  195 ILE A N   1 
ATOM 1351  C CA  . ILE A  1 187 ? 141.282 112.834  15.949  1.00 53.25  ?  195 ILE A CA  1 
ATOM 1352  C C   . ILE A  1 187 ? 141.357 113.771  14.748  1.00 53.83  ?  195 ILE A C   1 
ATOM 1353  O O   . ILE A  1 187 ? 140.965 114.937  14.832  1.00 54.07  ?  195 ILE A O   1 
ATOM 1354  C CB  . ILE A  1 187 ? 139.849 112.722  16.479  1.00 58.70  ?  195 ILE A CB  1 
ATOM 1355  C CG1 . ILE A  1 187 ? 139.804 111.777  17.682  1.00 53.64  ?  195 ILE A CG1 1 
ATOM 1356  C CG2 . ILE A  1 187 ? 138.921 112.245  15.382  1.00 57.39  ?  195 ILE A CG2 1 
ATOM 1357  C CD1 . ILE A  1 187 ? 138.414 111.547  18.225  1.00 52.45  ?  195 ILE A CD1 1 
ATOM 1358  N N   . GLU A  1 188 ? 141.858 113.261  13.628  1.00 51.19  ?  196 GLU A N   1 
ATOM 1359  C CA  . GLU A  1 188 ? 142.004 114.028  12.400  1.00 51.85  ?  196 GLU A CA  1 
ATOM 1360  C C   . GLU A  1 188 ? 140.844 113.740  11.457  1.00 50.88  ?  196 GLU A C   1 
ATOM 1361  O O   . GLU A  1 188 ? 140.140 112.736  11.587  1.00 50.27  ?  196 GLU A O   1 
ATOM 1362  C CB  . GLU A  1 188 ? 143.324 113.695  11.698  1.00 60.28  ?  196 GLU A CB  1 
ATOM 1363  C CG  . GLU A  1 188 ? 144.517 113.523  12.618  1.00 68.41  ?  196 GLU A CG  1 
ATOM 1364  C CD  . GLU A  1 188 ? 145.765 113.097  11.867  1.00 78.18  ?  196 GLU A CD  1 
ATOM 1365  O OE1 . GLU A  1 188 ? 145.965 113.565  10.725  1.00 80.79  ?  196 GLU A OE1 1 
ATOM 1366  O OE2 . GLU A  1 188 ? 146.544 112.288  12.414  1.00 83.78  -1 196 GLU A OE2 1 
ATOM 1367  N N   . ASP A  1 189 ? 140.645 114.646  10.502  1.00 49.08  ?  197 ASP A N   1 
ATOM 1368  C CA  . ASP A  1 189 ? 139.624 114.437  9.487   1.00 48.83  ?  197 ASP A CA  1 
ATOM 1369  C C   . ASP A  1 189 ? 140.011 113.265  8.594   1.00 48.90  ?  197 ASP A C   1 
ATOM 1370  O O   . ASP A  1 189 ? 141.102 113.244  8.017   1.00 49.37  ?  197 ASP A O   1 
ATOM 1371  C CB  . ASP A  1 189 ? 139.435 115.696  8.645   1.00 50.47  ?  197 ASP A CB  1 
ATOM 1372  C CG  . ASP A  1 189 ? 138.456 115.488  7.507   1.00 52.47  ?  197 ASP A CG  1 
ATOM 1373  O OD1 . ASP A  1 189 ? 137.234 115.521  7.759   1.00 49.01  ?  197 ASP A OD1 1 
ATOM 1374  O OD2 . ASP A  1 189 ? 138.907 115.275  6.362   1.00 59.38  -1 197 ASP A OD2 1 
ATOM 1375  N N   . GLY A  1 190 ? 139.113 112.294  8.474   1.00 49.32  ?  198 GLY A N   1 
ATOM 1376  C CA  . GLY A  1 190 ? 139.366 111.102  7.692   1.00 52.96  ?  198 GLY A CA  1 
ATOM 1377  C C   . GLY A  1 190 ? 139.642 109.861  8.511   1.00 54.63  ?  198 GLY A C   1 
ATOM 1378  O O   . GLY A  1 190 ? 139.628 108.758  7.950   1.00 58.81  ?  198 GLY A O   1 
ATOM 1379  N N   . ASP A  1 191 ? 139.903 110.001  9.809   1.00 51.34  ?  199 ASP A N   1 
ATOM 1380  C CA  . ASP A  1 191 ? 140.096 108.836  10.660  1.00 50.91  ?  199 ASP A CA  1 
ATOM 1381  C C   . ASP A  1 191 ? 138.824 107.997  10.696  1.00 49.64  ?  199 ASP A C   1 
ATOM 1382  O O   . ASP A  1 191 ? 137.715 108.500  10.500  1.00 49.00  ?  199 ASP A O   1 
ATOM 1383  C CB  . ASP A  1 191 ? 140.479 109.268  12.075  1.00 56.24  ?  199 ASP A CB  1 
ATOM 1384  C CG  . ASP A  1 191 ? 141.827 109.957  12.129  1.00 60.77  ?  199 ASP A CG  1 
ATOM 1385  O OD1 . ASP A  1 191 ? 142.351 110.328  11.056  1.00 64.87  ?  199 ASP A OD1 1 
ATOM 1386  O OD2 . ASP A  1 191 ? 142.358 110.136  13.245  1.00 61.71  -1 199 ASP A OD2 1 
ATOM 1387  N N   . MET A  1 192 ? 138.989 106.704  10.953  1.00 52.93  ?  200 MET A N   1 
ATOM 1388  C CA  . MET A  1 192 ? 137.864 105.782  10.972  1.00 51.86  ?  200 MET A CA  1 
ATOM 1389  C C   . MET A  1 192 ? 137.280 105.681  12.375  1.00 52.86  ?  200 MET A C   1 
ATOM 1390  O O   . MET A  1 192 ? 138.009 105.697  13.371  1.00 51.69  ?  200 MET A O   1 
ATOM 1391  C CB  . MET A  1 192 ? 138.289 104.400  10.476  1.00 52.58  ?  200 MET A CB  1 
ATOM 1392  C CG  . MET A  1 192 ? 138.805 104.397  9.047   1.00 56.88  ?  200 MET A CG  1 
ATOM 1393  S SD  . MET A  1 192 ? 137.606 105.059  7.873   1.00 56.84  ?  200 MET A SD  1 
ATOM 1394  C CE  . MET A  1 192 ? 136.280 103.867  8.022   1.00 53.25  ?  200 MET A CE  1 
ATOM 1395  N N   . VAL A  1 193 ? 135.957 105.587  12.444  1.00 55.95  ?  201 VAL A N   1 
ATOM 1396  C CA  . VAL A  1 193 ? 135.257 105.497  13.715  1.00 56.85  ?  201 VAL A CA  1 
ATOM 1397  C C   . VAL A  1 193 ? 135.103 104.030  14.096  1.00 59.52  ?  201 VAL A C   1 
ATOM 1398  O O   . VAL A  1 193 ? 135.266 103.127  13.273  1.00 63.98  ?  201 VAL A O   1 
ATOM 1399  C CB  . VAL A  1 193 ? 133.886 106.200  13.653  1.00 52.24  ?  201 VAL A CB  1 
ATOM 1400  C CG1 . VAL A  1 193 ? 133.443 106.646  15.041  1.00 48.86  ?  201 VAL A CG1 1 
ATOM 1401  C CG2 . VAL A  1 193 ? 133.940 107.377  12.699  1.00 59.85  ?  201 VAL A CG2 1 
ATOM 1402  N N   . ASP A  1 194 ? 134.804 103.794  15.370  1.00 57.97  ?  202 ASP A N   1 
ATOM 1403  C CA  . ASP A  1 194 ? 134.399 102.468  15.811  1.00 57.51  ?  202 ASP A CA  1 
ATOM 1404  C C   . ASP A  1 194 ? 133.162 102.025  15.039  1.00 54.32  ?  202 ASP A C   1 
ATOM 1405  O O   . ASP A  1 194 ? 132.173 102.759  14.954  1.00 53.50  ?  202 ASP A O   1 
ATOM 1406  C CB  . ASP A  1 194 ? 134.127 102.477  17.314  1.00 58.11  ?  202 ASP A CB  1 
ATOM 1407  C CG  . ASP A  1 194 ? 133.396 101.237  17.781  1.00 70.71  ?  202 ASP A CG  1 
ATOM 1408  O OD1 . ASP A  1 194 ? 133.874 100.119  17.493  1.00 74.32  ?  202 ASP A OD1 1 
ATOM 1409  O OD2 . ASP A  1 194 ? 132.340 101.383  18.433  1.00 77.04  -1 202 ASP A OD2 1 
ATOM 1410  N N   . THR A  1 195 ? 133.224 100.826  14.460  1.00 54.55  ?  203 THR A N   1 
ATOM 1411  C CA  . THR A  1 195 ? 132.162 100.331  13.594  1.00 51.70  ?  203 THR A CA  1 
ATOM 1412  C C   . THR A  1 195 ? 131.446 99.104   14.140  1.00 53.72  ?  203 THR A C   1 
ATOM 1413  O O   . THR A  1 195 ? 130.586 98.550   13.446  1.00 49.02  ?  203 THR A O   1 
ATOM 1414  C CB  . THR A  1 195 ? 132.724 100.002  12.203  1.00 47.19  ?  203 THR A CB  1 
ATOM 1415  O OG1 . THR A  1 195 ? 133.772 99.033   12.325  1.00 47.72  ?  203 THR A OG1 1 
ATOM 1416  C CG2 . THR A  1 195 ? 133.276 101.250  11.541  1.00 47.77  ?  203 THR A CG2 1 
ATOM 1417  N N   . GLY A  1 196 ? 131.763 98.669   15.357  1.00 55.85  ?  204 GLY A N   1 
ATOM 1418  C CA  . GLY A  1 196 ? 131.180 97.472   15.928  1.00 52.38  ?  204 GLY A CA  1 
ATOM 1419  C C   . GLY A  1 196 ? 132.165 96.343   16.121  1.00 49.86  ?  204 GLY A C   1 
ATOM 1420  O O   . GLY A  1 196 ? 131.804 95.319   16.715  1.00 46.85  ?  204 GLY A O   1 
ATOM 1421  N N   . TYR A  1 197 ? 133.393 96.491   15.628  1.00 49.91  ?  205 TYR A N   1 
ATOM 1422  C CA  . TYR A  1 197 ? 134.453 95.513   15.820  1.00 48.93  ?  205 TYR A CA  1 
ATOM 1423  C C   . TYR A  1 197 ? 135.471 95.948   16.864  1.00 50.03  ?  205 TYR A C   1 
ATOM 1424  O O   . TYR A  1 197 ? 136.475 95.256   17.059  1.00 50.63  ?  205 TYR A O   1 
ATOM 1425  C CB  . TYR A  1 197 ? 135.166 95.249   14.492  1.00 43.09  ?  205 TYR A CB  1 
ATOM 1426  C CG  . TYR A  1 197 ? 134.315 94.542   13.464  1.00 43.46  ?  205 TYR A CG  1 
ATOM 1427  C CD1 . TYR A  1 197 ? 134.136 93.165   13.508  1.00 47.46  ?  205 TYR A CD1 1 
ATOM 1428  C CD2 . TYR A  1 197 ? 133.690 95.252   12.448  1.00 44.26  ?  205 TYR A CD2 1 
ATOM 1429  C CE1 . TYR A  1 197 ? 133.361 92.514   12.565  1.00 49.48  ?  205 TYR A CE1 1 
ATOM 1430  C CE2 . TYR A  1 197 ? 132.913 94.612   11.502  1.00 46.82  ?  205 TYR A CE2 1 
ATOM 1431  C CZ  . TYR A  1 197 ? 132.752 93.243   11.564  1.00 49.84  ?  205 TYR A CZ  1 
ATOM 1432  O OH  . TYR A  1 197 ? 131.979 92.603   10.623  1.00 51.30  ?  205 TYR A OH  1 
ATOM 1433  N N   . GLY A  1 198 ? 135.240 97.070   17.536  1.00 53.31  ?  206 GLY A N   1 
ATOM 1434  C CA  . GLY A  1 198 ? 136.166 97.591   18.519  1.00 54.61  ?  206 GLY A CA  1 
ATOM 1435  C C   . GLY A  1 198 ? 136.997 98.739   17.973  1.00 54.86  ?  206 GLY A C   1 
ATOM 1436  O O   . GLY A  1 198 ? 137.029 99.022   16.772  1.00 56.49  ?  206 GLY A O   1 
ATOM 1437  N N   . ALA A  1 199 ? 137.678 99.416   18.891  1.00 51.69  ?  207 ALA A N   1 
ATOM 1438  C CA  . ALA A  1 199 ? 138.548 100.543  18.568  1.00 52.47  ?  207 ALA A CA  1 
ATOM 1439  C C   . ALA A  1 199 ? 139.987 100.051  18.682  1.00 53.60  ?  207 ALA A C   1 
ATOM 1440  O O   . ALA A  1 199 ? 140.564 100.035  19.774  1.00 54.05  ?  207 ALA A O   1 
ATOM 1441  C CB  . ALA A  1 199 ? 138.281 101.728  19.490  1.00 59.17  ?  207 ALA A CB  1 
ATOM 1442  N N   . MET A  1 200 ? 140.566 99.655   17.552  1.00 54.15  ?  208 MET A N   1 
ATOM 1443  C CA  . MET A  1 200 ? 141.899 99.076   17.551  1.00 58.32  ?  208 MET A CA  1 
ATOM 1444  C C   . MET A  1 200 ? 142.574 99.335   16.212  1.00 60.40  ?  208 MET A C   1 
ATOM 1445  O O   . MET A  1 200 ? 141.963 99.843   15.268  1.00 61.88  ?  208 MET A O   1 
ATOM 1446  C CB  . MET A  1 200 ? 141.844 97.572   17.833  1.00 54.13  ?  208 MET A CB  1 
ATOM 1447  C CG  . MET A  1 200 ? 140.739 96.858   17.071  1.00 58.87  ?  208 MET A CG  1 
ATOM 1448  S SD  . MET A  1 200 ? 140.961 95.072   16.973  1.00 67.85  ?  208 MET A SD  1 
ATOM 1449  C CE  . MET A  1 200 ? 142.410 94.974   15.927  1.00 76.71  ?  208 MET A CE  1 
ATOM 1450  N N   . ASP A  1 201 ? 143.856 98.971   16.147  1.00 54.38  ?  209 ASP A N   1 
ATOM 1451  C CA  . ASP A  1 201 ? 144.661 99.091   14.931  1.00 57.91  ?  209 ASP A CA  1 
ATOM 1452  C C   . ASP A  1 201 ? 144.537 97.771   14.183  1.00 56.95  ?  209 ASP A C   1 
ATOM 1453  O O   . ASP A  1 201 ? 145.258 96.808   14.448  1.00 62.13  ?  209 ASP A O   1 
ATOM 1454  C CB  . ASP A  1 201 ? 146.108 99.422   15.276  1.00 60.14  ?  209 ASP A CB  1 
ATOM 1455  C CG  . ASP A  1 201 ? 146.926 99.840   14.064  1.00 68.68  ?  209 ASP A CG  1 
ATOM 1456  O OD1 . ASP A  1 201 ? 146.537 99.502   12.926  1.00 74.30  ?  209 ASP A OD1 1 
ATOM 1457  O OD2 . ASP A  1 201 ? 147.967 100.507  14.252  1.00 68.70  -1 209 ASP A OD2 1 
ATOM 1458  N N   . PHE A  1 202 ? 143.599 97.724   13.237  1.00 54.65  ?  210 PHE A N   1 
ATOM 1459  C CA  . PHE A  1 202 ? 143.358 96.490   12.498  1.00 54.18  ?  210 PHE A CA  1 
ATOM 1460  C C   . PHE A  1 202 ? 144.513 96.154   11.566  1.00 59.97  ?  210 PHE A C   1 
ATOM 1461  O O   . PHE A  1 202 ? 144.737 94.977   11.259  1.00 67.06  ?  210 PHE A O   1 
ATOM 1462  C CB  . PHE A  1 202 ? 142.048 96.601   11.722  1.00 53.44  ?  210 PHE A CB  1 
ATOM 1463  C CG  . PHE A  1 202 ? 140.834 96.656   12.602  1.00 52.83  ?  210 PHE A CG  1 
ATOM 1464  C CD1 . PHE A  1 202 ? 140.158 95.500   12.949  1.00 52.63  ?  210 PHE A CD1 1 
ATOM 1465  C CD2 . PHE A  1 202 ? 140.378 97.867   13.098  1.00 52.51  ?  210 PHE A CD2 1 
ATOM 1466  C CE1 . PHE A  1 202 ? 139.047 95.550   13.763  1.00 52.12  ?  210 PHE A CE1 1 
ATOM 1467  C CE2 . PHE A  1 202 ? 139.269 97.923   13.913  1.00 52.00  ?  210 PHE A CE2 1 
ATOM 1468  C CZ  . PHE A  1 202 ? 138.601 96.764   14.246  1.00 51.81  ?  210 PHE A CZ  1 
ATOM 1469  N N   . LYS A  1 203 ? 145.254 97.165   11.109  1.00 56.22  ?  211 LYS A N   1 
ATOM 1470  C CA  . LYS A  1 203 ? 146.390 96.915   10.229  1.00 60.35  ?  211 LYS A CA  1 
ATOM 1471  C C   . LYS A  1 203 ? 147.536 96.250   10.980  1.00 65.19  ?  211 LYS A C   1 
ATOM 1472  O O   . LYS A  1 203 ? 148.235 95.394   10.426  1.00 74.61  ?  211 LYS A O   1 
ATOM 1473  C CB  . LYS A  1 203 ? 146.850 98.224   9.589   1.00 57.67  ?  211 LYS A CB  1 
ATOM 1474  C CG  . LYS A  1 203 ? 147.955 98.064   8.564   1.00 59.37  ?  211 LYS A CG  1 
ATOM 1475  C CD  . LYS A  1 203 ? 148.312 99.402   7.943   1.00 64.57  ?  211 LYS A CD  1 
ATOM 1476  C CE  . LYS A  1 203 ? 149.354 99.246   6.849   1.00 68.93  ?  211 LYS A CE  1 
ATOM 1477  N NZ  . LYS A  1 203 ? 149.683 100.554  6.215   1.00 72.05  1  211 LYS A NZ  1 
ATOM 1478  N N   . LEU A  1 204 ? 147.739 96.625   12.243  1.00 60.67  ?  212 LEU A N   1 
ATOM 1479  C CA  . LEU A  1 204 ? 148.868 96.128   13.021  1.00 66.16  ?  212 LEU A CA  1 
ATOM 1480  C C   . LEU A  1 204 ? 148.537 94.875   13.817  1.00 71.31  ?  212 LEU A C   1 
ATOM 1481  O O   . LEU A  1 204 ? 149.438 94.077   14.102  1.00 76.47  ?  212 LEU A O   1 
ATOM 1482  C CB  . LEU A  1 204 ? 149.371 97.212   13.977  1.00 61.24  ?  212 LEU A CB  1 
ATOM 1483  C CG  . LEU A  1 204 ? 150.518 98.099   13.487  1.00 68.95  ?  212 LEU A CG  1 
ATOM 1484  C CD1 . LEU A  1 204 ? 150.198 98.731   12.140  1.00 72.79  ?  212 LEU A CD1 1 
ATOM 1485  C CD2 . LEU A  1 204 ? 150.836 99.167   14.521  1.00 71.22  ?  212 LEU A CD2 1 
ATOM 1486  N N   . LEU A  1 205 ? 147.273 94.681   14.186  1.00 68.75  ?  213 LEU A N   1 
ATOM 1487  C CA  . LEU A  1 205 ? 146.873 93.558   15.020  1.00 65.12  ?  213 LEU A CA  1 
ATOM 1488  C C   . LEU A  1 205 ? 146.220 92.430   14.233  1.00 59.74  ?  213 LEU A C   1 
ATOM 1489  O O   . LEU A  1 205 ? 145.875 91.401   14.824  1.00 57.32  ?  213 LEU A O   1 
ATOM 1490  C CB  . LEU A  1 205 ? 145.924 94.039   16.122  1.00 61.06  ?  213 LEU A CB  1 
ATOM 1491  C CG  . LEU A  1 205 ? 146.552 94.927   17.197  1.00 60.50  ?  213 LEU A CG  1 
ATOM 1492  C CD1 . LEU A  1 205 ? 145.505 95.378   18.200  1.00 59.18  ?  213 LEU A CD1 1 
ATOM 1493  C CD2 . LEU A  1 205 ? 147.684 94.192   17.894  1.00 61.80  ?  213 LEU A CD2 1 
ATOM 1494  N N   . GLN A  1 206 ? 146.045 92.589   12.920  1.00 59.40  ?  214 GLN A N   1 
ATOM 1495  C CA  . GLN A  1 206 ? 145.450 91.546   12.079  1.00 59.06  ?  214 GLN A CA  1 
ATOM 1496  C C   . GLN A  1 206 ? 146.286 91.433   10.805  1.00 63.10  ?  214 GLN A C   1 
ATOM 1497  O O   . GLN A  1 206 ? 146.014 92.109   9.808   1.00 64.99  ?  214 GLN A O   1 
ATOM 1498  C CB  . GLN A  1 206 ? 143.990 91.848   11.771  1.00 59.91  ?  214 GLN A CB  1 
ATOM 1499  C CG  . GLN A  1 206 ? 143.089 91.840   12.991  1.00 57.33  ?  214 GLN A CG  1 
ATOM 1500  C CD  . GLN A  1 206 ? 141.660 92.207   12.658  1.00 60.42  ?  214 GLN A CD  1 
ATOM 1501  O OE1 . GLN A  1 206 ? 141.355 92.600   11.533  1.00 66.59  ?  214 GLN A OE1 1 
ATOM 1502  N NE2 . GLN A  1 206 ? 140.774 92.086   13.640  1.00 61.15  ?  214 GLN A NE2 1 
ATOM 1503  N N   . ASP A  1 207 ? 147.299 90.563   10.843  1.00 60.12  ?  215 ASP A N   1 
ATOM 1504  C CA  . ASP A  1 207 ? 148.076 90.245   9.652   1.00 61.65  ?  215 ASP A CA  1 
ATOM 1505  C C   . ASP A  1 207 ? 147.258 89.497   8.609   1.00 61.40  ?  215 ASP A C   1 
ATOM 1506  O O   . ASP A  1 207 ? 147.702 89.383   7.461   1.00 62.54  ?  215 ASP A O   1 
ATOM 1507  C CB  . ASP A  1 207 ? 149.305 89.415   10.031  1.00 66.20  ?  215 ASP A CB  1 
ATOM 1508  C CG  . ASP A  1 207 ? 150.091 90.020   11.180  1.00 66.94  ?  215 ASP A CG  1 
ATOM 1509  O OD1 . ASP A  1 207 ? 149.910 91.223   11.465  1.00 64.32  ?  215 ASP A OD1 1 
ATOM 1510  O OD2 . ASP A  1 207 ? 150.893 89.288   11.798  1.00 68.51  -1 215 ASP A OD2 1 
ATOM 1511  N N   . ASN A  1 208 ? 146.086 88.983   8.987   1.00 62.07  ?  216 ASN A N   1 
ATOM 1512  C CA  . ASN A  1 208 ? 145.245 88.236   8.059   1.00 59.23  ?  216 ASN A CA  1 
ATOM 1513  C C   . ASN A  1 208 ? 144.787 89.093   6.886   1.00 57.94  ?  216 ASN A C   1 
ATOM 1514  O O   . ASN A  1 208 ? 144.652 88.588   5.765   1.00 59.14  ?  216 ASN A O   1 
ATOM 1515  C CB  . ASN A  1 208 ? 144.036 87.674   8.805   1.00 56.77  ?  216 ASN A CB  1 
ATOM 1516  C CG  . ASN A  1 208 ? 143.412 86.501   8.097   1.00 71.88  ?  216 ASN A CG  1 
ATOM 1517  O OD1 . ASN A  1 208 ? 143.778 86.182   6.967   1.00 82.89  ?  216 ASN A OD1 1 
ATOM 1518  N ND2 . ASN A  1 208 ? 142.463 85.846   8.756   1.00 75.21  ?  216 ASN A ND2 1 
ATOM 1519  N N   . LYS A  1 209 ? 144.545 90.384   7.124   1.00 66.75  ?  217 LYS A N   1 
ATOM 1520  C CA  . LYS A  1 209 ? 143.906 91.266   6.147   1.00 65.12  ?  217 LYS A CA  1 
ATOM 1521  C C   . LYS A  1 209 ? 142.560 90.709   5.692   1.00 65.09  ?  217 LYS A C   1 
ATOM 1522  O O   . LYS A  1 209 ? 142.164 90.877   4.536   1.00 60.15  ?  217 LYS A O   1 
ATOM 1523  C CB  . LYS A  1 209 ? 144.813 91.522   4.939   1.00 58.71  ?  217 LYS A CB  1 
ATOM 1524  C CG  . LYS A  1 209 ? 146.101 92.255   5.268   1.00 60.27  ?  217 LYS A CG  1 
ATOM 1525  C CD  . LYS A  1 209 ? 146.840 92.662   4.002   1.00 63.89  ?  217 LYS A CD  1 
ATOM 1526  C CE  . LYS A  1 209 ? 148.097 93.452   4.326   1.00 69.44  ?  217 LYS A CE  1 
ATOM 1527  N NZ  . LYS A  1 209 ? 148.846 93.831   3.096   1.00 77.34  1  217 LYS A NZ  1 
ATOM 1528  N N   . SER A  1 210 ? 141.844 90.038   6.606   1.00 69.02  ?  218 SER A N   1 
ATOM 1529  C CA  . SER A  1 210 ? 140.603 89.376   6.222   1.00 64.30  ?  218 SER A CA  1 
ATOM 1530  C C   . SER A  1 210 ? 139.606 89.217   7.367   1.00 53.56  ?  218 SER A C   1 
ATOM 1531  O O   . SER A  1 210 ? 138.637 88.465   7.206   1.00 51.27  ?  218 SER A O   1 
ATOM 1532  C CB  . SER A  1 210 ? 140.915 87.999   5.615   1.00 64.72  ?  218 SER A CB  1 
ATOM 1533  O OG  . SER A  1 210 ? 141.690 88.122   4.432   1.00 65.29  ?  218 SER A OG  1 
ATOM 1534  N N   . GLU A  1 211 ? 139.795 89.881   8.508   1.00 56.53  ?  219 GLU A N   1 
ATOM 1535  C CA  . GLU A  1 211 ? 138.873 89.747   9.632   1.00 55.27  ?  219 GLU A CA  1 
ATOM 1536  C C   . GLU A  1 211 ? 137.746 90.770   9.604   1.00 54.08  ?  219 GLU A C   1 
ATOM 1537  O O   . GLU A  1 211 ? 136.663 90.500   10.137  1.00 53.10  ?  219 GLU A O   1 
ATOM 1538  C CB  . GLU A  1 211 ? 139.626 89.869   10.961  1.00 58.19  ?  219 GLU A CB  1 
ATOM 1539  C CG  . GLU A  1 211 ? 140.798 88.913   11.121  1.00 67.15  ?  219 GLU A CG  1 
ATOM 1540  C CD  . GLU A  1 211 ? 140.356 87.522   11.542  1.00 69.39  ?  219 GLU A CD  1 
ATOM 1541  O OE1 . GLU A  1 211 ? 139.433 87.422   12.377  1.00 72.09  ?  219 GLU A OE1 1 
ATOM 1542  O OE2 . GLU A  1 211 ? 140.931 86.530   11.044  1.00 67.80  -1 219 GLU A OE2 1 
ATOM 1543  N N   . VAL A  1 212 ? 137.976 91.933   9.006   1.00 57.96  ?  220 VAL A N   1 
ATOM 1544  C CA  . VAL A  1 212 ? 136.987 93.009   8.977   1.00 51.20  ?  220 VAL A CA  1 
ATOM 1545  C C   . VAL A  1 212 ? 136.885 93.522   7.547   1.00 51.79  ?  220 VAL A C   1 
ATOM 1546  O O   . VAL A  1 212 ? 137.788 93.291   6.727   1.00 54.47  ?  220 VAL A O   1 
ATOM 1547  C CB  . VAL A  1 212 ? 137.356 94.145   9.960   1.00 48.08  ?  220 VAL A CB  1 
ATOM 1548  C CG1 . VAL A  1 212 ? 137.079 93.714   11.387  1.00 47.42  ?  220 VAL A CG1 1 
ATOM 1549  C CG2 . VAL A  1 212 ? 138.813 94.519   9.801   1.00 49.27  ?  220 VAL A CG2 1 
ATOM 1550  N N   . PRO A  1 213 ? 135.790 94.205   7.206   1.00 49.48  ?  221 PRO A N   1 
ATOM 1551  C CA  . PRO A  1 213 ? 135.609 94.664   5.822   1.00 49.97  ?  221 PRO A CA  1 
ATOM 1552  C C   . PRO A  1 213 ? 136.722 95.601   5.375   1.00 50.84  ?  221 PRO A C   1 
ATOM 1553  O O   . PRO A  1 213 ? 137.537 96.086   6.163   1.00 50.96  ?  221 PRO A O   1 
ATOM 1554  C CB  . PRO A  1 213 ? 134.255 95.379   5.859   1.00 46.90  ?  221 PRO A CB  1 
ATOM 1555  C CG  . PRO A  1 213 ? 133.531 94.743   6.986   1.00 46.52  ?  221 PRO A CG  1 
ATOM 1556  C CD  . PRO A  1 213 ? 134.577 94.425   8.015   1.00 46.61  ?  221 PRO A CD  1 
ATOM 1557  N N   . LEU A  1 214 ? 136.735 95.857   4.062   1.00 53.92  ?  222 LEU A N   1 
ATOM 1558  C CA  . LEU A  1 214 ? 137.794 96.658   3.451   1.00 53.25  ?  222 LEU A CA  1 
ATOM 1559  C C   . LEU A  1 214 ? 137.858 98.066   4.029   1.00 51.34  ?  222 LEU A C   1 
ATOM 1560  O O   . LEU A  1 214 ? 138.910 98.712   3.964   1.00 51.14  ?  222 LEU A O   1 
ATOM 1561  C CB  . LEU A  1 214 ? 137.593 96.721   1.935   1.00 48.37  ?  222 LEU A CB  1 
ATOM 1562  C CG  . LEU A  1 214 ? 137.607 95.394   1.174   1.00 49.11  ?  222 LEU A CG  1 
ATOM 1563  C CD1 . LEU A  1 214 ? 137.002 95.566   -0.210  1.00 50.07  ?  222 LEU A CD1 1 
ATOM 1564  C CD2 . LEU A  1 214 ? 139.023 94.850   1.073   1.00 51.43  ?  222 LEU A CD2 1 
ATOM 1565  N N   . ASP A  1 215 ? 136.742 98.563   4.570   1.00 52.85  ?  223 ASP A N   1 
ATOM 1566  C CA  . ASP A  1 215 ? 136.720 99.892   5.174   1.00 50.22  ?  223 ASP A CA  1 
ATOM 1567  C C   . ASP A  1 215 ? 137.831 100.071  6.199   1.00 53.65  ?  223 ASP A C   1 
ATOM 1568  O O   . ASP A  1 215 ? 138.468 101.129  6.257   1.00 60.30  ?  223 ASP A O   1 
ATOM 1569  C CB  . ASP A  1 215 ? 135.362 100.146  5.828   1.00 50.50  ?  223 ASP A CB  1 
ATOM 1570  C CG  . ASP A  1 215 ? 134.387 100.821  4.895   1.00 58.17  ?  223 ASP A CG  1 
ATOM 1571  O OD1 . ASP A  1 215 ? 134.825 101.279  3.822   1.00 64.62  ?  223 ASP A OD1 1 
ATOM 1572  O OD2 . ASP A  1 215 ? 133.188 100.905  5.237   1.00 59.20  -1 223 ASP A OD2 1 
ATOM 1573  N N   . ILE A  1 216 ? 138.077 99.048   7.019   1.00 49.66  ?  224 ILE A N   1 
ATOM 1574  C CA  . ILE A  1 216 ? 138.925 99.185   8.196   1.00 52.77  ?  224 ILE A CA  1 
ATOM 1575  C C   . ILE A  1 216 ? 140.018 98.130   8.267   1.00 55.96  ?  224 ILE A C   1 
ATOM 1576  O O   . ILE A  1 216 ? 140.828 98.162   9.195   1.00 61.29  ?  224 ILE A O   1 
ATOM 1577  C CB  . ILE A  1 216 ? 138.085 99.163   9.489   1.00 44.76  ?  224 ILE A CB  1 
ATOM 1578  C CG1 . ILE A  1 216 ? 137.264 97.876   9.560   1.00 44.56  ?  224 ILE A CG1 1 
ATOM 1579  C CG2 . ILE A  1 216 ? 137.173 100.378  9.548   1.00 44.41  ?  224 ILE A CG2 1 
ATOM 1580  C CD1 . ILE A  1 216 ? 136.314 97.821   10.725  1.00 44.07  ?  224 ILE A CD1 1 
ATOM 1581  N N   . CYS A  1 217 ? 140.068 97.189   7.320   1.00 52.29  ?  225 CYS A N   1 
ATOM 1582  C CA  . CYS A  1 217 ? 141.004 96.072   7.421   1.00 55.46  ?  225 CYS A CA  1 
ATOM 1583  C C   . CYS A  1 217 ? 142.463 96.520   7.428   1.00 57.02  ?  225 CYS A C   1 
ATOM 1584  O O   . CYS A  1 217 ? 143.334 95.745   7.838   1.00 59.44  ?  225 CYS A O   1 
ATOM 1585  C CB  . CYS A  1 217 ? 140.750 95.074   6.287   1.00 54.95  ?  225 CYS A CB  1 
ATOM 1586  S SG  . CYS A  1 217 ? 141.402 95.552   4.676   1.00 59.28  ?  225 CYS A SG  1 
ATOM 1587  N N   . GLN A  1 218 ? 142.752 97.741   6.981   1.00 55.34  ?  226 GLN A N   1 
ATOM 1588  C CA  . GLN A  1 218 ? 144.104 98.286   7.016   1.00 56.59  ?  226 GLN A CA  1 
ATOM 1589  C C   . GLN A  1 218 ? 144.105 99.707   7.568   1.00 58.00  ?  226 GLN A C   1 
ATOM 1590  O O   . GLN A  1 218 ? 144.912 100.542  7.149   1.00 61.02  ?  226 GLN A O   1 
ATOM 1591  C CB  . GLN A  1 218 ? 144.748 98.245   5.629   1.00 54.99  ?  226 GLN A CB  1 
ATOM 1592  C CG  . GLN A  1 218 ? 145.076 96.841   5.140   1.00 55.37  ?  226 GLN A CG  1 
ATOM 1593  C CD  . GLN A  1 218 ? 146.300 96.253   5.820   1.00 60.38  ?  226 GLN A CD  1 
ATOM 1594  O OE1 . GLN A  1 218 ? 147.427 96.689   5.581   1.00 66.13  ?  226 GLN A OE1 1 
ATOM 1595  N NE2 . GLN A  1 218 ? 146.083 95.262   6.677   1.00 58.43  ?  226 GLN A NE2 1 
ATOM 1596  N N   . SER A  1 219 ? 143.211 99.994   8.514   1.00 60.80  ?  227 SER A N   1 
ATOM 1597  C CA  . SER A  1 219 ? 143.066 101.323  9.092   1.00 57.07  ?  227 SER A CA  1 
ATOM 1598  C C   . SER A  1 219 ? 142.981 101.213  10.611  1.00 53.53  ?  227 SER A C   1 
ATOM 1599  O O   . SER A  1 219 ? 143.085 100.126  11.188  1.00 54.96  ?  227 SER A O   1 
ATOM 1600  C CB  . SER A  1 219 ? 141.827 102.036  8.534   1.00 52.23  ?  227 SER A CB  1 
ATOM 1601  O OG  . SER A  1 219 ? 141.966 102.303  7.149   1.00 57.69  ?  227 SER A OG  1 
ATOM 1602  N N   . ILE A  1 220 ? 142.786 102.356  11.262  1.00 55.31  ?  228 ILE A N   1 
ATOM 1603  C CA  . ILE A  1 220 ? 142.663 102.440  12.711  1.00 54.11  ?  228 ILE A CA  1 
ATOM 1604  C C   . ILE A  1 220 ? 141.286 102.994  13.046  1.00 52.97  ?  228 ILE A C   1 
ATOM 1605  O O   . ILE A  1 220 ? 140.881 104.030  12.506  1.00 57.35  ?  228 ILE A O   1 
ATOM 1606  C CB  . ILE A  1 220 ? 143.766 103.319  13.329  1.00 48.93  ?  228 ILE A CB  1 
ATOM 1607  C CG1 . ILE A  1 220 ? 145.139 102.677  13.136  1.00 49.53  ?  228 ILE A CG1 1 
ATOM 1608  C CG2 . ILE A  1 220 ? 143.491 103.574  14.804  1.00 48.65  ?  228 ILE A CG2 1 
ATOM 1609  C CD1 . ILE A  1 220 ? 146.250 103.398  13.866  1.00 49.95  ?  228 ILE A CD1 1 
ATOM 1610  N N   . CYS A  1 221 ? 140.572 102.305  13.932  1.00 53.43  ?  229 CYS A N   1 
ATOM 1611  C CA  . CYS A  1 221 ? 139.287 102.770  14.439  1.00 53.38  ?  229 CYS A CA  1 
ATOM 1612  C C   . CYS A  1 221 ? 139.506 103.441  15.788  1.00 53.64  ?  229 CYS A C   1 
ATOM 1613  O O   . CYS A  1 221 ? 140.009 102.811  16.725  1.00 55.27  ?  229 CYS A O   1 
ATOM 1614  C CB  . CYS A  1 221 ? 138.294 101.617  14.566  1.00 58.14  ?  229 CYS A CB  1 
ATOM 1615  S SG  . CYS A  1 221 ? 137.690 100.995  12.991  1.00 64.67  ?  229 CYS A SG  1 
ATOM 1616  N N   . LYS A  1 222 ? 139.141 104.716  15.879  1.00 55.97  ?  230 LYS A N   1 
ATOM 1617  C CA  . LYS A  1 222 ? 139.319 105.501  17.091  1.00 54.61  ?  230 LYS A CA  1 
ATOM 1618  C C   . LYS A  1 222 ? 137.966 105.808  17.720  1.00 53.92  ?  230 LYS A C   1 
ATOM 1619  O O   . LYS A  1 222 ? 136.987 106.076  17.017  1.00 56.82  ?  230 LYS A O   1 
ATOM 1620  C CB  . LYS A  1 222 ? 140.061 106.806  16.793  1.00 50.72  ?  230 LYS A CB  1 
ATOM 1621  C CG  . LYS A  1 222 ? 141.466 106.618  16.250  1.00 54.03  ?  230 LYS A CG  1 
ATOM 1622  C CD  . LYS A  1 222 ? 142.181 107.952  16.121  1.00 58.47  ?  230 LYS A CD  1 
ATOM 1623  C CE  . LYS A  1 222 ? 143.547 107.791  15.476  1.00 60.82  ?  230 LYS A CE  1 
ATOM 1624  N NZ  . LYS A  1 222 ? 144.274 109.089  15.400  1.00 59.94  1  230 LYS A NZ  1 
ATOM 1625  N N   . TYR A  1 223 ? 137.921 105.763  19.049  1.00 53.04  ?  231 TYR A N   1 
ATOM 1626  C CA  . TYR A  1 223 ? 136.753 106.146  19.818  1.00 52.51  ?  231 TYR A CA  1 
ATOM 1627  C C   . TYR A  1 223 ? 137.120 107.320  20.714  1.00 54.79  ?  231 TYR A C   1 
ATOM 1628  O O   . TYR A  1 223 ? 138.188 107.297  21.344  1.00 59.22  ?  231 TYR A O   1 
ATOM 1629  C CB  . TYR A  1 223 ? 136.245 104.964  20.662  1.00 61.10  ?  231 TYR A CB  1 
ATOM 1630  C CG  . TYR A  1 223 ? 134.909 105.188  21.334  1.00 58.58  ?  231 TYR A CG  1 
ATOM 1631  C CD1 . TYR A  1 223 ? 133.748 105.336  20.585  1.00 58.53  ?  231 TYR A CD1 1 
ATOM 1632  C CD2 . TYR A  1 223 ? 134.802 105.217  22.719  1.00 55.56  ?  231 TYR A CD2 1 
ATOM 1633  C CE1 . TYR A  1 223 ? 132.523 105.531  21.197  1.00 57.59  ?  231 TYR A CE1 1 
ATOM 1634  C CE2 . TYR A  1 223 ? 133.582 105.407  23.338  1.00 53.34  ?  231 TYR A CE2 1 
ATOM 1635  C CZ  . TYR A  1 223 ? 132.446 105.563  22.573  1.00 52.84  ?  231 TYR A CZ  1 
ATOM 1636  O OH  . TYR A  1 223 ? 131.230 105.755  23.186  1.00 51.65  ?  231 TYR A OH  1 
ATOM 1637  N N   . PRO A  1 224 ? 136.291 108.360  20.793  1.00 51.84  ?  232 PRO A N   1 
ATOM 1638  C CA  . PRO A  1 224 ? 136.657 109.534  21.596  1.00 52.08  ?  232 PRO A CA  1 
ATOM 1639  C C   . PRO A  1 224 ? 136.828 109.167  23.063  1.00 55.74  ?  232 PRO A C   1 
ATOM 1640  O O   . PRO A  1 224 ? 135.991 108.479  23.651  1.00 57.52  ?  232 PRO A O   1 
ATOM 1641  C CB  . PRO A  1 224 ? 135.480 110.492  21.384  1.00 46.37  ?  232 PRO A CB  1 
ATOM 1642  C CG  . PRO A  1 224 ? 134.831 110.029  20.120  1.00 46.13  ?  232 PRO A CG  1 
ATOM 1643  C CD  . PRO A  1 224 ? 135.001 108.543  20.109  1.00 45.98  ?  232 PRO A CD  1 
ATOM 1644  N N   . ASP A  1 225 ? 137.932 109.628  23.650  1.00 57.16  ?  233 ASP A N   1 
ATOM 1645  C CA  . ASP A  1 225 ? 138.231 109.350  25.054  1.00 57.51  ?  233 ASP A CA  1 
ATOM 1646  C C   . ASP A  1 225 ? 137.521 110.397  25.905  1.00 59.47  ?  233 ASP A C   1 
ATOM 1647  O O   . ASP A  1 225 ? 138.115 111.357  26.403  1.00 56.56  ?  233 ASP A O   1 
ATOM 1648  C CB  . ASP A  1 225 ? 139.735 109.344  25.297  1.00 59.29  ?  233 ASP A CB  1 
ATOM 1649  C CG  . ASP A  1 225 ? 140.117 108.591  26.558  1.00 66.10  ?  233 ASP A CG  1 
ATOM 1650  O OD1 . ASP A  1 225 ? 139.212 108.262  27.354  1.00 70.05  ?  233 ASP A OD1 1 
ATOM 1651  O OD2 . ASP A  1 225 ? 141.323 108.332  26.756  1.00 68.88  -1 233 ASP A OD2 1 
ATOM 1652  N N   . TYR A  1 226 ? 136.207 110.204  26.059  1.00 58.90  ?  234 TYR A N   1 
ATOM 1653  C CA  . TYR A  1 226 ? 135.414 111.110  26.885  1.00 58.53  ?  234 TYR A CA  1 
ATOM 1654  C C   . TYR A  1 226 ? 135.921 111.145  28.321  1.00 56.35  ?  234 TYR A C   1 
ATOM 1655  O O   . TYR A  1 226 ? 135.866 112.195  28.973  1.00 58.48  ?  234 TYR A O   1 
ATOM 1656  C CB  . TYR A  1 226 ? 133.943 110.695  26.865  1.00 60.29  ?  234 TYR A CB  1 
ATOM 1657  C CG  . TYR A  1 226 ? 133.346 110.500  25.487  1.00 60.98  ?  234 TYR A CG  1 
ATOM 1658  C CD1 . TYR A  1 226 ? 133.173 111.573  24.622  1.00 59.32  ?  234 TYR A CD1 1 
ATOM 1659  C CD2 . TYR A  1 226 ? 132.930 109.243  25.062  1.00 61.87  ?  234 TYR A CD2 1 
ATOM 1660  C CE1 . TYR A  1 226 ? 132.615 111.397  23.366  1.00 57.36  ?  234 TYR A CE1 1 
ATOM 1661  C CE2 . TYR A  1 226 ? 132.371 109.058  23.810  1.00 59.72  ?  234 TYR A CE2 1 
ATOM 1662  C CZ  . TYR A  1 226 ? 132.216 110.138  22.966  1.00 57.53  ?  234 TYR A CZ  1 
ATOM 1663  O OH  . TYR A  1 226 ? 131.662 109.957  21.720  1.00 55.51  ?  234 TYR A OH  1 
ATOM 1664  N N   . LEU A  1 227 ? 136.414 110.012  28.827  1.00 56.55  ?  235 LEU A N   1 
ATOM 1665  C CA  . LEU A  1 227 ? 136.920 109.963  30.195  1.00 58.05  ?  235 LEU A CA  1 
ATOM 1666  C C   . LEU A  1 227 ? 138.126 110.876  30.368  1.00 61.05  ?  235 LEU A C   1 
ATOM 1667  O O   . LEU A  1 227 ? 138.252 111.566  31.387  1.00 62.19  ?  235 LEU A O   1 
ATOM 1668  C CB  . LEU A  1 227 ? 137.279 108.523  30.571  1.00 57.80  ?  235 LEU A CB  1 
ATOM 1669  C CG  . LEU A  1 227 ? 136.214 107.644  31.236  1.00 57.08  ?  235 LEU A CG  1 
ATOM 1670  C CD1 . LEU A  1 227 ? 134.877 107.722  30.514  1.00 56.50  ?  235 LEU A CD1 1 
ATOM 1671  C CD2 . LEU A  1 227 ? 136.693 106.204  31.313  1.00 57.53  ?  235 LEU A CD2 1 
ATOM 1672  N N   . GLN A  1 228 ? 139.022 110.895  29.381  1.00 60.82  ?  236 GLN A N   1 
ATOM 1673  C CA  . GLN A  1 228 ? 140.219 111.723  29.470  1.00 63.72  ?  236 GLN A CA  1 
ATOM 1674  C C   . GLN A  1 228 ? 139.910 113.191  29.197  1.00 66.04  ?  236 GLN A C   1 
ATOM 1675  O O   . GLN A  1 228 ? 140.426 114.075  29.890  1.00 71.68  ?  236 GLN A O   1 
ATOM 1676  C CB  . GLN A  1 228 ? 141.280 111.207  28.495  1.00 61.36  ?  236 GLN A CB  1 
ATOM 1677  C CG  . GLN A  1 228 ? 142.638 111.876  28.629  1.00 69.15  ?  236 GLN A CG  1 
ATOM 1678  C CD  . GLN A  1 228 ? 142.844 113.000  27.630  1.00 71.71  ?  236 GLN A CD  1 
ATOM 1679  O OE1 . GLN A  1 228 ? 141.903 113.449  26.975  1.00 67.32  ?  236 GLN A OE1 1 
ATOM 1680  N NE2 . GLN A  1 228 ? 144.084 113.460  27.507  1.00 78.21  ?  236 GLN A NE2 1 
ATOM 1681  N N   . MET A  1 229 ? 139.078 113.470  28.191  1.00 62.10  ?  237 MET A N   1 
ATOM 1682  C CA  . MET A  1 229 ? 138.762 114.854  27.855  1.00 62.57  ?  237 MET A CA  1 
ATOM 1683  C C   . MET A  1 229 ? 137.917 115.524  28.932  1.00 62.80  ?  237 MET A C   1 
ATOM 1684  O O   . MET A  1 229 ? 138.028 116.738  29.135  1.00 65.63  ?  237 MET A O   1 
ATOM 1685  C CB  . MET A  1 229 ? 138.045 114.916  26.506  1.00 61.90  ?  237 MET A CB  1 
ATOM 1686  C CG  . MET A  1 229 ? 138.920 114.550  25.320  1.00 63.93  ?  237 MET A CG  1 
ATOM 1687  S SD  . MET A  1 229 ? 138.067 114.767  23.747  1.00 64.08  ?  237 MET A SD  1 
ATOM 1688  C CE  . MET A  1 229 ? 136.664 113.677  23.968  1.00 65.43  ?  237 MET A CE  1 
ATOM 1689  N N   . SER A  1 230 ? 137.072 114.761  29.628  1.00 60.71  ?  238 SER A N   1 
ATOM 1690  C CA  . SER A  1 230 ? 136.263 115.342  30.694  1.00 63.83  ?  238 SER A CA  1 
ATOM 1691  C C   . SER A  1 230 ? 137.067 115.573  31.968  1.00 66.93  ?  238 SER A C   1 
ATOM 1692  O O   . SER A  1 230 ? 136.775 116.511  32.718  1.00 65.01  ?  238 SER A O   1 
ATOM 1693  C CB  . SER A  1 230 ? 135.057 114.447  30.985  1.00 65.12  ?  238 SER A CB  1 
ATOM 1694  O OG  . SER A  1 230 ? 135.356 113.491  31.987  1.00 67.51  ?  238 SER A OG  1 
ATOM 1695  N N   . ALA A  1 231 ? 138.080 114.746  32.223  1.00 63.19  ?  239 ALA A N   1 
ATOM 1696  C CA  . ALA A  1 231 ? 138.963 114.935  33.366  1.00 60.62  ?  239 ALA A CA  1 
ATOM 1697  C C   . ALA A  1 231 ? 140.081 115.931  33.092  1.00 68.38  ?  239 ALA A C   1 
ATOM 1698  O O   . ALA A  1 231 ? 140.958 116.100  33.945  1.00 71.93  ?  239 ALA A O   1 
ATOM 1699  C CB  . ALA A  1 231 ? 139.563 113.594  33.798  1.00 59.42  ?  239 ALA A CB  1 
ATOM 1700  N N   . ASP A  1 232 ? 140.073 116.577  31.927  1.00 70.91  ?  240 ASP A N   1 
ATOM 1701  C CA  . ASP A  1 232 ? 141.086 117.569  31.597  1.00 74.61  ?  240 ASP A CA  1 
ATOM 1702  C C   . ASP A  1 232 ? 141.071 118.711  32.607  1.00 77.92  ?  240 ASP A C   1 
ATOM 1703  O O   . ASP A  1 232 ? 140.027 119.077  33.154  1.00 80.42  ?  240 ASP A O   1 
ATOM 1704  C CB  . ASP A  1 232 ? 140.849 118.114  30.186  1.00 70.12  ?  240 ASP A CB  1 
ATOM 1705  C CG  . ASP A  1 232 ? 142.055 118.848  29.628  1.00 78.94  ?  240 ASP A CG  1 
ATOM 1706  O OD1 . ASP A  1 232 ? 142.864 119.380  30.416  1.00 84.13  ?  240 ASP A OD1 1 
ATOM 1707  O OD2 . ASP A  1 232 ? 142.189 118.897  28.388  1.00 83.21  -1 240 ASP A OD2 1 
ATOM 1708  N N   . ALA A  1 233 ? 142.255 119.272  32.856  1.00 71.48  ?  241 ALA A N   1 
ATOM 1709  C CA  . ALA A  1 233 ? 142.373 120.376  33.802  1.00 74.99  ?  241 ALA A CA  1 
ATOM 1710  C C   . ALA A  1 233 ? 141.664 121.619  33.278  1.00 75.80  ?  241 ALA A C   1 
ATOM 1711  O O   . ALA A  1 233 ? 140.773 122.167  33.937  1.00 77.74  ?  241 ALA A O   1 
ATOM 1712  C CB  . ALA A  1 233 ? 143.847 120.667  34.086  1.00 66.79  ?  241 ALA A CB  1 
ATOM 1713  N N   . TYR A  1 234 ? 142.040 122.073  32.082  1.00 75.82  ?  242 TYR A N   1 
ATOM 1714  C CA  . TYR A  1 234 ? 141.465 123.289  31.519  1.00 74.51  ?  242 TYR A CA  1 
ATOM 1715  C C   . TYR A  1 234 ? 140.177 123.033  30.751  1.00 71.29  ?  242 TYR A C   1 
ATOM 1716  O O   . TYR A  1 234 ? 139.325 123.926  30.675  1.00 75.74  ?  242 TYR A O   1 
ATOM 1717  C CB  . TYR A  1 234 ? 142.480 123.979  30.600  1.00 67.54  ?  242 TYR A CB  1 
ATOM 1718  C CG  . TYR A  1 234 ? 143.682 124.550  31.323  1.00 70.00  ?  242 TYR A CG  1 
ATOM 1719  C CD1 . TYR A  1 234 ? 143.697 125.873  31.744  1.00 72.89  ?  242 TYR A CD1 1 
ATOM 1720  C CD2 . TYR A  1 234 ? 144.800 123.767  31.584  1.00 68.46  ?  242 TYR A CD2 1 
ATOM 1721  C CE1 . TYR A  1 234 ? 144.790 126.402  32.407  1.00 74.58  ?  242 TYR A CE1 1 
ATOM 1722  C CE2 . TYR A  1 234 ? 145.899 124.288  32.246  1.00 72.21  ?  242 TYR A CE2 1 
ATOM 1723  C CZ  . TYR A  1 234 ? 145.887 125.606  32.654  1.00 74.84  ?  242 TYR A CZ  1 
ATOM 1724  O OH  . TYR A  1 234 ? 146.975 126.131  33.312  1.00 83.36  ?  242 TYR A OH  1 
ATOM 1725  N N   . GLY A  1 235 ? 140.009 121.842  30.182  1.00 73.07  ?  243 GLY A N   1 
ATOM 1726  C CA  . GLY A  1 235 ? 138.807 121.547  29.428  1.00 74.85  ?  243 GLY A CA  1 
ATOM 1727  C C   . GLY A  1 235 ? 138.779 122.112  28.027  1.00 74.46  ?  243 GLY A C   1 
ATOM 1728  O O   . GLY A  1 235 ? 137.696 122.365  27.490  1.00 70.86  ?  243 GLY A O   1 
ATOM 1729  N N   . ASP A  1 236 ? 139.944 122.318  27.413  1.00 74.64  ?  244 ASP A N   1 
ATOM 1730  C CA  . ASP A  1 236 ? 139.988 122.846  26.056  1.00 72.93  ?  244 ASP A CA  1 
ATOM 1731  C C   . ASP A  1 236 ? 139.631 121.788  25.020  1.00 65.26  ?  244 ASP A C   1 
ATOM 1732  O O   . ASP A  1 236 ? 139.114 122.127  23.949  1.00 62.84  ?  244 ASP A O   1 
ATOM 1733  C CB  . ASP A  1 236 ? 141.374 123.420  25.759  1.00 69.20  ?  244 ASP A CB  1 
ATOM 1734  C CG  . ASP A  1 236 ? 141.716 124.604  26.640  1.00 75.60  ?  244 ASP A CG  1 
ATOM 1735  O OD1 . ASP A  1 236 ? 140.783 125.274  27.127  1.00 78.84  ?  244 ASP A OD1 1 
ATOM 1736  O OD2 . ASP A  1 236 ? 142.919 124.864  26.847  1.00 80.35  -1 244 ASP A OD2 1 
ATOM 1737  N N   . SER A  1 237 ? 139.896 120.514  25.320  1.00 66.31  ?  245 SER A N   1 
ATOM 1738  C CA  . SER A  1 237 ? 139.694 119.459  24.333  1.00 63.55  ?  245 SER A CA  1 
ATOM 1739  C C   . SER A  1 237 ? 138.225 119.311  23.962  1.00 65.13  ?  245 SER A C   1 
ATOM 1740  O O   . SER A  1 237 ? 137.895 119.043  22.800  1.00 59.30  ?  245 SER A O   1 
ATOM 1741  C CB  . SER A  1 237 ? 140.240 118.136  24.868  1.00 60.97  ?  245 SER A CB  1 
ATOM 1742  O OG  . SER A  1 237 ? 141.617 118.238  25.179  1.00 63.60  ?  245 SER A OG  1 
ATOM 1743  N N   . MET A  1 238 ? 137.327 119.481  24.930  1.00 68.89  ?  246 MET A N   1 
ATOM 1744  C CA  . MET A  1 238 ? 135.908 119.225  24.696  1.00 68.06  ?  246 MET A CA  1 
ATOM 1745  C C   . MET A  1 238 ? 135.092 120.038  25.690  1.00 67.53  ?  246 MET A C   1 
ATOM 1746  O O   . MET A  1 238 ? 135.105 119.735  26.887  1.00 73.08  ?  246 MET A O   1 
ATOM 1747  C CB  . MET A  1 238 ? 135.617 117.735  24.833  1.00 69.67  ?  246 MET A CB  1 
ATOM 1748  C CG  . MET A  1 238 ? 134.150 117.374  24.962  1.00 69.32  ?  246 MET A CG  1 
ATOM 1749  S SD  . MET A  1 238 ? 133.947 115.714  25.644  1.00 66.08  ?  246 MET A SD  1 
ATOM 1750  C CE  . MET A  1 238 ? 134.608 115.937  27.295  1.00 65.46  ?  246 MET A CE  1 
ATOM 1751  N N   . PHE A  1 239 ? 134.383 121.060  25.205  1.00 58.70  ?  247 PHE A N   1 
ATOM 1752  C CA  . PHE A  1 239 ? 133.403 121.754  26.034  1.00 62.31  ?  247 PHE A CA  1 
ATOM 1753  C C   . PHE A  1 239 ? 131.982 121.608  25.500  1.00 65.60  ?  247 PHE A C   1 
ATOM 1754  O O   . PHE A  1 239 ? 131.079 122.313  25.966  1.00 68.68  ?  247 PHE A O   1 
ATOM 1755  C CB  . PHE A  1 239 ? 133.769 123.236  26.219  1.00 61.02  ?  247 PHE A CB  1 
ATOM 1756  C CG  . PHE A  1 239 ? 134.158 123.961  24.955  1.00 60.17  ?  247 PHE A CG  1 
ATOM 1757  C CD1 . PHE A  1 239 ? 133.242 124.171  23.937  1.00 57.06  ?  247 PHE A CD1 1 
ATOM 1758  C CD2 . PHE A  1 239 ? 135.437 124.481  24.812  1.00 63.19  ?  247 PHE A CD2 1 
ATOM 1759  C CE1 . PHE A  1 239 ? 133.605 124.857  22.789  1.00 55.52  ?  247 PHE A CE1 1 
ATOM 1760  C CE2 . PHE A  1 239 ? 135.803 125.167  23.669  1.00 58.48  ?  247 PHE A CE2 1 
ATOM 1761  C CZ  . PHE A  1 239 ? 134.886 125.356  22.657  1.00 57.43  ?  247 PHE A CZ  1 
ATOM 1762  N N   . PHE A  1 240 ? 131.761 120.708  24.543  1.00 70.11  ?  248 PHE A N   1 
ATOM 1763  C CA  . PHE A  1 240 ? 130.419 120.375  24.081  1.00 66.05  ?  248 PHE A CA  1 
ATOM 1764  C C   . PHE A  1 240 ? 130.478 119.013  23.405  1.00 63.81  ?  248 PHE A C   1 
ATOM 1765  O O   . PHE A  1 240 ? 131.290 118.807  22.495  1.00 70.17  ?  248 PHE A O   1 
ATOM 1766  C CB  . PHE A  1 240 ? 129.876 121.435  23.117  1.00 66.35  ?  248 PHE A CB  1 
ATOM 1767  C CG  . PHE A  1 240 ? 128.419 121.267  22.796  1.00 66.94  ?  248 PHE A CG  1 
ATOM 1768  C CD1 . PHE A  1 240 ? 127.448 121.744  23.661  1.00 72.20  ?  248 PHE A CD1 1 
ATOM 1769  C CD2 . PHE A  1 240 ? 128.020 120.624  21.636  1.00 64.61  ?  248 PHE A CD2 1 
ATOM 1770  C CE1 . PHE A  1 240 ? 126.104 121.591  23.373  1.00 72.94  ?  248 PHE A CE1 1 
ATOM 1771  C CE2 . PHE A  1 240 ? 126.679 120.468  21.342  1.00 67.81  ?  248 PHE A CE2 1 
ATOM 1772  C CZ  . PHE A  1 240 ? 125.719 120.952  22.213  1.00 71.42  ?  248 PHE A CZ  1 
ATOM 1773  N N   . CYS A  1 241 ? 129.612 118.098  23.840  1.00 63.01  ?  249 CYS A N   1 
ATOM 1774  C CA  . CYS A  1 241 ? 129.691 116.701  23.432  1.00 60.54  ?  249 CYS A CA  1 
ATOM 1775  C C   . CYS A  1 241 ? 128.299 116.094  23.352  1.00 58.93  ?  249 CYS A C   1 
ATOM 1776  O O   . CYS A  1 241 ? 127.538 116.152  24.322  1.00 62.05  ?  249 CYS A O   1 
ATOM 1777  C CB  . CYS A  1 241 ? 130.556 115.901  24.409  1.00 60.70  ?  249 CYS A CB  1 
ATOM 1778  S SG  . CYS A  1 241 ? 130.482 114.123  24.163  1.00 58.22  ?  249 CYS A SG  1 
ATOM 1779  N N   . LEU A  1 242 ? 127.978 115.508  22.199  1.00 56.64  ?  250 LEU A N   1 
ATOM 1780  C CA  . LEU A  1 242 ? 126.721 114.800  21.984  1.00 56.33  ?  250 LEU A CA  1 
ATOM 1781  C C   . LEU A  1 242 ? 127.021 113.452  21.347  1.00 63.75  ?  250 LEU A C   1 
ATOM 1782  O O   . LEU A  1 242 ? 127.519 113.401  20.219  1.00 68.51  ?  250 LEU A O   1 
ATOM 1783  C CB  . LEU A  1 242 ? 125.785 115.604  21.077  1.00 51.90  ?  250 LEU A CB  1 
ATOM 1784  C CG  . LEU A  1 242 ? 125.392 117.018  21.492  1.00 52.24  ?  250 LEU A CG  1 
ATOM 1785  C CD1 . LEU A  1 242 ? 124.619 117.677  20.364  1.00 52.33  ?  250 LEU A CD1 1 
ATOM 1786  C CD2 . LEU A  1 242 ? 124.572 116.998  22.770  1.00 52.25  ?  250 LEU A CD2 1 
ATOM 1787  N N   . ARG A  1 243 ? 126.717 112.366  22.052  1.00 64.58  ?  251 ARG A N   1 
ATOM 1788  C CA  . ARG A  1 243 ? 126.912 111.034  21.500  1.00 60.76  ?  251 ARG A CA  1 
ATOM 1789  C C   . ARG A  1 243 ? 125.585 110.287  21.476  1.00 57.14  ?  251 ARG A C   1 
ATOM 1790  O O   . ARG A  1 243 ? 124.706 110.514  22.314  1.00 57.60  ?  251 ARG A O   1 
ATOM 1791  C CB  . ARG A  1 243 ? 127.953 110.216  22.288  1.00 67.72  ?  251 ARG A CB  1 
ATOM 1792  C CG  . ARG A  1 243 ? 127.478 109.649  23.624  1.00 76.75  ?  251 ARG A CG  1 
ATOM 1793  C CD  . ARG A  1 243 ? 128.561 108.768  24.251  1.00 82.94  ?  251 ARG A CD  1 
ATOM 1794  N NE  . ARG A  1 243 ? 128.130 108.116  25.488  1.00 83.17  ?  251 ARG A NE  1 
ATOM 1795  C CZ  . ARG A  1 243 ? 127.609 106.891  25.547  1.00 71.72  ?  251 ARG A CZ  1 
ATOM 1796  N NH1 . ARG A  1 243 ? 127.456 106.178  24.438  1.00 65.54  1  251 ARG A NH1 1 
ATOM 1797  N NH2 . ARG A  1 243 ? 127.245 106.375  26.714  1.00 62.61  ?  251 ARG A NH2 1 
ATOM 1798  N N   . ARG A  1 244 ? 125.449 109.396  20.495  1.00 57.61  ?  252 ARG A N   1 
ATOM 1799  C CA  . ARG A  1 244 ? 124.252 108.583  20.323  1.00 54.04  ?  252 ARG A CA  1 
ATOM 1800  C C   . ARG A  1 244 ? 124.578 107.442  19.369  1.00 50.26  ?  252 ARG A C   1 
ATOM 1801  O O   . ARG A  1 244 ? 124.636 107.634  18.150  1.00 49.96  ?  252 ARG A O   1 
ATOM 1802  C CB  . ARG A  1 244 ? 123.081 109.416  19.798  1.00 58.28  ?  252 ARG A CB  1 
ATOM 1803  C CG  . ARG A  1 244 ? 121.707 108.811  20.085  1.00 61.39  ?  252 ARG A CG  1 
ATOM 1804  C CD  . ARG A  1 244 ? 121.272 107.807  19.026  1.00 64.17  ?  252 ARG A CD  1 
ATOM 1805  N NE  . ARG A  1 244 ? 120.071 107.080  19.434  1.00 68.31  ?  252 ARG A NE  1 
ATOM 1806  C CZ  . ARG A  1 244 ? 119.527 106.083  18.743  1.00 70.35  ?  252 ARG A CZ  1 
ATOM 1807  N NH1 . ARG A  1 244 ? 120.076 105.684  17.603  1.00 73.73  1  252 ARG A NH1 1 
ATOM 1808  N NH2 . ARG A  1 244 ? 118.434 105.481  19.193  1.00 68.66  ?  252 ARG A NH2 1 
ATOM 1809  N N   . GLU A  1 245 ? 124.794 106.253  19.921  1.00 53.40  ?  253 GLU A N   1 
ATOM 1810  C CA  . GLU A  1 245 ? 125.231 105.095  19.159  1.00 52.01  ?  253 GLU A CA  1 
ATOM 1811  C C   . GLU A  1 245 ? 124.348 103.898  19.481  1.00 47.18  ?  253 GLU A C   1 
ATOM 1812  O O   . GLU A  1 245 ? 123.816 103.778  20.588  1.00 45.45  ?  253 GLU A O   1 
ATOM 1813  C CB  . GLU A  1 245 ? 126.705 104.786  19.461  1.00 49.79  ?  253 GLU A CB  1 
ATOM 1814  C CG  . GLU A  1 245 ? 127.078 105.015  20.921  1.00 55.57  ?  253 GLU A CG  1 
ATOM 1815  C CD  . GLU A  1 245 ? 128.576 104.963  21.171  1.00 59.52  ?  253 GLU A CD  1 
ATOM 1816  O OE1 . GLU A  1 245 ? 129.237 104.029  20.674  1.00 57.91  ?  253 GLU A OE1 1 
ATOM 1817  O OE2 . GLU A  1 245 ? 129.093 105.868  21.861  1.00 62.52  -1 253 GLU A OE2 1 
ATOM 1818  N N   . GLN A  1 246 ? 124.189 103.016  18.496  1.00 43.98  ?  254 GLN A N   1 
ATOM 1819  C CA  . GLN A  1 246 ? 123.415 101.799  18.689  1.00 46.09  ?  254 GLN A CA  1 
ATOM 1820  C C   . GLN A  1 246 ? 123.925 100.717  17.749  1.00 46.94  ?  254 GLN A C   1 
ATOM 1821  O O   . GLN A  1 246 ? 124.412 101.001  16.648  1.00 52.85  ?  254 GLN A O   1 
ATOM 1822  C CB  . GLN A  1 246 ? 121.914 102.042  18.476  1.00 48.33  ?  254 GLN A CB  1 
ATOM 1823  C CG  . GLN A  1 246 ? 121.485 102.179  17.030  1.00 50.51  ?  254 GLN A CG  1 
ATOM 1824  C CD  . GLN A  1 246 ? 119.981 102.316  16.888  1.00 54.10  ?  254 GLN A CD  1 
ATOM 1825  O OE1 . GLN A  1 246 ? 119.285 102.657  17.844  1.00 56.01  ?  254 GLN A OE1 1 
ATOM 1826  N NE2 . GLN A  1 246 ? 119.472 102.044  15.693  1.00 56.69  ?  254 GLN A NE2 1 
ATOM 1827  N N   . VAL A  1 247 ? 123.812 99.468   18.205  1.00 43.02  ?  255 VAL A N   1 
ATOM 1828  C CA  . VAL A  1 247 ? 124.344 98.315   17.488  1.00 43.11  ?  255 VAL A CA  1 
ATOM 1829  C C   . VAL A  1 247 ? 123.754 97.042   18.081  1.00 43.06  ?  255 VAL A C   1 
ATOM 1830  O O   . VAL A  1 247 ? 123.414 96.997   19.269  1.00 42.97  ?  255 VAL A O   1 
ATOM 1831  C CB  . VAL A  1 247 ? 125.884 98.290   17.549  1.00 45.87  ?  255 VAL A CB  1 
ATOM 1832  C CG1 . VAL A  1 247 ? 126.361 98.117   18.986  1.00 45.87  ?  255 VAL A CG1 1 
ATOM 1833  C CG2 . VAL A  1 247 ? 126.453 97.196   16.650  1.00 46.77  ?  255 VAL A CG2 1 
ATOM 1834  N N   . PHE A  1 248 ? 123.622 96.004   17.257  1.00 44.75  ?  256 PHE A N   1 
ATOM 1835  C CA  . PHE A  1 248 ? 123.243 94.681   17.726  1.00 45.03  ?  256 PHE A CA  1 
ATOM 1836  C C   . PHE A  1 248 ? 123.896 93.641   16.828  1.00 48.90  ?  256 PHE A C   1 
ATOM 1837  O O   . PHE A  1 248 ? 124.375 93.950   15.732  1.00 52.99  ?  256 PHE A O   1 
ATOM 1838  C CB  . PHE A  1 248 ? 121.722 94.496   17.750  1.00 40.68  ?  256 PHE A CB  1 
ATOM 1839  C CG  . PHE A  1 248 ? 121.117 94.262   16.397  1.00 40.00  ?  256 PHE A CG  1 
ATOM 1840  C CD1 . PHE A  1 248 ? 120.827 95.327   15.562  1.00 40.59  ?  256 PHE A CD1 1 
ATOM 1841  C CD2 . PHE A  1 248 ? 120.825 92.977   15.967  1.00 40.18  ?  256 PHE A CD2 1 
ATOM 1842  C CE1 . PHE A  1 248 ? 120.264 95.114   14.319  1.00 45.74  ?  256 PHE A CE1 1 
ATOM 1843  C CE2 . PHE A  1 248 ? 120.265 92.759   14.725  1.00 40.44  ?  256 PHE A CE2 1 
ATOM 1844  C CZ  . PHE A  1 248 ? 119.984 93.828   13.899  1.00 44.33  ?  256 PHE A CZ  1 
ATOM 1845  N N   . ALA A  1 249 ? 123.910 92.400   17.309  1.00 48.56  ?  257 ALA A N   1 
ATOM 1846  C CA  . ALA A  1 249 ? 124.544 91.292   16.600  1.00 51.54  ?  257 ALA A CA  1 
ATOM 1847  C C   . ALA A  1 249 ? 123.529 90.667   15.650  1.00 45.96  ?  257 ALA A C   1 
ATOM 1848  O O   . ALA A  1 249 ? 122.527 90.094   16.088  1.00 44.63  ?  257 ALA A O   1 
ATOM 1849  C CB  . ALA A  1 249 ? 125.084 90.260   17.586  1.00 52.28  ?  257 ALA A CB  1 
ATOM 1850  N N   . ARG A  1 250 ? 123.796 90.767   14.348  1.00 45.14  ?  258 ARG A N   1 
ATOM 1851  C CA  . ARG A  1 250 ? 122.866 90.289   13.332  1.00 44.43  ?  258 ARG A CA  1 
ATOM 1852  C C   . ARG A  1 250 ? 123.096 88.820   12.991  1.00 44.94  ?  258 ARG A C   1 
ATOM 1853  O O   . ARG A  1 250 ? 122.146 88.031   12.969  1.00 45.03  ?  258 ARG A O   1 
ATOM 1854  C CB  . ARG A  1 250 ? 122.975 91.151   12.070  1.00 41.61  ?  258 ARG A CB  1 
ATOM 1855  C CG  . ARG A  1 250 ? 121.805 90.997   11.113  1.00 41.83  ?  258 ARG A CG  1 
ATOM 1856  C CD  . ARG A  1 250 ? 121.770 92.130   10.103  1.00 43.12  ?  258 ARG A CD  1 
ATOM 1857  N NE  . ARG A  1 250 ? 120.730 91.942   9.095   1.00 42.37  ?  258 ARG A NE  1 
ATOM 1858  C CZ  . ARG A  1 250 ? 120.245 92.917   8.335   1.00 46.28  ?  258 ARG A CZ  1 
ATOM 1859  N NH1 . ARG A  1 250 ? 120.702 94.153   8.468   1.00 47.90  1  258 ARG A NH1 1 
ATOM 1860  N NH2 . ARG A  1 250 ? 119.301 92.659   7.441   1.00 52.52  ?  258 ARG A NH2 1 
ATOM 1861  N N   . HIS A  1 251 ? 124.343 88.439   12.727  1.00 43.60  ?  259 HIS A N   1 
ATOM 1862  C CA  . HIS A  1 251 ? 124.688 87.064   12.401  1.00 44.22  ?  259 HIS A CA  1 
ATOM 1863  C C   . HIS A  1 251 ? 125.917 86.643   13.193  1.00 47.74  ?  259 HIS A C   1 
ATOM 1864  O O   . HIS A  1 251 ? 126.821 87.446   13.441  1.00 51.57  ?  259 HIS A O   1 
ATOM 1865  C CB  . HIS A  1 251 ? 124.949 86.894   10.901  1.00 43.45  ?  259 HIS A CB  1 
ATOM 1866  C CG  . HIS A  1 251 ? 123.729 87.069   10.053  1.00 45.04  ?  259 HIS A CG  1 
ATOM 1867  N ND1 . HIS A  1 251 ? 122.775 86.085   9.910   1.00 48.63  ?  259 HIS A ND1 1 
ATOM 1868  C CD2 . HIS A  1 251 ? 123.301 88.120   9.313   1.00 49.22  ?  259 HIS A CD2 1 
ATOM 1869  C CE1 . HIS A  1 251 ? 121.816 86.518   9.110   1.00 54.30  ?  259 HIS A CE1 1 
ATOM 1870  N NE2 . HIS A  1 251 ? 122.110 87.750   8.735   1.00 53.74  ?  259 HIS A NE2 1 
ATOM 1871  N N   . PHE A  1 252 ? 125.945 85.371   13.581  1.00 52.05  ?  260 PHE A N   1 
ATOM 1872  C CA  . PHE A  1 252 ? 127.026 84.811   14.382  1.00 50.55  ?  260 PHE A CA  1 
ATOM 1873  C C   . PHE A  1 252 ? 127.891 83.935   13.489  1.00 51.50  ?  260 PHE A C   1 
ATOM 1874  O O   . PHE A  1 252 ? 127.369 83.103   12.739  1.00 53.12  ?  260 PHE A O   1 
ATOM 1875  C CB  . PHE A  1 252 ? 126.495 83.989   15.563  1.00 48.80  ?  260 PHE A CB  1 
ATOM 1876  C CG  . PHE A  1 252 ? 125.512 84.720   16.445  1.00 48.38  ?  260 PHE A CG  1 
ATOM 1877  C CD1 . PHE A  1 252 ? 125.414 86.102   16.425  1.00 48.08  ?  260 PHE A CD1 1 
ATOM 1878  C CD2 . PHE A  1 252 ? 124.699 84.014   17.316  1.00 48.34  ?  260 PHE A CD2 1 
ATOM 1879  C CE1 . PHE A  1 252 ? 124.509 86.759   17.238  1.00 47.77  ?  260 PHE A CE1 1 
ATOM 1880  C CE2 . PHE A  1 252 ? 123.797 84.665   18.133  1.00 48.02  ?  260 PHE A CE2 1 
ATOM 1881  C CZ  . PHE A  1 252 ? 123.704 86.039   18.096  1.00 47.74  ?  260 PHE A CZ  1 
ATOM 1882  N N   . TRP A  1 253 ? 129.207 84.115   13.573  1.00 48.46  ?  261 TRP A N   1 
ATOM 1883  C CA  . TRP A  1 253 ? 130.135 83.455   12.669  1.00 50.65  ?  261 TRP A CA  1 
ATOM 1884  C C   . TRP A  1 253 ? 131.311 82.871   13.437  1.00 52.12  ?  261 TRP A C   1 
ATOM 1885  O O   . TRP A  1 253 ? 131.512 83.132   14.625  1.00 51.46  ?  261 TRP A O   1 
ATOM 1886  C CB  . TRP A  1 253 ? 130.641 84.425   11.595  1.00 52.43  ?  261 TRP A CB  1 
ATOM 1887  C CG  . TRP A  1 253 ? 129.626 84.722   10.554  1.00 51.39  ?  261 TRP A CG  1 
ATOM 1888  C CD1 . TRP A  1 253 ? 128.682 83.869   10.068  1.00 51.60  ?  261 TRP A CD1 1 
ATOM 1889  C CD2 . TRP A  1 253 ? 129.424 85.970   9.883   1.00 50.38  ?  261 TRP A CD2 1 
ATOM 1890  N NE1 . TRP A  1 253 ? 127.916 84.501   9.122   1.00 50.64  ?  261 TRP A NE1 1 
ATOM 1891  C CE2 . TRP A  1 253 ? 128.349 85.794   8.992   1.00 50.70  ?  261 TRP A CE2 1 
ATOM 1892  C CE3 . TRP A  1 253 ? 130.052 87.217   9.945   1.00 50.13  ?  261 TRP A CE3 1 
ATOM 1893  C CZ2 . TRP A  1 253 ? 127.886 86.818   8.168   1.00 48.83  ?  261 TRP A CZ2 1 
ATOM 1894  C CZ3 . TRP A  1 253 ? 129.592 88.231   9.126   1.00 49.79  ?  261 TRP A CZ3 1 
ATOM 1895  C CH2 . TRP A  1 253 ? 128.518 88.026   8.252   1.00 48.28  ?  261 TRP A CH2 1 
ATOM 1896  N N   . ASN A  1 254 ? 132.102 82.085   12.715  1.00 53.61  ?  262 ASN A N   1 
ATOM 1897  C CA  . ASN A  1 254 ? 133.306 81.455   13.227  1.00 56.21  ?  262 ASN A CA  1 
ATOM 1898  C C   . ASN A  1 254 ? 134.503 81.935   12.420  1.00 58.26  ?  262 ASN A C   1 
ATOM 1899  O O   . ASN A  1 254 ? 134.381 82.261   11.235  1.00 61.22  ?  262 ASN A O   1 
ATOM 1900  C CB  . ASN A  1 254 ? 133.203 79.928   13.151  1.00 52.60  ?  262 ASN A CB  1 
ATOM 1901  C CG  . ASN A  1 254 ? 133.470 79.263   14.479  1.00 61.81  ?  262 ASN A CG  1 
ATOM 1902  O OD1 . ASN A  1 254 ? 133.683 79.933   15.488  1.00 66.19  ?  262 ASN A OD1 1 
ATOM 1903  N ND2 . ASN A  1 254 ? 133.454 77.934   14.489  1.00 66.98  ?  262 ASN A ND2 1 
ATOM 1904  N N   . ARG A  1 255 ? 135.662 81.976   13.065  1.00 53.05  ?  263 ARG A N   1 
ATOM 1905  C CA  . ARG A  1 255 ? 136.888 82.428   12.426  1.00 55.98  ?  263 ARG A CA  1 
ATOM 1906  C C   . ARG A  1 255 ? 137.784 81.229   12.161  1.00 60.81  ?  263 ARG A C   1 
ATOM 1907  O O   . ARG A  1 255 ? 138.053 80.436   13.070  1.00 64.21  ?  263 ARG A O   1 
ATOM 1908  C CB  . ARG A  1 255 ? 137.616 83.451   13.299  1.00 57.99  ?  263 ARG A CB  1 
ATOM 1909  C CG  . ARG A  1 255 ? 136.772 84.653   13.671  1.00 54.97  ?  263 ARG A CG  1 
ATOM 1910  C CD  . ARG A  1 255 ? 136.668 85.654   12.534  1.00 54.31  ?  263 ARG A CD  1 
ATOM 1911  N NE  . ARG A  1 255 ? 136.448 87.008   13.035  1.00 52.34  ?  263 ARG A NE  1 
ATOM 1912  C CZ  . ARG A  1 255 ? 136.130 88.046   12.271  1.00 51.20  ?  263 ARG A CZ  1 
ATOM 1913  N NH1 . ARG A  1 255 ? 135.989 87.889   10.963  1.00 51.89  1  263 ARG A NH1 1 
ATOM 1914  N NH2 . ARG A  1 255 ? 135.950 89.242   12.814  1.00 49.56  ?  263 ARG A NH2 1 
ATOM 1915  N N   . SER A  1 256 ? 138.236 81.095   10.917  1.00 54.91  ?  264 SER A N   1 
ATOM 1916  C CA  . SER A  1 256 ? 139.176 80.043   10.573  1.00 55.66  ?  264 SER A CA  1 
ATOM 1917  C C   . SER A  1 256 ? 140.598 80.470   10.926  1.00 55.99  ?  264 SER A C   1 
ATOM 1918  O O   . SER A  1 256 ? 140.919 81.658   11.011  1.00 55.72  ?  264 SER A O   1 
ATOM 1919  C CB  . SER A  1 256 ? 139.075 79.689   9.089   1.00 66.67  ?  264 SER A CB  1 
ATOM 1920  O OG  . SER A  1 256 ? 139.396 80.801   8.273   1.00 74.06  ?  264 SER A OG  1 
ATOM 1921  N N   . GLY A  1 257 ? 141.456 79.475   11.129  1.00 60.67  ?  265 GLY A N   1 
ATOM 1922  C CA  . GLY A  1 257 ? 142.804 79.722   11.599  1.00 61.63  ?  265 GLY A CA  1 
ATOM 1923  C C   . GLY A  1 257 ? 143.071 79.014   12.909  1.00 61.76  ?  265 GLY A C   1 
ATOM 1924  O O   . GLY A  1 257 ? 142.155 78.836   13.717  1.00 60.62  ?  265 GLY A O   1 
ATOM 1925  N N   . THR A  1 258 ? 144.317 78.611   13.138  1.00 57.22  ?  266 THR A N   1 
ATOM 1926  C CA  . THR A  1 258 ? 144.635 77.830   14.325  1.00 57.60  ?  266 THR A CA  1 
ATOM 1927  C C   . THR A  1 258 ? 144.468 78.677   15.579  1.00 56.43  ?  266 THR A C   1 
ATOM 1928  O O   . THR A  1 258 ? 144.883 79.838   15.627  1.00 56.17  ?  266 THR A O   1 
ATOM 1929  C CB  . THR A  1 258 ? 146.059 77.280   14.243  1.00 58.79  ?  266 THR A CB  1 
ATOM 1930  O OG1 . THR A  1 258 ? 146.984 78.359   14.071  1.00 59.23  ?  266 THR A OG1 1 
ATOM 1931  C CG2 . THR A  1 258 ? 146.190 76.320   13.068  1.00 60.41  ?  266 THR A CG2 1 
ATOM 1932  N N   . MET A  1 259 ? 143.836 78.092   16.592  1.00 53.61  ?  267 MET A N   1 
ATOM 1933  C CA  . MET A  1 259 ? 143.566 78.808   17.831  1.00 53.07  ?  267 MET A CA  1 
ATOM 1934  C C   . MET A  1 259 ? 144.854 78.967   18.628  1.00 53.50  ?  267 MET A C   1 
ATOM 1935  O O   . MET A  1 259 ? 145.462 77.976   19.045  1.00 54.06  ?  267 MET A O   1 
ATOM 1936  C CB  . MET A  1 259 ? 142.514 78.064   18.649  1.00 59.03  ?  267 MET A CB  1 
ATOM 1937  C CG  . MET A  1 259 ? 141.226 77.752   17.898  1.00 57.29  ?  267 MET A CG  1 
ATOM 1938  S SD  . MET A  1 259 ? 140.065 79.132   17.832  1.00 53.05  ?  267 MET A SD  1 
ATOM 1939  C CE  . MET A  1 259 ? 140.581 79.991   16.347  1.00 52.87  ?  267 MET A CE  1 
ATOM 1940  N N   . GLY A  1 260 ? 145.267 80.216   18.845  1.00 53.82  ?  268 GLY A N   1 
ATOM 1941  C CA  . GLY A  1 260 ? 146.499 80.458   19.573  1.00 55.95  ?  268 GLY A CA  1 
ATOM 1942  C C   . GLY A  1 260 ? 146.389 80.146   21.051  1.00 55.94  ?  268 GLY A C   1 
ATOM 1943  O O   . GLY A  1 260 ? 147.387 79.804   21.692  1.00 63.52  ?  268 GLY A O   1 
ATOM 1944  N N   . ASP A  1 261 ? 145.189 80.255   21.611  1.00 55.40  ?  269 ASP A N   1 
ATOM 1945  C CA  . ASP A  1 261 ? 144.946 79.956   23.015  1.00 55.28  ?  269 ASP A CA  1 
ATOM 1946  C C   . ASP A  1 261 ? 144.327 78.571   23.125  1.00 55.51  ?  269 ASP A C   1 
ATOM 1947  O O   . ASP A  1 261 ? 143.280 78.305   22.525  1.00 54.12  ?  269 ASP A O   1 
ATOM 1948  C CB  . ASP A  1 261 ? 144.033 81.004   23.645  1.00 55.40  ?  269 ASP A CB  1 
ATOM 1949  C CG  . ASP A  1 261 ? 144.632 82.387   23.605  1.00 58.02  ?  269 ASP A CG  1 
ATOM 1950  O OD1 . ASP A  1 261 ? 145.866 82.497   23.767  1.00 56.68  ?  269 ASP A OD1 1 
ATOM 1951  O OD2 . ASP A  1 261 ? 143.872 83.360   23.412  1.00 61.33  -1 269 ASP A OD2 1 
ATOM 1952  N N   . GLN A  1 262 ? 144.969 77.698   23.895  1.00 61.19  ?  270 GLN A N   1 
ATOM 1953  C CA  . GLN A  1 262 ? 144.470 76.341   24.055  1.00 62.60  ?  270 GLN A CA  1 
ATOM 1954  C C   . GLN A  1 262 ? 143.187 76.338   24.872  1.00 60.65  ?  270 GLN A C   1 
ATOM 1955  O O   . GLN A  1 262 ? 143.141 76.880   25.980  1.00 60.66  ?  270 GLN A O   1 
ATOM 1956  C CB  . GLN A  1 262 ? 145.521 75.461   24.729  1.00 55.96  ?  270 GLN A CB  1 
ATOM 1957  C CG  . GLN A  1 262 ? 145.125 73.997   24.807  1.00 57.21  ?  270 GLN A CG  1 
ATOM 1958  C CD  . GLN A  1 262 ? 146.082 73.181   25.647  1.00 60.53  ?  270 GLN A CD  1 
ATOM 1959  O OE1 . GLN A  1 262 ? 146.995 72.546   25.123  1.00 62.35  ?  270 GLN A OE1 1 
ATOM 1960  N NE2 . GLN A  1 262 ? 145.877 73.191   26.957  1.00 61.53  ?  270 GLN A NE2 1 
ATOM 1961  N N   . LEU A  1 263 ? 142.142 75.741   24.314  1.00 57.46  ?  271 LEU A N   1 
ATOM 1962  C CA  . LEU A  1 263 ? 140.888 75.590   25.032  1.00 55.49  ?  271 LEU A CA  1 
ATOM 1963  C C   . LEU A  1 263 ? 141.111 74.669   26.225  1.00 59.72  ?  271 LEU A C   1 
ATOM 1964  O O   . LEU A  1 263 ? 141.481 73.502   26.031  1.00 65.92  ?  271 LEU A O   1 
ATOM 1965  C CB  . LEU A  1 263 ? 139.810 75.020   24.117  1.00 55.00  ?  271 LEU A CB  1 
ATOM 1966  C CG  . LEU A  1 263 ? 138.441 74.753   24.740  1.00 53.93  ?  271 LEU A CG  1 
ATOM 1967  C CD1 . LEU A  1 263 ? 137.870 76.031   25.317  1.00 52.62  ?  271 LEU A CD1 1 
ATOM 1968  C CD2 . LEU A  1 263 ? 137.491 74.157   23.715  1.00 53.62  ?  271 LEU A CD2 1 
ATOM 1969  N N   . PRO A  1 264 ? 140.926 75.144   27.455  1.00 54.99  ?  272 PRO A N   1 
ATOM 1970  C CA  . PRO A  1 264 ? 141.181 74.286   28.619  1.00 57.15  ?  272 PRO A CA  1 
ATOM 1971  C C   . PRO A  1 264 ? 140.260 73.076   28.614  1.00 57.36  ?  272 PRO A C   1 
ATOM 1972  O O   . PRO A  1 264 ? 139.043 73.199   28.458  1.00 54.50  ?  272 PRO A O   1 
ATOM 1973  C CB  . PRO A  1 264 ? 140.898 75.209   29.811  1.00 50.71  ?  272 PRO A CB  1 
ATOM 1974  C CG  . PRO A  1 264 ? 140.995 76.593   29.260  1.00 50.28  ?  272 PRO A CG  1 
ATOM 1975  C CD  . PRO A  1 264 ? 140.510 76.498   27.848  1.00 50.12  ?  272 PRO A CD  1 
ATOM 1976  N N   . GLU A  1 265 ? 140.856 71.896   28.785  1.00 65.09  ?  273 GLU A N   1 
ATOM 1977  C CA  . GLU A  1 265 ? 140.090 70.658   28.748  1.00 68.44  ?  273 GLU A CA  1 
ATOM 1978  C C   . GLU A  1 265 ? 139.167 70.500   29.949  1.00 69.51  ?  273 GLU A C   1 
ATOM 1979  O O   . GLU A  1 265 ? 138.381 69.545   29.985  1.00 69.54  ?  273 GLU A O   1 
ATOM 1980  C CB  . GLU A  1 265 ? 141.042 69.470   28.629  1.00 69.28  ?  273 GLU A CB  1 
ATOM 1981  C CG  . GLU A  1 265 ? 142.151 69.713   27.612  1.00 71.63  ?  273 GLU A CG  1 
ATOM 1982  C CD  . GLU A  1 265 ? 142.947 68.468   27.289  1.00 73.04  ?  273 GLU A CD  1 
ATOM 1983  O OE1 . GLU A  1 265 ? 143.080 67.600   28.176  1.00 74.23  ?  273 GLU A OE1 1 
ATOM 1984  O OE2 . GLU A  1 265 ? 143.443 68.361   26.147  1.00 73.33  -1 273 GLU A OE2 1 
ATOM 1985  N N   . SER A  1 266 ? 139.244 71.406   30.924  1.00 69.22  ?  274 SER A N   1 
ATOM 1986  C CA  . SER A  1 266 ? 138.313 71.417   32.044  1.00 63.22  ?  274 SER A CA  1 
ATOM 1987  C C   . SER A  1 266 ? 136.925 71.901   31.651  1.00 56.96  ?  274 SER A C   1 
ATOM 1988  O O   . SER A  1 266 ? 135.988 71.741   32.441  1.00 56.54  ?  274 SER A O   1 
ATOM 1989  C CB  . SER A  1 266 ? 138.860 72.303   33.165  1.00 70.89  ?  274 SER A CB  1 
ATOM 1990  O OG  . SER A  1 266 ? 140.260 72.135   33.312  1.00 74.13  ?  274 SER A OG  1 
ATOM 1991  N N   . LEU A  1 267 ? 136.770 72.490   30.467  1.00 51.36  ?  275 LEU A N   1 
ATOM 1992  C CA  . LEU A  1 267 ? 135.534 73.156   30.080  1.00 49.93  ?  275 LEU A CA  1 
ATOM 1993  C C   . LEU A  1 267 ? 134.685 72.354   29.102  1.00 49.91  ?  275 LEU A C   1 
ATOM 1994  O O   . LEU A  1 267 ? 133.645 72.855   28.663  1.00 49.43  ?  275 LEU A O   1 
ATOM 1995  C CB  . LEU A  1 267 ? 135.840 74.530   29.472  1.00 46.33  ?  275 LEU A CB  1 
ATOM 1996  C CG  . LEU A  1 267 ? 136.699 75.502   30.283  1.00 46.29  ?  275 LEU A CG  1 
ATOM 1997  C CD1 . LEU A  1 267 ? 136.824 76.828   29.552  1.00 45.90  ?  275 LEU A CD1 1 
ATOM 1998  C CD2 . LEU A  1 267 ? 136.136 75.706   31.678  1.00 46.10  ?  275 LEU A CD2 1 
ATOM 1999  N N   . TYR A  1 268 ? 135.092 71.142   28.736  1.00 50.96  ?  276 TYR A N   1 
ATOM 2000  C CA  . TYR A  1 268 ? 134.294 70.351   27.806  1.00 51.05  ?  276 TYR A CA  1 
ATOM 2001  C C   . TYR A  1 268 ? 134.659 68.883   27.961  1.00 52.91  ?  276 TYR A C   1 
ATOM 2002  O O   . TYR A  1 268 ? 135.621 68.526   28.646  1.00 55.28  ?  276 TYR A O   1 
ATOM 2003  C CB  . TYR A  1 268 ? 134.495 70.791   26.349  1.00 55.07  ?  276 TYR A CB  1 
ATOM 2004  C CG  . TYR A  1 268 ? 135.872 70.511   25.775  1.00 59.62  ?  276 TYR A CG  1 
ATOM 2005  C CD1 . TYR A  1 268 ? 136.009 69.864   24.552  1.00 59.44  ?  276 TYR A CD1 1 
ATOM 2006  C CD2 . TYR A  1 268 ? 137.029 70.896   26.440  1.00 62.66  ?  276 TYR A CD2 1 
ATOM 2007  C CE1 . TYR A  1 268 ? 137.257 69.603   24.015  1.00 61.23  ?  276 TYR A CE1 1 
ATOM 2008  C CE2 . TYR A  1 268 ? 138.278 70.639   25.907  1.00 61.58  ?  276 TYR A CE2 1 
ATOM 2009  C CZ  . TYR A  1 268 ? 138.387 69.994   24.698  1.00 62.59  ?  276 TYR A CZ  1 
ATOM 2010  O OH  . TYR A  1 268 ? 139.632 69.742   24.176  1.00 64.84  ?  276 TYR A OH  1 
ATOM 2011  N N   . ILE A  1 269 ? 133.874 68.035   27.299  1.00 54.93  ?  277 ILE A N   1 
ATOM 2012  C CA  . ILE A  1 269 ? 134.115 66.600   27.237  1.00 56.34  ?  277 ILE A CA  1 
ATOM 2013  C C   . ILE A  1 269 ? 134.237 66.211   25.770  1.00 56.85  ?  277 ILE A C   1 
ATOM 2014  O O   . ILE A  1 269 ? 133.361 66.537   24.961  1.00 56.04  ?  277 ILE A O   1 
ATOM 2015  C CB  . ILE A  1 269 ? 132.994 65.806   27.930  1.00 54.92  ?  277 ILE A CB  1 
ATOM 2016  C CG1 . ILE A  1 269 ? 132.827 66.285   29.374  1.00 54.91  ?  277 ILE A CG1 1 
ATOM 2017  C CG2 . ILE A  1 269 ? 133.308 64.326   27.902  1.00 62.54  ?  277 ILE A CG2 1 
ATOM 2018  C CD1 . ILE A  1 269 ? 131.711 65.596   30.130  1.00 55.45  ?  277 ILE A CD1 1 
ATOM 2019  N N   . LYS A  1 270 ? 135.315 65.498   25.433  1.00 63.42  ?  278 LYS A N   1 
ATOM 2020  C CA  . LYS A  1 270 ? 135.712 65.350   24.036  1.00 63.91  ?  278 LYS A CA  1 
ATOM 2021  C C   . LYS A  1 270 ? 134.822 64.393   23.255  1.00 68.52  ?  278 LYS A C   1 
ATOM 2022  O O   . LYS A  1 270 ? 134.791 64.469   22.022  1.00 76.03  ?  278 LYS A O   1 
ATOM 2023  C CB  . LYS A  1 270 ? 137.165 64.880   23.950  1.00 66.01  ?  278 LYS A CB  1 
ATOM 2024  C CG  . LYS A  1 270 ? 138.113 65.910   23.358  1.00 65.40  ?  278 LYS A CG  1 
ATOM 2025  C CD  . LYS A  1 270 ? 139.523 65.360   23.226  1.00 68.85  ?  278 LYS A CD  1 
ATOM 2026  C CE  . LYS A  1 270 ? 140.489 66.439   22.761  1.00 68.34  ?  278 LYS A CE  1 
ATOM 2027  N NZ  . LYS A  1 270 ? 141.852 65.897   22.514  1.00 71.67  1  278 LYS A NZ  1 
ATOM 2028  N N   . GLY A  1 271 ? 134.107 63.503   23.925  1.00 60.59  ?  279 GLY A N   1 
ATOM 2029  C CA  . GLY A  1 271 ? 133.330 62.502   23.227  1.00 61.57  ?  279 GLY A CA  1 
ATOM 2030  C C   . GLY A  1 271 ? 134.139 61.252   22.945  1.00 65.42  ?  279 GLY A C   1 
ATOM 2031  O O   . GLY A  1 271 ? 135.277 61.086   23.395  1.00 67.42  ?  279 GLY A O   1 
ATOM 2032  N N   . THR A  1 272 ? 133.531 60.354   22.164  1.00 61.51  ?  280 THR A N   1 
ATOM 2033  C CA  . THR A  1 272 ? 134.119 59.030   21.969  1.00 68.19  ?  280 THR A CA  1 
ATOM 2034  C C   . THR A  1 272 ? 135.458 59.111   21.241  1.00 75.94  ?  280 THR A C   1 
ATOM 2035  O O   . THR A  1 272 ? 136.408 58.407   21.601  1.00 80.19  ?  280 THR A O   1 
ATOM 2036  C CB  . THR A  1 272 ? 133.139 58.116   21.227  1.00 70.71  ?  280 THR A CB  1 
ATOM 2037  O OG1 . THR A  1 272 ? 133.764 56.855   20.963  1.00 79.12  ?  280 THR A OG1 1 
ATOM 2038  C CG2 . THR A  1 272 ? 132.674 58.742   19.916  1.00 67.35  ?  280 THR A CG2 1 
ATOM 2039  N N   . ASP A  1 273 ? 135.557 59.967   20.223  1.00 75.32  ?  281 ASP A N   1 
ATOM 2040  C CA  . ASP A  1 273 ? 136.803 60.170   19.480  1.00 76.74  ?  281 ASP A CA  1 
ATOM 2041  C C   . ASP A  1 273 ? 137.741 60.983   20.367  1.00 76.57  ?  281 ASP A C   1 
ATOM 2042  O O   . ASP A  1 273 ? 137.869 62.203   20.249  1.00 79.26  ?  281 ASP A O   1 
ATOM 2043  C CB  . ASP A  1 273 ? 136.557 60.855   18.142  1.00 78.45  ?  281 ASP A CB  1 
ATOM 2044  C CG  . ASP A  1 273 ? 137.713 60.667   17.178  1.00 80.27  ?  281 ASP A CG  1 
ATOM 2045  O OD1 . ASP A  1 273 ? 138.733 60.069   17.586  1.00 72.43  ?  281 ASP A OD1 1 
ATOM 2046  O OD2 . ASP A  1 273 ? 137.602 61.107   16.014  1.00 86.39  -1 281 ASP A OD2 1 
ATOM 2047  N N   . ILE A  1 274 ? 138.411 60.280   21.283  1.00 65.44  ?  282 ILE A N   1 
ATOM 2048  C CA  . ILE A  1 274 ? 139.220 60.937   22.302  1.00 65.70  ?  282 ILE A CA  1 
ATOM 2049  C C   . ILE A  1 274 ? 140.435 61.663   21.741  1.00 69.53  ?  282 ILE A C   1 
ATOM 2050  O O   . ILE A  1 274 ? 141.138 62.346   22.495  1.00 72.95  ?  282 ILE A O   1 
ATOM 2051  C CB  . ILE A  1 274 ? 139.665 59.872   23.326  1.00 66.73  ?  282 ILE A CB  1 
ATOM 2052  C CG1 . ILE A  1 274 ? 140.051 60.507   24.662  1.00 66.12  ?  282 ILE A CG1 1 
ATOM 2053  C CG2 . ILE A  1 274 ? 140.816 59.046   22.770  1.00 74.92  ?  282 ILE A CG2 1 
ATOM 2054  C CD1 . ILE A  1 274 ? 140.350 59.491   25.744  1.00 69.12  ?  282 ILE A CD1 1 
ATOM 2055  N N   . ARG A  1 275 ? 140.696 61.562   20.437  1.00 64.78  ?  283 ARG A N   1 
ATOM 2056  C CA  . ARG A  1 275 ? 141.774 62.311   19.802  1.00 65.09  ?  283 ARG A CA  1 
ATOM 2057  C C   . ARG A  1 275 ? 141.250 63.340   18.799  1.00 65.51  ?  283 ARG A C   1 
ATOM 2058  O O   . ARG A  1 275 ? 141.871 63.585   17.764  1.00 76.56  ?  283 ARG A O   1 
ATOM 2059  C CB  . ARG A  1 275 ? 142.775 61.351   19.158  1.00 62.52  ?  283 ARG A CB  1 
ATOM 2060  C CG  . ARG A  1 275 ? 142.198 60.040   18.663  1.00 64.44  ?  283 ARG A CG  1 
ATOM 2061  C CD  . ARG A  1 275 ? 143.306 59.007   18.468  1.00 70.06  ?  283 ARG A CD  1 
ATOM 2062  N NE  . ARG A  1 275 ? 144.144 59.267   17.300  1.00 69.82  ?  283 ARG A NE  1 
ATOM 2063  C CZ  . ARG A  1 275 ? 144.119 58.546   16.185  1.00 68.57  ?  283 ARG A CZ  1 
ATOM 2064  N NH1 . ARG A  1 275 ? 143.301 57.508   16.080  1.00 69.29  1  283 ARG A NH1 1 
ATOM 2065  N NH2 . ARG A  1 275 ? 144.922 58.857   15.177  1.00 69.65  ?  283 ARG A NH2 1 
ATOM 2066  N N   . ALA A  1 276 ? 140.105 63.941   19.107  1.00 64.22  ?  284 ALA A N   1 
ATOM 2067  C CA  . ALA A  1 276 ? 139.391 64.845   18.213  1.00 62.94  ?  284 ALA A CA  1 
ATOM 2068  C C   . ALA A  1 276 ? 139.786 66.292   18.478  1.00 61.75  ?  284 ALA A C   1 
ATOM 2069  O O   . ALA A  1 276 ? 139.749 66.752   19.623  1.00 61.00  ?  284 ALA A O   1 
ATOM 2070  C CB  . ALA A  1 276 ? 137.878 64.674   18.355  1.00 68.83  ?  284 ALA A CB  1 
ATOM 2071  N N   . ASN A  1 277 ? 140.166 66.999   17.426  1.00 64.06  ?  285 ASN A N   1 
ATOM 2072  C CA  . ASN A  1 277 ? 140.452 68.422   17.555  1.00 62.92  ?  285 ASN A CA  1 
ATOM 2073  C C   . ASN A  1 277 ? 139.164 69.206   17.802  1.00 58.44  ?  285 ASN A C   1 
ATOM 2074  O O   . ASN A  1 277 ? 138.217 69.100   17.012  1.00 55.43  ?  285 ASN A O   1 
ATOM 2075  C CB  . ASN A  1 277 ? 141.133 68.924   16.285  1.00 63.58  ?  285 ASN A CB  1 
ATOM 2076  C CG  . ASN A  1 277 ? 141.645 70.344   16.413  1.00 71.33  ?  285 ASN A CG  1 
ATOM 2077  O OD1 . ASN A  1 277 ? 141.460 71.001   17.437  1.00 72.49  ?  285 ASN A OD1 1 
ATOM 2078  N ND2 . ASN A  1 277 ? 142.281 70.834   15.355  1.00 76.27  ?  285 ASN A ND2 1 
ATOM 2079  N N   . PRO A  1 278 ? 139.089 69.994   18.877  1.00 65.17  ?  286 PRO A N   1 
ATOM 2080  C CA  . PRO A  1 278 ? 137.910 70.842   19.098  1.00 61.82  ?  286 PRO A CA  1 
ATOM 2081  C C   . PRO A  1 278 ? 137.773 71.900   18.013  1.00 59.58  ?  286 PRO A C   1 
ATOM 2082  O O   . PRO A  1 278 ? 138.755 72.524   17.604  1.00 62.01  ?  286 PRO A O   1 
ATOM 2083  C CB  . PRO A  1 278 ? 138.181 71.479   20.466  1.00 56.62  ?  286 PRO A CB  1 
ATOM 2084  C CG  . PRO A  1 278 ? 139.118 70.542   21.132  1.00 57.35  ?  286 PRO A CG  1 
ATOM 2085  C CD  . PRO A  1 278 ? 139.996 70.011   20.036  1.00 58.82  ?  286 PRO A CD  1 
ATOM 2086  N N   . GLY A  1 279 ? 136.546 72.080   17.537  1.00 55.60  ?  287 GLY A N   1 
ATOM 2087  C CA  . GLY A  1 279 ? 136.274 73.074   16.514  1.00 53.47  ?  287 GLY A CA  1 
ATOM 2088  C C   . GLY A  1 279 ? 136.647 74.483   16.949  1.00 51.95  ?  287 GLY A C   1 
ATOM 2089  O O   . GLY A  1 279 ? 136.882 74.781   18.121  1.00 52.58  ?  287 GLY A O   1 
ATOM 2090  N N   . SER A  1 280 ? 136.696 75.369   15.953  1.00 51.97  ?  288 SER A N   1 
ATOM 2091  C CA  . SER A  1 280 ? 137.054 76.767   16.179  1.00 51.21  ?  288 SER A CA  1 
ATOM 2092  C C   . SER A  1 280 ? 136.122 77.412   17.197  1.00 49.77  ?  288 SER A C   1 
ATOM 2093  O O   . SER A  1 280 ? 134.897 77.344   17.066  1.00 49.03  ?  288 SER A O   1 
ATOM 2094  C CB  . SER A  1 280 ? 137.008 77.536   14.858  1.00 47.96  ?  288 SER A CB  1 
ATOM 2095  O OG  . SER A  1 280 ? 137.382 78.891   15.035  1.00 47.60  ?  288 SER A OG  1 
ATOM 2096  N N   . TYR A  1 281 ? 136.709 78.032   18.222  1.00 50.10  ?  289 TYR A N   1 
ATOM 2097  C CA  . TYR A  1 281 ? 135.945 78.649   19.298  1.00 47.73  ?  289 TYR A CA  1 
ATOM 2098  C C   . TYR A  1 281 ? 136.250 80.138   19.428  1.00 45.91  ?  289 TYR A C   1 
ATOM 2099  O O   . TYR A  1 281 ? 136.255 80.685   20.532  1.00 48.20  ?  289 TYR A O   1 
ATOM 2100  C CB  . TYR A  1 281 ? 136.197 77.907   20.610  1.00 46.90  ?  289 TYR A CB  1 
ATOM 2101  C CG  . TYR A  1 281 ? 137.652 77.634   20.914  1.00 49.91  ?  289 TYR A CG  1 
ATOM 2102  C CD1 . TYR A  1 281 ? 138.495 78.650   21.350  1.00 49.83  ?  289 TYR A CD1 1 
ATOM 2103  C CD2 . TYR A  1 281 ? 138.207 76.384   20.661  1.00 52.99  ?  289 TYR A CD2 1 
ATOM 2104  C CE1 . TYR A  1 281 ? 139.830 78.402   21.617  1.00 54.53  ?  289 TYR A CE1 1 
ATOM 2105  C CE2 . TYR A  1 281 ? 139.543 76.132   20.902  1.00 55.85  ?  289 TYR A CE2 1 
ATOM 2106  C CZ  . TYR A  1 281 ? 140.350 77.142   21.382  1.00 56.98  ?  289 TYR A CZ  1 
ATOM 2107  O OH  . TYR A  1 281 ? 141.680 76.886   21.628  1.00 59.39  ?  289 TYR A OH  1 
ATOM 2108  N N   . LEU A  1 282 ? 136.521 80.799   18.303  1.00 53.21  ?  290 LEU A N   1 
ATOM 2109  C CA  . LEU A  1 282 ? 136.679 82.252   18.241  1.00 51.26  ?  290 LEU A CA  1 
ATOM 2110  C C   . LEU A  1 282 ? 135.489 82.790   17.450  1.00 48.63  ?  290 LEU A C   1 
ATOM 2111  O O   . LEU A  1 282 ? 135.457 82.699   16.219  1.00 48.96  ?  290 LEU A O   1 
ATOM 2112  C CB  . LEU A  1 282 ? 138.011 82.643   17.608  1.00 49.82  ?  290 LEU A CB  1 
ATOM 2113  C CG  . LEU A  1 282 ? 138.518 84.050   17.943  1.00 48.84  ?  290 LEU A CG  1 
ATOM 2114  C CD1 . LEU A  1 282 ? 140.033 84.091   17.884  1.00 54.26  ?  290 LEU A CD1 1 
ATOM 2115  C CD2 . LEU A  1 282 ? 137.924 85.102   17.021  1.00 47.44  ?  290 LEU A CD2 1 
ATOM 2116  N N   . TYR A  1 283 ? 134.513 83.343   18.163  1.00 47.21  ?  291 TYR A N   1 
ATOM 2117  C CA  . TYR A  1 283 ? 133.245 83.761   17.581  1.00 46.36  ?  291 TYR A CA  1 
ATOM 2118  C C   . TYR A  1 283 ? 133.228 85.272   17.408  1.00 45.78  ?  291 TYR A C   1 
ATOM 2119  O O   . TYR A  1 283 ? 133.551 86.011   18.343  1.00 46.97  ?  291 TYR A O   1 
ATOM 2120  C CB  . TYR A  1 283 ? 132.081 83.325   18.468  1.00 41.87  ?  291 TYR A CB  1 
ATOM 2121  C CG  . TYR A  1 283 ? 132.189 81.898   18.950  1.00 42.20  ?  291 TYR A CG  1 
ATOM 2122  C CD1 . TYR A  1 283 ? 131.755 80.842   18.159  1.00 42.48  ?  291 TYR A CD1 1 
ATOM 2123  C CD2 . TYR A  1 283 ? 132.732 81.607   20.195  1.00 42.29  ?  291 TYR A CD2 1 
ATOM 2124  C CE1 . TYR A  1 283 ? 131.852 79.537   18.597  1.00 42.82  ?  291 TYR A CE1 1 
ATOM 2125  C CE2 . TYR A  1 283 ? 132.837 80.304   20.639  1.00 42.63  ?  291 TYR A CE2 1 
ATOM 2126  C CZ  . TYR A  1 283 ? 132.394 79.273   19.836  1.00 42.90  ?  291 TYR A CZ  1 
ATOM 2127  O OH  . TYR A  1 283 ? 132.494 77.974   20.276  1.00 43.28  ?  291 TYR A OH  1 
ATOM 2128  N N   . SER A  1 284 ? 132.850 85.726   16.216  1.00 54.96  ?  292 SER A N   1 
ATOM 2129  C CA  . SER A  1 284 ? 132.777 87.152   15.912  1.00 53.83  ?  292 SER A CA  1 
ATOM 2130  C C   . SER A  1 284 ? 131.439 87.446   15.248  1.00 49.75  ?  292 SER A C   1 
ATOM 2131  O O   . SER A  1 284 ? 131.132 86.857   14.191  1.00 53.38  ?  292 SER A O   1 
ATOM 2132  C CB  . SER A  1 284 ? 133.939 87.582   15.014  1.00 54.24  ?  292 SER A CB  1 
ATOM 2133  O OG  . SER A  1 284 ? 133.732 88.887   14.504  1.00 56.97  ?  292 SER A OG  1 
ATOM 2134  N N   . PRO A  1 285 ? 130.620 88.328   15.812  1.00 48.09  ?  293 PRO A N   1 
ATOM 2135  C CA  . PRO A  1 285 ? 129.323 88.641   15.210  1.00 46.41  ?  293 PRO A CA  1 
ATOM 2136  C C   . PRO A  1 285 ? 129.425 89.721   14.143  1.00 47.41  ?  293 PRO A C   1 
ATOM 2137  O O   . PRO A  1 285 ? 130.363 90.521   14.107  1.00 47.80  ?  293 PRO A O   1 
ATOM 2138  C CB  . PRO A  1 285 ? 128.507 89.145   16.407  1.00 44.84  ?  293 PRO A CB  1 
ATOM 2139  C CG  . PRO A  1 285 ? 129.530 89.809   17.269  1.00 45.17  ?  293 PRO A CG  1 
ATOM 2140  C CD  . PRO A  1 285 ? 130.808 89.014   17.103  1.00 47.33  ?  293 PRO A CD  1 
ATOM 2141  N N   . SER A  1 286 ? 128.429 89.724   13.260  1.00 44.43  ?  294 SER A N   1 
ATOM 2142  C CA  . SER A  1 286 ? 128.278 90.801   12.294  1.00 44.03  ?  294 SER A CA  1 
ATOM 2143  C C   . SER A  1 286 ? 127.492 91.933   12.937  1.00 43.08  ?  294 SER A C   1 
ATOM 2144  O O   . SER A  1 286 ? 126.328 91.728   13.307  1.00 45.29  ?  294 SER A O   1 
ATOM 2145  C CB  . SER A  1 286 ? 127.562 90.316   11.046  1.00 40.69  ?  294 SER A CB  1 
ATOM 2146  O OG  . SER A  1 286 ? 126.243 89.896   11.345  1.00 40.52  ?  294 SER A OG  1 
ATOM 2147  N N   . PRO A  1 287 ? 128.071 93.118   13.103  1.00 44.18  ?  295 PRO A N   1 
ATOM 2148  C CA  . PRO A  1 287 ? 127.334 94.215   13.734  1.00 45.29  ?  295 PRO A CA  1 
ATOM 2149  C C   . PRO A  1 287 ? 126.242 94.747   12.820  1.00 47.57  ?  295 PRO A C   1 
ATOM 2150  O O   . PRO A  1 287 ? 126.226 94.503   11.612  1.00 48.53  ?  295 PRO A O   1 
ATOM 2151  C CB  . PRO A  1 287 ? 128.415 95.272   13.977  1.00 46.86  ?  295 PRO A CB  1 
ATOM 2152  C CG  . PRO A  1 287 ? 129.420 95.011   12.911  1.00 46.77  ?  295 PRO A CG  1 
ATOM 2153  C CD  . PRO A  1 287 ? 129.436 93.517   12.721  1.00 47.29  ?  295 PRO A CD  1 
ATOM 2154  N N   . SER A  1 288 ? 125.310 95.483   13.422  1.00 47.84  ?  296 SER A N   1 
ATOM 2155  C CA  . SER A  1 288 ? 124.256 96.126   12.651  1.00 47.08  ?  296 SER A CA  1 
ATOM 2156  C C   . SER A  1 288 ? 123.736 97.323   13.430  1.00 46.56  ?  296 SER A C   1 
ATOM 2157  O O   . SER A  1 288 ? 123.571 97.252   14.650  1.00 47.54  ?  296 SER A O   1 
ATOM 2158  C CB  . SER A  1 288 ? 123.112 95.157   12.337  1.00 40.99  ?  296 SER A CB  1 
ATOM 2159  O OG  . SER A  1 288 ? 122.102 95.803   11.582  1.00 40.99  ?  296 SER A OG  1 
ATOM 2160  N N   . GLY A  1 289 ? 123.474 98.414   12.717  1.00 48.53  ?  297 GLY A N   1 
ATOM 2161  C CA  . GLY A  1 289 ? 123.017 99.643   13.324  1.00 47.18  ?  297 GLY A CA  1 
ATOM 2162  C C   . GLY A  1 289 ? 121.516 99.773   13.427  1.00 46.90  ?  297 GLY A C   1 
ATOM 2163  O O   . GLY A  1 289 ? 121.022 100.861  13.744  1.00 46.33  ?  297 GLY A O   1 
ATOM 2164  N N   . SER A  1 290 ? 120.783 98.693   13.176  1.00 48.57  ?  298 SER A N   1 
ATOM 2165  C CA  . SER A  1 290 ? 119.320 98.632   13.289  1.00 47.36  ?  298 SER A CA  1 
ATOM 2166  C C   . SER A  1 290 ? 118.704 99.736   12.422  1.00 44.92  ?  298 SER A C   1 
ATOM 2167  O O   . SER A  1 290 ? 119.242 100.086  11.364  1.00 47.84  ?  298 SER A O   1 
ATOM 2168  C CB  . SER A  1 290 ? 118.921 98.679   14.755  1.00 47.05  ?  298 SER A CB  1 
ATOM 2169  O OG  . SER A  1 290 ? 117.512 98.632   14.900  1.00 48.46  ?  298 SER A OG  1 
ATOM 2170  N N   . VAL A  1 291 ? 117.573 100.281  12.854  1.00 43.92  ?  299 VAL A N   1 
ATOM 2171  C CA  . VAL A  1 291 ? 116.817 101.235  12.053  1.00 45.62  ?  299 VAL A CA  1 
ATOM 2172  C C   . VAL A  1 291 ? 117.431 102.620  12.183  1.00 51.11  ?  299 VAL A C   1 
ATOM 2173  O O   . VAL A  1 291 ? 117.841 103.041  13.271  1.00 56.54  ?  299 VAL A O   1 
ATOM 2174  C CB  . VAL A  1 291 ? 115.339 101.244  12.486  1.00 44.54  ?  299 VAL A CB  1 
ATOM 2175  C CG1 . VAL A  1 291 ? 114.523 102.178  11.602  1.00 46.23  ?  299 VAL A CG1 1 
ATOM 2176  C CG2 . VAL A  1 291 ? 114.765 99.837   12.450  1.00 49.82  ?  299 VAL A CG2 1 
ATOM 2177  N N   . VAL A  1 292 ? 117.499 103.333  11.063  1.00 48.47  ?  300 VAL A N   1 
ATOM 2178  C CA  . VAL A  1 292 ? 117.861 104.743  11.046  1.00 49.62  ?  300 VAL A CA  1 
ATOM 2179  C C   . VAL A  1 292 ? 116.571 105.532  10.896  1.00 49.70  ?  300 VAL A C   1 
ATOM 2180  O O   . VAL A  1 292 ? 115.860 105.388  9.894   1.00 49.53  ?  300 VAL A O   1 
ATOM 2181  C CB  . VAL A  1 292 ? 118.842 105.066  9.909   1.00 51.19  ?  300 VAL A CB  1 
ATOM 2182  C CG1 . VAL A  1 292 ? 118.949 106.570  9.718   1.00 47.33  ?  300 VAL A CG1 1 
ATOM 2183  C CG2 . VAL A  1 292 ? 120.209 104.463  10.196  1.00 54.60  ?  300 VAL A CG2 1 
ATOM 2184  N N   . THR A  1 293 ? 116.257 106.351  11.894  1.00 50.37  ?  301 THR A N   1 
ATOM 2185  C CA  . THR A  1 293 ? 115.038 107.143  11.896  1.00 49.78  ?  301 THR A CA  1 
ATOM 2186  C C   . THR A  1 293 ? 115.365 108.597  12.201  1.00 51.94  ?  301 THR A C   1 
ATOM 2187  O O   . THR A  1 293 ? 116.320 108.898  12.924  1.00 53.89  ?  301 THR A O   1 
ATOM 2188  C CB  . THR A  1 293 ? 114.027 106.610  12.920  1.00 46.69  ?  301 THR A CB  1 
ATOM 2189  O OG1 . THR A  1 293 ? 112.924 107.518  13.022  1.00 52.81  ?  301 THR A OG1 1 
ATOM 2190  C CG2 . THR A  1 293 ? 114.682 106.453  14.284  1.00 46.09  ?  301 THR A CG2 1 
ATOM 2191  N N   . SER A  1 294 ? 114.564 109.501  11.633  1.00 50.60  ?  302 SER A N   1 
ATOM 2192  C CA  . SER A  1 294 ? 114.749 110.924  11.888  1.00 50.12  ?  302 SER A CA  1 
ATOM 2193  C C   . SER A  1 294 ? 114.334 111.328  13.297  1.00 50.34  ?  302 SER A C   1 
ATOM 2194  O O   . SER A  1 294 ? 114.666 112.438  13.726  1.00 52.30  ?  302 SER A O   1 
ATOM 2195  C CB  . SER A  1 294 ? 113.976 111.748  10.857  1.00 41.54  ?  302 SER A CB  1 
ATOM 2196  O OG  . SER A  1 294 ? 112.651 111.273  10.718  1.00 41.64  ?  302 SER A OG  1 
ATOM 2197  N N   . ASP A  1 295 ? 113.619 110.464  14.022  1.00 48.16  ?  303 ASP A N   1 
ATOM 2198  C CA  . ASP A  1 295 ? 113.319 110.754  15.420  1.00 49.99  ?  303 ASP A CA  1 
ATOM 2199  C C   . ASP A  1 295 ? 114.586 110.743  16.264  1.00 50.72  ?  303 ASP A C   1 
ATOM 2200  O O   . ASP A  1 295 ? 114.745 111.570  17.170  1.00 55.69  ?  303 ASP A O   1 
ATOM 2201  C CB  . ASP A  1 295 ? 112.307 109.744  15.964  1.00 50.90  ?  303 ASP A CB  1 
ATOM 2202  C CG  . ASP A  1 295 ? 110.966 109.827  15.263  1.00 62.10  ?  303 ASP A CG  1 
ATOM 2203  O OD1 . ASP A  1 295 ? 110.645 110.905  14.717  1.00 70.72  ?  303 ASP A OD1 1 
ATOM 2204  O OD2 . ASP A  1 295 ? 110.229 108.817  15.263  1.00 62.32  -1 303 ASP A OD2 1 
ATOM 2205  N N   . SER A  1 296 ? 115.500 109.820  15.976  1.00 48.81  ?  304 SER A N   1 
ATOM 2206  C CA  . SER A  1 296 ? 116.786 109.741  16.655  1.00 48.53  ?  304 SER A CA  1 
ATOM 2207  C C   . SER A  1 296 ? 117.837 110.653  16.039  1.00 48.85  ?  304 SER A C   1 
ATOM 2208  O O   . SER A  1 296 ? 119.003 110.586  16.443  1.00 48.71  ?  304 SER A O   1 
ATOM 2209  C CB  . SER A  1 296 ? 117.292 108.296  16.655  1.00 54.92  ?  304 SER A CB  1 
ATOM 2210  O OG  . SER A  1 296 ? 116.390 107.444  17.337  1.00 57.45  ?  304 SER A OG  1 
ATOM 2211  N N   . GLN A  1 297 ? 117.459 111.484  15.070  1.00 49.61  ?  305 GLN A N   1 
ATOM 2212  C CA  . GLN A  1 297 ? 118.420 112.363  14.421  1.00 52.11  ?  305 GLN A CA  1 
ATOM 2213  C C   . GLN A  1 297 ? 118.988 113.361  15.423  1.00 51.79  ?  305 GLN A C   1 
ATOM 2214  O O   . GLN A  1 297 ? 118.302 113.815  16.342  1.00 59.05  ?  305 GLN A O   1 
ATOM 2215  C CB  . GLN A  1 297 ? 117.761 113.099  13.252  1.00 53.51  ?  305 GLN A CB  1 
ATOM 2216  C CG  . GLN A  1 297 ? 118.736 113.636  12.215  1.00 53.13  ?  305 GLN A CG  1 
ATOM 2217  C CD  . GLN A  1 297 ? 119.522 112.538  11.524  1.00 51.09  ?  305 GLN A CD  1 
ATOM 2218  O OE1 . GLN A  1 297 ? 120.669 112.738  11.129  1.00 58.27  ?  305 GLN A OE1 1 
ATOM 2219  N NE2 . GLN A  1 297 ? 118.905 111.370  11.371  1.00 46.69  ?  305 GLN A NE2 1 
ATOM 2220  N N   . LEU A  1 298 ? 120.261 113.708  15.236  1.00 51.37  ?  306 LEU A N   1 
ATOM 2221  C CA  . LEU A  1 298 ? 120.984 114.528  16.195  1.00 51.78  ?  306 LEU A CA  1 
ATOM 2222  C C   . LEU A  1 298 ? 121.500 115.839  15.617  1.00 52.59  ?  306 LEU A C   1 
ATOM 2223  O O   . LEU A  1 298 ? 121.952 116.696  16.385  1.00 53.13  ?  306 LEU A O   1 
ATOM 2224  C CB  . LEU A  1 298 ? 122.162 113.729  16.776  1.00 52.29  ?  306 LEU A CB  1 
ATOM 2225  C CG  . LEU A  1 298 ? 122.847 114.197  18.061  1.00 52.62  ?  306 LEU A CG  1 
ATOM 2226  C CD1 . LEU A  1 298 ? 122.922 113.058  19.065  1.00 52.05  ?  306 LEU A CD1 1 
ATOM 2227  C CD2 . LEU A  1 298 ? 124.234 114.736  17.758  1.00 53.56  ?  306 LEU A CD2 1 
ATOM 2228  N N   . PHE A  1 299 ? 121.422 116.037  14.306  1.00 52.88  ?  307 PHE A N   1 
ATOM 2229  C CA  . PHE A  1 299 ? 121.916 117.242  13.655  1.00 54.38  ?  307 PHE A CA  1 
ATOM 2230  C C   . PHE A  1 299 ? 120.745 117.997  13.028  1.00 56.10  ?  307 PHE A C   1 
ATOM 2231  O O   . PHE A  1 299 ? 119.577 117.673  13.261  1.00 56.37  ?  307 PHE A O   1 
ATOM 2232  C CB  . PHE A  1 299 ? 122.997 116.886  12.633  1.00 50.17  ?  307 PHE A CB  1 
ATOM 2233  C CG  . PHE A  1 299 ? 124.163 116.155  13.228  1.00 54.68  ?  307 PHE A CG  1 
ATOM 2234  C CD1 . PHE A  1 299 ? 125.004 116.789  14.130  1.00 56.43  ?  307 PHE A CD1 1 
ATOM 2235  C CD2 . PHE A  1 299 ? 124.403 114.830  12.910  1.00 56.93  ?  307 PHE A CD2 1 
ATOM 2236  C CE1 . PHE A  1 299 ? 126.074 116.119  14.690  1.00 56.20  ?  307 PHE A CE1 1 
ATOM 2237  C CE2 . PHE A  1 299 ? 125.473 114.153  13.468  1.00 58.12  ?  307 PHE A CE2 1 
ATOM 2238  C CZ  . PHE A  1 299 ? 126.308 114.798  14.360  1.00 57.26  ?  307 PHE A CZ  1 
ATOM 2239  N N   . ASN A  1 300 ? 121.071 119.020  12.235  1.00 50.97  ?  308 ASN A N   1 
ATOM 2240  C CA  . ASN A  1 300 ? 120.089 119.958  11.690  1.00 53.82  ?  308 ASN A CA  1 
ATOM 2241  C C   . ASN A  1 300 ? 119.292 120.643  12.793  1.00 58.93  ?  308 ASN A C   1 
ATOM 2242  O O   . ASN A  1 300 ? 118.180 121.126  12.557  1.00 65.68  ?  308 ASN A O   1 
ATOM 2243  C CB  . ASN A  1 300 ? 119.142 119.283  10.689  1.00 53.94  ?  308 ASN A CB  1 
ATOM 2244  C CG  . ASN A  1 300 ? 119.801 119.017  9.348   1.00 55.75  ?  308 ASN A CG  1 
ATOM 2245  O OD1 . ASN A  1 300 ? 120.987 119.286  9.164   1.00 57.64  ?  308 ASN A OD1 1 
ATOM 2246  N ND2 . ASN A  1 300 ? 119.028 118.502  8.399   1.00 55.78  ?  308 ASN A ND2 1 
ATOM 2247  N N   . LYS A  1 301 ? 119.849 120.685  14.002  1.00 56.93  ?  309 LYS A N   1 
ATOM 2248  C CA  . LYS A  1 301 ? 119.247 121.299  15.166  1.00 57.94  ?  309 LYS A CA  1 
ATOM 2249  C C   . LYS A  1 301 ? 120.171 122.365  15.739  1.00 58.39  ?  309 LYS A C   1 
ATOM 2250  O O   . LYS A  1 301 ? 121.396 122.207  15.703  1.00 56.01  ?  309 LYS A O   1 
ATOM 2251  C CB  . LYS A  1 301 ? 118.967 120.252  16.254  1.00 60.14  ?  309 LYS A CB  1 
ATOM 2252  C CG  . LYS A  1 301 ? 118.101 119.087  15.819  1.00 65.77  ?  309 LYS A CG  1 
ATOM 2253  C CD  . LYS A  1 301 ? 118.117 117.993  16.876  1.00 67.80  ?  309 LYS A CD  1 
ATOM 2254  C CE  . LYS A  1 301 ? 117.796 118.547  18.254  1.00 71.16  ?  309 LYS A CE  1 
ATOM 2255  N NZ  . LYS A  1 301 ? 117.952 117.510  19.312  1.00 73.00  1  309 LYS A NZ  1 
ATOM 2256  N N   . PRO A  1 302 ? 119.622 123.459  16.257  1.00 53.37  ?  310 PRO A N   1 
ATOM 2257  C CA  . PRO A  1 302 ? 120.458 124.440  16.953  1.00 54.23  ?  310 PRO A CA  1 
ATOM 2258  C C   . PRO A  1 302 ? 120.804 123.957  18.352  1.00 53.94  ?  310 PRO A C   1 
ATOM 2259  O O   . PRO A  1 302 ? 119.969 123.389  19.060  1.00 53.55  ?  310 PRO A O   1 
ATOM 2260  C CB  . PRO A  1 302 ? 119.570 125.689  16.997  1.00 57.98  ?  310 PRO A CB  1 
ATOM 2261  C CG  . PRO A  1 302 ? 118.182 125.145  16.993  1.00 57.84  ?  310 PRO A CG  1 
ATOM 2262  C CD  . PRO A  1 302 ? 118.224 123.909  16.133  1.00 57.39  ?  310 PRO A CD  1 
ATOM 2263  N N   . TYR A  1 303 ? 122.055 124.175  18.745  1.00 53.86  ?  311 TYR A N   1 
ATOM 2264  C CA  . TYR A  1 303 ? 122.519 123.843  20.086  1.00 53.80  ?  311 TYR A CA  1 
ATOM 2265  C C   . TYR A  1 303 ? 123.156 125.081  20.694  1.00 58.98  ?  311 TYR A C   1 
ATOM 2266  O O   . TYR A  1 303 ? 124.074 125.662  20.105  1.00 62.20  ?  311 TYR A O   1 
ATOM 2267  C CB  . TYR A  1 303 ? 123.510 122.677  20.066  1.00 59.76  ?  311 TYR A CB  1 
ATOM 2268  C CG  . TYR A  1 303 ? 122.895 121.367  19.630  1.00 62.44  ?  311 TYR A CG  1 
ATOM 2269  C CD1 . TYR A  1 303 ? 122.125 120.615  20.506  1.00 63.44  ?  311 TYR A CD1 1 
ATOM 2270  C CD2 . TYR A  1 303 ? 123.091 120.878  18.345  1.00 67.78  ?  311 TYR A CD2 1 
ATOM 2271  C CE1 . TYR A  1 303 ? 121.559 119.415  20.114  1.00 63.64  ?  311 TYR A CE1 1 
ATOM 2272  C CE2 . TYR A  1 303 ? 122.532 119.678  17.944  1.00 67.46  ?  311 TYR A CE2 1 
ATOM 2273  C CZ  . TYR A  1 303 ? 121.767 118.951  18.832  1.00 63.91  ?  311 TYR A CZ  1 
ATOM 2274  O OH  . TYR A  1 303 ? 121.208 117.758  18.436  1.00 61.54  ?  311 TYR A OH  1 
ATOM 2275  N N   . TRP A  1 304 ? 122.672 125.482  21.865  1.00 62.95  ?  312 TRP A N   1 
ATOM 2276  C CA  . TRP A  1 304 ? 123.133 126.687  22.541  1.00 60.43  ?  312 TRP A CA  1 
ATOM 2277  C C   . TRP A  1 304 ? 124.008 126.285  23.717  1.00 61.12  ?  312 TRP A C   1 
ATOM 2278  O O   . TRP A  1 304 ? 123.554 125.571  24.618  1.00 61.50  ?  312 TRP A O   1 
ATOM 2279  C CB  . TRP A  1 304 ? 121.950 127.531  23.015  1.00 56.47  ?  312 TRP A CB  1 
ATOM 2280  C CG  . TRP A  1 304 ? 120.888 127.670  21.980  1.00 56.31  ?  312 TRP A CG  1 
ATOM 2281  C CD1 . TRP A  1 304 ? 119.620 127.174  22.038  1.00 56.14  ?  312 TRP A CD1 1 
ATOM 2282  C CD2 . TRP A  1 304 ? 121.005 128.333  20.717  1.00 57.06  ?  312 TRP A CD2 1 
ATOM 2283  N NE1 . TRP A  1 304 ? 118.934 127.496  20.892  1.00 58.72  ?  312 TRP A NE1 1 
ATOM 2284  C CE2 . TRP A  1 304 ? 119.763 128.207  20.065  1.00 60.82  ?  312 TRP A CE2 1 
ATOM 2285  C CE3 . TRP A  1 304 ? 122.037 129.025  20.076  1.00 58.03  ?  312 TRP A CE3 1 
ATOM 2286  C CZ2 . TRP A  1 304 ? 119.525 128.746  18.803  1.00 65.35  ?  312 TRP A CZ2 1 
ATOM 2287  C CZ3 . TRP A  1 304 ? 121.798 129.559  18.824  1.00 63.62  ?  312 TRP A CZ3 1 
ATOM 2288  C CH2 . TRP A  1 304 ? 120.553 129.415  18.200  1.00 65.26  ?  312 TRP A CH2 1 
ATOM 2289  N N   . LEU A  1 305 ? 125.257 126.739  23.707  1.00 65.29  ?  313 LEU A N   1 
ATOM 2290  C CA  . LEU A  1 305 ? 126.193 126.447  24.784  1.00 62.49  ?  313 LEU A CA  1 
ATOM 2291  C C   . LEU A  1 305 ? 126.075 127.544  25.834  1.00 67.74  ?  313 LEU A C   1 
ATOM 2292  O O   . LEU A  1 305 ? 126.396 128.707  25.569  1.00 67.35  ?  313 LEU A O   1 
ATOM 2293  C CB  . LEU A  1 305 ? 127.620 126.336  24.253  1.00 62.65  ?  313 LEU A CB  1 
ATOM 2294  C CG  . LEU A  1 305 ? 128.699 125.949  25.269  1.00 67.45  ?  313 LEU A CG  1 
ATOM 2295  C CD1 . LEU A  1 305 ? 129.723 125.029  24.625  1.00 69.71  ?  313 LEU A CD1 1 
ATOM 2296  C CD2 . LEU A  1 305 ? 129.388 127.180  25.845  1.00 75.99  ?  313 LEU A CD2 1 
ATOM 2297  N N   . HIS A  1 306 ? 125.603 127.175  27.021  1.00 70.79  ?  314 HIS A N   1 
ATOM 2298  C CA  . HIS A  1 306 ? 125.550 128.103  28.142  1.00 77.73  ?  314 HIS A CA  1 
ATOM 2299  C C   . HIS A  1 306 ? 126.675 127.773  29.111  1.00 75.51  ?  314 HIS A C   1 
ATOM 2300  O O   . HIS A  1 306 ? 127.625 128.547  29.265  1.00 75.54  ?  314 HIS A O   1 
ATOM 2301  C CB  . HIS A  1 306 ? 124.192 128.041  28.847  1.00 77.02  ?  314 HIS A CB  1 
ATOM 2302  C CG  . HIS A  1 306 ? 123.053 128.553  28.021  1.00 81.56  ?  314 HIS A CG  1 
ATOM 2303  N ND1 . HIS A  1 306 ? 122.168 127.719  27.373  1.00 81.01  ?  314 HIS A ND1 1 
ATOM 2304  C CD2 . HIS A  1 306 ? 122.651 129.816  27.741  1.00 85.77  ?  314 HIS A CD2 1 
ATOM 2305  C CE1 . HIS A  1 306 ? 121.271 128.445  26.729  1.00 82.11  ?  314 HIS A CE1 1 
ATOM 2306  N NE2 . HIS A  1 306 ? 121.543 129.721  26.936  1.00 85.26  ?  314 HIS A NE2 1 
ATOM 2307  N N   . LYS A  1 307 ? 126.576 126.617  29.759  1.00 74.60  ?  315 LYS A N   1 
ATOM 2308  C CA  . LYS A  1 307 ? 127.603 126.119  30.660  1.00 73.25  ?  315 LYS A CA  1 
ATOM 2309  C C   . LYS A  1 307 ? 128.361 124.994  29.974  1.00 70.30  ?  315 LYS A C   1 
ATOM 2310  O O   . LYS A  1 307 ? 127.750 124.043  29.477  1.00 67.37  ?  315 LYS A O   1 
ATOM 2311  C CB  . LYS A  1 307 ? 126.980 125.611  31.962  1.00 76.37  ?  315 LYS A CB  1 
ATOM 2312  C CG  . LYS A  1 307 ? 125.770 126.407  32.416  1.00 83.60  ?  315 LYS A CG  1 
ATOM 2313  C CD  . LYS A  1 307 ? 125.133 125.789  33.649  1.00 84.01  ?  315 LYS A CD  1 
ATOM 2314  C CE  . LYS A  1 307 ? 123.752 126.374  33.905  1.00 80.81  ?  315 LYS A CE  1 
ATOM 2315  N NZ  . LYS A  1 307 ? 122.772 125.940  32.869  1.00 72.54  1  315 LYS A NZ  1 
ATOM 2316  N N   . ALA A  1 308 ? 129.684 125.109  29.936  1.00 68.31  ?  316 ALA A N   1 
ATOM 2317  C CA  . ALA A  1 308 ? 130.499 124.049  29.372  1.00 66.85  ?  316 ALA A CA  1 
ATOM 2318  C C   . ALA A  1 308 ? 130.756 122.968  30.418  1.00 63.66  ?  316 ALA A C   1 
ATOM 2319  O O   . ALA A  1 308 ? 130.545 123.160  31.619  1.00 65.10  ?  316 ALA A O   1 
ATOM 2320  C CB  . ALA A  1 308 ? 131.818 124.610  28.849  1.00 67.95  ?  316 ALA A CB  1 
ATOM 2321  N N   . GLN A  1 309 ? 131.230 121.811  29.949  1.00 63.73  ?  317 GLN A N   1 
ATOM 2322  C CA  . GLN A  1 309 ? 131.546 120.732  30.877  1.00 63.14  ?  317 GLN A CA  1 
ATOM 2323  C C   . GLN A  1 309 ? 132.836 121.016  31.634  1.00 66.65  ?  317 GLN A C   1 
ATOM 2324  O O   . GLN A  1 309 ? 132.973 120.618  32.796  1.00 66.31  ?  317 GLN A O   1 
ATOM 2325  C CB  . GLN A  1 309 ? 131.631 119.398  30.130  1.00 61.72  ?  317 GLN A CB  1 
ATOM 2326  C CG  . GLN A  1 309 ? 132.813 119.255  29.179  1.00 61.59  ?  317 GLN A CG  1 
ATOM 2327  C CD  . GLN A  1 309 ? 134.074 118.784  29.880  1.00 65.65  ?  317 GLN A CD  1 
ATOM 2328  O OE1 . GLN A  1 309 ? 134.013 118.205  30.965  1.00 65.58  ?  317 GLN A OE1 1 
ATOM 2329  N NE2 . GLN A  1 309 ? 135.223 119.039  29.268  1.00 69.89  ?  317 GLN A NE2 1 
ATOM 2330  N N   . GLY A  1 310 ? 133.788 121.696  30.994  1.00 65.41  ?  318 GLY A N   1 
ATOM 2331  C CA  . GLY A  1 310 ? 135.047 122.040  31.613  1.00 67.89  ?  318 GLY A CA  1 
ATOM 2332  C C   . GLY A  1 310 ? 135.095 123.495  32.044  1.00 69.12  ?  318 GLY A C   1 
ATOM 2333  O O   . GLY A  1 310 ? 134.101 124.223  32.015  1.00 72.47  ?  318 GLY A O   1 
ATOM 2334  N N   . LEU A  1 311 ? 136.292 123.920  32.453  1.00 61.25  ?  319 LEU A N   1 
ATOM 2335  C CA  . LEU A  1 311 ? 136.459 125.294  32.912  1.00 64.34  ?  319 LEU A CA  1 
ATOM 2336  C C   . LEU A  1 311 ? 136.468 126.281  31.750  1.00 64.82  ?  319 LEU A C   1 
ATOM 2337  O O   . LEU A  1 311 ? 135.982 127.408  31.895  1.00 66.58  ?  319 LEU A O   1 
ATOM 2338  C CB  . LEU A  1 311 ? 137.735 125.417  33.744  1.00 64.73  ?  319 LEU A CB  1 
ATOM 2339  C CG  . LEU A  1 311 ? 137.534 125.291  35.258  1.00 65.50  ?  319 LEU A CG  1 
ATOM 2340  C CD1 . LEU A  1 311 ? 136.897 123.965  35.625  1.00 64.01  ?  319 LEU A CD1 1 
ATOM 2341  C CD2 . LEU A  1 311 ? 138.846 125.463  35.995  1.00 67.11  ?  319 LEU A CD2 1 
ATOM 2342  N N   . ASN A  1 312 ? 137.010 125.884  30.601  1.00 62.23  ?  320 ASN A N   1 
ATOM 2343  C CA  . ASN A  1 312 ? 136.912 126.696  29.391  1.00 62.33  ?  320 ASN A CA  1 
ATOM 2344  C C   . ASN A  1 312 ? 135.469 126.677  28.901  1.00 61.17  ?  320 ASN A C   1 
ATOM 2345  O O   . ASN A  1 312 ? 134.975 125.641  28.444  1.00 59.63  ?  320 ASN A O   1 
ATOM 2346  C CB  . ASN A  1 312 ? 137.865 126.167  28.323  1.00 65.51  ?  320 ASN A CB  1 
ATOM 2347  C CG  . ASN A  1 312 ? 138.005 127.106  27.135  1.00 67.28  ?  320 ASN A CG  1 
ATOM 2348  O OD1 . ASN A  1 312 ? 137.076 127.832  26.781  1.00 66.78  ?  320 ASN A OD1 1 
ATOM 2349  N ND2 . ASN A  1 312 ? 139.175 127.088  26.510  1.00 72.51  ?  320 ASN A ND2 1 
ATOM 2350  N N   . ASN A  1 313 ? 134.794 127.818  28.985  1.00 62.35  ?  321 ASN A N   1 
ATOM 2351  C CA  . ASN A  1 313 ? 133.371 127.899  28.655  1.00 65.33  ?  321 ASN A CA  1 
ATOM 2352  C C   . ASN A  1 313 ? 133.174 128.390  27.223  1.00 66.50  ?  321 ASN A C   1 
ATOM 2353  O O   . ASN A  1 313 ? 132.594 129.445  26.964  1.00 68.69  ?  321 ASN A O   1 
ATOM 2354  C CB  . ASN A  1 313 ? 132.643 128.797  29.651  1.00 68.77  ?  321 ASN A CB  1 
ATOM 2355  C CG  . ASN A  1 313 ? 131.135 128.654  29.562  1.00 67.99  ?  321 ASN A CG  1 
ATOM 2356  O OD1 . ASN A  1 313 ? 130.601 127.548  29.628  1.00 67.39  ?  321 ASN A OD1 1 
ATOM 2357  N ND2 . ASN A  1 313 ? 130.442 129.774  29.403  1.00 69.84  ?  321 ASN A ND2 1 
ATOM 2358  N N   . GLY A  1 314 ? 133.675 127.596  26.282  1.00 66.92  ?  322 GLY A N   1 
ATOM 2359  C CA  . GLY A  1 314 ? 133.479 127.903  24.879  1.00 70.24  ?  322 GLY A CA  1 
ATOM 2360  C C   . GLY A  1 314 ? 134.289 129.075  24.377  1.00 72.36  ?  322 GLY A C   1 
ATOM 2361  O O   . GLY A  1 314 ? 133.838 129.789  23.476  1.00 71.99  ?  322 GLY A O   1 
ATOM 2362  N N   . ILE A  1 315 ? 135.477 129.291  24.930  1.00 61.30  ?  323 ILE A N   1 
ATOM 2363  C CA  . ILE A  1 315 ? 136.337 130.395  24.522  1.00 62.76  ?  323 ILE A CA  1 
ATOM 2364  C C   . ILE A  1 315 ? 137.296 129.882  23.459  1.00 62.12  ?  323 ILE A C   1 
ATOM 2365  O O   . ILE A  1 315 ? 138.018 128.905  23.681  1.00 67.48  ?  323 ILE A O   1 
ATOM 2366  C CB  . ILE A  1 315 ? 137.099 130.977  25.719  1.00 62.90  ?  323 ILE A CB  1 
ATOM 2367  C CG1 . ILE A  1 315 ? 136.122 131.638  26.691  1.00 63.47  ?  323 ILE A CG1 1 
ATOM 2368  C CG2 . ILE A  1 315 ? 138.153 131.963  25.249  1.00 64.53  ?  323 ILE A CG2 1 
ATOM 2369  C CD1 . ILE A  1 315 ? 136.797 132.349  27.823  1.00 65.25  ?  323 ILE A CD1 1 
ATOM 2370  N N   . CYS A  1 316 ? 137.309 130.547  22.305  1.00 60.10  ?  324 CYS A N   1 
ATOM 2371  C CA  . CYS A  1 316 ? 138.087 130.091  21.155  1.00 59.81  ?  324 CYS A CA  1 
ATOM 2372  C C   . CYS A  1 316 ? 139.457 130.761  21.198  1.00 61.52  ?  324 CYS A C   1 
ATOM 2373  O O   . CYS A  1 316 ? 139.710 131.784  20.558  1.00 62.64  ?  324 CYS A O   1 
ATOM 2374  C CB  . CYS A  1 316 ? 137.347 130.398  19.860  1.00 65.20  ?  324 CYS A CB  1 
ATOM 2375  S SG  . CYS A  1 316 ? 135.626 129.846  19.850  1.00 67.45  ?  324 CYS A SG  1 
ATOM 2376  N N   . TRP A  1 317 ? 140.354 130.167  21.983  1.00 61.82  ?  325 TRP A N   1 
ATOM 2377  C CA  . TRP A  1 317 ? 141.721 130.662  22.044  1.00 64.67  ?  325 TRP A CA  1 
ATOM 2378  C C   . TRP A  1 317 ? 142.376 130.576  20.672  1.00 65.87  ?  325 TRP A C   1 
ATOM 2379  O O   . TRP A  1 317 ? 142.097 129.671  19.881  1.00 71.46  ?  325 TRP A O   1 
ATOM 2380  C CB  . TRP A  1 317 ? 142.534 129.875  23.071  1.00 65.74  ?  325 TRP A CB  1 
ATOM 2381  C CG  . TRP A  1 317 ? 141.983 129.973  24.456  1.00 65.93  ?  325 TRP A CG  1 
ATOM 2382  C CD1 . TRP A  1 317 ? 141.440 128.964  25.194  1.00 65.42  ?  325 TRP A CD1 1 
ATOM 2383  C CD2 . TRP A  1 317 ? 141.892 131.155  25.261  1.00 69.14  ?  325 TRP A CD2 1 
ATOM 2384  N NE1 . TRP A  1 317 ? 141.031 129.440  26.416  1.00 69.88  ?  325 TRP A NE1 1 
ATOM 2385  C CE2 . TRP A  1 317 ? 141.296 130.783  26.481  1.00 71.49  ?  325 TRP A CE2 1 
ATOM 2386  C CE3 . TRP A  1 317 ? 142.263 132.490  25.070  1.00 72.49  ?  325 TRP A CE3 1 
ATOM 2387  C CZ2 . TRP A  1 317 ? 141.062 131.696  27.507  1.00 74.42  ?  325 TRP A CZ2 1 
ATOM 2388  C CZ3 . TRP A  1 317 ? 142.029 133.395  26.089  1.00 75.70  ?  325 TRP A CZ3 1 
ATOM 2389  C CH2 . TRP A  1 317 ? 141.435 132.994  27.292  1.00 76.89  ?  325 TRP A CH2 1 
ATOM 2390  N N   . HIS A  1 318 ? 143.247 131.544  20.390  1.00 60.45  ?  326 HIS A N   1 
ATOM 2391  C CA  . HIS A  1 318 ? 143.936 131.667  19.107  1.00 60.92  ?  326 HIS A CA  1 
ATOM 2392  C C   . HIS A  1 318 ? 142.964 131.818  17.942  1.00 59.98  ?  326 HIS A C   1 
ATOM 2393  O O   . HIS A  1 318 ? 143.333 131.576  16.788  1.00 59.88  ?  326 HIS A O   1 
ATOM 2394  C CB  . HIS A  1 318 ? 144.879 130.484  18.865  1.00 67.07  ?  326 HIS A CB  1 
ATOM 2395  C CG  . HIS A  1 318 ? 146.069 130.472  19.770  1.00 68.44  ?  326 HIS A CG  1 
ATOM 2396  N ND1 . HIS A  1 318 ? 146.154 129.653  20.874  1.00 67.94  ?  326 HIS A ND1 1 
ATOM 2397  C CD2 . HIS A  1 318 ? 147.218 131.188  19.742  1.00 70.37  ?  326 HIS A CD2 1 
ATOM 2398  C CE1 . HIS A  1 318 ? 147.307 129.860  21.485  1.00 69.52  ?  326 HIS A CE1 1 
ATOM 2399  N NE2 . HIS A  1 318 ? 147.971 130.786  20.818  1.00 71.02  ?  326 HIS A NE2 1 
ATOM 2400  N N   . ASN A  1 319 ? 141.721 132.206  18.236  1.00 64.79  ?  327 ASN A N   1 
ATOM 2401  C CA  . ASN A  1 319 ? 140.714 132.492  17.214  1.00 69.60  ?  327 ASN A CA  1 
ATOM 2402  C C   . ASN A  1 319 ? 140.499 131.294  16.292  1.00 66.03  ?  327 ASN A C   1 
ATOM 2403  O O   . ASN A  1 319 ? 140.421 131.433  15.070  1.00 68.86  ?  327 ASN A O   1 
ATOM 2404  C CB  . ASN A  1 319 ? 141.089 133.743  16.417  1.00 71.94  ?  327 ASN A CB  1 
ATOM 2405  C CG  . ASN A  1 319 ? 141.560 134.877  17.308  1.00 75.36  ?  327 ASN A CG  1 
ATOM 2406  O OD1 . ASN A  1 319 ? 141.016 135.096  18.390  1.00 77.40  ?  327 ASN A OD1 1 
ATOM 2407  N ND2 . ASN A  1 319 ? 142.586 135.595  16.863  1.00 75.40  ?  327 ASN A ND2 1 
ATOM 2408  N N   . GLN A  1 320 ? 140.409 130.105  16.884  1.00 70.94  ?  328 GLN A N   1 
ATOM 2409  C CA  . GLN A  1 320 ? 140.151 128.884  16.137  1.00 65.20  ?  328 GLN A CA  1 
ATOM 2410  C C   . GLN A  1 320 ? 139.198 128.003  16.932  1.00 63.94  ?  328 GLN A C   1 
ATOM 2411  O O   . GLN A  1 320 ? 139.036 128.160  18.144  1.00 66.65  ?  328 GLN A O   1 
ATOM 2412  C CB  . GLN A  1 320 ? 141.450 128.132  15.822  1.00 62.64  ?  328 GLN A CB  1 
ATOM 2413  C CG  . GLN A  1 320 ? 142.174 127.593  17.041  1.00 61.56  ?  328 GLN A CG  1 
ATOM 2414  C CD  . GLN A  1 320 ? 143.458 126.876  16.675  1.00 67.21  ?  328 GLN A CD  1 
ATOM 2415  O OE1 . GLN A  1 320 ? 143.808 126.768  15.499  1.00 67.87  ?  328 GLN A OE1 1 
ATOM 2416  N NE2 . GLN A  1 320 ? 144.171 126.386  17.682  1.00 71.46  ?  328 GLN A NE2 1 
ATOM 2417  N N   . LEU A  1 321 ? 138.570 127.066  16.227  1.00 65.08  ?  329 LEU A N   1 
ATOM 2418  C CA  . LEU A  1 321 ? 137.552 126.205  16.811  1.00 59.19  ?  329 LEU A CA  1 
ATOM 2419  C C   . LEU A  1 321 ? 137.535 124.887  16.051  1.00 56.93  ?  329 LEU A C   1 
ATOM 2420  O O   . LEU A  1 321 ? 137.374 124.876  14.829  1.00 57.24  ?  329 LEU A O   1 
ATOM 2421  C CB  . LEU A  1 321 ? 136.176 126.884  16.765  1.00 57.37  ?  329 LEU A CB  1 
ATOM 2422  C CG  . LEU A  1 321 ? 134.944 126.127  17.263  1.00 60.42  ?  329 LEU A CG  1 
ATOM 2423  C CD1 . LEU A  1 321 ? 134.002 127.081  17.976  1.00 59.34  ?  329 LEU A CD1 1 
ATOM 2424  C CD2 . LEU A  1 321 ? 134.223 125.440  16.112  1.00 65.59  ?  329 LEU A CD2 1 
ATOM 2425  N N   . PHE A  1 322 ? 137.682 123.789  16.782  1.00 59.09  ?  330 PHE A N   1 
ATOM 2426  C CA  . PHE A  1 322 ? 137.745 122.448  16.218  1.00 58.36  ?  330 PHE A CA  1 
ATOM 2427  C C   . PHE A  1 322 ? 136.397 121.757  16.383  1.00 60.08  ?  330 PHE A C   1 
ATOM 2428  O O   . PHE A  1 322 ? 135.861 121.685  17.496  1.00 65.09  ?  330 PHE A O   1 
ATOM 2429  C CB  . PHE A  1 322 ? 138.853 121.652  16.907  1.00 56.73  ?  330 PHE A CB  1 
ATOM 2430  C CG  . PHE A  1 322 ? 140.224 121.977  16.401  1.00 59.41  ?  330 PHE A CG  1 
ATOM 2431  C CD1 . PHE A  1 322 ? 140.500 121.942  15.046  1.00 59.79  ?  330 PHE A CD1 1 
ATOM 2432  C CD2 . PHE A  1 322 ? 141.215 122.401  17.268  1.00 61.75  ?  330 PHE A CD2 1 
ATOM 2433  C CE1 . PHE A  1 322 ? 141.757 122.253  14.576  1.00 60.16  ?  330 PHE A CE1 1 
ATOM 2434  C CE2 . PHE A  1 322 ? 142.471 122.731  16.798  1.00 62.36  ?  330 PHE A CE2 1 
ATOM 2435  C CZ  . PHE A  1 322 ? 142.741 122.654  15.450  1.00 62.69  ?  330 PHE A CZ  1 
ATOM 2436  N N   . LEU A  1 323 ? 135.848 121.262  15.271  1.00 55.03  ?  331 LEU A N   1 
ATOM 2437  C CA  . LEU A  1 323 ? 134.540 120.611  15.261  1.00 51.71  ?  331 LEU A CA  1 
ATOM 2438  C C   . LEU A  1 323 ? 134.703 119.183  14.753  1.00 50.84  ?  331 LEU A C   1 
ATOM 2439  O O   . LEU A  1 323 ? 134.907 118.965  13.556  1.00 50.89  ?  331 LEU A O   1 
ATOM 2440  C CB  . LEU A  1 323 ? 133.549 121.393  14.394  1.00 51.41  ?  331 LEU A CB  1 
ATOM 2441  C CG  . LEU A  1 323 ? 132.035 121.227  14.604  1.00 50.53  ?  331 LEU A CG  1 
ATOM 2442  C CD1 . LEU A  1 323 ? 131.272 122.113  13.635  1.00 50.89  ?  331 LEU A CD1 1 
ATOM 2443  C CD2 . LEU A  1 323 ? 131.568 119.787  14.460  1.00 49.68  ?  331 LEU A CD2 1 
ATOM 2444  N N   . THR A  1 324 ? 134.577 118.215  15.654  1.00 52.74  ?  332 THR A N   1 
ATOM 2445  C CA  . THR A  1 324 ? 134.588 116.802  15.300  1.00 51.36  ?  332 THR A CA  1 
ATOM 2446  C C   . THR A  1 324 ? 133.151 116.303  15.203  1.00 51.29  ?  332 THR A C   1 
ATOM 2447  O O   . THR A  1 324 ? 132.337 116.577  16.089  1.00 51.46  ?  332 THR A O   1 
ATOM 2448  C CB  . THR A  1 324 ? 135.364 115.990  16.338  1.00 51.55  ?  332 THR A CB  1 
ATOM 2449  O OG1 . THR A  1 324 ? 136.700 116.499  16.443  1.00 53.89  ?  332 THR A OG1 1 
ATOM 2450  C CG2 . THR A  1 324 ? 135.416 114.525  15.938  1.00 53.22  ?  332 THR A CG2 1 
ATOM 2451  N N   . VAL A  1 325 ? 132.836 115.583  14.129  1.00 54.81  ?  333 VAL A N   1 
ATOM 2452  C CA  . VAL A  1 325 ? 131.469 115.126  13.895  1.00 51.96  ?  333 VAL A CA  1 
ATOM 2453  C C   . VAL A  1 325 ? 131.508 113.793  13.159  1.00 49.75  ?  333 VAL A C   1 
ATOM 2454  O O   . VAL A  1 325 ? 132.305 113.597  12.235  1.00 50.17  ?  333 VAL A O   1 
ATOM 2455  C CB  . VAL A  1 325 ? 130.644 116.178  13.116  1.00 44.49  ?  333 VAL A CB  1 
ATOM 2456  C CG1 . VAL A  1 325 ? 131.418 116.687  11.921  1.00 44.83  ?  333 VAL A CG1 1 
ATOM 2457  C CG2 . VAL A  1 325 ? 129.310 115.599  12.672  1.00 44.19  ?  333 VAL A CG2 1 
ATOM 2458  N N   . VAL A  1 326 ? 130.655 112.868  13.600  1.00 48.63  ?  334 VAL A N   1 
ATOM 2459  C CA  . VAL A  1 326 ? 130.439 111.584  12.944  1.00 48.59  ?  334 VAL A CA  1 
ATOM 2460  C C   . VAL A  1 326 ? 128.941 111.406  12.754  1.00 46.80  ?  334 VAL A C   1 
ATOM 2461  O O   . VAL A  1 326 ? 128.169 111.563  13.707  1.00 48.25  ?  334 VAL A O   1 
ATOM 2462  C CB  . VAL A  1 326 ? 131.017 110.412  13.761  1.00 40.96  ?  334 VAL A CB  1 
ATOM 2463  C CG1 . VAL A  1 326 ? 130.614 109.083  13.146  1.00 40.78  ?  334 VAL A CG1 1 
ATOM 2464  C CG2 . VAL A  1 326 ? 132.521 110.526  13.853  1.00 41.26  ?  334 VAL A CG2 1 
ATOM 2465  N N   . ASP A  1 327 ? 128.531 111.084  11.529  1.00 45.70  ?  335 ASP A N   1 
ATOM 2466  C CA  . ASP A  1 327 ? 127.118 110.877  11.210  1.00 45.36  ?  335 ASP A CA  1 
ATOM 2467  C C   . ASP A  1 327 ? 127.039 109.706  10.237  1.00 46.91  ?  335 ASP A C   1 
ATOM 2468  O O   . ASP A  1 327 ? 127.352 109.854  9.052   1.00 53.67  ?  335 ASP A O   1 
ATOM 2469  C CB  . ASP A  1 327 ? 126.489 112.135  10.625  1.00 48.63  ?  335 ASP A CB  1 
ATOM 2470  C CG  . ASP A  1 327 ? 125.012 111.963  10.321  1.00 52.17  ?  335 ASP A CG  1 
ATOM 2471  O OD1 . ASP A  1 327 ? 124.401 111.008  10.848  1.00 50.67  ?  335 ASP A OD1 1 
ATOM 2472  O OD2 . ASP A  1 327 ? 124.459 112.787  9.560   1.00 54.61  -1 335 ASP A OD2 1 
ATOM 2473  N N   . THR A  1 328 ? 126.613 108.550  10.740  1.00 44.09  ?  336 THR A N   1 
ATOM 2474  C CA  . THR A  1 328 ? 126.499 107.342  9.938   1.00 44.91  ?  336 THR A CA  1 
ATOM 2475  C C   . THR A  1 328 ? 125.067 107.064  9.506   1.00 53.94  ?  336 THR A C   1 
ATOM 2476  O O   . THR A  1 328 ? 124.786 105.986  8.971   1.00 59.50  ?  336 THR A O   1 
ATOM 2477  C CB  . THR A  1 328 ? 127.052 106.145  10.713  1.00 45.23  ?  336 THR A CB  1 
ATOM 2478  O OG1 . THR A  1 328 ? 126.140 105.787  11.759  1.00 44.65  ?  336 THR A OG1 1 
ATOM 2479  C CG2 . THR A  1 328 ? 128.395 106.496  11.330  1.00 45.59  ?  336 THR A CG2 1 
ATOM 2480  N N   . THR A  1 329 ? 124.158 108.013  9.723   1.00 55.76  ?  337 THR A N   1 
ATOM 2481  C CA  . THR A  1 329 ? 122.760 107.862  9.346   1.00 46.84  ?  337 THR A CA  1 
ATOM 2482  C C   . THR A  1 329 ? 122.503 108.212  7.887   1.00 46.80  ?  337 THR A C   1 
ATOM 2483  O O   . THR A  1 329 ? 121.348 108.172  7.450   1.00 46.86  ?  337 THR A O   1 
ATOM 2484  C CB  . THR A  1 329 ? 121.882 108.732  10.248  1.00 48.05  ?  337 THR A CB  1 
ATOM 2485  O OG1 . THR A  1 329 ? 122.248 110.109  10.088  1.00 48.25  ?  337 THR A OG1 1 
ATOM 2486  C CG2 . THR A  1 329 ? 122.069 108.335  11.705  1.00 47.83  ?  337 THR A CG2 1 
ATOM 2487  N N   . ARG A  1 330 ? 123.543 108.552  7.133   1.00 48.49  ?  338 ARG A N   1 
ATOM 2488  C CA  . ARG A  1 330 ? 123.464 108.856  5.708   1.00 53.71  ?  338 ARG A CA  1 
ATOM 2489  C C   . ARG A  1 330 ? 124.519 108.062  4.953   1.00 53.11  ?  338 ARG A C   1 
ATOM 2490  O O   . ARG A  1 330 ? 125.270 108.590  4.131   1.00 52.57  ?  338 ARG A O   1 
ATOM 2491  C CB  . ARG A  1 330 ? 123.623 110.354  5.462   1.00 51.36  ?  338 ARG A CB  1 
ATOM 2492  C CG  . ARG A  1 330 ? 122.452 111.189  5.949   1.00 51.93  ?  338 ARG A CG  1 
ATOM 2493  C CD  . ARG A  1 330 ? 122.817 112.663  6.072   1.00 52.20  ?  338 ARG A CD  1 
ATOM 2494  N NE  . ARG A  1 330 ? 121.635 113.488  6.311   1.00 52.04  ?  338 ARG A NE  1 
ATOM 2495  C CZ  . ARG A  1 330 ? 121.093 113.702  7.506   1.00 46.04  ?  338 ARG A CZ  1 
ATOM 2496  N NH1 . ARG A  1 330 ? 121.627 113.153  8.587   1.00 45.47  1  338 ARG A NH1 1 
ATOM 2497  N NH2 . ARG A  1 330 ? 120.016 114.467  7.618   1.00 46.73  ?  338 ARG A NH2 1 
ATOM 2498  N N   . SER A  1 331 ? 124.577 106.762  5.232   1.00 49.50  ?  339 SER A N   1 
ATOM 2499  C CA  . SER A  1 331 ? 125.628 105.893  4.724   1.00 49.77  ?  339 SER A CA  1 
ATOM 2500  C C   . SER A  1 331 ? 125.288 105.261  3.379   1.00 50.48  ?  339 SER A C   1 
ATOM 2501  O O   . SER A  1 331 ? 126.037 104.397  2.912   1.00 50.58  ?  339 SER A O   1 
ATOM 2502  C CB  . SER A  1 331 ? 125.935 104.796  5.747   1.00 52.26  ?  339 SER A CB  1 
ATOM 2503  O OG  . SER A  1 331 ? 124.777 104.031  6.036   1.00 51.29  ?  339 SER A OG  1 
ATOM 2504  N N   . THR A  1 332 ? 124.188 105.670  2.750   1.00 51.72  ?  340 THR A N   1 
ATOM 2505  C CA  . THR A  1 332 ? 123.822 105.123  1.450   1.00 50.84  ?  340 THR A CA  1 
ATOM 2506  C C   . THR A  1 332 ? 124.911 105.403  0.419   1.00 52.66  ?  340 THR A C   1 
ATOM 2507  O O   . THR A  1 332 ? 125.560 106.452  0.442   1.00 54.31  ?  340 THR A O   1 
ATOM 2508  C CB  . THR A  1 332 ? 122.483 105.708  0.990   1.00 51.91  ?  340 THR A CB  1 
ATOM 2509  O OG1 . THR A  1 332 ? 122.221 105.316  -0.364  1.00 58.59  ?  340 THR A OG1 1 
ATOM 2510  C CG2 . THR A  1 332 ? 122.493 107.233  1.092   1.00 47.60  ?  340 THR A CG2 1 
ATOM 2511  N N   . ASN A  1 333 ? 125.116 104.449  -0.486  1.00 50.84  ?  341 ASN A N   1 
ATOM 2512  C CA  . ASN A  1 333 ? 126.175 104.519  -1.484  1.00 49.30  ?  341 ASN A CA  1 
ATOM 2513  C C   . ASN A  1 333 ? 125.569 104.514  -2.879  1.00 50.42  ?  341 ASN A C   1 
ATOM 2514  O O   . ASN A  1 333 ? 124.745 103.651  -3.203  1.00 50.15  ?  341 ASN A O   1 
ATOM 2515  C CB  . ASN A  1 333 ? 127.158 103.356  -1.332  1.00 44.13  ?  341 ASN A CB  1 
ATOM 2516  C CG  . ASN A  1 333 ? 128.082 103.529  -0.145  1.00 43.90  ?  341 ASN A CG  1 
ATOM 2517  O OD1 . ASN A  1 333 ? 128.594 104.620  0.101   1.00 43.91  ?  341 ASN A OD1 1 
ATOM 2518  N ND2 . ASN A  1 333 ? 128.304 102.450  0.596   1.00 43.73  ?  341 ASN A ND2 1 
ATOM 2519  N N   . LEU A  1 334 ? 125.979 105.477  -3.697  1.00 51.78  ?  342 LEU A N   1 
ATOM 2520  C CA  . LEU A  1 334 ? 125.560 105.531  -5.089  1.00 55.11  ?  342 LEU A CA  1 
ATOM 2521  C C   . LEU A  1 334 ? 126.332 104.501  -5.902  1.00 62.12  ?  342 LEU A C   1 
ATOM 2522  O O   . LEU A  1 334 ? 127.555 104.386  -5.773  1.00 70.17  ?  342 LEU A O   1 
ATOM 2523  C CB  . LEU A  1 334 ? 125.790 106.928  -5.663  1.00 50.70  ?  342 LEU A CB  1 
ATOM 2524  C CG  . LEU A  1 334 ? 125.180 108.104  -4.903  1.00 52.15  ?  342 LEU A CG  1 
ATOM 2525  C CD1 . LEU A  1 334 ? 125.494 109.410  -5.615  1.00 55.85  ?  342 LEU A CD1 1 
ATOM 2526  C CD2 . LEU A  1 334 ? 123.680 107.920  -4.738  1.00 53.08  ?  342 LEU A CD2 1 
ATOM 2527  N N   . SER A  1 335 ? 125.617 103.747  -6.733  1.00 56.00  ?  343 SER A N   1 
ATOM 2528  C CA  . SER A  1 335 ? 126.223 102.794  -7.656  1.00 55.47  ?  343 SER A CA  1 
ATOM 2529  C C   . SER A  1 335 ? 126.054 103.350  -9.063  1.00 56.40  ?  343 SER A C   1 
ATOM 2530  O O   . SER A  1 335 ? 124.936 103.401  -9.587  1.00 56.40  ?  343 SER A O   1 
ATOM 2531  C CB  . SER A  1 335 ? 125.591 101.409  -7.524  1.00 64.73  ?  343 SER A CB  1 
ATOM 2532  O OG  . SER A  1 335 ? 124.191 101.452  -7.747  1.00 68.15  ?  343 SER A OG  1 
ATOM 2533  N N   . VAL A  1 336 ? 127.159 103.781  -9.665  1.00 53.24  ?  344 VAL A N   1 
ATOM 2534  C CA  . VAL A  1 336 ? 127.169 104.319  -11.020 1.00 54.61  ?  344 VAL A CA  1 
ATOM 2535  C C   . VAL A  1 336 ? 127.802 103.278  -11.927 1.00 55.97  ?  344 VAL A C   1 
ATOM 2536  O O   . VAL A  1 336 ? 128.867 102.744  -11.608 1.00 57.55  ?  344 VAL A O   1 
ATOM 2537  C CB  . VAL A  1 336 ? 127.942 105.649  -11.088 1.00 58.20  ?  344 VAL A CB  1 
ATOM 2538  C CG1 . VAL A  1 336 ? 128.097 106.111  -12.531 1.00 62.50  ?  344 VAL A CG1 1 
ATOM 2539  C CG2 . VAL A  1 336 ? 127.250 106.712  -10.249 1.00 59.19  ?  344 VAL A CG2 1 
ATOM 2540  N N   . CYS A  1 337 ? 127.165 102.999  -13.061 1.00 55.55  ?  345 CYS A N   1 
ATOM 2541  C CA  . CYS A  1 337 ? 127.692 102.023  -14.004 1.00 58.53  ?  345 CYS A CA  1 
ATOM 2542  C C   . CYS A  1 337 ? 127.675 102.606  -15.408 1.00 61.43  ?  345 CYS A C   1 
ATOM 2543  O O   . CYS A  1 337 ? 126.764 103.359  -15.768 1.00 61.07  ?  345 CYS A O   1 
ATOM 2544  C CB  . CYS A  1 337 ? 126.894 100.714  -13.972 1.00 61.79  ?  345 CYS A CB  1 
ATOM 2545  S SG  . CYS A  1 337 ? 125.422 100.716  -15.005 1.00 65.54  ?  345 CYS A SG  1 
ATOM 2546  N N   . ALA A  1 338 ? 128.701 102.272  -16.191 1.00 60.65  ?  346 ALA A N   1 
ATOM 2547  C CA  . ALA A  1 338 ? 128.844 102.780  -17.548 1.00 64.56  ?  346 ALA A CA  1 
ATOM 2548  C C   . ALA A  1 338 ? 129.127 101.627  -18.497 1.00 68.01  ?  346 ALA A C   1 
ATOM 2549  O O   . ALA A  1 338 ? 129.939 100.750  -18.193 1.00 68.22  ?  346 ALA A O   1 
ATOM 2550  C CB  . ALA A  1 338 ? 129.965 103.821  -17.643 1.00 67.89  ?  346 ALA A CB  1 
ATOM 2551  N N   . SER A  1 339 ? 128.460 101.634  -19.648 1.00 65.95  ?  347 SER A N   1 
ATOM 2552  C CA  . SER A  1 339 ? 128.646 100.566  -20.619 1.00 68.35  ?  347 SER A CA  1 
ATOM 2553  C C   . SER A  1 339 ? 130.040 100.645  -21.229 1.00 75.31  ?  347 SER A C   1 
ATOM 2554  O O   . SER A  1 339 ? 130.578 101.734  -21.451 1.00 75.39  ?  347 SER A O   1 
ATOM 2555  C CB  . SER A  1 339 ? 127.585 100.645  -21.716 1.00 68.13  ?  347 SER A CB  1 
ATOM 2556  O OG  . SER A  1 339 ? 127.614 101.902  -22.368 1.00 68.40  ?  347 SER A OG  1 
ATOM 2557  N N   . THR A  1 340 ? 130.626 99.477   -21.501 1.00 75.19  ?  348 THR A N   1 
ATOM 2558  C CA  . THR A  1 340 ? 131.948 99.426   -22.110 1.00 78.65  ?  348 THR A CA  1 
ATOM 2559  C C   . THR A  1 340 ? 131.910 99.671   -23.611 1.00 88.93  ?  348 THR A C   1 
ATOM 2560  O O   . THR A  1 340 ? 132.919 100.103  -24.180 1.00 96.63  ?  348 THR A O   1 
ATOM 2561  C CB  . THR A  1 340 ? 132.606 98.073   -21.835 1.00 74.61  ?  348 THR A CB  1 
ATOM 2562  O OG1 . THR A  1 340 ? 131.831 97.033   -22.444 1.00 78.05  ?  348 THR A OG1 1 
ATOM 2563  C CG2 . THR A  1 340 ? 132.688 97.819   -20.338 1.00 72.81  ?  348 THR A CG2 1 
ATOM 2564  N N   . THR A  1 341 ? 130.779 99.409   -24.259 1.00 90.12  ?  349 THR A N   1 
ATOM 2565  C CA  . THR A  1 341 ? 130.599 99.782   -25.652 1.00 95.41  ?  349 THR A CA  1 
ATOM 2566  C C   . THR A  1 341 ? 130.154 101.238  -25.738 1.00 97.60  ?  349 THR A C   1 
ATOM 2567  O O   . THR A  1 341 ? 129.482 101.753  -24.839 1.00 93.24  ?  349 THR A O   1 
ATOM 2568  C CB  . THR A  1 341 ? 129.568 98.869   -26.323 1.00 91.45  ?  349 THR A CB  1 
ATOM 2569  O OG1 . THR A  1 341 ? 129.806 97.509   -25.936 1.00 84.58  ?  349 THR A OG1 1 
ATOM 2570  C CG2 . THR A  1 341 ? 129.666 98.971   -27.839 1.00 99.08  ?  349 THR A CG2 1 
ATOM 2571  N N   . SER A  1 342 ? 130.562 101.910  -26.821 1.00 108.57 ?  350 SER A N   1 
ATOM 2572  C CA  . SER A  1 342 ? 130.236 103.325  -26.991 1.00 107.77 ?  350 SER A CA  1 
ATOM 2573  C C   . SER A  1 342 ? 128.735 103.553  -26.868 1.00 103.93 ?  350 SER A C   1 
ATOM 2574  O O   . SER A  1 342 ? 128.286 104.486  -26.192 1.00 95.05  ?  350 SER A O   1 
ATOM 2575  C CB  . SER A  1 342 ? 130.752 103.830  -28.339 1.00 115.82 ?  350 SER A CB  1 
ATOM 2576  O OG  . SER A  1 342 ? 130.519 105.220  -28.480 1.00 116.34 ?  350 SER A OG  1 
ATOM 2577  N N   . SER A  1 343 ? 127.944 102.707  -27.523 1.00 97.58  ?  351 SER A N   1 
ATOM 2578  C CA  . SER A  1 343 ? 126.512 102.637  -27.290 1.00 99.60  ?  351 SER A CA  1 
ATOM 2579  C C   . SER A  1 343 ? 126.164 101.187  -26.999 1.00 105.74 ?  351 SER A C   1 
ATOM 2580  O O   . SER A  1 343 ? 126.709 100.273  -27.625 1.00 107.90 ?  351 SER A O   1 
ATOM 2581  C CB  . SER A  1 343 ? 125.713 103.151  -28.494 1.00 111.16 ?  351 SER A CB  1 
ATOM 2582  O OG  . SER A  1 343 ? 124.332 103.245  -28.187 1.00 108.00 ?  351 SER A OG  1 
ATOM 2583  N N   . ILE A  1 344 ? 125.261 100.982  -26.051 1.00 104.53 ?  352 ILE A N   1 
ATOM 2584  C CA  . ILE A  1 344 ? 124.974 99.623   -25.573 1.00 102.84 ?  352 ILE A CA  1 
ATOM 2585  C C   . ILE A  1 344 ? 124.195 98.854   -26.637 1.00 107.11 ?  352 ILE A C   1 
ATOM 2586  O O   . ILE A  1 344 ? 123.170 99.354   -27.136 1.00 109.70 ?  352 ILE A O   1 
ATOM 2587  C CB  . ILE A  1 344 ? 124.211 99.672   -24.244 1.00 95.12  ?  352 ILE A CB  1 
ATOM 2588  C CG1 . ILE A  1 344 ? 123.828 98.261   -23.796 1.00 84.91  ?  352 ILE A CG1 1 
ATOM 2589  C CG2 . ILE A  1 344 ? 122.991 100.585  -24.338 1.00 94.38  ?  352 ILE A CG2 1 
ATOM 2590  C CD1 . ILE A  1 344 ? 125.018 97.342   -23.590 1.00 79.57  ?  352 ILE A CD1 1 
ATOM 2591  N N   . PRO A  1 345 ? 124.635 97.658   -27.031 1.00 105.87 ?  353 PRO A N   1 
ATOM 2592  C CA  . PRO A  1 345 ? 123.719 96.738   -27.717 1.00 97.50  ?  353 PRO A CA  1 
ATOM 2593  C C   . PRO A  1 345 ? 122.696 96.214   -26.721 1.00 87.72  ?  353 PRO A C   1 
ATOM 2594  O O   . PRO A  1 345 ? 123.044 95.807   -25.611 1.00 87.58  ?  353 PRO A O   1 
ATOM 2595  C CB  . PRO A  1 345 ? 124.641 95.624   -28.234 1.00 95.53  ?  353 PRO A CB  1 
ATOM 2596  C CG  . PRO A  1 345 ? 126.030 96.200   -28.171 1.00 98.72  ?  353 PRO A CG  1 
ATOM 2597  C CD  . PRO A  1 345 ? 126.014 97.142   -27.010 1.00 98.55  ?  353 PRO A CD  1 
ATOM 2598  N N   . ASN A  1 346 ? 121.427 96.216   -27.127 1.00 77.56  ?  354 ASN A N   1 
ATOM 2599  C CA  . ASN A  1 346 ? 120.331 95.934   -26.205 1.00 70.94  ?  354 ASN A CA  1 
ATOM 2600  C C   . ASN A  1 346 ? 120.327 94.496   -25.697 1.00 70.67  ?  354 ASN A C   1 
ATOM 2601  O O   . ASN A  1 346 ? 119.307 93.804   -25.771 1.00 71.04  ?  354 ASN A O   1 
ATOM 2602  C CB  . ASN A  1 346 ? 118.995 96.270   -26.866 1.00 83.68  ?  354 ASN A CB  1 
ATOM 2603  C CG  . ASN A  1 346 ? 118.771 97.765   -26.990 1.00 86.74  ?  354 ASN A CG  1 
ATOM 2604  O OD1 . ASN A  1 346 ? 118.084 98.371   -26.168 1.00 80.75  ?  354 ASN A OD1 1 
ATOM 2605  N ND2 . ASN A  1 346 ? 119.360 98.368   -28.016 1.00 96.22  ?  354 ASN A ND2 1 
ATOM 2606  N N   . VAL A  1 347 ? 121.461 94.054   -25.159 1.00 62.91  ?  355 VAL A N   1 
ATOM 2607  C CA  . VAL A  1 347 ? 121.611 92.737   -24.550 1.00 62.53  ?  355 VAL A CA  1 
ATOM 2608  C C   . VAL A  1 347 ? 122.534 92.898   -23.352 1.00 60.72  ?  355 VAL A C   1 
ATOM 2609  O O   . VAL A  1 347 ? 123.601 93.511   -23.463 1.00 60.81  ?  355 VAL A O   1 
ATOM 2610  C CB  . VAL A  1 347 ? 122.173 91.694   -25.538 1.00 64.08  ?  355 VAL A CB  1 
ATOM 2611  C CG1 . VAL A  1 347 ? 121.088 91.214   -26.488 1.00 64.77  ?  355 VAL A CG1 1 
ATOM 2612  C CG2 . VAL A  1 347 ? 123.337 92.277   -26.324 1.00 64.57  ?  355 VAL A CG2 1 
ATOM 2613  N N   . TYR A  1 348 ? 122.124 92.364   -22.206 1.00 62.34  ?  356 TYR A N   1 
ATOM 2614  C CA  . TYR A  1 348 ? 122.884 92.527   -20.975 1.00 59.58  ?  356 TYR A CA  1 
ATOM 2615  C C   . TYR A  1 348 ? 123.844 91.364   -20.774 1.00 65.93  ?  356 TYR A C   1 
ATOM 2616  O O   . TYR A  1 348 ? 123.438 90.198   -20.801 1.00 75.28  ?  356 TYR A O   1 
ATOM 2617  C CB  . TYR A  1 348 ? 121.950 92.643   -19.769 1.00 60.15  ?  356 TYR A CB  1 
ATOM 2618  C CG  . TYR A  1 348 ? 122.676 92.557   -18.445 1.00 57.87  ?  356 TYR A CG  1 
ATOM 2619  C CD1 . TYR A  1 348 ? 123.357 93.651   -17.932 1.00 56.87  ?  356 TYR A CD1 1 
ATOM 2620  C CD2 . TYR A  1 348 ? 122.686 91.378   -17.711 1.00 57.37  ?  356 TYR A CD2 1 
ATOM 2621  C CE1 . TYR A  1 348 ? 124.027 93.573   -16.726 1.00 55.43  ?  356 TYR A CE1 1 
ATOM 2622  C CE2 . TYR A  1 348 ? 123.353 91.291   -16.506 1.00 55.91  ?  356 TYR A CE2 1 
ATOM 2623  C CZ  . TYR A  1 348 ? 124.020 92.392   -16.018 1.00 54.96  ?  356 TYR A CZ  1 
ATOM 2624  O OH  . TYR A  1 348 ? 124.685 92.312   -14.817 1.00 53.62  ?  356 TYR A OH  1 
ATOM 2625  N N   . THR A  1 349 ? 125.118 91.695   -20.571 1.00 59.67  ?  357 THR A N   1 
ATOM 2626  C CA  . THR A  1 349 ? 126.151 90.779   -20.126 1.00 59.74  ?  357 THR A CA  1 
ATOM 2627  C C   . THR A  1 349 ? 126.995 91.558   -19.127 1.00 58.24  ?  357 THR A C   1 
ATOM 2628  O O   . THR A  1 349 ? 127.292 92.739   -19.358 1.00 58.15  ?  357 THR A O   1 
ATOM 2629  C CB  . THR A  1 349 ? 127.036 90.255   -21.267 1.00 53.61  ?  357 THR A CB  1 
ATOM 2630  O OG1 . THR A  1 349 ? 127.608 91.360   -21.979 1.00 53.87  ?  357 THR A OG1 1 
ATOM 2631  C CG2 . THR A  1 349 ? 126.231 89.391   -22.225 1.00 54.31  ?  357 THR A CG2 1 
ATOM 2632  N N   . PRO A  1 350 ? 127.380 90.940   -18.010 1.00 59.53  ?  358 PRO A N   1 
ATOM 2633  C CA  . PRO A  1 350 ? 128.159 91.675   -17.001 1.00 58.45  ?  358 PRO A CA  1 
ATOM 2634  C C   . PRO A  1 350 ? 129.480 92.209   -17.524 1.00 61.00  ?  358 PRO A C   1 
ATOM 2635  O O   . PRO A  1 350 ? 130.000 93.185   -16.968 1.00 60.49  ?  358 PRO A O   1 
ATOM 2636  C CB  . PRO A  1 350 ? 128.376 90.633   -15.895 1.00 67.08  ?  358 PRO A CB  1 
ATOM 2637  C CG  . PRO A  1 350 ? 128.180 89.324   -16.567 1.00 68.78  ?  358 PRO A CG  1 
ATOM 2638  C CD  . PRO A  1 350 ? 127.152 89.540   -17.623 1.00 70.06  ?  358 PRO A CD  1 
ATOM 2639  N N   . THR A  1 351 ? 130.032 91.618   -18.581 1.00 60.46  ?  359 THR A N   1 
ATOM 2640  C CA  . THR A  1 351 ? 131.302 92.079   -19.121 1.00 63.45  ?  359 THR A CA  1 
ATOM 2641  C C   . THR A  1 351 ? 131.176 93.369   -19.917 1.00 69.74  ?  359 THR A C   1 
ATOM 2642  O O   . THR A  1 351 ? 132.202 93.977   -20.240 1.00 79.93  ?  359 THR A O   1 
ATOM 2643  C CB  . THR A  1 351 ? 131.917 90.996   -20.008 1.00 65.07  ?  359 THR A CB  1 
ATOM 2644  O OG1 . THR A  1 351 ? 131.138 90.863   -21.204 1.00 69.80  ?  359 THR A OG1 1 
ATOM 2645  C CG2 . THR A  1 351 ? 131.942 89.666   -19.275 1.00 63.10  ?  359 THR A CG2 1 
ATOM 2646  N N   . SER A  1 352 ? 129.958 93.797   -20.246 1.00 63.82  ?  360 SER A N   1 
ATOM 2647  C CA  . SER A  1 352 ? 129.742 95.001   -21.036 1.00 63.50  ?  360 SER A CA  1 
ATOM 2648  C C   . SER A  1 352 ? 129.276 96.176   -20.183 1.00 60.73  ?  360 SER A C   1 
ATOM 2649  O O   . SER A  1 352 ? 128.703 97.133   -20.716 1.00 63.68  ?  360 SER A O   1 
ATOM 2650  C CB  . SER A  1 352 ? 128.742 94.727   -22.160 1.00 59.42  ?  360 SER A CB  1 
ATOM 2651  O OG  . SER A  1 352 ? 127.623 94.000   -21.689 1.00 58.61  ?  360 SER A OG  1 
ATOM 2652  N N   . PHE A  1 353 ? 129.509 96.122   -18.873 1.00 58.27  ?  361 PHE A N   1 
ATOM 2653  C CA  . PHE A  1 353 ? 129.138 97.204   -17.971 1.00 56.60  ?  361 PHE A CA  1 
ATOM 2654  C C   . PHE A  1 353 ? 130.159 97.281   -16.847 1.00 55.57  ?  361 PHE A C   1 
ATOM 2655  O O   . PHE A  1 353 ? 130.446 96.269   -16.200 1.00 55.16  ?  361 PHE A O   1 
ATOM 2656  C CB  . PHE A  1 353 ? 127.736 96.986   -17.391 1.00 55.15  ?  361 PHE A CB  1 
ATOM 2657  C CG  . PHE A  1 353 ? 126.626 97.210   -18.377 1.00 56.03  ?  361 PHE A CG  1 
ATOM 2658  C CD1 . PHE A  1 353 ? 126.227 98.491   -18.715 1.00 56.06  ?  361 PHE A CD1 1 
ATOM 2659  C CD2 . PHE A  1 353 ? 125.976 96.135   -18.960 1.00 56.90  ?  361 PHE A CD2 1 
ATOM 2660  C CE1 . PHE A  1 353 ? 125.200 98.695   -19.619 1.00 56.97  ?  361 PHE A CE1 1 
ATOM 2661  C CE2 . PHE A  1 353 ? 124.951 96.334   -19.864 1.00 57.83  ?  361 PHE A CE2 1 
ATOM 2662  C CZ  . PHE A  1 353 ? 124.562 97.615   -20.192 1.00 57.86  ?  361 PHE A CZ  1 
ATOM 2663  N N   . LYS A  1 354 ? 130.706 98.471   -16.624 1.00 53.04  ?  362 LYS A N   1 
ATOM 2664  C CA  . LYS A  1 354 ? 131.613 98.728   -15.514 1.00 52.62  ?  362 LYS A CA  1 
ATOM 2665  C C   . LYS A  1 354 ? 130.846 99.331   -14.343 1.00 51.78  ?  362 LYS A C   1 
ATOM 2666  O O   . LYS A  1 354 ? 130.070 100.278  -14.522 1.00 51.62  ?  362 LYS A O   1 
ATOM 2667  C CB  . LYS A  1 354 ? 132.753 99.652   -15.942 1.00 55.51  ?  362 LYS A CB  1 
ATOM 2668  C CG  . LYS A  1 354 ? 133.766 98.989   -16.864 1.00 56.72  ?  362 LYS A CG  1 
ATOM 2669  C CD  . LYS A  1 354 ? 135.175 99.130   -16.312 1.00 56.87  ?  362 LYS A CD  1 
ATOM 2670  C CE  . LYS A  1 354 ? 136.212 99.164   -17.421 1.00 58.96  ?  362 LYS A CE  1 
ATOM 2671  N NZ  . LYS A  1 354 ? 137.554 99.551   -16.902 1.00 59.17  1  362 LYS A NZ  1 
ATOM 2672  N N   . GLU A  1 355 ? 131.069 98.782   -13.150 1.00 53.93  ?  363 GLU A N   1 
ATOM 2673  C CA  . GLU A  1 355 ? 130.360 99.170   -11.936 1.00 52.18  ?  363 GLU A CA  1 
ATOM 2674  C C   . GLU A  1 355 ? 131.300 99.915   -10.996 1.00 51.50  ?  363 GLU A C   1 
ATOM 2675  O O   . GLU A  1 355 ? 132.412 99.451   -10.722 1.00 51.84  ?  363 GLU A O   1 
ATOM 2676  C CB  . GLU A  1 355 ? 129.777 97.941   -11.233 1.00 61.21  ?  363 GLU A CB  1 
ATOM 2677  C CG  . GLU A  1 355 ? 128.832 97.109   -12.089 1.00 68.35  ?  363 GLU A CG  1 
ATOM 2678  C CD  . GLU A  1 355 ? 127.442 97.707   -12.177 1.00 71.90  ?  363 GLU A CD  1 
ATOM 2679  O OE1 . GLU A  1 355 ? 127.090 98.529   -11.304 1.00 71.18  ?  363 GLU A OE1 1 
ATOM 2680  O OE2 . GLU A  1 355 ? 126.701 97.352   -13.120 1.00 75.45  -1 363 GLU A OE2 1 
ATOM 2681  N N   . TYR A  1 356 ? 130.841 101.058  -10.494 1.00 58.67  ?  364 TYR A N   1 
ATOM 2682  C CA  . TYR A  1 356 ? 131.590 101.916  -9.587  1.00 57.42  ?  364 TYR A CA  1 
ATOM 2683  C C   . TYR A  1 356 ? 130.722 102.276  -8.389  1.00 53.87  ?  364 TYR A C   1 
ATOM 2684  O O   . TYR A  1 356 ? 129.508 102.463  -8.524  1.00 52.82  ?  364 TYR A O   1 
ATOM 2685  C CB  . TYR A  1 356 ? 132.054 103.209  -10.282 1.00 53.24  ?  364 TYR A CB  1 
ATOM 2686  C CG  . TYR A  1 356 ? 132.877 103.004  -11.535 1.00 58.07  ?  364 TYR A CG  1 
ATOM 2687  C CD1 . TYR A  1 356 ? 132.270 102.724  -12.753 1.00 60.58  ?  364 TYR A CD1 1 
ATOM 2688  C CD2 . TYR A  1 356 ? 134.261 103.114  -11.505 1.00 61.86  ?  364 TYR A CD2 1 
ATOM 2689  C CE1 . TYR A  1 356 ? 133.019 102.543  -13.901 1.00 64.32  ?  364 TYR A CE1 1 
ATOM 2690  C CE2 . TYR A  1 356 ? 135.018 102.939  -12.648 1.00 66.72  ?  364 TYR A CE2 1 
ATOM 2691  C CZ  . TYR A  1 356 ? 134.393 102.651  -13.843 1.00 66.69  ?  364 TYR A CZ  1 
ATOM 2692  O OH  . TYR A  1 356 ? 135.144 102.473  -14.982 1.00 70.93  ?  364 TYR A OH  1 
ATOM 2693  N N   . ALA A  1 357 ? 131.351 102.372  -7.218  1.00 54.49  ?  365 ALA A N   1 
ATOM 2694  C CA  . ALA A  1 357 ? 130.675 102.747  -5.981  1.00 52.67  ?  365 ALA A CA  1 
ATOM 2695  C C   . ALA A  1 357 ? 131.224 104.082  -5.497  1.00 52.54  ?  365 ALA A C   1 
ATOM 2696  O O   . ALA A  1 357 ? 132.431 104.212  -5.266  1.00 58.63  ?  365 ALA A O   1 
ATOM 2697  C CB  . ALA A  1 357 ? 130.855 101.672  -4.909  1.00 48.83  ?  365 ALA A CB  1 
ATOM 2698  N N   . ARG A  1 358 ? 130.343 105.069  -5.352  1.00 54.01  ?  366 ARG A N   1 
ATOM 2699  C CA  . ARG A  1 358 ? 130.713 106.401  -4.893  1.00 53.94  ?  366 ARG A CA  1 
ATOM 2700  C C   . ARG A  1 358 ? 129.873 106.790  -3.685  1.00 50.30  ?  366 ARG A C   1 
ATOM 2701  O O   . ARG A  1 358 ? 128.688 106.453  -3.607  1.00 50.54  ?  366 ARG A O   1 
ATOM 2702  C CB  . ARG A  1 358 ? 130.540 107.441  -6.005  1.00 50.86  ?  366 ARG A CB  1 
ATOM 2703  C CG  . ARG A  1 358 ? 131.508 107.266  -7.158  1.00 53.85  ?  366 ARG A CG  1 
ATOM 2704  C CD  . ARG A  1 358 ? 132.942 107.346  -6.670  1.00 54.53  ?  366 ARG A CD  1 
ATOM 2705  N NE  . ARG A  1 358 ? 133.756 106.270  -7.223  1.00 60.71  ?  366 ARG A NE  1 
ATOM 2706  C CZ  . ARG A  1 358 ? 134.489 106.382  -8.324  1.00 68.68  ?  366 ARG A CZ  1 
ATOM 2707  N NH1 . ARG A  1 358 ? 134.514 107.527  -8.992  1.00 71.48  1  366 ARG A NH1 1 
ATOM 2708  N NH2 . ARG A  1 358 ? 135.200 105.349  -8.757  1.00 72.20  ?  366 ARG A NH2 1 
ATOM 2709  N N   . HIS A  1 359 ? 130.492 107.506  -2.749  1.00 51.86  ?  367 HIS A N   1 
ATOM 2710  C CA  . HIS A  1 359 ? 129.833 107.997  -1.549  1.00 50.30  ?  367 HIS A CA  1 
ATOM 2711  C C   . HIS A  1 359 ? 129.967 109.511  -1.451  1.00 51.95  ?  367 HIS A C   1 
ATOM 2712  O O   . HIS A  1 359 ? 130.910 110.109  -1.986  1.00 54.22  ?  367 HIS A O   1 
ATOM 2713  C CB  . HIS A  1 359 ? 130.405 107.341  -0.287  1.00 54.95  ?  367 HIS A CB  1 
ATOM 2714  C CG  . HIS A  1 359 ? 129.675 107.713  0.967   1.00 55.20  ?  367 HIS A CG  1 
ATOM 2715  N ND1 . HIS A  1 359 ? 128.369 107.345  1.205   1.00 53.71  ?  367 HIS A ND1 1 
ATOM 2716  C CD2 . HIS A  1 359 ? 130.068 108.427  2.048   1.00 53.29  ?  367 HIS A CD2 1 
ATOM 2717  C CE1 . HIS A  1 359 ? 127.988 107.814  2.380   1.00 52.66  ?  367 HIS A CE1 1 
ATOM 2718  N NE2 . HIS A  1 359 ? 129.001 108.474  2.912   1.00 50.22  ?  367 HIS A NE2 1 
ATOM 2719  N N   . VAL A  1 360 ? 129.016 110.117  -0.740  1.00 54.61  ?  368 VAL A N   1 
ATOM 2720  C CA  . VAL A  1 360 ? 128.828 111.562  -0.713  1.00 53.94  ?  368 VAL A CA  1 
ATOM 2721  C C   . VAL A  1 360 ? 128.610 112.014  0.727   1.00 53.69  ?  368 VAL A C   1 
ATOM 2722  O O   . VAL A  1 360 ? 127.876 111.372  1.486   1.00 57.09  ?  368 VAL A O   1 
ATOM 2723  C CB  . VAL A  1 360 ? 127.632 111.973  -1.597  1.00 49.45  ?  368 VAL A CB  1 
ATOM 2724  C CG1 . VAL A  1 360 ? 127.150 113.360  -1.233  1.00 49.56  ?  368 VAL A CG1 1 
ATOM 2725  C CG2 . VAL A  1 360 ? 128.000 111.890  -3.065  1.00 50.54  ?  368 VAL A CG2 1 
ATOM 2726  N N   . GLU A  1 361 ? 129.244 113.128  1.100   1.00 50.62  ?  369 GLU A N   1 
ATOM 2727  C CA  . GLU A  1 361 ? 129.035 113.760  2.397   1.00 50.37  ?  369 GLU A CA  1 
ATOM 2728  C C   . GLU A  1 361 ? 128.763 115.242  2.186   1.00 50.62  ?  369 GLU A C   1 
ATOM 2729  O O   . GLU A  1 361 ? 129.455 115.896  1.398   1.00 51.02  ?  369 GLU A O   1 
ATOM 2730  C CB  . GLU A  1 361 ? 130.245 113.568  3.318   1.00 53.99  ?  369 GLU A CB  1 
ATOM 2731  C CG  . GLU A  1 361 ? 130.468 112.129  3.762   1.00 64.16  ?  369 GLU A CG  1 
ATOM 2732  C CD  . GLU A  1 361 ? 129.409 111.646  4.738   1.00 70.62  ?  369 GLU A CD  1 
ATOM 2733  O OE1 . GLU A  1 361 ? 129.211 112.311  5.777   1.00 73.90  ?  369 GLU A OE1 1 
ATOM 2734  O OE2 . GLU A  1 361 ? 128.774 110.603  4.465   1.00 71.64  -1 369 GLU A OE2 1 
ATOM 2735  N N   . GLU A  1 362 ? 127.753 115.767  2.881   1.00 53.10  ?  370 GLU A N   1 
ATOM 2736  C CA  . GLU A  1 362 ? 127.342 117.158  2.732   1.00 54.97  ?  370 GLU A CA  1 
ATOM 2737  C C   . GLU A  1 362 ? 127.084 117.772  4.102   1.00 53.93  ?  370 GLU A C   1 
ATOM 2738  O O   . GLU A  1 362 ? 126.343 117.206  4.911   1.00 53.52  ?  370 GLU A O   1 
ATOM 2739  C CB  . GLU A  1 362 ? 126.096 117.263  1.845   1.00 51.57  ?  370 GLU A CB  1 
ATOM 2740  C CG  . GLU A  1 362 ? 125.466 118.644  1.790   1.00 56.60  ?  370 GLU A CG  1 
ATOM 2741  C CD  . GLU A  1 362 ? 124.252 118.688  0.876   1.00 58.73  ?  370 GLU A CD  1 
ATOM 2742  O OE1 . GLU A  1 362 ? 123.456 119.646  0.979   1.00 57.29  ?  370 GLU A OE1 1 
ATOM 2743  O OE2 . GLU A  1 362 ? 124.091 117.760  0.057   1.00 61.62  -1 370 GLU A OE2 1 
ATOM 2744  N N   . PHE A  1 363 ? 127.697 118.929  4.353   1.00 51.82  ?  371 PHE A N   1 
ATOM 2745  C CA  . PHE A  1 363 ? 127.620 119.638  5.621   1.00 51.61  ?  371 PHE A CA  1 
ATOM 2746  C C   . PHE A  1 363 ? 127.294 121.108  5.384   1.00 60.43  ?  371 PHE A C   1 
ATOM 2747  O O   . PHE A  1 363 ? 127.435 121.634  4.275   1.00 67.24  ?  371 PHE A O   1 
ATOM 2748  C CB  . PHE A  1 363 ? 128.930 119.542  6.422   1.00 52.43  ?  371 PHE A CB  1 
ATOM 2749  C CG  . PHE A  1 363 ? 129.255 118.158  6.907   1.00 50.68  ?  371 PHE A CG  1 
ATOM 2750  C CD1 . PHE A  1 363 ? 129.082 117.828  8.240   1.00 49.32  ?  371 PHE A CD1 1 
ATOM 2751  C CD2 . PHE A  1 363 ? 129.731 117.190  6.039   1.00 51.02  ?  371 PHE A CD2 1 
ATOM 2752  C CE1 . PHE A  1 363 ? 129.377 116.560  8.701   1.00 47.89  ?  371 PHE A CE1 1 
ATOM 2753  C CE2 . PHE A  1 363 ? 130.028 115.918  6.493   1.00 52.63  ?  371 PHE A CE2 1 
ATOM 2754  C CZ  . PHE A  1 363 ? 129.850 115.603  7.827   1.00 47.83  ?  371 PHE A CZ  1 
ATOM 2755  N N   . ASP A  1 364 ? 126.873 121.771  6.466   1.00 56.66  ?  372 ASP A N   1 
ATOM 2756  C CA  . ASP A  1 364 ? 126.607 123.213  6.450   1.00 58.01  ?  372 ASP A CA  1 
ATOM 2757  C C   . ASP A  1 364 ? 126.765 123.713  7.891   1.00 57.57  ?  372 ASP A C   1 
ATOM 2758  O O   . ASP A  1 364 ? 125.820 123.663  8.678   1.00 62.09  ?  372 ASP A O   1 
ATOM 2759  C CB  . ASP A  1 364 ? 125.229 123.525  5.901   1.00 59.25  ?  372 ASP A CB  1 
ATOM 2760  C CG  . ASP A  1 364 ? 124.926 125.014  5.885   1.00 67.42  ?  372 ASP A CG  1 
ATOM 2761  O OD1 . ASP A  1 364 ? 125.873 125.820  6.001   1.00 72.08  ?  372 ASP A OD1 1 
ATOM 2762  O OD2 . ASP A  1 364 ? 123.736 125.378  5.765   1.00 68.86  -1 372 ASP A OD2 1 
ATOM 2763  N N   . LEU A  1 365 ? 127.966 124.188  8.214   1.00 55.98  ?  373 LEU A N   1 
ATOM 2764  C CA  . LEU A  1 365 ? 128.283 124.608  9.573   1.00 51.98  ?  373 LEU A CA  1 
ATOM 2765  C C   . LEU A  1 365 ? 127.807 126.035  9.826   1.00 56.94  ?  373 LEU A C   1 
ATOM 2766  O O   . LEU A  1 365 ? 128.021 126.926  8.998   1.00 62.28  ?  373 LEU A O   1 
ATOM 2767  C CB  . LEU A  1 365 ? 129.786 124.500  9.822   1.00 48.61  ?  373 LEU A CB  1 
ATOM 2768  C CG  . LEU A  1 365 ? 130.410 123.141  9.501   1.00 48.31  ?  373 LEU A CG  1 
ATOM 2769  C CD1 . LEU A  1 365 ? 131.901 123.154  9.792   1.00 48.53  ?  373 LEU A CD1 1 
ATOM 2770  C CD2 . LEU A  1 365 ? 129.714 122.035  10.279  1.00 47.79  ?  373 LEU A CD2 1 
ATOM 2771  N N   . GLN A  1 366 ? 127.163 126.247  10.974  1.00 53.94  ?  374 GLN A N   1 
ATOM 2772  C CA  . GLN A  1 366 ? 126.669 127.556  11.381  1.00 54.96  ?  374 GLN A CA  1 
ATOM 2773  C C   . GLN A  1 366 ? 127.024 127.796  12.842  1.00 55.17  ?  374 GLN A C   1 
ATOM 2774  O O   . GLN A  1 366 ? 126.958 126.876  13.663  1.00 54.28  ?  374 GLN A O   1 
ATOM 2775  C CB  . GLN A  1 366 ? 125.153 127.668  11.176  1.00 57.60  ?  374 GLN A CB  1 
ATOM 2776  C CG  . GLN A  1 366 ? 124.707 127.441  9.739   1.00 60.23  ?  374 GLN A CG  1 
ATOM 2777  C CD  . GLN A  1 366 ? 123.207 127.261  9.611   1.00 66.06  ?  374 GLN A CD  1 
ATOM 2778  O OE1 . GLN A  1 366 ? 122.429 128.092  10.081  1.00 74.17  ?  374 GLN A OE1 1 
ATOM 2779  N NE2 . GLN A  1 366 ? 122.793 126.170  8.975   1.00 62.44  ?  374 GLN A NE2 1 
ATOM 2780  N N   . PHE A  1 367 ? 127.393 129.036  13.166  1.00 56.58  ?  375 PHE A N   1 
ATOM 2781  C CA  . PHE A  1 367 ? 127.893 129.372  14.492  1.00 56.95  ?  375 PHE A CA  1 
ATOM 2782  C C   . PHE A  1 367 ? 127.395 130.744  14.923  1.00 59.70  ?  375 PHE A C   1 
ATOM 2783  O O   . PHE A  1 367 ? 127.167 131.632  14.096  1.00 61.97  ?  375 PHE A O   1 
ATOM 2784  C CB  . PHE A  1 367 ? 129.425 129.367  14.550  1.00 60.45  ?  375 PHE A CB  1 
ATOM 2785  C CG  . PHE A  1 367 ? 130.048 128.052  14.191  1.00 58.00  ?  375 PHE A CG  1 
ATOM 2786  C CD1 . PHE A  1 367 ? 130.218 127.068  15.149  1.00 55.12  ?  375 PHE A CD1 1 
ATOM 2787  C CD2 . PHE A  1 367 ? 130.482 127.807  12.899  1.00 58.62  ?  375 PHE A CD2 1 
ATOM 2788  C CE1 . PHE A  1 367 ? 130.798 125.858  14.823  1.00 53.23  ?  375 PHE A CE1 1 
ATOM 2789  C CE2 . PHE A  1 367 ? 131.064 126.599  12.565  1.00 55.15  ?  375 PHE A CE2 1 
ATOM 2790  C CZ  . PHE A  1 367 ? 131.223 125.624  13.529  1.00 53.08  ?  375 PHE A CZ  1 
ATOM 2791  N N   . ILE A  1 368 ? 127.214 130.899  16.233  1.00 57.79  ?  376 ILE A N   1 
ATOM 2792  C CA  . ILE A  1 368 ? 126.944 132.186  16.867  1.00 59.21  ?  376 ILE A CA  1 
ATOM 2793  C C   . ILE A  1 368 ? 128.055 132.431  17.879  1.00 59.90  ?  376 ILE A C   1 
ATOM 2794  O O   . ILE A  1 368 ? 128.173 131.700  18.872  1.00 59.30  ?  376 ILE A O   1 
ATOM 2795  C CB  . ILE A  1 368 ? 125.566 132.227  17.540  1.00 59.62  ?  376 ILE A CB  1 
ATOM 2796  C CG1 . ILE A  1 368 ? 124.451 132.155  16.495  1.00 58.99  ?  376 ILE A CG1 1 
ATOM 2797  C CG2 . ILE A  1 368 ? 125.426 133.480  18.391  1.00 62.13  ?  376 ILE A CG2 1 
ATOM 2798  C CD1 . ILE A  1 368 ? 124.425 133.340  15.553  1.00 61.69  ?  376 ILE A CD1 1 
ATOM 2799  N N   . PHE A  1 369 ? 128.871 133.452  17.632  1.00 59.83  ?  377 PHE A N   1 
ATOM 2800  C CA  . PHE A  1 369 ? 129.994 133.791  18.492  1.00 60.76  ?  377 PHE A CA  1 
ATOM 2801  C C   . PHE A  1 369 ? 129.705 135.065  19.276  1.00 62.35  ?  377 PHE A C   1 
ATOM 2802  O O   . PHE A  1 369 ? 128.926 135.920  18.845  1.00 63.07  ?  377 PHE A O   1 
ATOM 2803  C CB  . PHE A  1 369 ? 131.282 133.965  17.684  1.00 60.76  ?  377 PHE A CB  1 
ATOM 2804  C CG  . PHE A  1 369 ? 131.787 132.694  17.067  1.00 59.43  ?  377 PHE A CG  1 
ATOM 2805  C CD1 . PHE A  1 369 ? 132.384 131.720  17.851  1.00 58.73  ?  377 PHE A CD1 1 
ATOM 2806  C CD2 . PHE A  1 369 ? 131.676 132.477  15.706  1.00 58.97  ?  377 PHE A CD2 1 
ATOM 2807  C CE1 . PHE A  1 369 ? 132.855 130.551  17.288  1.00 57.61  ?  377 PHE A CE1 1 
ATOM 2808  C CE2 . PHE A  1 369 ? 132.150 131.313  15.137  1.00 57.88  ?  377 PHE A CE2 1 
ATOM 2809  C CZ  . PHE A  1 369 ? 132.736 130.346  15.929  1.00 57.20  ?  377 PHE A CZ  1 
ATOM 2810  N N   . GLN A  1 370 ? 130.344 135.178  20.439  1.00 60.11  ?  378 GLN A N   1 
ATOM 2811  C CA  . GLN A  1 370 ? 130.184 136.317  21.333  1.00 63.35  ?  378 GLN A CA  1 
ATOM 2812  C C   . GLN A  1 370 ? 131.541 136.958  21.580  1.00 68.71  ?  378 GLN A C   1 
ATOM 2813  O O   . GLN A  1 370 ? 132.508 136.264  21.914  1.00 70.71  ?  378 GLN A O   1 
ATOM 2814  C CB  . GLN A  1 370 ? 129.552 135.884  22.657  1.00 65.37  ?  378 GLN A CB  1 
ATOM 2815  C CG  . GLN A  1 370 ? 129.465 136.980  23.703  1.00 72.35  ?  378 GLN A CG  1 
ATOM 2816  C CD  . GLN A  1 370 ? 128.774 136.518  24.972  1.00 74.08  ?  378 GLN A CD  1 
ATOM 2817  O OE1 . GLN A  1 370 ? 128.864 135.350  25.352  1.00 68.90  ?  378 GLN A OE1 1 
ATOM 2818  N NE2 . GLN A  1 370 ? 128.077 137.434  25.635  1.00 79.29  ?  378 GLN A NE2 1 
ATOM 2819  N N   . LEU A  1 371 ? 131.610 138.278  21.420  1.00 64.25  ?  379 LEU A N   1 
ATOM 2820  C CA  . LEU A  1 371 ? 132.847 139.010  21.653  1.00 66.33  ?  379 LEU A CA  1 
ATOM 2821  C C   . LEU A  1 371 ? 133.070 139.202  23.148  1.00 67.85  ?  379 LEU A C   1 
ATOM 2822  O O   . LEU A  1 371 ? 132.132 139.485  23.898  1.00 71.04  ?  379 LEU A O   1 
ATOM 2823  C CB  . LEU A  1 371 ? 132.803 140.362  20.942  1.00 66.10  ?  379 LEU A CB  1 
ATOM 2824  C CG  . LEU A  1 371 ? 134.093 141.178  20.942  1.00 72.32  ?  379 LEU A CG  1 
ATOM 2825  C CD1 . LEU A  1 371 ? 135.225 140.350  20.365  1.00 75.51  ?  379 LEU A CD1 1 
ATOM 2826  C CD2 . LEU A  1 371 ? 133.912 142.463  20.150  1.00 74.81  ?  379 LEU A CD2 1 
ATOM 2827  N N   . CYS A  1 372 ? 134.321 139.050  23.583  1.00 65.98  ?  380 CYS A N   1 
ATOM 2828  C CA  . CYS A  1 372 ? 134.638 139.087  25.004  1.00 68.82  ?  380 CYS A CA  1 
ATOM 2829  C C   . CYS A  1 372 ? 135.879 139.931  25.260  1.00 72.62  ?  380 CYS A C   1 
ATOM 2830  O O   . CYS A  1 372 ? 136.727 140.119  24.384  1.00 69.88  ?  380 CYS A O   1 
ATOM 2831  C CB  . CYS A  1 372 ? 134.852 137.677  25.570  1.00 73.39  ?  380 CYS A CB  1 
ATOM 2832  S SG  . CYS A  1 372 ? 133.427 136.586  25.414  1.00 70.33  ?  380 CYS A SG  1 
ATOM 2833  N N   . LYS A  1 373 ? 135.962 140.444  26.485  1.00 73.19  ?  381 LYS A N   1 
ATOM 2834  C CA  . LYS A  1 373 ? 137.103 141.202  26.973  1.00 76.56  ?  381 LYS A CA  1 
ATOM 2835  C C   . LYS A  1 373 ? 137.837 140.392  28.033  1.00 76.34  ?  381 LYS A C   1 
ATOM 2836  O O   . LYS A  1 373 ? 137.237 139.585  28.748  1.00 73.97  ?  381 LYS A O   1 
ATOM 2837  C CB  . LYS A  1 373 ? 136.673 142.542  27.577  1.00 81.23  ?  381 LYS A CB  1 
ATOM 2838  C CG  . LYS A  1 373 ? 135.717 143.351  26.727  1.00 82.73  ?  381 LYS A CG  1 
ATOM 2839  C CD  . LYS A  1 373 ? 135.333 144.640  27.435  1.00 88.36  ?  381 LYS A CD  1 
ATOM 2840  C CE  . LYS A  1 373 ? 134.620 144.369  28.750  1.00 89.14  ?  381 LYS A CE  1 
ATOM 2841  N NZ  . LYS A  1 373 ? 134.184 145.629  29.414  1.00 91.71  1  381 LYS A NZ  1 
ATOM 2842  N N   . ILE A  1 374 ? 139.144 140.618  28.132  1.00 77.72  ?  382 ILE A N   1 
ATOM 2843  C CA  . ILE A  1 374 ? 139.980 140.014  29.165  1.00 78.40  ?  382 ILE A CA  1 
ATOM 2844  C C   . ILE A  1 374 ? 140.861 141.115  29.735  1.00 81.80  ?  382 ILE A C   1 
ATOM 2845  O O   . ILE A  1 374 ? 141.788 141.583  29.062  1.00 84.52  ?  382 ILE A O   1 
ATOM 2846  C CB  . ILE A  1 374 ? 140.830 138.852  28.633  1.00 79.22  ?  382 ILE A CB  1 
ATOM 2847  C CG1 . ILE A  1 374 ? 139.936 137.704  28.159  1.00 80.64  ?  382 ILE A CG1 1 
ATOM 2848  C CG2 . ILE A  1 374 ? 141.794 138.362  29.704  1.00 77.44  ?  382 ILE A CG2 1 
ATOM 2849  C CD1 . ILE A  1 374 ? 140.703 136.516  27.625  1.00 81.93  ?  382 ILE A CD1 1 
ATOM 2850  N N   . THR A  1 375 ? 140.573 141.535  30.964  1.00 78.33  ?  383 THR A N   1 
ATOM 2851  C CA  . THR A  1 375 ? 141.374 142.562  31.621  1.00 80.94  ?  383 THR A CA  1 
ATOM 2852  C C   . THR A  1 375 ? 142.713 141.963  32.033  1.00 81.44  ?  383 THR A C   1 
ATOM 2853  O O   . THR A  1 375 ? 142.774 141.111  32.926  1.00 80.88  ?  383 THR A O   1 
ATOM 2854  C CB  . THR A  1 375 ? 140.631 143.117  32.832  1.00 80.02  ?  383 THR A CB  1 
ATOM 2855  O OG1 . THR A  1 375 ? 139.375 143.666  32.414  1.00 79.64  ?  383 THR A OG1 1 
ATOM 2856  C CG2 . THR A  1 375 ? 141.452 144.205  33.504  1.00 82.88  ?  383 THR A CG2 1 
ATOM 2857  N N   . LEU A  1 376 ? 143.790 142.405  31.381  1.00 81.87  ?  384 LEU A N   1 
ATOM 2858  C CA  . LEU A  1 376 ? 145.120 141.830  31.585  1.00 82.96  ?  384 LEU A CA  1 
ATOM 2859  C C   . LEU A  1 376 ? 145.719 142.409  32.863  1.00 90.14  ?  384 LEU A C   1 
ATOM 2860  O O   . LEU A  1 376 ? 146.596 143.277  32.852  1.00 96.43  ?  384 LEU A O   1 
ATOM 2861  C CB  . LEU A  1 376 ? 146.008 142.093  30.378  1.00 84.09  ?  384 LEU A CB  1 
ATOM 2862  C CG  . LEU A  1 376 ? 145.599 141.389  29.085  1.00 81.82  ?  384 LEU A CG  1 
ATOM 2863  C CD1 . LEU A  1 376 ? 146.562 141.742  27.964  1.00 82.61  ?  384 LEU A CD1 1 
ATOM 2864  C CD2 . LEU A  1 376 ? 145.530 139.884  29.290  1.00 79.74  ?  384 LEU A CD2 1 
ATOM 2865  N N   . THR A  1 377 ? 145.234 141.899  33.989  1.00 89.85  ?  385 THR A N   1 
ATOM 2866  C CA  . THR A  1 377 ? 145.761 142.233  35.301  1.00 93.81  ?  385 THR A CA  1 
ATOM 2867  C C   . THR A  1 377 ? 147.030 141.424  35.567  1.00 94.61  ?  385 THR A C   1 
ATOM 2868  O O   . THR A  1 377 ? 147.469 140.616  34.745  1.00 92.13  ?  385 THR A O   1 
ATOM 2869  C CB  . THR A  1 377 ? 144.700 141.956  36.368  1.00 87.54  ?  385 THR A CB  1 
ATOM 2870  O OG1 . THR A  1 377 ? 143.401 142.231  35.832  1.00 86.33  ?  385 THR A OG1 1 
ATOM 2871  C CG2 . THR A  1 377 ? 144.908 142.823  37.598  1.00 90.17  ?  385 THR A CG2 1 
ATOM 2872  N N   . THR A  1 378 ? 147.643 141.660  36.724  1.00 100.57 ?  386 THR A N   1 
ATOM 2873  C CA  . THR A  1 378 ? 148.532 140.664  37.294  1.00 100.18 ?  386 THR A CA  1 
ATOM 2874  C C   . THR A  1 378 ? 147.683 139.512  37.829  1.00 98.22  ?  386 THR A C   1 
ATOM 2875  O O   . THR A  1 378 ? 146.451 139.524  37.733  1.00 99.39  ?  386 THR A O   1 
ATOM 2876  C CB  . THR A  1 378 ? 149.404 141.282  38.384  1.00 96.50  ?  386 THR A CB  1 
ATOM 2877  O OG1 . THR A  1 378 ? 148.570 141.845  39.403  1.00 98.13  ?  386 THR A OG1 1 
ATOM 2878  C CG2 . THR A  1 378 ? 150.291 142.372  37.798  1.00 100.37 ?  386 THR A CG2 1 
ATOM 2879  N N   . GLU A  1 379 ? 148.341 138.498  38.393  1.00 99.60  ?  387 GLU A N   1 
ATOM 2880  C CA  . GLU A  1 379 ? 147.671 137.254  38.773  1.00 97.38  ?  387 GLU A CA  1 
ATOM 2881  C C   . GLU A  1 379 ? 147.062 136.603  37.533  1.00 95.50  ?  387 GLU A C   1 
ATOM 2882  O O   . GLU A  1 379 ? 147.440 135.489  37.157  1.00 97.36  ?  387 GLU A O   1 
ATOM 2883  C CB  . GLU A  1 379 ? 146.594 137.502  39.838  1.00 100.56 ?  387 GLU A CB  1 
ATOM 2884  C CG  . GLU A  1 379 ? 147.090 138.202  41.096  1.00 106.09 ?  387 GLU A CG  1 
ATOM 2885  C CD  . GLU A  1 379 ? 147.796 137.267  42.055  1.00 107.20 ?  387 GLU A CD  1 
ATOM 2886  O OE1 . GLU A  1 379 ? 148.021 137.670  43.216  1.00 110.98 ?  387 GLU A OE1 1 
ATOM 2887  O OE2 . GLU A  1 379 ? 148.123 136.131  41.653  1.00 104.48 -1 387 GLU A OE2 1 
ATOM 2888  N N   . VAL A  1 380 ? 146.111 137.292  36.899  1.00 90.41  ?  388 VAL A N   1 
ATOM 2889  C CA  . VAL A  1 380 ? 145.715 137.025  35.520  1.00 87.78  ?  388 VAL A CA  1 
ATOM 2890  C C   . VAL A  1 380 ? 146.922 137.312  34.632  1.00 89.40  ?  388 VAL A C   1 
ATOM 2891  O O   . VAL A  1 380 ? 147.923 137.870  35.098  1.00 96.44  ?  388 VAL A O   1 
ATOM 2892  C CB  . VAL A  1 380 ? 144.492 137.877  35.122  1.00 91.66  ?  388 VAL A CB  1 
ATOM 2893  C CG1 . VAL A  1 380 ? 143.826 137.340  33.857  1.00 82.07  ?  388 VAL A CG1 1 
ATOM 2894  C CG2 . VAL A  1 380 ? 143.495 137.943  36.270  1.00 96.73  ?  388 VAL A CG2 1 
ATOM 2895  N N   . MET A  1 381 ? 146.850 136.910  33.359  1.00 82.31  ?  389 MET A N   1 
ATOM 2896  C CA  . MET A  1 381 ? 147.929 137.080  32.386  1.00 87.42  ?  389 MET A CA  1 
ATOM 2897  C C   . MET A  1 381 ? 149.122 136.194  32.731  1.00 92.38  ?  389 MET A C   1 
ATOM 2898  O O   . MET A  1 381 ? 149.631 135.477  31.863  1.00 96.83  ?  389 MET A O   1 
ATOM 2899  C CB  . MET A  1 381 ? 148.347 138.552  32.276  1.00 91.66  ?  389 MET A CB  1 
ATOM 2900  C CG  . MET A  1 381 ? 149.802 138.767  31.898  1.00 96.84  ?  389 MET A CG  1 
ATOM 2901  S SD  . MET A  1 381 ? 150.219 140.514  31.730  1.00 105.27 ?  389 MET A SD  1 
ATOM 2902  C CE  . MET A  1 381 ? 149.390 140.914  30.195  1.00 101.47 ?  389 MET A CE  1 
ATOM 2903  N N   . SER A  1 382 ? 149.580 136.229  33.985  1.00 91.21  ?  390 SER A N   1 
ATOM 2904  C CA  . SER A  1 382 ? 150.534 135.221  34.433  1.00 88.07  ?  390 SER A CA  1 
ATOM 2905  C C   . SER A  1 382 ? 149.877 133.849  34.475  1.00 83.54  ?  390 SER A C   1 
ATOM 2906  O O   . SER A  1 382 ? 150.509 132.836  34.152  1.00 82.33  ?  390 SER A O   1 
ATOM 2907  C CB  . SER A  1 382 ? 151.098 135.594  35.804  1.00 83.50  ?  390 SER A CB  1 
ATOM 2908  O OG  . SER A  1 382 ? 150.170 135.306  36.834  1.00 82.85  ?  390 SER A OG  1 
ATOM 2909  N N   . TYR A  1 383 ? 148.602 133.802  34.870  1.00 84.41  ?  391 TYR A N   1 
ATOM 2910  C CA  . TYR A  1 383 ? 147.825 132.575  34.739  1.00 79.89  ?  391 TYR A CA  1 
ATOM 2911  C C   . TYR A  1 383 ? 147.657 132.197  33.272  1.00 78.09  ?  391 TYR A C   1 
ATOM 2912  O O   . TYR A  1 383 ? 147.761 131.019  32.910  1.00 76.59  ?  391 TYR A O   1 
ATOM 2913  C CB  . TYR A  1 383 ? 146.465 132.750  35.420  1.00 73.60  ?  391 TYR A CB  1 
ATOM 2914  C CG  . TYR A  1 383 ? 145.459 131.659  35.122  1.00 71.04  ?  391 TYR A CG  1 
ATOM 2915  C CD1 . TYR A  1 383 ? 145.465 130.468  35.837  1.00 70.19  ?  391 TYR A CD1 1 
ATOM 2916  C CD2 . TYR A  1 383 ? 144.498 131.824  34.133  1.00 69.58  ?  391 TYR A CD2 1 
ATOM 2917  C CE1 . TYR A  1 383 ? 144.547 129.469  35.571  1.00 67.95  ?  391 TYR A CE1 1 
ATOM 2918  C CE2 . TYR A  1 383 ? 143.578 130.830  33.859  1.00 67.37  ?  391 TYR A CE2 1 
ATOM 2919  C CZ  . TYR A  1 383 ? 143.606 129.656  34.581  1.00 66.56  ?  391 TYR A CZ  1 
ATOM 2920  O OH  . TYR A  1 383 ? 142.689 128.668  34.309  1.00 64.44  ?  391 TYR A OH  1 
ATOM 2921  N N   . ILE A  1 384 ? 147.400 133.187  32.413  1.00 81.29  ?  392 ILE A N   1 
ATOM 2922  C CA  . ILE A  1 384 ? 147.317 132.930  30.977  1.00 74.19  ?  392 ILE A CA  1 
ATOM 2923  C C   . ILE A  1 384 ? 148.668 132.477  30.441  1.00 75.46  ?  392 ILE A C   1 
ATOM 2924  O O   . ILE A  1 384 ? 148.747 131.622  29.550  1.00 72.90  ?  392 ILE A O   1 
ATOM 2925  C CB  . ILE A  1 384 ? 146.803 134.181  30.239  1.00 72.33  ?  392 ILE A CB  1 
ATOM 2926  C CG1 . ILE A  1 384 ? 145.377 134.515  30.678  1.00 71.56  ?  392 ILE A CG1 1 
ATOM 2927  C CG2 . ILE A  1 384 ? 146.857 133.980  28.732  1.00 71.28  ?  392 ILE A CG2 1 
ATOM 2928  C CD1 . ILE A  1 384 ? 144.773 135.691  29.939  1.00 72.01  ?  392 ILE A CD1 1 
ATOM 2929  N N   . HIS A  1 385 ? 149.753 133.042  30.973  1.00 78.03  ?  393 HIS A N   1 
ATOM 2930  C CA  . HIS A  1 385 ? 151.087 132.628  30.551  1.00 83.17  ?  393 HIS A CA  1 
ATOM 2931  C C   . HIS A  1 385 ? 151.344 131.170  30.916  1.00 84.15  ?  393 HIS A C   1 
ATOM 2932  O O   . HIS A  1 385 ? 151.856 130.394  30.102  1.00 85.40  ?  393 HIS A O   1 
ATOM 2933  C CB  . HIS A  1 385 ? 152.142 133.542  31.177  1.00 82.62  ?  393 HIS A CB  1 
ATOM 2934  C CG  . HIS A  1 385 ? 153.546 133.210  30.777  1.00 85.23  ?  393 HIS A CG  1 
ATOM 2935  N ND1 . HIS A  1 385 ? 154.325 132.308  31.470  1.00 86.58  ?  393 HIS A ND1 1 
ATOM 2936  C CD2 . HIS A  1 385 ? 154.312 133.662  29.756  1.00 87.36  ?  393 HIS A CD2 1 
ATOM 2937  C CE1 . HIS A  1 385 ? 155.510 132.218  30.892  1.00 90.54  ?  393 HIS A CE1 1 
ATOM 2938  N NE2 . HIS A  1 385 ? 155.528 133.029  29.850  1.00 91.57  ?  393 HIS A NE2 1 
ATOM 2939  N N   . ASN A  1 386 ? 150.993 130.780  32.146  1.00 87.11  ?  394 ASN A N   1 
ATOM 2940  C CA  . ASN A  1 386 ? 151.131 129.383  32.546  1.00 86.92  ?  394 ASN A CA  1 
ATOM 2941  C C   . ASN A  1 386 ? 150.195 128.475  31.758  1.00 83.13  ?  394 ASN A C   1 
ATOM 2942  O O   . ASN A  1 386 ? 150.485 127.284  31.588  1.00 78.08  ?  394 ASN A O   1 
ATOM 2943  C CB  . ASN A  1 386 ? 150.872 129.235  34.046  1.00 88.15  ?  394 ASN A CB  1 
ATOM 2944  C CG  . ASN A  1 386 ? 151.326 127.892  34.586  1.00 87.00  ?  394 ASN A CG  1 
ATOM 2945  O OD1 . ASN A  1 386 ? 152.461 127.744  35.040  1.00 89.07  ?  394 ASN A OD1 1 
ATOM 2946  N ND2 . ASN A  1 386 ? 150.439 126.904  34.538  1.00 83.58  ?  394 ASN A ND2 1 
ATOM 2947  N N   . MET A  1 387 ? 149.076 129.012  31.273  1.00 86.51  ?  395 MET A N   1 
ATOM 2948  C CA  . MET A  1 387 ? 148.164 128.226  30.449  1.00 80.13  ?  395 MET A CA  1 
ATOM 2949  C C   . MET A  1 387 ? 148.749 127.995  29.061  1.00 72.05  ?  395 MET A C   1 
ATOM 2950  O O   . MET A  1 387 ? 148.982 126.853  28.651  1.00 70.17  ?  395 MET A O   1 
ATOM 2951  C CB  . MET A  1 387 ? 146.807 128.929  30.366  1.00 83.07  ?  395 MET A CB  1 
ATOM 2952  C CG  . MET A  1 387 ? 145.764 128.206  29.535  1.00 78.21  ?  395 MET A CG  1 
ATOM 2953  S SD  . MET A  1 387 ? 144.157 129.022  29.621  1.00 78.75  ?  395 MET A SD  1 
ATOM 2954  C CE  . MET A  1 387 ? 143.183 127.958  28.557  1.00 78.61  ?  395 MET A CE  1 
ATOM 2955  N N   . ASN A  1 388 ? 148.991 129.076  28.320  1.00 77.72  ?  396 ASN A N   1 
ATOM 2956  C CA  . ASN A  1 388 ? 149.590 128.993  26.990  1.00 78.40  ?  396 ASN A CA  1 
ATOM 2957  C C   . ASN A  1 388 ? 150.367 130.278  26.746  1.00 87.56  ?  396 ASN A C   1 
ATOM 2958  O O   . ASN A  1 388 ? 149.764 131.340  26.562  1.00 95.17  ?  396 ASN A O   1 
ATOM 2959  C CB  . ASN A  1 388 ? 148.531 128.781  25.910  1.00 80.47  ?  396 ASN A CB  1 
ATOM 2960  C CG  . ASN A  1 388 ? 148.532 127.368  25.360  1.00 85.08  ?  396 ASN A CG  1 
ATOM 2961  O OD1 . ASN A  1 388 ? 149.391 127.005  24.557  1.00 87.25  ?  396 ASN A OD1 1 
ATOM 2962  N ND2 . ASN A  1 388 ? 147.564 126.564  25.787  1.00 86.82  ?  396 ASN A ND2 1 
ATOM 2963  N N   . THR A  1 389 ? 151.700 130.183  26.760  1.00 83.46  ?  397 THR A N   1 
ATOM 2964  C CA  . THR A  1 389 ? 152.529 131.349  26.469  1.00 88.98  ?  397 THR A CA  1 
ATOM 2965  C C   . THR A  1 389 ? 152.220 131.917  25.090  1.00 88.98  ?  397 THR A C   1 
ATOM 2966  O O   . THR A  1 389 ? 152.272 133.138  24.891  1.00 94.79  ?  397 THR A O   1 
ATOM 2967  C CB  . THR A  1 389 ? 154.010 130.971  26.587  1.00 87.86  ?  397 THR A CB  1 
ATOM 2968  O OG1 . THR A  1 389 ? 154.378 130.901  27.971  1.00 88.67  ?  397 THR A OG1 1 
ATOM 2969  C CG2 . THR A  1 389 ? 154.905 131.980  25.876  1.00 94.75  ?  397 THR A CG2 1 
ATOM 2970  N N   . THR A  1 390 ? 151.848 131.057  24.141  1.00 83.10  ?  398 THR A N   1 
ATOM 2971  C CA  . THR A  1 390 ? 151.559 131.508  22.787  1.00 82.74  ?  398 THR A CA  1 
ATOM 2972  C C   . THR A  1 390 ? 150.302 132.368  22.708  1.00 82.13  ?  398 THR A C   1 
ATOM 2973  O O   . THR A  1 390 ? 150.105 133.055  21.701  1.00 82.37  ?  398 THR A O   1 
ATOM 2974  C CB  . THR A  1 390 ? 151.433 130.304  21.853  1.00 90.58  ?  398 THR A CB  1 
ATOM 2975  O OG1 . THR A  1 390 ? 150.949 130.734  20.574  1.00 91.44  ?  398 THR A OG1 1 
ATOM 2976  C CG2 . THR A  1 390 ? 150.491 129.264  22.442  1.00 89.07  ?  398 THR A CG2 1 
ATOM 2977  N N   . ILE A  1 391 ? 149.444 132.342  23.732  1.00 85.99  ?  399 ILE A N   1 
ATOM 2978  C CA  . ILE A  1 391 ? 148.293 133.242  23.753  1.00 86.48  ?  399 ILE A CA  1 
ATOM 2979  C C   . ILE A  1 391 ? 148.755 134.686  23.900  1.00 92.09  ?  399 ILE A C   1 
ATOM 2980  O O   . ILE A  1 391 ? 148.363 135.565  23.124  1.00 96.19  ?  399 ILE A O   1 
ATOM 2981  C CB  . ILE A  1 391 ? 147.315 132.850  24.875  1.00 81.41  ?  399 ILE A CB  1 
ATOM 2982  C CG1 . ILE A  1 391 ? 146.627 131.525  24.550  1.00 77.68  ?  399 ILE A CG1 1 
ATOM 2983  C CG2 . ILE A  1 391 ? 146.278 133.942  25.078  1.00 80.81  ?  399 ILE A CG2 1 
ATOM 2984  C CD1 . ILE A  1 391 ? 145.651 131.075  25.615  1.00 76.90  ?  399 ILE A CD1 1 
ATOM 2985  N N   . LEU A  1 392 ? 149.593 134.951  24.905  1.00 85.35  ?  400 LEU A N   1 
ATOM 2986  C CA  . LEU A  1 392 ? 150.174 136.281  25.051  1.00 87.72  ?  400 LEU A CA  1 
ATOM 2987  C C   . LEU A  1 392 ? 151.095 136.599  23.882  1.00 88.72  ?  400 LEU A C   1 
ATOM 2988  O O   . LEU A  1 392 ? 151.150 137.745  23.420  1.00 90.04  ?  400 LEU A O   1 
ATOM 2989  C CB  . LEU A  1 392 ? 150.928 136.383  26.375  1.00 81.98  ?  400 LEU A CB  1 
ATOM 2990  C CG  . LEU A  1 392 ? 150.065 136.278  27.632  1.00 82.63  ?  400 LEU A CG  1 
ATOM 2991  C CD1 . LEU A  1 392 ? 150.936 136.279  28.876  1.00 87.45  ?  400 LEU A CD1 1 
ATOM 2992  C CD2 . LEU A  1 392 ? 149.050 137.407  27.677  1.00 85.43  ?  400 LEU A CD2 1 
ATOM 2993  N N   . GLU A  1 393 ? 151.834 135.596  23.401  1.00 98.20  ?  401 GLU A N   1 
ATOM 2994  C CA  . GLU A  1 393 ? 152.721 135.803  22.261  1.00 100.63 ?  401 GLU A CA  1 
ATOM 2995  C C   . GLU A  1 393 ? 151.953 136.295  21.037  1.00 98.57  ?  401 GLU A C   1 
ATOM 2996  O O   . GLU A  1 393 ? 152.413 137.203  20.336  1.00 99.57  ?  401 GLU A O   1 
ATOM 2997  C CB  . GLU A  1 393 ? 153.465 134.505  21.941  1.00 103.34 ?  401 GLU A CB  1 
ATOM 2998  C CG  . GLU A  1 393 ? 154.429 134.579  20.761  1.00 109.34 ?  401 GLU A CG  1 
ATOM 2999  C CD  . GLU A  1 393 ? 155.685 135.374  21.062  1.00 121.64 ?  401 GLU A CD  1 
ATOM 3000  O OE1 . GLU A  1 393 ? 156.767 134.754  21.156  1.00 123.53 ?  401 GLU A OE1 1 
ATOM 3001  O OE2 . GLU A  1 393 ? 155.594 136.610  21.217  1.00 129.59 -1 401 GLU A OE2 1 
ATOM 3002  N N   . ASP A  1 394 ? 150.779 135.720  20.763  1.00 98.40  ?  402 ASP A N   1 
ATOM 3003  C CA  . ASP A  1 394 ? 150.005 136.176  19.614  1.00 96.68  ?  402 ASP A CA  1 
ATOM 3004  C C   . ASP A  1 394 ? 149.336 137.521  19.854  1.00 89.14  ?  402 ASP A C   1 
ATOM 3005  O O   . ASP A  1 394 ? 149.002 138.210  18.886  1.00 86.92  ?  402 ASP A O   1 
ATOM 3006  C CB  . ASP A  1 394 ? 148.950 135.136  19.238  1.00 97.38  ?  402 ASP A CB  1 
ATOM 3007  C CG  . ASP A  1 394 ? 149.548 133.920  18.568  1.00 103.86 ?  402 ASP A CG  1 
ATOM 3008  O OD1 . ASP A  1 394 ? 150.799 133.829  18.539  1.00 108.37 ?  402 ASP A OD1 1 
ATOM 3009  O OD2 . ASP A  1 394 ? 148.767 133.044  18.114  1.00 103.18 -1 402 ASP A OD2 1 
ATOM 3010  N N   . TRP A  1 395 ? 149.123 137.912  21.110  1.00 87.77  ?  403 TRP A N   1 
ATOM 3011  C CA  . TRP A  1 395 ? 148.582 139.237  21.385  1.00 93.47  ?  403 TRP A CA  1 
ATOM 3012  C C   . TRP A  1 395 ? 149.696 140.273  21.463  1.00 100.96 ?  403 TRP A C   1 
ATOM 3013  O O   . TRP A  1 395 ? 150.375 140.523  20.464  1.00 105.12 ?  403 TRP A O   1 
ATOM 3014  C CB  . TRP A  1 395 ? 147.781 139.224  22.689  1.00 97.22  ?  403 TRP A CB  1 
ATOM 3015  C CG  . TRP A  1 395 ? 146.449 138.543  22.579  1.00 90.67  ?  403 TRP A CG  1 
ATOM 3016  C CD1 . TRP A  1 395 ? 145.749 138.285  21.435  1.00 85.59  ?  403 TRP A CD1 1 
ATOM 3017  C CD2 . TRP A  1 395 ? 145.659 138.024  23.657  1.00 85.59  ?  403 TRP A CD2 1 
ATOM 3018  N NE1 . TRP A  1 395 ? 144.571 137.644  21.735  1.00 80.93  ?  403 TRP A NE1 1 
ATOM 3019  C CE2 . TRP A  1 395 ? 144.492 137.472  23.092  1.00 81.67  ?  403 TRP A CE2 1 
ATOM 3020  C CE3 . TRP A  1 395 ? 145.824 137.976  25.045  1.00 84.16  ?  403 TRP A CE3 1 
ATOM 3021  C CZ2 . TRP A  1 395 ? 143.497 136.878  23.866  1.00 79.46  ?  403 TRP A CZ2 1 
ATOM 3022  C CZ3 . TRP A  1 395 ? 144.835 137.387  25.812  1.00 80.62  ?  403 TRP A CZ3 1 
ATOM 3023  C CH2 . TRP A  1 395 ? 143.687 136.846  25.221  1.00 79.18  ?  403 TRP A CH2 1 
ATOM 3024  N N   . ASN A  1 396 ? 149.928 140.801  22.667  1.00 92.96  ?  404 ASN A N   1 
ATOM 3025  C CA  . ASN A  1 396 ? 150.922 141.832  23.014  1.00 98.10  ?  404 ASN A CA  1 
ATOM 3026  C C   . ASN A  1 396 ? 150.755 142.200  24.485  1.00 99.57  ?  404 ASN A C   1 
ATOM 3027  O O   . ASN A  1 396 ? 151.605 141.884  25.316  1.00 96.33  ?  404 ASN A O   1 
ATOM 3028  C CB  . ASN A  1 396 ? 150.805 143.113  22.166  1.00 104.38 ?  404 ASN A CB  1 
ATOM 3029  C CG  . ASN A  1 396 ? 151.389 142.967  20.773  1.00 105.40 ?  404 ASN A CG  1 
ATOM 3030  O OD1 . ASN A  1 396 ? 152.509 142.481  20.606  1.00 103.48 ?  404 ASN A OD1 1 
ATOM 3031  N ND2 . ASN A  1 396 ? 150.633 143.387  19.765  1.00 107.51 ?  404 ASN A ND2 1 
ATOM 3032  N N   . GLN A  1 431 ? 154.762 129.521  13.740  1.00 121.25 ?  439 GLN A N   1 
ATOM 3033  C CA  . GLN A  1 431 ? 154.571 128.079  13.632  1.00 120.97 ?  439 GLN A CA  1 
ATOM 3034  C C   . GLN A  1 431 ? 153.242 127.650  14.250  1.00 116.69 ?  439 GLN A C   1 
ATOM 3035  O O   . GLN A  1 431 ? 152.567 128.441  14.908  1.00 117.36 ?  439 GLN A O   1 
ATOM 3036  C CB  . GLN A  1 431 ? 155.725 127.329  14.299  1.00 124.48 ?  439 GLN A CB  1 
ATOM 3037  C CG  . GLN A  1 431 ? 155.864 127.598  15.787  1.00 126.76 ?  439 GLN A CG  1 
ATOM 3038  C CD  . GLN A  1 431 ? 157.105 126.963  16.378  1.00 128.60 ?  439 GLN A CD  1 
ATOM 3039  O OE1 . GLN A  1 431 ? 157.910 126.364  15.663  1.00 127.90 ?  439 GLN A OE1 1 
ATOM 3040  N NE2 . GLN A  1 431 ? 157.267 127.088  17.690  1.00 130.47 ?  439 GLN A NE2 1 
ATOM 3041  N N   . ASP A  1 432 ? 152.874 126.385  14.030  1.00 111.67 ?  440 ASP A N   1 
ATOM 3042  C CA  . ASP A  1 432 ? 151.595 125.855  14.467  1.00 98.22  ?  440 ASP A CA  1 
ATOM 3043  C C   . ASP A  1 432 ? 151.755 124.372  14.774  1.00 91.54  ?  440 ASP A C   1 
ATOM 3044  O O   . ASP A  1 432 ? 152.231 123.622  13.906  1.00 86.89  ?  440 ASP A O   1 
ATOM 3045  C CB  . ASP A  1 432 ? 150.517 126.060  13.401  1.00 94.86  ?  440 ASP A CB  1 
ATOM 3046  C CG  . ASP A  1 432 ? 149.251 125.281  13.692  1.00 90.99  ?  440 ASP A CG  1 
ATOM 3047  O OD1 . ASP A  1 432 ? 148.704 125.420  14.805  1.00 89.31  ?  440 ASP A OD1 1 
ATOM 3048  O OD2 . ASP A  1 432 ? 148.802 124.529  12.801  1.00 90.84  -1 440 ASP A OD2 1 
ATOM 3049  N N   . PRO A  1 433 ? 151.376 123.920  15.975  1.00 93.17  ?  441 PRO A N   1 
ATOM 3050  C CA  . PRO A  1 433 ? 151.537 122.499  16.314  1.00 89.94  ?  441 PRO A CA  1 
ATOM 3051  C C   . PRO A  1 433 ? 150.490 121.594  15.692  1.00 82.46  ?  441 PRO A C   1 
ATOM 3052  O O   . PRO A  1 433 ? 150.641 120.366  15.754  1.00 76.82  ?  441 PRO A O   1 
ATOM 3053  C CB  . PRO A  1 433 ? 151.419 122.497  17.843  1.00 79.52  ?  441 PRO A CB  1 
ATOM 3054  C CG  . PRO A  1 433 ? 150.511 123.644  18.129  1.00 79.18  ?  441 PRO A CG  1 
ATOM 3055  C CD  . PRO A  1 433 ? 150.851 124.702  17.108  1.00 82.41  ?  441 PRO A CD  1 
ATOM 3056  N N   . TYR A  1 434 ? 149.436 122.156  15.103  1.00 79.73  ?  442 TYR A N   1 
ATOM 3057  C CA  . TYR A  1 434 ? 148.331 121.372  14.575  1.00 79.97  ?  442 TYR A CA  1 
ATOM 3058  C C   . TYR A  1 434 ? 148.417 121.158  13.070  1.00 86.67  ?  442 TYR A C   1 
ATOM 3059  O O   . TYR A  1 434 ? 147.596 120.418  12.519  1.00 85.57  ?  442 TYR A O   1 
ATOM 3060  C CB  . TYR A  1 434 ? 146.998 122.034  14.943  1.00 70.95  ?  442 TYR A CB  1 
ATOM 3061  C CG  . TYR A  1 434 ? 146.754 122.040  16.434  1.00 71.35  ?  442 TYR A CG  1 
ATOM 3062  C CD1 . TYR A  1 434 ? 147.276 121.036  17.241  1.00 72.34  ?  442 TYR A CD1 1 
ATOM 3063  C CD2 . TYR A  1 434 ? 146.022 123.052  17.038  1.00 73.54  ?  442 TYR A CD2 1 
ATOM 3064  C CE1 . TYR A  1 434 ? 147.066 121.033  18.604  1.00 72.86  ?  442 TYR A CE1 1 
ATOM 3065  C CE2 . TYR A  1 434 ? 145.807 123.057  18.405  1.00 74.15  ?  442 TYR A CE2 1 
ATOM 3066  C CZ  . TYR A  1 434 ? 146.333 122.044  19.182  1.00 74.56  ?  442 TYR A CZ  1 
ATOM 3067  O OH  . TYR A  1 434 ? 146.125 122.041  20.542  1.00 77.99  ?  442 TYR A OH  1 
ATOM 3068  N N   . ASP A  1 435 ? 149.386 121.779  12.396  1.00 90.49  ?  443 ASP A N   1 
ATOM 3069  C CA  . ASP A  1 435 ? 149.576 121.554  10.969  1.00 97.65  ?  443 ASP A CA  1 
ATOM 3070  C C   . ASP A  1 435 ? 150.218 120.204  10.682  1.00 91.43  ?  443 ASP A C   1 
ATOM 3071  O O   . ASP A  1 435 ? 150.286 119.799  9.516   1.00 84.84  ?  443 ASP A O   1 
ATOM 3072  C CB  . ASP A  1 435 ? 150.423 122.674  10.360  1.00 108.28 ?  443 ASP A CB  1 
ATOM 3073  C CG  . ASP A  1 435 ? 150.268 122.767  8.853   1.00 116.26 ?  443 ASP A CG  1 
ATOM 3074  O OD1 . ASP A  1 435 ? 149.194 122.385  8.340   1.00 116.52 ?  443 ASP A OD1 1 
ATOM 3075  O OD2 . ASP A  1 435 ? 151.217 123.224  8.182   1.00 120.36 -1 443 ASP A OD2 1 
ATOM 3076  N N   . LYS A  1 436 ? 150.685 119.505  11.717  1.00 93.69  ?  444 LYS A N   1 
ATOM 3077  C CA  . LYS A  1 436 ? 151.147 118.135  11.553  1.00 92.42  ?  444 LYS A CA  1 
ATOM 3078  C C   . LYS A  1 436 ? 149.990 117.174  11.317  1.00 85.41  ?  444 LYS A C   1 
ATOM 3079  O O   . LYS A  1 436 ? 150.210 116.065  10.819  1.00 84.28  ?  444 LYS A O   1 
ATOM 3080  C CB  . LYS A  1 436 ? 151.928 117.714  12.800  1.00 98.63  ?  444 LYS A CB  1 
ATOM 3081  C CG  . LYS A  1 436 ? 152.816 116.494  12.643  1.00 102.55 ?  444 LYS A CG  1 
ATOM 3082  C CD  . LYS A  1 436 ? 153.763 116.382  13.829  1.00 103.90 ?  444 LYS A CD  1 
ATOM 3083  C CE  . LYS A  1 436 ? 152.998 116.453  15.144  1.00 98.00  ?  444 LYS A CE  1 
ATOM 3084  N NZ  . LYS A  1 436 ? 153.900 116.485  16.327  1.00 97.81  1  444 LYS A NZ  1 
ATOM 3085  N N   . LEU A  1 437 ? 148.772 117.578  11.662  1.00 83.66  ?  445 LEU A N   1 
ATOM 3086  C CA  . LEU A  1 437 ? 147.573 116.775  11.489  1.00 72.49  ?  445 LEU A CA  1 
ATOM 3087  C C   . LEU A  1 437 ? 146.755 117.286  10.308  1.00 70.03  ?  445 LEU A C   1 
ATOM 3088  O O   . LEU A  1 437 ? 146.870 118.443  9.895   1.00 64.16  ?  445 LEU A O   1 
ATOM 3089  C CB  . LEU A  1 437 ? 146.728 116.803  12.763  1.00 70.49  ?  445 LEU A CB  1 
ATOM 3090  C CG  . LEU A  1 437 ? 147.506 116.497  14.043  1.00 69.59  ?  445 LEU A CG  1 
ATOM 3091  C CD1 . LEU A  1 437 ? 146.722 116.949  15.262  1.00 68.18  ?  445 LEU A CD1 1 
ATOM 3092  C CD2 . LEU A  1 437 ? 147.836 115.015  14.128  1.00 69.37  ?  445 LEU A CD2 1 
ATOM 3093  N N   . LYS A  1 438 ? 145.912 116.409  9.772   1.00 69.76  ?  446 LYS A N   1 
ATOM 3094  C CA  . LYS A  1 438 ? 145.086 116.727  8.615   1.00 71.10  ?  446 LYS A CA  1 
ATOM 3095  C C   . LYS A  1 438 ? 143.684 117.090  9.088   1.00 67.80  ?  446 LYS A C   1 
ATOM 3096  O O   . LYS A  1 438 ? 143.030 116.293  9.769   1.00 61.53  ?  446 LYS A O   1 
ATOM 3097  C CB  . LYS A  1 438 ? 145.033 115.567  7.623   1.00 66.31  ?  446 LYS A CB  1 
ATOM 3098  C CG  . LYS A  1 438 ? 144.329 115.944  6.330   1.00 72.35  ?  446 LYS A CG  1 
ATOM 3099  C CD  . LYS A  1 438 ? 145.002 117.162  5.703   1.00 82.49  ?  446 LYS A CD  1 
ATOM 3100  C CE  . LYS A  1 438 ? 144.048 117.951  4.817   1.00 83.54  ?  446 LYS A CE  1 
ATOM 3101  N NZ  . LYS A  1 438 ? 144.559 119.328  4.553   1.00 83.76  1  446 LYS A NZ  1 
ATOM 3102  N N   . PHE A  1 439 ? 143.227 118.285  8.723   1.00 67.85  ?  447 PHE A N   1 
ATOM 3103  C CA  . PHE A  1 439 ? 141.894 118.756  9.069   1.00 63.85  ?  447 PHE A CA  1 
ATOM 3104  C C   . PHE A  1 439 ? 141.181 119.249  7.816   1.00 63.19  ?  447 PHE A C   1 
ATOM 3105  O O   . PHE A  1 439 ? 141.786 119.439  6.758   1.00 66.50  ?  447 PHE A O   1 
ATOM 3106  C CB  . PHE A  1 439 ? 141.942 119.879  10.115  1.00 62.37  ?  447 PHE A CB  1 
ATOM 3107  C CG  . PHE A  1 439 ? 142.627 119.492  11.393  1.00 60.32  ?  447 PHE A CG  1 
ATOM 3108  C CD1 . PHE A  1 439 ? 141.992 118.683  12.316  1.00 59.23  ?  447 PHE A CD1 1 
ATOM 3109  C CD2 . PHE A  1 439 ? 143.900 119.954  11.679  1.00 62.96  ?  447 PHE A CD2 1 
ATOM 3110  C CE1 . PHE A  1 439 ? 142.618 118.329  13.496  1.00 61.09  ?  447 PHE A CE1 1 
ATOM 3111  C CE2 . PHE A  1 439 ? 144.532 119.605  12.859  1.00 60.42  ?  447 PHE A CE2 1 
ATOM 3112  C CZ  . PHE A  1 439 ? 143.890 118.792  13.767  1.00 59.94  ?  447 PHE A CZ  1 
ATOM 3113  N N   . TRP A  1 440 ? 139.871 119.450  7.953   1.00 53.75  ?  448 TRP A N   1 
ATOM 3114  C CA  . TRP A  1 440 ? 139.076 120.086  6.912   1.00 53.81  ?  448 TRP A CA  1 
ATOM 3115  C C   . TRP A  1 440 ? 139.077 121.585  7.181   1.00 57.11  ?  448 TRP A C   1 
ATOM 3116  O O   . TRP A  1 440 ? 138.445 122.028  8.153   1.00 59.71  ?  448 TRP A O   1 
ATOM 3117  C CB  . TRP A  1 440 ? 137.656 119.533  6.908   1.00 49.44  ?  448 TRP A CB  1 
ATOM 3118  C CG  . TRP A  1 440 ? 136.811 119.951  5.733   1.00 49.49  ?  448 TRP A CG  1 
ATOM 3119  C CD1 . TRP A  1 440 ? 136.878 121.128  5.042   1.00 50.52  ?  448 TRP A CD1 1 
ATOM 3120  C CD2 . TRP A  1 440 ? 135.786 119.175  5.098   1.00 48.60  ?  448 TRP A CD2 1 
ATOM 3121  N NE1 . TRP A  1 440 ? 135.949 121.138  4.030   1.00 50.31  ?  448 TRP A NE1 1 
ATOM 3122  C CE2 . TRP A  1 440 ? 135.268 119.950  4.041   1.00 49.14  ?  448 TRP A CE2 1 
ATOM 3123  C CE3 . TRP A  1 440 ? 135.253 117.903  5.325   1.00 47.47  ?  448 TRP A CE3 1 
ATOM 3124  C CZ2 . TRP A  1 440 ? 134.243 119.494  3.214   1.00 48.62  ?  448 TRP A CZ2 1 
ATOM 3125  C CZ3 . TRP A  1 440 ? 134.235 117.452  4.502   1.00 46.94  ?  448 TRP A CZ3 1 
ATOM 3126  C CH2 . TRP A  1 440 ? 133.742 118.246  3.460   1.00 47.53  ?  448 TRP A CH2 1 
ATOM 3127  N N   . PRO A  1 441 ? 139.760 122.395  6.371   1.00 58.95  ?  449 PRO A N   1 
ATOM 3128  C CA  . PRO A  1 441 ? 139.880 123.824  6.687   1.00 59.69  ?  449 PRO A CA  1 
ATOM 3129  C C   . PRO A  1 441 ? 138.573 124.561  6.438   1.00 57.22  ?  449 PRO A C   1 
ATOM 3130  O O   . PRO A  1 441 ? 137.926 124.384  5.404   1.00 53.63  ?  449 PRO A O   1 
ATOM 3131  C CB  . PRO A  1 441 ? 140.987 124.303  5.741   1.00 55.58  ?  449 PRO A CB  1 
ATOM 3132  C CG  . PRO A  1 441 ? 140.896 123.380  4.579   1.00 55.22  ?  449 PRO A CG  1 
ATOM 3133  C CD  . PRO A  1 441 ? 140.473 122.040  5.133   1.00 56.24  ?  449 PRO A CD  1 
ATOM 3134  N N   . VAL A  1 442 ? 138.193 125.394  7.402   1.00 58.13  ?  450 VAL A N   1 
ATOM 3135  C CA  . VAL A  1 442 ? 137.001 126.228  7.319   1.00 58.02  ?  450 VAL A CA  1 
ATOM 3136  C C   . VAL A  1 442 ? 137.436 127.642  7.679   1.00 59.43  ?  450 VAL A C   1 
ATOM 3137  O O   . VAL A  1 442 ? 137.661 127.947  8.854   1.00 59.62  ?  450 VAL A O   1 
ATOM 3138  C CB  . VAL A  1 442 ? 135.885 125.740  8.248   1.00 57.45  ?  450 VAL A CB  1 
ATOM 3139  C CG1 . VAL A  1 442 ? 134.764 126.757  8.306   1.00 57.64  ?  450 VAL A CG1 1 
ATOM 3140  C CG2 . VAL A  1 442 ? 135.361 124.387  7.786   1.00 56.17  ?  450 VAL A CG2 1 
ATOM 3141  N N   . ASP A  1 443 ? 137.553 128.510  6.678   1.00 64.49  ?  451 ASP A N   1 
ATOM 3142  C CA  . ASP A  1 443 ? 137.997 129.883  6.895   1.00 70.35  ?  451 ASP A CA  1 
ATOM 3143  C C   . ASP A  1 443 ? 136.757 130.758  7.047   1.00 68.41  ?  451 ASP A C   1 
ATOM 3144  O O   . ASP A  1 443 ? 136.000 130.946  6.089   1.00 69.88  ?  451 ASP A O   1 
ATOM 3145  C CB  . ASP A  1 443 ? 138.885 130.344  5.741   1.00 73.69  ?  451 ASP A CB  1 
ATOM 3146  C CG  . ASP A  1 443 ? 139.526 131.705  5.988   1.00 85.82  ?  451 ASP A CG  1 
ATOM 3147  O OD1 . ASP A  1 443 ? 138.896 132.584  6.615   1.00 90.25  ?  451 ASP A OD1 1 
ATOM 3148  O OD2 . ASP A  1 443 ? 140.681 131.894  5.549   1.00 90.63  -1 451 ASP A OD2 1 
ATOM 3149  N N   . LEU A  1 444 ? 136.549 131.294  8.250   1.00 63.60  ?  452 LEU A N   1 
ATOM 3150  C CA  . LEU A  1 444 ? 135.409 132.155  8.536   1.00 64.01  ?  452 LEU A CA  1 
ATOM 3151  C C   . LEU A  1 444 ? 135.827 133.584  8.863   1.00 71.61  ?  452 LEU A C   1 
ATOM 3152  O O   . LEU A  1 444 ? 135.029 134.346  9.417   1.00 82.41  ?  452 LEU A O   1 
ATOM 3153  C CB  . LEU A  1 444 ? 134.574 131.575  9.678   1.00 62.86  ?  452 LEU A CB  1 
ATOM 3154  C CG  . LEU A  1 444 ? 133.869 130.244  9.408   1.00 61.21  ?  452 LEU A CG  1 
ATOM 3155  C CD1 . LEU A  1 444 ? 132.842 129.957  10.489  1.00 60.29  ?  452 LEU A CD1 1 
ATOM 3156  C CD2 . LEU A  1 444 ? 133.218 130.241  8.034   1.00 61.09  ?  452 LEU A CD2 1 
ATOM 3157  N N   . LYS A  1 445 ? 137.066 133.960  8.538   1.00 63.76  ?  453 LYS A N   1 
ATOM 3158  C CA  . LYS A  1 445 ? 137.518 135.321  8.807   1.00 65.52  ?  453 LYS A CA  1 
ATOM 3159  C C   . LYS A  1 445 ? 136.708 136.350  8.030   1.00 66.26  ?  453 LYS A C   1 
ATOM 3160  O O   . LYS A  1 445 ? 136.500 137.468  8.512   1.00 67.38  ?  453 LYS A O   1 
ATOM 3161  C CB  . LYS A  1 445 ? 139.002 135.444  8.466   1.00 67.58  ?  453 LYS A CB  1 
ATOM 3162  C CG  . LYS A  1 445 ? 139.890 134.490  9.246   1.00 67.92  ?  453 LYS A CG  1 
ATOM 3163  C CD  . LYS A  1 445 ? 141.353 134.652  8.866   1.00 75.13  ?  453 LYS A CD  1 
ATOM 3164  C CE  . LYS A  1 445 ? 141.571 134.368  7.386   1.00 78.77  ?  453 LYS A CE  1 
ATOM 3165  N NZ  . LYS A  1 445 ? 143.002 134.494  6.991   1.00 84.04  1  453 LYS A NZ  1 
ATOM 3166  N N   . GLU A  1 446 ? 136.237 135.990  6.838   1.00 66.49  ?  454 GLU A N   1 
ATOM 3167  C CA  . GLU A  1 446 ? 135.447 136.878  5.997   1.00 73.21  ?  454 GLU A CA  1 
ATOM 3168  C C   . GLU A  1 446 ? 133.959 136.563  6.056   1.00 65.49  ?  454 GLU A C   1 
ATOM 3169  O O   . GLU A  1 446 ? 133.199 137.049  5.213   1.00 66.23  ?  454 GLU A O   1 
ATOM 3170  C CB  . GLU A  1 446 ? 135.925 136.809  4.543   1.00 78.07  ?  454 GLU A CB  1 
ATOM 3171  C CG  . GLU A  1 446 ? 135.812 135.429  3.893   1.00 84.54  ?  454 GLU A CG  1 
ATOM 3172  C CD  . GLU A  1 446 ? 136.865 134.439  4.364   1.00 87.62  ?  454 GLU A CD  1 
ATOM 3173  O OE1 . GLU A  1 446 ? 137.776 134.842  5.120   1.00 92.66  ?  454 GLU A OE1 1 
ATOM 3174  O OE2 . GLU A  1 446 ? 136.772 133.253  3.982   1.00 83.81  -1 454 GLU A OE2 1 
ATOM 3175  N N   . ARG A  1 447 ? 133.523 135.766  7.032   1.00 69.57  ?  455 ARG A N   1 
ATOM 3176  C CA  . ARG A  1 447 ? 132.156 135.269  7.070   1.00 68.07  ?  455 ARG A CA  1 
ATOM 3177  C C   . ARG A  1 447 ? 131.395 135.700  8.315   1.00 67.46  ?  455 ARG A C   1 
ATOM 3178  O O   . ARG A  1 447 ? 130.244 135.285  8.495   1.00 68.36  ?  455 ARG A O   1 
ATOM 3179  C CB  . ARG A  1 447 ? 132.151 133.736  6.979   1.00 73.14  ?  455 ARG A CB  1 
ATOM 3180  C CG  . ARG A  1 447 ? 132.951 133.173  5.813   1.00 75.02  ?  455 ARG A CG  1 
ATOM 3181  C CD  . ARG A  1 447 ? 132.355 133.578  4.478   1.00 79.09  ?  455 ARG A CD  1 
ATOM 3182  N NE  . ARG A  1 447 ? 131.426 132.571  3.974   1.00 79.03  ?  455 ARG A NE  1 
ATOM 3183  C CZ  . ARG A  1 447 ? 131.789 131.522  3.243   1.00 82.95  ?  455 ARG A CZ  1 
ATOM 3184  N NH1 . ARG A  1 447 ? 133.065 131.338  2.928   1.00 85.36  1  455 ARG A NH1 1 
ATOM 3185  N NH2 . ARG A  1 447 ? 130.875 130.655  2.827   1.00 83.78  ?  455 ARG A NH2 1 
ATOM 3186  N N   . PHE A  1 448 ? 132.000 136.513  9.175   1.00 62.06  ?  456 PHE A N   1 
ATOM 3187  C CA  . PHE A  1 448 ? 131.321 137.028  10.354  1.00 62.31  ?  456 PHE A CA  1 
ATOM 3188  C C   . PHE A  1 448 ? 130.358 138.140  9.960   1.00 63.33  ?  456 PHE A C   1 
ATOM 3189  O O   . PHE A  1 448 ? 130.656 138.956  9.083   1.00 64.50  ?  456 PHE A O   1 
ATOM 3190  C CB  . PHE A  1 448 ? 132.342 137.545  11.366  1.00 69.79  ?  456 PHE A CB  1 
ATOM 3191  C CG  . PHE A  1 448 ? 132.806 136.506  12.344  1.00 66.92  ?  456 PHE A CG  1 
ATOM 3192  C CD1 . PHE A  1 448 ? 133.283 135.283  11.902  1.00 64.36  ?  456 PHE A CD1 1 
ATOM 3193  C CD2 . PHE A  1 448 ? 132.796 136.763  13.705  1.00 67.53  ?  456 PHE A CD2 1 
ATOM 3194  C CE1 . PHE A  1 448 ? 133.717 134.326  12.800  1.00 61.94  ?  456 PHE A CE1 1 
ATOM 3195  C CE2 . PHE A  1 448 ? 133.234 135.810  14.607  1.00 66.26  ?  456 PHE A CE2 1 
ATOM 3196  C CZ  . PHE A  1 448 ? 133.698 134.592  14.152  1.00 62.48  ?  456 PHE A CZ  1 
ATOM 3197  N N   . SER A  1 449 ? 129.195 138.166  10.608  1.00 61.19  ?  457 SER A N   1 
ATOM 3198  C CA  . SER A  1 449 ? 128.200 139.195  10.342  1.00 62.22  ?  457 SER A CA  1 
ATOM 3199  C C   . SER A  1 449 ? 127.429 139.479  11.620  1.00 62.39  ?  457 SER A C   1 
ATOM 3200  O O   . SER A  1 449 ? 127.044 138.554  12.339  1.00 61.13  ?  457 SER A O   1 
ATOM 3201  C CB  . SER A  1 449 ? 127.238 138.780  9.224   1.00 59.61  ?  457 SER A CB  1 
ATOM 3202  O OG  . SER A  1 449 ? 126.219 139.750  9.049   1.00 60.66  ?  457 SER A OG  1 
ATOM 3203  N N   . ALA A  1 450 ? 127.207 140.765  11.892  1.00 64.64  ?  458 ALA A N   1 
ATOM 3204  C CA  . ALA A  1 450 ? 126.483 141.194  13.081  1.00 67.09  ?  458 ALA A CA  1 
ATOM 3205  C C   . ALA A  1 450 ? 124.974 141.259  12.884  1.00 68.53  ?  458 ALA A C   1 
ATOM 3206  O O   . ALA A  1 450 ? 124.245 141.386  13.873  1.00 66.53  ?  458 ALA A O   1 
ATOM 3207  C CB  . ALA A  1 450 ? 126.994 142.563  13.541  1.00 68.55  ?  458 ALA A CB  1 
ATOM 3208  N N   . ASP A  1 451 ? 124.489 141.186  11.643  1.00 70.79  ?  459 ASP A N   1 
ATOM 3209  C CA  . ASP A  1 451 ? 123.051 141.185  11.367  1.00 72.06  ?  459 ASP A CA  1 
ATOM 3210  C C   . ASP A  1 451 ? 122.531 139.761  11.553  1.00 68.63  ?  459 ASP A C   1 
ATOM 3211  O O   . ASP A  1 451 ? 122.378 138.985  10.607  1.00 67.36  ?  459 ASP A O   1 
ATOM 3212  C CB  . ASP A  1 451 ? 122.766 141.711  9.965   1.00 67.02  ?  459 ASP A CB  1 
ATOM 3213  C CG  . ASP A  1 451 ? 123.376 143.078  9.718   1.00 74.46  ?  459 ASP A CG  1 
ATOM 3214  O OD1 . ASP A  1 451 ? 123.238 143.961  10.589  1.00 81.05  ?  459 ASP A OD1 1 
ATOM 3215  O OD2 . ASP A  1 451 ? 123.992 143.270  8.649   1.00 75.66  -1 459 ASP A OD2 1 
ATOM 3216  N N   . LEU A  1 452 ? 122.250 139.420  12.814  1.00 69.44  ?  460 LEU A N   1 
ATOM 3217  C CA  . LEU A  1 452 ? 121.868 138.050  13.143  1.00 65.51  ?  460 LEU A CA  1 
ATOM 3218  C C   . LEU A  1 452 ? 120.534 137.660  12.521  1.00 65.13  ?  460 LEU A C   1 
ATOM 3219  O O   . LEU A  1 452 ? 120.352 136.501  12.133  1.00 62.34  ?  460 LEU A O   1 
ATOM 3220  C CB  . LEU A  1 452 ? 121.813 137.870  14.660  1.00 67.37  ?  460 LEU A CB  1 
ATOM 3221  C CG  . LEU A  1 452 ? 123.107 138.154  15.426  1.00 66.80  ?  460 LEU A CG  1 
ATOM 3222  C CD1 . LEU A  1 452 ? 122.993 137.683  16.867  1.00 65.26  ?  460 LEU A CD1 1 
ATOM 3223  C CD2 . LEU A  1 452 ? 124.298 137.510  14.740  1.00 65.09  ?  460 LEU A CD2 1 
ATOM 3224  N N   . ASP A  1 453 ? 119.598 138.602  12.405  1.00 68.07  ?  461 ASP A N   1 
ATOM 3225  C CA  . ASP A  1 453 ? 118.277 138.298  11.865  1.00 71.84  ?  461 ASP A CA  1 
ATOM 3226  C C   . ASP A  1 453 ? 118.296 137.946  10.382  1.00 68.69  ?  461 ASP A C   1 
ATOM 3227  O O   . ASP A  1 453 ? 117.242 137.601  9.835   1.00 69.82  ?  461 ASP A O   1 
ATOM 3228  C CB  . ASP A  1 453 ? 117.332 139.479  12.106  1.00 75.35  ?  461 ASP A CB  1 
ATOM 3229  C CG  . ASP A  1 453 ? 117.805 140.755  11.432  1.00 84.48  ?  461 ASP A CG  1 
ATOM 3230  O OD1 . ASP A  1 453 ? 119.032 140.924  11.264  1.00 88.93  ?  461 ASP A OD1 1 
ATOM 3231  O OD2 . ASP A  1 453 ? 116.949 141.592  11.073  1.00 87.52  -1 461 ASP A OD2 1 
ATOM 3232  N N   . GLN A  1 454 ? 119.447 138.023  9.721   1.00 67.65  ?  462 GLN A N   1 
ATOM 3233  C CA  . GLN A  1 454 ? 119.565 137.688  8.309   1.00 67.52  ?  462 GLN A CA  1 
ATOM 3234  C C   . GLN A  1 454 ? 119.896 136.220  8.066   1.00 64.06  ?  462 GLN A C   1 
ATOM 3235  O O   . GLN A  1 454 ? 119.983 135.805  6.906   1.00 65.55  ?  462 GLN A O   1 
ATOM 3236  C CB  . GLN A  1 454 ? 120.636 138.568  7.660   1.00 64.04  ?  462 GLN A CB  1 
ATOM 3237  C CG  . GLN A  1 454 ? 120.390 140.054  7.840   1.00 65.94  ?  462 GLN A CG  1 
ATOM 3238  C CD  . GLN A  1 454 ? 119.306 140.580  6.929   1.00 69.21  ?  462 GLN A CD  1 
ATOM 3239  O OE1 . GLN A  1 454 ? 119.490 140.666  5.716   1.00 70.58  ?  462 GLN A OE1 1 
ATOM 3240  N NE2 . GLN A  1 454 ? 118.164 140.934  7.510   1.00 72.19  ?  462 GLN A NE2 1 
ATOM 3241  N N   . PHE A  1 455 ? 120.078 135.430  9.119   1.00 67.15  ?  463 PHE A N   1 
ATOM 3242  C CA  . PHE A  1 455 ? 120.499 134.044  9.003   1.00 65.56  ?  463 PHE A CA  1 
ATOM 3243  C C   . PHE A  1 455 ? 119.619 133.152  9.865   1.00 64.52  ?  463 PHE A C   1 
ATOM 3244  O O   . PHE A  1 455 ? 119.113 133.591  10.903  1.00 64.97  ?  463 PHE A O   1 
ATOM 3245  C CB  . PHE A  1 455 ? 121.969 133.883  9.418   1.00 63.42  ?  463 PHE A CB  1 
ATOM 3246  C CG  . PHE A  1 455 ? 122.893 134.861  8.753   1.00 65.65  ?  463 PHE A CG  1 
ATOM 3247  C CD1 . PHE A  1 455 ? 123.351 135.975  9.435   1.00 67.36  ?  463 PHE A CD1 1 
ATOM 3248  C CD2 . PHE A  1 455 ? 123.294 134.674  7.441   1.00 68.56  ?  463 PHE A CD2 1 
ATOM 3249  C CE1 . PHE A  1 455 ? 124.199 136.878  8.824   1.00 69.45  ?  463 PHE A CE1 1 
ATOM 3250  C CE2 . PHE A  1 455 ? 124.141 135.574  6.825   1.00 71.30  ?  463 PHE A CE2 1 
ATOM 3251  C CZ  . PHE A  1 455 ? 124.594 136.677  7.518   1.00 71.42  ?  463 PHE A CZ  1 
ATOM 3252  N N   . PRO A  1 456 ? 119.416 131.886  9.456   1.00 70.90  ?  464 PRO A N   1 
ATOM 3253  C CA  . PRO A  1 456 ? 118.545 130.986  10.228  1.00 68.62  ?  464 PRO A CA  1 
ATOM 3254  C C   . PRO A  1 456 ? 118.996 130.785  11.667  1.00 66.23  ?  464 PRO A C   1 
ATOM 3255  O O   . PRO A  1 456 ? 118.216 131.010  12.600  1.00 66.35  ?  464 PRO A O   1 
ATOM 3256  C CB  . PRO A  1 456 ? 118.607 129.672  9.436   1.00 65.91  ?  464 PRO A CB  1 
ATOM 3257  C CG  . PRO A  1 456 ? 119.843 129.775  8.597   1.00 65.75  ?  464 PRO A CG  1 
ATOM 3258  C CD  . PRO A  1 456 ? 119.981 131.224  8.268   1.00 69.51  ?  464 PRO A CD  1 
ATOM 3259  N N   . LEU A  1 457 ? 120.248 130.360  11.861  1.00 66.45  ?  465 LEU A N   1 
ATOM 3260  C CA  . LEU A  1 457 ? 120.765 130.211  13.218  1.00 66.21  ?  465 LEU A CA  1 
ATOM 3261  C C   . LEU A  1 457 ? 120.738 131.532  13.972  1.00 68.26  ?  465 LEU A C   1 
ATOM 3262  O O   . LEU A  1 457 ? 120.542 131.548  15.192  1.00 68.11  ?  465 LEU A O   1 
ATOM 3263  C CB  . LEU A  1 457 ? 122.188 129.654  13.190  1.00 62.93  ?  465 LEU A CB  1 
ATOM 3264  C CG  . LEU A  1 457 ? 122.771 129.344  14.571  1.00 59.10  ?  465 LEU A CG  1 
ATOM 3265  C CD1 . LEU A  1 457 ? 122.005 128.208  15.228  1.00 57.50  ?  465 LEU A CD1 1 
ATOM 3266  C CD2 . LEU A  1 457 ? 124.247 129.019  14.487  1.00 58.45  ?  465 LEU A CD2 1 
ATOM 3267  N N   . GLY A  1 458 ? 120.924 132.647  13.264  1.00 65.16  ?  466 GLY A N   1 
ATOM 3268  C CA  . GLY A  1 458 ? 120.840 133.945  13.911  1.00 70.53  ?  466 GLY A CA  1 
ATOM 3269  C C   . GLY A  1 458 ? 119.448 134.255  14.425  1.00 68.96  ?  466 GLY A C   1 
ATOM 3270  O O   . GLY A  1 458 ? 119.291 134.798  15.520  1.00 65.16  ?  466 GLY A O   1 
ATOM 3271  N N   . ARG A  1 459 ? 118.421 133.930  13.638  1.00 63.36  ?  467 ARG A N   1 
ATOM 3272  C CA  . ARG A  1 459 ? 117.044 134.141  14.076  1.00 64.00  ?  467 ARG A CA  1 
ATOM 3273  C C   . ARG A  1 459 ? 116.693 133.224  15.243  1.00 64.97  ?  467 ARG A C   1 
ATOM 3274  O O   . ARG A  1 459 ? 116.155 133.673  16.268  1.00 69.58  ?  467 ARG A O   1 
ATOM 3275  C CB  . ARG A  1 459 ? 116.094 133.914  12.900  1.00 61.57  ?  467 ARG A CB  1 
ATOM 3276  C CG  . ARG A  1 459 ? 116.321 134.868  11.740  1.00 64.23  ?  467 ARG A CG  1 
ATOM 3277  C CD  . ARG A  1 459 ? 115.295 134.666  10.642  1.00 65.78  ?  467 ARG A CD  1 
ATOM 3278  N NE  . ARG A  1 459 ? 115.571 133.479  9.837   1.00 63.10  ?  467 ARG A NE  1 
ATOM 3279  C CZ  . ARG A  1 459 ? 116.408 133.455  8.803   1.00 62.64  ?  467 ARG A CZ  1 
ATOM 3280  N NH1 . ARG A  1 459 ? 116.597 132.331  8.124   1.00 60.25  1  467 ARG A NH1 1 
ATOM 3281  N NH2 . ARG A  1 459 ? 117.058 134.555  8.447   1.00 64.92  ?  467 ARG A NH2 1 
ATOM 3282  N N   . LYS A  1 460 ? 117.007 131.930  15.106  1.00 70.95  ?  468 LYS A N   1 
ATOM 3283  C CA  . LYS A  1 460 ? 116.778 130.989  16.196  1.00 69.20  ?  468 LYS A CA  1 
ATOM 3284  C C   . LYS A  1 460 ? 117.492 131.436  17.463  1.00 69.91  ?  468 LYS A C   1 
ATOM 3285  O O   . LYS A  1 460 ? 117.006 131.189  18.573  1.00 69.45  ?  468 LYS A O   1 
ATOM 3286  C CB  . LYS A  1 460 ? 117.247 129.591  15.793  1.00 71.42  ?  468 LYS A CB  1 
ATOM 3287  C CG  . LYS A  1 460 ? 116.575 129.025  14.552  1.00 72.61  ?  468 LYS A CG  1 
ATOM 3288  C CD  . LYS A  1 460 ? 116.932 127.557  14.367  1.00 71.93  ?  468 LYS A CD  1 
ATOM 3289  C CE  . LYS A  1 460 ? 116.564 127.057  12.979  1.00 70.09  ?  468 LYS A CE  1 
ATOM 3290  N NZ  . LYS A  1 460 ? 117.611 126.150  12.425  1.00 63.36  1  468 LYS A NZ  1 
ATOM 3291  N N   . PHE A  1 461 ? 118.644 132.092  17.314  1.00 68.18  ?  469 PHE A N   1 
ATOM 3292  C CA  . PHE A  1 461 ? 119.341 132.659  18.459  1.00 66.24  ?  469 PHE A CA  1 
ATOM 3293  C C   . PHE A  1 461 ? 118.669 133.929  18.959  1.00 70.20  ?  469 PHE A C   1 
ATOM 3294  O O   . PHE A  1 461 ? 118.760 134.245  20.149  1.00 71.55  ?  469 PHE A O   1 
ATOM 3295  C CB  . PHE A  1 461 ? 120.798 132.943  18.098  1.00 63.29  ?  469 PHE A CB  1 
ATOM 3296  C CG  . PHE A  1 461 ? 121.571 133.612  19.191  1.00 63.74  ?  469 PHE A CG  1 
ATOM 3297  C CD1 . PHE A  1 461 ? 121.907 132.920  20.341  1.00 61.90  ?  469 PHE A CD1 1 
ATOM 3298  C CD2 . PHE A  1 461 ? 121.963 134.933  19.069  1.00 66.55  ?  469 PHE A CD2 1 
ATOM 3299  C CE1 . PHE A  1 461 ? 122.620 133.534  21.352  1.00 63.29  ?  469 PHE A CE1 1 
ATOM 3300  C CE2 . PHE A  1 461 ? 122.677 135.554  20.076  1.00 69.47  ?  469 PHE A CE2 1 
ATOM 3301  C CZ  . PHE A  1 461 ? 123.007 134.853  21.219  1.00 67.94  ?  469 PHE A CZ  1 
ATOM 3302  N N   . LEU A  1 462 ? 118.003 134.674  18.073  1.00 69.07  ?  470 LEU A N   1 
ATOM 3303  C CA  . LEU A  1 462 ? 117.248 135.836  18.519  1.00 72.11  ?  470 LEU A CA  1 
ATOM 3304  C C   . LEU A  1 462 ? 116.024 135.439  19.325  1.00 72.38  ?  470 LEU A C   1 
ATOM 3305  O O   . LEU A  1 462 ? 115.520 136.256  20.103  1.00 76.33  ?  470 LEU A O   1 
ATOM 3306  C CB  . LEU A  1 462 ? 116.829 136.699  17.329  1.00 68.37  ?  470 LEU A CB  1 
ATOM 3307  C CG  . LEU A  1 462 ? 117.949 137.469  16.630  1.00 68.35  ?  470 LEU A CG  1 
ATOM 3308  C CD1 . LEU A  1 462 ? 117.374 138.435  15.608  1.00 73.67  ?  470 LEU A CD1 1 
ATOM 3309  C CD2 . LEU A  1 462 ? 118.807 138.202  17.649  1.00 66.03  ?  470 LEU A CD2 1 
ATOM 3310  N N   . LEU A  1 463 ? 115.537 134.208  19.166  1.00 70.03  ?  471 LEU A N   1 
ATOM 3311  C CA  . LEU A  1 463 ? 114.527 133.712  20.095  1.00 71.24  ?  471 LEU A CA  1 
ATOM 3312  C C   . LEU A  1 463 ? 115.167 133.208  21.387  1.00 74.20  ?  471 LEU A C   1 
ATOM 3313  O O   . LEU A  1 463 ? 114.882 132.091  21.830  1.00 74.19  ?  471 LEU A O   1 
ATOM 3314  C CB  . LEU A  1 463 ? 113.693 132.603  19.449  1.00 71.74  ?  471 LEU A CB  1 
ATOM 3315  C CG  . LEU A  1 463 ? 112.352 133.027  18.845  1.00 73.07  ?  471 LEU A CG  1 
ATOM 3316  C CD1 . LEU A  1 463 ? 112.556 133.869  17.591  1.00 75.10  ?  471 LEU A CD1 1 
ATOM 3317  C CD2 . LEU A  1 463 ? 111.474 131.813  18.553  1.00 71.08  ?  471 LEU A CD2 1 
ATOM 3318  N N   . GLN A  1 464 ? 116.040 134.020  21.993  1.00 80.21  ?  472 GLN A N   1 
ATOM 3319  C CA  . GLN A  1 464 ? 116.670 133.669  23.262  1.00 81.22  ?  472 GLN A CA  1 
ATOM 3320  C C   . GLN A  1 464 ? 116.734 134.811  24.265  1.00 83.53  ?  472 GLN A C   1 
ATOM 3321  O O   . GLN A  1 464 ? 117.060 134.550  25.428  1.00 80.12  ?  472 GLN A O   1 
ATOM 3322  C CB  . GLN A  1 464 ? 118.092 133.137  23.031  1.00 82.43  ?  472 GLN A CB  1 
ATOM 3323  C CG  . GLN A  1 464 ? 118.158 131.858  22.215  1.00 75.88  ?  472 GLN A CG  1 
ATOM 3324  C CD  . GLN A  1 464 ? 117.655 130.654  22.987  1.00 72.88  ?  472 GLN A CD  1 
ATOM 3325  O OE1 . GLN A  1 464 ? 118.395 130.062  23.775  1.00 73.81  ?  472 GLN A OE1 1 
ATOM 3326  N NE2 . GLN A  1 464 ? 116.396 130.290  22.775  1.00 69.07  ?  472 GLN A NE2 1 
ATOM 3327  N N   . LEU A  1 465 ? 116.495 136.056  23.854  1.00 86.30  ?  473 LEU A N   1 
ATOM 3328  C CA  . LEU A  1 465 ? 116.383 137.209  24.750  1.00 90.11  ?  473 LEU A CA  1 
ATOM 3329  C C   . LEU A  1 465 ? 115.742 136.879  26.098  1.00 90.85  ?  473 LEU A C   1 
ATOM 3330  O O   . LEU A  1 465 ? 116.436 136.636  27.083  1.00 88.84  ?  473 LEU A O   1 
ATOM 3331  C CB  . LEU A  1 465 ? 115.590 138.328  24.072  1.00 86.37  ?  473 LEU A CB  1 
ATOM 3332  C CG  . LEU A  1 465 ? 115.314 139.585  24.901  1.00 88.76  ?  473 LEU A CG  1 
ATOM 3333  C CD1 . LEU A  1 465 ? 116.607 140.316  25.211  1.00 87.57  ?  473 LEU A CD1 1 
ATOM 3334  C CD2 . LEU A  1 465 ? 114.321 140.506  24.200  1.00 90.83  ?  473 LEU A CD2 1 
ATOM 3335  N N   . LYS B  1 12  ? 115.860 97.710   68.437  1.00 78.64  ?  20  LYS B N   1 
ATOM 3336  C CA  . LYS B  1 12  ? 115.269 98.463   67.337  1.00 79.33  ?  20  LYS B CA  1 
ATOM 3337  C C   . LYS B  1 12  ? 116.321 99.321   66.641  1.00 81.23  ?  20  LYS B C   1 
ATOM 3338  O O   . LYS B  1 12  ? 117.010 100.116  67.283  1.00 82.89  ?  20  LYS B O   1 
ATOM 3339  C CB  . LYS B  1 12  ? 114.121 99.338   67.844  1.00 75.20  ?  20  LYS B CB  1 
ATOM 3340  C CG  . LYS B  1 12  ? 113.461 100.189  66.771  1.00 78.36  ?  20  LYS B CG  1 
ATOM 3341  C CD  . LYS B  1 12  ? 112.232 100.899  67.318  1.00 84.56  ?  20  LYS B CD  1 
ATOM 3342  C CE  . LYS B  1 12  ? 111.585 101.783  66.266  1.00 84.73  ?  20  LYS B CE  1 
ATOM 3343  N NZ  . LYS B  1 12  ? 110.377 102.475  66.793  1.00 87.26  1  20  LYS B NZ  1 
ATOM 3344  N N   . VAL B  1 13  ? 116.434 99.162   65.324  1.00 84.99  ?  21  VAL B N   1 
ATOM 3345  C CA  . VAL B  1 13  ? 117.432 99.891   64.548  1.00 79.34  ?  21  VAL B CA  1 
ATOM 3346  C C   . VAL B  1 13  ? 116.906 101.283  64.229  1.00 76.67  ?  21  VAL B C   1 
ATOM 3347  O O   . VAL B  1 13  ? 115.711 101.474  63.969  1.00 72.92  ?  21  VAL B O   1 
ATOM 3348  C CB  . VAL B  1 13  ? 117.799 99.107   63.272  1.00 78.30  ?  21  VAL B CB  1 
ATOM 3349  C CG1 . VAL B  1 13  ? 116.566 98.841   62.420  1.00 77.69  ?  21  VAL B CG1 1 
ATOM 3350  C CG2 . VAL B  1 13  ? 118.862 99.839   62.472  1.00 73.42  ?  21  VAL B CG2 1 
ATOM 3351  N N   . VAL B  1 14  ? 117.802 102.267  64.255  1.00 73.59  ?  22  VAL B N   1 
ATOM 3352  C CA  . VAL B  1 14  ? 117.452 103.675  64.125  1.00 74.54  ?  22  VAL B CA  1 
ATOM 3353  C C   . VAL B  1 14  ? 118.130 104.235  62.884  1.00 74.02  ?  22  VAL B C   1 
ATOM 3354  O O   . VAL B  1 14  ? 119.257 103.849  62.556  1.00 75.24  ?  22  VAL B O   1 
ATOM 3355  C CB  . VAL B  1 14  ? 117.867 104.474  65.380  1.00 72.97  ?  22  VAL B CB  1 
ATOM 3356  C CG1 . VAL B  1 14  ? 117.427 105.930  65.271  1.00 75.29  ?  22  VAL B CG1 1 
ATOM 3357  C CG2 . VAL B  1 14  ? 117.305 103.825  66.636  1.00 74.55  ?  22  VAL B CG2 1 
ATOM 3358  N N   . SER B  1 15  ? 117.434 105.131  62.186  1.00 67.60  ?  23  SER B N   1 
ATOM 3359  C CA  . SER B  1 15  ? 118.023 105.791  61.030  1.00 67.23  ?  23  SER B CA  1 
ATOM 3360  C C   . SER B  1 15  ? 119.268 106.564  61.443  1.00 68.40  ?  23  SER B C   1 
ATOM 3361  O O   . SER B  1 15  ? 119.329 107.143  62.531  1.00 71.29  ?  23  SER B O   1 
ATOM 3362  C CB  . SER B  1 15  ? 117.013 106.735  60.381  1.00 68.55  ?  23  SER B CB  1 
ATOM 3363  O OG  . SER B  1 15  ? 117.652 107.599  59.459  1.00 69.06  ?  23  SER B OG  1 
ATOM 3364  N N   . THR B  1 16  ? 120.269 106.570  60.562  1.00 66.80  ?  24  THR B N   1 
ATOM 3365  C CA  . THR B  1 16  ? 121.520 107.261  60.848  1.00 69.72  ?  24  THR B CA  1 
ATOM 3366  C C   . THR B  1 16  ? 121.385 108.776  60.804  1.00 73.44  ?  24  THR B C   1 
ATOM 3367  O O   . THR B  1 16  ? 122.286 109.474  61.280  1.00 74.85  ?  24  THR B O   1 
ATOM 3368  C CB  . THR B  1 16  ? 122.602 106.817  59.867  1.00 69.83  ?  24  THR B CB  1 
ATOM 3369  O OG1 . THR B  1 16  ? 122.204 107.148  58.531  1.00 69.34  ?  24  THR B OG1 1 
ATOM 3370  C CG2 . THR B  1 16  ? 122.824 105.316  59.971  1.00 68.91  ?  24  THR B CG2 1 
ATOM 3371  N N   . ASP B  1 17  ? 120.292 109.301  60.249  1.00 67.75  ?  25  ASP B N   1 
ATOM 3372  C CA  . ASP B  1 17  ? 120.077 110.742  60.222  1.00 69.56  ?  25  ASP B CA  1 
ATOM 3373  C C   . ASP B  1 17  ? 119.696 111.314  61.580  1.00 71.51  ?  25  ASP B C   1 
ATOM 3374  O O   . ASP B  1 17  ? 119.537 112.534  61.689  1.00 73.26  ?  25  ASP B O   1 
ATOM 3375  C CB  . ASP B  1 17  ? 118.995 111.085  59.198  1.00 76.00  ?  25  ASP B CB  1 
ATOM 3376  C CG  . ASP B  1 17  ? 119.303 110.536  57.821  1.00 79.91  ?  25  ASP B CG  1 
ATOM 3377  O OD1 . ASP B  1 17  ? 120.495 110.301  57.527  1.00 82.43  ?  25  ASP B OD1 1 
ATOM 3378  O OD2 . ASP B  1 17  ? 118.353 110.338  57.034  1.00 79.32  -1 25  ASP B OD2 1 
ATOM 3379  N N   . GLU B  1 18  ? 119.548 110.479  62.609  1.00 65.89  ?  26  GLU B N   1 
ATOM 3380  C CA  . GLU B  1 18  ? 119.179 110.954  63.935  1.00 68.57  ?  26  GLU B CA  1 
ATOM 3381  C C   . GLU B  1 18  ? 120.352 111.041  64.901  1.00 71.33  ?  26  GLU B C   1 
ATOM 3382  O O   . GLU B  1 18  ? 120.229 111.706  65.936  1.00 75.16  ?  26  GLU B O   1 
ATOM 3383  C CB  . GLU B  1 18  ? 118.096 110.054  64.543  1.00 75.07  ?  26  GLU B CB  1 
ATOM 3384  C CG  . GLU B  1 18  ? 116.825 109.975  63.716  1.00 77.89  ?  26  GLU B CG  1 
ATOM 3385  C CD  . GLU B  1 18  ? 115.683 109.322  64.469  1.00 86.10  ?  26  GLU B CD  1 
ATOM 3386  O OE1 . GLU B  1 18  ? 115.574 109.546  65.693  1.00 91.02  ?  26  GLU B OE1 1 
ATOM 3387  O OE2 . GLU B  1 18  ? 114.895 108.584  63.841  1.00 88.89  -1 26  GLU B OE2 1 
ATOM 3388  N N   . TYR B  1 19  ? 121.478 110.387  64.601  1.00 67.42  ?  27  TYR B N   1 
ATOM 3389  C CA  . TYR B  1 19  ? 122.645 110.442  65.474  1.00 70.62  ?  27  TYR B CA  1 
ATOM 3390  C C   . TYR B  1 19  ? 123.936 110.720  64.711  1.00 70.71  ?  27  TYR B C   1 
ATOM 3391  O O   . TYR B  1 19  ? 125.021 110.572  65.284  1.00 73.22  ?  27  TYR B O   1 
ATOM 3392  C CB  . TYR B  1 19  ? 122.784 109.141  66.278  1.00 74.03  ?  27  TYR B CB  1 
ATOM 3393  C CG  . TYR B  1 19  ? 123.041 107.908  65.440  1.00 74.76  ?  27  TYR B CG  1 
ATOM 3394  C CD1 . TYR B  1 19  ? 121.991 107.188  64.883  1.00 71.67  ?  27  TYR B CD1 1 
ATOM 3395  C CD2 . TYR B  1 19  ? 124.336 107.451  65.222  1.00 79.00  ?  27  TYR B CD2 1 
ATOM 3396  C CE1 . TYR B  1 19  ? 122.225 106.058  64.120  1.00 69.72  ?  27  TYR B CE1 1 
ATOM 3397  C CE2 . TYR B  1 19  ? 124.579 106.324  64.461  1.00 76.43  ?  27  TYR B CE2 1 
ATOM 3398  C CZ  . TYR B  1 19  ? 123.521 105.631  63.913  1.00 73.23  ?  27  TYR B CZ  1 
ATOM 3399  O OH  . TYR B  1 19  ? 123.762 104.506  63.155  1.00 72.60  ?  27  TYR B OH  1 
ATOM 3400  N N   . VAL B  1 20  ? 123.852 111.124  63.445  1.00 69.07  ?  28  VAL B N   1 
ATOM 3401  C CA  . VAL B  1 20  ? 125.020 111.469  62.636  1.00 69.25  ?  28  VAL B CA  1 
ATOM 3402  C C   . VAL B  1 20  ? 124.713 112.801  61.961  1.00 70.51  ?  28  VAL B C   1 
ATOM 3403  O O   . VAL B  1 20  ? 124.026 112.841  60.934  1.00 67.72  ?  28  VAL B O   1 
ATOM 3404  C CB  . VAL B  1 20  ? 125.365 110.392  61.602  1.00 61.67  ?  28  VAL B CB  1 
ATOM 3405  C CG1 . VAL B  1 20  ? 126.613 110.787  60.833  1.00 61.86  ?  28  VAL B CG1 1 
ATOM 3406  C CG2 . VAL B  1 20  ? 125.561 109.044  62.276  1.00 61.25  ?  28  VAL B CG2 1 
ATOM 3407  N N   . THR B  1 21  ? 125.214 113.891  62.536  1.00 66.05  ?  29  THR B N   1 
ATOM 3408  C CA  . THR B  1 21  ? 125.011 115.217  61.969  1.00 67.94  ?  29  THR B CA  1 
ATOM 3409  C C   . THR B  1 21  ? 125.980 115.465  60.819  1.00 67.20  ?  29  THR B C   1 
ATOM 3410  O O   . THR B  1 21  ? 127.147 115.066  60.873  1.00 67.72  ?  29  THR B O   1 
ATOM 3411  C CB  . THR B  1 21  ? 125.191 116.292  63.042  1.00 65.53  ?  29  THR B CB  1 
ATOM 3412  O OG1 . THR B  1 21  ? 126.466 116.128  63.677  1.00 65.27  ?  29  THR B OG1 1 
ATOM 3413  C CG2 . THR B  1 21  ? 124.091 116.187  64.092  1.00 69.78  ?  29  THR B CG2 1 
ATOM 3414  N N   . ARG B  1 22  ? 125.487 116.126  59.776  1.00 59.00  ?  30  ARG B N   1 
ATOM 3415  C CA  . ARG B  1 22  ? 126.258 116.361  58.565  1.00 58.67  ?  30  ARG B CA  1 
ATOM 3416  C C   . ARG B  1 22  ? 126.796 117.786  58.542  1.00 59.90  ?  30  ARG B C   1 
ATOM 3417  O O   . ARG B  1 22  ? 126.233 118.695  59.156  1.00 60.85  ?  30  ARG B O   1 
ATOM 3418  C CB  . ARG B  1 22  ? 125.406 116.110  57.320  1.00 75.80  ?  30  ARG B CB  1 
ATOM 3419  C CG  . ARG B  1 22  ? 124.964 114.669  57.156  1.00 70.44  ?  30  ARG B CG  1 
ATOM 3420  C CD  . ARG B  1 22  ? 124.069 114.499  55.942  1.00 64.53  ?  30  ARG B CD  1 
ATOM 3421  N NE  . ARG B  1 22  ? 123.598 113.125  55.819  1.00 60.74  ?  30  ARG B NE  1 
ATOM 3422  C CZ  . ARG B  1 22  ? 124.211 112.190  55.102  1.00 59.08  ?  30  ARG B CZ  1 
ATOM 3423  N NH1 . ARG B  1 22  ? 125.321 112.484  54.440  1.00 55.60  1  30  ARG B NH1 1 
ATOM 3424  N NH2 . ARG B  1 22  ? 123.715 110.961  55.047  1.00 59.22  ?  30  ARG B NH2 1 
ATOM 3425  N N   . THR B  1 23  ? 127.891 117.972  57.813  1.00 61.00  ?  31  THR B N   1 
ATOM 3426  C CA  . THR B  1 23  ? 128.559 119.258  57.687  1.00 63.43  ?  31  THR B CA  1 
ATOM 3427  C C   . THR B  1 23  ? 128.570 119.703  56.230  1.00 62.86  ?  31  THR B C   1 
ATOM 3428  O O   . THR B  1 23  ? 128.159 118.972  55.326  1.00 60.60  ?  31  THR B O   1 
ATOM 3429  C CB  . THR B  1 23  ? 129.994 119.188  58.222  1.00 61.88  ?  31  THR B CB  1 
ATOM 3430  O OG1 . THR B  1 23  ? 130.812 118.456  57.301  1.00 60.84  ?  31  THR B OG1 1 
ATOM 3431  C CG2 . THR B  1 23  ? 130.024 118.497  59.576  1.00 62.22  ?  31  THR B CG2 1 
ATOM 3432  N N   . SER B  1 24  ? 129.057 120.922  56.012  1.00 63.54  ?  32  SER B N   1 
ATOM 3433  C CA  . SER B  1 24  ? 129.222 121.474  54.675  1.00 69.48  ?  32  SER B CA  1 
ATOM 3434  C C   . SER B  1 24  ? 130.585 121.153  54.074  1.00 71.60  ?  32  SER B C   1 
ATOM 3435  O O   . SER B  1 24  ? 130.912 121.662  52.996  1.00 73.01  ?  32  SER B O   1 
ATOM 3436  C CB  . SER B  1 24  ? 129.008 122.990  54.699  1.00 72.81  ?  32  SER B CB  1 
ATOM 3437  O OG  . SER B  1 24  ? 129.907 123.618  55.598  1.00 79.90  ?  32  SER B OG  1 
ATOM 3438  N N   . ILE B  1 25  ? 131.384 120.328  54.744  1.00 73.61  ?  33  ILE B N   1 
ATOM 3439  C CA  . ILE B  1 25  ? 132.685 119.925  54.225  1.00 69.16  ?  33  ILE B CA  1 
ATOM 3440  C C   . ILE B  1 25  ? 132.469 118.829  53.189  1.00 63.68  ?  33  ILE B C   1 
ATOM 3441  O O   . ILE B  1 25  ? 131.981 117.741  53.514  1.00 60.31  ?  33  ILE B O   1 
ATOM 3442  C CB  . ILE B  1 25  ? 133.604 119.441  55.355  1.00 66.45  ?  33  ILE B CB  1 
ATOM 3443  C CG1 . ILE B  1 25  ? 133.654 120.467  56.488  1.00 70.22  ?  33  ILE B CG1 1 
ATOM 3444  C CG2 . ILE B  1 25  ? 134.999 119.169  54.824  1.00 69.30  ?  33  ILE B CG2 1 
ATOM 3445  C CD1 . ILE B  1 25  ? 134.407 121.733  56.140  1.00 74.97  ?  33  ILE B CD1 1 
ATOM 3446  N N   . PHE B  1 26  ? 132.836 119.110  51.942  1.00 67.52  ?  34  PHE B N   1 
ATOM 3447  C CA  . PHE B  1 26  ? 132.691 118.159  50.849  1.00 70.34  ?  34  PHE B CA  1 
ATOM 3448  C C   . PHE B  1 26  ? 134.038 117.929  50.180  1.00 63.18  ?  34  PHE B C   1 
ATOM 3449  O O   . PHE B  1 26  ? 134.832 118.861  50.020  1.00 67.07  ?  34  PHE B O   1 
ATOM 3450  C CB  . PHE B  1 26  ? 131.672 118.650  49.813  1.00 71.07  ?  34  PHE B CB  1 
ATOM 3451  C CG  . PHE B  1 26  ? 130.257 118.679  50.318  1.00 63.16  ?  34  PHE B CG  1 
ATOM 3452  C CD1 . PHE B  1 26  ? 129.521 117.511  50.421  1.00 59.07  ?  34  PHE B CD1 1 
ATOM 3453  C CD2 . PHE B  1 26  ? 129.661 119.873  50.686  1.00 66.50  ?  34  PHE B CD2 1 
ATOM 3454  C CE1 . PHE B  1 26  ? 128.219 117.533  50.882  1.00 58.36  ?  34  PHE B CE1 1 
ATOM 3455  C CE2 . PHE B  1 26  ? 128.360 119.900  51.148  1.00 65.79  ?  34  PHE B CE2 1 
ATOM 3456  C CZ  . PHE B  1 26  ? 127.639 118.728  51.248  1.00 61.74  ?  34  PHE B CZ  1 
ATOM 3457  N N   . TYR B  1 27  ? 134.287 116.684  49.782  1.00 66.12  ?  35  TYR B N   1 
ATOM 3458  C CA  . TYR B  1 27  ? 135.515 116.325  49.091  1.00 66.19  ?  35  TYR B CA  1 
ATOM 3459  C C   . TYR B  1 27  ? 135.193 115.543  47.827  1.00 68.84  ?  35  TYR B C   1 
ATOM 3460  O O   . TYR B  1 27  ? 134.212 114.795  47.770  1.00 57.91  ?  35  TYR B O   1 
ATOM 3461  C CB  . TYR B  1 27  ? 136.443 115.492  49.985  1.00 61.39  ?  35  TYR B CB  1 
ATOM 3462  C CG  . TYR B  1 27  ? 137.250 116.306  50.969  1.00 69.15  ?  35  TYR B CG  1 
ATOM 3463  C CD1 . TYR B  1 27  ? 138.557 116.678  50.683  1.00 74.87  ?  35  TYR B CD1 1 
ATOM 3464  C CD2 . TYR B  1 27  ? 136.707 116.704  52.183  1.00 69.16  ?  35  TYR B CD2 1 
ATOM 3465  C CE1 . TYR B  1 27  ? 139.301 117.421  51.578  1.00 75.94  ?  35  TYR B CE1 1 
ATOM 3466  C CE2 . TYR B  1 27  ? 137.446 117.446  53.085  1.00 74.59  ?  35  TYR B CE2 1 
ATOM 3467  C CZ  . TYR B  1 27  ? 138.740 117.803  52.776  1.00 78.03  ?  35  TYR B CZ  1 
ATOM 3468  O OH  . TYR B  1 27  ? 139.478 118.543  53.670  1.00 83.84  ?  35  TYR B OH  1 
ATOM 3469  N N   . HIS B  1 28  ? 136.035 115.722  46.813  1.00 65.73  ?  36  HIS B N   1 
ATOM 3470  C CA  . HIS B  1 28  ? 135.974 114.926  45.596  1.00 63.66  ?  36  HIS B CA  1 
ATOM 3471  C C   . HIS B  1 28  ? 137.090 113.895  45.628  1.00 63.12  ?  36  HIS B C   1 
ATOM 3472  O O   . HIS B  1 28  ? 138.245 114.231  45.912  1.00 65.07  ?  36  HIS B O   1 
ATOM 3473  C CB  . HIS B  1 28  ? 136.109 115.794  44.344  1.00 65.98  ?  36  HIS B CB  1 
ATOM 3474  C CG  . HIS B  1 28  ? 136.294 115.003  43.086  1.00 62.84  ?  36  HIS B CG  1 
ATOM 3475  N ND1 . HIS B  1 28  ? 137.523 114.535  42.673  1.00 63.23  ?  36  HIS B ND1 1 
ATOM 3476  C CD2 . HIS B  1 28  ? 135.403 114.595  42.151  1.00 65.70  ?  36  HIS B CD2 1 
ATOM 3477  C CE1 . HIS B  1 28  ? 137.381 113.872  41.539  1.00 64.73  ?  36  HIS B CE1 1 
ATOM 3478  N NE2 . HIS B  1 28  ? 136.105 113.895  41.200  1.00 57.93  ?  36  HIS B NE2 1 
ATOM 3479  N N   . ALA B  1 29  ? 136.746 112.647  45.334  1.00 64.27  ?  37  ALA B N   1 
ATOM 3480  C CA  . ALA B  1 29  ? 137.723 111.574  45.263  1.00 63.64  ?  37  ALA B CA  1 
ATOM 3481  C C   . ALA B  1 29  ? 137.501 110.788  43.984  1.00 61.46  ?  37  ALA B C   1 
ATOM 3482  O O   . ALA B  1 29  ? 136.362 110.491  43.623  1.00 59.76  ?  37  ALA B O   1 
ATOM 3483  C CB  . ALA B  1 29  ? 137.623 110.646  46.472  1.00 62.06  ?  37  ALA B CB  1 
ATOM 3484  N N   . GLY B  1 30  ? 138.586 110.453  43.301  1.00 70.53  ?  38  GLY B N   1 
ATOM 3485  C CA  . GLY B  1 30  ? 138.442 109.711  42.067  1.00 67.34  ?  38  GLY B CA  1 
ATOM 3486  C C   . GLY B  1 30  ? 139.695 108.974  41.661  1.00 65.34  ?  38  GLY B C   1 
ATOM 3487  O O   . GLY B  1 30  ? 140.786 109.550  41.646  1.00 73.66  ?  38  GLY B O   1 
ATOM 3488  N N   . SER B  1 31  ? 139.544 107.703  41.306  1.00 63.19  ?  39  SER B N   1 
ATOM 3489  C CA  . SER B  1 31  ? 140.648 106.952  40.738  1.00 66.85  ?  39  SER B CA  1 
ATOM 3490  C C   . SER B  1 31  ? 140.913 107.422  39.313  1.00 77.27  ?  39  SER B C   1 
ATOM 3491  O O   . SER B  1 31  ? 140.054 108.015  38.655  1.00 84.50  ?  39  SER B O   1 
ATOM 3492  C CB  . SER B  1 31  ? 140.347 105.454  40.757  1.00 61.88  ?  39  SER B CB  1 
ATOM 3493  O OG  . SER B  1 31  ? 139.218 105.153  39.955  1.00 59.25  ?  39  SER B OG  1 
ATOM 3494  N N   . SER B  1 32  ? 142.125 107.164  38.839  1.00 74.59  ?  40  SER B N   1 
ATOM 3495  C CA  . SER B  1 32  ? 142.442 107.407  37.441  1.00 82.96  ?  40  SER B CA  1 
ATOM 3496  C C   . SER B  1 32  ? 141.728 106.362  36.583  1.00 72.96  ?  40  SER B C   1 
ATOM 3497  O O   . SER B  1 32  ? 140.879 105.598  37.053  1.00 65.84  ?  40  SER B O   1 
ATOM 3498  C CB  . SER B  1 32  ? 143.953 107.396  37.231  1.00 94.22  ?  40  SER B CB  1 
ATOM 3499  O OG  . SER B  1 32  ? 144.285 107.680  35.882  1.00 95.70  ?  40  SER B OG  1 
ATOM 3500  N N   . ARG B  1 33  ? 142.071 106.319  35.301  1.00 77.07  ?  41  ARG B N   1 
ATOM 3501  C CA  . ARG B  1 33  ? 141.499 105.317  34.414  1.00 68.30  ?  41  ARG B CA  1 
ATOM 3502  C C   . ARG B  1 33  ? 141.943 103.923  34.837  1.00 65.25  ?  41  ARG B C   1 
ATOM 3503  O O   . ARG B  1 33  ? 143.140 103.656  34.978  1.00 68.03  ?  41  ARG B O   1 
ATOM 3504  C CB  . ARG B  1 33  ? 141.911 105.590  32.970  1.00 70.33  ?  41  ARG B CB  1 
ATOM 3505  C CG  . ARG B  1 33  ? 141.470 104.524  31.985  1.00 63.48  ?  41  ARG B CG  1 
ATOM 3506  C CD  . ARG B  1 33  ? 141.441 105.081  30.578  1.00 61.57  ?  41  ARG B CD  1 
ATOM 3507  N NE  . ARG B  1 33  ? 142.664 105.813  30.267  1.00 70.20  ?  41  ARG B NE  1 
ATOM 3508  C CZ  . ARG B  1 33  ? 142.841 106.537  29.168  1.00 77.04  ?  41  ARG B CZ  1 
ATOM 3509  N NH1 . ARG B  1 33  ? 141.870 106.630  28.269  1.00 75.94  1  41  ARG B NH1 1 
ATOM 3510  N NH2 . ARG B  1 33  ? 143.988 107.171  28.967  1.00 84.93  ?  41  ARG B NH2 1 
ATOM 3511  N N   . LEU B  1 34  ? 140.976 103.037  35.043  1.00 56.70  ?  42  LEU B N   1 
ATOM 3512  C CA  . LEU B  1 34  ? 141.238 101.639  35.351  1.00 59.30  ?  42  LEU B CA  1 
ATOM 3513  C C   . LEU B  1 34  ? 140.924 100.820  34.111  1.00 62.70  ?  42  LEU B C   1 
ATOM 3514  O O   . LEU B  1 34  ? 139.891 101.035  33.474  1.00 63.62  ?  42  LEU B O   1 
ATOM 3515  C CB  . LEU B  1 34  ? 140.387 101.158  36.529  1.00 55.78  ?  42  LEU B CB  1 
ATOM 3516  C CG  . LEU B  1 34  ? 140.448 101.942  37.840  1.00 56.05  ?  42  LEU B CG  1 
ATOM 3517  C CD1 . LEU B  1 34  ? 139.299 101.536  38.750  1.00 53.82  ?  42  LEU B CD1 1 
ATOM 3518  C CD2 . LEU B  1 34  ? 141.783 101.726  38.534  1.00 59.34  ?  42  LEU B CD2 1 
ATOM 3519  N N   . LEU B  1 35  ? 141.816 99.906   33.748  1.00 51.26  ?  43  LEU B N   1 
ATOM 3520  C CA  . LEU B  1 35  ? 141.546 99.067   32.591  1.00 50.84  ?  43  LEU B CA  1 
ATOM 3521  C C   . LEU B  1 35  ? 142.124 97.683   32.821  1.00 52.69  ?  43  LEU B C   1 
ATOM 3522  O O   . LEU B  1 35  ? 143.107 97.513   33.545  1.00 55.19  ?  43  LEU B O   1 
ATOM 3523  C CB  . LEU B  1 35  ? 142.096 99.689   31.298  1.00 53.38  ?  43  LEU B CB  1 
ATOM 3524  C CG  . LEU B  1 35  ? 143.530 100.220  31.255  1.00 56.65  ?  43  LEU B CG  1 
ATOM 3525  C CD1 . LEU B  1 35  ? 144.548 99.108   31.021  1.00 60.73  ?  43  LEU B CD1 1 
ATOM 3526  C CD2 . LEU B  1 35  ? 143.648 101.301  30.191  1.00 56.76  ?  43  LEU B CD2 1 
ATOM 3527  N N   . THR B  1 36  ? 141.491 96.695   32.199  1.00 50.77  ?  44  THR B N   1 
ATOM 3528  C CA  . THR B  1 36  ? 141.961 95.322   32.275  1.00 51.54  ?  44  THR B CA  1 
ATOM 3529  C C   . THR B  1 36  ? 141.673 94.630   30.952  1.00 51.66  ?  44  THR B C   1 
ATOM 3530  O O   . THR B  1 36  ? 140.577 94.770   30.398  1.00 50.76  ?  44  THR B O   1 
ATOM 3531  C CB  . THR B  1 36  ? 141.301 94.576   33.443  1.00 58.61  ?  44  THR B CB  1 
ATOM 3532  O OG1 . THR B  1 36  ? 141.612 93.179   33.364  1.00 71.33  ?  44  THR B OG1 1 
ATOM 3533  C CG2 . THR B  1 36  ? 139.788 94.766   33.428  1.00 48.11  ?  44  THR B CG2 1 
ATOM 3534  N N   . VAL B  1 37  ? 142.666 93.908   30.439  1.00 54.37  ?  45  VAL B N   1 
ATOM 3535  C CA  . VAL B  1 37  ? 142.519 93.128   29.220  1.00 54.14  ?  45  VAL B CA  1 
ATOM 3536  C C   . VAL B  1 37  ? 142.708 91.664   29.586  1.00 55.19  ?  45  VAL B C   1 
ATOM 3537  O O   . VAL B  1 37  ? 143.337 91.326   30.592  1.00 58.26  ?  45  VAL B O   1 
ATOM 3538  C CB  . VAL B  1 37  ? 143.517 93.551   28.120  1.00 51.01  ?  45  VAL B CB  1 
ATOM 3539  C CG1 . VAL B  1 37  ? 143.584 95.063   28.014  1.00 50.26  ?  45  VAL B CG1 1 
ATOM 3540  C CG2 . VAL B  1 37  ? 144.897 92.973   28.392  1.00 54.87  ?  45  VAL B CG2 1 
ATOM 3541  N N   . GLY B  1 38  ? 142.146 90.789   28.764  1.00 57.20  ?  46  GLY B N   1 
ATOM 3542  C CA  . GLY B  1 38  ? 142.308 89.372   29.017  1.00 59.59  ?  46  GLY B CA  1 
ATOM 3543  C C   . GLY B  1 38  ? 141.516 88.536   28.043  1.00 58.24  ?  46  GLY B C   1 
ATOM 3544  O O   . GLY B  1 38  ? 141.120 89.006   26.978  1.00 51.45  ?  46  GLY B O   1 
ATOM 3545  N N   . HIS B  1 39  ? 141.308 87.278   28.415  1.00 65.62  ?  47  HIS B N   1 
ATOM 3546  C CA  . HIS B  1 39  ? 140.507 86.429   27.545  1.00 60.27  ?  47  HIS B CA  1 
ATOM 3547  C C   . HIS B  1 39  ? 139.039 86.486   27.961  1.00 54.70  ?  47  HIS B C   1 
ATOM 3548  O O   . HIS B  1 39  ? 138.732 86.461   29.157  1.00 53.61  ?  47  HIS B O   1 
ATOM 3549  C CB  . HIS B  1 39  ? 141.001 84.989   27.598  1.00 58.55  ?  47  HIS B CB  1 
ATOM 3550  C CG  . HIS B  1 39  ? 140.475 84.127   26.495  1.00 57.68  ?  47  HIS B CG  1 
ATOM 3551  N ND1 . HIS B  1 39  ? 139.280 83.448   26.588  1.00 53.71  ?  47  HIS B ND1 1 
ATOM 3552  C CD2 . HIS B  1 39  ? 140.984 83.829   25.276  1.00 64.34  ?  47  HIS B CD2 1 
ATOM 3553  C CE1 . HIS B  1 39  ? 139.074 82.770   25.472  1.00 54.70  ?  47  HIS B CE1 1 
ATOM 3554  N NE2 . HIS B  1 39  ? 140.093 82.983   24.660  1.00 61.35  ?  47  HIS B NE2 1 
ATOM 3555  N N   . PRO B  1 40  ? 138.117 86.566   26.999  1.00 57.03  ?  48  PRO B N   1 
ATOM 3556  C CA  . PRO B  1 40  ? 136.703 86.746   27.358  1.00 54.02  ?  48  PRO B CA  1 
ATOM 3557  C C   . PRO B  1 40  ? 136.040 85.495   27.904  1.00 54.02  ?  48  PRO B C   1 
ATOM 3558  O O   . PRO B  1 40  ? 134.987 85.608   28.543  1.00 51.90  ?  48  PRO B O   1 
ATOM 3559  C CB  . PRO B  1 40  ? 136.060 87.175   26.033  1.00 53.11  ?  48  PRO B CB  1 
ATOM 3560  C CG  . PRO B  1 40  ? 136.918 86.536   24.993  1.00 57.11  ?  48  PRO B CG  1 
ATOM 3561  C CD  . PRO B  1 40  ? 138.322 86.575   25.540  1.00 60.75  ?  48  PRO B CD  1 
ATOM 3562  N N   . TYR B  1 41  ? 136.612 84.315   27.683  1.00 51.17  ?  49  TYR B N   1 
ATOM 3563  C CA  . TYR B  1 41  ? 135.954 83.062   28.030  1.00 51.44  ?  49  TYR B CA  1 
ATOM 3564  C C   . TYR B  1 41  ? 136.594 82.332   29.201  1.00 53.44  ?  49  TYR B C   1 
ATOM 3565  O O   . TYR B  1 41  ? 135.879 81.735   30.009  1.00 52.82  ?  49  TYR B O   1 
ATOM 3566  C CB  . TYR B  1 41  ? 135.927 82.125   26.815  1.00 54.49  ?  49  TYR B CB  1 
ATOM 3567  C CG  . TYR B  1 41  ? 135.250 82.692   25.584  1.00 52.09  ?  49  TYR B CG  1 
ATOM 3568  C CD1 . TYR B  1 41  ? 134.272 83.674   25.688  1.00 48.34  ?  49  TYR B CD1 1 
ATOM 3569  C CD2 . TYR B  1 41  ? 135.579 82.229   24.316  1.00 54.80  ?  49  TYR B CD2 1 
ATOM 3570  C CE1 . TYR B  1 41  ? 133.650 84.187   24.563  1.00 48.15  ?  49  TYR B CE1 1 
ATOM 3571  C CE2 . TYR B  1 41  ? 134.962 82.735   23.184  1.00 55.26  ?  49  TYR B CE2 1 
ATOM 3572  C CZ  . TYR B  1 41  ? 133.998 83.713   23.315  1.00 52.74  ?  49  TYR B CZ  1 
ATOM 3573  O OH  . TYR B  1 41  ? 133.381 84.219   22.193  1.00 53.57  ?  49  TYR B OH  1 
ATOM 3574  N N   . PHE B  1 42  ? 137.920 82.363   29.324  1.00 53.18  ?  50  PHE B N   1 
ATOM 3575  C CA  . PHE B  1 42  ? 138.597 81.551   30.326  1.00 58.48  ?  50  PHE B CA  1 
ATOM 3576  C C   . PHE B  1 42  ? 140.007 82.076   30.546  1.00 67.04  ?  50  PHE B C   1 
ATOM 3577  O O   . PHE B  1 42  ? 140.592 82.727   29.678  1.00 70.94  ?  50  PHE B O   1 
ATOM 3578  C CB  . PHE B  1 42  ? 138.651 80.078   29.906  1.00 52.74  ?  50  PHE B CB  1 
ATOM 3579  C CG  . PHE B  1 42  ? 139.065 79.872   28.475  1.00 54.52  ?  50  PHE B CG  1 
ATOM 3580  C CD1 . PHE B  1 42  ? 140.392 79.989   28.095  1.00 58.78  ?  50  PHE B CD1 1 
ATOM 3581  C CD2 . PHE B  1 42  ? 138.126 79.554   27.510  1.00 53.14  ?  50  PHE B CD2 1 
ATOM 3582  C CE1 . PHE B  1 42  ? 140.770 79.799   26.780  1.00 60.64  ?  50  PHE B CE1 1 
ATOM 3583  C CE2 . PHE B  1 42  ? 138.499 79.364   26.193  1.00 54.18  ?  50  PHE B CE2 1 
ATOM 3584  C CZ  . PHE B  1 42  ? 139.823 79.484   25.829  1.00 58.30  ?  50  PHE B CZ  1 
ATOM 3585  N N   . LYS B  1 43  ? 140.545 81.774   31.725  1.00 62.02  ?  51  LYS B N   1 
ATOM 3586  C CA  . LYS B  1 43  ? 141.945 82.053   32.008  1.00 63.79  ?  51  LYS B CA  1 
ATOM 3587  C C   . LYS B  1 43  ? 142.835 81.177   31.134  1.00 67.65  ?  51  LYS B C   1 
ATOM 3588  O O   . LYS B  1 43  ? 142.671 79.954   31.094  1.00 69.35  ?  51  LYS B O   1 
ATOM 3589  C CB  . LYS B  1 43  ? 142.241 81.807   33.487  1.00 64.51  ?  51  LYS B CB  1 
ATOM 3590  C CG  . LYS B  1 43  ? 143.692 82.017   33.882  1.00 72.69  ?  51  LYS B CG  1 
ATOM 3591  C CD  . LYS B  1 43  ? 143.989 81.357   35.222  1.00 77.64  ?  51  LYS B CD  1 
ATOM 3592  C CE  . LYS B  1 43  ? 143.169 81.982   36.341  1.00 73.91  ?  51  LYS B CE  1 
ATOM 3593  N NZ  . LYS B  1 43  ? 143.477 81.379   37.668  1.00 73.76  1  51  LYS B NZ  1 
ATOM 3594  N N   . VAL B  1 44  ? 143.771 81.803   30.427  1.00 63.65  ?  52  VAL B N   1 
ATOM 3595  C CA  . VAL B  1 44  ? 144.670 81.077   29.534  1.00 67.10  ?  52  VAL B CA  1 
ATOM 3596  C C   . VAL B  1 44  ? 146.059 81.019   30.156  1.00 71.15  ?  52  VAL B C   1 
ATOM 3597  O O   . VAL B  1 44  ? 146.790 82.020   30.130  1.00 71.74  ?  52  VAL B O   1 
ATOM 3598  C CB  . VAL B  1 44  ? 144.728 81.728   28.144  1.00 62.85  ?  52  VAL B CB  1 
ATOM 3599  C CG1 . VAL B  1 44  ? 145.526 80.860   27.183  1.00 66.39  ?  52  VAL B CG1 1 
ATOM 3600  C CG2 . VAL B  1 44  ? 143.330 81.984   27.615  1.00 58.84  ?  52  VAL B CG2 1 
ATOM 3601  N N   . PRO B  1 45  ? 146.465 79.886   30.724  1.00 75.81  ?  53  PRO B N   1 
ATOM 3602  C CA  . PRO B  1 45  ? 147.813 79.790   31.293  1.00 82.31  ?  53  PRO B CA  1 
ATOM 3603  C C   . PRO B  1 45  ? 148.868 79.621   30.210  1.00 87.31  ?  53  PRO B C   1 
ATOM 3604  O O   . PRO B  1 45  ? 148.693 78.863   29.253  1.00 90.53  ?  53  PRO B O   1 
ATOM 3605  C CB  . PRO B  1 45  ? 147.736 78.543   32.187  1.00 76.55  ?  53  PRO B CB  1 
ATOM 3606  C CG  . PRO B  1 45  ? 146.267 78.228   32.317  1.00 74.89  ?  53  PRO B CG  1 
ATOM 3607  C CD  . PRO B  1 45  ? 145.649 78.706   31.045  1.00 74.04  ?  53  PRO B CD  1 
ATOM 3608  N N   . LYS B  1 46  ? 149.972 80.348   30.367  1.00 88.15  ?  54  LYS B N   1 
ATOM 3609  C CA  . LYS B  1 46  ? 151.141 80.202   29.508  1.00 92.14  ?  54  LYS B CA  1 
ATOM 3610  C C   . LYS B  1 46  ? 152.354 79.964   30.392  1.00 105.67 ?  54  LYS B C   1 
ATOM 3611  O O   . LYS B  1 46  ? 152.669 80.794   31.251  1.00 109.27 ?  54  LYS B O   1 
ATOM 3612  C CB  . LYS B  1 46  ? 151.354 81.433   28.623  1.00 95.46  ?  54  LYS B CB  1 
ATOM 3613  C CG  . LYS B  1 46  ? 152.732 81.473   27.977  1.00 107.59 ?  54  LYS B CG  1 
ATOM 3614  C CD  . LYS B  1 46  ? 152.840 82.554   26.915  1.00 104.36 ?  54  LYS B CD  1 
ATOM 3615  C CE  . LYS B  1 46  ? 154.294 82.807   26.543  1.00 104.35 ?  54  LYS B CE  1 
ATOM 3616  N NZ  . LYS B  1 46  ? 155.017 81.539   26.250  1.00 109.17 1  54  LYS B NZ  1 
ATOM 3617  N N   . GLY B  1 47  ? 153.030 78.837   30.182  1.00 103.57 ?  55  GLY B N   1 
ATOM 3618  C CA  . GLY B  1 47  ? 154.176 78.478   30.993  1.00 111.91 ?  55  GLY B CA  1 
ATOM 3619  C C   . GLY B  1 47  ? 155.321 79.467   30.917  1.00 122.11 ?  55  GLY B C   1 
ATOM 3620  O O   . GLY B  1 47  ? 155.876 79.711   29.840  1.00 125.27 ?  55  GLY B O   1 
ATOM 3621  N N   . GLY B  1 48  ? 155.679 80.047   32.060  1.00 127.22 ?  56  GLY B N   1 
ATOM 3622  C CA  . GLY B  1 48  ? 156.770 81.000   32.132  1.00 143.52 ?  56  GLY B CA  1 
ATOM 3623  C C   . GLY B  1 48  ? 157.975 80.441   32.865  1.00 160.90 ?  56  GLY B C   1 
ATOM 3624  O O   . GLY B  1 48  ? 158.257 79.249   32.702  1.00 168.24 ?  56  GLY B O   1 
ATOM 3625  N N   . ASN B  1 49  ? 158.708 81.228   33.666  1.00 159.72 ?  57  ASN B N   1 
ATOM 3626  C CA  . ASN B  1 49  ? 158.495 82.652   33.994  1.00 158.48 ?  57  ASN B CA  1 
ATOM 3627  C C   . ASN B  1 49  ? 157.084 82.977   34.504  1.00 155.42 ?  57  ASN B C   1 
ATOM 3628  O O   . ASN B  1 49  ? 156.458 83.941   34.065  1.00 151.78 ?  57  ASN B O   1 
ATOM 3629  C CB  . ASN B  1 49  ? 158.837 83.538   32.786  1.00 156.74 ?  57  ASN B CB  1 
ATOM 3630  C CG  . ASN B  1 49  ? 159.079 84.986   33.172  1.00 148.51 ?  57  ASN B CG  1 
ATOM 3631  O OD1 . ASN B  1 49  ? 159.150 85.321   34.355  1.00 146.40 ?  57  ASN B OD1 1 
ATOM 3632  N ND2 . ASN B  1 49  ? 159.207 85.852   32.174  1.00 141.54 ?  57  ASN B ND2 1 
ATOM 3633  N N   . GLY B  1 50  ? 156.599 82.165   35.439  1.00 156.56 ?  58  GLY B N   1 
ATOM 3634  C CA  . GLY B  1 50  ? 155.257 82.313   35.968  1.00 151.53 ?  58  GLY B CA  1 
ATOM 3635  C C   . GLY B  1 50  ? 155.009 83.609   36.715  1.00 148.15 ?  58  GLY B C   1 
ATOM 3636  O O   . GLY B  1 50  ? 155.690 83.889   37.707  1.00 151.61 ?  58  GLY B O   1 
ATOM 3637  N N   . ARG B  1 51  ? 154.047 84.414   36.261  1.00 145.50 ?  59  ARG B N   1 
ATOM 3638  C CA  . ARG B  1 51  ? 153.226 84.109   35.090  1.00 136.49 ?  59  ARG B CA  1 
ATOM 3639  C C   . ARG B  1 51  ? 153.014 85.341   34.213  1.00 126.39 ?  59  ARG B C   1 
ATOM 3640  O O   . ARG B  1 51  ? 152.787 86.439   34.722  1.00 124.70 ?  59  ARG B O   1 
ATOM 3641  C CB  . ARG B  1 51  ? 151.851 83.566   35.512  1.00 128.83 ?  59  ARG B CB  1 
ATOM 3642  C CG  . ARG B  1 51  ? 151.835 82.158   36.088  1.00 134.02 ?  59  ARG B CG  1 
ATOM 3643  C CD  . ARG B  1 51  ? 150.416 81.610   36.150  1.00 132.56 ?  59  ARG B CD  1 
ATOM 3644  N NE  . ARG B  1 51  ? 150.387 80.164   36.360  1.00 134.59 ?  59  ARG B NE  1 
ATOM 3645  C CZ  . ARG B  1 51  ? 150.583 79.264   35.401  1.00 131.90 ?  59  ARG B CZ  1 
ATOM 3646  N NH1 . ARG B  1 51  ? 150.822 79.656   34.157  1.00 128.96 1  59  ARG B NH1 1 
ATOM 3647  N NH2 . ARG B  1 51  ? 150.538 77.969   35.685  1.00 131.86 ?  59  ARG B NH2 1 
ATOM 3648  N N   . GLN B  1 52  ? 153.093 85.161   32.893  1.00 122.72 ?  60  GLN B N   1 
ATOM 3649  C CA  . GLN B  1 52  ? 152.623 86.161   31.940  1.00 112.08 ?  60  GLN B CA  1 
ATOM 3650  C C   . GLN B  1 52  ? 151.295 85.753   31.308  1.00 102.10 ?  60  GLN B C   1 
ATOM 3651  O O   . GLN B  1 52  ? 151.022 86.084   30.149  1.00 94.02  ?  60  GLN B O   1 
ATOM 3652  C CB  . GLN B  1 52  ? 153.678 86.428   30.863  1.00 114.58 ?  60  GLN B CB  1 
ATOM 3653  C CG  . GLN B  1 52  ? 153.960 85.268   29.915  1.00 115.98 ?  60  GLN B CG  1 
ATOM 3654  C CD  . GLN B  1 52  ? 154.845 84.209   30.531  1.00 121.50 ?  60  GLN B CD  1 
ATOM 3655  O OE1 . GLN B  1 52  ? 155.394 84.399   31.613  1.00 121.09 ?  60  GLN B OE1 1 
ATOM 3656  N NE2 . GLN B  1 52  ? 154.990 83.084   29.842  1.00 126.45 ?  60  GLN B NE2 1 
ATOM 3657  N N   . ASP B  1 53  ? 150.452 85.060   32.069  1.00 96.02  ?  61  ASP B N   1 
ATOM 3658  C CA  . ASP B  1 53  ? 149.176 84.573   31.571  1.00 93.87  ?  61  ASP B CA  1 
ATOM 3659  C C   . ASP B  1 53  ? 148.181 85.719   31.422  1.00 87.35  ?  61  ASP B C   1 
ATOM 3660  O O   . ASP B  1 53  ? 148.308 86.776   32.046  1.00 87.10  ?  61  ASP B O   1 
ATOM 3661  C CB  . ASP B  1 53  ? 148.609 83.513   32.512  1.00 96.31  ?  61  ASP B CB  1 
ATOM 3662  C CG  . ASP B  1 53  ? 149.602 82.411   32.809  1.00 106.27 ?  61  ASP B CG  1 
ATOM 3663  O OD1 . ASP B  1 53  ? 150.795 82.582   32.479  1.00 112.31 ?  61  ASP B OD1 1 
ATOM 3664  O OD2 . ASP B  1 53  ? 149.194 81.377   33.376  1.00 109.32 -1 61  ASP B OD2 1 
ATOM 3665  N N   . VAL B  1 54  ? 147.183 85.500   30.579  1.00 63.91  ?  62  VAL B N   1 
ATOM 3666  C CA  . VAL B  1 54  ? 146.068 86.430   30.418  1.00 63.52  ?  62  VAL B CA  1 
ATOM 3667  C C   . VAL B  1 54  ? 144.920 85.959   31.305  1.00 63.58  ?  62  VAL B C   1 
ATOM 3668  O O   . VAL B  1 54  ? 144.652 84.750   31.359  1.00 63.71  ?  62  VAL B O   1 
ATOM 3669  C CB  . VAL B  1 54  ? 145.628 86.554   28.944  1.00 64.57  ?  62  VAL B CB  1 
ATOM 3670  C CG1 . VAL B  1 54  ? 146.820 86.900   28.067  1.00 64.82  ?  62  VAL B CG1 1 
ATOM 3671  C CG2 . VAL B  1 54  ? 144.977 85.279   28.442  1.00 67.16  ?  62  VAL B CG2 1 
ATOM 3672  N N   . PRO B  1 55  ? 144.275 86.848   32.050  1.00 59.26  ?  63  PRO B N   1 
ATOM 3673  C CA  . PRO B  1 55  ? 143.182 86.445   32.934  1.00 59.33  ?  63  PRO B CA  1 
ATOM 3674  C C   . PRO B  1 55  ? 141.840 86.438   32.210  1.00 58.92  ?  63  PRO B C   1 
ATOM 3675  O O   . PRO B  1 55  ? 141.717 86.863   31.060  1.00 58.60  ?  63  PRO B O   1 
ATOM 3676  C CB  . PRO B  1 55  ? 143.212 87.527   34.020  1.00 65.00  ?  63  PRO B CB  1 
ATOM 3677  C CG  . PRO B  1 55  ? 143.674 88.742   33.287  1.00 61.76  ?  63  PRO B CG  1 
ATOM 3678  C CD  . PRO B  1 55  ? 144.649 88.261   32.242  1.00 58.84  ?  63  PRO B CD  1 
ATOM 3679  N N   . LYS B  1 56  ? 140.827 85.945   32.918  1.00 62.34  ?  64  LYS B N   1 
ATOM 3680  C CA  . LYS B  1 56  ? 139.462 85.936   32.404  1.00 60.34  ?  64  LYS B CA  1 
ATOM 3681  C C   . LYS B  1 56  ? 138.853 87.318   32.604  1.00 57.47  ?  64  LYS B C   1 
ATOM 3682  O O   . LYS B  1 56  ? 138.565 87.723   33.735  1.00 58.42  ?  64  LYS B O   1 
ATOM 3683  C CB  . LYS B  1 56  ? 138.629 84.863   33.097  1.00 57.74  ?  64  LYS B CB  1 
ATOM 3684  C CG  . LYS B  1 56  ? 137.228 84.706   32.525  1.00 51.38  ?  64  LYS B CG  1 
ATOM 3685  C CD  . LYS B  1 56  ? 136.418 83.693   33.317  1.00 52.23  ?  64  LYS B CD  1 
ATOM 3686  C CE  . LYS B  1 56  ? 135.022 83.532   32.743  1.00 50.22  ?  64  LYS B CE  1 
ATOM 3687  N NZ  . LYS B  1 56  ? 134.206 82.582   33.546  1.00 51.95  1  64  LYS B NZ  1 
ATOM 3688  N N   . VAL B  1 57  ? 138.665 88.046   31.508  1.00 59.01  ?  65  VAL B N   1 
ATOM 3689  C CA  . VAL B  1 57  ? 138.081 89.382   31.531  1.00 54.66  ?  65  VAL B CA  1 
ATOM 3690  C C   . VAL B  1 57  ? 136.853 89.334   30.630  1.00 53.72  ?  65  VAL B C   1 
ATOM 3691  O O   . VAL B  1 57  ? 136.964 89.461   29.405  1.00 56.28  ?  65  VAL B O   1 
ATOM 3692  C CB  . VAL B  1 57  ? 139.070 90.458   31.072  1.00 53.71  ?  65  VAL B CB  1 
ATOM 3693  C CG1 . VAL B  1 57  ? 138.413 91.830   31.099  1.00 53.26  ?  65  VAL B CG1 1 
ATOM 3694  C CG2 . VAL B  1 57  ? 140.315 90.435   31.942  1.00 55.01  ?  65  VAL B CG2 1 
ATOM 3695  N N   . SER B  1 58  ? 135.682 89.135   31.225  1.00 49.03  ?  66  SER B N   1 
ATOM 3696  C CA  . SER B  1 58  ? 134.435 89.053   30.483  1.00 48.77  ?  66  SER B CA  1 
ATOM 3697  C C   . SER B  1 58  ? 133.548 90.247   30.804  1.00 48.65  ?  66  SER B C   1 
ATOM 3698  O O   . SER B  1 58  ? 133.537 90.752   31.930  1.00 48.82  ?  66  SER B O   1 
ATOM 3699  C CB  . SER B  1 58  ? 133.689 87.755   30.802  1.00 49.59  ?  66  SER B CB  1 
ATOM 3700  O OG  . SER B  1 58  ? 132.677 87.503   29.844  1.00 49.36  ?  66  SER B OG  1 
ATOM 3701  N N   . ALA B  1 59  ? 132.804 90.700   29.792  1.00 49.33  ?  67  ALA B N   1 
ATOM 3702  C CA  . ALA B  1 59  ? 131.826 91.758   30.007  1.00 55.62  ?  67  ALA B CA  1 
ATOM 3703  C C   . ALA B  1 59  ? 130.664 91.293   30.871  1.00 59.39  ?  67  ALA B C   1 
ATOM 3704  O O   . ALA B  1 59  ? 129.909 92.128   31.382  1.00 66.44  ?  67  ALA B O   1 
ATOM 3705  C CB  . ALA B  1 59  ? 131.303 92.277   28.669  1.00 57.23  ?  67  ALA B CB  1 
ATOM 3706  N N   . TYR B  1 60  ? 130.501 89.981   31.042  1.00 52.85  ?  68  TYR B N   1 
ATOM 3707  C CA  . TYR B  1 60  ? 129.470 89.417   31.901  1.00 50.00  ?  68  TYR B CA  1 
ATOM 3708  C C   . TYR B  1 60  ? 130.032 89.000   33.254  1.00 51.04  ?  68  TYR B C   1 
ATOM 3709  O O   . TYR B  1 60  ? 129.597 88.002   33.838  1.00 53.95  ?  68  TYR B O   1 
ATOM 3710  C CB  . TYR B  1 60  ? 128.791 88.249   31.190  1.00 52.91  ?  68  TYR B CB  1 
ATOM 3711  C CG  . TYR B  1 60  ? 128.283 88.649   29.825  1.00 50.48  ?  68  TYR B CG  1 
ATOM 3712  C CD1 . TYR B  1 60  ? 127.052 89.270   29.678  1.00 49.05  ?  68  TYR B CD1 1 
ATOM 3713  C CD2 . TYR B  1 60  ? 129.050 88.440   28.688  1.00 49.86  ?  68  TYR B CD2 1 
ATOM 3714  C CE1 . TYR B  1 60  ? 126.589 89.657   28.436  1.00 47.58  ?  68  TYR B CE1 1 
ATOM 3715  C CE2 . TYR B  1 60  ? 128.595 88.820   27.440  1.00 51.75  ?  68  TYR B CE2 1 
ATOM 3716  C CZ  . TYR B  1 60  ? 127.364 89.427   27.320  1.00 52.16  ?  68  TYR B CZ  1 
ATOM 3717  O OH  . TYR B  1 60  ? 126.908 89.806   26.077  1.00 59.33  ?  68  TYR B OH  1 
ATOM 3718  N N   . GLN B  1 61  ? 131.004 89.757   33.754  1.00 48.42  ?  69  GLN B N   1 
ATOM 3719  C CA  . GLN B  1 61  ? 131.604 89.554   35.061  1.00 51.51  ?  69  GLN B CA  1 
ATOM 3720  C C   . GLN B  1 61  ? 131.202 90.694   35.987  1.00 56.59  ?  69  GLN B C   1 
ATOM 3721  O O   . GLN B  1 61  ? 131.070 91.842   35.551  1.00 57.21  ?  69  GLN B O   1 
ATOM 3722  C CB  . GLN B  1 61  ? 133.131 89.492   34.963  1.00 50.30  ?  69  GLN B CB  1 
ATOM 3723  C CG  . GLN B  1 61  ? 133.698 88.117   34.671  1.00 52.58  ?  69  GLN B CG  1 
ATOM 3724  C CD  . GLN B  1 61  ? 135.210 88.136   34.549  1.00 54.62  ?  69  GLN B CD  1 
ATOM 3725  O OE1 . GLN B  1 61  ? 135.803 89.155   34.194  1.00 52.00  ?  69  GLN B OE1 1 
ATOM 3726  N NE2 . GLN B  1 61  ? 135.842 87.009   34.856  1.00 58.81  ?  69  GLN B NE2 1 
ATOM 3727  N N   . TYR B  1 62  ? 131.001 90.373   37.261  1.00 55.53  ?  70  TYR B N   1 
ATOM 3728  C CA  . TYR B  1 62  ? 130.780 91.409   38.259  1.00 48.32  ?  70  TYR B CA  1 
ATOM 3729  C C   . TYR B  1 62  ? 132.068 92.189   38.486  1.00 49.31  ?  70  TYR B C   1 
ATOM 3730  O O   . TYR B  1 62  ? 133.142 91.600   38.640  1.00 51.22  ?  70  TYR B O   1 
ATOM 3731  C CB  . TYR B  1 62  ? 130.300 90.793   39.572  1.00 49.78  ?  70  TYR B CB  1 
ATOM 3732  C CG  . TYR B  1 62  ? 128.835 90.426   39.592  1.00 48.25  ?  70  TYR B CG  1 
ATOM 3733  C CD1 . TYR B  1 62  ? 127.877 91.331   40.030  1.00 48.22  ?  70  TYR B CD1 1 
ATOM 3734  C CD2 . TYR B  1 62  ? 128.411 89.171   39.182  1.00 52.08  ?  70  TYR B CD2 1 
ATOM 3735  C CE1 . TYR B  1 62  ? 126.537 90.997   40.052  1.00 49.96  ?  70  TYR B CE1 1 
ATOM 3736  C CE2 . TYR B  1 62  ? 127.075 88.827   39.202  1.00 51.12  ?  70  TYR B CE2 1 
ATOM 3737  C CZ  . TYR B  1 62  ? 126.142 89.743   39.637  1.00 49.98  ?  70  TYR B CZ  1 
ATOM 3738  O OH  . TYR B  1 62  ? 124.811 89.399   39.655  1.00 48.15  ?  70  TYR B OH  1 
ATOM 3739  N N   . ARG B  1 63  ? 131.965 93.514   38.495  1.00 46.63  ?  71  ARG B N   1 
ATOM 3740  C CA  . ARG B  1 63  ? 133.082 94.383   38.850  1.00 46.83  ?  71  ARG B CA  1 
ATOM 3741  C C   . ARG B  1 63  ? 132.804 94.936   40.242  1.00 47.14  ?  71  ARG B C   1 
ATOM 3742  O O   . ARG B  1 63  ? 131.916 95.775   40.414  1.00 47.07  ?  71  ARG B O   1 
ATOM 3743  C CB  . ARG B  1 63  ? 133.253 95.507   37.830  1.00 52.15  ?  71  ARG B CB  1 
ATOM 3744  C CG  . ARG B  1 63  ? 133.652 95.046   36.435  1.00 53.93  ?  71  ARG B CG  1 
ATOM 3745  C CD  . ARG B  1 63  ? 135.164 94.976   36.278  1.00 57.63  ?  71  ARG B CD  1 
ATOM 3746  N NE  . ARG B  1 63  ? 135.725 93.721   36.769  1.00 58.42  ?  71  ARG B NE  1 
ATOM 3747  C CZ  . ARG B  1 63  ? 135.805 92.608   36.047  1.00 54.81  ?  71  ARG B CZ  1 
ATOM 3748  N NH1 . ARG B  1 63  ? 135.362 92.591   34.796  1.00 51.48  1  71  ARG B NH1 1 
ATOM 3749  N NH2 . ARG B  1 63  ? 136.333 91.512   36.575  1.00 53.94  ?  71  ARG B NH2 1 
ATOM 3750  N N   . VAL B  1 64  ? 133.553 94.467   41.235  1.00 49.29  ?  72  VAL B N   1 
ATOM 3751  C CA  . VAL B  1 64  ? 133.331 94.850   42.626  1.00 49.63  ?  72  VAL B CA  1 
ATOM 3752  C C   . VAL B  1 64  ? 134.569 95.599   43.098  1.00 49.94  ?  72  VAL B C   1 
ATOM 3753  O O   . VAL B  1 64  ? 135.607 94.993   43.392  1.00 51.18  ?  72  VAL B O   1 
ATOM 3754  C CB  . VAL B  1 64  ? 133.029 93.646   43.523  1.00 51.47  ?  72  VAL B CB  1 
ATOM 3755  C CG1 . VAL B  1 64  ? 132.632 94.117   44.913  1.00 53.58  ?  72  VAL B CG1 1 
ATOM 3756  C CG2 . VAL B  1 64  ? 131.923 92.797   42.914  1.00 49.79  ?  72  VAL B CG2 1 
ATOM 3757  N N   . PHE B  1 65  ? 134.459 96.923   43.176  1.00 52.79  ?  73  PHE B N   1 
ATOM 3758  C CA  . PHE B  1 65  ? 135.545 97.778   43.630  1.00 54.43  ?  73  PHE B CA  1 
ATOM 3759  C C   . PHE B  1 65  ? 135.436 97.989   45.134  1.00 57.31  ?  73  PHE B C   1 
ATOM 3760  O O   . PHE B  1 65  ? 134.369 98.354   45.642  1.00 56.96  ?  73  PHE B O   1 
ATOM 3761  C CB  . PHE B  1 65  ? 135.504 99.127   42.913  1.00 53.29  ?  73  PHE B CB  1 
ATOM 3762  C CG  . PHE B  1 65  ? 135.516 99.022   41.418  1.00 50.48  ?  73  PHE B CG  1 
ATOM 3763  C CD1 . PHE B  1 65  ? 134.336 99.108   40.698  1.00 48.43  ?  73  PHE B CD1 1 
ATOM 3764  C CD2 . PHE B  1 65  ? 136.705 98.842   40.732  1.00 59.01  ?  73  PHE B CD2 1 
ATOM 3765  C CE1 . PHE B  1 65  ? 134.341 99.014   39.320  1.00 47.56  ?  73  PHE B CE1 1 
ATOM 3766  C CE2 . PHE B  1 65  ? 136.718 98.746   39.351  1.00 54.39  ?  73  PHE B CE2 1 
ATOM 3767  C CZ  . PHE B  1 65  ? 135.533 98.832   38.645  1.00 49.20  ?  73  PHE B CZ  1 
ATOM 3768  N N   . ARG B  1 66  ? 136.540 97.752   45.838  1.00 58.07  ?  74  ARG B N   1 
ATOM 3769  C CA  . ARG B  1 66  ? 136.666 98.083   47.255  1.00 66.67  ?  74  ARG B CA  1 
ATOM 3770  C C   . ARG B  1 66  ? 137.404 99.414   47.344  1.00 66.94  ?  74  ARG B C   1 
ATOM 3771  O O   . ARG B  1 66  ? 138.628 99.473   47.193  1.00 67.24  ?  74  ARG B O   1 
ATOM 3772  C CB  . ARG B  1 66  ? 137.388 96.983   48.025  1.00 63.69  ?  74  ARG B CB  1 
ATOM 3773  C CG  . ARG B  1 66  ? 137.575 97.293   49.504  1.00 62.44  ?  74  ARG B CG  1 
ATOM 3774  C CD  . ARG B  1 66  ? 138.021 96.061   50.272  1.00 66.53  ?  74  ARG B CD  1 
ATOM 3775  N NE  . ARG B  1 66  ? 137.962 96.264   51.716  1.00 72.87  ?  74  ARG B NE  1 
ATOM 3776  C CZ  . ARG B  1 66  ? 138.168 95.305   52.613  1.00 77.38  ?  74  ARG B CZ  1 
ATOM 3777  N NH1 . ARG B  1 66  ? 138.447 94.072   52.214  1.00 82.09  1  74  ARG B NH1 1 
ATOM 3778  N NH2 . ARG B  1 66  ? 138.093 95.577   53.909  1.00 76.18  ?  74  ARG B NH2 1 
ATOM 3779  N N   . VAL B  1 67  ? 136.650 100.482  47.576  1.00 63.37  ?  75  VAL B N   1 
ATOM 3780  C CA  . VAL B  1 67  ? 137.194 101.831  47.641  1.00 62.72  ?  75  VAL B CA  1 
ATOM 3781  C C   . VAL B  1 67  ? 137.582 102.103  49.089  1.00 62.08  ?  75  VAL B C   1 
ATOM 3782  O O   . VAL B  1 67  ? 136.722 102.177  49.971  1.00 61.36  ?  75  VAL B O   1 
ATOM 3783  C CB  . VAL B  1 67  ? 136.185 102.866  47.131  1.00 60.11  ?  75  VAL B CB  1 
ATOM 3784  C CG1 . VAL B  1 67  ? 136.787 104.257  47.175  1.00 63.38  ?  75  VAL B CG1 1 
ATOM 3785  C CG2 . VAL B  1 67  ? 135.737 102.513  45.720  1.00 57.64  ?  75  VAL B CG2 1 
ATOM 3786  N N   . LYS B  1 68  ? 138.882 102.245  49.334  1.00 63.07  ?  76  LYS B N   1 
ATOM 3787  C CA  . LYS B  1 68  ? 139.392 102.552  50.661  1.00 67.04  ?  76  LYS B CA  1 
ATOM 3788  C C   . LYS B  1 68  ? 139.530 104.061  50.813  1.00 67.47  ?  76  LYS B C   1 
ATOM 3789  O O   . LYS B  1 68  ? 140.177 104.719  49.991  1.00 66.60  ?  76  LYS B O   1 
ATOM 3790  C CB  . LYS B  1 68  ? 140.733 101.854  50.886  1.00 72.44  ?  76  LYS B CB  1 
ATOM 3791  C CG  . LYS B  1 68  ? 140.584 100.371  51.206  1.00 80.76  ?  76  LYS B CG  1 
ATOM 3792  C CD  . LYS B  1 68  ? 141.923 99.688   51.426  1.00 86.82  ?  76  LYS B CD  1 
ATOM 3793  C CE  . LYS B  1 68  ? 141.744 98.180   51.546  1.00 86.47  ?  76  LYS B CE  1 
ATOM 3794  N NZ  . LYS B  1 68  ? 143.015 97.490   51.896  1.00 89.22  1  76  LYS B NZ  1 
ATOM 3795  N N   . LEU B  1 69  ? 138.914 104.610  51.881  1.00 68.51  ?  77  LEU B N   1 
ATOM 3796  C CA  . LEU B  1 69  ? 138.876 106.034  52.173  1.00 67.73  ?  77  LEU B CA  1 
ATOM 3797  C C   . LEU B  1 69  ? 139.836 106.390  53.303  1.00 71.29  ?  77  LEU B C   1 
ATOM 3798  O O   . LEU B  1 69  ? 140.134 105.554  54.162  1.00 69.70  ?  77  LEU B O   1 
ATOM 3799  C CB  . LEU B  1 69  ? 137.455 106.460  52.560  1.00 66.05  ?  77  LEU B CB  1 
ATOM 3800  C CG  . LEU B  1 69  ? 136.361 106.078  51.561  1.00 64.23  ?  77  LEU B CG  1 
ATOM 3801  C CD1 . LEU B  1 69  ? 134.991 106.543  52.038  1.00 62.00  ?  77  LEU B CD1 1 
ATOM 3802  C CD2 . LEU B  1 69  ? 136.680 106.642  50.185  1.00 64.55  ?  77  LEU B CD2 1 
ATOM 3803  N N   . PRO B  1 70  ? 140.344 107.620  53.322  1.00 64.80  ?  78  PRO B N   1 
ATOM 3804  C CA  . PRO B  1 70  ? 141.207 108.039  54.429  1.00 67.41  ?  78  PRO B CA  1 
ATOM 3805  C C   . PRO B  1 70  ? 140.411 108.191  55.714  1.00 69.44  ?  78  PRO B C   1 
ATOM 3806  O O   . PRO B  1 70  ? 139.245 108.591  55.706  1.00 67.73  ?  78  PRO B O   1 
ATOM 3807  C CB  . PRO B  1 70  ? 141.763 109.386  53.956  1.00 67.52  ?  78  PRO B CB  1 
ATOM 3808  C CG  . PRO B  1 70  ? 140.724 109.905  53.025  1.00 65.71  ?  78  PRO B CG  1 
ATOM 3809  C CD  . PRO B  1 70  ? 140.157 108.696  52.333  1.00 63.29  ?  78  PRO B CD  1 
ATOM 3810  N N   . ASP B  1 71  ? 141.057 107.858  56.822  1.00 72.52  ?  79  ASP B N   1 
ATOM 3811  C CA  . ASP B  1 71  ? 140.435 107.982  58.132  1.00 73.91  ?  79  ASP B CA  1 
ATOM 3812  C C   . ASP B  1 71  ? 140.164 109.454  58.429  1.00 74.89  ?  79  ASP B C   1 
ATOM 3813  O O   . ASP B  1 71  ? 141.118 110.240  58.537  1.00 76.80  ?  79  ASP B O   1 
ATOM 3814  C CB  . ASP B  1 71  ? 141.342 107.372  59.199  1.00 79.43  ?  79  ASP B CB  1 
ATOM 3815  C CG  . ASP B  1 71  ? 140.624 107.123  60.513  1.00 85.35  ?  79  ASP B CG  1 
ATOM 3816  O OD1 . ASP B  1 71  ? 139.587 107.769  60.772  1.00 84.57  ?  79  ASP B OD1 1 
ATOM 3817  O OD2 . ASP B  1 71  ? 141.103 106.271  61.292  1.00 91.57  -1 79  ASP B OD2 1 
ATOM 3818  N N   . PRO B  1 72  ? 138.902 109.871  58.564  1.00 73.98  ?  80  PRO B N   1 
ATOM 3819  C CA  . PRO B  1 72  ? 138.636 111.295  58.822  1.00 75.30  ?  80  PRO B CA  1 
ATOM 3820  C C   . PRO B  1 72  ? 139.146 111.764  60.172  1.00 78.14  ?  80  PRO B C   1 
ATOM 3821  O O   . PRO B  1 72  ? 139.419 112.960  60.336  1.00 79.82  ?  80  PRO B O   1 
ATOM 3822  C CB  . PRO B  1 72  ? 137.107 111.388  58.727  1.00 70.15  ?  80  PRO B CB  1 
ATOM 3823  C CG  . PRO B  1 72  ? 136.632 110.017  59.072  1.00 68.95  ?  80  PRO B CG  1 
ATOM 3824  C CD  . PRO B  1 72  ? 137.665 109.074  58.522  1.00 68.43  ?  80  PRO B CD  1 
ATOM 3825  N N   . ASN B  1 73  ? 139.282 110.861  61.144  1.00 80.23  ?  81  ASN B N   1 
ATOM 3826  C CA  . ASN B  1 73  ? 139.890 111.235  62.416  1.00 83.16  ?  81  ASN B CA  1 
ATOM 3827  C C   . ASN B  1 73  ? 141.397 111.394  62.266  1.00 84.90  ?  81  ASN B C   1 
ATOM 3828  O O   . ASN B  1 73  ? 141.999 112.288  62.871  1.00 88.70  ?  81  ASN B O   1 
ATOM 3829  C CB  . ASN B  1 73  ? 139.553 110.199  63.486  1.00 80.88  ?  81  ASN B CB  1 
ATOM 3830  C CG  . ASN B  1 73  ? 138.067 109.905  63.562  1.00 79.12  ?  81  ASN B CG  1 
ATOM 3831  O OD1 . ASN B  1 73  ? 137.314 110.616  64.227  1.00 80.86  ?  81  ASN B OD1 1 
ATOM 3832  N ND2 . ASN B  1 73  ? 137.637 108.852  62.878  1.00 77.85  ?  81  ASN B ND2 1 
ATOM 3833  N N   . LYS B  1 74  ? 142.022 110.530  61.462  1.00 93.20  ?  82  LYS B N   1 
ATOM 3834  C CA  . LYS B  1 74  ? 143.436 110.675  61.138  1.00 92.76  ?  82  LYS B CA  1 
ATOM 3835  C C   . LYS B  1 74  ? 143.685 111.803  60.144  1.00 88.95  ?  82  LYS B C   1 
ATOM 3836  O O   . LYS B  1 74  ? 144.830 112.247  60.002  1.00 88.56  ?  82  LYS B O   1 
ATOM 3837  C CB  . LYS B  1 74  ? 143.970 109.354  60.575  1.00 90.60  ?  82  LYS B CB  1 
ATOM 3838  C CG  . LYS B  1 74  ? 145.483 109.189  60.594  1.00 95.55  ?  82  LYS B CG  1 
ATOM 3839  C CD  . LYS B  1 74  ? 146.022 109.037  62.005  1.00 101.00 ?  82  LYS B CD  1 
ATOM 3840  C CE  . LYS B  1 74  ? 147.483 108.615  61.985  1.00 100.14 ?  82  LYS B CE  1 
ATOM 3841  N NZ  . LYS B  1 74  ? 148.337 109.600  61.267  1.00 98.22  1  82  LYS B NZ  1 
ATOM 3842  N N   . PHE B  1 75  ? 142.644 112.273  59.458  1.00 93.23  ?  83  PHE B N   1 
ATOM 3843  C CA  . PHE B  1 75  ? 142.786 113.374  58.513  1.00 96.83  ?  83  PHE B CA  1 
ATOM 3844  C C   . PHE B  1 75  ? 143.243 114.635  59.236  1.00 104.63 ?  83  PHE B C   1 
ATOM 3845  O O   . PHE B  1 75  ? 142.602 115.079  60.195  1.00 106.60 ?  83  PHE B O   1 
ATOM 3846  C CB  . PHE B  1 75  ? 141.452 113.612  57.804  1.00 100.84 ?  83  PHE B CB  1 
ATOM 3847  C CG  . PHE B  1 75  ? 141.584 113.944  56.344  1.00 95.22  ?  83  PHE B CG  1 
ATOM 3848  C CD1 . PHE B  1 75  ? 141.565 112.940  55.391  1.00 86.60  ?  83  PHE B CD1 1 
ATOM 3849  C CD2 . PHE B  1 75  ? 141.714 115.256  55.924  1.00 98.84  ?  83  PHE B CD2 1 
ATOM 3850  C CE1 . PHE B  1 75  ? 141.681 113.237  54.047  1.00 84.22  ?  83  PHE B CE1 1 
ATOM 3851  C CE2 . PHE B  1 75  ? 141.829 115.559  54.581  1.00 96.98  ?  83  PHE B CE2 1 
ATOM 3852  C CZ  . PHE B  1 75  ? 141.813 114.548  53.642  1.00 88.89  ?  83  PHE B CZ  1 
ATOM 3853  N N   . GLY B  1 76  ? 144.352 115.212  58.777  1.00 111.76 ?  84  GLY B N   1 
ATOM 3854  C CA  . GLY B  1 76  ? 144.929 116.369  59.435  1.00 123.17 ?  84  GLY B CA  1 
ATOM 3855  C C   . GLY B  1 76  ? 144.779 117.679  58.688  1.00 128.01 ?  84  GLY B C   1 
ATOM 3856  O O   . GLY B  1 76  ? 145.478 118.651  58.992  1.00 133.75 ?  84  GLY B O   1 
ATOM 3857  N N   . LEU B  1 77  ? 143.879 117.725  57.709  1.00 126.93 ?  85  LEU B N   1 
ATOM 3858  C CA  . LEU B  1 77  ? 143.669 118.943  56.931  1.00 130.75 ?  85  LEU B CA  1 
ATOM 3859  C C   . LEU B  1 77  ? 142.634 119.870  57.571  1.00 140.93 ?  85  LEU B C   1 
ATOM 3860  O O   . LEU B  1 77  ? 142.882 121.080  57.654  1.00 143.83 ?  85  LEU B O   1 
ATOM 3861  C CB  . LEU B  1 77  ? 143.273 118.610  55.489  1.00 128.04 ?  85  LEU B CB  1 
ATOM 3862  C CG  . LEU B  1 77  ? 144.410 118.322  54.501  1.00 119.48 ?  85  LEU B CG  1 
ATOM 3863  C CD1 . LEU B  1 77  ? 145.391 119.487  54.466  1.00 118.98 ?  85  LEU B CD1 1 
ATOM 3864  C CD2 . LEU B  1 77  ? 145.135 117.022  54.826  1.00 115.56 ?  85  LEU B CD2 1 
ATOM 3865  N N   . PRO B  1 78  ? 141.478 119.379  58.029  1.00 140.29 ?  86  PRO B N   1 
ATOM 3866  C CA  . PRO B  1 78  ? 140.540 120.277  58.711  1.00 142.22 ?  86  PRO B CA  1 
ATOM 3867  C C   . PRO B  1 78  ? 141.054 120.679  60.084  1.00 148.18 ?  86  PRO B C   1 
ATOM 3868  O O   . PRO B  1 78  ? 141.762 119.927  60.758  1.00 149.13 ?  86  PRO B O   1 
ATOM 3869  C CB  . PRO B  1 78  ? 139.258 119.444  58.817  1.00 135.46 ?  86  PRO B CB  1 
ATOM 3870  C CG  . PRO B  1 78  ? 139.727 118.044  58.807  1.00 136.32 ?  86  PRO B CG  1 
ATOM 3871  C CD  . PRO B  1 78  ? 140.898 118.030  57.872  1.00 133.14 ?  86  PRO B CD  1 
ATOM 3872  N N   . ASP B  1 79  ? 140.683 121.889  60.492  1.00 143.66 ?  87  ASP B N   1 
ATOM 3873  C CA  . ASP B  1 79  ? 141.100 122.424  61.777  1.00 148.01 ?  87  ASP B CA  1 
ATOM 3874  C C   . ASP B  1 79  ? 140.207 121.894  62.896  1.00 147.81 ?  87  ASP B C   1 
ATOM 3875  O O   . ASP B  1 79  ? 139.100 121.401  62.665  1.00 143.72 ?  87  ASP B O   1 
ATOM 3876  C CB  . ASP B  1 79  ? 141.062 123.953  61.757  1.00 152.61 ?  87  ASP B CB  1 
ATOM 3877  C CG  . ASP B  1 79  ? 139.733 124.498  61.260  1.00 143.68 ?  87  ASP B CG  1 
ATOM 3878  O OD1 . ASP B  1 79  ? 139.048 123.792  60.490  1.00 136.73 ?  87  ASP B OD1 1 
ATOM 3879  O OD2 . ASP B  1 79  ? 139.373 125.632  61.639  1.00 141.90 -1 87  ASP B OD2 1 
ATOM 3880  N N   . ASN B  1 80  ? 140.707 122.005  64.129  1.00 147.65 ?  88  ASN B N   1 
ATOM 3881  C CA  . ASN B  1 80  ? 139.976 121.522  65.303  1.00 140.03 ?  88  ASN B CA  1 
ATOM 3882  C C   . ASN B  1 80  ? 138.722 122.336  65.603  1.00 132.70 ?  88  ASN B C   1 
ATOM 3883  O O   . ASN B  1 80  ? 138.080 122.092  66.633  1.00 129.99 ?  88  ASN B O   1 
ATOM 3884  C CB  . ASN B  1 80  ? 140.895 121.517  66.526  1.00 147.45 ?  88  ASN B CB  1 
ATOM 3885  C CG  . ASN B  1 80  ? 141.945 120.424  66.461  1.00 143.78 ?  88  ASN B CG  1 
ATOM 3886  O OD1 . ASN B  1 80  ? 143.140 120.687  66.597  1.00 144.98 ?  88  ASN B OD1 1 
ATOM 3887  N ND2 . ASN B  1 80  ? 141.502 119.189  66.258  1.00 138.58 ?  88  ASN B ND2 1 
ATOM 3888  N N   . THR B  1 81  ? 138.361 123.286  64.739  1.00 137.58 ?  89  THR B N   1 
ATOM 3889  C CA  . THR B  1 81  ? 137.113 124.020  64.890  1.00 132.64 ?  89  THR B CA  1 
ATOM 3890  C C   . THR B  1 81  ? 135.918 123.230  64.376  1.00 119.38 ?  89  THR B C   1 
ATOM 3891  O O   . THR B  1 81  ? 134.793 123.460  64.835  1.00 118.09 ?  89  THR B O   1 
ATOM 3892  C CB  . THR B  1 81  ? 137.204 125.362  64.155  1.00 136.50 ?  89  THR B CB  1 
ATOM 3893  O OG1 . THR B  1 81  ? 138.444 126.003  64.481  1.00 142.14 ?  89  THR B OG1 1 
ATOM 3894  C CG2 . THR B  1 81  ? 136.057 126.280  64.557  1.00 138.08 ?  89  THR B CG2 1 
ATOM 3895  N N   . VAL B  1 82  ? 136.138 122.293  63.451  1.00 116.05 ?  90  VAL B N   1 
ATOM 3896  C CA  . VAL B  1 82  ? 135.023 121.535  62.894  1.00 111.23 ?  90  VAL B CA  1 
ATOM 3897  C C   . VAL B  1 82  ? 134.496 120.520  63.902  1.00 111.01 ?  90  VAL B C   1 
ATOM 3898  O O   . VAL B  1 82  ? 133.301 120.203  63.900  1.00 108.14 ?  90  VAL B O   1 
ATOM 3899  C CB  . VAL B  1 82  ? 135.438 120.863  61.570  1.00 114.63 ?  90  VAL B CB  1 
ATOM 3900  C CG1 . VAL B  1 82  ? 135.943 121.907  60.582  1.00 114.23 ?  90  VAL B CG1 1 
ATOM 3901  C CG2 . VAL B  1 82  ? 136.493 119.792  61.806  1.00 113.50 ?  90  VAL B CG2 1 
ATOM 3902  N N   . TYR B  1 83  ? 135.354 120.003  64.780  1.00 106.59 ?  91  TYR B N   1 
ATOM 3903  C CA  . TYR B  1 83  ? 134.927 119.028  65.775  1.00 104.21 ?  91  TYR B CA  1 
ATOM 3904  C C   . TYR B  1 83  ? 135.990 118.931  66.858  1.00 107.02 ?  91  TYR B C   1 
ATOM 3905  O O   . TYR B  1 83  ? 137.127 119.374  66.679  1.00 109.62 ?  91  TYR B O   1 
ATOM 3906  C CB  . TYR B  1 83  ? 134.670 117.652  65.148  1.00 92.70  ?  91  TYR B CB  1 
ATOM 3907  C CG  . TYR B  1 83  ? 135.831 116.686  65.248  1.00 86.97  ?  91  TYR B CG  1 
ATOM 3908  C CD1 . TYR B  1 83  ? 135.774 115.596  66.107  1.00 87.06  ?  91  TYR B CD1 1 
ATOM 3909  C CD2 . TYR B  1 83  ? 136.979 116.857  64.484  1.00 84.57  ?  91  TYR B CD2 1 
ATOM 3910  C CE1 . TYR B  1 83  ? 136.824 114.704  66.204  1.00 87.39  ?  91  TYR B CE1 1 
ATOM 3911  C CE2 . TYR B  1 83  ? 138.038 115.970  64.577  1.00 86.11  ?  91  TYR B CE2 1 
ATOM 3912  C CZ  . TYR B  1 83  ? 137.954 114.895  65.440  1.00 86.71  ?  91  TYR B CZ  1 
ATOM 3913  O OH  . TYR B  1 83  ? 139.000 114.005  65.541  1.00 86.06  ?  91  TYR B OH  1 
ATOM 3914  N N   . ASP B  1 84  ? 135.604 118.339  67.987  1.00 92.11  ?  92  ASP B N   1 
ATOM 3915  C CA  . ASP B  1 84  ? 136.523 118.100  69.083  1.00 94.55  ?  92  ASP B CA  1 
ATOM 3916  C C   . ASP B  1 84  ? 136.672 116.601  69.310  1.00 93.31  ?  92  ASP B C   1 
ATOM 3917  O O   . ASP B  1 84  ? 135.665 115.897  69.471  1.00 91.78  ?  92  ASP B O   1 
ATOM 3918  C CB  . ASP B  1 84  ? 136.038 118.785  70.375  1.00 100.13 ?  92  ASP B CB  1 
ATOM 3919  C CG  . ASP B  1 84  ? 134.642 118.355  70.778  1.00 95.19  ?  92  ASP B CG  1 
ATOM 3920  O OD1 . ASP B  1 84  ? 133.829 118.052  69.879  1.00 93.71  ?  92  ASP B OD1 1 
ATOM 3921  O OD2 . ASP B  1 84  ? 134.360 118.317  71.994  1.00 94.08  -1 92  ASP B OD2 1 
ATOM 3922  N N   . PRO B  1 85  ? 137.899 116.073  69.320  1.00 97.21  ?  93  PRO B N   1 
ATOM 3923  C CA  . PRO B  1 85  ? 138.085 114.624  69.486  1.00 95.07  ?  93  PRO B CA  1 
ATOM 3924  C C   . PRO B  1 85  ? 137.898 114.148  70.918  1.00 91.87  ?  93  PRO B C   1 
ATOM 3925  O O   . PRO B  1 85  ? 138.537 113.178  71.337  1.00 90.46  ?  93  PRO B O   1 
ATOM 3926  C CB  . PRO B  1 85  ? 139.527 114.405  69.012  1.00 97.34  ?  93  PRO B CB  1 
ATOM 3927  C CG  . PRO B  1 85  ? 140.205 115.704  69.295  1.00 101.24 ?  93  PRO B CG  1 
ATOM 3928  C CD  . PRO B  1 85  ? 139.170 116.773  69.063  1.00 99.87  ?  93  PRO B CD  1 
ATOM 3929  N N   . ASN B  1 86  ? 137.031 114.814  71.679  1.00 85.36  ?  94  ASN B N   1 
ATOM 3930  C CA  . ASN B  1 86  ? 136.768 114.439  73.062  1.00 87.32  ?  94  ASN B CA  1 
ATOM 3931  C C   . ASN B  1 86  ? 135.496 113.614  73.211  1.00 85.47  ?  94  ASN B C   1 
ATOM 3932  O O   . ASN B  1 86  ? 135.500 112.589  73.899  1.00 85.93  ?  94  ASN B O   1 
ATOM 3933  C CB  . ASN B  1 86  ? 136.681 115.696  73.935  1.00 89.20  ?  94  ASN B CB  1 
ATOM 3934  C CG  . ASN B  1 86  ? 137.952 116.520  73.899  1.00 96.71  ?  94  ASN B CG  1 
ATOM 3935  O OD1 . ASN B  1 86  ? 139.049 115.985  73.742  1.00 100.69 ?  94  ASN B OD1 1 
ATOM 3936  N ND2 . ASN B  1 86  ? 137.809 117.834  74.037  1.00 99.97  ?  94  ASN B ND2 1 
ATOM 3937  N N   . SER B  1 87  ? 134.401 114.044  72.581  1.00 92.12  ?  95  SER B N   1 
ATOM 3938  C CA  . SER B  1 87  ? 133.148 113.300  72.614  1.00 90.72  ?  95  SER B CA  1 
ATOM 3939  C C   . SER B  1 87  ? 132.528 113.137  71.231  1.00 83.54  ?  95  SER B C   1 
ATOM 3940  O O   . SER B  1 87  ? 131.381 112.685  71.129  1.00 79.91  ?  95  SER B O   1 
ATOM 3941  C CB  . SER B  1 87  ? 132.144 113.967  73.560  1.00 86.41  ?  95  SER B CB  1 
ATOM 3942  O OG  . SER B  1 87  ? 132.677 114.104  74.866  1.00 89.49  ?  95  SER B OG  1 
ATOM 3943  N N   . GLN B  1 88  ? 133.245 113.496  70.169  1.00 84.99  ?  96  GLN B N   1 
ATOM 3944  C CA  . GLN B  1 88  ? 132.740 113.391  68.810  1.00 82.14  ?  96  GLN B CA  1 
ATOM 3945  C C   . GLN B  1 88  ? 133.785 112.712  67.937  1.00 80.94  ?  96  GLN B C   1 
ATOM 3946  O O   . GLN B  1 88  ? 134.990 112.879  68.142  1.00 82.53  ?  96  GLN B O   1 
ATOM 3947  C CB  . GLN B  1 88  ? 132.394 114.770  68.226  1.00 87.09  ?  96  GLN B CB  1 
ATOM 3948  C CG  . GLN B  1 88  ? 131.226 115.468  68.905  1.00 90.12  ?  96  GLN B CG  1 
ATOM 3949  C CD  . GLN B  1 88  ? 130.896 116.804  68.265  1.00 87.90  ?  96  GLN B CD  1 
ATOM 3950  O OE1 . GLN B  1 88  ? 131.774 117.485  67.733  1.00 89.27  ?  96  GLN B OE1 1 
ATOM 3951  N NE2 . GLN B  1 88  ? 129.625 117.187  68.316  1.00 83.96  ?  96  GLN B NE2 1 
ATOM 3952  N N   . ARG B  1 89  ? 133.313 111.938  66.960  1.00 77.65  ?  97  ARG B N   1 
ATOM 3953  C CA  . ARG B  1 89  ? 134.196 111.301  65.995  1.00 76.30  ?  97  ARG B CA  1 
ATOM 3954  C C   . ARG B  1 89  ? 133.625 111.467  64.595  1.00 73.76  ?  97  ARG B C   1 
ATOM 3955  O O   . ARG B  1 89  ? 132.414 111.621  64.415  1.00 72.69  ?  97  ARG B O   1 
ATOM 3956  C CB  . ARG B  1 89  ? 134.404 109.814  66.312  1.00 77.87  ?  97  ARG B CB  1 
ATOM 3957  C CG  . ARG B  1 89  ? 135.228 109.574  67.564  1.00 81.74  ?  97  ARG B CG  1 
ATOM 3958  C CD  . ARG B  1 89  ? 136.643 110.098  67.392  1.00 83.22  ?  97  ARG B CD  1 
ATOM 3959  N NE  . ARG B  1 89  ? 137.347 110.191  68.666  1.00 88.17  ?  97  ARG B NE  1 
ATOM 3960  C CZ  . ARG B  1 89  ? 138.109 109.228  69.171  1.00 92.98  ?  97  ARG B CZ  1 
ATOM 3961  N NH1 . ARG B  1 89  ? 138.272 108.092  68.507  1.00 89.91  1  97  ARG B NH1 1 
ATOM 3962  N NH2 . ARG B  1 89  ? 138.711 109.403  70.340  1.00 101.05 ?  97  ARG B NH2 1 
ATOM 3963  N N   . LEU B  1 90  ? 134.510 111.429  63.606  1.00 74.03  ?  98  LEU B N   1 
ATOM 3964  C CA  . LEU B  1 90  ? 134.150 111.691  62.221  1.00 71.27  ?  98  LEU B CA  1 
ATOM 3965  C C   . LEU B  1 90  ? 134.040 110.400  61.419  1.00 68.91  ?  98  LEU B C   1 
ATOM 3966  O O   . LEU B  1 90  ? 134.676 109.390  61.731  1.00 69.07  ?  98  LEU B O   1 
ATOM 3967  C CB  . LEU B  1 90  ? 135.168 112.626  61.560  1.00 69.74  ?  98  LEU B CB  1 
ATOM 3968  C CG  . LEU B  1 90  ? 134.958 114.139  61.678  1.00 71.30  ?  98  LEU B CG  1 
ATOM 3969  C CD1 . LEU B  1 90  ? 134.410 114.538  63.035  1.00 73.20  ?  98  LEU B CD1 1 
ATOM 3970  C CD2 . LEU B  1 90  ? 136.256 114.880  61.384  1.00 72.86  ?  98  LEU B CD2 1 
ATOM 3971  N N   . VAL B  1 91  ? 133.219 110.451  60.374  1.00 67.44  ?  99  VAL B N   1 
ATOM 3972  C CA  . VAL B  1 91  ? 133.036 109.336  59.453  1.00 65.15  ?  99  VAL B CA  1 
ATOM 3973  C C   . VAL B  1 91  ? 132.579 109.909  58.118  1.00 63.60  ?  99  VAL B C   1 
ATOM 3974  O O   . VAL B  1 91  ? 131.834 110.892  58.076  1.00 63.95  ?  99  VAL B O   1 
ATOM 3975  C CB  . VAL B  1 91  ? 132.037 108.295  60.007  1.00 65.25  ?  99  VAL B CB  1 
ATOM 3976  C CG1 . VAL B  1 91  ? 130.660 108.913  60.193  1.00 65.17  ?  99  VAL B CG1 1 
ATOM 3977  C CG2 . VAL B  1 91  ? 131.974 107.075  59.105  1.00 64.68  ?  99  VAL B CG2 1 
ATOM 3978  N N   . TRP B  1 92  ? 133.045 109.309  57.026  1.00 62.30  ?  100 TRP B N   1 
ATOM 3979  C CA  . TRP B  1 92  ? 132.687 109.785  55.699  1.00 60.91  ?  100 TRP B CA  1 
ATOM 3980  C C   . TRP B  1 92  ? 131.309 109.281  55.294  1.00 59.22  ?  100 TRP B C   1 
ATOM 3981  O O   . TRP B  1 92  ? 130.925 108.149  55.604  1.00 58.43  ?  100 TRP B O   1 
ATOM 3982  C CB  . TRP B  1 92  ? 133.719 109.336  54.663  1.00 58.00  ?  100 TRP B CB  1 
ATOM 3983  C CG  . TRP B  1 92  ? 135.039 110.033  54.763  1.00 59.67  ?  100 TRP B CG  1 
ATOM 3984  C CD1 . TRP B  1 92  ? 136.235 109.477  55.109  1.00 60.53  ?  100 TRP B CD1 1 
ATOM 3985  C CD2 . TRP B  1 92  ? 135.300 111.416  54.500  1.00 60.89  ?  100 TRP B CD2 1 
ATOM 3986  N NE1 . TRP B  1 92  ? 137.224 110.430  55.085  1.00 62.20  ?  100 TRP B NE1 1 
ATOM 3987  C CE2 . TRP B  1 92  ? 136.676 111.629  54.715  1.00 62.46  ?  100 TRP B CE2 1 
ATOM 3988  C CE3 . TRP B  1 92  ? 134.503 112.496  54.108  1.00 61.01  ?  100 TRP B CE3 1 
ATOM 3989  C CZ2 . TRP B  1 92  ? 137.272 112.876  54.551  1.00 64.08  ?  100 TRP B CZ2 1 
ATOM 3990  C CZ3 . TRP B  1 92  ? 135.098 113.734  53.946  1.00 62.64  ?  100 TRP B CZ3 1 
ATOM 3991  C CH2 . TRP B  1 92  ? 136.468 113.914  54.167  1.00 64.16  ?  100 TRP B CH2 1 
ATOM 3992  N N   . ALA B  1 93  ? 130.562 110.139  54.603  1.00 66.11  ?  101 ALA B N   1 
ATOM 3993  C CA  . ALA B  1 93  ? 129.254 109.796  54.064  1.00 67.96  ?  101 ALA B CA  1 
ATOM 3994  C C   . ALA B  1 93  ? 129.256 110.093  52.573  1.00 63.05  ?  101 ALA B C   1 
ATOM 3995  O O   . ALA B  1 93  ? 129.601 111.205  52.160  1.00 64.52  ?  101 ALA B O   1 
ATOM 3996  C CB  . ALA B  1 93  ? 128.134 110.572  54.763  1.00 66.93  ?  101 ALA B CB  1 
ATOM 3997  N N   . CYS B  1 94  ? 128.880 109.102  51.770  1.00 65.26  ?  102 CYS B N   1 
ATOM 3998  C CA  . CYS B  1 94  ? 128.884 109.258  50.323  1.00 66.20  ?  102 CYS B CA  1 
ATOM 3999  C C   . CYS B  1 94  ? 127.661 110.048  49.871  1.00 67.13  ?  102 CYS B C   1 
ATOM 4000  O O   . CYS B  1 94  ? 126.538 109.776  50.307  1.00 67.11  ?  102 CYS B O   1 
ATOM 4001  C CB  . CYS B  1 94  ? 128.924 107.896  49.635  1.00 70.36  ?  102 CYS B CB  1 
ATOM 4002  S SG  . CYS B  1 94  ? 128.983 108.005  47.835  1.00 67.52  ?  102 CYS B SG  1 
ATOM 4003  N N   . VAL B  1 95  ? 127.885 111.032  48.998  1.00 71.75  ?  103 VAL B N   1 
ATOM 4004  C CA  . VAL B  1 95  ? 126.829 111.903  48.503  1.00 68.07  ?  103 VAL B CA  1 
ATOM 4005  C C   . VAL B  1 95  ? 126.650 111.782  46.995  1.00 66.35  ?  103 VAL B C   1 
ATOM 4006  O O   . VAL B  1 95  ? 125.516 111.707  46.506  1.00 64.68  ?  103 VAL B O   1 
ATOM 4007  C CB  . VAL B  1 95  ? 127.091 113.372  48.901  1.00 60.48  ?  103 VAL B CB  1 
ATOM 4008  C CG1 . VAL B  1 95  ? 126.223 114.315  48.083  1.00 60.42  ?  103 VAL B CG1 1 
ATOM 4009  C CG2 . VAL B  1 95  ? 126.839 113.563  50.385  1.00 61.18  ?  103 VAL B CG2 1 
ATOM 4010  N N   . GLY B  1 96  ? 127.741 111.753  46.240  1.00 70.28  ?  104 GLY B N   1 
ATOM 4011  C CA  . GLY B  1 96  ? 127.659 111.675  44.795  1.00 67.35  ?  104 GLY B CA  1 
ATOM 4012  C C   . GLY B  1 96  ? 128.519 110.557  44.246  1.00 61.11  ?  104 GLY B C   1 
ATOM 4013  O O   . GLY B  1 96  ? 129.568 110.223  44.795  1.00 62.19  ?  104 GLY B O   1 
ATOM 4014  N N   . VAL B  1 97  ? 128.051 109.971  43.144  1.00 60.31  ?  105 VAL B N   1 
ATOM 4015  C CA  . VAL B  1 97  ? 128.754 108.875  42.479  1.00 59.10  ?  105 VAL B CA  1 
ATOM 4016  C C   . VAL B  1 97  ? 128.600 109.030  40.973  1.00 56.50  ?  105 VAL B C   1 
ATOM 4017  O O   . VAL B  1 97  ? 127.491 109.250  40.476  1.00 56.41  ?  105 VAL B O   1 
ATOM 4018  C CB  . VAL B  1 97  ? 128.230 107.493  42.921  1.00 59.76  ?  105 VAL B CB  1 
ATOM 4019  C CG1 . VAL B  1 97  ? 128.853 106.392  42.077  1.00 59.96  ?  105 VAL B CG1 1 
ATOM 4020  C CG2 . VAL B  1 97  ? 128.521 107.247  44.389  1.00 62.74  ?  105 VAL B CG2 1 
ATOM 4021  N N   . GLU B  1 98  ? 129.710 108.911  40.246  1.00 55.17  ?  106 GLU B N   1 
ATOM 4022  C CA  . GLU B  1 98  ? 129.695 108.823  38.790  1.00 54.82  ?  106 GLU B CA  1 
ATOM 4023  C C   . GLU B  1 98  ? 130.602 107.679  38.367  1.00 54.61  ?  106 GLU B C   1 
ATOM 4024  O O   . GLU B  1 98  ? 131.801 107.693  38.665  1.00 54.78  ?  106 GLU B O   1 
ATOM 4025  C CB  . GLU B  1 98  ? 130.148 110.128  38.132  1.00 62.68  ?  106 GLU B CB  1 
ATOM 4026  C CG  . GLU B  1 98  ? 129.990 110.111  36.615  1.00 66.81  ?  106 GLU B CG  1 
ATOM 4027  C CD  . GLU B  1 98  ? 130.382 111.420  35.958  1.00 79.89  ?  106 GLU B CD  1 
ATOM 4028  O OE1 . GLU B  1 98  ? 130.292 112.476  36.621  1.00 85.04  ?  106 GLU B OE1 1 
ATOM 4029  O OE2 . GLU B  1 98  ? 130.779 111.392  34.773  1.00 85.81  -1 106 GLU B OE2 1 
ATOM 4030  N N   . ILE B  1 99  ? 130.030 106.694  37.684  1.00 57.20  ?  107 ILE B N   1 
ATOM 4031  C CA  . ILE B  1 99  ? 130.763 105.525  37.212  1.00 56.32  ?  107 ILE B CA  1 
ATOM 4032  C C   . ILE B  1 99  ? 131.092 105.746  35.741  1.00 56.23  ?  107 ILE B C   1 
ATOM 4033  O O   . ILE B  1 99  ? 130.192 105.798  34.895  1.00 53.73  ?  107 ILE B O   1 
ATOM 4034  C CB  . ILE B  1 99  ? 129.959 104.235  37.415  1.00 50.14  ?  107 ILE B CB  1 
ATOM 4035  C CG1 . ILE B  1 99  ? 129.654 104.031  38.898  1.00 50.42  ?  107 ILE B CG1 1 
ATOM 4036  C CG2 . ILE B  1 99  ? 130.712 103.045  36.848  1.00 49.96  ?  107 ILE B CG2 1 
ATOM 4037  C CD1 . ILE B  1 99  ? 128.773 102.845  39.170  1.00 50.30  ?  107 ILE B CD1 1 
ATOM 4038  N N   . GLY B  1 100 ? 132.380 105.873  35.431  1.00 53.40  ?  108 GLY B N   1 
ATOM 4039  C CA  . GLY B  1 100 ? 132.814 106.107  34.067  1.00 53.39  ?  108 GLY B CA  1 
ATOM 4040  C C   . GLY B  1 100 ? 133.097 104.810  33.336  1.00 56.64  ?  108 GLY B C   1 
ATOM 4041  O O   . GLY B  1 100 ? 133.783 103.928  33.859  1.00 62.28  ?  108 GLY B O   1 
ATOM 4042  N N   . ARG B  1 101 ? 132.552 104.694  32.127  1.00 60.36  ?  109 ARG B N   1 
ATOM 4043  C CA  . ARG B  1 101 ? 132.830 103.582  31.228  1.00 55.34  ?  109 ARG B CA  1 
ATOM 4044  C C   . ARG B  1 101 ? 133.496 104.121  29.970  1.00 58.53  ?  109 ARG B C   1 
ATOM 4045  O O   . ARG B  1 101 ? 133.080 105.152  29.431  1.00 64.55  ?  109 ARG B O   1 
ATOM 4046  C CB  . ARG B  1 101 ? 131.548 102.823  30.876  1.00 56.79  ?  109 ARG B CB  1 
ATOM 4047  C CG  . ARG B  1 101 ? 130.926 102.098  32.060  1.00 55.58  ?  109 ARG B CG  1 
ATOM 4048  C CD  . ARG B  1 101 ? 131.817 100.980  32.574  1.00 57.23  ?  109 ARG B CD  1 
ATOM 4049  N NE  . ARG B  1 101 ? 131.564 99.717   31.884  1.00 58.43  ?  109 ARG B NE  1 
ATOM 4050  C CZ  . ARG B  1 101 ? 132.419 99.124   31.057  1.00 56.09  ?  109 ARG B CZ  1 
ATOM 4051  N NH1 . ARG B  1 101 ? 133.596 99.679   30.801  1.00 55.75  1  109 ARG B NH1 1 
ATOM 4052  N NH2 . ARG B  1 101 ? 132.092 97.974   30.483  1.00 53.62  ?  109 ARG B NH2 1 
ATOM 4053  N N   . GLY B  1 102 ? 134.527 103.421  29.498  1.00 59.06  ?  110 GLY B N   1 
ATOM 4054  C CA  . GLY B  1 102 ? 135.382 103.973  28.466  1.00 57.70  ?  110 GLY B CA  1 
ATOM 4055  C C   . GLY B  1 102 ? 135.147 103.487  27.050  1.00 61.12  ?  110 GLY B C   1 
ATOM 4056  O O   . GLY B  1 102 ? 134.960 104.297  26.137  1.00 73.32  ?  110 GLY B O   1 
ATOM 4057  N N   . GLN B  1 103 ? 135.156 102.172  26.852  1.00 57.18  ?  111 GLN B N   1 
ATOM 4058  C CA  . GLN B  1 103 ? 135.139 101.606  25.514  1.00 56.80  ?  111 GLN B CA  1 
ATOM 4059  C C   . GLN B  1 103 ? 133.810 101.883  24.807  1.00 56.69  ?  111 GLN B C   1 
ATOM 4060  O O   . GLN B  1 103 ? 132.811 102.213  25.449  1.00 56.65  ?  111 GLN B O   1 
ATOM 4061  C CB  . GLN B  1 103 ? 135.407 100.106  25.587  1.00 62.70  ?  111 GLN B CB  1 
ATOM 4062  C CG  . GLN B  1 103 ? 136.767 99.764   26.174  1.00 62.27  ?  111 GLN B CG  1 
ATOM 4063  C CD  . GLN B  1 103 ? 137.915 100.331  25.357  1.00 59.26  ?  111 GLN B CD  1 
ATOM 4064  O OE1 . GLN B  1 103 ? 138.388 99.698   24.413  1.00 60.79  ?  111 GLN B OE1 1 
ATOM 4065  N NE2 . GLN B  1 103 ? 138.375 101.523  25.724  1.00 56.14  ?  111 GLN B NE2 1 
ATOM 4066  N N   . PRO B  1 104 ? 133.781 101.777  23.479  1.00 55.49  ?  112 PRO B N   1 
ATOM 4067  C CA  . PRO B  1 104 ? 132.527 102.001  22.751  1.00 55.91  ?  112 PRO B CA  1 
ATOM 4068  C C   . PRO B  1 104 ? 131.526 100.878  22.972  1.00 53.51  ?  112 PRO B C   1 
ATOM 4069  O O   . PRO B  1 104 ? 131.866 99.762   23.371  1.00 50.98  ?  112 PRO B O   1 
ATOM 4070  C CB  . PRO B  1 104 ? 132.972 102.058  21.286  1.00 58.26  ?  112 PRO B CB  1 
ATOM 4071  C CG  . PRO B  1 104 ? 134.249 101.299  21.250  1.00 58.01  ?  112 PRO B CG  1 
ATOM 4072  C CD  . PRO B  1 104 ? 134.918 101.595  22.560  1.00 58.31  ?  112 PRO B CD  1 
ATOM 4073  N N   . LEU B  1 105 ? 130.265 101.196  22.691  1.00 52.97  ?  113 LEU B N   1 
ATOM 4074  C CA  . LEU B  1 105 ? 129.193 100.222  22.834  1.00 51.56  ?  113 LEU B CA  1 
ATOM 4075  C C   . LEU B  1 105 ? 129.311 99.140   21.769  1.00 51.60  ?  113 LEU B C   1 
ATOM 4076  O O   . LEU B  1 105 ? 129.547 99.428   20.593  1.00 53.94  ?  113 LEU B O   1 
ATOM 4077  C CB  . LEU B  1 105 ? 127.831 100.910  22.730  1.00 47.78  ?  113 LEU B CB  1 
ATOM 4078  C CG  . LEU B  1 105 ? 127.522 101.983  23.775  1.00 48.37  ?  113 LEU B CG  1 
ATOM 4079  C CD1 . LEU B  1 105 ? 126.096 102.479  23.622  1.00 49.10  ?  113 LEU B CD1 1 
ATOM 4080  C CD2 . LEU B  1 105 ? 127.762 101.455  25.177  1.00 47.62  ?  113 LEU B CD2 1 
ATOM 4081  N N   . GLY B  1 106 ? 129.146 97.890   22.188  1.00 54.07  ?  114 GLY B N   1 
ATOM 4082  C CA  . GLY B  1 106 ? 129.228 96.779   21.260  1.00 54.41  ?  114 GLY B CA  1 
ATOM 4083  C C   . GLY B  1 106 ? 128.600 95.530   21.832  1.00 49.79  ?  114 GLY B C   1 
ATOM 4084  O O   . GLY B  1 106 ? 128.364 95.423   23.040  1.00 49.51  ?  114 GLY B O   1 
ATOM 4085  N N   . VAL B  1 107 ? 128.328 94.580   20.942  1.00 51.90  ?  115 VAL B N   1 
ATOM 4086  C CA  . VAL B  1 107 ? 127.768 93.285   21.305  1.00 54.45  ?  115 VAL B CA  1 
ATOM 4087  C C   . VAL B  1 107 ? 128.801 92.210   21.005  1.00 54.97  ?  115 VAL B C   1 
ATOM 4088  O O   . VAL B  1 107 ? 129.444 92.231   19.948  1.00 55.03  ?  115 VAL B O   1 
ATOM 4089  C CB  . VAL B  1 107 ? 126.451 93.010   20.555  1.00 52.77  ?  115 VAL B CB  1 
ATOM 4090  C CG1 . VAL B  1 107 ? 125.770 91.770   21.113  1.00 55.42  ?  115 VAL B CG1 1 
ATOM 4091  C CG2 . VAL B  1 107 ? 125.533 94.216   20.647  1.00 56.30  ?  115 VAL B CG2 1 
ATOM 4092  N N   . GLY B  1 108 ? 128.960 91.274   21.933  1.00 56.21  ?  116 GLY B N   1 
ATOM 4093  C CA  . GLY B  1 108 ? 129.937 90.214   21.783  1.00 56.75  ?  116 GLY B CA  1 
ATOM 4094  C C   . GLY B  1 108 ? 129.317 88.852   22.007  1.00 58.18  ?  116 GLY B C   1 
ATOM 4095  O O   . GLY B  1 108 ? 128.333 88.703   22.731  1.00 63.74  ?  116 GLY B O   1 
ATOM 4096  N N   . LEU B  1 109 ? 129.914 87.850   21.368  1.00 52.84  ?  117 LEU B N   1 
ATOM 4097  C CA  . LEU B  1 109 ? 129.400 86.489   21.402  1.00 50.79  ?  117 LEU B CA  1 
ATOM 4098  C C   . LEU B  1 109 ? 130.168 85.627   22.393  1.00 52.17  ?  117 LEU B C   1 
ATOM 4099  O O   . LEU B  1 109 ? 131.355 85.840   22.651  1.00 51.22  ?  117 LEU B O   1 
ATOM 4100  C CB  . LEU B  1 109 ? 129.469 85.837   20.021  1.00 51.77  ?  117 LEU B CB  1 
ATOM 4101  C CG  . LEU B  1 109 ? 128.737 86.558   18.898  1.00 50.53  ?  117 LEU B CG  1 
ATOM 4102  C CD1 . LEU B  1 109 ? 128.840 85.766   17.605  1.00 48.26  ?  117 LEU B CD1 1 
ATOM 4103  C CD2 . LEU B  1 109 ? 127.292 86.790   19.292  1.00 52.52  ?  117 LEU B CD2 1 
ATOM 4104  N N   . SER B  1 110 ? 129.468 84.636   22.936  1.00 47.84  ?  118 SER B N   1 
ATOM 4105  C CA  . SER B  1 110 ? 130.064 83.579   23.739  1.00 48.24  ?  118 SER B CA  1 
ATOM 4106  C C   . SER B  1 110 ? 129.503 82.257   23.246  1.00 48.80  ?  118 SER B C   1 
ATOM 4107  O O   . SER B  1 110 ? 128.295 82.142   23.018  1.00 48.89  ?  118 SER B O   1 
ATOM 4108  C CB  . SER B  1 110 ? 129.771 83.768   25.229  1.00 49.60  ?  118 SER B CB  1 
ATOM 4109  O OG  . SER B  1 110 ? 130.080 85.086   25.643  1.00 53.26  ?  118 SER B OG  1 
ATOM 4110  N N   . GLY B  1 111 ? 130.374 81.272   23.059  1.00 45.92  ?  119 GLY B N   1 
ATOM 4111  C CA  . GLY B  1 111 ? 129.928 80.020   22.487  1.00 46.06  ?  119 GLY B CA  1 
ATOM 4112  C C   . GLY B  1 111 ? 130.600 78.783   23.042  1.00 46.80  ?  119 GLY B C   1 
ATOM 4113  O O   . GLY B  1 111 ? 131.294 78.830   24.062  1.00 47.22  ?  119 GLY B O   1 
ATOM 4114  N N   . HIS B  1 112 ? 130.389 77.666   22.361  1.00 50.76  ?  120 HIS B N   1 
ATOM 4115  C CA  . HIS B  1 112 ? 130.897 76.362   22.752  1.00 51.91  ?  120 HIS B CA  1 
ATOM 4116  C C   . HIS B  1 112 ? 130.975 75.484   21.510  1.00 52.63  ?  120 HIS B C   1 
ATOM 4117  O O   . HIS B  1 112 ? 129.999 75.388   20.750  1.00 52.64  ?  120 HIS B O   1 
ATOM 4118  C CB  . HIS B  1 112 ? 129.995 75.732   23.816  1.00 54.44  ?  120 HIS B CB  1 
ATOM 4119  C CG  . HIS B  1 112 ? 130.666 74.670   24.631  1.00 56.46  ?  120 HIS B CG  1 
ATOM 4120  N ND1 . HIS B  1 112 ? 131.235 73.548   24.071  1.00 58.39  ?  120 HIS B ND1 1 
ATOM 4121  C CD2 . HIS B  1 112 ? 130.849 74.557   25.968  1.00 56.93  ?  120 HIS B CD2 1 
ATOM 4122  C CE1 . HIS B  1 112 ? 131.744 72.791   25.026  1.00 62.97  ?  120 HIS B CE1 1 
ATOM 4123  N NE2 . HIS B  1 112 ? 131.524 73.381   26.187  1.00 62.07  ?  120 HIS B NE2 1 
ATOM 4124  N N   . PRO B  1 113 ? 132.125 74.856   21.252  1.00 50.83  ?  121 PRO B N   1 
ATOM 4125  C CA  . PRO B  1 113 ? 132.217 73.968   20.084  1.00 51.68  ?  121 PRO B CA  1 
ATOM 4126  C C   . PRO B  1 113 ? 131.366 72.724   20.225  1.00 52.86  ?  121 PRO B C   1 
ATOM 4127  O O   . PRO B  1 113 ? 130.874 72.204   19.216  1.00 55.61  ?  121 PRO B O   1 
ATOM 4128  C CB  . PRO B  1 113 ? 133.712 73.624   20.018  1.00 53.39  ?  121 PRO B CB  1 
ATOM 4129  C CG  . PRO B  1 113 ? 134.393 74.680   20.838  1.00 52.36  ?  121 PRO B CG  1 
ATOM 4130  C CD  . PRO B  1 113 ? 133.423 75.024   21.923  1.00 51.15  ?  121 PRO B CD  1 
ATOM 4131  N N   . LEU B  1 114 ? 131.175 72.233   21.447  1.00 54.47  ?  122 LEU B N   1 
ATOM 4132  C CA  . LEU B  1 114 ? 130.371 71.042   21.676  1.00 56.80  ?  122 LEU B CA  1 
ATOM 4133  C C   . LEU B  1 114 ? 129.140 71.392   22.497  1.00 55.28  ?  122 LEU B C   1 
ATOM 4134  O O   . LEU B  1 114 ? 128.924 70.839   23.579  1.00 56.95  ?  122 LEU B O   1 
ATOM 4135  C CB  . LEU B  1 114 ? 131.205 69.965   22.370  1.00 52.98  ?  122 LEU B CB  1 
ATOM 4136  C CG  . LEU B  1 114 ? 132.531 69.662   21.669  1.00 53.12  ?  122 LEU B CG  1 
ATOM 4137  C CD1 . LEU B  1 114 ? 133.290 68.565   22.393  1.00 53.96  ?  122 LEU B CD1 1 
ATOM 4138  C CD2 . LEU B  1 114 ? 132.288 69.282   20.216  1.00 53.10  ?  122 LEU B CD2 1 
ATOM 4139  N N   . TYR B  1 115 ? 128.333 72.315   21.983  1.00 56.68  ?  123 TYR B N   1 
ATOM 4140  C CA  . TYR B  1 115 ? 127.101 72.720   22.642  1.00 56.19  ?  123 TYR B CA  1 
ATOM 4141  C C   . TYR B  1 115 ? 126.037 71.649   22.446  1.00 56.87  ?  123 TYR B C   1 
ATOM 4142  O O   . TYR B  1 115 ? 125.917 71.066   21.365  1.00 57.46  ?  123 TYR B O   1 
ATOM 4143  C CB  . TYR B  1 115 ? 126.628 74.061   22.080  1.00 53.41  ?  123 TYR B CB  1 
ATOM 4144  C CG  . TYR B  1 115 ? 125.474 74.697   22.817  1.00 53.22  ?  123 TYR B CG  1 
ATOM 4145  C CD1 . TYR B  1 115 ? 125.695 75.495   23.932  1.00 56.48  ?  123 TYR B CD1 1 
ATOM 4146  C CD2 . TYR B  1 115 ? 124.167 74.519   22.386  1.00 55.39  ?  123 TYR B CD2 1 
ATOM 4147  C CE1 . TYR B  1 115 ? 124.643 76.088   24.605  1.00 58.08  ?  123 TYR B CE1 1 
ATOM 4148  C CE2 . TYR B  1 115 ? 123.108 75.108   23.053  1.00 57.84  ?  123 TYR B CE2 1 
ATOM 4149  C CZ  . TYR B  1 115 ? 123.352 75.891   24.161  1.00 58.18  ?  123 TYR B CZ  1 
ATOM 4150  O OH  . TYR B  1 115 ? 122.300 76.479   24.827  1.00 56.77  ?  123 TYR B OH  1 
ATOM 4151  N N   . ASN B  1 116 ? 125.263 71.387   23.499  1.00 55.37  ?  124 ASN B N   1 
ATOM 4152  C CA  . ASN B  1 116 ? 124.260 70.323   23.459  1.00 56.53  ?  124 ASN B CA  1 
ATOM 4153  C C   . ASN B  1 116 ? 123.009 70.840   22.752  1.00 56.23  ?  124 ASN B C   1 
ATOM 4154  O O   . ASN B  1 116 ? 122.023 71.254   23.367  1.00 56.13  ?  124 ASN B O   1 
ATOM 4155  C CB  . ASN B  1 116 ? 123.943 69.819   24.860  1.00 57.13  ?  124 ASN B CB  1 
ATOM 4156  C CG  . ASN B  1 116 ? 122.974 68.654   24.850  1.00 59.48  ?  124 ASN B CG  1 
ATOM 4157  O OD1 . ASN B  1 116 ? 122.804 67.983   23.831  1.00 60.39  ?  124 ASN B OD1 1 
ATOM 4158  N ND2 . ASN B  1 116 ? 122.329 68.410   25.983  1.00 67.66  ?  124 ASN B ND2 1 
ATOM 4159  N N   . LYS B  1 117 ? 123.059 70.804   21.422  1.00 63.72  ?  125 LYS B N   1 
ATOM 4160  C CA  . LYS B  1 117 ? 121.941 71.195   20.569  1.00 62.24  ?  125 LYS B CA  1 
ATOM 4161  C C   . LYS B  1 117 ? 121.542 69.981   19.742  1.00 64.83  ?  125 LYS B C   1 
ATOM 4162  O O   . LYS B  1 117 ? 122.286 69.558   18.849  1.00 65.60  ?  125 LYS B O   1 
ATOM 4163  C CB  . LYS B  1 117 ? 122.314 72.375   19.672  1.00 60.98  ?  125 LYS B CB  1 
ATOM 4164  C CG  . LYS B  1 117 ? 121.292 72.669   18.585  1.00 62.09  ?  125 LYS B CG  1 
ATOM 4165  C CD  . LYS B  1 117 ? 121.795 73.741   17.631  1.00 60.64  ?  125 LYS B CD  1 
ATOM 4166  C CE  . LYS B  1 117 ? 121.232 73.540   16.233  1.00 64.99  ?  125 LYS B CE  1 
ATOM 4167  N NZ  . LYS B  1 117 ? 121.987 74.319   15.211  1.00 65.52  1  125 LYS B NZ  1 
ATOM 4168  N N   . LEU B  1 118 ? 120.372 69.422   20.036  1.00 57.37  ?  126 LEU B N   1 
ATOM 4169  C CA  . LEU B  1 118 ? 119.890 68.231   19.328  1.00 60.14  ?  126 LEU B CA  1 
ATOM 4170  C C   . LEU B  1 118 ? 119.145 68.641   18.060  1.00 64.52  ?  126 LEU B C   1 
ATOM 4171  O O   . LEU B  1 118 ? 119.659 68.484   16.949  1.00 69.08  ?  126 LEU B O   1 
ATOM 4172  C CB  . LEU B  1 118 ? 119.015 67.385   20.254  1.00 62.73  ?  126 LEU B CB  1 
ATOM 4173  C CG  . LEU B  1 118 ? 118.407 66.116   19.656  1.00 63.57  ?  126 LEU B CG  1 
ATOM 4174  C CD1 . LEU B  1 118 ? 119.498 65.192   19.143  1.00 63.57  ?  126 LEU B CD1 1 
ATOM 4175  C CD2 . LEU B  1 118 ? 117.542 65.407   20.685  1.00 64.22  ?  126 LEU B CD2 1 
ATOM 4176  N N   . ASP B  1 119 ? 117.931 69.160   18.216  1.00 60.13  ?  127 ASP B N   1 
ATOM 4177  C CA  . ASP B  1 119 ? 117.082 69.528   17.094  1.00 61.85  ?  127 ASP B CA  1 
ATOM 4178  C C   . ASP B  1 119 ? 116.603 70.963   17.247  1.00 59.55  ?  127 ASP B C   1 
ATOM 4179  O O   . ASP B  1 119 ? 116.437 71.464   18.362  1.00 66.20  ?  127 ASP B O   1 
ATOM 4180  C CB  . ASP B  1 119 ? 115.866 68.600   16.975  1.00 70.04  ?  127 ASP B CB  1 
ATOM 4181  C CG  . ASP B  1 119 ? 116.229 67.231   16.451  1.00 80.00  ?  127 ASP B CG  1 
ATOM 4182  O OD1 . ASP B  1 119 ? 117.262 67.117   15.761  1.00 79.63  ?  127 ASP B OD1 1 
ATOM 4183  O OD2 . ASP B  1 119 ? 115.481 66.270   16.727  1.00 89.38  -1 127 ASP B OD2 1 
ATOM 4184  N N   . ASP B  1 120 ? 116.387 71.623   16.113  1.00 57.27  ?  128 ASP B N   1 
ATOM 4185  C CA  . ASP B  1 120 ? 115.734 72.924   16.114  1.00 56.37  ?  128 ASP B CA  1 
ATOM 4186  C C   . ASP B  1 120 ? 114.242 72.684   16.312  1.00 58.44  ?  128 ASP B C   1 
ATOM 4187  O O   . ASP B  1 120 ? 113.591 72.054   15.472  1.00 60.98  ?  128 ASP B O   1 
ATOM 4188  C CB  . ASP B  1 120 ? 116.027 73.669   14.812  1.00 63.31  ?  128 ASP B CB  1 
ATOM 4189  C CG  . ASP B  1 120 ? 115.482 75.092   14.801  1.00 65.59  ?  128 ASP B CG  1 
ATOM 4190  O OD1 . ASP B  1 120 ? 114.297 75.300   15.138  1.00 70.56  ?  128 ASP B OD1 1 
ATOM 4191  O OD2 . ASP B  1 120 ? 116.249 76.011   14.449  1.00 63.31  -1 128 ASP B OD2 1 
ATOM 4192  N N   . THR B  1 121 ? 113.707 73.189   17.422  1.00 52.42  ?  129 THR B N   1 
ATOM 4193  C CA  . THR B  1 121 ? 112.327 72.962   17.831  1.00 54.39  ?  129 THR B CA  1 
ATOM 4194  C C   . THR B  1 121 ? 111.412 74.146   17.543  1.00 54.57  ?  129 THR B C   1 
ATOM 4195  O O   . THR B  1 121 ? 110.297 74.196   18.074  1.00 55.91  ?  129 THR B O   1 
ATOM 4196  C CB  . THR B  1 121 ? 112.275 72.611   19.318  1.00 52.55  ?  129 THR B CB  1 
ATOM 4197  O OG1 . THR B  1 121 ? 112.868 73.670   20.079  1.00 49.74  ?  129 THR B OG1 1 
ATOM 4198  C CG2 . THR B  1 121 ? 113.030 71.316   19.584  1.00 53.03  ?  129 THR B CG2 1 
ATOM 4199  N N   . GLU B  1 122 ? 111.844 75.090   16.710  1.00 54.97  ?  130 GLU B N   1 
ATOM 4200  C CA  . GLU B  1 122 ? 111.066 76.303   16.495  1.00 55.05  ?  130 GLU B CA  1 
ATOM 4201  C C   . GLU B  1 122 ? 110.209 76.197   15.240  1.00 57.83  ?  130 GLU B C   1 
ATOM 4202  O O   . GLU B  1 122 ? 108.982 76.120   15.332  1.00 59.91  ?  130 GLU B O   1 
ATOM 4203  C CB  . GLU B  1 122 ? 112.001 77.514   16.410  1.00 54.44  ?  130 GLU B CB  1 
ATOM 4204  C CG  . GLU B  1 122 ? 111.297 78.859   16.337  1.00 54.33  ?  130 GLU B CG  1 
ATOM 4205  C CD  . GLU B  1 122 ? 112.194 79.961   15.810  1.00 52.49  ?  130 GLU B CD  1 
ATOM 4206  O OE1 . GLU B  1 122 ? 111.780 81.138   15.860  1.00 52.09  ?  130 GLU B OE1 1 
ATOM 4207  O OE2 . GLU B  1 122 ? 113.317 79.654   15.360  1.00 51.58  -1 130 GLU B OE2 1 
ATOM 4208  N N   . ASN B  1 123 ? 110.831 76.183   14.069  1.00 63.33  ?  131 ASN B N   1 
ATOM 4209  C CA  . ASN B  1 123 ? 110.109 75.944   12.826  1.00 66.26  ?  131 ASN B CA  1 
ATOM 4210  C C   . ASN B  1 123 ? 111.055 75.255   11.849  1.00 66.96  ?  131 ASN B C   1 
ATOM 4211  O O   . ASN B  1 123 ? 111.269 75.708   10.724  1.00 72.51  ?  131 ASN B O   1 
ATOM 4212  C CB  . ASN B  1 123 ? 109.540 77.243   12.257  1.00 57.04  ?  131 ASN B CB  1 
ATOM 4213  C CG  . ASN B  1 123 ? 108.715 77.015   11.001  1.00 60.37  ?  131 ASN B CG  1 
ATOM 4214  O OD1 . ASN B  1 123 ? 107.930 76.070   10.926  1.00 62.88  ?  131 ASN B OD1 1 
ATOM 4215  N ND2 . ASN B  1 123 ? 108.891 77.880   10.008  1.00 60.64  ?  131 ASN B ND2 1 
ATOM 4216  N N   . SER B  1 124 ? 111.654 74.153   12.285  1.00 85.59  ?  132 SER B N   1 
ATOM 4217  C CA  . SER B  1 124 ? 112.634 73.459   11.464  1.00 92.98  ?  132 SER B CA  1 
ATOM 4218  C C   . SER B  1 124 ? 111.941 72.505   10.501  1.00 101.30 ?  132 SER B C   1 
ATOM 4219  O O   . SER B  1 124 ? 111.263 71.562   10.922  1.00 101.02 ?  132 SER B O   1 
ATOM 4220  C CB  . SER B  1 124 ? 113.626 72.706   12.347  1.00 90.51  ?  132 SER B CB  1 
ATOM 4221  O OG  . SER B  1 124 ? 114.666 72.138   11.571  1.00 90.82  ?  132 SER B OG  1 
ATOM 4222  N N   . HIS B  1 125 ? 112.107 72.769   9.206   1.00 119.87 ?  133 HIS B N   1 
ATOM 4223  C CA  . HIS B  1 125 ? 111.710 71.861   8.141   1.00 130.58 ?  133 HIS B CA  1 
ATOM 4224  C C   . HIS B  1 125 ? 112.919 71.285   7.417   1.00 130.58 ?  133 HIS B C   1 
ATOM 4225  O O   . HIS B  1 125 ? 112.767 70.672   6.354   1.00 134.86 ?  133 HIS B O   1 
ATOM 4226  C CB  . HIS B  1 125 ? 110.788 72.580   7.151   1.00 138.99 ?  133 HIS B CB  1 
ATOM 4227  C CG  . HIS B  1 125 ? 110.081 71.663   6.201   1.00 149.60 ?  133 HIS B CG  1 
ATOM 4228  N ND1 . HIS B  1 125 ? 109.727 70.373   6.532   1.00 154.18 ?  133 HIS B ND1 1 
ATOM 4229  C CD2 . HIS B  1 125 ? 109.679 71.846   4.921   1.00 152.50 ?  133 HIS B CD2 1 
ATOM 4230  C CE1 . HIS B  1 125 ? 109.131 69.803   5.500   1.00 158.37 ?  133 HIS B CE1 1 
ATOM 4231  N NE2 . HIS B  1 125 ? 109.089 70.676   4.509   1.00 157.59 ?  133 HIS B NE2 1 
ATOM 4232  N N   . VAL B  1 126 ? 114.117 71.457   7.974   1.00 131.31 ?  134 VAL B N   1 
ATOM 4233  C CA  . VAL B  1 126 ? 115.320 70.962   7.314   1.00 130.82 ?  134 VAL B CA  1 
ATOM 4234  C C   . VAL B  1 126 ? 115.417 69.446   7.451   1.00 136.09 ?  134 VAL B C   1 
ATOM 4235  O O   . VAL B  1 126 ? 115.350 68.711   6.459   1.00 145.23 ?  134 VAL B O   1 
ATOM 4236  C CB  . VAL B  1 126 ? 116.569 71.662   7.876   1.00 138.88 ?  134 VAL B CB  1 
ATOM 4237  C CG1 . VAL B  1 126 ? 117.799 71.280   7.066   1.00 137.92 ?  134 VAL B CG1 1 
ATOM 4238  C CG2 . VAL B  1 126 ? 116.371 73.172   7.887   1.00 134.71 ?  134 VAL B CG2 1 
ATOM 4239  N N   . ALA B  1 127 ? 115.554 68.959   8.679   1.00 134.96 ?  135 ALA B N   1 
ATOM 4240  C CA  . ALA B  1 127 ? 115.694 67.529   8.952   1.00 137.21 ?  135 ALA B CA  1 
ATOM 4241  C C   . ALA B  1 127 ? 115.539 67.310   10.454  1.00 137.84 ?  135 ALA B C   1 
ATOM 4242  O O   . ALA B  1 127 ? 115.179 68.228   11.201  1.00 138.04 ?  135 ALA B O   1 
ATOM 4243  C CB  . ALA B  1 127 ? 117.032 66.992   8.439   1.00 140.66 ?  135 ALA B CB  1 
ATOM 4244  N N   . SER B  1 128 ? 115.805 66.079   10.893  1.00 126.47 ?  136 SER B N   1 
ATOM 4245  C CA  . SER B  1 128 ? 115.802 65.701   12.299  1.00 122.74 ?  136 SER B CA  1 
ATOM 4246  C C   . SER B  1 128 ? 117.046 64.869   12.579  1.00 125.36 ?  136 SER B C   1 
ATOM 4247  O O   . SER B  1 128 ? 117.413 64.001   11.781  1.00 128.27 ?  136 SER B O   1 
ATOM 4248  C CB  . SER B  1 128 ? 114.535 64.916   12.670  1.00 111.22 ?  136 SER B CB  1 
ATOM 4249  O OG  . SER B  1 128 ? 114.568 64.499   14.025  1.00 107.81 ?  136 SER B OG  1 
ATOM 4250  N N   . ALA B  1 129 ? 117.694 65.139   13.709  1.00 117.38 ?  137 ALA B N   1 
ATOM 4251  C CA  . ALA B  1 129 ? 118.979 64.531   14.026  1.00 120.08 ?  137 ALA B CA  1 
ATOM 4252  C C   . ALA B  1 129 ? 118.809 63.208   14.765  1.00 124.56 ?  137 ALA B C   1 
ATOM 4253  O O   . ALA B  1 129 ? 117.878 63.022   15.554  1.00 124.41 ?  137 ALA B O   1 
ATOM 4254  C CB  . ALA B  1 129 ? 119.834 65.483   14.865  1.00 112.03 ?  137 ALA B CB  1 
ATOM 4255  N N   . VAL B  1 130 ? 119.732 62.286   14.493  1.00 126.60 ?  138 VAL B N   1 
ATOM 4256  C CA  . VAL B  1 130 ? 119.764 60.985   15.152  1.00 130.54 ?  138 VAL B CA  1 
ATOM 4257  C C   . VAL B  1 130 ? 120.481 61.118   16.490  1.00 136.05 ?  138 VAL B C   1 
ATOM 4258  O O   . VAL B  1 130 ? 121.483 61.835   16.611  1.00 136.21 ?  138 VAL B O   1 
ATOM 4259  C CB  . VAL B  1 130 ? 120.443 59.942   14.245  1.00 120.91 ?  138 VAL B CB  1 
ATOM 4260  C CG1 . VAL B  1 130 ? 120.478 58.577   14.918  1.00 123.39 ?  138 VAL B CG1 1 
ATOM 4261  C CG2 . VAL B  1 130 ? 119.729 59.863   12.903  1.00 123.03 ?  138 VAL B CG2 1 
ATOM 4262  N N   . ASP B  1 131 ? 119.962 60.425   17.507  1.00 128.55 ?  139 ASP B N   1 
ATOM 4263  C CA  . ASP B  1 131 ? 120.452 60.566   18.874  1.00 125.64 ?  139 ASP B CA  1 
ATOM 4264  C C   . ASP B  1 131 ? 121.704 59.741   19.163  1.00 126.71 ?  139 ASP B C   1 
ATOM 4265  O O   . ASP B  1 131 ? 122.393 60.024   20.149  1.00 126.57 ?  139 ASP B O   1 
ATOM 4266  C CB  . ASP B  1 131 ? 119.337 60.178   19.853  1.00 124.26 ?  139 ASP B CB  1 
ATOM 4267  C CG  . ASP B  1 131 ? 119.745 60.339   21.306  1.00 116.85 ?  139 ASP B CG  1 
ATOM 4268  O OD1 . ASP B  1 131 ? 119.722 61.482   21.812  1.00 108.82 ?  139 ASP B OD1 1 
ATOM 4269  O OD2 . ASP B  1 131 ? 120.083 59.319   21.943  1.00 116.82 -1 139 ASP B OD2 1 
ATOM 4270  N N   . THR B  1 132 ? 122.019 58.744   18.332  1.00 129.75 ?  140 THR B N   1 
ATOM 4271  C CA  . THR B  1 132 ? 123.090 57.800   18.652  1.00 123.31 ?  140 THR B CA  1 
ATOM 4272  C C   . THR B  1 132 ? 124.433 58.500   18.848  1.00 116.20 ?  140 THR B C   1 
ATOM 4273  O O   . THR B  1 132 ? 125.027 58.442   19.931  1.00 115.85 ?  140 THR B O   1 
ATOM 4274  C CB  . THR B  1 132 ? 123.197 56.738   17.556  1.00 125.62 ?  140 THR B CB  1 
ATOM 4275  O OG1 . THR B  1 132 ? 121.968 56.005   17.475  1.00 128.37 ?  140 THR B OG1 1 
ATOM 4276  C CG2 . THR B  1 132 ? 124.338 55.776   17.856  1.00 123.72 ?  140 THR B CG2 1 
ATOM 4277  N N   . LYS B  1 133 ? 124.932 59.163   17.807  1.00 115.73 ?  141 LYS B N   1 
ATOM 4278  C CA  . LYS B  1 133 ? 126.288 59.702   17.822  1.00 109.82 ?  141 LYS B CA  1 
ATOM 4279  C C   . LYS B  1 133 ? 126.344 60.991   18.644  1.00 103.76 ?  141 LYS B C   1 
ATOM 4280  O O   . LYS B  1 133 ? 125.372 61.399   19.286  1.00 101.98 ?  141 LYS B O   1 
ATOM 4281  C CB  . LYS B  1 133 ? 126.784 59.920   16.395  1.00 104.80 ?  141 LYS B CB  1 
ATOM 4282  C CG  . LYS B  1 133 ? 126.570 58.734   15.468  1.00 109.84 ?  141 LYS B CG  1 
ATOM 4283  C CD  . LYS B  1 133 ? 127.284 57.494   15.982  1.00 111.60 ?  141 LYS B CD  1 
ATOM 4284  C CE  . LYS B  1 133 ? 128.796 57.673   15.953  1.00 107.70 ?  141 LYS B CE  1 
ATOM 4285  N NZ  . LYS B  1 133 ? 129.514 56.438   16.376  1.00 107.90 1  141 LYS B NZ  1 
ATOM 4286  N N   . ASP B  1 134 ? 127.505 61.647   18.630  1.00 95.41  ?  142 ASP B N   1 
ATOM 4287  C CA  . ASP B  1 134 ? 127.722 62.899   19.355  1.00 86.19  ?  142 ASP B CA  1 
ATOM 4288  C C   . ASP B  1 134 ? 127.024 64.018   18.594  1.00 82.13  ?  142 ASP B C   1 
ATOM 4289  O O   . ASP B  1 134 ? 127.594 64.649   17.703  1.00 81.41  ?  142 ASP B O   1 
ATOM 4290  C CB  . ASP B  1 134 ? 129.212 63.179   19.519  1.00 79.57  ?  142 ASP B CB  1 
ATOM 4291  C CG  . ASP B  1 134 ? 129.486 64.480   20.254  1.00 74.24  ?  142 ASP B CG  1 
ATOM 4292  O OD1 . ASP B  1 134 ? 128.619 64.918   21.039  1.00 75.34  ?  142 ASP B OD1 1 
ATOM 4293  O OD2 . ASP B  1 134 ? 130.568 65.068   20.044  1.00 70.39  -1 142 ASP B OD2 1 
ATOM 4294  N N   . THR B  1 135 ? 125.770 64.273   18.958  1.00 83.60  ?  143 THR B N   1 
ATOM 4295  C CA  . THR B  1 135 ? 124.969 65.300   18.294  1.00 77.66  ?  143 THR B CA  1 
ATOM 4296  C C   . THR B  1 135 ? 125.113 66.641   19.016  1.00 70.61  ?  143 THR B C   1 
ATOM 4297  O O   . THR B  1 135 ? 124.157 67.227   19.525  1.00 70.40  ?  143 THR B O   1 
ATOM 4298  C CB  . THR B  1 135 ? 123.511 64.857   18.217  1.00 77.42  ?  143 THR B CB  1 
ATOM 4299  O OG1 . THR B  1 135 ? 122.680 65.981   17.899  1.00 83.74  ?  143 THR B OG1 1 
ATOM 4300  C CG2 . THR B  1 135 ? 123.065 64.238   19.539  1.00 70.93  ?  143 THR B CG2 1 
ATOM 4301  N N   . ARG B  1 136 ? 126.352 67.128   19.042  1.00 62.80  ?  144 ARG B N   1 
ATOM 4302  C CA  . ARG B  1 136 ? 126.691 68.401   19.666  1.00 60.30  ?  144 ARG B CA  1 
ATOM 4303  C C   . ARG B  1 136 ? 127.278 69.322   18.607  1.00 59.44  ?  144 ARG B C   1 
ATOM 4304  O O   . ARG B  1 136 ? 128.312 69.008   18.009  1.00 67.21  ?  144 ARG B O   1 
ATOM 4305  C CB  . ARG B  1 136 ? 127.669 68.210   20.827  1.00 57.94  ?  144 ARG B CB  1 
ATOM 4306  C CG  . ARG B  1 136 ? 127.025 67.644   22.085  1.00 58.39  ?  144 ARG B CG  1 
ATOM 4307  C CD  . ARG B  1 136 ? 127.978 67.684   23.267  1.00 57.53  ?  144 ARG B CD  1 
ATOM 4308  N NE  . ARG B  1 136 ? 129.201 66.929   23.016  1.00 58.54  ?  144 ARG B NE  1 
ATOM 4309  C CZ  . ARG B  1 136 ? 130.143 66.710   23.927  1.00 58.45  ?  144 ARG B CZ  1 
ATOM 4310  N NH1 . ARG B  1 136 ? 130.003 67.191   25.155  1.00 59.57  1  144 ARG B NH1 1 
ATOM 4311  N NH2 . ARG B  1 136 ? 131.225 66.011   23.612  1.00 59.63  ?  144 ARG B NH2 1 
ATOM 4312  N N   . ASP B  1 137 ? 126.621 70.455   18.386  1.00 57.70  ?  145 ASP B N   1 
ATOM 4313  C CA  . ASP B  1 137 ? 126.995 71.416   17.360  1.00 57.11  ?  145 ASP B CA  1 
ATOM 4314  C C   . ASP B  1 137 ? 127.805 72.559   17.961  1.00 54.94  ?  145 ASP B C   1 
ATOM 4315  O O   . ASP B  1 137 ? 127.764 72.817   19.165  1.00 53.73  ?  145 ASP B O   1 
ATOM 4316  C CB  . ASP B  1 137 ? 125.749 71.968   16.661  1.00 63.32  ?  145 ASP B CB  1 
ATOM 4317  C CG  . ASP B  1 137 ? 124.831 70.869   16.144  1.00 79.06  ?  145 ASP B CG  1 
ATOM 4318  O OD1 . ASP B  1 137 ? 125.022 69.697   16.533  1.00 85.60  ?  145 ASP B OD1 1 
ATOM 4319  O OD2 . ASP B  1 137 ? 123.912 71.180   15.355  1.00 83.34  -1 145 ASP B OD2 1 
ATOM 4320  N N   . ASN B  1 138 ? 128.559 73.237   17.097  1.00 58.11  ?  146 ASN B N   1 
ATOM 4321  C CA  . ASN B  1 138 ? 129.314 74.424   17.487  1.00 55.84  ?  146 ASN B CA  1 
ATOM 4322  C C   . ASN B  1 138 ? 128.360 75.613   17.493  1.00 54.99  ?  146 ASN B C   1 
ATOM 4323  O O   . ASN B  1 138 ? 127.932 76.080   16.432  1.00 57.40  ?  146 ASN B O   1 
ATOM 4324  C CB  . ASN B  1 138 ? 130.480 74.648   16.528  1.00 57.31  ?  146 ASN B CB  1 
ATOM 4325  C CG  . ASN B  1 138 ? 131.462 75.695   17.024  1.00 54.20  ?  146 ASN B CG  1 
ATOM 4326  O OD1 . ASN B  1 138 ? 131.103 76.591   17.786  1.00 55.43  ?  146 ASN B OD1 1 
ATOM 4327  N ND2 . ASN B  1 138 ? 132.712 75.586   16.586  1.00 51.22  ?  146 ASN B ND2 1 
ATOM 4328  N N   . VAL B  1 139 ? 128.023 76.105   18.684  1.00 46.68  ?  147 VAL B N   1 
ATOM 4329  C CA  . VAL B  1 139 ? 126.957 77.086   18.850  1.00 46.68  ?  147 VAL B CA  1 
ATOM 4330  C C   . VAL B  1 139 ? 127.490 78.284   19.620  1.00 46.09  ?  147 VAL B C   1 
ATOM 4331  O O   . VAL B  1 139 ? 128.128 78.120   20.664  1.00 45.91  ?  147 VAL B O   1 
ATOM 4332  C CB  . VAL B  1 139 ? 125.744 76.475   19.577  1.00 48.14  ?  147 VAL B CB  1 
ATOM 4333  C CG1 . VAL B  1 139 ? 124.878 77.561   20.186  1.00 48.03  ?  147 VAL B CG1 1 
ATOM 4334  C CG2 . VAL B  1 139 ? 124.938 75.609   18.622  1.00 48.76  ?  147 VAL B CG2 1 
ATOM 4335  N N   . SER B  1 140 ? 127.215 79.483   19.115  1.00 43.10  ?  148 SER B N   1 
ATOM 4336  C CA  . SER B  1 140 ? 127.500 80.726   19.816  1.00 42.61  ?  148 SER B CA  1 
ATOM 4337  C C   . SER B  1 140 ? 126.197 81.470   20.077  1.00 42.77  ?  148 SER B C   1 
ATOM 4338  O O   . SER B  1 140 ? 125.151 81.169   19.494  1.00 43.21  ?  148 SER B O   1 
ATOM 4339  C CB  . SER B  1 140 ? 128.469 81.607   19.018  1.00 46.96  ?  148 SER B CB  1 
ATOM 4340  O OG  . SER B  1 140 ? 127.837 82.165   17.880  1.00 46.66  ?  148 SER B OG  1 
ATOM 4341  N N   . VAL B  1 141 ? 126.265 82.458   20.968  1.00 47.95  ?  149 VAL B N   1 
ATOM 4342  C CA  . VAL B  1 141 ? 125.074 83.185   21.384  1.00 46.82  ?  149 VAL B CA  1 
ATOM 4343  C C   . VAL B  1 141 ? 125.510 84.497   22.016  1.00 46.14  ?  149 VAL B C   1 
ATOM 4344  O O   . VAL B  1 141 ? 126.577 84.583   22.631  1.00 44.63  ?  149 VAL B O   1 
ATOM 4345  C CB  . VAL B  1 141 ? 124.218 82.329   22.355  1.00 43.03  ?  149 VAL B CB  1 
ATOM 4346  C CG1 . VAL B  1 141 ? 124.892 82.204   23.716  1.00 42.83  ?  149 VAL B CG1 1 
ATOM 4347  C CG2 . VAL B  1 141 ? 122.823 82.897   22.483  1.00 43.30  ?  149 VAL B CG2 1 
ATOM 4348  N N   . ASP B  1 142 ? 124.691 85.533   21.838  1.00 47.97  ?  150 ASP B N   1 
ATOM 4349  C CA  . ASP B  1 142 ? 124.873 86.792   22.548  1.00 48.24  ?  150 ASP B CA  1 
ATOM 4350  C C   . ASP B  1 142 ? 123.996 86.785   23.794  1.00 54.41  ?  150 ASP B C   1 
ATOM 4351  O O   . ASP B  1 142 ? 122.789 86.532   23.717  1.00 61.91  ?  150 ASP B O   1 
ATOM 4352  C CB  . ASP B  1 142 ? 124.545 87.989   21.652  1.00 49.55  ?  150 ASP B CB  1 
ATOM 4353  C CG  . ASP B  1 142 ? 123.076 88.071   21.296  1.00 54.88  ?  150 ASP B CG  1 
ATOM 4354  O OD1 . ASP B  1 142 ? 122.497 87.027   20.925  1.00 59.25  ?  150 ASP B OD1 1 
ATOM 4355  O OD2 . ASP B  1 142 ? 122.500 89.175   21.398  1.00 54.28  -1 150 ASP B OD2 1 
ATOM 4356  N N   . TYR B  1 143 ? 124.609 87.047   24.942  1.00 54.97  ?  151 TYR B N   1 
ATOM 4357  C CA  . TYR B  1 143 ? 123.930 86.852   26.210  1.00 51.25  ?  151 TYR B CA  1 
ATOM 4358  C C   . TYR B  1 143 ? 122.866 87.923   26.450  1.00 52.37  ?  151 TYR B C   1 
ATOM 4359  O O   . TYR B  1 143 ? 122.716 88.889   25.694  1.00 48.36  ?  151 TYR B O   1 
ATOM 4360  C CB  . TYR B  1 143 ? 124.932 86.867   27.358  1.00 48.64  ?  151 TYR B CB  1 
ATOM 4361  C CG  . TYR B  1 143 ? 125.726 85.597   27.512  1.00 48.79  ?  151 TYR B CG  1 
ATOM 4362  C CD1 . TYR B  1 143 ? 125.166 84.361   27.221  1.00 45.88  ?  151 TYR B CD1 1 
ATOM 4363  C CD2 . TYR B  1 143 ? 127.031 85.633   27.978  1.00 52.54  ?  151 TYR B CD2 1 
ATOM 4364  C CE1 . TYR B  1 143 ? 125.892 83.199   27.377  1.00 47.32  ?  151 TYR B CE1 1 
ATOM 4365  C CE2 . TYR B  1 143 ? 127.763 84.481   28.138  1.00 52.54  ?  151 TYR B CE2 1 
ATOM 4366  C CZ  . TYR B  1 143 ? 127.192 83.268   27.837  1.00 51.85  ?  151 TYR B CZ  1 
ATOM 4367  O OH  . TYR B  1 143 ? 127.935 82.126   28.002  1.00 57.57  ?  151 TYR B OH  1 
ATOM 4368  N N   . LYS B  1 144 ? 122.114 87.716   27.531  1.00 58.48  ?  152 LYS B N   1 
ATOM 4369  C CA  . LYS B  1 144 ? 121.165 88.703   28.027  1.00 46.44  ?  152 LYS B CA  1 
ATOM 4370  C C   . LYS B  1 144 ? 121.879 89.993   28.408  1.00 42.44  ?  152 LYS B C   1 
ATOM 4371  O O   . LYS B  1 144 ? 122.987 89.970   28.952  1.00 45.62  ?  152 LYS B O   1 
ATOM 4372  C CB  . LYS B  1 144 ? 120.434 88.121   29.235  1.00 41.31  ?  152 LYS B CB  1 
ATOM 4373  C CG  . LYS B  1 144 ? 119.965 89.129   30.255  1.00 47.07  ?  152 LYS B CG  1 
ATOM 4374  C CD  . LYS B  1 144 ? 119.361 88.419   31.453  1.00 51.58  ?  152 LYS B CD  1 
ATOM 4375  C CE  . LYS B  1 144 ? 119.051 89.394   32.568  1.00 51.91  ?  152 LYS B CE  1 
ATOM 4376  N NZ  . LYS B  1 144 ? 118.530 88.701   33.779  1.00 56.73  1  152 LYS B NZ  1 
ATOM 4377  N N   . GLN B  1 145 ? 121.234 91.127   28.136  1.00 42.64  ?  153 GLN B N   1 
ATOM 4378  C CA  . GLN B  1 145 ? 121.824 92.430   28.417  1.00 42.02  ?  153 GLN B CA  1 
ATOM 4379  C C   . GLN B  1 145 ? 121.496 92.846   29.846  1.00 41.82  ?  153 GLN B C   1 
ATOM 4380  O O   . GLN B  1 145 ? 120.328 92.835   30.248  1.00 46.07  ?  153 GLN B O   1 
ATOM 4381  C CB  . GLN B  1 145 ? 121.325 93.471   27.413  1.00 42.58  ?  153 GLN B CB  1 
ATOM 4382  C CG  . GLN B  1 145 ? 121.896 94.864   27.611  1.00 47.29  ?  153 GLN B CG  1 
ATOM 4383  C CD  . GLN B  1 145 ? 121.215 95.901   26.732  1.00 50.82  ?  153 GLN B CD  1 
ATOM 4384  O OE1 . GLN B  1 145 ? 120.813 95.606   25.606  1.00 46.55  ?  153 GLN B OE1 1 
ATOM 4385  N NE2 . GLN B  1 145 ? 121.082 97.120   27.245  1.00 54.33  ?  153 GLN B NE2 1 
ATOM 4386  N N   . THR B  1 146 ? 122.526 93.221   30.606  1.00 43.64  ?  154 THR B N   1 
ATOM 4387  C CA  . THR B  1 146 ? 122.373 93.532   32.023  1.00 44.15  ?  154 THR B CA  1 
ATOM 4388  C C   . THR B  1 146 ? 123.228 94.732   32.400  1.00 43.06  ?  154 THR B C   1 
ATOM 4389  O O   . THR B  1 146 ? 124.435 94.744   32.143  1.00 45.36  ?  154 THR B O   1 
ATOM 4390  C CB  . THR B  1 146 ? 122.761 92.330   32.897  1.00 46.05  ?  154 THR B CB  1 
ATOM 4391  O OG1 . THR B  1 146 ? 122.049 91.165   32.462  1.00 47.79  ?  154 THR B OG1 1 
ATOM 4392  C CG2 . THR B  1 146 ? 122.434 92.600   34.358  1.00 47.53  ?  154 THR B CG2 1 
ATOM 4393  N N   . GLN B  1 147 ? 122.599 95.729   33.021  1.00 43.37  ?  155 GLN B N   1 
ATOM 4394  C CA  . GLN B  1 147 ? 123.290 96.866   33.621  1.00 42.79  ?  155 GLN B CA  1 
ATOM 4395  C C   . GLN B  1 147 ? 122.849 96.969   35.073  1.00 45.66  ?  155 GLN B C   1 
ATOM 4396  O O   . GLN B  1 147 ? 121.651 97.086   35.345  1.00 47.33  ?  155 GLN B O   1 
ATOM 4397  C CB  . GLN B  1 147 ? 122.964 98.170   32.890  1.00 43.19  ?  155 GLN B CB  1 
ATOM 4398  C CG  . GLN B  1 147 ? 123.243 98.175   31.406  1.00 43.22  ?  155 GLN B CG  1 
ATOM 4399  C CD  . GLN B  1 147 ? 122.856 99.494   30.766  1.00 43.87  ?  155 GLN B CD  1 
ATOM 4400  O OE1 . GLN B  1 147 ? 123.571 100.489  30.884  1.00 43.92  ?  155 GLN B OE1 1 
ATOM 4401  N NE2 . GLN B  1 147 ? 121.705 99.514   30.099  1.00 44.59  ?  155 GLN B NE2 1 
ATOM 4402  N N   . LEU B  1 148 ? 123.797 96.925   36.004  1.00 43.93  ?  156 LEU B N   1 
ATOM 4403  C CA  . LEU B  1 148 ? 123.425 97.067   37.404  1.00 44.43  ?  156 LEU B CA  1 
ATOM 4404  C C   . LEU B  1 148 ? 124.514 97.818   38.155  1.00 44.38  ?  156 LEU B C   1 
ATOM 4405  O O   . LEU B  1 148 ? 125.684 97.825   37.760  1.00 43.94  ?  156 LEU B O   1 
ATOM 4406  C CB  . LEU B  1 148 ? 123.137 95.706   38.057  1.00 43.04  ?  156 LEU B CB  1 
ATOM 4407  C CG  . LEU B  1 148 ? 124.276 94.773   38.471  1.00 49.70  ?  156 LEU B CG  1 
ATOM 4408  C CD1 . LEU B  1 148 ? 124.676 94.988   39.927  1.00 53.74  ?  156 LEU B CD1 1 
ATOM 4409  C CD2 . LEU B  1 148 ? 123.871 93.325   38.235  1.00 52.58  ?  156 LEU B CD2 1 
ATOM 4410  N N   . CYS B  1 149 ? 124.101 98.453   39.251  1.00 48.34  ?  157 CYS B N   1 
ATOM 4411  C CA  . CYS B  1 149 ? 124.976 99.263   40.087  1.00 49.63  ?  157 CYS B CA  1 
ATOM 4412  C C   . CYS B  1 149 ? 124.450 99.240   41.513  1.00 50.63  ?  157 CYS B C   1 
ATOM 4413  O O   . CYS B  1 149 ? 123.273 99.528   41.747  1.00 51.15  ?  157 CYS B O   1 
ATOM 4414  C CB  . CYS B  1 149 ? 125.053 100.704  39.574  1.00 55.73  ?  157 CYS B CB  1 
ATOM 4415  S SG  . CYS B  1 149 ? 125.808 101.856  40.735  1.00 61.86  ?  157 CYS B SG  1 
ATOM 4416  N N   . ILE B  1 150 ? 125.323 98.897   42.457  1.00 45.80  ?  158 ILE B N   1 
ATOM 4417  C CA  . ILE B  1 150 ? 124.981 98.788   43.870  1.00 53.08  ?  158 ILE B CA  1 
ATOM 4418  C C   . ILE B  1 150 ? 126.095 99.437   44.678  1.00 54.62  ?  158 ILE B C   1 
ATOM 4419  O O   . ILE B  1 150 ? 127.274 99.114   44.487  1.00 57.23  ?  158 ILE B O   1 
ATOM 4420  C CB  . ILE B  1 150 ? 124.790 97.320   44.303  1.00 50.66  ?  158 ILE B CB  1 
ATOM 4421  C CG1 . ILE B  1 150 ? 123.609 96.688   43.565  1.00 49.00  ?  158 ILE B CG1 1 
ATOM 4422  C CG2 . ILE B  1 150 ? 124.594 97.225   45.809  1.00 52.55  ?  158 ILE B CG2 1 
ATOM 4423  C CD1 . ILE B  1 150 ? 123.351 95.254   43.956  1.00 50.82  ?  158 ILE B CD1 1 
ATOM 4424  N N   . ILE B  1 151 ? 125.728 100.342  45.582  1.00 53.48  ?  159 ILE B N   1 
ATOM 4425  C CA  . ILE B  1 151 ? 126.689 101.055  46.417  1.00 54.26  ?  159 ILE B CA  1 
ATOM 4426  C C   . ILE B  1 151 ? 126.401 100.730  47.875  1.00 55.84  ?  159 ILE B C   1 
ATOM 4427  O O   . ILE B  1 151 ? 125.243 100.773  48.307  1.00 57.80  ?  159 ILE B O   1 
ATOM 4428  C CB  . ILE B  1 151 ? 126.633 102.574  46.181  1.00 53.28  ?  159 ILE B CB  1 
ATOM 4429  C CG1 . ILE B  1 151 ? 126.606 102.881  44.686  1.00 60.89  ?  159 ILE B CG1 1 
ATOM 4430  C CG2 . ILE B  1 151 ? 127.824 103.256  46.833  1.00 54.31  ?  159 ILE B CG2 1 
ATOM 4431  C CD1 . ILE B  1 151 ? 126.421 104.342  44.377  1.00 60.16  ?  159 ILE B CD1 1 
ATOM 4432  N N   . GLY B  1 152 ? 127.447 100.405  48.625  1.00 49.91  ?  160 GLY B N   1 
ATOM 4433  C CA  . GLY B  1 152 ? 127.285 100.121  50.032  1.00 53.23  ?  160 GLY B CA  1 
ATOM 4434  C C   . GLY B  1 152 ? 128.576 100.331  50.789  1.00 54.95  ?  160 GLY B C   1 
ATOM 4435  O O   . GLY B  1 152 ? 129.545 100.882  50.266  1.00 53.54  ?  160 GLY B O   1 
ATOM 4436  N N   . CYS B  1 153 ? 128.568 99.899   52.048  1.00 52.97  ?  161 CYS B N   1 
ATOM 4437  C CA  . CYS B  1 153 ? 129.780 99.793   52.848  1.00 59.77  ?  161 CYS B CA  1 
ATOM 4438  C C   . CYS B  1 153 ? 130.094 98.350   53.206  1.00 59.13  ?  161 CYS B C   1 
ATOM 4439  O O   . CYS B  1 153 ? 131.068 98.093   53.923  1.00 58.64  ?  161 CYS B O   1 
ATOM 4440  C CB  . CYS B  1 153 ? 129.655 100.639  54.122  1.00 66.06  ?  161 CYS B CB  1 
ATOM 4441  S SG  . CYS B  1 153 ? 128.209 100.258  55.140  1.00 69.61  ?  161 CYS B SG  1 
ATOM 4442  N N   . VAL B  1 154 ? 129.288 97.412   52.721  1.00 65.80  ?  162 VAL B N   1 
ATOM 4443  C CA  . VAL B  1 154 ? 129.460 95.975   52.909  1.00 67.18  ?  162 VAL B CA  1 
ATOM 4444  C C   . VAL B  1 154 ? 129.262 95.352   51.532  1.00 62.58  ?  162 VAL B C   1 
ATOM 4445  O O   . VAL B  1 154 ? 128.397 95.818   50.776  1.00 62.07  ?  162 VAL B O   1 
ATOM 4446  C CB  . VAL B  1 154 ? 128.465 95.430   53.951  1.00 63.34  ?  162 VAL B CB  1 
ATOM 4447  C CG1 . VAL B  1 154 ? 128.370 93.910   53.896  1.00 69.17  ?  162 VAL B CG1 1 
ATOM 4448  C CG2 . VAL B  1 154 ? 128.856 95.890   55.348  1.00 63.90  ?  162 VAL B CG2 1 
ATOM 4449  N N   . PRO B  1 155 ? 130.039 94.339   51.142  1.00 59.66  ?  163 PRO B N   1 
ATOM 4450  C CA  . PRO B  1 155 ? 129.856 93.754   49.808  1.00 57.04  ?  163 PRO B CA  1 
ATOM 4451  C C   . PRO B  1 155 ? 128.426 93.272   49.603  1.00 56.61  ?  163 PRO B C   1 
ATOM 4452  O O   . PRO B  1 155 ? 127.780 92.767   50.524  1.00 58.95  ?  163 PRO B O   1 
ATOM 4453  C CB  . PRO B  1 155 ? 130.859 92.594   49.783  1.00 55.52  ?  163 PRO B CB  1 
ATOM 4454  C CG  . PRO B  1 155 ? 131.229 92.356   51.214  1.00 57.53  ?  163 PRO B CG  1 
ATOM 4455  C CD  . PRO B  1 155 ? 131.141 93.694   51.874  1.00 58.06  ?  163 PRO B CD  1 
ATOM 4456  N N   . ALA B  1 156 ? 127.932 93.459   48.382  1.00 55.58  ?  164 ALA B N   1 
ATOM 4457  C CA  . ALA B  1 156 ? 126.551 93.140   48.061  1.00 55.42  ?  164 ALA B CA  1 
ATOM 4458  C C   . ALA B  1 156 ? 126.301 91.640   48.178  1.00 57.03  ?  164 ALA B C   1 
ATOM 4459  O O   . ALA B  1 156 ? 127.211 90.815   48.052  1.00 60.42  ?  164 ALA B O   1 
ATOM 4460  C CB  . ALA B  1 156 ? 126.200 93.624   46.655  1.00 59.21  ?  164 ALA B CB  1 
ATOM 4461  N N   . ILE B  1 157 ? 125.042 91.291   48.418  1.00 53.58  ?  165 ILE B N   1 
ATOM 4462  C CA  . ILE B  1 157 ? 124.627 89.908   48.609  1.00 54.68  ?  165 ILE B CA  1 
ATOM 4463  C C   . ILE B  1 157 ? 123.958 89.423   47.333  1.00 54.39  ?  165 ILE B C   1 
ATOM 4464  O O   . ILE B  1 157 ? 123.028 90.062   46.825  1.00 59.07  ?  165 ILE B O   1 
ATOM 4465  C CB  . ILE B  1 157 ? 123.681 89.769   49.817  1.00 54.93  ?  165 ILE B CB  1 
ATOM 4466  C CG1 . ILE B  1 157 ? 124.473 89.689   51.126  1.00 57.96  ?  165 ILE B CG1 1 
ATOM 4467  C CG2 . ILE B  1 157 ? 122.792 88.544   49.668  1.00 56.76  ?  165 ILE B CG2 1 
ATOM 4468  C CD1 . ILE B  1 157 ? 125.046 91.010   51.598  1.00 70.81  ?  165 ILE B CD1 1 
ATOM 4469  N N   . GLY B  1 158 ? 124.443 88.304   46.804  1.00 50.39  ?  166 GLY B N   1 
ATOM 4470  C CA  . GLY B  1 158 ? 123.852 87.700   45.628  1.00 53.23  ?  166 GLY B CA  1 
ATOM 4471  C C   . GLY B  1 158 ? 123.311 86.314   45.904  1.00 56.16  ?  166 GLY B C   1 
ATOM 4472  O O   . GLY B  1 158 ? 123.690 85.677   46.891  1.00 60.08  ?  166 GLY B O   1 
ATOM 4473  N N   . GLU B  1 159 ? 122.415 85.839   45.046  1.00 53.88  ?  167 GLU B N   1 
ATOM 4474  C CA  . GLU B  1 159 ? 121.802 84.530   45.195  1.00 56.89  ?  167 GLU B CA  1 
ATOM 4475  C C   . GLU B  1 159 ? 122.116 83.665   43.983  1.00 56.63  ?  167 GLU B C   1 
ATOM 4476  O O   . GLU B  1 159 ? 122.301 84.170   42.871  1.00 55.69  ?  167 GLU B O   1 
ATOM 4477  C CB  . GLU B  1 159 ? 120.282 84.644   45.367  1.00 57.75  ?  167 GLU B CB  1 
ATOM 4478  C CG  . GLU B  1 159 ? 119.564 85.218   44.154  1.00 61.59  ?  167 GLU B CG  1 
ATOM 4479  C CD  . GLU B  1 159 ? 118.083 85.429   44.399  1.00 68.50  ?  167 GLU B CD  1 
ATOM 4480  O OE1 . GLU B  1 159 ? 117.511 86.377   43.819  1.00 68.93  ?  167 GLU B OE1 1 
ATOM 4481  O OE2 . GLU B  1 159 ? 117.493 84.656   45.184  1.00 73.39  -1 167 GLU B OE2 1 
ATOM 4482  N N   . HIS B  1 160 ? 122.179 82.354   44.209  1.00 51.60  ?  168 HIS B N   1 
ATOM 4483  C CA  . HIS B  1 160 ? 122.307 81.412   43.106  1.00 49.24  ?  168 HIS B CA  1 
ATOM 4484  C C   . HIS B  1 160 ? 121.890 80.033   43.594  1.00 52.99  ?  168 HIS B C   1 
ATOM 4485  O O   . HIS B  1 160 ? 121.892 79.750   44.795  1.00 60.24  ?  168 HIS B O   1 
ATOM 4486  C CB  . HIS B  1 160 ? 123.730 81.385   42.533  1.00 53.58  ?  168 HIS B CB  1 
ATOM 4487  C CG  . HIS B  1 160 ? 124.706 80.608   43.359  1.00 56.43  ?  168 HIS B CG  1 
ATOM 4488  N ND1 . HIS B  1 160 ? 125.384 81.159   44.425  1.00 58.31  ?  168 HIS B ND1 1 
ATOM 4489  C CD2 . HIS B  1 160 ? 125.132 79.326   43.264  1.00 60.34  ?  168 HIS B CD2 1 
ATOM 4490  C CE1 . HIS B  1 160 ? 126.178 80.246   44.958  1.00 64.79  ?  168 HIS B CE1 1 
ATOM 4491  N NE2 . HIS B  1 160 ? 126.044 79.126   44.270  1.00 65.92  ?  168 HIS B NE2 1 
ATOM 4492  N N   . TRP B  1 161 ? 121.520 79.185   42.640  1.00 51.30  ?  169 TRP B N   1 
ATOM 4493  C CA  . TRP B  1 161 ? 121.067 77.834   42.929  1.00 51.98  ?  169 TRP B CA  1 
ATOM 4494  C C   . TRP B  1 161 ? 122.227 76.850   42.871  1.00 51.94  ?  169 TRP B C   1 
ATOM 4495  O O   . TRP B  1 161 ? 123.058 76.906   41.961  1.00 51.48  ?  169 TRP B O   1 
ATOM 4496  C CB  . TRP B  1 161 ? 119.974 77.418   41.944  1.00 50.23  ?  169 TRP B CB  1 
ATOM 4497  C CG  . TRP B  1 161 ? 118.679 78.115   42.195  1.00 50.73  ?  169 TRP B CG  1 
ATOM 4498  C CD1 . TRP B  1 161 ? 118.213 79.235   41.571  1.00 49.32  ?  169 TRP B CD1 1 
ATOM 4499  C CD2 . TRP B  1 161 ? 117.685 77.747   43.155  1.00 53.03  ?  169 TRP B CD2 1 
ATOM 4500  N NE1 . TRP B  1 161 ? 116.985 79.584   42.081  1.00 50.59  ?  169 TRP B NE1 1 
ATOM 4501  C CE2 . TRP B  1 161 ? 116.640 78.685   43.055  1.00 52.88  ?  169 TRP B CE2 1 
ATOM 4502  C CE3 . TRP B  1 161 ? 117.576 76.711   44.088  1.00 57.11  ?  169 TRP B CE3 1 
ATOM 4503  C CZ2 . TRP B  1 161 ? 115.502 78.620   43.856  1.00 55.02  ?  169 TRP B CZ2 1 
ATOM 4504  C CZ3 . TRP B  1 161 ? 116.444 76.648   44.879  1.00 62.42  ?  169 TRP B CZ3 1 
ATOM 4505  C CH2 . TRP B  1 161 ? 115.422 77.596   44.757  1.00 58.72  ?  169 TRP B CH2 1 
ATOM 4506  N N   . THR B  1 162 ? 122.287 75.958   43.857  1.00 51.89  ?  170 THR B N   1 
ATOM 4507  C CA  . THR B  1 162 ? 123.342 74.960   43.935  1.00 54.78  ?  170 THR B CA  1 
ATOM 4508  C C   . THR B  1 162 ? 122.743 73.591   44.226  1.00 59.31  ?  170 THR B C   1 
ATOM 4509  O O   . THR B  1 162 ? 121.582 73.466   44.629  1.00 60.72  ?  170 THR B O   1 
ATOM 4510  C CB  . THR B  1 162 ? 124.374 75.308   45.017  1.00 57.68  ?  170 THR B CB  1 
ATOM 4511  O OG1 . THR B  1 162 ? 125.595 74.601   44.763  1.00 61.39  ?  170 THR B OG1 1 
ATOM 4512  C CG2 . THR B  1 162 ? 123.848 74.921   46.391  1.00 61.44  ?  170 THR B CG2 1 
ATOM 4513  N N   . LYS B  1 163 ? 123.556 72.559   44.002  1.00 61.00  ?  171 LYS B N   1 
ATOM 4514  C CA  . LYS B  1 163 ? 123.190 71.196   44.363  1.00 64.89  ?  171 LYS B CA  1 
ATOM 4515  C C   . LYS B  1 163 ? 123.045 71.078   45.874  1.00 65.91  ?  171 LYS B C   1 
ATOM 4516  O O   . LYS B  1 163 ? 124.045 70.986   46.592  1.00 66.89  ?  171 LYS B O   1 
ATOM 4517  C CB  . LYS B  1 163 ? 124.230 70.202   43.837  1.00 65.18  ?  171 LYS B CB  1 
ATOM 4518  C CG  . LYS B  1 163 ? 123.941 68.751   44.191  1.00 70.04  ?  171 LYS B CG  1 
ATOM 4519  C CD  . LYS B  1 163 ? 125.063 67.827   43.739  1.00 72.30  ?  171 LYS B CD  1 
ATOM 4520  C CE  . LYS B  1 163 ? 124.958 67.525   42.250  1.00 71.20  ?  171 LYS B CE  1 
ATOM 4521  N NZ  . LYS B  1 163 ? 126.020 66.591   41.784  1.00 72.41  1  171 LYS B NZ  1 
ATOM 4522  N N   . GLY B  1 164 ? 121.809 71.092   46.365  1.00 66.93  ?  172 GLY B N   1 
ATOM 4523  C CA  . GLY B  1 164 ? 121.594 71.043   47.797  1.00 74.29  ?  172 GLY B CA  1 
ATOM 4524  C C   . GLY B  1 164 ? 122.025 69.721   48.402  1.00 82.44  ?  172 GLY B C   1 
ATOM 4525  O O   . GLY B  1 164 ? 122.051 68.680   47.743  1.00 84.30  ?  172 GLY B O   1 
ATOM 4526  N N   . THR B  1 165 ? 122.381 69.777   49.684  1.00 93.30  ?  173 THR B N   1 
ATOM 4527  C CA  . THR B  1 165 ? 122.709 68.573   50.434  1.00 101.36 ?  173 THR B CA  1 
ATOM 4528  C C   . THR B  1 165 ? 121.534 67.600   50.434  1.00 106.19 ?  173 THR B C   1 
ATOM 4529  O O   . THR B  1 165 ? 120.374 67.991   50.275  1.00 103.52 ?  173 THR B O   1 
ATOM 4530  C CB  . THR B  1 165 ? 123.098 68.929   51.869  1.00 104.06 ?  173 THR B CB  1 
ATOM 4531  O OG1 . THR B  1 165 ? 122.067 69.727   52.462  1.00 104.35 ?  173 THR B OG1 1 
ATOM 4532  C CG2 . THR B  1 165 ? 124.407 69.705   51.884  1.00 100.71 ?  173 THR B CG2 1 
ATOM 4533  N N   . ALA B  1 166 ? 121.854 66.315   50.596  1.00 107.87 ?  174 ALA B N   1 
ATOM 4534  C CA  . ALA B  1 166 ? 120.841 65.266   50.628  1.00 122.50 ?  174 ALA B CA  1 
ATOM 4535  C C   . ALA B  1 166 ? 119.731 65.601   51.617  1.00 134.41 ?  174 ALA B C   1 
ATOM 4536  O O   . ALA B  1 166 ? 119.988 66.068   52.729  1.00 139.87 ?  174 ALA B O   1 
ATOM 4537  C CB  . ALA B  1 166 ? 121.483 63.926   50.993  1.00 125.41 ?  174 ALA B CB  1 
ATOM 4538  N N   . SER B  1 167 ? 118.486 65.376   51.186  1.00 143.34 ?  175 SER B N   1 
ATOM 4539  C CA  . SER B  1 167 ? 117.324 65.745   51.992  1.00 147.43 ?  175 SER B CA  1 
ATOM 4540  C C   . SER B  1 167 ? 117.361 65.074   53.362  1.00 153.31 ?  175 SER B C   1 
ATOM 4541  O O   . SER B  1 167 ? 117.261 65.743   54.398  1.00 154.60 ?  175 SER B O   1 
ATOM 4542  C CB  . SER B  1 167 ? 116.037 65.384   51.249  1.00 156.62 ?  175 SER B CB  1 
ATOM 4543  O OG  . SER B  1 167 ? 114.893 65.784   51.985  1.00 158.99 ?  175 SER B OG  1 
ATOM 4544  N N   . LYS B  1 168 ? 117.507 63.751   53.385  1.00 156.98 ?  176 LYS B N   1 
ATOM 4545  C CA  . LYS B  1 168 ? 117.565 62.981   54.622  1.00 155.27 ?  176 LYS B CA  1 
ATOM 4546  C C   . LYS B  1 168 ? 118.819 62.114   54.605  1.00 152.73 ?  176 LYS B C   1 
ATOM 4547  O O   . LYS B  1 168 ? 119.549 62.111   53.606  1.00 148.18 ?  176 LYS B O   1 
ATOM 4548  C CB  . LYS B  1 168 ? 116.314 62.108   54.774  1.00 150.47 ?  176 LYS B CB  1 
ATOM 4549  C CG  . LYS B  1 168 ? 115.073 62.616   54.063  1.00 143.95 ?  176 LYS B CG  1 
ATOM 4550  C CD  . LYS B  1 168 ? 113.949 61.595   54.162  1.00 143.85 ?  176 LYS B CD  1 
ATOM 4551  C CE  . LYS B  1 168 ? 112.830 61.896   53.181  1.00 136.73 ?  176 LYS B CE  1 
ATOM 4552  N NZ  . LYS B  1 168 ? 112.234 63.239   53.414  1.00 130.63 1  176 LYS B NZ  1 
ATOM 4553  N N   . PRO B  1 169 ? 119.116 61.364   55.681  1.00 148.42 ?  177 PRO B N   1 
ATOM 4554  C CA  . PRO B  1 169 ? 120.124 60.300   55.563  1.00 153.98 ?  177 PRO B CA  1 
ATOM 4555  C C   . PRO B  1 169 ? 119.679 59.195   54.617  1.00 160.05 ?  177 PRO B C   1 
ATOM 4556  O O   . PRO B  1 169 ? 119.517 58.040   55.023  1.00 165.80 ?  177 PRO B O   1 
ATOM 4557  C CB  . PRO B  1 169 ? 120.273 59.786   57.003  1.00 154.95 ?  177 PRO B CB  1 
ATOM 4558  C CG  . PRO B  1 169 ? 119.058 60.273   57.726  1.00 155.95 ?  177 PRO B CG  1 
ATOM 4559  C CD  . PRO B  1 169 ? 118.707 61.573   57.081  1.00 148.82 ?  177 PRO B CD  1 
ATOM 4560  N N   . THR B  1 170 ? 119.474 59.548   53.349  1.00 151.82 ?  178 THR B N   1 
ATOM 4561  C CA  . THR B  1 170 ? 118.887 58.661   52.356  1.00 151.73 ?  178 THR B CA  1 
ATOM 4562  C C   . THR B  1 170 ? 119.889 58.442   51.232  1.00 148.17 ?  178 THR B C   1 
ATOM 4563  O O   . THR B  1 170 ? 120.461 59.404   50.706  1.00 142.27 ?  178 THR B O   1 
ATOM 4564  C CB  . THR B  1 170 ? 117.583 59.246   51.800  1.00 140.79 ?  178 THR B CB  1 
ATOM 4565  O OG1 . THR B  1 170 ? 116.566 59.197   52.809  1.00 141.50 ?  178 THR B OG1 1 
ATOM 4566  C CG2 . THR B  1 170 ? 117.115 58.465   50.580  1.00 138.96 ?  178 THR B CG2 1 
ATOM 4567  N N   . THR B  1 171 ? 120.100 57.179   50.871  1.00 143.68 ?  179 THR B N   1 
ATOM 4568  C CA  . THR B  1 171 ? 120.935 56.823   49.729  1.00 130.96 ?  179 THR B CA  1 
ATOM 4569  C C   . THR B  1 171 ? 120.128 57.006   48.449  1.00 126.02 ?  179 THR B C   1 
ATOM 4570  O O   . THR B  1 171 ? 119.136 56.305   48.226  1.00 128.32 ?  179 THR B O   1 
ATOM 4571  C CB  . THR B  1 171 ? 121.441 55.390   49.861  1.00 125.60 ?  179 THR B CB  1 
ATOM 4572  O OG1 . THR B  1 171 ? 120.327 54.491   49.936  1.00 129.28 ?  179 THR B OG1 1 
ATOM 4573  C CG2 . THR B  1 171 ? 122.293 55.240   51.114  1.00 127.48 ?  179 THR B CG2 1 
ATOM 4574  N N   . VAL B  1 172 ? 120.544 57.950   47.611  1.00 118.60 ?  180 VAL B N   1 
ATOM 4575  C CA  . VAL B  1 172 ? 119.860 58.232   46.356  1.00 112.04 ?  180 VAL B CA  1 
ATOM 4576  C C   . VAL B  1 172 ? 120.674 57.632   45.217  1.00 111.79 ?  180 VAL B C   1 
ATOM 4577  O O   . VAL B  1 172 ? 121.909 57.576   45.263  1.00 112.06 ?  180 VAL B O   1 
ATOM 4578  C CB  . VAL B  1 172 ? 119.638 59.750   46.165  1.00 104.46 ?  180 VAL B CB  1 
ATOM 4579  C CG1 . VAL B  1 172 ? 120.964 60.477   45.980  1.00 95.98  ?  180 VAL B CG1 1 
ATOM 4580  C CG2 . VAL B  1 172 ? 118.695 60.018   44.999  1.00 103.47 ?  180 VAL B CG2 1 
ATOM 4581  N N   . VAL B  1 173 ? 119.969 57.157   44.188  1.00 104.12 ?  181 VAL B N   1 
ATOM 4582  C CA  . VAL B  1 173 ? 120.623 56.490   43.070  1.00 101.13 ?  181 VAL B CA  1 
ATOM 4583  C C   . VAL B  1 173 ? 121.423 57.497   42.253  1.00 93.56  ?  181 VAL B C   1 
ATOM 4584  O O   . VAL B  1 173 ? 121.051 58.672   42.125  1.00 89.25  ?  181 VAL B O   1 
ATOM 4585  C CB  . VAL B  1 173 ? 119.583 55.769   42.192  1.00 94.01  ?  181 VAL B CB  1 
ATOM 4586  C CG1 . VAL B  1 173 ? 120.263 54.801   41.234  1.00 96.26  ?  181 VAL B CG1 1 
ATOM 4587  C CG2 . VAL B  1 173 ? 118.568 55.043   43.061  1.00 101.34 ?  181 VAL B CG2 1 
ATOM 4588  N N   . GLN B  1 174 ? 122.539 57.035   41.695  1.00 88.42  ?  182 GLN B N   1 
ATOM 4589  C CA  . GLN B  1 174 ? 123.330 57.875   40.810  1.00 83.64  ?  182 GLN B CA  1 
ATOM 4590  C C   . GLN B  1 174 ? 122.560 58.145   39.524  1.00 77.68  ?  182 GLN B C   1 
ATOM 4591  O O   . GLN B  1 174 ? 121.959 57.240   38.938  1.00 76.97  ?  182 GLN B O   1 
ATOM 4592  C CB  . GLN B  1 174 ? 124.668 57.208   40.495  1.00 86.79  ?  182 GLN B CB  1 
ATOM 4593  C CG  . GLN B  1 174 ? 125.560 58.015   39.566  1.00 83.20  ?  182 GLN B CG  1 
ATOM 4594  C CD  . GLN B  1 174 ? 125.958 59.354   40.155  1.00 79.31  ?  182 GLN B CD  1 
ATOM 4595  O OE1 . GLN B  1 174 ? 126.313 59.447   41.329  1.00 80.82  ?  182 GLN B OE1 1 
ATOM 4596  N NE2 . GLN B  1 174 ? 125.902 60.400   39.340  1.00 76.18  ?  182 GLN B NE2 1 
ATOM 4597  N N   . GLY B  1 175 ? 122.572 59.403   39.090  1.00 77.49  ?  183 GLY B N   1 
ATOM 4598  C CA  . GLY B  1 175 ? 121.817 59.827   37.932  1.00 72.60  ?  183 GLY B CA  1 
ATOM 4599  C C   . GLY B  1 175 ? 120.489 60.474   38.254  1.00 71.23  ?  183 GLY B C   1 
ATOM 4600  O O   . GLY B  1 175 ? 119.853 61.029   37.350  1.00 68.21  ?  183 GLY B O   1 
ATOM 4601  N N   . ASP B  1 176 ? 120.049 60.411   39.507  1.00 69.64  ?  184 ASP B N   1 
ATOM 4602  C CA  . ASP B  1 176 ? 118.828 61.085   39.911  1.00 69.37  ?  184 ASP B CA  1 
ATOM 4603  C C   . ASP B  1 176 ? 119.048 62.594   39.963  1.00 67.06  ?  184 ASP B C   1 
ATOM 4604  O O   . ASP B  1 176 ? 120.179 63.084   40.027  1.00 68.84  ?  184 ASP B O   1 
ATOM 4605  C CB  . ASP B  1 176 ? 118.366 60.572   41.275  1.00 79.67  ?  184 ASP B CB  1 
ATOM 4606  C CG  . ASP B  1 176 ? 117.948 59.115   41.238  1.00 83.51  ?  184 ASP B CG  1 
ATOM 4607  O OD1 . ASP B  1 176 ? 118.251 58.436   40.234  1.00 86.85  ?  184 ASP B OD1 1 
ATOM 4608  O OD2 . ASP B  1 176 ? 117.324 58.647   42.214  1.00 85.20  -1 184 ASP B OD2 1 
ATOM 4609  N N   . CYS B  1 177 ? 117.949 63.333   39.922  1.00 61.94  ?  185 CYS B N   1 
ATOM 4610  C CA  . CYS B  1 177 ? 118.032 64.788   39.980  1.00 62.09  ?  185 CYS B CA  1 
ATOM 4611  C C   . CYS B  1 177 ? 118.355 65.224   41.404  1.00 63.22  ?  185 CYS B C   1 
ATOM 4612  O O   . CYS B  1 177 ? 117.613 64.876   42.332  1.00 66.72  ?  185 CYS B O   1 
ATOM 4613  C CB  . CYS B  1 177 ? 116.726 65.419   39.514  1.00 66.87  ?  185 CYS B CB  1 
ATOM 4614  S SG  . CYS B  1 177 ? 116.773 67.225   39.410  1.00 65.79  ?  185 CYS B SG  1 
ATOM 4615  N N   . PRO B  1 178 ? 119.435 65.966   41.627  1.00 66.55  ?  186 PRO B N   1 
ATOM 4616  C CA  . PRO B  1 178 ? 119.775 66.400   42.986  1.00 65.07  ?  186 PRO B CA  1 
ATOM 4617  C C   . PRO B  1 178 ? 118.826 67.479   43.471  1.00 64.21  ?  186 PRO B C   1 
ATOM 4618  O O   . PRO B  1 178 ? 118.184 68.166   42.661  1.00 60.62  ?  186 PRO B O   1 
ATOM 4619  C CB  . PRO B  1 178 ? 121.201 66.944   42.830  1.00 66.56  ?  186 PRO B CB  1 
ATOM 4620  C CG  . PRO B  1 178 ? 121.256 67.411   41.412  1.00 63.81  ?  186 PRO B CG  1 
ATOM 4621  C CD  . PRO B  1 178 ? 120.411 66.441   40.630  1.00 65.32  ?  186 PRO B CD  1 
ATOM 4622  N N   . PRO B  1 179 ? 118.698 67.654   44.786  1.00 68.88  ?  187 PRO B N   1 
ATOM 4623  C CA  . PRO B  1 179 ? 117.868 68.749   45.301  1.00 67.34  ?  187 PRO B CA  1 
ATOM 4624  C C   . PRO B  1 179 ? 118.514 70.097   45.020  1.00 68.75  ?  187 PRO B C   1 
ATOM 4625  O O   . PRO B  1 179 ? 119.734 70.252   45.106  1.00 73.76  ?  187 PRO B O   1 
ATOM 4626  C CB  . PRO B  1 179 ? 117.792 68.469   46.808  1.00 64.81  ?  187 PRO B CB  1 
ATOM 4627  C CG  . PRO B  1 179 ? 118.271 67.056   46.980  1.00 66.95  ?  187 PRO B CG  1 
ATOM 4628  C CD  . PRO B  1 179 ? 119.233 66.809   45.866  1.00 65.42  ?  187 PRO B CD  1 
ATOM 4629  N N   . LEU B  1 180 ? 117.682 71.079   44.687  1.00 63.61  ?  188 LEU B N   1 
ATOM 4630  C CA  . LEU B  1 180 ? 118.146 72.428   44.395  1.00 60.21  ?  188 LEU B CA  1 
ATOM 4631  C C   . LEU B  1 180 ? 117.991 73.298   45.634  1.00 62.33  ?  188 LEU B C   1 
ATOM 4632  O O   . LEU B  1 180 ? 116.914 73.340   46.239  1.00 65.56  ?  188 LEU B O   1 
ATOM 4633  C CB  . LEU B  1 180 ? 117.373 73.030   43.222  1.00 60.12  ?  188 LEU B CB  1 
ATOM 4634  C CG  . LEU B  1 180 ? 117.410 72.233   41.918  1.00 56.29  ?  188 LEU B CG  1 
ATOM 4635  C CD1 . LEU B  1 180 ? 116.713 72.998   40.805  1.00 53.96  ?  188 LEU B CD1 1 
ATOM 4636  C CD2 . LEU B  1 180 ? 118.842 71.903   41.533  1.00 56.36  ?  188 LEU B CD2 1 
ATOM 4637  N N   . GLU B  1 181 ? 119.067 73.986   46.011  1.00 63.34  ?  189 GLU B N   1 
ATOM 4638  C CA  . GLU B  1 181 ? 119.084 74.844   47.188  1.00 63.57  ?  189 GLU B CA  1 
ATOM 4639  C C   . GLU B  1 181 ? 119.524 76.245   46.794  1.00 60.53  ?  189 GLU B C   1 
ATOM 4640  O O   . GLU B  1 181 ? 120.562 76.415   46.146  1.00 59.13  ?  189 GLU B O   1 
ATOM 4641  C CB  . GLU B  1 181 ? 120.017 74.284   48.263  1.00 61.47  ?  189 GLU B CB  1 
ATOM 4642  C CG  . GLU B  1 181 ? 120.117 75.148   49.507  1.00 73.33  ?  189 GLU B CG  1 
ATOM 4643  C CD  . GLU B  1 181 ? 121.028 74.549   50.561  1.00 85.29  ?  189 GLU B CD  1 
ATOM 4644  O OE1 . GLU B  1 181 ? 121.463 73.390   50.384  1.00 88.49  ?  189 GLU B OE1 1 
ATOM 4645  O OE2 . GLU B  1 181 ? 121.311 75.238   51.565  1.00 90.59  -1 189 GLU B OE2 1 
ATOM 4646  N N   . LEU B  1 182 ? 118.735 77.242   47.188  1.00 60.77  ?  190 LEU B N   1 
ATOM 4647  C CA  . LEU B  1 182 ? 119.100 78.633   46.963  1.00 58.22  ?  190 LEU B CA  1 
ATOM 4648  C C   . LEU B  1 182 ? 120.086 79.088   48.030  1.00 60.06  ?  190 LEU B C   1 
ATOM 4649  O O   . LEU B  1 182 ? 119.906 78.813   49.220  1.00 65.66  ?  190 LEU B O   1 
ATOM 4650  C CB  . LEU B  1 182 ? 117.855 79.521   46.981  1.00 58.56  ?  190 LEU B CB  1 
ATOM 4651  C CG  . LEU B  1 182 ? 118.042 80.970   46.534  1.00 55.32  ?  190 LEU B CG  1 
ATOM 4652  C CD1 . LEU B  1 182 ? 118.493 81.028   45.084  1.00 53.03  ?  190 LEU B CD1 1 
ATOM 4653  C CD2 . LEU B  1 182 ? 116.758 81.758   46.730  1.00 55.14  ?  190 LEU B CD2 1 
ATOM 4654  N N   . ILE B  1 183 ? 121.134 79.787   47.601  1.00 55.23  ?  191 ILE B N   1 
ATOM 4655  C CA  . ILE B  1 183 ? 122.232 80.159   48.484  1.00 57.00  ?  191 ILE B CA  1 
ATOM 4656  C C   . ILE B  1 183 ? 122.585 81.622   48.247  1.00 57.55  ?  191 ILE B C   1 
ATOM 4657  O O   . ILE B  1 183 ? 122.672 82.068   47.096  1.00 63.31  ?  191 ILE B O   1 
ATOM 4658  C CB  . ILE B  1 183 ? 123.461 79.253   48.268  1.00 56.92  ?  191 ILE B CB  1 
ATOM 4659  C CG1 . ILE B  1 183 ? 123.268 77.921   48.996  1.00 57.76  ?  191 ILE B CG1 1 
ATOM 4660  C CG2 . ILE B  1 183 ? 124.738 79.937   48.733  1.00 57.63  ?  191 ILE B CG2 1 
ATOM 4661  C CD1 . ILE B  1 183 ? 124.538 77.110   49.149  1.00 58.31  ?  191 ILE B CD1 1 
ATOM 4662  N N   . ASN B  1 184 ? 122.767 82.364   49.339  1.00 55.58  ?  192 ASN B N   1 
ATOM 4663  C CA  . ASN B  1 184 ? 123.270 83.730   49.309  1.00 55.03  ?  192 ASN B CA  1 
ATOM 4664  C C   . ASN B  1 184 ? 124.763 83.751   49.613  1.00 58.40  ?  192 ASN B C   1 
ATOM 4665  O O   . ASN B  1 184 ? 125.231 83.081   50.539  1.00 56.87  ?  192 ASN B O   1 
ATOM 4666  C CB  . ASN B  1 184 ? 122.526 84.610   50.315  1.00 56.26  ?  192 ASN B CB  1 
ATOM 4667  C CG  . ASN B  1 184 ? 121.113 84.926   49.876  1.00 55.26  ?  192 ASN B CG  1 
ATOM 4668  O OD1 . ASN B  1 184 ? 120.160 84.739   50.630  1.00 55.88  ?  192 ASN B OD1 1 
ATOM 4669  N ND2 . ASN B  1 184 ? 120.971 85.419   48.652  1.00 54.03  ?  192 ASN B ND2 1 
ATOM 4670  N N   . THR B  1 185 ? 125.504 84.528   48.831  1.00 58.84  ?  193 THR B N   1 
ATOM 4671  C CA  . THR B  1 185 ? 126.943 84.677   48.975  1.00 58.70  ?  193 THR B CA  1 
ATOM 4672  C C   . THR B  1 185 ? 127.330 86.114   48.664  1.00 58.33  ?  193 THR B C   1 
ATOM 4673  O O   . THR B  1 185 ? 126.650 86.785   47.880  1.00 51.15  ?  193 THR B O   1 
ATOM 4674  C CB  . THR B  1 185 ? 127.711 83.728   48.039  1.00 61.01  ?  193 THR B CB  1 
ATOM 4675  O OG1 . THR B  1 185 ? 127.064 83.688   46.760  1.00 60.59  ?  193 THR B OG1 1 
ATOM 4676  C CG2 . THR B  1 185 ? 127.772 82.326   48.626  1.00 61.39  ?  193 THR B CG2 1 
ATOM 4677  N N   . PRO B  1 186 ? 128.404 86.616   49.272  1.00 55.01  ?  194 PRO B N   1 
ATOM 4678  C CA  . PRO B  1 186 ? 128.890 87.953   48.910  1.00 54.53  ?  194 PRO B CA  1 
ATOM 4679  C C   . PRO B  1 186 ? 129.410 87.977   47.481  1.00 58.95  ?  194 PRO B C   1 
ATOM 4680  O O   . PRO B  1 186 ? 130.113 87.065   47.039  1.00 60.89  ?  194 PRO B O   1 
ATOM 4681  C CB  . PRO B  1 186 ? 130.011 88.211   49.923  1.00 50.76  ?  194 PRO B CB  1 
ATOM 4682  C CG  . PRO B  1 186 ? 130.453 86.853   50.347  1.00 50.81  ?  194 PRO B CG  1 
ATOM 4683  C CD  . PRO B  1 186 ? 129.216 86.005   50.338  1.00 50.56  ?  194 PRO B CD  1 
ATOM 4684  N N   . ILE B  1 187 ? 129.047 89.031   46.756  1.00 60.97  ?  195 ILE B N   1 
ATOM 4685  C CA  . ILE B  1 187 ? 129.420 89.171   45.351  1.00 55.80  ?  195 ILE B CA  1 
ATOM 4686  C C   . ILE B  1 187 ? 130.842 89.717   45.274  1.00 60.96  ?  195 ILE B C   1 
ATOM 4687  O O   . ILE B  1 187 ? 131.105 90.856   45.667  1.00 67.00  ?  195 ILE B O   1 
ATOM 4688  C CB  . ILE B  1 187 ? 128.440 90.074   44.594  1.00 55.87  ?  195 ILE B CB  1 
ATOM 4689  C CG1 . ILE B  1 187 ? 127.023 89.503   44.663  1.00 54.91  ?  195 ILE B CG1 1 
ATOM 4690  C CG2 . ILE B  1 187 ? 128.882 90.243   43.152  1.00 55.10  ?  195 ILE B CG2 1 
ATOM 4691  C CD1 . ILE B  1 187 ? 126.010 90.300   43.872  1.00 56.83  ?  195 ILE B CD1 1 
ATOM 4692  N N   . GLU B  1 188 ? 131.760 88.902   44.766  1.00 58.96  ?  196 GLU B N   1 
ATOM 4693  C CA  . GLU B  1 188 ? 133.158 89.269   44.612  1.00 58.74  ?  196 GLU B CA  1 
ATOM 4694  C C   . GLU B  1 188 ? 133.424 89.699   43.175  1.00 55.05  ?  196 GLU B C   1 
ATOM 4695  O O   . GLU B  1 188 ? 132.651 89.403   42.261  1.00 52.29  ?  196 GLU B O   1 
ATOM 4696  C CB  . GLU B  1 188 ? 134.074 88.098   44.979  1.00 61.74  ?  196 GLU B CB  1 
ATOM 4697  C CG  . GLU B  1 188 ? 133.631 87.305   46.196  1.00 65.26  ?  196 GLU B CG  1 
ATOM 4698  C CD  . GLU B  1 188 ? 134.513 86.099   46.450  1.00 72.41  ?  196 GLU B CD  1 
ATOM 4699  O OE1 . GLU B  1 188 ? 135.739 86.198   46.226  1.00 70.64  ?  196 GLU B OE1 1 
ATOM 4700  O OE2 . GLU B  1 188 ? 133.979 85.049   46.867  1.00 81.32  -1 196 GLU B OE2 1 
ATOM 4701  N N   . ASP B  1 189 ? 134.527 90.419   42.988  1.00 50.92  ?  197 ASP B N   1 
ATOM 4702  C CA  . ASP B  1 189 ? 134.932 90.820   41.647  1.00 50.13  ?  197 ASP B CA  1 
ATOM 4703  C C   . ASP B  1 189 ? 135.334 89.596   40.837  1.00 52.13  ?  197 ASP B C   1 
ATOM 4704  O O   . ASP B  1 189 ? 136.159 88.790   41.279  1.00 56.87  ?  197 ASP B O   1 
ATOM 4705  C CB  . ASP B  1 189 ? 136.087 91.816   41.703  1.00 54.00  ?  197 ASP B CB  1 
ATOM 4706  C CG  . ASP B  1 189 ? 136.601 92.182   40.323  1.00 57.64  ?  197 ASP B CG  1 
ATOM 4707  O OD1 . ASP B  1 189 ? 135.957 93.013   39.649  1.00 55.16  ?  197 ASP B OD1 1 
ATOM 4708  O OD2 . ASP B  1 189 ? 137.645 91.636   39.908  1.00 63.67  -1 197 ASP B OD2 1 
ATOM 4709  N N   . GLY B  1 190 ? 134.742 89.451   39.654  1.00 48.30  ?  198 GLY B N   1 
ATOM 4710  C CA  . GLY B  1 190 ? 134.995 88.314   38.795  1.00 50.81  ?  198 GLY B CA  1 
ATOM 4711  C C   . GLY B  1 190 ? 133.869 87.307   38.735  1.00 50.66  ?  198 GLY B C   1 
ATOM 4712  O O   . GLY B  1 190 ? 133.894 86.429   37.862  1.00 55.35  ?  198 GLY B O   1 
ATOM 4713  N N   . ASP B  1 191 ? 132.894 87.388   39.638  1.00 53.59  ?  199 ASP B N   1 
ATOM 4714  C CA  . ASP B  1 191 ? 131.748 86.494   39.578  1.00 50.45  ?  199 ASP B CA  1 
ATOM 4715  C C   . ASP B  1 191 ? 130.973 86.714   38.284  1.00 48.43  ?  199 ASP B C   1 
ATOM 4716  O O   . ASP B  1 191 ? 130.979 87.804   37.707  1.00 51.45  ?  199 ASP B O   1 
ATOM 4717  C CB  . ASP B  1 191 ? 130.834 86.725   40.781  1.00 51.17  ?  199 ASP B CB  1 
ATOM 4718  C CG  . ASP B  1 191 ? 131.495 86.362   42.095  1.00 55.92  ?  199 ASP B CG  1 
ATOM 4719  O OD1 . ASP B  1 191 ? 132.731 86.177   42.109  1.00 59.95  ?  199 ASP B OD1 1 
ATOM 4720  O OD2 . ASP B  1 191 ? 130.781 86.266   43.114  1.00 58.65  -1 199 ASP B OD2 1 
ATOM 4721  N N   . MET B  1 192 ? 130.288 85.668   37.834  1.00 48.79  ?  200 MET B N   1 
ATOM 4722  C CA  . MET B  1 192 ? 129.539 85.728   36.588  1.00 52.50  ?  200 MET B CA  1 
ATOM 4723  C C   . MET B  1 192 ? 128.106 86.172   36.850  1.00 52.53  ?  200 MET B C   1 
ATOM 4724  O O   . MET B  1 192 ? 127.499 85.799   37.857  1.00 54.22  ?  200 MET B O   1 
ATOM 4725  C CB  . MET B  1 192 ? 129.546 84.371   35.882  1.00 58.21  ?  200 MET B CB  1 
ATOM 4726  C CG  . MET B  1 192 ? 130.932 83.879   35.493  1.00 61.03  ?  200 MET B CG  1 
ATOM 4727  S SD  . MET B  1 192 ? 131.811 85.042   34.429  1.00 60.40  ?  200 MET B SD  1 
ATOM 4728  C CE  . MET B  1 192 ? 130.750 85.051   32.986  1.00 54.62  ?  200 MET B CE  1 
ATOM 4729  N N   . VAL B  1 193 ? 127.578 86.980   35.940  1.00 48.20  ?  201 VAL B N   1 
ATOM 4730  C CA  . VAL B  1 193 ? 126.222 87.490   36.055  1.00 47.52  ?  201 VAL B CA  1 
ATOM 4731  C C   . VAL B  1 193 ? 125.271 86.531   35.351  1.00 46.28  ?  201 VAL B C   1 
ATOM 4732  O O   . VAL B  1 193 ? 125.681 85.667   34.573  1.00 45.70  ?  201 VAL B O   1 
ATOM 4733  C CB  . VAL B  1 193 ? 126.111 88.913   35.472  1.00 50.23  ?  201 VAL B CB  1 
ATOM 4734  C CG1 . VAL B  1 193 ? 124.976 89.684   36.136  1.00 53.98  ?  201 VAL B CG1 1 
ATOM 4735  C CG2 . VAL B  1 193 ? 127.430 89.648   35.630  1.00 54.42  ?  201 VAL B CG2 1 
ATOM 4736  N N   . ASP B  1 194 ? 123.983 86.669   35.650  1.00 47.92  ?  202 ASP B N   1 
ATOM 4737  C CA  . ASP B  1 194 ? 122.962 85.977   34.877  1.00 51.03  ?  202 ASP B CA  1 
ATOM 4738  C C   . ASP B  1 194 ? 123.059 86.378   33.411  1.00 48.51  ?  202 ASP B C   1 
ATOM 4739  O O   . ASP B  1 194 ? 123.070 87.567   33.079  1.00 54.69  ?  202 ASP B O   1 
ATOM 4740  C CB  . ASP B  1 194 ? 121.577 86.304   35.433  1.00 56.45  ?  202 ASP B CB  1 
ATOM 4741  C CG  . ASP B  1 194 ? 120.461 85.904   34.490  1.00 66.54  ?  202 ASP B CG  1 
ATOM 4742  O OD1 . ASP B  1 194 ? 120.425 84.727   34.066  1.00 72.51  ?  202 ASP B OD1 1 
ATOM 4743  O OD2 . ASP B  1 194 ? 119.619 86.771   34.170  1.00 67.26  -1 202 ASP B OD2 1 
ATOM 4744  N N   . THR B  1 195 ? 123.139 85.381   32.530  1.00 48.83  ?  203 THR B N   1 
ATOM 4745  C CA  . THR B  1 195 ? 123.342 85.626   31.107  1.00 51.09  ?  203 THR B CA  1 
ATOM 4746  C C   . THR B  1 195 ? 122.171 85.163   30.251  1.00 51.28  ?  203 THR B C   1 
ATOM 4747  O O   . THR B  1 195 ? 122.253 85.237   29.020  1.00 47.64  ?  203 THR B O   1 
ATOM 4748  C CB  . THR B  1 195 ? 124.628 84.948   30.628  1.00 49.88  ?  203 THR B CB  1 
ATOM 4749  O OG1 . THR B  1 195 ? 124.553 83.540   30.883  1.00 53.06  ?  203 THR B OG1 1 
ATOM 4750  C CG2 . THR B  1 195 ? 125.832 85.529   31.347  1.00 51.40  ?  203 THR B CG2 1 
ATOM 4751  N N   . GLY B  1 196 ? 121.085 84.697   30.861  1.00 52.26  ?  204 GLY B N   1 
ATOM 4752  C CA  . GLY B  1 196 ? 119.944 84.188   30.129  1.00 51.37  ?  204 GLY B CA  1 
ATOM 4753  C C   . GLY B  1 196 ? 119.701 82.707   30.303  1.00 50.39  ?  204 GLY B C   1 
ATOM 4754  O O   . GLY B  1 196 ? 118.680 82.203   29.818  1.00 49.14  ?  204 GLY B O   1 
ATOM 4755  N N   . TYR B  1 197 ? 120.610 81.990   30.959  1.00 50.10  ?  205 TYR B N   1 
ATOM 4756  C CA  . TYR B  1 197 ? 120.423 80.581   31.272  1.00 50.58  ?  205 TYR B CA  1 
ATOM 4757  C C   . TYR B  1 197 ? 120.075 80.348   32.738  1.00 57.44  ?  205 TYR B C   1 
ATOM 4758  O O   . TYR B  1 197 ? 119.984 79.194   33.167  1.00 63.96  ?  205 TYR B O   1 
ATOM 4759  C CB  . TYR B  1 197 ? 121.674 79.787   30.895  1.00 48.95  ?  205 TYR B CB  1 
ATOM 4760  C CG  . TYR B  1 197 ? 121.904 79.686   29.405  1.00 51.91  ?  205 TYR B CG  1 
ATOM 4761  C CD1 . TYR B  1 197 ? 121.209 78.758   28.639  1.00 56.54  ?  205 TYR B CD1 1 
ATOM 4762  C CD2 . TYR B  1 197 ? 122.814 80.515   28.763  1.00 49.88  ?  205 TYR B CD2 1 
ATOM 4763  C CE1 . TYR B  1 197 ? 121.414 78.658   27.277  1.00 54.57  ?  205 TYR B CE1 1 
ATOM 4764  C CE2 . TYR B  1 197 ? 123.025 80.422   27.398  1.00 48.45  ?  205 TYR B CE2 1 
ATOM 4765  C CZ  . TYR B  1 197 ? 122.321 79.491   26.661  1.00 49.91  ?  205 TYR B CZ  1 
ATOM 4766  O OH  . TYR B  1 197 ? 122.523 79.390   25.304  1.00 50.39  ?  205 TYR B OH  1 
ATOM 4767  N N   . GLY B  1 198 ? 119.879 81.411   33.510  1.00 53.33  ?  206 GLY B N   1 
ATOM 4768  C CA  . GLY B  1 198 ? 119.573 81.300   34.920  1.00 51.89  ?  206 GLY B CA  1 
ATOM 4769  C C   . GLY B  1 198 ? 120.786 81.568   35.793  1.00 51.62  ?  206 GLY B C   1 
ATOM 4770  O O   . GLY B  1 198 ? 121.932 81.612   35.341  1.00 54.58  ?  206 GLY B O   1 
ATOM 4771  N N   . ALA B  1 199 ? 120.511 81.748   37.081  1.00 47.29  ?  207 ALA B N   1 
ATOM 4772  C CA  . ALA B  1 199 ? 121.537 82.015   38.087  1.00 53.88  ?  207 ALA B CA  1 
ATOM 4773  C C   . ALA B  1 199 ? 121.729 80.748   38.912  1.00 56.00  ?  207 ALA B C   1 
ATOM 4774  O O   . ALA B  1 199 ? 120.993 80.506   39.873  1.00 58.25  ?  207 ALA B O   1 
ATOM 4775  C CB  . ALA B  1 199 ? 121.146 83.199   38.965  1.00 58.87  ?  207 ALA B CB  1 
ATOM 4776  N N   . MET B  1 200 ? 122.723 79.944   38.540  1.00 53.11  ?  208 MET B N   1 
ATOM 4777  C CA  . MET B  1 200 ? 122.956 78.668   39.200  1.00 52.93  ?  208 MET B CA  1 
ATOM 4778  C C   . MET B  1 200 ? 124.425 78.287   39.083  1.00 53.77  ?  208 MET B C   1 
ATOM 4779  O O   . MET B  1 200 ? 125.214 78.952   38.405  1.00 54.06  ?  208 MET B O   1 
ATOM 4780  C CB  . MET B  1 200 ? 122.069 77.570   38.606  1.00 51.04  ?  208 MET B CB  1 
ATOM 4781  C CG  . MET B  1 200 ? 121.995 77.603   37.089  1.00 49.17  ?  208 MET B CG  1 
ATOM 4782  S SD  . MET B  1 200 ? 121.405 76.061   36.369  1.00 52.90  ?  208 MET B SD  1 
ATOM 4783  C CE  . MET B  1 200 ? 122.767 74.970   36.755  1.00 59.21  ?  208 MET B CE  1 
ATOM 4784  N N   . ASP B  1 201 ? 124.781 77.197   39.761  1.00 50.59  ?  209 ASP B N   1 
ATOM 4785  C CA  . ASP B  1 201 ? 126.136 76.651   39.733  1.00 50.49  ?  209 ASP B CA  1 
ATOM 4786  C C   . ASP B  1 201 ? 126.193 75.631   38.603  1.00 52.61  ?  209 ASP B C   1 
ATOM 4787  O O   . ASP B  1 201 ? 125.842 74.462   38.784  1.00 57.54  ?  209 ASP B O   1 
ATOM 4788  C CB  . ASP B  1 201 ? 126.490 76.026   41.078  1.00 55.01  ?  209 ASP B CB  1 
ATOM 4789  C CG  . ASP B  1 201 ? 127.967 75.697   41.206  1.00 58.60  ?  209 ASP B CG  1 
ATOM 4790  O OD1 . ASP B  1 201 ? 128.651 75.555   40.171  1.00 55.39  ?  209 ASP B OD1 1 
ATOM 4791  O OD2 . ASP B  1 201 ? 128.445 75.573   42.354  1.00 66.55  -1 209 ASP B OD2 1 
ATOM 4792  N N   . PHE B  1 202 ? 126.648 76.077   37.430  1.00 53.61  ?  210 PHE B N   1 
ATOM 4793  C CA  . PHE B  1 202 ? 126.691 75.199   36.266  1.00 53.10  ?  210 PHE B CA  1 
ATOM 4794  C C   . PHE B  1 202 ? 127.729 74.097   36.426  1.00 59.44  ?  210 PHE B C   1 
ATOM 4795  O O   . PHE B  1 202 ? 127.597 73.030   35.815  1.00 60.74  ?  210 PHE B O   1 
ATOM 4796  C CB  . PHE B  1 202 ? 126.963 76.023   35.012  1.00 52.47  ?  210 PHE B CB  1 
ATOM 4797  C CG  . PHE B  1 202 ? 125.838 76.942   34.650  1.00 51.04  ?  210 PHE B CG  1 
ATOM 4798  C CD1 . PHE B  1 202 ? 124.766 76.488   33.901  1.00 53.17  ?  210 PHE B CD1 1 
ATOM 4799  C CD2 . PHE B  1 202 ? 125.846 78.259   35.072  1.00 49.90  ?  210 PHE B CD2 1 
ATOM 4800  C CE1 . PHE B  1 202 ? 123.727 77.335   33.572  1.00 52.55  ?  210 PHE B CE1 1 
ATOM 4801  C CE2 . PHE B  1 202 ? 124.812 79.111   34.747  1.00 51.08  ?  210 PHE B CE2 1 
ATOM 4802  C CZ  . PHE B  1 202 ? 123.750 78.650   33.996  1.00 52.58  ?  210 PHE B CZ  1 
ATOM 4803  N N   . LYS B  1 203 ? 128.766 74.335   37.231  1.00 60.57  ?  211 LYS B N   1 
ATOM 4804  C CA  . LYS B  1 203 ? 129.786 73.316   37.452  1.00 60.76  ?  211 LYS B CA  1 
ATOM 4805  C C   . LYS B  1 203 ? 129.236 72.145   38.256  1.00 58.93  ?  211 LYS B C   1 
ATOM 4806  O O   . LYS B  1 203 ? 129.600 70.990   38.010  1.00 61.25  ?  211 LYS B O   1 
ATOM 4807  C CB  . LYS B  1 203 ? 130.988 73.932   38.167  1.00 58.62  ?  211 LYS B CB  1 
ATOM 4808  C CG  . LYS B  1 203 ? 132.156 72.982   38.375  1.00 61.20  ?  211 LYS B CG  1 
ATOM 4809  C CD  . LYS B  1 203 ? 133.309 73.689   39.071  1.00 65.03  ?  211 LYS B CD  1 
ATOM 4810  C CE  . LYS B  1 203 ? 134.514 72.777   39.221  1.00 70.65  ?  211 LYS B CE  1 
ATOM 4811  N NZ  . LYS B  1 203 ? 135.652 73.477   39.881  1.00 74.49  1  211 LYS B NZ  1 
ATOM 4812  N N   . LEU B  1 204 ? 128.357 72.423   39.217  1.00 55.94  ?  212 LEU B N   1 
ATOM 4813  C CA  . LEU B  1 204 ? 127.860 71.389   40.113  1.00 59.00  ?  212 LEU B CA  1 
ATOM 4814  C C   . LEU B  1 204 ? 126.570 70.742   39.629  1.00 59.73  ?  212 LEU B C   1 
ATOM 4815  O O   . LEU B  1 204 ? 126.316 69.575   39.951  1.00 65.35  ?  212 LEU B O   1 
ATOM 4816  C CB  . LEU B  1 204 ? 127.639 71.969   41.513  1.00 53.92  ?  212 LEU B CB  1 
ATOM 4817  C CG  . LEU B  1 204 ? 128.789 71.844   42.514  1.00 55.09  ?  212 LEU B CG  1 
ATOM 4818  C CD1 . LEU B  1 204 ? 130.084 72.400   41.945  1.00 54.87  ?  212 LEU B CD1 1 
ATOM 4819  C CD2 . LEU B  1 204 ? 128.433 72.540   43.819  1.00 56.04  ?  212 LEU B CD2 1 
ATOM 4820  N N   . LEU B  1 205 ? 125.749 71.460   38.865  1.00 54.32  ?  213 LEU B N   1 
ATOM 4821  C CA  . LEU B  1 205 ? 124.453 70.952   38.438  1.00 54.54  ?  213 LEU B CA  1 
ATOM 4822  C C   . LEU B  1 205 ? 124.433 70.471   36.994  1.00 54.72  ?  213 LEU B C   1 
ATOM 4823  O O   . LEU B  1 205 ? 123.399 69.972   36.540  1.00 57.92  ?  213 LEU B O   1 
ATOM 4824  C CB  . LEU B  1 205 ? 123.378 72.026   38.633  1.00 50.47  ?  213 LEU B CB  1 
ATOM 4825  C CG  . LEU B  1 205 ? 123.011 72.375   40.075  1.00 50.83  ?  213 LEU B CG  1 
ATOM 4826  C CD1 . LEU B  1 205 ? 121.984 73.490   40.110  1.00 50.78  ?  213 LEU B CD1 1 
ATOM 4827  C CD2 . LEU B  1 205 ? 122.479 71.143   40.776  1.00 51.14  ?  213 LEU B CD2 1 
ATOM 4828  N N   . GLN B  1 206 ? 125.539 70.597   36.262  1.00 61.57  ?  214 GLN B N   1 
ATOM 4829  C CA  . GLN B  1 206 ? 125.607 70.138   34.870  1.00 60.82  ?  214 GLN B CA  1 
ATOM 4830  C C   . GLN B  1 206 ? 126.925 69.392   34.676  1.00 63.75  ?  214 GLN B C   1 
ATOM 4831  O O   . GLN B  1 206 ? 127.947 69.992   34.329  1.00 64.60  ?  214 GLN B O   1 
ATOM 4832  C CB  . GLN B  1 206 ? 125.464 71.294   33.889  1.00 59.05  ?  214 GLN B CB  1 
ATOM 4833  C CG  . GLN B  1 206 ? 124.105 71.972   33.914  1.00 57.70  ?  214 GLN B CG  1 
ATOM 4834  C CD  . GLN B  1 206 ? 124.026 73.155   32.970  1.00 57.12  ?  214 GLN B CD  1 
ATOM 4835  O OE1 . GLN B  1 206 ? 125.030 73.571   32.392  1.00 57.53  ?  214 GLN B OE1 1 
ATOM 4836  N NE2 . GLN B  1 206 ? 122.826 73.700   32.802  1.00 59.28  ?  214 GLN B NE2 1 
ATOM 4837  N N   . ASP B  1 207 ? 126.891 68.077   34.901  1.00 64.46  ?  215 ASP B N   1 
ATOM 4838  C CA  . ASP B  1 207 ? 128.032 67.223   34.595  1.00 68.64  ?  215 ASP B CA  1 
ATOM 4839  C C   . ASP B  1 207 ? 128.299 67.132   33.098  1.00 63.33  ?  215 ASP B C   1 
ATOM 4840  O O   . ASP B  1 207 ? 129.367 66.652   32.703  1.00 63.87  ?  215 ASP B O   1 
ATOM 4841  C CB  . ASP B  1 207 ? 127.805 65.821   35.166  1.00 70.39  ?  215 ASP B CB  1 
ATOM 4842  C CG  . ASP B  1 207 ? 127.368 65.844   36.620  1.00 71.80  ?  215 ASP B CG  1 
ATOM 4843  O OD1 . ASP B  1 207 ? 127.559 66.884   37.286  1.00 73.54  ?  215 ASP B OD1 1 
ATOM 4844  O OD2 . ASP B  1 207 ? 126.833 64.821   37.097  1.00 73.16  -1 215 ASP B OD2 1 
ATOM 4845  N N   . ASN B  1 208 ? 127.352 67.577   32.268  1.00 61.60  ?  216 ASN B N   1 
ATOM 4846  C CA  . ASN B  1 208 ? 127.512 67.503   30.820  1.00 59.16  ?  216 ASN B CA  1 
ATOM 4847  C C   . ASN B  1 208 ? 128.706 68.320   30.346  1.00 58.60  ?  216 ASN B C   1 
ATOM 4848  O O   . ASN B  1 208 ? 129.393 67.930   29.395  1.00 60.87  ?  216 ASN B O   1 
ATOM 4849  C CB  . ASN B  1 208 ? 126.231 67.989   30.141  1.00 64.12  ?  216 ASN B CB  1 
ATOM 4850  C CG  . ASN B  1 208 ? 126.092 67.488   28.723  1.00 68.56  ?  216 ASN B CG  1 
ATOM 4851  O OD1 . ASN B  1 208 ? 127.016 66.898   28.165  1.00 75.73  ?  216 ASN B OD1 1 
ATOM 4852  N ND2 . ASN B  1 208 ? 124.925 67.715   28.130  1.00 66.13  ?  216 ASN B ND2 1 
ATOM 4853  N N   . LYS B  1 209 ? 128.966 69.458   30.994  1.00 64.11  ?  217 LYS B N   1 
ATOM 4854  C CA  . LYS B  1 209 ? 129.948 70.432   30.514  1.00 62.08  ?  217 LYS B CA  1 
ATOM 4855  C C   . LYS B  1 209 ? 129.650 70.842   29.075  1.00 60.52  ?  217 LYS B C   1 
ATOM 4856  O O   . LYS B  1 209 ? 130.559 71.114   28.287  1.00 60.76  ?  217 LYS B O   1 
ATOM 4857  C CB  . LYS B  1 209 ? 131.382 69.902   30.640  1.00 53.50  ?  217 LYS B CB  1 
ATOM 4858  C CG  . LYS B  1 209 ? 131.837 69.654   32.069  1.00 55.47  ?  217 LYS B CG  1 
ATOM 4859  C CD  . LYS B  1 209 ? 133.325 69.342   32.132  1.00 56.96  ?  217 LYS B CD  1 
ATOM 4860  C CE  . LYS B  1 209 ? 133.786 69.160   33.570  1.00 59.16  ?  217 LYS B CE  1 
ATOM 4861  N NZ  . LYS B  1 209 ? 135.234 68.826   33.665  1.00 63.63  1  217 LYS B NZ  1 
ATOM 4862  N N   . SER B  1 210 ? 128.361 70.895   28.727  1.00 62.08  ?  218 SER B N   1 
ATOM 4863  C CA  . SER B  1 210 ? 127.982 71.162   27.345  1.00 58.48  ?  218 SER B CA  1 
ATOM 4864  C C   . SER B  1 210 ? 126.613 71.820   27.217  1.00 58.95  ?  218 SER B C   1 
ATOM 4865  O O   . SER B  1 210 ? 126.095 71.895   26.096  1.00 57.85  ?  218 SER B O   1 
ATOM 4866  C CB  . SER B  1 210 ? 127.994 69.858   26.535  1.00 59.25  ?  218 SER B CB  1 
ATOM 4867  O OG  . SER B  1 210 ? 129.289 69.287   26.497  1.00 66.07  ?  218 SER B OG  1 
ATOM 4868  N N   . GLU B  1 211 ? 126.010 72.297   28.305  1.00 58.89  ?  219 GLU B N   1 
ATOM 4869  C CA  . GLU B  1 211 ? 124.691 72.910   28.232  1.00 56.38  ?  219 GLU B CA  1 
ATOM 4870  C C   . GLU B  1 211 ? 124.752 74.416   28.021  1.00 55.94  ?  219 GLU B C   1 
ATOM 4871  O O   . GLU B  1 211 ? 123.821 74.991   27.446  1.00 60.86  ?  219 GLU B O   1 
ATOM 4872  C CB  . GLU B  1 211 ? 123.895 72.608   29.505  1.00 55.61  ?  219 GLU B CB  1 
ATOM 4873  C CG  . GLU B  1 211 ? 123.839 71.131   29.869  1.00 63.26  ?  219 GLU B CG  1 
ATOM 4874  C CD  . GLU B  1 211 ? 122.819 70.356   29.057  1.00 66.97  ?  219 GLU B CD  1 
ATOM 4875  O OE1 . GLU B  1 211 ? 121.725 70.898   28.793  1.00 68.28  ?  219 GLU B OE1 1 
ATOM 4876  O OE2 . GLU B  1 211 ? 123.111 69.197   28.691  1.00 69.11  -1 219 GLU B OE2 1 
ATOM 4877  N N   . VAL B  1 212 ? 125.820 75.067   28.474  1.00 51.64  ?  220 VAL B N   1 
ATOM 4878  C CA  . VAL B  1 212 ? 125.948 76.520   28.371  1.00 49.92  ?  220 VAL B CA  1 
ATOM 4879  C C   . VAL B  1 212 ? 127.331 76.839   27.821  1.00 47.89  ?  220 VAL B C   1 
ATOM 4880  O O   . VAL B  1 212 ? 128.246 76.003   27.885  1.00 49.63  ?  220 VAL B O   1 
ATOM 4881  C CB  . VAL B  1 212 ? 125.713 77.210   29.736  1.00 52.63  ?  220 VAL B CB  1 
ATOM 4882  C CG1 . VAL B  1 212 ? 124.234 77.208   30.080  1.00 52.79  ?  220 VAL B CG1 1 
ATOM 4883  C CG2 . VAL B  1 212 ? 126.509 76.516   30.822  1.00 55.11  ?  220 VAL B CG2 1 
ATOM 4884  N N   . PRO B  1 213 ? 127.513 78.036   27.259  1.00 47.31  ?  221 PRO B N   1 
ATOM 4885  C CA  . PRO B  1 213 ? 128.803 78.378   26.643  1.00 46.06  ?  221 PRO B CA  1 
ATOM 4886  C C   . PRO B  1 213 ? 129.955 78.349   27.639  1.00 47.65  ?  221 PRO B C   1 
ATOM 4887  O O   . PRO B  1 213 ? 129.781 78.257   28.856  1.00 48.48  ?  221 PRO B O   1 
ATOM 4888  C CB  . PRO B  1 213 ? 128.573 79.788   26.094  1.00 43.02  ?  221 PRO B CB  1 
ATOM 4889  C CG  . PRO B  1 213 ? 127.111 79.864   25.869  1.00 42.94  ?  221 PRO B CG  1 
ATOM 4890  C CD  . PRO B  1 213 ? 126.488 79.054   26.966  1.00 43.10  ?  221 PRO B CD  1 
ATOM 4891  N N   . LEU B  1 214 ? 131.165 78.433   27.077  1.00 48.76  ?  222 LEU B N   1 
ATOM 4892  C CA  . LEU B  1 214 ? 132.389 78.330   27.867  1.00 50.38  ?  222 LEU B CA  1 
ATOM 4893  C C   . LEU B  1 214 ? 132.490 79.424   28.922  1.00 51.40  ?  222 LEU B C   1 
ATOM 4894  O O   . LEU B  1 214 ? 133.194 79.251   29.923  1.00 52.30  ?  222 LEU B O   1 
ATOM 4895  C CB  . LEU B  1 214 ? 133.604 78.374   26.941  1.00 48.32  ?  222 LEU B CB  1 
ATOM 4896  C CG  . LEU B  1 214 ? 133.660 77.260   25.896  1.00 48.65  ?  222 LEU B CG  1 
ATOM 4897  C CD1 . LEU B  1 214 ? 134.638 77.612   24.792  1.00 48.66  ?  222 LEU B CD1 1 
ATOM 4898  C CD2 . LEU B  1 214 ? 134.042 75.943   26.549  1.00 50.72  ?  222 LEU B CD2 1 
ATOM 4899  N N   . ASP B  1 215 ? 131.823 80.562   28.703  1.00 50.29  ?  223 ASP B N   1 
ATOM 4900  C CA  . ASP B  1 215 ? 131.830 81.640   29.688  1.00 52.07  ?  223 ASP B CA  1 
ATOM 4901  C C   . ASP B  1 215 ? 131.442 81.143   31.074  1.00 52.87  ?  223 ASP B C   1 
ATOM 4902  O O   . ASP B  1 215 ? 132.046 81.539   32.078  1.00 51.50  ?  223 ASP B O   1 
ATOM 4903  C CB  . ASP B  1 215 ? 130.874 82.753   29.255  1.00 49.08  ?  223 ASP B CB  1 
ATOM 4904  C CG  . ASP B  1 215 ? 131.558 83.827   28.449  1.00 61.28  ?  223 ASP B CG  1 
ATOM 4905  O OD1 . ASP B  1 215 ? 132.803 83.829   28.406  1.00 71.98  ?  223 ASP B OD1 1 
ATOM 4906  O OD2 . ASP B  1 215 ? 130.851 84.677   27.866  1.00 62.06  -1 223 ASP B OD2 1 
ATOM 4907  N N   . ILE B  1 216 ? 130.435 80.271   31.147  1.00 48.71  ?  224 ILE B N   1 
ATOM 4908  C CA  . ILE B  1 216 ? 129.790 79.927   32.406  1.00 47.89  ?  224 ILE B CA  1 
ATOM 4909  C C   . ILE B  1 216 ? 129.705 78.428   32.642  1.00 48.07  ?  224 ILE B C   1 
ATOM 4910  O O   . ILE B  1 216 ? 129.230 78.009   33.698  1.00 49.03  ?  224 ILE B O   1 
ATOM 4911  C CB  . ILE B  1 216 ? 128.383 80.552   32.485  1.00 43.28  ?  224 ILE B CB  1 
ATOM 4912  C CG1 . ILE B  1 216 ? 127.534 80.080   31.305  1.00 42.98  ?  224 ILE B CG1 1 
ATOM 4913  C CG2 . ILE B  1 216 ? 128.473 82.069   32.472  1.00 43.35  ?  224 ILE B CG2 1 
ATOM 4914  C CD1 . ILE B  1 216 ? 126.181 80.737   31.222  1.00 42.93  ?  224 ILE B CD1 1 
ATOM 4915  N N   . CYS B  1 217 ? 130.146 77.599   31.692  1.00 47.80  ?  225 CYS B N   1 
ATOM 4916  C CA  . CYS B  1 217 ? 129.940 76.157   31.800  1.00 47.94  ?  225 CYS B CA  1 
ATOM 4917  C C   . CYS B  1 217 ? 130.624 75.548   33.018  1.00 48.95  ?  225 CYS B C   1 
ATOM 4918  O O   . CYS B  1 217 ? 130.261 74.438   33.425  1.00 49.25  ?  225 CYS B O   1 
ATOM 4919  C CB  . CYS B  1 217 ? 130.424 75.460   30.527  1.00 52.35  ?  225 CYS B CB  1 
ATOM 4920  S SG  . CYS B  1 217 ? 132.211 75.250   30.424  1.00 56.38  ?  225 CYS B SG  1 
ATOM 4921  N N   . GLN B  1 218 ? 131.599 76.240   33.608  1.00 49.10  ?  226 GLN B N   1 
ATOM 4922  C CA  . GLN B  1 218 ? 132.275 75.770   34.812  1.00 50.74  ?  226 GLN B CA  1 
ATOM 4923  C C   . GLN B  1 218 ? 132.364 76.883   35.849  1.00 48.57  ?  226 GLN B C   1 
ATOM 4924  O O   . GLN B  1 218 ? 133.334 76.959   36.608  1.00 50.18  ?  226 GLN B O   1 
ATOM 4925  C CB  . GLN B  1 218 ? 133.669 75.231   34.486  1.00 55.34  ?  226 GLN B CB  1 
ATOM 4926  C CG  . GLN B  1 218 ? 133.683 73.923   33.701  1.00 55.58  ?  226 GLN B CG  1 
ATOM 4927  C CD  . GLN B  1 218 ? 133.342 72.719   34.557  1.00 57.75  ?  226 GLN B CD  1 
ATOM 4928  O OE1 . GLN B  1 218 ? 132.243 72.170   34.471  1.00 58.49  ?  226 GLN B OE1 1 
ATOM 4929  N NE2 . GLN B  1 218 ? 134.290 72.297   35.387  1.00 59.33  ?  226 GLN B NE2 1 
ATOM 4930  N N   . SER B  1 219 ? 131.356 77.749   35.896  1.00 48.42  ?  227 SER B N   1 
ATOM 4931  C CA  . SER B  1 219 ? 131.337 78.887   36.800  1.00 48.82  ?  227 SER B CA  1 
ATOM 4932  C C   . SER B  1 219 ? 129.970 78.979   37.470  1.00 51.42  ?  227 SER B C   1 
ATOM 4933  O O   . SER B  1 219 ? 129.093 78.132   37.273  1.00 49.35  ?  227 SER B O   1 
ATOM 4934  C CB  . SER B  1 219 ? 131.669 80.185   36.053  1.00 51.53  ?  227 SER B CB  1 
ATOM 4935  O OG  . SER B  1 219 ? 133.003 80.167   35.576  1.00 57.26  ?  227 SER B OG  1 
ATOM 4936  N N   . ILE B  1 220 ? 129.795 80.027   38.273  1.00 56.77  ?  228 ILE B N   1 
ATOM 4937  C CA  . ILE B  1 220 ? 128.553 80.296   38.987  1.00 55.22  ?  228 ILE B CA  1 
ATOM 4938  C C   . ILE B  1 220 ? 128.006 81.633   38.510  1.00 54.61  ?  228 ILE B C   1 
ATOM 4939  O O   . ILE B  1 220 ? 128.730 82.636   38.499  1.00 60.30  ?  228 ILE B O   1 
ATOM 4940  C CB  . ILE B  1 220 ? 128.764 80.317   40.513  1.00 52.94  ?  228 ILE B CB  1 
ATOM 4941  C CG1 . ILE B  1 220 ? 129.170 78.936   41.027  1.00 54.86  ?  228 ILE B CG1 1 
ATOM 4942  C CG2 . ILE B  1 220 ? 127.514 80.818   41.224  1.00 52.78  ?  228 ILE B CG2 1 
ATOM 4943  C CD1 . ILE B  1 220 ? 129.228 78.847   42.539  1.00 57.27  ?  228 ILE B CD1 1 
ATOM 4944  N N   . CYS B  1 221 ? 126.733 81.649   38.126  1.00 50.58  ?  229 CYS B N   1 
ATOM 4945  C CA  . CYS B  1 221 ? 126.042 82.877   37.759  1.00 48.61  ?  229 CYS B CA  1 
ATOM 4946  C C   . CYS B  1 221 ? 125.249 83.357   38.968  1.00 48.89  ?  229 CYS B C   1 
ATOM 4947  O O   . CYS B  1 221 ? 124.372 82.640   39.463  1.00 51.33  ?  229 CYS B O   1 
ATOM 4948  C CB  . CYS B  1 221 ? 125.120 82.655   36.561  1.00 50.27  ?  229 CYS B CB  1 
ATOM 4949  S SG  . CYS B  1 221 ? 125.972 82.409   34.985  1.00 46.51  ?  229 CYS B SG  1 
ATOM 4950  N N   . LYS B  1 222 ? 125.563 84.557   39.447  1.00 48.75  ?  230 LYS B N   1 
ATOM 4951  C CA  . LYS B  1 222 ? 124.922 85.123   40.624  1.00 50.89  ?  230 LYS B CA  1 
ATOM 4952  C C   . LYS B  1 222 ? 124.034 86.294   40.227  1.00 50.81  ?  230 LYS B C   1 
ATOM 4953  O O   . LYS B  1 222 ? 124.394 87.091   39.355  1.00 51.86  ?  230 LYS B O   1 
ATOM 4954  C CB  . LYS B  1 222 ? 125.964 85.580   41.651  1.00 49.97  ?  230 LYS B CB  1 
ATOM 4955  C CG  . LYS B  1 222 ? 126.836 84.456   42.192  1.00 51.75  ?  230 LYS B CG  1 
ATOM 4956  C CD  . LYS B  1 222 ? 127.748 84.935   43.313  1.00 52.34  ?  230 LYS B CD  1 
ATOM 4957  C CE  . LYS B  1 222 ? 128.684 83.826   43.776  1.00 55.58  ?  230 LYS B CE  1 
ATOM 4958  N NZ  . LYS B  1 222 ? 129.543 84.255   44.914  1.00 61.03  1  230 LYS B NZ  1 
ATOM 4959  N N   . TYR B  1 223 ? 122.879 86.397   40.879  1.00 51.47  ?  231 TYR B N   1 
ATOM 4960  C CA  . TYR B  1 223 ? 121.967 87.507   40.695  1.00 50.49  ?  231 TYR B CA  1 
ATOM 4961  C C   . TYR B  1 223 ? 121.824 88.260   42.012  1.00 55.86  ?  231 TYR B C   1 
ATOM 4962  O O   . TYR B  1 223 ? 121.701 87.623   43.068  1.00 58.77  ?  231 TYR B O   1 
ATOM 4963  C CB  . TYR B  1 223 ? 120.591 87.011   40.212  1.00 53.82  ?  231 TYR B CB  1 
ATOM 4964  C CG  . TYR B  1 223 ? 119.652 88.121   39.806  1.00 54.47  ?  231 TYR B CG  1 
ATOM 4965  C CD1 . TYR B  1 223 ? 119.918 88.913   38.697  1.00 55.56  ?  231 TYR B CD1 1 
ATOM 4966  C CD2 . TYR B  1 223 ? 118.499 88.378   40.533  1.00 58.29  ?  231 TYR B CD2 1 
ATOM 4967  C CE1 . TYR B  1 223 ? 119.062 89.933   38.327  1.00 56.53  ?  231 TYR B CE1 1 
ATOM 4968  C CE2 . TYR B  1 223 ? 117.637 89.391   40.170  1.00 58.77  ?  231 TYR B CE2 1 
ATOM 4969  C CZ  . TYR B  1 223 ? 117.923 90.166   39.066  1.00 58.20  ?  231 TYR B CZ  1 
ATOM 4970  O OH  . TYR B  1 223 ? 117.065 91.178   38.703  1.00 59.13  ?  231 TYR B OH  1 
ATOM 4971  N N   . PRO B  1 224 ? 121.869 89.592   42.006  1.00 56.75  ?  232 PRO B N   1 
ATOM 4972  C CA  . PRO B  1 224 ? 121.785 90.333   43.272  1.00 56.93  ?  232 PRO B CA  1 
ATOM 4973  C C   . PRO B  1 224 ? 120.459 90.075   43.970  1.00 59.98  ?  232 PRO B C   1 
ATOM 4974  O O   . PRO B  1 224 ? 119.391 90.130   43.356  1.00 59.03  ?  232 PRO B O   1 
ATOM 4975  C CB  . PRO B  1 224 ? 121.924 91.798   42.840  1.00 53.67  ?  232 PRO B CB  1 
ATOM 4976  C CG  . PRO B  1 224 ? 122.583 91.745   41.509  1.00 53.32  ?  232 PRO B CG  1 
ATOM 4977  C CD  . PRO B  1 224 ? 122.070 90.495   40.861  1.00 52.95  ?  232 PRO B CD  1 
ATOM 4978  N N   . ASP B  1 225 ? 120.537 89.784   45.269  1.00 58.15  ?  233 ASP B N   1 
ATOM 4979  C CA  . ASP B  1 225 ? 119.349 89.503   46.072  1.00 55.59  ?  233 ASP B CA  1 
ATOM 4980  C C   . ASP B  1 225 ? 118.781 90.835   46.556  1.00 54.90  ?  233 ASP B C   1 
ATOM 4981  O O   . ASP B  1 225 ? 118.950 91.245   47.707  1.00 54.09  ?  233 ASP B O   1 
ATOM 4982  C CB  . ASP B  1 225 ? 119.695 88.573   47.228  1.00 53.67  ?  233 ASP B CB  1 
ATOM 4983  C CG  . ASP B  1 225 ? 118.484 87.842   47.772  1.00 64.15  ?  233 ASP B CG  1 
ATOM 4984  O OD1 . ASP B  1 225 ? 117.347 88.210   47.409  1.00 69.14  ?  233 ASP B OD1 1 
ATOM 4985  O OD2 . ASP B  1 225 ? 118.671 86.896   48.567  1.00 61.69  -1 233 ASP B OD2 1 
ATOM 4986  N N   . TYR B  1 226 ? 118.101 91.528   45.636  1.00 53.99  ?  234 TYR B N   1 
ATOM 4987  C CA  . TYR B  1 226 ? 117.478 92.806   45.972  1.00 60.15  ?  234 TYR B CA  1 
ATOM 4988  C C   . TYR B  1 226 ? 116.463 92.649   47.095  1.00 61.93  ?  234 TYR B C   1 
ATOM 4989  O O   . TYR B  1 226 ? 116.312 93.540   47.940  1.00 67.51  ?  234 TYR B O   1 
ATOM 4990  C CB  . TYR B  1 226 ? 116.797 93.402   44.737  1.00 64.18  ?  234 TYR B CB  1 
ATOM 4991  C CG  . TYR B  1 226 ? 117.664 93.480   43.498  1.00 67.21  ?  234 TYR B CG  1 
ATOM 4992  C CD1 . TYR B  1 226 ? 118.757 94.337   43.436  1.00 68.12  ?  234 TYR B CD1 1 
ATOM 4993  C CD2 . TYR B  1 226 ? 117.381 92.700   42.384  1.00 70.26  ?  234 TYR B CD2 1 
ATOM 4994  C CE1 . TYR B  1 226 ? 119.545 94.410   42.300  1.00 68.49  ?  234 TYR B CE1 1 
ATOM 4995  C CE2 . TYR B  1 226 ? 118.162 92.766   41.245  1.00 71.86  ?  234 TYR B CE2 1 
ATOM 4996  C CZ  . TYR B  1 226 ? 119.243 93.621   41.207  1.00 70.47  ?  234 TYR B CZ  1 
ATOM 4997  O OH  . TYR B  1 226 ? 120.020 93.684   40.071  1.00 68.96  ?  234 TYR B OH  1 
ATOM 4998  N N   . LEU B  1 227 ? 115.752 91.519   47.115  1.00 60.97  ?  235 LEU B N   1 
ATOM 4999  C CA  . LEU B  1 227 ? 114.752 91.280   48.149  1.00 59.29  ?  235 LEU B CA  1 
ATOM 5000  C C   . LEU B  1 227 ? 115.390 91.173   49.528  1.00 58.81  ?  235 LEU B C   1 
ATOM 5001  O O   . LEU B  1 227 ? 114.868 91.720   50.508  1.00 59.91  ?  235 LEU B O   1 
ATOM 5002  C CB  . LEU B  1 227 ? 113.959 90.014   47.818  1.00 59.72  ?  235 LEU B CB  1 
ATOM 5003  C CG  . LEU B  1 227 ? 112.673 90.169   46.997  1.00 57.85  ?  235 LEU B CG  1 
ATOM 5004  C CD1 . LEU B  1 227 ? 112.868 91.084   45.799  1.00 58.54  ?  235 LEU B CD1 1 
ATOM 5005  C CD2 . LEU B  1 227 ? 112.189 88.805   46.534  1.00 57.08  ?  235 LEU B CD2 1 
ATOM 5006  N N   . GLN B  1 228 ? 116.526 90.481   49.625  1.00 56.44  ?  236 GLN B N   1 
ATOM 5007  C CA  . GLN B  1 228 ? 117.176 90.310   50.919  1.00 58.75  ?  236 GLN B CA  1 
ATOM 5008  C C   . GLN B  1 228 ? 117.926 91.568   51.338  1.00 59.72  ?  236 GLN B C   1 
ATOM 5009  O O   . GLN B  1 228 ? 117.864 91.967   52.506  1.00 65.40  ?  236 GLN B O   1 
ATOM 5010  C CB  . GLN B  1 228 ? 118.115 89.104   50.876  1.00 58.81  ?  236 GLN B CB  1 
ATOM 5011  C CG  . GLN B  1 228 ? 118.702 88.702   52.220  1.00 64.32  ?  236 GLN B CG  1 
ATOM 5012  C CD  . GLN B  1 228 ? 120.092 89.261   52.446  1.00 71.79  ?  236 GLN B CD  1 
ATOM 5013  O OE1 . GLN B  1 228 ? 120.547 90.142   51.716  1.00 74.59  ?  236 GLN B OE1 1 
ATOM 5014  N NE2 . GLN B  1 228 ? 120.780 88.740   53.455  1.00 76.53  ?  236 GLN B NE2 1 
ATOM 5015  N N   . MET B  1 229 ? 118.634 92.207   50.403  1.00 59.11  ?  237 MET B N   1 
ATOM 5016  C CA  . MET B  1 229 ? 119.386 93.410   50.747  1.00 59.93  ?  237 MET B CA  1 
ATOM 5017  C C   . MET B  1 229 ? 118.466 94.576   51.080  1.00 59.16  ?  237 MET B C   1 
ATOM 5018  O O   . MET B  1 229 ? 118.826 95.432   51.897  1.00 60.80  ?  237 MET B O   1 
ATOM 5019  C CB  . MET B  1 229 ? 120.324 93.797   49.605  1.00 58.31  ?  237 MET B CB  1 
ATOM 5020  C CG  . MET B  1 229 ? 121.474 92.839   49.381  1.00 58.65  ?  237 MET B CG  1 
ATOM 5021  S SD  . MET B  1 229 ? 122.585 93.476   48.118  1.00 59.69  ?  237 MET B SD  1 
ATOM 5022  C CE  . MET B  1 229 ? 121.459 93.632   46.736  1.00 55.45  ?  237 MET B CE  1 
ATOM 5023  N N   . SER B  1 230 ? 117.286 94.634   50.460  1.00 60.29  ?  238 SER B N   1 
ATOM 5024  C CA  . SER B  1 230 ? 116.342 95.697   50.781  1.00 62.81  ?  238 SER B CA  1 
ATOM 5025  C C   . SER B  1 230 ? 115.634 95.436   52.103  1.00 63.97  ?  238 SER B C   1 
ATOM 5026  O O   . SER B  1 230 ? 115.255 96.385   52.797  1.00 63.71  ?  238 SER B O   1 
ATOM 5027  C CB  . SER B  1 230 ? 115.321 95.856   49.655  1.00 66.44  ?  238 SER B CB  1 
ATOM 5028  O OG  . SER B  1 230 ? 114.189 95.038   49.883  1.00 73.83  ?  238 SER B OG  1 
ATOM 5029  N N   . ALA B  1 231 ? 115.452 94.167   52.466  1.00 63.44  ?  239 ALA B N   1 
ATOM 5030  C CA  . ALA B  1 231 ? 114.883 93.806   53.757  1.00 66.81  ?  239 ALA B CA  1 
ATOM 5031  C C   . ALA B  1 231 ? 115.917 93.795   54.873  1.00 65.78  ?  239 ALA B C   1 
ATOM 5032  O O   . ALA B  1 231 ? 115.585 93.404   55.997  1.00 70.41  ?  239 ALA B O   1 
ATOM 5033  C CB  . ALA B  1 231 ? 114.203 92.437   53.672  1.00 71.99  ?  239 ALA B CB  1 
ATOM 5034  N N   . ASP B  1 232 ? 117.156 94.187   54.585  1.00 60.94  ?  240 ASP B N   1 
ATOM 5035  C CA  . ASP B  1 232 ? 118.182 94.260   55.613  1.00 65.28  ?  240 ASP B CA  1 
ATOM 5036  C C   . ASP B  1 232 ? 117.769 95.248   56.698  1.00 70.43  ?  240 ASP B C   1 
ATOM 5037  O O   . ASP B  1 232 ? 117.105 96.254   56.436  1.00 72.23  ?  240 ASP B O   1 
ATOM 5038  C CB  . ASP B  1 232 ? 119.522 94.670   54.997  1.00 69.46  ?  240 ASP B CB  1 
ATOM 5039  C CG  . ASP B  1 232 ? 120.701 94.395   55.915  1.00 80.11  ?  240 ASP B CG  1 
ATOM 5040  O OD1 . ASP B  1 232 ? 120.518 94.377   57.151  1.00 85.04  ?  240 ASP B OD1 1 
ATOM 5041  O OD2 . ASP B  1 232 ? 121.820 94.193   55.394  1.00 83.94  -1 240 ASP B OD2 1 
ATOM 5042  N N   . ALA B  1 233 ? 118.177 94.950   57.932  1.00 70.13  ?  241 ALA B N   1 
ATOM 5043  C CA  . ALA B  1 233 ? 117.825 95.800   59.064  1.00 73.13  ?  241 ALA B CA  1 
ATOM 5044  C C   . ALA B  1 233 ? 118.493 97.167   58.961  1.00 77.24  ?  241 ALA B C   1 
ATOM 5045  O O   . ALA B  1 233 ? 117.822 98.205   58.989  1.00 81.22  ?  241 ALA B O   1 
ATOM 5046  C CB  . ALA B  1 233 ? 118.206 95.110   60.375  1.00 72.84  ?  241 ALA B CB  1 
ATOM 5047  N N   . TYR B  1 234 ? 119.819 97.185   58.838  1.00 69.16  ?  242 TYR B N   1 
ATOM 5048  C CA  . TYR B  1 234 ? 120.567 98.436   58.831  1.00 71.98  ?  242 TYR B CA  1 
ATOM 5049  C C   . TYR B  1 234 ? 120.678 99.063   57.449  1.00 64.23  ?  242 TYR B C   1 
ATOM 5050  O O   . TYR B  1 234 ? 120.791 100.291  57.345  1.00 64.71  ?  242 TYR B O   1 
ATOM 5051  C CB  . TYR B  1 234 ? 121.970 98.203   59.395  1.00 63.90  ?  242 TYR B CB  1 
ATOM 5052  C CG  . TYR B  1 234 ? 121.976 97.829   60.858  1.00 67.05  ?  242 TYR B CG  1 
ATOM 5053  C CD1 . TYR B  1 234 ? 122.096 98.800   61.843  1.00 69.88  ?  242 TYR B CD1 1 
ATOM 5054  C CD2 . TYR B  1 234 ? 121.855 96.503   61.255  1.00 70.37  ?  242 TYR B CD2 1 
ATOM 5055  C CE1 . TYR B  1 234 ? 122.095 98.461   63.184  1.00 73.45  ?  242 TYR B CE1 1 
ATOM 5056  C CE2 . TYR B  1 234 ? 121.856 96.155   62.592  1.00 73.89  ?  242 TYR B CE2 1 
ATOM 5057  C CZ  . TYR B  1 234 ? 121.977 97.137   63.553  1.00 75.16  ?  242 TYR B CZ  1 
ATOM 5058  O OH  . TYR B  1 234 ? 121.979 96.794   64.885  1.00 76.46  ?  242 TYR B OH  1 
ATOM 5059  N N   . GLY B  1 235 ? 120.639 98.259   56.390  1.00 68.98  ?  243 GLY B N   1 
ATOM 5060  C CA  . GLY B  1 235 ? 120.782 98.791   55.050  1.00 67.10  ?  243 GLY B CA  1 
ATOM 5061  C C   . GLY B  1 235 ? 122.207 99.079   54.638  1.00 62.67  ?  243 GLY B C   1 
ATOM 5062  O O   . GLY B  1 235 ? 122.437 99.956   53.799  1.00 61.76  ?  243 GLY B O   1 
ATOM 5063  N N   . ASP B  1 236 ? 123.180 98.366   55.212  1.00 63.59  ?  244 ASP B N   1 
ATOM 5064  C CA  . ASP B  1 236 ? 124.577 98.570   54.850  1.00 64.55  ?  244 ASP B CA  1 
ATOM 5065  C C   . ASP B  1 236 ? 124.923 97.929   53.513  1.00 66.99  ?  244 ASP B C   1 
ATOM 5066  O O   . ASP B  1 236 ? 125.805 98.425   52.803  1.00 70.10  ?  244 ASP B O   1 
ATOM 5067  C CB  . ASP B  1 236 ? 125.494 97.999   55.934  1.00 60.86  ?  244 ASP B CB  1 
ATOM 5068  C CG  . ASP B  1 236 ? 125.335 98.698   57.265  1.00 71.41  ?  244 ASP B CG  1 
ATOM 5069  O OD1 . ASP B  1 236 ? 124.906 99.870   57.278  1.00 80.62  ?  244 ASP B OD1 1 
ATOM 5070  O OD2 . ASP B  1 236 ? 125.644 98.074   58.302  1.00 72.59  -1 244 ASP B OD2 1 
ATOM 5071  N N   . SER B  1 237 ? 124.246 96.833   53.161  1.00 71.16  ?  245 SER B N   1 
ATOM 5072  C CA  . SER B  1 237 ? 124.597 96.095   51.953  1.00 66.19  ?  245 SER B CA  1 
ATOM 5073  C C   . SER B  1 237 ? 124.328 96.914   50.697  1.00 65.44  ?  245 SER B C   1 
ATOM 5074  O O   . SER B  1 237 ? 125.090 96.838   49.726  1.00 70.89  ?  245 SER B O   1 
ATOM 5075  C CB  . SER B  1 237 ? 123.824 94.778   51.906  1.00 65.05  ?  245 SER B CB  1 
ATOM 5076  O OG  . SER B  1 237 ? 124.105 93.983   53.045  1.00 71.23  ?  245 SER B OG  1 
ATOM 5077  N N   . MET B  1 238 ? 123.256 97.702   50.696  1.00 60.50  ?  246 MET B N   1 
ATOM 5078  C CA  . MET B  1 238 ? 122.848 98.415   49.490  1.00 62.49  ?  246 MET B CA  1 
ATOM 5079  C C   . MET B  1 238 ? 122.044 99.640   49.901  1.00 62.22  ?  246 MET B C   1 
ATOM 5080  O O   . MET B  1 238 ? 120.926 99.499   50.406  1.00 63.72  ?  246 MET B O   1 
ATOM 5081  C CB  . MET B  1 238 ? 122.031 97.500   48.583  1.00 68.76  ?  246 MET B CB  1 
ATOM 5082  C CG  . MET B  1 238 ? 121.264 98.213   47.481  1.00 66.45  ?  246 MET B CG  1 
ATOM 5083  S SD  . MET B  1 238 ? 119.943 97.183   46.807  1.00 59.83  ?  246 MET B SD  1 
ATOM 5084  C CE  . MET B  1 238 ? 118.856 97.042   48.222  1.00 61.23  ?  246 MET B CE  1 
ATOM 5085  N N   . PHE B  1 239 ? 122.605 100.830  49.692  1.00 57.46  ?  247 PHE B N   1 
ATOM 5086  C CA  . PHE B  1 239 ? 121.836 102.058  49.841  1.00 61.00  ?  247 PHE B CA  1 
ATOM 5087  C C   . PHE B  1 239 ? 121.700 102.819  48.528  1.00 60.06  ?  247 PHE B C   1 
ATOM 5088  O O   . PHE B  1 239 ? 121.255 103.973  48.535  1.00 64.76  ?  247 PHE B O   1 
ATOM 5089  C CB  . PHE B  1 239 ? 122.431 102.961  50.932  1.00 66.81  ?  247 PHE B CB  1 
ATOM 5090  C CG  . PHE B  1 239 ? 123.924 103.145  50.859  1.00 60.08  ?  247 PHE B CG  1 
ATOM 5091  C CD1 . PHE B  1 239 ? 124.513 103.795  49.789  1.00 56.22  ?  247 PHE B CD1 1 
ATOM 5092  C CD2 . PHE B  1 239 ? 124.732 102.717  51.900  1.00 59.23  ?  247 PHE B CD2 1 
ATOM 5093  C CE1 . PHE B  1 239 ? 125.880 103.979  49.740  1.00 58.56  ?  247 PHE B CE1 1 
ATOM 5094  C CE2 . PHE B  1 239 ? 126.100 102.900  51.858  1.00 59.32  ?  247 PHE B CE2 1 
ATOM 5095  C CZ  . PHE B  1 239 ? 126.675 103.531  50.776  1.00 59.28  ?  247 PHE B CZ  1 
ATOM 5096  N N   . PHE B  1 240 ? 122.069 102.204  47.406  1.00 63.26  ?  248 PHE B N   1 
ATOM 5097  C CA  . PHE B  1 240 ? 121.835 102.777  46.087  1.00 64.78  ?  248 PHE B CA  1 
ATOM 5098  C C   . PHE B  1 240 ? 121.907 101.651  45.066  1.00 64.72  ?  248 PHE B C   1 
ATOM 5099  O O   . PHE B  1 240 ? 122.894 100.906  45.036  1.00 71.54  ?  248 PHE B O   1 
ATOM 5100  C CB  . PHE B  1 240 ? 122.856 103.872  45.758  1.00 66.97  ?  248 PHE B CB  1 
ATOM 5101  C CG  . PHE B  1 240 ? 122.530 104.648  44.515  1.00 71.31  ?  248 PHE B CG  1 
ATOM 5102  C CD1 . PHE B  1 240 ? 121.612 105.686  44.552  1.00 77.96  ?  248 PHE B CD1 1 
ATOM 5103  C CD2 . PHE B  1 240 ? 123.136 104.337  43.309  1.00 72.72  ?  248 PHE B CD2 1 
ATOM 5104  C CE1 . PHE B  1 240 ? 121.306 106.403  43.409  1.00 81.33  ?  248 PHE B CE1 1 
ATOM 5105  C CE2 . PHE B  1 240 ? 122.838 105.050  42.162  1.00 77.57  ?  248 PHE B CE2 1 
ATOM 5106  C CZ  . PHE B  1 240 ? 121.920 106.084  42.211  1.00 80.86  ?  248 PHE B CZ  1 
ATOM 5107  N N   . CYS B  1 241 ? 120.872 101.537  44.234  1.00 62.98  ?  249 CYS B N   1 
ATOM 5108  C CA  . CYS B  1 241 ? 120.725 100.396  43.339  1.00 59.56  ?  249 CYS B CA  1 
ATOM 5109  C C   . CYS B  1 241 ? 120.049 100.828  42.046  1.00 58.95  ?  249 CYS B C   1 
ATOM 5110  O O   . CYS B  1 241 ? 118.959 101.405  42.077  1.00 66.13  ?  249 CYS B O   1 
ATOM 5111  C CB  . CYS B  1 241 ? 119.915 99.284   44.009  1.00 63.31  ?  249 CYS B CB  1 
ATOM 5112  S SG  . CYS B  1 241 ? 119.436 97.944   42.903  1.00 66.61  ?  249 CYS B SG  1 
ATOM 5113  N N   . LEU B  1 242 ? 120.691 100.532  40.917  1.00 58.33  ?  250 LEU B N   1 
ATOM 5114  C CA  . LEU B  1 242 ? 120.132 100.790  39.594  1.00 56.16  ?  250 LEU B CA  1 
ATOM 5115  C C   . LEU B  1 242 ? 120.274 99.531   38.753  1.00 55.09  ?  250 LEU B C   1 
ATOM 5116  O O   . LEU B  1 242 ? 121.396 99.102   38.464  1.00 57.76  ?  250 LEU B O   1 
ATOM 5117  C CB  . LEU B  1 242 ? 120.836 101.965  38.909  1.00 54.39  ?  250 LEU B CB  1 
ATOM 5118  C CG  . LEU B  1 242 ? 120.832 103.312  39.629  1.00 54.90  ?  250 LEU B CG  1 
ATOM 5119  C CD1 . LEU B  1 242 ? 121.712 104.304  38.890  1.00 55.05  ?  250 LEU B CD1 1 
ATOM 5120  C CD2 . LEU B  1 242 ? 119.417 103.842  39.762  1.00 54.91  ?  250 LEU B CD2 1 
ATOM 5121  N N   . ARG B  1 243 ? 119.148 98.944   38.358  1.00 54.04  ?  251 ARG B N   1 
ATOM 5122  C CA  . ARG B  1 243 ? 119.144 97.756   37.520  1.00 48.91  ?  251 ARG B CA  1 
ATOM 5123  C C   . ARG B  1 243 ? 118.394 98.041   36.226  1.00 48.24  ?  251 ARG B C   1 
ATOM 5124  O O   . ARG B  1 243 ? 117.474 98.865   36.189  1.00 48.94  ?  251 ARG B O   1 
ATOM 5125  C CB  . ARG B  1 243 ? 118.517 96.552   38.243  1.00 62.08  ?  251 ARG B CB  1 
ATOM 5126  C CG  . ARG B  1 243 ? 117.000 96.596   38.370  1.00 71.18  ?  251 ARG B CG  1 
ATOM 5127  C CD  . ARG B  1 243 ? 116.470 95.323   39.021  1.00 77.77  ?  251 ARG B CD  1 
ATOM 5128  N NE  . ARG B  1 243 ? 115.010 95.296   39.100  1.00 76.52  ?  251 ARG B NE  1 
ATOM 5129  C CZ  . ARG B  1 243 ? 114.219 94.730   38.191  1.00 63.21  ?  251 ARG B CZ  1 
ATOM 5130  N NH1 . ARG B  1 243 ? 114.744 94.132   37.129  1.00 55.77  1  251 ARG B NH1 1 
ATOM 5131  N NH2 . ARG B  1 243 ? 112.902 94.755   38.348  1.00 55.10  ?  251 ARG B NH2 1 
ATOM 5132  N N   . ARG B  1 244 ? 118.809 97.352   35.160  1.00 49.03  ?  252 ARG B N   1 
ATOM 5133  C CA  . ARG B  1 244 ? 118.204 97.526   33.840  1.00 49.64  ?  252 ARG B CA  1 
ATOM 5134  C C   . ARG B  1 244 ? 118.657 96.342   32.982  1.00 50.50  ?  252 ARG B C   1 
ATOM 5135  O O   . ARG B  1 244 ? 119.797 96.321   32.509  1.00 53.65  ?  252 ARG B O   1 
ATOM 5136  C CB  . ARG B  1 244 ? 118.605 98.857   33.221  1.00 48.06  ?  252 ARG B CB  1 
ATOM 5137  C CG  . ARG B  1 244 ? 117.659 99.358   32.139  1.00 50.95  ?  252 ARG B CG  1 
ATOM 5138  C CD  . ARG B  1 244 ? 118.001 98.806   30.767  1.00 55.83  ?  252 ARG B CD  1 
ATOM 5139  N NE  . ARG B  1 244 ? 116.957 99.105   29.789  1.00 61.05  ?  252 ARG B NE  1 
ATOM 5140  C CZ  . ARG B  1 244 ? 116.960 98.668   28.534  1.00 65.99  ?  252 ARG B CZ  1 
ATOM 5141  N NH1 . ARG B  1 244 ? 117.957 97.910   28.094  1.00 69.61  1  252 ARG B NH1 1 
ATOM 5142  N NH2 . ARG B  1 244 ? 115.966 98.989   27.716  1.00 64.26  ?  252 ARG B NH2 1 
ATOM 5143  N N   . GLU B  1 245 ? 117.763 95.373   32.793  1.00 46.82  ?  253 GLU B N   1 
ATOM 5144  C CA  . GLU B  1 245 ? 118.075 94.137   32.091  1.00 45.50  ?  253 GLU B CA  1 
ATOM 5145  C C   . GLU B  1 245 ? 117.029 93.864   31.019  1.00 44.78  ?  253 GLU B C   1 
ATOM 5146  O O   . GLU B  1 245 ? 115.861 94.233   31.162  1.00 45.28  ?  253 GLU B O   1 
ATOM 5147  C CB  . GLU B  1 245 ? 118.137 92.951   33.063  1.00 44.97  ?  253 GLU B CB  1 
ATOM 5148  C CG  . GLU B  1 245 ? 117.081 93.010   34.159  1.00 50.64  ?  253 GLU B CG  1 
ATOM 5149  C CD  . GLU B  1 245 ? 117.282 91.964   35.243  1.00 57.61  ?  253 GLU B CD  1 
ATOM 5150  O OE1 . GLU B  1 245 ? 117.516 90.785   34.906  1.00 50.86  ?  253 GLU B OE1 1 
ATOM 5151  O OE2 . GLU B  1 245 ? 117.210 92.323   36.438  1.00 68.63  -1 253 GLU B OE2 1 
ATOM 5152  N N   . GLN B  1 246 ? 117.462 93.210   29.941  1.00 47.70  ?  254 GLN B N   1 
ATOM 5153  C CA  . GLN B  1 246 ? 116.552 92.822   28.872  1.00 46.79  ?  254 GLN B CA  1 
ATOM 5154  C C   . GLN B  1 246 ? 117.099 91.587   28.168  1.00 45.87  ?  254 GLN B C   1 
ATOM 5155  O O   . GLN B  1 246 ? 118.315 91.379   28.091  1.00 45.44  ?  254 GLN B O   1 
ATOM 5156  C CB  . GLN B  1 246 ? 116.321 93.953   27.862  1.00 42.59  ?  254 GLN B CB  1 
ATOM 5157  C CG  . GLN B  1 246 ? 117.457 94.186   26.884  1.00 42.56  ?  254 GLN B CG  1 
ATOM 5158  C CD  . GLN B  1 246 ? 117.114 95.235   25.842  1.00 50.14  ?  254 GLN B CD  1 
ATOM 5159  O OE1 . GLN B  1 246 ? 116.197 96.034   26.030  1.00 55.80  ?  254 GLN B OE1 1 
ATOM 5160  N NE2 . GLN B  1 246 ? 117.843 95.229   24.732  1.00 49.80  ?  254 GLN B NE2 1 
ATOM 5161  N N   . VAL B  1 247 ? 116.178 90.770   27.653  1.00 41.06  ?  255 VAL B N   1 
ATOM 5162  C CA  . VAL B  1 247 ? 116.508 89.489   27.038  1.00 40.86  ?  255 VAL B CA  1 
ATOM 5163  C C   . VAL B  1 247 ? 115.306 88.990   26.246  1.00 40.74  ?  255 VAL B C   1 
ATOM 5164  O O   . VAL B  1 247 ? 114.158 89.312   26.573  1.00 40.84  ?  255 VAL B O   1 
ATOM 5165  C CB  . VAL B  1 247 ? 116.940 88.463   28.105  1.00 39.60  ?  255 VAL B CB  1 
ATOM 5166  C CG1 . VAL B  1 247 ? 115.794 88.177   29.060  1.00 39.76  ?  255 VAL B CG1 1 
ATOM 5167  C CG2 . VAL B  1 247 ? 117.436 87.175   27.459  1.00 39.41  ?  255 VAL B CG2 1 
ATOM 5168  N N   . PHE B  1 248 ? 115.558 88.218   25.189  1.00 37.42  ?  256 PHE B N   1 
ATOM 5169  C CA  . PHE B  1 248 ? 114.491 87.541   24.467  1.00 38.43  ?  256 PHE B CA  1 
ATOM 5170  C C   . PHE B  1 248 ? 115.020 86.230   23.904  1.00 40.69  ?  256 PHE B C   1 
ATOM 5171  O O   . PHE B  1 248 ? 116.232 86.021   23.793  1.00 46.33  ?  256 PHE B O   1 
ATOM 5172  C CB  . PHE B  1 248 ? 113.907 88.424   23.355  1.00 38.60  ?  256 PHE B CB  1 
ATOM 5173  C CG  . PHE B  1 248 ? 114.783 88.540   22.140  1.00 38.43  ?  256 PHE B CG  1 
ATOM 5174  C CD1 . PHE B  1 248 ? 115.815 89.461   22.103  1.00 38.44  ?  256 PHE B CD1 1 
ATOM 5175  C CD2 . PHE B  1 248 ? 114.571 87.736   21.033  1.00 38.29  ?  256 PHE B CD2 1 
ATOM 5176  C CE1 . PHE B  1 248 ? 116.618 89.578   20.984  1.00 38.31  ?  256 PHE B CE1 1 
ATOM 5177  C CE2 . PHE B  1 248 ? 115.373 87.845   19.915  1.00 38.15  ?  256 PHE B CE2 1 
ATOM 5178  C CZ  . PHE B  1 248 ? 116.398 88.767   19.890  1.00 38.16  ?  256 PHE B CZ  1 
ATOM 5179  N N   . ALA B  1 249 ? 114.089 85.351   23.536  1.00 39.70  ?  257 ALA B N   1 
ATOM 5180  C CA  . ALA B  1 249 ? 114.418 84.019   23.042  1.00 41.56  ?  257 ALA B CA  1 
ATOM 5181  C C   . ALA B  1 249 ? 114.618 84.071   21.532  1.00 42.17  ?  257 ALA B C   1 
ATOM 5182  O O   . ALA B  1 249 ? 113.674 84.348   20.783  1.00 40.34  ?  257 ALA B O   1 
ATOM 5183  C CB  . ALA B  1 249 ? 113.321 83.023   23.410  1.00 42.66  ?  257 ALA B CB  1 
ATOM 5184  N N   . ARG B  1 250 ? 115.843 83.795   21.087  1.00 48.32  ?  258 ARG B N   1 
ATOM 5185  C CA  . ARG B  1 250 ? 116.206 83.911   19.680  1.00 46.71  ?  258 ARG B CA  1 
ATOM 5186  C C   . ARG B  1 250 ? 115.958 82.618   18.908  1.00 45.45  ?  258 ARG B C   1 
ATOM 5187  O O   . ARG B  1 250 ? 115.360 82.644   17.827  1.00 45.34  ?  258 ARG B O   1 
ATOM 5188  C CB  . ARG B  1 250 ? 117.672 84.338   19.561  1.00 46.10  ?  258 ARG B CB  1 
ATOM 5189  C CG  . ARG B  1 250 ? 118.058 84.903   18.206  1.00 43.42  ?  258 ARG B CG  1 
ATOM 5190  C CD  . ARG B  1 250 ? 119.374 85.660   18.302  1.00 47.48  ?  258 ARG B CD  1 
ATOM 5191  N NE  . ARG B  1 250 ? 119.845 86.138   17.006  1.00 48.66  ?  258 ARG B NE  1 
ATOM 5192  C CZ  . ARG B  1 250 ? 120.738 87.110   16.849  1.00 45.95  ?  258 ARG B CZ  1 
ATOM 5193  N NH1 . ARG B  1 250 ? 121.258 87.712   17.909  1.00 44.38  1  258 ARG B NH1 1 
ATOM 5194  N NH2 . ARG B  1 250 ? 121.113 87.482   15.632  1.00 45.33  ?  258 ARG B NH2 1 
ATOM 5195  N N   . HIS B  1 251 ? 116.420 81.485   19.434  1.00 46.79  ?  259 HIS B N   1 
ATOM 5196  C CA  . HIS B  1 251 ? 116.237 80.196   18.781  1.00 47.95  ?  259 HIS B CA  1 
ATOM 5197  C C   . HIS B  1 251 ? 115.795 79.159   19.803  1.00 48.33  ?  259 HIS B C   1 
ATOM 5198  O O   . HIS B  1 251 ? 116.174 79.218   20.976  1.00 46.98  ?  259 HIS B O   1 
ATOM 5199  C CB  . HIS B  1 251 ? 117.520 79.728   18.078  1.00 51.31  ?  259 HIS B CB  1 
ATOM 5200  C CG  . HIS B  1 251 ? 117.903 80.571   16.903  1.00 51.09  ?  259 HIS B CG  1 
ATOM 5201  N ND1 . HIS B  1 251 ? 117.281 80.465   15.677  1.00 52.13  ?  259 HIS B ND1 1 
ATOM 5202  C CD2 . HIS B  1 251 ? 118.841 81.537   16.767  1.00 50.38  ?  259 HIS B CD2 1 
ATOM 5203  C CE1 . HIS B  1 251 ? 117.822 81.328   14.836  1.00 50.17  ?  259 HIS B CE1 1 
ATOM 5204  N NE2 . HIS B  1 251 ? 118.771 81.992   15.472  1.00 48.64  ?  259 HIS B NE2 1 
ATOM 5205  N N   . PHE B  1 252 ? 114.977 78.215   19.346  1.00 47.34  ?  260 PHE B N   1 
ATOM 5206  C CA  . PHE B  1 252 ? 114.431 77.163   20.193  1.00 48.08  ?  260 PHE B CA  1 
ATOM 5207  C C   . PHE B  1 252 ? 115.147 75.861   19.866  1.00 48.37  ?  260 PHE B C   1 
ATOM 5208  O O   . PHE B  1 252 ? 115.290 75.510   18.690  1.00 48.24  ?  260 PHE B O   1 
ATOM 5209  C CB  . PHE B  1 252 ? 112.922 76.991   19.987  1.00 43.61  ?  260 PHE B CB  1 
ATOM 5210  C CG  . PHE B  1 252 ? 112.127 78.266   20.106  1.00 42.95  ?  260 PHE B CG  1 
ATOM 5211  C CD1 . PHE B  1 252 ? 112.654 79.395   20.712  1.00 42.33  ?  260 PHE B CD1 1 
ATOM 5212  C CD2 . PHE B  1 252 ? 110.829 78.318   19.632  1.00 48.00  ?  260 PHE B CD2 1 
ATOM 5213  C CE1 . PHE B  1 252 ? 111.915 80.556   20.811  1.00 48.52  ?  260 PHE B CE1 1 
ATOM 5214  C CE2 . PHE B  1 252 ? 110.084 79.473   19.730  1.00 57.08  ?  260 PHE B CE2 1 
ATOM 5215  C CZ  . PHE B  1 252 ? 110.626 80.593   20.323  1.00 56.62  ?  260 PHE B CZ  1 
ATOM 5216  N N   . TRP B  1 253 ? 115.589 75.143   20.895  1.00 45.69  ?  261 TRP B N   1 
ATOM 5217  C CA  . TRP B  1 253 ? 116.433 73.975   20.697  1.00 46.86  ?  261 TRP B CA  1 
ATOM 5218  C C   . TRP B  1 253 ? 115.970 72.810   21.561  1.00 51.35  ?  261 TRP B C   1 
ATOM 5219  O O   . TRP B  1 253 ? 115.102 72.940   22.429  1.00 54.47  ?  261 TRP B O   1 
ATOM 5220  C CB  . TRP B  1 253 ? 117.900 74.293   21.005  1.00 50.43  ?  261 TRP B CB  1 
ATOM 5221  C CG  . TRP B  1 253 ? 118.549 75.143   19.971  1.00 51.22  ?  261 TRP B CG  1 
ATOM 5222  C CD1 . TRP B  1 253 ? 118.284 75.149   18.634  1.00 53.22  ?  261 TRP B CD1 1 
ATOM 5223  C CD2 . TRP B  1 253 ? 119.575 76.117   20.182  1.00 51.61  ?  261 TRP B CD2 1 
ATOM 5224  N NE1 . TRP B  1 253 ? 119.081 76.068   17.998  1.00 52.67  ?  261 TRP B NE1 1 
ATOM 5225  C CE2 . TRP B  1 253 ? 119.884 76.676   18.927  1.00 52.23  ?  261 TRP B CE2 1 
ATOM 5226  C CE3 . TRP B  1 253 ? 120.263 76.571   21.311  1.00 55.34  ?  261 TRP B CE3 1 
ATOM 5227  C CZ2 . TRP B  1 253 ? 120.849 77.664   18.769  1.00 57.76  ?  261 TRP B CZ2 1 
ATOM 5228  C CZ3 . TRP B  1 253 ? 121.222 77.552   21.152  1.00 59.69  ?  261 TRP B CZ3 1 
ATOM 5229  C CH2 . TRP B  1 253 ? 121.504 78.090   19.890  1.00 61.70  ?  261 TRP B CH2 1 
ATOM 5230  N N   . ASN B  1 254 ? 116.584 71.658   21.302  1.00 53.46  ?  262 ASN B N   1 
ATOM 5231  C CA  . ASN B  1 254 ? 116.356 70.422   22.030  1.00 52.74  ?  262 ASN B CA  1 
ATOM 5232  C C   . ASN B  1 254 ? 117.668 69.972   22.658  1.00 54.18  ?  262 ASN B C   1 
ATOM 5233  O O   . ASN B  1 254 ? 118.750 70.244   22.129  1.00 63.14  ?  262 ASN B O   1 
ATOM 5234  C CB  . ASN B  1 254 ? 115.824 69.328   21.097  1.00 49.18  ?  262 ASN B CB  1 
ATOM 5235  C CG  . ASN B  1 254 ? 114.533 68.720   21.588  1.00 54.61  ?  262 ASN B CG  1 
ATOM 5236  O OD1 . ASN B  1 254 ? 113.982 69.143   22.603  1.00 59.94  ?  262 ASN B OD1 1 
ATOM 5237  N ND2 . ASN B  1 254 ? 114.034 67.726   20.862  1.00 54.25  ?  262 ASN B ND2 1 
ATOM 5238  N N   . ARG B  1 255 ? 117.573 69.284   23.790  1.00 49.65  ?  263 ARG B N   1 
ATOM 5239  C CA  . ARG B  1 255 ? 118.746 68.790   24.498  1.00 49.68  ?  263 ARG B CA  1 
ATOM 5240  C C   . ARG B  1 255 ? 118.832 67.279   24.341  1.00 49.87  ?  263 ARG B C   1 
ATOM 5241  O O   . ARG B  1 255 ? 117.863 66.565   24.619  1.00 50.13  ?  263 ARG B O   1 
ATOM 5242  C CB  . ARG B  1 255 ? 118.695 69.168   25.978  1.00 56.23  ?  263 ARG B CB  1 
ATOM 5243  C CG  . ARG B  1 255 ? 118.565 70.659   26.226  1.00 54.21  ?  263 ARG B CG  1 
ATOM 5244  C CD  . ARG B  1 255 ? 119.889 71.383   26.074  1.00 51.68  ?  263 ARG B CD  1 
ATOM 5245  N NE  . ARG B  1 255 ? 119.923 72.598   26.883  1.00 50.78  ?  263 ARG B NE  1 
ATOM 5246  C CZ  . ARG B  1 255 ? 120.875 73.522   26.806  1.00 49.88  ?  263 ARG B CZ  1 
ATOM 5247  N NH1 . ARG B  1 255 ? 121.878 73.376   25.953  1.00 50.02  1  263 ARG B NH1 1 
ATOM 5248  N NH2 . ARG B  1 255 ? 120.823 74.596   27.582  1.00 49.68  ?  263 ARG B NH2 1 
ATOM 5249  N N   . SER B  1 256 ? 119.992 66.796   23.909  1.00 57.40  ?  264 SER B N   1 
ATOM 5250  C CA  . SER B  1 256 ? 120.209 65.363   23.810  1.00 67.09  ?  264 SER B CA  1 
ATOM 5251  C C   . SER B  1 256 ? 120.577 64.792   25.176  1.00 72.12  ?  264 SER B C   1 
ATOM 5252  O O   . SER B  1 256 ? 121.053 65.497   26.070  1.00 72.07  ?  264 SER B O   1 
ATOM 5253  C CB  . SER B  1 256 ? 121.301 65.046   22.785  1.00 69.66  ?  264 SER B CB  1 
ATOM 5254  O OG  . SER B  1 256 ? 122.543 65.612   23.162  1.00 71.08  ?  264 SER B OG  1 
ATOM 5255  N N   . GLY B  1 257 ? 120.336 63.495   25.332  1.00 65.22  ?  265 GLY B N   1 
ATOM 5256  C CA  . GLY B  1 257 ? 120.510 62.853   26.619  1.00 59.99  ?  265 GLY B CA  1 
ATOM 5257  C C   . GLY B  1 257 ? 119.217 62.231   27.098  1.00 55.83  ?  265 GLY B C   1 
ATOM 5258  O O   . GLY B  1 257 ? 118.132 62.718   26.768  1.00 54.01  ?  265 GLY B O   1 
ATOM 5259  N N   . THR B  1 258 ? 119.317 61.152   27.867  1.00 53.92  ?  266 THR B N   1 
ATOM 5260  C CA  . THR B  1 258 ? 118.127 60.434   28.299  1.00 58.15  ?  266 THR B CA  1 
ATOM 5261  C C   . THR B  1 258 ? 117.310 61.280   29.269  1.00 54.96  ?  266 THR B C   1 
ATOM 5262  O O   . THR B  1 258 ? 117.851 61.901   30.187  1.00 54.97  ?  266 THR B O   1 
ATOM 5263  C CB  . THR B  1 258 ? 118.515 59.107   28.949  1.00 62.42  ?  266 THR B CB  1 
ATOM 5264  O OG1 . THR B  1 258 ? 119.409 59.353   30.041  1.00 66.49  ?  266 THR B OG1 1 
ATOM 5265  C CG2 . THR B  1 258 ? 119.203 58.201   27.934  1.00 61.29  ?  266 THR B CG2 1 
ATOM 5266  N N   . MET B  1 259 ? 115.996 61.302   29.057  1.00 52.20  ?  267 MET B N   1 
ATOM 5267  C CA  . MET B  1 259 ? 115.107 62.117   29.875  1.00 51.84  ?  267 MET B CA  1 
ATOM 5268  C C   . MET B  1 259 ? 114.946 61.498   31.258  1.00 54.26  ?  267 MET B C   1 
ATOM 5269  O O   . MET B  1 259 ? 114.421 60.388   31.395  1.00 56.26  ?  267 MET B O   1 
ATOM 5270  C CB  . MET B  1 259 ? 113.751 62.259   29.192  1.00 57.51  ?  267 MET B CB  1 
ATOM 5271  C CG  . MET B  1 259 ? 113.804 62.787   27.765  1.00 54.46  ?  267 MET B CG  1 
ATOM 5272  S SD  . MET B  1 259 ? 113.922 64.586   27.657  1.00 52.91  ?  267 MET B SD  1 
ATOM 5273  C CE  . MET B  1 259 ? 115.694 64.850   27.712  1.00 53.03  ?  267 MET B CE  1 
ATOM 5274  N N   . GLY B  1 260 ? 115.387 62.223   32.287  1.00 49.88  ?  268 GLY B N   1 
ATOM 5275  C CA  . GLY B  1 260 ? 115.299 61.703   33.639  1.00 52.52  ?  268 GLY B CA  1 
ATOM 5276  C C   . GLY B  1 260 ? 113.886 61.668   34.180  1.00 57.75  ?  268 GLY B C   1 
ATOM 5277  O O   . GLY B  1 260 ? 113.567 60.839   35.037  1.00 66.90  ?  268 GLY B O   1 
ATOM 5278  N N   . ASP B  1 261 ? 113.023 62.558   33.699  1.00 52.92  ?  269 ASP B N   1 
ATOM 5279  C CA  . ASP B  1 261 ? 111.631 62.611   34.123  1.00 49.87  ?  269 ASP B CA  1 
ATOM 5280  C C   . ASP B  1 261 ? 110.777 61.930   33.064  1.00 51.29  ?  269 ASP B C   1 
ATOM 5281  O O   . ASP B  1 261 ? 110.797 62.332   31.896  1.00 49.49  ?  269 ASP B O   1 
ATOM 5282  C CB  . ASP B  1 261 ? 111.177 64.056   34.327  1.00 49.33  ?  269 ASP B CB  1 
ATOM 5283  C CG  . ASP B  1 261 ? 111.978 64.771   35.391  1.00 49.86  ?  269 ASP B CG  1 
ATOM 5284  O OD1 . ASP B  1 261 ? 112.343 64.116   36.390  1.00 52.98  ?  269 ASP B OD1 1 
ATOM 5285  O OD2 . ASP B  1 261 ? 112.241 65.983   35.228  1.00 47.26  -1 269 ASP B OD2 1 
ATOM 5286  N N   . GLN B  1 262 ? 110.029 60.909   33.471  1.00 53.29  ?  270 GLN B N   1 
ATOM 5287  C CA  . GLN B  1 262 ? 109.187 60.186   32.528  1.00 53.15  ?  270 GLN B CA  1 
ATOM 5288  C C   . GLN B  1 262 ? 108.006 61.050   32.105  1.00 51.00  ?  270 GLN B C   1 
ATOM 5289  O O   . GLN B  1 262 ? 107.253 61.550   32.947  1.00 51.59  ?  270 GLN B O   1 
ATOM 5290  C CB  . GLN B  1 262 ? 108.701 58.874   33.140  1.00 57.76  ?  270 GLN B CB  1 
ATOM 5291  C CG  . GLN B  1 262 ? 107.942 57.985   32.166  1.00 58.06  ?  270 GLN B CG  1 
ATOM 5292  C CD  . GLN B  1 262 ? 107.326 56.777   32.841  1.00 61.41  ?  270 GLN B CD  1 
ATOM 5293  O OE1 . GLN B  1 262 ? 106.152 56.787   33.212  1.00 67.32  ?  270 GLN B OE1 1 
ATOM 5294  N NE2 . GLN B  1 262 ? 108.119 55.725   33.005  1.00 63.86  ?  270 GLN B NE2 1 
ATOM 5295  N N   . LEU B  1 263 ? 107.851 61.230   30.801  1.00 46.38  ?  271 LEU B N   1 
ATOM 5296  C CA  . LEU B  1 263 ? 106.731 61.985   30.264  1.00 46.34  ?  271 LEU B CA  1 
ATOM 5297  C C   . LEU B  1 263 ? 105.429 61.258   30.576  1.00 46.88  ?  271 LEU B C   1 
ATOM 5298  O O   . LEU B  1 263 ? 105.236 60.126   30.109  1.00 47.18  ?  271 LEU B O   1 
ATOM 5299  C CB  . LEU B  1 263 ? 106.890 62.168   28.757  1.00 47.14  ?  271 LEU B CB  1 
ATOM 5300  C CG  . LEU B  1 263 ? 105.770 62.907   28.025  1.00 46.33  ?  271 LEU B CG  1 
ATOM 5301  C CD1 . LEU B  1 263 ? 105.601 64.300   28.598  1.00 44.98  ?  271 LEU B CD1 1 
ATOM 5302  C CD2 . LEU B  1 263 ? 106.048 62.971   26.533  1.00 44.84  ?  271 LEU B CD2 1 
ATOM 5303  N N   . PRO B  1 264 ? 104.524 61.854   31.353  1.00 45.48  ?  272 PRO B N   1 
ATOM 5304  C CA  . PRO B  1 264 ? 103.281 61.159   31.706  1.00 46.75  ?  272 PRO B CA  1 
ATOM 5305  C C   . PRO B  1 264 ? 102.468 60.837   30.463  1.00 46.86  ?  272 PRO B C   1 
ATOM 5306  O O   . PRO B  1 264 ? 102.226 61.699   29.616  1.00 45.96  ?  272 PRO B O   1 
ATOM 5307  C CB  . PRO B  1 264 ? 102.557 62.161   32.613  1.00 49.06  ?  272 PRO B CB  1 
ATOM 5308  C CG  . PRO B  1 264 ? 103.622 63.087   33.095  1.00 48.11  ?  272 PRO B CG  1 
ATOM 5309  C CD  . PRO B  1 264 ? 104.604 63.185   31.973  1.00 47.04  ?  272 PRO B CD  1 
ATOM 5310  N N   . GLU B  1 265 ? 102.042 59.578   30.364  1.00 50.10  ?  273 GLU B N   1 
ATOM 5311  C CA  . GLU B  1 265 ? 101.307 59.111   29.198  1.00 50.89  ?  273 GLU B CA  1 
ATOM 5312  C C   . GLU B  1 265 ? 99.915  59.718   29.091  1.00 50.46  ?  273 GLU B C   1 
ATOM 5313  O O   . GLU B  1 265 ? 99.240  59.501   28.079  1.00 54.91  ?  273 GLU B O   1 
ATOM 5314  C CB  . GLU B  1 265 ? 101.228 57.584   29.231  1.00 55.68  ?  273 GLU B CB  1 
ATOM 5315  C CG  . GLU B  1 265 ? 102.556 56.932   29.605  1.00 60.71  ?  273 GLU B CG  1 
ATOM 5316  C CD  . GLU B  1 265 ? 102.558 55.428   29.418  1.00 63.08  ?  273 GLU B CD  1 
ATOM 5317  O OE1 . GLU B  1 265 ? 101.490 54.808   29.585  1.00 60.90  ?  273 GLU B OE1 1 
ATOM 5318  O OE2 . GLU B  1 265 ? 103.627 54.864   29.106  1.00 64.92  -1 273 GLU B OE2 1 
ATOM 5319  N N   . SER B  1 266 ? 99.476  60.476   30.098  1.00 47.58  ?  274 SER B N   1 
ATOM 5320  C CA  . SER B  1 266 ? 98.204  61.183   30.030  1.00 47.90  ?  274 SER B CA  1 
ATOM 5321  C C   . SER B  1 266 ? 98.237  62.387   29.099  1.00 45.31  ?  274 SER B C   1 
ATOM 5322  O O   . SER B  1 266 ? 97.171  62.909   28.759  1.00 45.80  ?  274 SER B O   1 
ATOM 5323  C CB  . SER B  1 266 ? 97.790  61.649   31.427  1.00 48.15  ?  274 SER B CB  1 
ATOM 5324  O OG  . SER B  1 266 ? 98.084  60.664   32.401  1.00 52.35  ?  274 SER B OG  1 
ATOM 5325  N N   . LEU B  1 267 ? 99.418  62.831   28.671  1.00 45.15  ?  275 LEU B N   1 
ATOM 5326  C CA  . LEU B  1 267 ? 99.559  64.093   27.960  1.00 43.87  ?  275 LEU B CA  1 
ATOM 5327  C C   . LEU B  1 267 ? 99.750  63.940   26.456  1.00 43.38  ?  275 LEU B C   1 
ATOM 5328  O O   . LEU B  1 267 ? 99.903  64.953   25.768  1.00 42.36  ?  275 LEU B O   1 
ATOM 5329  C CB  . LEU B  1 267 ? 100.737 64.889   28.534  1.00 40.61  ?  275 LEU B CB  1 
ATOM 5330  C CG  . LEU B  1 267 ? 100.750 65.151   30.041  1.00 40.74  ?  275 LEU B CG  1 
ATOM 5331  C CD1 . LEU B  1 267 ? 101.947 66.006   30.423  1.00 40.28  ?  275 LEU B CD1 1 
ATOM 5332  C CD2 . LEU B  1 267 ? 99.457  65.810   30.484  1.00 40.97  ?  275 LEU B CD2 1 
ATOM 5333  N N   . TYR B  1 268 ? 99.733  62.722   25.921  1.00 44.03  ?  276 TYR B N   1 
ATOM 5334  C CA  . TYR B  1 268 ? 99.916  62.561   24.485  1.00 43.89  ?  276 TYR B CA  1 
ATOM 5335  C C   . TYR B  1 268 ? 99.341  61.222   24.047  1.00 44.42  ?  276 TYR B C   1 
ATOM 5336  O O   . TYR B  1 268 ? 98.968  60.379   24.866  1.00 44.86  ?  276 TYR B O   1 
ATOM 5337  C CB  . TYR B  1 268 ? 101.394 62.660   24.077  1.00 50.55  ?  276 TYR B CB  1 
ATOM 5338  C CG  . TYR B  1 268 ? 102.282 61.528   24.565  1.00 56.15  ?  276 TYR B CG  1 
ATOM 5339  C CD1 . TYR B  1 268 ? 103.139 60.877   23.686  1.00 52.55  ?  276 TYR B CD1 1 
ATOM 5340  C CD2 . TYR B  1 268 ? 102.277 61.118   25.893  1.00 58.94  ?  276 TYR B CD2 1 
ATOM 5341  C CE1 . TYR B  1 268 ? 103.954 59.847   24.111  1.00 53.25  ?  276 TYR B CE1 1 
ATOM 5342  C CE2 . TYR B  1 268 ? 103.092 60.087   26.326  1.00 57.71  ?  276 TYR B CE2 1 
ATOM 5343  C CZ  . TYR B  1 268 ? 103.927 59.457   25.431  1.00 55.17  ?  276 TYR B CZ  1 
ATOM 5344  O OH  . TYR B  1 268 ? 104.740 58.432   25.855  1.00 56.04  ?  276 TYR B OH  1 
ATOM 5345  N N   . ILE B  1 269 ? 99.283  61.044   22.729  1.00 51.53  ?  277 ILE B N   1 
ATOM 5346  C CA  . ILE B  1 269 ? 98.850  59.806   22.096  1.00 54.42  ?  277 ILE B CA  1 
ATOM 5347  C C   . ILE B  1 269 ? 99.978  59.318   21.197  1.00 54.69  ?  277 ILE B C   1 
ATOM 5348  O O   . ILE B  1 269 ? 100.487 60.078   20.364  1.00 54.38  ?  277 ILE B O   1 
ATOM 5349  C CB  . ILE B  1 269 ? 97.549  60.007   21.299  1.00 50.05  ?  277 ILE B CB  1 
ATOM 5350  C CG1 . ILE B  1 269 ? 96.456  60.573   22.212  1.00 50.27  ?  277 ILE B CG1 1 
ATOM 5351  C CG2 . ILE B  1 269 ? 97.109  58.702   20.659  1.00 50.60  ?  277 ILE B CG2 1 
ATOM 5352  C CD1 . ILE B  1 269 ? 95.146  60.855   21.508  1.00 50.58  ?  277 ILE B CD1 1 
ATOM 5353  N N   . LYS B  1 270 ? 100.357 58.048   21.356  1.00 58.85  ?  278 LYS B N   1 
ATOM 5354  C CA  . LYS B  1 270 ? 101.614 57.561   20.800  1.00 58.41  ?  278 LYS B CA  1 
ATOM 5355  C C   . LYS B  1 270 ? 101.564 57.364   19.290  1.00 61.83  ?  278 LYS B C   1 
ATOM 5356  O O   . LYS B  1 270 ? 102.620 57.346   18.648  1.00 64.41  ?  278 LYS B O   1 
ATOM 5357  C CB  . LYS B  1 270 ? 102.010 56.248   21.478  1.00 52.41  ?  278 LYS B CB  1 
ATOM 5358  C CG  . LYS B  1 270 ? 103.254 56.349   22.344  1.00 51.36  ?  278 LYS B CG  1 
ATOM 5359  C CD  . LYS B  1 270 ? 103.628 55.001   22.933  1.00 53.78  ?  278 LYS B CD  1 
ATOM 5360  C CE  . LYS B  1 270 ? 104.783 55.131   23.912  1.00 53.03  ?  278 LYS B CE  1 
ATOM 5361  N NZ  . LYS B  1 270 ? 105.233 53.804   24.416  1.00 55.44  1  278 LYS B NZ  1 
ATOM 5362  N N   . GLY B  1 271 ? 100.385 57.217   18.709  1.00 58.41  ?  279 GLY B N   1 
ATOM 5363  C CA  . GLY B  1 271 ? 100.302 56.931   17.292  1.00 59.68  ?  279 GLY B CA  1 
ATOM 5364  C C   . GLY B  1 271 ? 100.349 55.445   17.003  1.00 66.32  ?  279 GLY B C   1 
ATOM 5365  O O   . GLY B  1 271 ? 100.315 54.595   17.900  1.00 75.92  ?  279 GLY B O   1 
ATOM 5366  N N   . THR B  1 272 ? 100.432 55.129   15.706  1.00 61.34  ?  280 THR B N   1 
ATOM 5367  C CA  . THR B  1 272 ? 100.299 53.739   15.274  1.00 63.81  ?  280 THR B CA  1 
ATOM 5368  C C   . THR B  1 272 ? 101.455 52.877   15.774  1.00 70.60  ?  280 THR B C   1 
ATOM 5369  O O   . THR B  1 272 ? 101.240 51.742   16.214  1.00 77.33  ?  280 THR B O   1 
ATOM 5370  C CB  . THR B  1 272 ? 100.191 53.670   13.750  1.00 68.11  ?  280 THR B CB  1 
ATOM 5371  O OG1 . THR B  1 272 ? 101.469 53.353   13.189  1.00 66.78  ?  280 THR B OG1 1 
ATOM 5372  C CG2 . THR B  1 272 ? 99.737  55.010   13.186  1.00 67.39  ?  280 THR B CG2 1 
ATOM 5373  N N   . ASP B  1 273 ? 102.685 53.385   15.706  1.00 70.98  ?  281 ASP B N   1 
ATOM 5374  C CA  . ASP B  1 273 ? 103.863 52.663   16.194  1.00 72.11  ?  281 ASP B CA  1 
ATOM 5375  C C   . ASP B  1 273 ? 103.894 52.737   17.718  1.00 68.01  ?  281 ASP B C   1 
ATOM 5376  O O   . ASP B  1 273 ? 104.550 53.596   18.308  1.00 72.78  ?  281 ASP B O   1 
ATOM 5377  C CB  . ASP B  1 273 ? 105.145 53.211   15.581  1.00 72.72  ?  281 ASP B CB  1 
ATOM 5378  C CG  . ASP B  1 273 ? 106.301 52.230   15.693  1.00 75.18  ?  281 ASP B CG  1 
ATOM 5379  O OD1 . ASP B  1 273 ? 106.107 51.158   16.309  1.00 73.95  ?  281 ASP B OD1 1 
ATOM 5380  O OD2 . ASP B  1 273 ? 107.395 52.526   15.174  1.00 77.32  -1 281 ASP B OD2 1 
ATOM 5381  N N   . ILE B  1 274 ? 103.175 51.822   18.370  1.00 61.91  ?  282 ILE B N   1 
ATOM 5382  C CA  . ILE B  1 274 ? 103.025 51.832   19.825  1.00 63.23  ?  282 ILE B CA  1 
ATOM 5383  C C   . ILE B  1 274 ? 104.343 51.507   20.524  1.00 63.47  ?  282 ILE B C   1 
ATOM 5384  O O   . ILE B  1 274 ? 104.364 51.157   21.708  1.00 67.96  ?  282 ILE B O   1 
ATOM 5385  C CB  . ILE B  1 274 ? 101.918 50.854   20.261  1.00 62.55  ?  282 ILE B CB  1 
ATOM 5386  C CG1 . ILE B  1 274 ? 100.795 50.825   19.228  1.00 63.43  ?  282 ILE B CG1 1 
ATOM 5387  C CG2 . ILE B  1 274 ? 101.323 51.270   21.590  1.00 63.42  ?  282 ILE B CG2 1 
ATOM 5388  C CD1 . ILE B  1 274 ? 99.678  49.864   19.570  1.00 66.40  ?  282 ILE B CD1 1 
ATOM 5389  N N   . ARG B  1 275 ? 105.453 51.625   19.798  1.00 63.59  ?  283 ARG B N   1 
ATOM 5390  C CA  . ARG B  1 275 ? 106.793 51.492   20.353  1.00 62.49  ?  283 ARG B CA  1 
ATOM 5391  C C   . ARG B  1 275 ? 107.534 52.820   20.360  1.00 61.56  ?  283 ARG B C   1 
ATOM 5392  O O   . ARG B  1 275 ? 108.683 52.876   20.813  1.00 68.67  ?  283 ARG B O   1 
ATOM 5393  C CB  . ARG B  1 275 ? 107.616 50.465   19.558  1.00 66.75  ?  283 ARG B CB  1 
ATOM 5394  C CG  . ARG B  1 275 ? 107.151 49.019   19.652  1.00 65.81  ?  283 ARG B CG  1 
ATOM 5395  C CD  . ARG B  1 275 ? 106.653 48.494   18.311  1.00 72.42  ?  283 ARG B CD  1 
ATOM 5396  N NE  . ARG B  1 275 ? 107.755 48.284   17.372  1.00 76.93  ?  283 ARG B NE  1 
ATOM 5397  C CZ  . ARG B  1 275 ? 108.690 47.345   17.500  1.00 76.35  ?  283 ARG B CZ  1 
ATOM 5398  N NH1 . ARG B  1 275 ? 108.671 46.519   18.537  1.00 73.29  1  283 ARG B NH1 1 
ATOM 5399  N NH2 . ARG B  1 275 ? 109.654 47.239   16.594  1.00 77.82  ?  283 ARG B NH2 1 
ATOM 5400  N N   . ALA B  1 276 ? 106.892 53.880   19.876  1.00 65.19  ?  284 ALA B N   1 
ATOM 5401  C CA  . ALA B  1 276 ? 107.535 55.164   19.630  1.00 65.89  ?  284 ALA B CA  1 
ATOM 5402  C C   . ALA B  1 276 ? 108.186 55.727   20.883  1.00 63.56  ?  284 ALA B C   1 
ATOM 5403  O O   . ALA B  1 276 ? 107.528 55.930   21.906  1.00 66.72  ?  284 ALA B O   1 
ATOM 5404  C CB  . ALA B  1 276 ? 106.509 56.157   19.078  1.00 75.80  ?  284 ALA B CB  1 
ATOM 5405  N N   . ASN B  1 277 ? 109.484 55.968   20.792  1.00 70.42  ?  285 ASN B N   1 
ATOM 5406  C CA  . ASN B  1 277 ? 110.191 56.661   21.854  1.00 63.42  ?  285 ASN B CA  1 
ATOM 5407  C C   . ASN B  1 277 ? 109.777 58.127   21.828  1.00 61.79  ?  285 ASN B C   1 
ATOM 5408  O O   . ASN B  1 277 ? 109.858 58.766   20.772  1.00 68.24  ?  285 ASN B O   1 
ATOM 5409  C CB  . ASN B  1 277 ? 111.700 56.519   21.647  1.00 62.87  ?  285 ASN B CB  1 
ATOM 5410  C CG  . ASN B  1 277 ? 112.512 57.028   22.824  1.00 69.55  ?  285 ASN B CG  1 
ATOM 5411  O OD1 . ASN B  1 277 ? 111.969 57.550   23.796  1.00 75.18  ?  285 ASN B OD1 1 
ATOM 5412  N ND2 . ASN B  1 277 ? 113.829 56.882   22.734  1.00 71.65  ?  285 ASN B ND2 1 
ATOM 5413  N N   . PRO B  1 278 ? 109.299 58.687   22.937  1.00 57.03  ?  286 PRO B N   1 
ATOM 5414  C CA  . PRO B  1 278 ? 108.968 60.117   22.940  1.00 54.24  ?  286 PRO B CA  1 
ATOM 5415  C C   . PRO B  1 278 ? 110.216 60.958   22.723  1.00 54.41  ?  286 PRO B C   1 
ATOM 5416  O O   . PRO B  1 278 ? 111.248 60.745   23.364  1.00 56.13  ?  286 PRO B O   1 
ATOM 5417  C CB  . PRO B  1 278 ? 108.368 60.340   24.334  1.00 54.22  ?  286 PRO B CB  1 
ATOM 5418  C CG  . PRO B  1 278 ? 107.880 58.998   24.750  1.00 56.99  ?  286 PRO B CG  1 
ATOM 5419  C CD  . PRO B  1 278 ? 108.874 58.025   24.182  1.00 57.55  ?  286 PRO B CD  1 
ATOM 5420  N N   . GLY B  1 279 ? 110.113 61.915   21.809  1.00 56.51  ?  287 GLY B N   1 
ATOM 5421  C CA  . GLY B  1 279 ? 111.223 62.802   21.524  1.00 51.06  ?  287 GLY B CA  1 
ATOM 5422  C C   . GLY B  1 279 ? 111.644 63.602   22.742  1.00 50.77  ?  287 GLY B C   1 
ATOM 5423  O O   . GLY B  1 279 ? 110.952 63.680   23.757  1.00 56.56  ?  287 GLY B O   1 
ATOM 5424  N N   . SER B  1 280 ? 112.830 64.195   22.633  1.00 49.33  ?  288 SER B N   1 
ATOM 5425  C CA  . SER B  1 280 ? 113.356 65.017   23.715  1.00 48.71  ?  288 SER B CA  1 
ATOM 5426  C C   . SER B  1 280 ? 112.391 66.153   24.025  1.00 47.83  ?  288 SER B C   1 
ATOM 5427  O O   . SER B  1 280 ? 111.992 66.907   23.132  1.00 46.61  ?  288 SER B O   1 
ATOM 5428  C CB  . SER B  1 280 ? 114.727 65.573   23.339  1.00 48.07  ?  288 SER B CB  1 
ATOM 5429  O OG  . SER B  1 280 ? 115.268 66.350   24.393  1.00 47.77  ?  288 SER B OG  1 
ATOM 5430  N N   . TYR B  1 281 ? 112.009 66.270   25.296  1.00 52.32  ?  289 TYR B N   1 
ATOM 5431  C CA  . TYR B  1 281 ? 111.062 67.287   25.731  1.00 51.41  ?  289 TYR B CA  1 
ATOM 5432  C C   . TYR B  1 281 ? 111.682 68.199   26.784  1.00 49.10  ?  289 TYR B C   1 
ATOM 5433  O O   . TYR B  1 281 ? 110.997 68.692   27.682  1.00 49.63  ?  289 TYR B O   1 
ATOM 5434  C CB  . TYR B  1 281 ? 109.774 66.627   26.225  1.00 47.27  ?  289 TYR B CB  1 
ATOM 5435  C CG  . TYR B  1 281 ? 109.980 65.455   27.159  1.00 47.90  ?  289 TYR B CG  1 
ATOM 5436  C CD1 . TYR B  1 281 ? 110.286 65.651   28.500  1.00 49.32  ?  289 TYR B CD1 1 
ATOM 5437  C CD2 . TYR B  1 281 ? 109.962 64.152   26.675  1.00 49.39  ?  289 TYR B CD2 1 
ATOM 5438  C CE1 . TYR B  1 281 ? 110.485 64.578   29.349  1.00 52.30  ?  289 TYR B CE1 1 
ATOM 5439  C CE2 . TYR B  1 281 ? 110.178 63.073   27.511  1.00 52.32  ?  289 TYR B CE2 1 
ATOM 5440  C CZ  . TYR B  1 281 ? 110.439 63.291   28.847  1.00 53.80  ?  289 TYR B CZ  1 
ATOM 5441  O OH  . TYR B  1 281 ? 110.650 62.217   29.681  1.00 56.93  ?  289 TYR B OH  1 
ATOM 5442  N N   . LEU B  1 282 ? 112.990 68.421   26.677  1.00 47.92  ?  290 LEU B N   1 
ATOM 5443  C CA  . LEU B  1 282 ? 113.716 69.395   27.486  1.00 47.37  ?  290 LEU B CA  1 
ATOM 5444  C C   . LEU B  1 282 ? 114.155 70.500   26.533  1.00 44.50  ?  290 LEU B C   1 
ATOM 5445  O O   . LEU B  1 282 ? 115.143 70.349   25.810  1.00 50.46  ?  290 LEU B O   1 
ATOM 5446  C CB  . LEU B  1 282 ? 114.905 68.755   28.198  1.00 47.65  ?  290 LEU B CB  1 
ATOM 5447  C CG  . LEU B  1 282 ? 115.425 69.512   29.424  1.00 48.02  ?  290 LEU B CG  1 
ATOM 5448  C CD1 . LEU B  1 282 ? 116.061 68.559   30.416  1.00 51.11  ?  290 LEU B CD1 1 
ATOM 5449  C CD2 . LEU B  1 282 ? 116.413 70.596   29.033  1.00 45.86  ?  290 LEU B CD2 1 
ATOM 5450  N N   . TYR B  1 283 ? 113.422 71.608   26.537  1.00 46.35  ?  291 TYR B N   1 
ATOM 5451  C CA  . TYR B  1 283 ? 113.638 72.691   25.589  1.00 44.70  ?  291 TYR B CA  1 
ATOM 5452  C C   . TYR B  1 283 ? 114.373 73.833   26.276  1.00 45.87  ?  291 TYR B C   1 
ATOM 5453  O O   . TYR B  1 283 ? 113.984 74.261   27.367  1.00 57.93  ?  291 TYR B O   1 
ATOM 5454  C CB  . TYR B  1 283 ? 112.311 73.181   25.010  1.00 45.43  ?  291 TYR B CB  1 
ATOM 5455  C CG  . TYR B  1 283 ? 111.404 72.064   24.550  1.00 48.32  ?  291 TYR B CG  1 
ATOM 5456  C CD1 . TYR B  1 283 ? 111.555 71.497   23.290  1.00 45.40  ?  291 TYR B CD1 1 
ATOM 5457  C CD2 . TYR B  1 283 ? 110.400 71.573   25.374  1.00 49.50  ?  291 TYR B CD2 1 
ATOM 5458  C CE1 . TYR B  1 283 ? 110.729 70.477   22.861  1.00 45.96  ?  291 TYR B CE1 1 
ATOM 5459  C CE2 . TYR B  1 283 ? 109.571 70.551   24.955  1.00 50.40  ?  291 TYR B CE2 1 
ATOM 5460  C CZ  . TYR B  1 283 ? 109.739 70.007   23.698  1.00 49.79  ?  291 TYR B CZ  1 
ATOM 5461  O OH  . TYR B  1 283 ? 108.914 68.990   23.279  1.00 54.67  ?  291 TYR B OH  1 
ATOM 5462  N N   . SER B  1 284 ? 115.434 74.320   25.635  1.00 45.40  ?  292 SER B N   1 
ATOM 5463  C CA  . SER B  1 284 ? 116.238 75.412   26.171  1.00 45.23  ?  292 SER B CA  1 
ATOM 5464  C C   . SER B  1 284 ? 116.446 76.451   25.079  1.00 44.58  ?  292 SER B C   1 
ATOM 5465  O O   . SER B  1 284 ? 116.995 76.119   24.007  1.00 44.28  ?  292 SER B O   1 
ATOM 5466  C CB  . SER B  1 284 ? 117.576 74.890   26.698  1.00 48.27  ?  292 SER B CB  1 
ATOM 5467  O OG  . SER B  1 284 ? 118.469 75.955   26.974  1.00 54.39  ?  292 SER B OG  1 
ATOM 5468  N N   . PRO B  1 285 ? 116.036 77.698   25.290  1.00 48.30  ?  293 PRO B N   1 
ATOM 5469  C CA  . PRO B  1 285 ? 116.206 78.732   24.267  1.00 45.41  ?  293 PRO B CA  1 
ATOM 5470  C C   . PRO B  1 285 ? 117.573 79.400   24.325  1.00 42.59  ?  293 PRO B C   1 
ATOM 5471  O O   . PRO B  1 285 ? 118.258 79.406   25.350  1.00 42.71  ?  293 PRO B O   1 
ATOM 5472  C CB  . PRO B  1 285 ? 115.104 79.739   24.620  1.00 47.30  ?  293 PRO B CB  1 
ATOM 5473  C CG  . PRO B  1 285 ? 115.007 79.639   26.108  1.00 47.48  ?  293 PRO B CG  1 
ATOM 5474  C CD  . PRO B  1 285 ? 115.287 78.195   26.458  1.00 48.32  ?  293 PRO B CD  1 
ATOM 5475  N N   . SER B  1 286 ? 117.959 79.970   23.186  1.00 44.08  ?  294 SER B N   1 
ATOM 5476  C CA  . SER B  1 286 ? 119.153 80.800   23.116  1.00 43.82  ?  294 SER B CA  1 
ATOM 5477  C C   . SER B  1 286 ? 118.794 82.232   23.491  1.00 43.75  ?  294 SER B C   1 
ATOM 5478  O O   . SER B  1 286 ? 117.977 82.853   22.800  1.00 43.53  ?  294 SER B O   1 
ATOM 5479  C CB  . SER B  1 286 ? 119.759 80.765   21.723  1.00 47.54  ?  294 SER B CB  1 
ATOM 5480  O OG  . SER B  1 286 ? 118.872 81.313   20.764  1.00 48.12  ?  294 SER B OG  1 
ATOM 5481  N N   . PRO B  1 287 ? 119.352 82.783   24.564  1.00 40.34  ?  295 PRO B N   1 
ATOM 5482  C CA  . PRO B  1 287 ? 119.024 84.160   24.940  1.00 40.43  ?  295 PRO B CA  1 
ATOM 5483  C C   . PRO B  1 287 ? 119.632 85.160   23.969  1.00 40.33  ?  295 PRO B C   1 
ATOM 5484  O O   . PRO B  1 287 ? 120.527 84.844   23.183  1.00 40.20  ?  295 PRO B O   1 
ATOM 5485  C CB  . PRO B  1 287 ? 119.639 84.299   26.335  1.00 39.78  ?  295 PRO B CB  1 
ATOM 5486  C CG  . PRO B  1 287 ? 120.774 83.335   26.325  1.00 39.73  ?  295 PRO B CG  1 
ATOM 5487  C CD  . PRO B  1 287 ? 120.314 82.169   25.494  1.00 39.59  ?  295 PRO B CD  1 
ATOM 5488  N N   . SER B  1 288 ? 119.118 86.386   24.019  1.00 46.45  ?  296 SER B N   1 
ATOM 5489  C CA  . SER B  1 288 ? 119.675 87.458   23.206  1.00 42.82  ?  296 SER B CA  1 
ATOM 5490  C C   . SER B  1 288 ? 119.348 88.792   23.857  1.00 41.38  ?  296 SER B C   1 
ATOM 5491  O O   . SER B  1 288 ? 118.231 88.994   24.339  1.00 42.79  ?  296 SER B O   1 
ATOM 5492  C CB  . SER B  1 288 ? 119.135 87.414   21.773  1.00 44.29  ?  296 SER B CB  1 
ATOM 5493  O OG  . SER B  1 288 ? 119.680 88.463   20.992  1.00 46.12  ?  296 SER B OG  1 
ATOM 5494  N N   . GLY B  1 289 ? 120.322 89.698   23.859  1.00 40.84  ?  297 GLY B N   1 
ATOM 5495  C CA  . GLY B  1 289 ? 120.154 90.988   24.489  1.00 41.69  ?  297 GLY B CA  1 
ATOM 5496  C C   . GLY B  1 289 ? 119.644 92.089   23.588  1.00 43.30  ?  297 GLY B C   1 
ATOM 5497  O O   . GLY B  1 289 ? 119.639 93.253   24.004  1.00 46.58  ?  297 GLY B O   1 
ATOM 5498  N N   . SER B  1 290 ? 119.206 91.756   22.382  1.00 38.92  ?  298 SER B N   1 
ATOM 5499  C CA  . SER B  1 290 ? 118.625 92.703   21.426  1.00 38.99  ?  298 SER B CA  1 
ATOM 5500  C C   . SER B  1 290 ? 119.598 93.865   21.187  1.00 40.72  ?  298 SER B C   1 
ATOM 5501  O O   . SER B  1 290 ? 120.820 93.695   21.237  1.00 41.62  ?  298 SER B O   1 
ATOM 5502  C CB  . SER B  1 290 ? 117.250 93.118   21.916  1.00 42.82  ?  298 SER B CB  1 
ATOM 5503  O OG  . SER B  1 290 ? 116.658 94.053   21.032  1.00 48.94  ?  298 SER B OG  1 
ATOM 5504  N N   . VAL B  1 291 ? 119.059 95.053   20.931  1.00 39.82  ?  299 VAL B N   1 
ATOM 5505  C CA  . VAL B  1 291 ? 119.859 96.208   20.542  1.00 41.05  ?  299 VAL B CA  1 
ATOM 5506  C C   . VAL B  1 291 ? 120.463 96.868   21.774  1.00 47.60  ?  299 VAL B C   1 
ATOM 5507  O O   . VAL B  1 291 ? 119.806 97.012   22.812  1.00 54.77  ?  299 VAL B O   1 
ATOM 5508  C CB  . VAL B  1 291 ? 118.999 97.208   19.747  1.00 40.33  ?  299 VAL B CB  1 
ATOM 5509  C CG1 . VAL B  1 291 ? 119.844 98.378   19.261  1.00 40.51  ?  299 VAL B CG1 1 
ATOM 5510  C CG2 . VAL B  1 291 ? 118.312 96.511   18.581  1.00 40.10  ?  299 VAL B CG2 1 
ATOM 5511  N N   . VAL B  1 292 ? 121.724 97.274   21.657  1.00 44.49  ?  300 VAL B N   1 
ATOM 5512  C CA  . VAL B  1 292 ? 122.394 98.093   22.661  1.00 42.20  ?  300 VAL B CA  1 
ATOM 5513  C C   . VAL B  1 292 ? 122.418 99.522   22.144  1.00 45.35  ?  300 VAL B C   1 
ATOM 5514  O O   . VAL B  1 292 ? 123.013 99.799   21.097  1.00 55.17  ?  300 VAL B O   1 
ATOM 5515  C CB  . VAL B  1 292 ? 123.818 97.592   22.944  1.00 40.99  ?  300 VAL B CB  1 
ATOM 5516  C CG1 . VAL B  1 292 ? 124.595 98.634   23.735  1.00 41.37  ?  300 VAL B CG1 1 
ATOM 5517  C CG2 . VAL B  1 292 ? 123.781 96.266   23.689  1.00 40.84  ?  300 VAL B CG2 1 
ATOM 5518  N N   . THR B  1 293 ? 121.773 100.431  22.867  1.00 45.91  ?  301 THR B N   1 
ATOM 5519  C CA  . THR B  1 293 ? 121.714 101.828  22.468  1.00 47.79  ?  301 THR B CA  1 
ATOM 5520  C C   . THR B  1 293 ? 122.123 102.711  23.637  1.00 49.07  ?  301 THR B C   1 
ATOM 5521  O O   . THR B  1 293 ? 121.901 102.371  24.803  1.00 48.46  ?  301 THR B O   1 
ATOM 5522  C CB  . THR B  1 293 ? 120.311 102.223  21.984  1.00 50.82  ?  301 THR B CB  1 
ATOM 5523  O OG1 . THR B  1 293 ? 120.258 103.639  21.770  1.00 52.39  ?  301 THR B OG1 1 
ATOM 5524  C CG2 . THR B  1 293 ? 119.259 101.828  23.010  1.00 52.43  ?  301 THR B CG2 1 
ATOM 5525  N N   . SER B  1 294 ? 122.730 103.855  23.313  1.00 50.76  ?  302 SER B N   1 
ATOM 5526  C CA  . SER B  1 294 ? 123.132 104.801  24.346  1.00 54.64  ?  302 SER B CA  1 
ATOM 5527  C C   . SER B  1 294 ? 121.946 105.505  24.989  1.00 55.34  ?  302 SER B C   1 
ATOM 5528  O O   . SER B  1 294 ? 122.121 106.151  26.027  1.00 56.00  ?  302 SER B O   1 
ATOM 5529  C CB  . SER B  1 294 ? 124.102 105.834  23.768  1.00 54.50  ?  302 SER B CB  1 
ATOM 5530  O OG  . SER B  1 294 ? 123.613 106.367  22.551  1.00 55.93  ?  302 SER B OG  1 
ATOM 5531  N N   . ASP B  1 295 ? 120.753 105.408  24.396  1.00 50.22  ?  303 ASP B N   1 
ATOM 5532  C CA  . ASP B  1 295 ? 119.563 105.943  25.048  1.00 50.35  ?  303 ASP B CA  1 
ATOM 5533  C C   . ASP B  1 295 ? 119.232 105.154  26.307  1.00 50.31  ?  303 ASP B C   1 
ATOM 5534  O O   . ASP B  1 295 ? 118.808 105.728  27.316  1.00 50.58  ?  303 ASP B O   1 
ATOM 5535  C CB  . ASP B  1 295 ? 118.380 105.935  24.078  1.00 62.32  ?  303 ASP B CB  1 
ATOM 5536  C CG  . ASP B  1 295 ? 118.598 106.846  22.880  1.00 69.73  ?  303 ASP B CG  1 
ATOM 5537  O OD1 . ASP B  1 295 ? 119.390 107.807  22.992  1.00 72.80  ?  303 ASP B OD1 1 
ATOM 5538  O OD2 . ASP B  1 295 ? 117.970 106.604  21.827  1.00 71.56  -1 303 ASP B OD2 1 
ATOM 5539  N N   . SER B  1 296 ? 119.426 103.838  26.267  1.00 53.05  ?  304 SER B N   1 
ATOM 5540  C CA  . SER B  1 296 ? 119.222 102.970  27.418  1.00 54.13  ?  304 SER B CA  1 
ATOM 5541  C C   . SER B  1 296 ? 120.440 102.907  28.332  1.00 51.71  ?  304 SER B C   1 
ATOM 5542  O O   . SER B  1 296 ? 120.444 102.116  29.283  1.00 45.32  ?  304 SER B O   1 
ATOM 5543  C CB  . SER B  1 296 ? 118.859 101.557  26.949  1.00 62.19  ?  304 SER B CB  1 
ATOM 5544  O OG  . SER B  1 296 ? 117.663 101.560  26.187  1.00 67.20  ?  304 SER B OG  1 
ATOM 5545  N N   . GLN B  1 297 ? 121.467 103.709  28.058  1.00 53.79  ?  305 GLN B N   1 
ATOM 5546  C CA  . GLN B  1 297 ? 122.688 103.676  28.851  1.00 52.02  ?  305 GLN B CA  1 
ATOM 5547  C C   . GLN B  1 297 ? 122.414 104.108  30.287  1.00 53.49  ?  305 GLN B C   1 
ATOM 5548  O O   . GLN B  1 297 ? 121.556 104.952  30.557  1.00 58.45  ?  305 GLN B O   1 
ATOM 5549  C CB  . GLN B  1 297 ? 123.756 104.572  28.217  1.00 48.30  ?  305 GLN B CB  1 
ATOM 5550  C CG  . GLN B  1 297 ? 125.184 104.252  28.635  1.00 47.77  ?  305 GLN B CG  1 
ATOM 5551  C CD  . GLN B  1 297 ? 125.617 102.855  28.228  1.00 47.16  ?  305 GLN B CD  1 
ATOM 5552  O OE1 . GLN B  1 297 ? 126.426 102.223  28.906  1.00 47.58  ?  305 GLN B OE1 1 
ATOM 5553  N NE2 . GLN B  1 297 ? 125.074 102.364  27.119  1.00 44.86  ?  305 GLN B NE2 1 
ATOM 5554  N N   . LEU B  1 298 ? 123.156 103.509  31.216  1.00 49.69  ?  306 LEU B N   1 
ATOM 5555  C CA  . LEU B  1 298 ? 122.932 103.713  32.636  1.00 50.52  ?  306 LEU B CA  1 
ATOM 5556  C C   . LEU B  1 298 ? 124.136 104.298  33.363  1.00 52.06  ?  306 LEU B C   1 
ATOM 5557  O O   . LEU B  1 298 ? 124.001 104.686  34.529  1.00 53.19  ?  306 LEU B O   1 
ATOM 5558  C CB  . LEU B  1 298 ? 122.532 102.384  33.298  1.00 49.69  ?  306 LEU B CB  1 
ATOM 5559  C CG  . LEU B  1 298 ? 121.883 102.390  34.684  1.00 53.97  ?  306 LEU B CG  1 
ATOM 5560  C CD1 . LEU B  1 298 ? 120.594 101.587  34.667  1.00 53.60  ?  306 LEU B CD1 1 
ATOM 5561  C CD2 . LEU B  1 298 ? 122.844 101.837  35.722  1.00 57.65  ?  306 LEU B CD2 1 
ATOM 5562  N N   . PHE B  1 299 ? 125.292 104.397  32.714  1.00 53.03  ?  307 PHE B N   1 
ATOM 5563  C CA  . PHE B  1 299 ? 126.502 104.922  33.334  1.00 56.94  ?  307 PHE B CA  1 
ATOM 5564  C C   . PHE B  1 299 ? 126.925 106.209  32.624  1.00 57.69  ?  307 PHE B C   1 
ATOM 5565  O O   . PHE B  1 299 ? 126.193 106.754  31.793  1.00 56.82  ?  307 PHE B O   1 
ATOM 5566  C CB  . PHE B  1 299 ? 127.609 103.867  33.323  1.00 59.51  ?  307 PHE B CB  1 
ATOM 5567  C CG  . PHE B  1 299 ? 127.228 102.589  34.012  1.00 59.69  ?  307 PHE B CG  1 
ATOM 5568  C CD1 . PHE B  1 299 ? 126.986 102.570  35.377  1.00 58.15  ?  307 PHE B CD1 1 
ATOM 5569  C CD2 . PHE B  1 299 ? 127.110 101.408  33.298  1.00 54.36  ?  307 PHE B CD2 1 
ATOM 5570  C CE1 . PHE B  1 299 ? 126.632 101.398  36.016  1.00 52.78  ?  307 PHE B CE1 1 
ATOM 5571  C CE2 . PHE B  1 299 ? 126.756 100.233  33.931  1.00 50.84  ?  307 PHE B CE2 1 
ATOM 5572  C CZ  . PHE B  1 299 ? 126.516 100.228  35.292  1.00 51.73  ?  307 PHE B CZ  1 
ATOM 5573  N N   . ASN B  1 300 ? 128.120 106.695  32.968  1.00 59.45  ?  308 ASN B N   1 
ATOM 5574  C CA  . ASN B  1 300 ? 128.630 107.991  32.518  1.00 65.41  ?  308 ASN B CA  1 
ATOM 5575  C C   . ASN B  1 300 ? 127.710 109.143  32.911  1.00 67.86  ?  308 ASN B C   1 
ATOM 5576  O O   . ASN B  1 300 ? 127.751 110.214  32.298  1.00 70.09  ?  308 ASN B O   1 
ATOM 5577  C CB  . ASN B  1 300 ? 128.884 108.007  31.006  1.00 63.76  ?  308 ASN B CB  1 
ATOM 5578  C CG  . ASN B  1 300 ? 130.138 107.248  30.619  1.00 65.27  ?  308 ASN B CG  1 
ATOM 5579  O OD1 . ASN B  1 300 ? 130.812 106.666  31.469  1.00 58.80  ?  308 ASN B OD1 1 
ATOM 5580  N ND2 . ASN B  1 300 ? 130.461 107.257  29.330  1.00 72.61  ?  308 ASN B ND2 1 
ATOM 5581  N N   . LYS B  1 301 ? 126.873 108.938  33.926  1.00 66.78  ?  309 LYS B N   1 
ATOM 5582  C CA  . LYS B  1 301 ? 125.962 109.944  34.432  1.00 63.28  ?  309 LYS B CA  1 
ATOM 5583  C C   . LYS B  1 301 ? 126.201 110.162  35.920  1.00 64.05  ?  309 LYS B C   1 
ATOM 5584  O O   . LYS B  1 301 ? 126.510 109.208  36.642  1.00 65.36  ?  309 LYS B O   1 
ATOM 5585  C CB  . LYS B  1 301 ? 124.499 109.530  34.215  1.00 62.51  ?  309 LYS B CB  1 
ATOM 5586  C CG  . LYS B  1 301 ? 124.128 109.220  32.776  1.00 65.10  ?  309 LYS B CG  1 
ATOM 5587  C CD  . LYS B  1 301 ? 122.746 108.586  32.703  1.00 63.23  ?  309 LYS B CD  1 
ATOM 5588  C CE  . LYS B  1 301 ? 121.719 109.421  33.455  1.00 66.97  ?  309 LYS B CE  1 
ATOM 5589  N NZ  . LYS B  1 301 ? 120.386 108.758  33.523  1.00 67.43  1  309 LYS B NZ  1 
ATOM 5590  N N   . PRO B  1 302 ? 126.071 111.392  36.407  1.00 62.12  ?  310 PRO B N   1 
ATOM 5591  C CA  . PRO B  1 302 ? 126.162 111.620  37.852  1.00 60.54  ?  310 PRO B CA  1 
ATOM 5592  C C   . PRO B  1 302 ? 124.879 111.210  38.558  1.00 59.16  ?  310 PRO B C   1 
ATOM 5593  O O   . PRO B  1 302 ? 123.771 111.452  38.074  1.00 60.08  ?  310 PRO B O   1 
ATOM 5594  C CB  . PRO B  1 302 ? 126.401 113.131  37.954  1.00 61.31  ?  310 PRO B CB  1 
ATOM 5595  C CG  . PRO B  1 302 ? 125.754 113.683  36.731  1.00 60.62  ?  310 PRO B CG  1 
ATOM 5596  C CD  . PRO B  1 302 ? 125.958 112.652  35.652  1.00 59.10  ?  310 PRO B CD  1 
ATOM 5597  N N   . TYR B  1 303 ? 125.043 110.567  39.711  1.00 57.47  ?  311 TYR B N   1 
ATOM 5598  C CA  . TYR B  1 303 ? 123.928 110.168  40.559  1.00 58.96  ?  311 TYR B CA  1 
ATOM 5599  C C   . TYR B  1 303 ? 124.162 110.693  41.967  1.00 65.78  ?  311 TYR B C   1 
ATOM 5600  O O   . TYR B  1 303 ? 125.213 110.435  42.565  1.00 70.01  ?  311 TYR B O   1 
ATOM 5601  C CB  . TYR B  1 303 ? 123.748 108.647  40.573  1.00 59.65  ?  311 TYR B CB  1 
ATOM 5602  C CG  . TYR B  1 303 ? 123.311 108.076  39.242  1.00 62.84  ?  311 TYR B CG  1 
ATOM 5603  C CD1 . TYR B  1 303 ? 121.987 108.161  38.832  1.00 68.14  ?  311 TYR B CD1 1 
ATOM 5604  C CD2 . TYR B  1 303 ? 124.218 107.451  38.398  1.00 66.26  ?  311 TYR B CD2 1 
ATOM 5605  C CE1 . TYR B  1 303 ? 121.579 107.642  37.617  1.00 71.29  ?  311 TYR B CE1 1 
ATOM 5606  C CE2 . TYR B  1 303 ? 123.820 106.928  37.181  1.00 69.17  ?  311 TYR B CE2 1 
ATOM 5607  C CZ  . TYR B  1 303 ? 122.499 107.026  36.796  1.00 73.34  ?  311 TYR B CZ  1 
ATOM 5608  O OH  . TYR B  1 303 ? 122.097 106.507  35.586  1.00 78.56  ?  311 TYR B OH  1 
ATOM 5609  N N   . TRP B  1 304 ? 123.183 111.431  42.485  1.00 64.29  ?  312 TRP B N   1 
ATOM 5610  C CA  . TRP B  1 304 ? 123.266 112.070  43.792  1.00 67.15  ?  312 TRP B CA  1 
ATOM 5611  C C   . TRP B  1 304 ? 122.398 111.306  44.781  1.00 70.54  ?  312 TRP B C   1 
ATOM 5612  O O   . TRP B  1 304 ? 121.189 111.162  44.570  1.00 70.75  ?  312 TRP B O   1 
ATOM 5613  C CB  . TRP B  1 304 ? 122.830 113.532  43.711  1.00 61.69  ?  312 TRP B CB  1 
ATOM 5614  C CG  . TRP B  1 304 ? 123.435 114.258  42.558  1.00 62.63  ?  312 TRP B CG  1 
ATOM 5615  C CD1 . TRP B  1 304 ? 122.785 114.759  41.469  1.00 62.21  ?  312 TRP B CD1 1 
ATOM 5616  C CD2 . TRP B  1 304 ? 124.822 114.561  42.373  1.00 66.36  ?  312 TRP B CD2 1 
ATOM 5617  N NE1 . TRP B  1 304 ? 123.681 115.359  40.618  1.00 64.80  ?  312 TRP B NE1 1 
ATOM 5618  C CE2 . TRP B  1 304 ? 124.939 115.251  41.151  1.00 66.34  ?  312 TRP B CE2 1 
ATOM 5619  C CE3 . TRP B  1 304 ? 125.976 114.319  43.125  1.00 68.46  ?  312 TRP B CE3 1 
ATOM 5620  C CZ2 . TRP B  1 304 ? 126.162 115.700  40.663  1.00 65.68  ?  312 TRP B CZ2 1 
ATOM 5621  C CZ3 . TRP B  1 304 ? 127.189 114.765  42.639  1.00 59.13  ?  312 TRP B CZ3 1 
ATOM 5622  C CH2 . TRP B  1 304 ? 127.273 115.447  41.420  1.00 64.56  ?  312 TRP B CH2 1 
ATOM 5623  N N   . LEU B  1 305 ? 123.019 110.817  45.850  1.00 70.99  ?  313 LEU B N   1 
ATOM 5624  C CA  . LEU B  1 305 ? 122.319 110.079  46.895  1.00 66.23  ?  313 LEU B CA  1 
ATOM 5625  C C   . LEU B  1 305 ? 121.845 111.059  47.963  1.00 69.23  ?  313 LEU B C   1 
ATOM 5626  O O   . LEU B  1 305 ? 122.660 111.678  48.655  1.00 72.10  ?  313 LEU B O   1 
ATOM 5627  C CB  . LEU B  1 305 ? 123.228 109.007  47.490  1.00 66.17  ?  313 LEU B CB  1 
ATOM 5628  C CG  . LEU B  1 305 ? 122.633 108.085  48.557  1.00 70.42  ?  313 LEU B CG  1 
ATOM 5629  C CD1 . LEU B  1 305 ? 123.171 106.679  48.382  1.00 70.49  ?  313 LEU B CD1 1 
ATOM 5630  C CD2 . LEU B  1 305 ? 122.945 108.594  49.957  1.00 76.69  ?  313 LEU B CD2 1 
ATOM 5631  N N   . HIS B  1 306 ? 120.527 111.203  48.093  1.00 69.87  ?  314 HIS B N   1 
ATOM 5632  C CA  . HIS B  1 306 ? 119.947 112.014  49.156  1.00 74.71  ?  314 HIS B CA  1 
ATOM 5633  C C   . HIS B  1 306 ? 119.372 111.109  50.237  1.00 71.74  ?  314 HIS B C   1 
ATOM 5634  O O   . HIS B  1 306 ? 119.903 111.048  51.350  1.00 77.71  ?  314 HIS B O   1 
ATOM 5635  C CB  . HIS B  1 306 ? 118.871 112.955  48.608  1.00 77.24  ?  314 HIS B CB  1 
ATOM 5636  C CG  . HIS B  1 306 ? 119.407 114.038  47.724  1.00 79.41  ?  314 HIS B CG  1 
ATOM 5637  N ND1 . HIS B  1 306 ? 119.328 113.986  46.349  1.00 75.46  ?  314 HIS B ND1 1 
ATOM 5638  C CD2 . HIS B  1 306 ? 120.027 115.204  48.021  1.00 83.37  ?  314 HIS B CD2 1 
ATOM 5639  C CE1 . HIS B  1 306 ? 119.878 115.072  45.837  1.00 78.47  ?  314 HIS B CE1 1 
ATOM 5640  N NE2 . HIS B  1 306 ? 120.310 115.828  46.830  1.00 82.98  ?  314 HIS B NE2 1 
ATOM 5641  N N   . LYS B  1 307 ? 118.298 110.394  49.917  1.00 67.94  ?  315 LYS B N   1 
ATOM 5642  C CA  . LYS B  1 307 ? 117.714 109.417  50.824  1.00 69.69  ?  315 LYS B CA  1 
ATOM 5643  C C   . LYS B  1 307 ? 118.073 108.018  50.346  1.00 72.38  ?  315 LYS B C   1 
ATOM 5644  O O   . LYS B  1 307 ? 117.843 107.676  49.182  1.00 77.70  ?  315 LYS B O   1 
ATOM 5645  C CB  . LYS B  1 307 ? 116.194 109.565  50.908  1.00 72.08  ?  315 LYS B CB  1 
ATOM 5646  C CG  . LYS B  1 307 ? 115.682 110.991  50.846  1.00 77.58  ?  315 LYS B CG  1 
ATOM 5647  C CD  . LYS B  1 307 ? 114.159 111.015  50.856  1.00 81.20  ?  315 LYS B CD  1 
ATOM 5648  C CE  . LYS B  1 307 ? 113.612 112.384  50.482  1.00 83.79  ?  315 LYS B CE  1 
ATOM 5649  N NZ  . LYS B  1 307 ? 113.842 112.704  49.046  1.00 81.12  1  315 LYS B NZ  1 
ATOM 5650  N N   . ALA B  1 308 ? 118.634 107.218  51.244  1.00 69.50  ?  316 ALA B N   1 
ATOM 5651  C CA  . ALA B  1 308 ? 118.969 105.843  50.922  1.00 67.00  ?  316 ALA B CA  1 
ATOM 5652  C C   . ALA B  1 308 ? 117.739 104.952  51.069  1.00 69.59  ?  316 ALA B C   1 
ATOM 5653  O O   . ALA B  1 308 ? 116.721 105.338  51.650  1.00 74.33  ?  316 ALA B O   1 
ATOM 5654  C CB  . ALA B  1 308 ? 120.100 105.350  51.819  1.00 59.50  ?  316 ALA B CB  1 
ATOM 5655  N N   . GLN B  1 309 ? 117.841 103.733  50.535  1.00 66.60  ?  317 GLN B N   1 
ATOM 5656  C CA  . GLN B  1 309 ? 116.727 102.800  50.656  1.00 64.47  ?  317 GLN B CA  1 
ATOM 5657  C C   . GLN B  1 309 ? 116.615 102.247  52.070  1.00 66.72  ?  317 GLN B C   1 
ATOM 5658  O O   . GLN B  1 309 ? 115.506 101.968  52.538  1.00 70.38  ?  317 GLN B O   1 
ATOM 5659  C CB  . GLN B  1 309 ? 116.871 101.664  49.640  1.00 65.53  ?  317 GLN B CB  1 
ATOM 5660  C CG  . GLN B  1 309 ? 118.027 100.705  49.903  1.00 69.65  ?  317 GLN B CG  1 
ATOM 5661  C CD  . GLN B  1 309 ? 117.671 99.599   50.886  1.00 69.75  ?  317 GLN B CD  1 
ATOM 5662  O OE1 . GLN B  1 309 ? 116.496 99.290   51.092  1.00 69.04  ?  317 GLN B OE1 1 
ATOM 5663  N NE2 . GLN B  1 309 ? 118.685 99.012   51.511  1.00 69.56  ?  317 GLN B NE2 1 
ATOM 5664  N N   . GLY B  1 310 ? 117.744 102.082  52.761  1.00 65.70  ?  318 GLY B N   1 
ATOM 5665  C CA  . GLY B  1 310 ? 117.760 101.571  54.112  1.00 69.07  ?  318 GLY B CA  1 
ATOM 5666  C C   . GLY B  1 310 ? 117.966 102.664  55.145  1.00 67.05  ?  318 GLY B C   1 
ATOM 5667  O O   . GLY B  1 310 ? 117.932 103.862  54.853  1.00 64.86  ?  318 GLY B O   1 
ATOM 5668  N N   . LEU B  1 311 ? 118.179 102.230  56.388  1.00 61.85  ?  319 LEU B N   1 
ATOM 5669  C CA  . LEU B  1 311 ? 118.377 103.190  57.468  1.00 67.31  ?  319 LEU B CA  1 
ATOM 5670  C C   . LEU B  1 311 ? 119.761 103.825  57.409  1.00 66.36  ?  319 LEU B C   1 
ATOM 5671  O O   . LEU B  1 311 ? 119.914 105.002  57.752  1.00 68.79  ?  319 LEU B O   1 
ATOM 5672  C CB  . LEU B  1 311 ? 118.148 102.520  58.823  1.00 75.79  ?  319 LEU B CB  1 
ATOM 5673  C CG  . LEU B  1 311 ? 116.736 102.692  59.392  1.00 71.22  ?  319 LEU B CG  1 
ATOM 5674  C CD1 . LEU B  1 311 ? 115.703 102.135  58.437  1.00 68.34  ?  319 LEU B CD1 1 
ATOM 5675  C CD2 . LEU B  1 311 ? 116.606 102.037  60.752  1.00 68.77  ?  319 LEU B CD2 1 
ATOM 5676  N N   . ASN B  1 312 ? 120.773 103.073  56.982  1.00 64.64  ?  320 ASN B N   1 
ATOM 5677  C CA  . ASN B  1 312 ? 122.091 103.649  56.737  1.00 68.34  ?  320 ASN B CA  1 
ATOM 5678  C C   . ASN B  1 312 ? 122.011 104.544  55.506  1.00 69.90  ?  320 ASN B C   1 
ATOM 5679  O O   . ASN B  1 312 ? 121.833 104.059  54.384  1.00 67.67  ?  320 ASN B O   1 
ATOM 5680  C CB  . ASN B  1 312 ? 123.126 102.542  56.555  1.00 67.07  ?  320 ASN B CB  1 
ATOM 5681  C CG  . ASN B  1 312 ? 124.552 103.064  56.552  1.00 69.42  ?  320 ASN B CG  1 
ATOM 5682  O OD1 . ASN B  1 312 ? 124.821 104.188  56.128  1.00 67.65  ?  320 ASN B OD1 1 
ATOM 5683  N ND2 . ASN B  1 312 ? 125.477 102.244  57.036  1.00 75.73  ?  320 ASN B ND2 1 
ATOM 5684  N N   . ASN B  1 313 ? 122.152 105.849  55.710  1.00 68.64  ?  321 ASN B N   1 
ATOM 5685  C CA  . ASN B  1 313 ? 121.959 106.826  54.639  1.00 69.65  ?  321 ASN B CA  1 
ATOM 5686  C C   . ASN B  1 313 ? 123.298 107.211  54.012  1.00 71.44  ?  321 ASN B C   1 
ATOM 5687  O O   . ASN B  1 313 ? 123.736 108.362  54.048  1.00 76.49  ?  321 ASN B O   1 
ATOM 5688  C CB  . ASN B  1 313 ? 121.220 108.051  55.171  1.00 71.24  ?  321 ASN B CB  1 
ATOM 5689  C CG  . ASN B  1 313 ? 120.687 108.934  54.063  1.00 71.50  ?  321 ASN B CG  1 
ATOM 5690  O OD1 . ASN B  1 313 ? 119.992 108.467  53.160  1.00 66.58  ?  321 ASN B OD1 1 
ATOM 5691  N ND2 . ASN B  1 313 ? 121.006 110.220  54.126  1.00 77.42  ?  321 ASN B ND2 1 
ATOM 5692  N N   . GLY B  1 314 ? 123.950 106.210  53.427  1.00 69.56  ?  322 GLY B N   1 
ATOM 5693  C CA  . GLY B  1 314 ? 125.190 106.444  52.713  1.00 66.97  ?  322 GLY B CA  1 
ATOM 5694  C C   . GLY B  1 314 ? 126.384 106.734  53.592  1.00 67.88  ?  322 GLY B C   1 
ATOM 5695  O O   . GLY B  1 314 ? 127.276 107.482  53.182  1.00 67.79  ?  322 GLY B O   1 
ATOM 5696  N N   . ILE B  1 315 ? 126.430 106.160  54.789  1.00 60.29  ?  323 ILE B N   1 
ATOM 5697  C CA  . ILE B  1 315 ? 127.543 106.370  55.706  1.00 60.97  ?  323 ILE B CA  1 
ATOM 5698  C C   . ILE B  1 315 ? 128.546 105.242  55.514  1.00 60.76  ?  323 ILE B C   1 
ATOM 5699  O O   . ILE B  1 315 ? 128.195 104.062  55.614  1.00 60.38  ?  323 ILE B O   1 
ATOM 5700  C CB  . ILE B  1 315 ? 127.060 106.439  57.161  1.00 59.83  ?  323 ILE B CB  1 
ATOM 5701  C CG1 . ILE B  1 315 ? 126.206 107.689  57.363  1.00 60.50  ?  323 ILE B CG1 1 
ATOM 5702  C CG2 . ILE B  1 315 ? 128.243 106.419  58.119  1.00 61.70  ?  323 ILE B CG2 1 
ATOM 5703  C CD1 . ILE B  1 315 ? 125.805 107.918  58.788  1.00 62.22  ?  323 ILE B CD1 1 
ATOM 5704  N N   . CYS B  1 316 ? 129.796 105.606  55.235  1.00 56.07  ?  324 CYS B N   1 
ATOM 5705  C CA  . CYS B  1 316 ? 130.837 104.628  54.922  1.00 63.23  ?  324 CYS B CA  1 
ATOM 5706  C C   . CYS B  1 316 ? 131.583 104.275  56.205  1.00 57.63  ?  324 CYS B C   1 
ATOM 5707  O O   . CYS B  1 316 ? 132.639 104.824  56.525  1.00 59.97  ?  324 CYS B O   1 
ATOM 5708  C CB  . CYS B  1 316 ? 131.772 105.169  53.849  1.00 75.04  ?  324 CYS B CB  1 
ATOM 5709  S SG  . CYS B  1 316 ? 130.919 105.793  52.380  1.00 73.96  ?  324 CYS B SG  1 
ATOM 5710  N N   . TRP B  1 317 ? 131.004 103.338  56.954  1.00 58.42  ?  325 TRP B N   1 
ATOM 5711  C CA  . TRP B  1 317 ? 131.656 102.836  58.155  1.00 62.28  ?  325 TRP B CA  1 
ATOM 5712  C C   . TRP B  1 317 ? 132.996 102.199  57.807  1.00 67.30  ?  325 TRP B C   1 
ATOM 5713  O O   . TRP B  1 317 ? 133.175 101.619  56.733  1.00 67.28  ?  325 TRP B O   1 
ATOM 5714  C CB  . TRP B  1 317 ? 130.764 101.822  58.870  1.00 61.96  ?  325 TRP B CB  1 
ATOM 5715  C CG  . TRP B  1 317 ? 129.463 102.385  59.339  1.00 62.16  ?  325 TRP B CG  1 
ATOM 5716  C CD1 . TRP B  1 317 ? 128.220 102.072  58.876  1.00 60.71  ?  325 TRP B CD1 1 
ATOM 5717  C CD2 . TRP B  1 317 ? 129.273 103.355  60.376  1.00 68.41  ?  325 TRP B CD2 1 
ATOM 5718  N NE1 . TRP B  1 317 ? 127.267 102.791  59.556  1.00 65.22  ?  325 TRP B NE1 1 
ATOM 5719  C CE2 . TRP B  1 317 ? 127.888 103.587  60.482  1.00 69.86  ?  325 TRP B CE2 1 
ATOM 5720  C CE3 . TRP B  1 317 ? 130.141 104.053  61.223  1.00 74.30  ?  325 TRP B CE3 1 
ATOM 5721  C CZ2 . TRP B  1 317 ? 127.349 104.485  61.402  1.00 74.04  ?  325 TRP B CZ2 1 
ATOM 5722  C CZ3 . TRP B  1 317 ? 129.604 104.945  62.135  1.00 76.38  ?  325 TRP B CZ3 1 
ATOM 5723  C CH2 . TRP B  1 317 ? 128.222 105.152  62.217  1.00 76.41  ?  325 TRP B CH2 1 
ATOM 5724  N N   . HIS B  1 318 ? 133.946 102.328  58.733  1.00 60.27  ?  326 HIS B N   1 
ATOM 5725  C CA  . HIS B  1 318 ? 135.315 101.839  58.576  1.00 60.74  ?  326 HIS B CA  1 
ATOM 5726  C C   . HIS B  1 318 ? 136.025 102.471  57.384  1.00 60.17  ?  326 HIS B C   1 
ATOM 5727  O O   . HIS B  1 318 ? 137.040 101.945  56.916  1.00 60.02  ?  326 HIS B O   1 
ATOM 5728  C CB  . HIS B  1 318 ? 135.355 100.311  58.468  1.00 65.51  ?  326 HIS B CB  1 
ATOM 5729  C CG  . HIS B  1 318 ? 135.006 99.611   59.743  1.00 66.52  ?  326 HIS B CG  1 
ATOM 5730  N ND1 . HIS B  1 318 ? 133.768 99.050   59.969  1.00 65.63  ?  326 HIS B ND1 1 
ATOM 5731  C CD2 . HIS B  1 318 ? 135.730 99.390   60.865  1.00 69.99  ?  326 HIS B CD2 1 
ATOM 5732  C CE1 . HIS B  1 318 ? 133.746 98.508   61.174  1.00 67.74  ?  326 HIS B CE1 1 
ATOM 5733  N NE2 . HIS B  1 318 ? 134.925 98.700   61.738  1.00 70.72  ?  326 HIS B NE2 1 
ATOM 5734  N N   . ASN B  1 319 ? 135.505 103.598  56.893  1.00 60.15  ?  327 ASN B N   1 
ATOM 5735  C CA  . ASN B  1 319 ? 136.146 104.377  55.834  1.00 59.89  ?  327 ASN B CA  1 
ATOM 5736  C C   . ASN B  1 319 ? 136.384 103.539  54.578  1.00 57.95  ?  327 ASN B C   1 
ATOM 5737  O O   . ASN B  1 319 ? 137.459 103.580  53.975  1.00 58.11  ?  327 ASN B O   1 
ATOM 5738  C CB  . ASN B  1 319 ? 137.449 104.994  56.339  1.00 61.95  ?  327 ASN B CB  1 
ATOM 5739  C CG  . ASN B  1 319 ? 137.296 105.607  57.715  1.00 65.28  ?  327 ASN B CG  1 
ATOM 5740  O OD1 . ASN B  1 319 ? 136.276 106.225  58.019  1.00 65.16  ?  327 ASN B OD1 1 
ATOM 5741  N ND2 . ASN B  1 319 ? 138.303 105.425  58.561  1.00 68.43  ?  327 ASN B ND2 1 
ATOM 5742  N N   . GLN B  1 320 ? 135.378 102.760  54.191  1.00 60.41  ?  328 GLN B N   1 
ATOM 5743  C CA  . GLN B  1 320 ? 135.438 101.954  52.981  1.00 58.52  ?  328 GLN B CA  1 
ATOM 5744  C C   . GLN B  1 320 ? 134.077 101.981  52.302  1.00 56.80  ?  328 GLN B C   1 
ATOM 5745  O O   . GLN B  1 320 ? 133.059 102.308  52.918  1.00 57.01  ?  328 GLN B O   1 
ATOM 5746  C CB  . GLN B  1 320 ? 135.865 100.512  53.284  1.00 59.77  ?  328 GLN B CB  1 
ATOM 5747  C CG  . GLN B  1 320 ? 134.866 99.726   54.115  1.00 63.38  ?  328 GLN B CG  1 
ATOM 5748  C CD  . GLN B  1 320 ? 135.338 98.316   54.408  1.00 66.83  ?  328 GLN B CD  1 
ATOM 5749  O OE1 . GLN B  1 320 ? 136.419 97.910   53.981  1.00 66.14  ?  328 GLN B OE1 1 
ATOM 5750  N NE2 . GLN B  1 320 ? 134.531 97.563   55.146  1.00 71.69  ?  328 GLN B NE2 1 
ATOM 5751  N N   . LEU B  1 321 ? 134.067 101.625  51.020  1.00 59.25  ?  329 LEU B N   1 
ATOM 5752  C CA  . LEU B  1 321 ? 132.851 101.683  50.221  1.00 56.49  ?  329 LEU B CA  1 
ATOM 5753  C C   . LEU B  1 321 ? 132.927 100.623  49.133  1.00 62.03  ?  329 LEU B C   1 
ATOM 5754  O O   . LEU B  1 321 ? 133.886 100.599  48.357  1.00 63.99  ?  329 LEU B O   1 
ATOM 5755  C CB  . LEU B  1 321 ? 132.665 103.078  49.607  1.00 53.16  ?  329 LEU B CB  1 
ATOM 5756  C CG  . LEU B  1 321 ? 131.483 103.325  48.666  1.00 57.10  ?  329 LEU B CG  1 
ATOM 5757  C CD1 . LEU B  1 321 ? 130.920 104.719  48.884  1.00 52.39  ?  329 LEU B CD1 1 
ATOM 5758  C CD2 . LEU B  1 321 ? 131.894 103.150  47.210  1.00 58.09  ?  329 LEU B CD2 1 
ATOM 5759  N N   . PHE B  1 322 ? 131.917 99.762   49.073  1.00 55.68  ?  330 PHE B N   1 
ATOM 5760  C CA  . PHE B  1 322 ? 131.873 98.667   48.115  1.00 53.27  ?  330 PHE B CA  1 
ATOM 5761  C C   . PHE B  1 322 ? 130.959 99.042   46.956  1.00 50.77  ?  330 PHE B C   1 
ATOM 5762  O O   . PHE B  1 322 ? 129.799 99.416   47.169  1.00 53.64  ?  330 PHE B O   1 
ATOM 5763  C CB  . PHE B  1 322 ? 131.389 97.379   48.783  1.00 55.16  ?  330 PHE B CB  1 
ATOM 5764  C CG  . PHE B  1 322 ? 132.440 96.695   49.610  1.00 57.33  ?  330 PHE B CG  1 
ATOM 5765  C CD1 . PHE B  1 322 ? 133.326 95.801   49.032  1.00 56.89  ?  330 PHE B CD1 1 
ATOM 5766  C CD2 . PHE B  1 322 ? 132.547 96.954   50.967  1.00 60.01  ?  330 PHE B CD2 1 
ATOM 5767  C CE1 . PHE B  1 322 ? 134.297 95.175   49.793  1.00 59.14  ?  330 PHE B CE1 1 
ATOM 5768  C CE2 . PHE B  1 322 ? 133.513 96.332   51.734  1.00 62.27  ?  330 PHE B CE2 1 
ATOM 5769  C CZ  . PHE B  1 322 ? 134.389 95.441   51.146  1.00 61.83  ?  330 PHE B CZ  1 
ATOM 5770  N N   . LEU B  1 323 ? 131.490 98.952   45.736  1.00 56.58  ?  331 LEU B N   1 
ATOM 5771  C CA  . LEU B  1 323 ? 130.760 99.316   44.523  1.00 54.19  ?  331 LEU B CA  1 
ATOM 5772  C C   . LEU B  1 323 ? 130.691 98.095   43.614  1.00 51.53  ?  331 LEU B C   1 
ATOM 5773  O O   . LEU B  1 323 ? 131.701 97.702   43.023  1.00 50.84  ?  331 LEU B O   1 
ATOM 5774  C CB  . LEU B  1 323 ? 131.435 100.490  43.811  1.00 50.68  ?  331 LEU B CB  1 
ATOM 5775  C CG  . LEU B  1 323 ? 130.641 101.370  42.833  1.00 49.87  ?  331 LEU B CG  1 
ATOM 5776  C CD1 . LEU B  1 323 ? 131.538 102.458  42.269  1.00 50.59  ?  331 LEU B CD1 1 
ATOM 5777  C CD2 . LEU B  1 323 ? 129.999 100.587  41.696  1.00 48.11  ?  331 LEU B CD2 1 
ATOM 5778  N N   . THR B  1 324 ? 129.506 97.506   43.488  1.00 49.49  ?  332 THR B N   1 
ATOM 5779  C CA  . THR B  1 324 ? 129.276 96.413   42.551  1.00 48.07  ?  332 THR B CA  1 
ATOM 5780  C C   . THR B  1 324 ? 128.646 96.978   41.284  1.00 46.96  ?  332 THR B C   1 
ATOM 5781  O O   . THR B  1 324 ? 127.704 97.770   41.358  1.00 46.94  ?  332 THR B O   1 
ATOM 5782  C CB  . THR B  1 324 ? 128.375 95.341   43.166  1.00 49.46  ?  332 THR B CB  1 
ATOM 5783  O OG1 . THR B  1 324 ? 128.974 94.844   44.369  1.00 50.60  ?  332 THR B OG1 1 
ATOM 5784  C CG2 . THR B  1 324 ? 128.180 94.187   42.196  1.00 50.06  ?  332 THR B CG2 1 
ATOM 5785  N N   . VAL B  1 325 ? 129.169 96.586   40.126  1.00 50.95  ?  333 VAL B N   1 
ATOM 5786  C CA  . VAL B  1 325 ? 128.703 97.140   38.858  1.00 49.39  ?  333 VAL B CA  1 
ATOM 5787  C C   . VAL B  1 325 ? 128.825 96.076   37.775  1.00 44.37  ?  333 VAL B C   1 
ATOM 5788  O O   . VAL B  1 325 ? 129.822 95.350   37.702  1.00 42.41  ?  333 VAL B O   1 
ATOM 5789  C CB  . VAL B  1 325 ? 129.477 98.427   38.485  1.00 48.85  ?  333 VAL B CB  1 
ATOM 5790  C CG1 . VAL B  1 325 ? 130.968 98.224   38.649  1.00 51.59  ?  333 VAL B CG1 1 
ATOM 5791  C CG2 . VAL B  1 325 ? 129.158 98.858   37.064  1.00 46.79  ?  333 VAL B CG2 1 
ATOM 5792  N N   . VAL B  1 326 ? 127.787 95.982   36.945  1.00 45.92  ?  334 VAL B N   1 
ATOM 5793  C CA  . VAL B  1 326 ? 127.767 95.109   35.778  1.00 44.22  ?  334 VAL B CA  1 
ATOM 5794  C C   . VAL B  1 326 ? 127.344 95.933   34.571  1.00 44.29  ?  334 VAL B C   1 
ATOM 5795  O O   . VAL B  1 326 ? 126.337 96.648   34.625  1.00 43.50  ?  334 VAL B O   1 
ATOM 5796  C CB  . VAL B  1 326 ? 126.818 93.911   35.973  1.00 46.65  ?  334 VAL B CB  1 
ATOM 5797  C CG1 . VAL B  1 326 ? 126.665 93.134   34.673  1.00 44.73  ?  334 VAL B CG1 1 
ATOM 5798  C CG2 . VAL B  1 326 ? 127.332 93.008   37.076  1.00 46.88  ?  334 VAL B CG2 1 
ATOM 5799  N N   . ASP B  1 327 ? 128.114 95.837   33.489  1.00 52.26  ?  335 ASP B N   1 
ATOM 5800  C CA  . ASP B  1 327 ? 127.824 96.558   32.253  1.00 47.11  ?  335 ASP B CA  1 
ATOM 5801  C C   . ASP B  1 327 ? 128.146 95.637   31.086  1.00 44.84  ?  335 ASP B C   1 
ATOM 5802  O O   . ASP B  1 327 ? 129.320 95.411   30.778  1.00 51.50  ?  335 ASP B O   1 
ATOM 5803  C CB  . ASP B  1 327 ? 128.624 97.857   32.155  1.00 49.13  ?  335 ASP B CB  1 
ATOM 5804  C CG  . ASP B  1 327 ? 128.317 98.636   30.889  1.00 48.99  ?  335 ASP B CG  1 
ATOM 5805  O OD1 . ASP B  1 327 ? 127.274 98.363   30.257  1.00 46.24  ?  335 ASP B OD1 1 
ATOM 5806  O OD2 . ASP B  1 327 ? 129.122 99.517   30.521  1.00 49.77  -1 335 ASP B OD2 1 
ATOM 5807  N N   . THR B  1 328 ? 127.109 95.104   30.447  1.00 45.13  ?  336 THR B N   1 
ATOM 5808  C CA  . THR B  1 328 ? 127.269 94.211   29.309  1.00 45.10  ?  336 THR B CA  1 
ATOM 5809  C C   . THR B  1 328 ? 127.023 94.913   27.979  1.00 45.50  ?  336 THR B C   1 
ATOM 5810  O O   . THR B  1 328 ? 126.953 94.249   26.939  1.00 45.38  ?  336 THR B O   1 
ATOM 5811  C CB  . THR B  1 328 ? 126.333 93.012   29.452  1.00 48.05  ?  336 THR B CB  1 
ATOM 5812  O OG1 . THR B  1 328 ? 124.982 93.423   29.204  1.00 50.20  ?  336 THR B OG1 1 
ATOM 5813  C CG2 . THR B  1 328 ? 126.425 92.447   30.858  1.00 46.68  ?  336 THR B CG2 1 
ATOM 5814  N N   . THR B  1 329 ? 126.896 96.239   27.989  1.00 45.18  ?  337 THR B N   1 
ATOM 5815  C CA  . THR B  1 329 ? 126.658 97.012   26.778  1.00 45.68  ?  337 THR B CA  1 
ATOM 5816  C C   . THR B  1 329 ? 127.937 97.336   26.017  1.00 47.01  ?  337 THR B C   1 
ATOM 5817  O O   . THR B  1 329 ? 127.872 98.034   24.999  1.00 47.70  ?  337 THR B O   1 
ATOM 5818  C CB  . THR B  1 329 ? 125.917 98.307   27.123  1.00 44.30  ?  337 THR B CB  1 
ATOM 5819  O OG1 . THR B  1 329 ? 126.710 99.087   28.027  1.00 44.94  ?  337 THR B OG1 1 
ATOM 5820  C CG2 . THR B  1 329 ? 124.576 97.996   27.768  1.00 43.15  ?  337 THR B CG2 1 
ATOM 5821  N N   . ARG B  1 330 ? 129.087 96.857   26.483  1.00 46.37  ?  338 ARG B N   1 
ATOM 5822  C CA  . ARG B  1 330 ? 130.375 97.039   25.820  1.00 50.65  ?  338 ARG B CA  1 
ATOM 5823  C C   . ARG B  1 330 ? 131.101 95.704   25.711  1.00 52.14  ?  338 ARG B C   1 
ATOM 5824  O O   . ARG B  1 330 ? 132.281 95.576   26.042  1.00 49.13  ?  338 ARG B O   1 
ATOM 5825  C CB  . ARG B  1 330 ? 131.223 98.067   26.564  1.00 51.55  ?  338 ARG B CB  1 
ATOM 5826  C CG  . ARG B  1 330 ? 130.702 99.497   26.477  1.00 48.03  ?  338 ARG B CG  1 
ATOM 5827  C CD  . ARG B  1 330 ? 131.324 100.375  27.556  1.00 54.36  ?  338 ARG B CD  1 
ATOM 5828  N NE  . ARG B  1 330 ? 131.031 101.793  27.359  1.00 54.51  ?  338 ARG B NE  1 
ATOM 5829  C CZ  . ARG B  1 330 ? 129.924 102.400  27.774  1.00 49.15  ?  338 ARG B CZ  1 
ATOM 5830  N NH1 . ARG B  1 330 ? 128.990 101.712  28.415  1.00 46.76  1  338 ARG B NH1 1 
ATOM 5831  N NH2 . ARG B  1 330 ? 129.751 103.695  27.548  1.00 50.49  ?  338 ARG B NH2 1 
ATOM 5832  N N   . SER B  1 331 ? 130.387 94.685   25.232  1.00 50.13  ?  339 SER B N   1 
ATOM 5833  C CA  . SER B  1 331 ? 130.870 93.309   25.216  1.00 49.51  ?  339 SER B CA  1 
ATOM 5834  C C   . SER B  1 331 ? 131.625 92.948   23.943  1.00 53.70  ?  339 SER B C   1 
ATOM 5835  O O   . SER B  1 331 ? 131.925 91.768   23.736  1.00 56.30  ?  339 SER B O   1 
ATOM 5836  C CB  . SER B  1 331 ? 129.703 92.337   25.407  1.00 50.48  ?  339 SER B CB  1 
ATOM 5837  O OG  . SER B  1 331 ? 128.731 92.496   24.388  1.00 52.56  ?  339 SER B OG  1 
ATOM 5838  N N   . THR B  1 332 ? 131.926 93.923   23.088  1.00 50.84  ?  340 THR B N   1 
ATOM 5839  C CA  . THR B  1 332 ? 132.664 93.648   21.862  1.00 52.32  ?  340 THR B CA  1 
ATOM 5840  C C   . THR B  1 332 ? 134.026 93.034   22.172  1.00 52.47  ?  340 THR B C   1 
ATOM 5841  O O   . THR B  1 332 ? 134.665 93.353   23.178  1.00 53.43  ?  340 THR B O   1 
ATOM 5842  C CB  . THR B  1 332 ? 132.838 94.933   21.047  1.00 55.96  ?  340 THR B CB  1 
ATOM 5843  O OG1 . THR B  1 332 ? 133.731 94.692   19.952  1.00 59.75  ?  340 THR B OG1 1 
ATOM 5844  C CG2 . THR B  1 332 ? 133.391 96.057   21.919  1.00 57.01  ?  340 THR B CG2 1 
ATOM 5845  N N   . ASN B  1 333 ? 134.465 92.133   21.295  1.00 49.45  ?  341 ASN B N   1 
ATOM 5846  C CA  . ASN B  1 333 ? 135.701 91.386   21.481  1.00 52.30  ?  341 ASN B CA  1 
ATOM 5847  C C   . ASN B  1 333 ? 136.684 91.707   20.367  1.00 58.97  ?  341 ASN B C   1 
ATOM 5848  O O   . ASN B  1 333 ? 136.337 91.637   19.183  1.00 61.88  ?  341 ASN B O   1 
ATOM 5849  C CB  . ASN B  1 333 ? 135.444 89.878   21.515  1.00 48.80  ?  341 ASN B CB  1 
ATOM 5850  C CG  . ASN B  1 333 ? 134.854 89.418   22.825  1.00 47.34  ?  341 ASN B CG  1 
ATOM 5851  O OD1 . ASN B  1 333 ? 135.288 89.844   23.896  1.00 47.49  ?  341 ASN B OD1 1 
ATOM 5852  N ND2 . ASN B  1 333 ? 133.867 88.534   22.752  1.00 46.05  ?  341 ASN B ND2 1 
ATOM 5853  N N   . LEU B  1 334 ? 137.907 92.058   20.754  1.00 53.94  ?  342 LEU B N   1 
ATOM 5854  C CA  . LEU B  1 334 ? 138.986 92.269   19.802  1.00 56.70  ?  342 LEU B CA  1 
ATOM 5855  C C   . LEU B  1 334 ? 139.511 90.919   19.331  1.00 62.16  ?  342 LEU B C   1 
ATOM 5856  O O   . LEU B  1 334 ? 139.774 90.029   20.146  1.00 67.83  ?  342 LEU B O   1 
ATOM 5857  C CB  . LEU B  1 334 ? 140.115 93.073   20.446  1.00 50.26  ?  342 LEU B CB  1 
ATOM 5858  C CG  . LEU B  1 334 ? 139.758 94.408   21.099  1.00 49.72  ?  342 LEU B CG  1 
ATOM 5859  C CD1 . LEU B  1 334 ? 141.004 95.054   21.681  1.00 51.53  ?  342 LEU B CD1 1 
ATOM 5860  C CD2 . LEU B  1 334 ? 139.090 95.334   20.096  1.00 49.71  ?  342 LEU B CD2 1 
ATOM 5861  N N   . SER B  1 335 ? 139.671 90.767   18.021  1.00 58.35  ?  343 SER B N   1 
ATOM 5862  C CA  . SER B  1 335 ? 140.248 89.561   17.439  1.00 60.72  ?  343 SER B CA  1 
ATOM 5863  C C   . SER B  1 335 ? 141.626 89.914   16.894  1.00 61.11  ?  343 SER B C   1 
ATOM 5864  O O   . SER B  1 335 ? 141.740 90.623   15.888  1.00 62.88  ?  343 SER B O   1 
ATOM 5865  C CB  . SER B  1 335 ? 139.345 88.989   16.348  1.00 68.81  ?  343 SER B CB  1 
ATOM 5866  O OG  . SER B  1 335 ? 139.096 89.946   15.333  1.00 74.77  ?  343 SER B OG  1 
ATOM 5867  N N   . VAL B  1 336 ? 142.668 89.432   17.566  1.00 55.84  ?  344 VAL B N   1 
ATOM 5868  C CA  . VAL B  1 336 ? 144.050 89.655   17.157  1.00 60.17  ?  344 VAL B CA  1 
ATOM 5869  C C   . VAL B  1 336 ? 144.603 88.347   16.615  1.00 66.00  ?  344 VAL B C   1 
ATOM 5870  O O   . VAL B  1 336 ? 144.471 87.304   17.260  1.00 69.43  ?  344 VAL B O   1 
ATOM 5871  C CB  . VAL B  1 336 ? 144.901 90.164   18.333  1.00 60.62  ?  344 VAL B CB  1 
ATOM 5872  C CG1 . VAL B  1 336 ? 146.370 90.224   17.944  1.00 66.30  ?  344 VAL B CG1 1 
ATOM 5873  C CG2 . VAL B  1 336 ? 144.398 91.522   18.800  1.00 60.24  ?  344 VAL B CG2 1 
ATOM 5874  N N   . CYS B  1 337 ? 145.242 88.400   15.449  1.00 63.04  ?  345 CYS B N   1 
ATOM 5875  C CA  . CYS B  1 337 ? 145.829 87.212   14.844  1.00 67.75  ?  345 CYS B CA  1 
ATOM 5876  C C   . CYS B  1 337 ? 147.249 87.525   14.397  1.00 70.02  ?  345 CYS B C   1 
ATOM 5877  O O   . CYS B  1 337 ? 147.534 88.637   13.941  1.00 70.69  ?  345 CYS B O   1 
ATOM 5878  C CB  . CYS B  1 337 ? 144.987 86.698   13.664  1.00 69.16  ?  345 CYS B CB  1 
ATOM 5879  S SG  . CYS B  1 337 ? 145.297 87.491   12.076  1.00 75.59  ?  345 CYS B SG  1 
ATOM 5880  N N   . ALA B  1 338 ? 148.139 86.545   14.541  1.00 67.02  ?  346 ALA B N   1 
ATOM 5881  C CA  . ALA B  1 338 ? 149.548 86.719   14.220  1.00 71.34  ?  346 ALA B CA  1 
ATOM 5882  C C   . ALA B  1 338 ? 150.015 85.587   13.321  1.00 73.79  ?  346 ALA B C   1 
ATOM 5883  O O   . ALA B  1 338 ? 149.690 84.421   13.558  1.00 72.86  ?  346 ALA B O   1 
ATOM 5884  C CB  . ALA B  1 338 ? 150.410 86.766   15.488  1.00 75.59  ?  346 ALA B CB  1 
ATOM 5885  N N   . SER B  1 339 ? 150.785 85.936   12.295  1.00 72.71  ?  347 SER B N   1 
ATOM 5886  C CA  . SER B  1 339 ? 151.254 84.943   11.339  1.00 77.38  ?  347 SER B CA  1 
ATOM 5887  C C   . SER B  1 339 ? 152.269 84.004   11.979  1.00 86.62  ?  347 SER B C   1 
ATOM 5888  O O   . SER B  1 339 ? 153.080 84.413   12.815  1.00 91.39  ?  347 SER B O   1 
ATOM 5889  C CB  . SER B  1 339 ? 151.871 85.633   10.125  1.00 81.34  ?  347 SER B CB  1 
ATOM 5890  O OG  . SER B  1 339 ? 152.930 86.493   10.509  1.00 84.86  ?  347 SER B OG  1 
ATOM 5891  N N   . THR B  1 340 ? 152.212 82.730   11.582  1.00 79.90  ?  348 THR B N   1 
ATOM 5892  C CA  . THR B  1 340 ? 153.166 81.741   12.069  1.00 87.99  ?  348 THR B CA  1 
ATOM 5893  C C   . THR B  1 340 ? 154.494 81.799   11.328  1.00 106.69 ?  348 THR B C   1 
ATOM 5894  O O   . THR B  1 340 ? 155.516 81.372   11.876  1.00 111.23 ?  348 THR B O   1 
ATOM 5895  C CB  . THR B  1 340 ? 152.575 80.335   11.954  1.00 90.68  ?  348 THR B CB  1 
ATOM 5896  O OG1 . THR B  1 340 ? 152.320 80.036   10.575  1.00 92.86  ?  348 THR B OG1 1 
ATOM 5897  C CG2 . THR B  1 340 ? 151.276 80.237   12.741  1.00 79.91  ?  348 THR B CG2 1 
ATOM 5898  N N   . THR B  1 341 ? 154.498 82.305   10.098  1.00 102.29 ?  349 THR B N   1 
ATOM 5899  C CA  . THR B  1 341 ? 155.734 82.584   9.385   1.00 112.34 ?  349 THR B CA  1 
ATOM 5900  C C   . THR B  1 341 ? 156.257 83.957   9.797   1.00 115.92 ?  349 THR B C   1 
ATOM 5901  O O   . THR B  1 341 ? 155.482 84.854   10.144  1.00 112.17 ?  349 THR B O   1 
ATOM 5902  C CB  . THR B  1 341 ? 155.505 82.533   7.872   1.00 109.69 ?  349 THR B CB  1 
ATOM 5903  O OG1 . THR B  1 341 ? 154.699 81.392   7.547   1.00 99.84  ?  349 THR B OG1 1 
ATOM 5904  C CG2 . THR B  1 341 ? 156.829 82.432   7.127   1.00 120.92 ?  349 THR B CG2 1 
ATOM 5905  N N   . SER B  1 342 ? 157.587 84.107   9.785   1.00 124.05 ?  350 SER B N   1 
ATOM 5906  C CA  . SER B  1 342 ? 158.199 85.362   10.221  1.00 120.22 ?  350 SER B CA  1 
ATOM 5907  C C   . SER B  1 342 ? 157.614 86.547   9.463   1.00 113.09 ?  350 SER B C   1 
ATOM 5908  O O   . SER B  1 342 ? 157.239 87.563   10.061  1.00 106.57 ?  350 SER B O   1 
ATOM 5909  C CB  . SER B  1 342 ? 159.715 85.298   10.034  1.00 126.80 ?  350 SER B CB  1 
ATOM 5910  O OG  . SER B  1 342 ? 160.335 86.474   10.525  1.00 126.74 ?  350 SER B OG  1 
ATOM 5911  N N   . SER B  1 343 ? 157.528 86.433   8.141   1.00 124.19 ?  351 SER B N   1 
ATOM 5912  C CA  . SER B  1 343 ? 156.751 87.351   7.325   1.00 121.30 ?  351 SER B CA  1 
ATOM 5913  C C   . SER B  1 343 ? 155.843 86.524   6.430   1.00 120.93 ?  351 SER B C   1 
ATOM 5914  O O   . SER B  1 343 ? 156.248 85.469   5.931   1.00 125.63 ?  351 SER B O   1 
ATOM 5915  C CB  . SER B  1 343 ? 157.644 88.268   6.480   1.00 124.42 ?  351 SER B CB  1 
ATOM 5916  O OG  . SER B  1 343 ? 156.873 89.267   5.832   1.00 118.60 ?  351 SER B OG  1 
ATOM 5917  N N   . ILE B  1 344 ? 154.623 87.000   6.230   1.00 119.56 ?  352 ILE B N   1 
ATOM 5918  C CA  . ILE B  1 344 ? 153.636 86.201   5.494   1.00 114.24 ?  352 ILE B CA  1 
ATOM 5919  C C   . ILE B  1 344 ? 154.013 86.146   4.018   1.00 122.54 ?  352 ILE B C   1 
ATOM 5920  O O   . ILE B  1 344 ? 154.261 87.198   3.402   1.00 126.65 ?  352 ILE B O   1 
ATOM 5921  C CB  . ILE B  1 344 ? 152.216 86.759   5.689   1.00 107.51 ?  352 ILE B CB  1 
ATOM 5922  C CG1 . ILE B  1 344 ? 152.194 88.222   6.170   1.00 96.14  ?  352 ILE B CG1 1 
ATOM 5923  C CG2 . ILE B  1 344 ? 151.424 85.855   6.614   1.00 106.19 ?  352 ILE B CG2 1 
ATOM 5924  C CD1 . ILE B  1 344 ? 152.796 89.246   5.216   1.00 99.27  ?  352 ILE B CD1 1 
ATOM 5925  N N   . PRO B  1 345 ? 154.082 84.964   3.412   1.00 119.11 ?  353 PRO B N   1 
ATOM 5926  C CA  . PRO B  1 345 ? 154.029 84.901   1.950   1.00 116.62 ?  353 PRO B CA  1 
ATOM 5927  C C   . PRO B  1 345 ? 152.632 85.285   1.501   1.00 105.55 ?  353 PRO B C   1 
ATOM 5928  O O   . PRO B  1 345 ? 151.636 84.847   2.082   1.00 98.49  ?  353 PRO B O   1 
ATOM 5929  C CB  . PRO B  1 345 ? 154.345 83.431   1.636   1.00 108.99 ?  353 PRO B CB  1 
ATOM 5930  C CG  . PRO B  1 345 ? 154.948 82.879   2.898   1.00 111.94 ?  353 PRO B CG  1 
ATOM 5931  C CD  . PRO B  1 345 ? 154.295 83.636   4.010   1.00 109.50 ?  353 PRO B CD  1 
ATOM 5932  N N   . ASN B  1 346 ? 152.560 86.121   0.468   1.00 103.23 ?  354 ASN B N   1 
ATOM 5933  C CA  . ASN B  1 346 ? 151.289 86.714   0.066   1.00 95.25  ?  354 ASN B CA  1 
ATOM 5934  C C   . ASN B  1 346 ? 150.307 85.664   -0.445  1.00 89.35  ?  354 ASN B C   1 
ATOM 5935  O O   . ASN B  1 346 ? 149.757 85.790   -1.543  1.00 92.85  ?  354 ASN B O   1 
ATOM 5936  C CB  . ASN B  1 346 ? 151.522 87.797   -0.989  1.00 98.32  ?  354 ASN B CB  1 
ATOM 5937  C CG  . ASN B  1 346 ? 152.138 89.055   -0.403  1.00 97.50  ?  354 ASN B CG  1 
ATOM 5938  O OD1 . ASN B  1 346 ? 151.438 90.025   -0.116  1.00 94.97  ?  354 ASN B OD1 1 
ATOM 5939  N ND2 . ASN B  1 346 ? 153.454 89.041   -0.218  1.00 100.68 ?  354 ASN B ND2 1 
ATOM 5940  N N   . VAL B  1 347 ? 150.085 84.630   0.365   1.00 82.95  ?  355 VAL B N   1 
ATOM 5941  C CA  . VAL B  1 347 ? 149.128 83.565   0.096   1.00 80.72  ?  355 VAL B CA  1 
ATOM 5942  C C   . VAL B  1 347 ? 148.508 83.174   1.429   1.00 76.85  ?  355 VAL B C   1 
ATOM 5943  O O   . VAL B  1 347 ? 149.226 82.945   2.409   1.00 77.43  ?  355 VAL B O   1 
ATOM 5944  C CB  . VAL B  1 347 ? 149.785 82.343   -0.577  1.00 82.56  ?  355 VAL B CB  1 
ATOM 5945  C CG1 . VAL B  1 347 ? 150.013 82.604   -2.046  1.00 85.71  ?  355 VAL B CG1 1 
ATOM 5946  C CG2 . VAL B  1 347 ? 151.108 82.005   0.099   1.00 85.51  ?  355 VAL B CG2 1 
ATOM 5947  N N   . TYR B  1 348 ? 147.182 83.114   1.477   1.00 71.57  ?  356 TYR B N   1 
ATOM 5948  C CA  . TYR B  1 348 ? 146.484 82.818   2.719   1.00 67.99  ?  356 TYR B CA  1 
ATOM 5949  C C   . TYR B  1 348 ? 146.189 81.329   2.825   1.00 67.45  ?  356 TYR B C   1 
ATOM 5950  O O   . TYR B  1 348 ? 145.640 80.727   1.896   1.00 67.93  ?  356 TYR B O   1 
ATOM 5951  C CB  . TYR B  1 348 ? 145.183 83.613   2.832   1.00 71.74  ?  356 TYR B CB  1 
ATOM 5952  C CG  . TYR B  1 348 ? 144.335 83.174   4.006   1.00 68.18  ?  356 TYR B CG  1 
ATOM 5953  C CD1 . TYR B  1 348 ? 144.636 83.593   5.294   1.00 66.77  ?  356 TYR B CD1 1 
ATOM 5954  C CD2 . TYR B  1 348 ? 143.242 82.335   3.830   1.00 66.41  ?  356 TYR B CD2 1 
ATOM 5955  C CE1 . TYR B  1 348 ? 143.873 83.191   6.375   1.00 63.71  ?  356 TYR B CE1 1 
ATOM 5956  C CE2 . TYR B  1 348 ? 142.471 81.930   4.906   1.00 63.34  ?  356 TYR B CE2 1 
ATOM 5957  C CZ  . TYR B  1 348 ? 142.791 82.363   6.176   1.00 62.02  ?  356 TYR B CZ  1 
ATOM 5958  O OH  . TYR B  1 348 ? 142.032 81.967   7.253   1.00 59.14  ?  356 TYR B OH  1 
ATOM 5959  N N   . THR B  1 349 ? 146.563 80.742   3.960   1.00 67.75  ?  357 THR B N   1 
ATOM 5960  C CA  . THR B  1 349 ? 146.164 79.402   4.345   1.00 66.64  ?  357 THR B CA  1 
ATOM 5961  C C   . THR B  1 349 ? 145.825 79.465   5.827   1.00 64.25  ?  357 THR B C   1 
ATOM 5962  O O   . THR B  1 349 ? 146.545 80.114   6.600   1.00 64.19  ?  357 THR B O   1 
ATOM 5963  C CB  . THR B  1 349 ? 147.254 78.349   4.097   1.00 64.73  ?  357 THR B CB  1 
ATOM 5964  O OG1 . THR B  1 349 ? 148.461 78.736   4.765   1.00 65.90  ?  357 THR B OG1 1 
ATOM 5965  C CG2 . THR B  1 349 ? 147.520 78.187   2.609   1.00 66.35  ?  357 THR B CG2 1 
ATOM 5966  N N   . PRO B  1 350 ? 144.737 78.816   6.248   1.00 68.54  ?  358 PRO B N   1 
ATOM 5967  C CA  . PRO B  1 350 ? 144.329 78.904   7.660   1.00 66.21  ?  358 PRO B CA  1 
ATOM 5968  C C   . PRO B  1 350 ? 145.380 78.409   8.636   1.00 69.77  ?  358 PRO B C   1 
ATOM 5969  O O   . PRO B  1 350 ? 145.361 78.818   9.803   1.00 71.65  ?  358 PRO B O   1 
ATOM 5970  C CB  . PRO B  1 350 ? 143.063 78.037   7.715   1.00 70.72  ?  358 PRO B CB  1 
ATOM 5971  C CG  . PRO B  1 350 ? 143.154 77.146   6.516   1.00 73.12  ?  358 PRO B CG  1 
ATOM 5972  C CD  . PRO B  1 350 ? 143.848 77.945   5.463   1.00 76.89  ?  358 PRO B CD  1 
ATOM 5973  N N   . THR B  1 351 ? 146.300 77.550   8.200   1.00 66.92  ?  359 THR B N   1 
ATOM 5974  C CA  . THR B  1 351 ? 147.330 77.023   9.084   1.00 68.18  ?  359 THR B CA  1 
ATOM 5975  C C   . THR B  1 351 ? 148.441 78.023   9.375   1.00 71.00  ?  359 THR B C   1 
ATOM 5976  O O   . THR B  1 351 ? 149.255 77.771   10.269  1.00 75.33  ?  359 THR B O   1 
ATOM 5977  C CB  . THR B  1 351 ? 147.938 75.756   8.479   1.00 66.39  ?  359 THR B CB  1 
ATOM 5978  O OG1 . THR B  1 351 ? 148.719 76.105   7.330   1.00 69.85  ?  359 THR B OG1 1 
ATOM 5979  C CG2 . THR B  1 351 ? 146.841 74.793   8.056   1.00 64.24  ?  359 THR B CG2 1 
ATOM 5980  N N   . SER B  1 352 ? 148.493 79.144   8.656   1.00 69.39  ?  360 SER B N   1 
ATOM 5981  C CA  . SER B  1 352 ? 149.570 80.116   8.791   1.00 74.56  ?  360 SER B CA  1 
ATOM 5982  C C   . SER B  1 352 ? 149.166 81.347   9.599   1.00 73.68  ?  360 SER B C   1 
ATOM 5983  O O   . SER B  1 352 ? 149.810 82.395   9.479   1.00 75.39  ?  360 SER B O   1 
ATOM 5984  C CB  . SER B  1 352 ? 150.071 80.536   7.410   1.00 71.20  ?  360 SER B CB  1 
ATOM 5985  O OG  . SER B  1 352 ? 148.987 80.806   6.540   1.00 68.97  ?  360 SER B OG  1 
ATOM 5986  N N   . PHE B  1 353 ? 148.122 81.243   10.419  1.00 79.02  ?  361 PHE B N   1 
ATOM 5987  C CA  . PHE B  1 353 ? 147.691 82.358   11.254  1.00 73.15  ?  361 PHE B CA  1 
ATOM 5988  C C   . PHE B  1 353 ? 147.156 81.831   12.574  1.00 71.44  ?  361 PHE B C   1 
ATOM 5989  O O   . PHE B  1 353 ? 146.290 80.951   12.588  1.00 71.62  ?  361 PHE B O   1 
ATOM 5990  C CB  . PHE B  1 353 ? 146.616 83.202   10.558  1.00 65.47  ?  361 PHE B CB  1 
ATOM 5991  C CG  . PHE B  1 353 ? 147.142 84.072   9.455   1.00 69.86  ?  361 PHE B CG  1 
ATOM 5992  C CD1 . PHE B  1 353 ? 147.805 85.252   9.746   1.00 74.74  ?  361 PHE B CD1 1 
ATOM 5993  C CD2 . PHE B  1 353 ? 146.966 83.716   8.129   1.00 72.05  ?  361 PHE B CD2 1 
ATOM 5994  C CE1 . PHE B  1 353 ? 148.287 86.059   8.736   1.00 79.67  ?  361 PHE B CE1 1 
ATOM 5995  C CE2 . PHE B  1 353 ? 147.446 84.519   7.114   1.00 78.43  ?  361 PHE B CE2 1 
ATOM 5996  C CZ  . PHE B  1 353 ? 148.105 85.692   7.418   1.00 82.76  ?  361 PHE B CZ  1 
ATOM 5997  N N   . LYS B  1 354 ? 147.670 82.376   13.673  1.00 74.03  ?  362 LYS B N   1 
ATOM 5998  C CA  . LYS B  1 354 ? 147.177 82.063   15.007  1.00 70.55  ?  362 LYS B CA  1 
ATOM 5999  C C   . LYS B  1 354 ? 146.150 83.111   15.413  1.00 63.89  ?  362 LYS B C   1 
ATOM 6000  O O   . LYS B  1 354 ? 146.402 84.316   15.294  1.00 63.59  ?  362 LYS B O   1 
ATOM 6001  C CB  . LYS B  1 354 ? 148.326 82.021   16.015  1.00 64.66  ?  362 LYS B CB  1 
ATOM 6002  C CG  . LYS B  1 354 ? 149.247 80.823   15.852  1.00 66.26  ?  362 LYS B CG  1 
ATOM 6003  C CD  . LYS B  1 354 ? 149.081 79.833   16.990  1.00 64.05  ?  362 LYS B CD  1 
ATOM 6004  C CE  . LYS B  1 354 ? 150.383 79.102   17.272  1.00 70.40  ?  362 LYS B CE  1 
ATOM 6005  N NZ  . LYS B  1 354 ? 150.293 78.267   18.500  1.00 71.84  1  362 LYS B NZ  1 
ATOM 6006  N N   . GLU B  1 355 ? 144.999 82.651   15.897  1.00 66.32  ?  363 GLU B N   1 
ATOM 6007  C CA  . GLU B  1 355 ? 143.878 83.519   16.228  1.00 61.31  ?  363 GLU B CA  1 
ATOM 6008  C C   . GLU B  1 355 ? 143.695 83.592   17.738  1.00 58.79  ?  363 GLU B C   1 
ATOM 6009  O O   . GLU B  1 355 ? 143.651 82.562   18.418  1.00 60.46  ?  363 GLU B O   1 
ATOM 6010  C CB  . GLU B  1 355 ? 142.593 83.025   15.561  1.00 59.12  ?  363 GLU B CB  1 
ATOM 6011  C CG  . GLU B  1 355 ? 142.687 82.921   14.049  1.00 67.96  ?  363 GLU B CG  1 
ATOM 6012  C CD  . GLU B  1 355 ? 142.541 84.266   13.366  1.00 74.03  ?  363 GLU B CD  1 
ATOM 6013  O OE1 . GLU B  1 355 ? 142.004 85.200   13.999  1.00 73.35  ?  363 GLU B OE1 1 
ATOM 6014  O OE2 . GLU B  1 355 ? 142.965 84.390   12.198  1.00 79.94  -1 363 GLU B OE2 1 
ATOM 6015  N N   . TYR B  1 356 ? 143.575 84.814   18.245  1.00 56.57  ?  364 TYR B N   1 
ATOM 6016  C CA  . TYR B  1 356 ? 143.398 85.103   19.659  1.00 55.20  ?  364 TYR B CA  1 
ATOM 6017  C C   . TYR B  1 356 ? 142.227 86.058   19.838  1.00 52.96  ?  364 TYR B C   1 
ATOM 6018  O O   . TYR B  1 356 ? 142.031 86.973   19.030  1.00 53.16  ?  364 TYR B O   1 
ATOM 6019  C CB  . TYR B  1 356 ? 144.654 85.739   20.272  1.00 53.04  ?  364 TYR B CB  1 
ATOM 6020  C CG  . TYR B  1 356 ? 145.930 84.943   20.118  1.00 56.32  ?  364 TYR B CG  1 
ATOM 6021  C CD1 . TYR B  1 356 ? 146.659 84.978   18.936  1.00 59.05  ?  364 TYR B CD1 1 
ATOM 6022  C CD2 . TYR B  1 356 ? 146.422 84.182   21.168  1.00 57.27  ?  364 TYR B CD2 1 
ATOM 6023  C CE1 . TYR B  1 356 ? 147.834 84.258   18.800  1.00 62.61  ?  364 TYR B CE1 1 
ATOM 6024  C CE2 . TYR B  1 356 ? 147.596 83.463   21.043  1.00 60.85  ?  364 TYR B CE2 1 
ATOM 6025  C CZ  . TYR B  1 356 ? 148.298 83.504   19.858  1.00 63.52  ?  364 TYR B CZ  1 
ATOM 6026  O OH  . TYR B  1 356 ? 149.463 82.785   19.736  1.00 67.26  ?  364 TYR B OH  1 
ATOM 6027  N N   . ALA B  1 357 ? 141.467 85.848   20.910  1.00 55.30  ?  365 ALA B N   1 
ATOM 6028  C CA  . ALA B  1 357 ? 140.338 86.696   21.270  1.00 53.23  ?  365 ALA B CA  1 
ATOM 6029  C C   . ALA B  1 357 ? 140.653 87.382   22.592  1.00 53.08  ?  365 ALA B C   1 
ATOM 6030  O O   . ALA B  1 357 ? 140.914 86.710   23.595  1.00 53.06  ?  365 ALA B O   1 
ATOM 6031  C CB  . ALA B  1 357 ? 139.048 85.883   21.376  1.00 52.93  ?  365 ALA B CB  1 
ATOM 6032  N N   . ARG B  1 358 ? 140.639 88.713   22.589  1.00 54.84  ?  366 ARG B N   1 
ATOM 6033  C CA  . ARG B  1 358 ? 140.927 89.508   23.773  1.00 53.36  ?  366 ARG B CA  1 
ATOM 6034  C C   . ARG B  1 358 ? 139.774 90.461   24.054  1.00 51.00  ?  366 ARG B C   1 
ATOM 6035  O O   . ARG B  1 358 ? 139.153 90.987   23.126  1.00 53.45  ?  366 ARG B O   1 
ATOM 6036  C CB  . ARG B  1 358 ? 142.225 90.303   23.606  1.00 51.89  ?  366 ARG B CB  1 
ATOM 6037  C CG  . ARG B  1 358 ? 143.473 89.446   23.541  1.00 54.00  ?  366 ARG B CG  1 
ATOM 6038  C CD  . ARG B  1 358 ? 143.622 88.605   24.793  1.00 53.77  ?  366 ARG B CD  1 
ATOM 6039  N NE  . ARG B  1 358 ? 143.962 87.223   24.471  1.00 54.44  ?  366 ARG B NE  1 
ATOM 6040  C CZ  . ARG B  1 358 ? 145.204 86.755   24.425  1.00 60.18  ?  366 ARG B CZ  1 
ATOM 6041  N NH1 . ARG B  1 358 ? 146.226 87.559   24.684  1.00 65.88  1  366 ARG B NH1 1 
ATOM 6042  N NH2 . ARG B  1 358 ? 145.425 85.483   24.120  1.00 63.71  ?  366 ARG B NH2 1 
ATOM 6043  N N   . HIS B  1 359 ? 139.493 90.677   25.336  1.00 49.65  ?  367 HIS B N   1 
ATOM 6044  C CA  . HIS B  1 359 ? 138.458 91.595   25.778  1.00 48.13  ?  367 HIS B CA  1 
ATOM 6045  C C   . HIS B  1 359 ? 139.053 92.637   26.717  1.00 48.99  ?  367 HIS B C   1 
ATOM 6046  O O   . HIS B  1 359 ? 140.063 92.392   27.391  1.00 50.36  ?  367 HIS B O   1 
ATOM 6047  C CB  . HIS B  1 359 ? 137.313 90.851   26.474  1.00 57.29  ?  367 HIS B CB  1 
ATOM 6048  C CG  . HIS B  1 359 ? 136.147 91.726   26.817  1.00 58.09  ?  367 HIS B CG  1 
ATOM 6049  N ND1 . HIS B  1 359 ? 135.354 92.317   25.857  1.00 58.10  ?  367 HIS B ND1 1 
ATOM 6050  C CD2 . HIS B  1 359 ? 135.643 92.113   28.013  1.00 58.95  ?  367 HIS B CD2 1 
ATOM 6051  C CE1 . HIS B  1 359 ? 134.411 93.029   26.447  1.00 58.07  ?  367 HIS B CE1 1 
ATOM 6052  N NE2 . HIS B  1 359 ? 134.564 92.922   27.754  1.00 59.74  ?  367 HIS B NE2 1 
ATOM 6053  N N   . VAL B  1 360 ? 138.393 93.794   26.768  1.00 52.40  ?  368 VAL B N   1 
ATOM 6054  C CA  . VAL B  1 360 ? 138.908 94.994   27.417  1.00 54.27  ?  368 VAL B CA  1 
ATOM 6055  C C   . VAL B  1 360 ? 137.799 95.621   28.254  1.00 54.93  ?  368 VAL B C   1 
ATOM 6056  O O   . VAL B  1 360 ? 136.650 95.712   27.810  1.00 57.42  ?  368 VAL B O   1 
ATOM 6057  C CB  . VAL B  1 360 ? 139.433 96.001   26.371  1.00 51.66  ?  368 VAL B CB  1 
ATOM 6058  C CG1 . VAL B  1 360 ? 139.533 97.393   26.964  1.00 52.16  ?  368 VAL B CG1 1 
ATOM 6059  C CG2 . VAL B  1 360 ? 140.771 95.544   25.808  1.00 53.75  ?  368 VAL B CG2 1 
ATOM 6060  N N   . GLU B  1 361 ? 138.144 96.060   29.466  1.00 51.28  ?  369 GLU B N   1 
ATOM 6061  C CA  . GLU B  1 361 ? 137.220 96.788   30.328  1.00 50.17  ?  369 GLU B CA  1 
ATOM 6062  C C   . GLU B  1 361 ? 137.895 98.050   30.849  1.00 51.57  ?  369 GLU B C   1 
ATOM 6063  O O   . GLU B  1 361 ? 139.048 98.004   31.292  1.00 53.26  ?  369 GLU B O   1 
ATOM 6064  C CB  . GLU B  1 361 ? 136.744 95.913   31.492  1.00 55.78  ?  369 GLU B CB  1 
ATOM 6065  C CG  . GLU B  1 361 ? 135.860 94.747   31.068  1.00 59.90  ?  369 GLU B CG  1 
ATOM 6066  C CD  . GLU B  1 361 ? 134.488 95.194   30.583  1.00 63.47  ?  369 GLU B CD  1 
ATOM 6067  O OE1 . GLU B  1 361 ? 133.791 95.907   31.336  1.00 65.96  ?  369 GLU B OE1 1 
ATOM 6068  O OE2 . GLU B  1 361 ? 134.106 94.833   29.450  1.00 63.41  -1 369 GLU B OE2 1 
ATOM 6069  N N   . GLU B  1 362 ? 137.172 99.171   30.805  1.00 55.72  ?  370 GLU B N   1 
ATOM 6070  C CA  . GLU B  1 362 ? 137.708 100.468  31.205  1.00 59.49  ?  370 GLU B CA  1 
ATOM 6071  C C   . GLU B  1 362 ? 136.697 101.206  32.071  1.00 59.64  ?  370 GLU B C   1 
ATOM 6072  O O   . GLU B  1 362 ? 135.533 101.349  31.685  1.00 61.09  ?  370 GLU B O   1 
ATOM 6073  C CB  . GLU B  1 362 ? 138.065 101.317  29.979  1.00 57.37  ?  370 GLU B CB  1 
ATOM 6074  C CG  . GLU B  1 362 ? 138.432 102.760  30.302  1.00 64.90  ?  370 GLU B CG  1 
ATOM 6075  C CD  . GLU B  1 362 ? 138.788 103.566  29.064  1.00 70.26  ?  370 GLU B CD  1 
ATOM 6076  O OE1 . GLU B  1 362 ? 139.050 102.955  28.006  1.00 73.37  ?  370 GLU B OE1 1 
ATOM 6077  O OE2 . GLU B  1 362 ? 138.813 104.813  29.152  1.00 70.10  -1 370 GLU B OE2 1 
ATOM 6078  N N   . PHE B  1 363 ? 137.150 101.678  33.233  1.00 57.27  ?  371 PHE B N   1 
ATOM 6079  C CA  . PHE B  1 363 ? 136.321 102.368  34.209  1.00 55.75  ?  371 PHE B CA  1 
ATOM 6080  C C   . PHE B  1 363 ? 137.015 103.644  34.668  1.00 59.53  ?  371 PHE B C   1 
ATOM 6081  O O   . PHE B  1 363 ? 138.222 103.828  34.479  1.00 63.54  ?  371 PHE B O   1 
ATOM 6082  C CB  . PHE B  1 363 ? 136.029 101.491  35.438  1.00 56.77  ?  371 PHE B CB  1 
ATOM 6083  C CG  . PHE B  1 363 ? 135.190 100.284  35.143  1.00 53.79  ?  371 PHE B CG  1 
ATOM 6084  C CD1 . PHE B  1 363 ? 133.855 100.255  35.505  1.00 51.07  ?  371 PHE B CD1 1 
ATOM 6085  C CD2 . PHE B  1 363 ? 135.730 99.182   34.502  1.00 53.91  ?  371 PHE B CD2 1 
ATOM 6086  C CE1 . PHE B  1 363 ? 133.075 99.148   35.241  1.00 49.75  ?  371 PHE B CE1 1 
ATOM 6087  C CE2 . PHE B  1 363 ? 134.955 98.073   34.232  1.00 53.76  ?  371 PHE B CE2 1 
ATOM 6088  C CZ  . PHE B  1 363 ? 133.625 98.057   34.601  1.00 50.48  ?  371 PHE B CZ  1 
ATOM 6089  N N   . ASP B  1 364 ? 136.229 104.522  35.296  1.00 63.11  ?  372 ASP B N   1 
ATOM 6090  C CA  . ASP B  1 364 ? 136.760 105.748  35.899  1.00 68.14  ?  372 ASP B CA  1 
ATOM 6091  C C   . ASP B  1 364 ? 135.778 106.156  37.004  1.00 61.83  ?  372 ASP B C   1 
ATOM 6092  O O   . ASP B  1 364 ? 134.787 106.839  36.744  1.00 58.53  ?  372 ASP B O   1 
ATOM 6093  C CB  . ASP B  1 364 ? 136.949 106.852  34.876  1.00 68.17  ?  372 ASP B CB  1 
ATOM 6094  C CG  . ASP B  1 364 ? 137.512 108.127  35.485  1.00 74.91  ?  372 ASP B CG  1 
ATOM 6095  O OD1 . ASP B  1 364 ? 138.031 108.073  36.619  1.00 81.27  ?  372 ASP B OD1 1 
ATOM 6096  O OD2 . ASP B  1 364 ? 137.443 109.185  34.824  1.00 73.50  -1 372 ASP B OD2 1 
ATOM 6097  N N   . LEU B  1 365 ? 136.073 105.724  38.228  1.00 57.67  ?  373 LEU B N   1 
ATOM 6098  C CA  . LEU B  1 365 ? 135.179 105.943  39.357  1.00 55.53  ?  373 LEU B CA  1 
ATOM 6099  C C   . LEU B  1 365 ? 135.371 107.341  39.932  1.00 59.25  ?  373 LEU B C   1 
ATOM 6100  O O   . LEU B  1 365 ? 136.504 107.788  40.135  1.00 67.12  ?  373 LEU B O   1 
ATOM 6101  C CB  . LEU B  1 365 ? 135.430 104.892  40.437  1.00 52.54  ?  373 LEU B CB  1 
ATOM 6102  C CG  . LEU B  1 365 ? 135.388 103.438  39.968  1.00 51.55  ?  373 LEU B CG  1 
ATOM 6103  C CD1 . LEU B  1 365 ? 135.655 102.494  41.127  1.00 52.04  ?  373 LEU B CD1 1 
ATOM 6104  C CD2 . LEU B  1 365 ? 134.048 103.133  39.323  1.00 49.42  ?  373 LEU B CD2 1 
ATOM 6105  N N   . GLN B  1 366 ? 134.260 108.029  40.195  1.00 59.32  ?  374 GLN B N   1 
ATOM 6106  C CA  . GLN B  1 366 ? 134.279 109.368  40.767  1.00 60.87  ?  374 GLN B CA  1 
ATOM 6107  C C   . GLN B  1 366 ? 133.252 109.454  41.887  1.00 59.77  ?  374 GLN B C   1 
ATOM 6108  O O   . GLN B  1 366 ? 132.159 108.889  41.785  1.00 58.46  ?  374 GLN B O   1 
ATOM 6109  C CB  . GLN B  1 366 ? 133.999 110.430  39.696  1.00 59.67  ?  374 GLN B CB  1 
ATOM 6110  C CG  . GLN B  1 366 ? 134.993 110.408  38.542  1.00 63.41  ?  374 GLN B CG  1 
ATOM 6111  C CD  . GLN B  1 366 ? 134.540 111.236  37.357  1.00 67.84  ?  374 GLN B CD  1 
ATOM 6112  O OE1 . GLN B  1 366 ? 134.214 112.415  37.495  1.00 71.70  ?  374 GLN B OE1 1 
ATOM 6113  N NE2 . GLN B  1 366 ? 134.514 110.618  36.183  1.00 67.59  ?  374 GLN B NE2 1 
ATOM 6114  N N   . PHE B  1 367 ? 133.610 110.159  42.958  1.00 55.91  ?  375 PHE B N   1 
ATOM 6115  C CA  . PHE B  1 367 ? 132.798 110.214  44.164  1.00 55.45  ?  375 PHE B CA  1 
ATOM 6116  C C   . PHE B  1 367 ? 132.868 111.599  44.789  1.00 58.02  ?  375 PHE B C   1 
ATOM 6117  O O   . PHE B  1 367 ? 133.894 112.284  44.717  1.00 60.98  ?  375 PHE B O   1 
ATOM 6118  C CB  . PHE B  1 367 ? 133.250 109.179  45.201  1.00 56.91  ?  375 PHE B CB  1 
ATOM 6119  C CG  . PHE B  1 367 ? 133.204 107.765  44.713  1.00 55.70  ?  375 PHE B CG  1 
ATOM 6120  C CD1 . PHE B  1 367 ? 132.036 107.028  44.794  1.00 53.97  ?  375 PHE B CD1 1 
ATOM 6121  C CD2 . PHE B  1 367 ? 134.335 107.165  44.187  1.00 56.44  ?  375 PHE B CD2 1 
ATOM 6122  C CE1 . PHE B  1 367 ? 131.993 105.721  44.349  1.00 52.98  ?  375 PHE B CE1 1 
ATOM 6123  C CE2 . PHE B  1 367 ? 134.300 105.858  43.741  1.00 55.42  ?  375 PHE B CE2 1 
ATOM 6124  C CZ  . PHE B  1 367 ? 133.127 105.135  43.823  1.00 53.64  ?  375 PHE B CZ  1 
ATOM 6125  N N   . ILE B  1 368 ? 131.763 111.991  45.419  1.00 59.39  ?  376 ILE B N   1 
ATOM 6126  C CA  . ILE B  1 368 ? 131.677 113.185  46.253  1.00 61.79  ?  376 ILE B CA  1 
ATOM 6127  C C   . ILE B  1 368 ? 131.270 112.737  47.649  1.00 67.54  ?  376 ILE B C   1 
ATOM 6128  O O   . ILE B  1 368 ? 130.165 112.208  47.837  1.00 59.53  ?  376 ILE B O   1 
ATOM 6129  C CB  . ILE B  1 368 ? 130.673 114.208  45.699  1.00 58.64  ?  376 ILE B CB  1 
ATOM 6130  C CG1 . ILE B  1 368 ? 131.157 114.770  44.364  1.00 58.89  ?  376 ILE B CG1 1 
ATOM 6131  C CG2 . ILE B  1 368 ? 130.466 115.334  46.695  1.00 59.95  ?  376 ILE B CG2 1 
ATOM 6132  C CD1 . ILE B  1 368 ? 132.442 115.553  44.469  1.00 61.00  ?  376 ILE B CD1 1 
ATOM 6133  N N   . PHE B  1 369 ? 132.161 112.934  48.619  1.00 63.78  ?  377 PHE B N   1 
ATOM 6134  C CA  . PHE B  1 369 ? 131.940 112.535  50.001  1.00 64.40  ?  377 PHE B CA  1 
ATOM 6135  C C   . PHE B  1 369 ? 131.679 113.754  50.878  1.00 67.68  ?  377 PHE B C   1 
ATOM 6136  O O   . PHE B  1 369 ? 132.143 114.862  50.590  1.00 70.97  ?  377 PHE B O   1 
ATOM 6137  C CB  . PHE B  1 369 ? 133.139 111.759  50.555  1.00 71.85  ?  377 PHE B CB  1 
ATOM 6138  C CG  . PHE B  1 369 ? 133.352 110.422  49.906  1.00 68.31  ?  377 PHE B CG  1 
ATOM 6139  C CD1 . PHE B  1 369 ? 132.514 109.357  50.192  1.00 64.05  ?  377 PHE B CD1 1 
ATOM 6140  C CD2 . PHE B  1 369 ? 134.394 110.229  49.015  1.00 65.61  ?  377 PHE B CD2 1 
ATOM 6141  C CE1 . PHE B  1 369 ? 132.710 108.125  49.599  1.00 59.98  ?  377 PHE B CE1 1 
ATOM 6142  C CE2 . PHE B  1 369 ? 134.596 109.000  48.421  1.00 62.91  ?  377 PHE B CE2 1 
ATOM 6143  C CZ  . PHE B  1 369 ? 133.751 107.947  48.711  1.00 60.37  ?  377 PHE B CZ  1 
ATOM 6144  N N   . GLN B  1 370 ? 130.938 113.530  51.962  1.00 61.41  ?  378 GLN B N   1 
ATOM 6145  C CA  . GLN B  1 370 ? 130.568 114.573  52.911  1.00 60.92  ?  378 GLN B CA  1 
ATOM 6146  C C   . GLN B  1 370 ? 131.048 114.193  54.304  1.00 63.70  ?  378 GLN B C   1 
ATOM 6147  O O   . GLN B  1 370 ? 130.811 113.070  54.763  1.00 62.67  ?  378 GLN B O   1 
ATOM 6148  C CB  . GLN B  1 370 ? 129.056 114.794  52.922  1.00 64.12  ?  378 GLN B CB  1 
ATOM 6149  C CG  . GLN B  1 370 ? 128.582 115.773  53.979  1.00 67.50  ?  378 GLN B CG  1 
ATOM 6150  C CD  . GLN B  1 370 ? 127.088 116.016  53.914  1.00 66.85  ?  378 GLN B CD  1 
ATOM 6151  O OE1 . GLN B  1 370 ? 126.318 115.126  53.552  1.00 65.09  ?  378 GLN B OE1 1 
ATOM 6152  N NE2 . GLN B  1 370 ? 126.670 117.228  54.263  1.00 67.64  ?  378 GLN B NE2 1 
ATOM 6153  N N   . LEU B  1 371 ? 131.714 115.130  54.974  1.00 61.07  ?  379 LEU B N   1 
ATOM 6154  C CA  . LEU B  1 371 ? 132.207 114.902  56.325  1.00 64.83  ?  379 LEU B CA  1 
ATOM 6155  C C   . LEU B  1 371 ? 131.071 115.026  57.335  1.00 64.61  ?  379 LEU B C   1 
ATOM 6156  O O   . LEU B  1 371 ? 130.212 115.905  57.218  1.00 64.91  ?  379 LEU B O   1 
ATOM 6157  C CB  . LEU B  1 371 ? 133.321 115.896  56.654  1.00 58.43  ?  379 LEU B CB  1 
ATOM 6158  C CG  . LEU B  1 371 ? 134.066 115.676  57.968  1.00 62.50  ?  379 LEU B CG  1 
ATOM 6159  C CD1 . LEU B  1 371 ? 134.634 114.269  58.015  1.00 62.18  ?  379 LEU B CD1 1 
ATOM 6160  C CD2 . LEU B  1 371 ? 135.166 116.711  58.135  1.00 77.07  ?  379 LEU B CD2 1 
ATOM 6161  N N   . CYS B  1 372 ? 131.068 114.138  58.329  1.00 64.13  ?  380 CYS B N   1 
ATOM 6162  C CA  . CYS B  1 372 ? 129.986 114.072  59.303  1.00 63.27  ?  380 CYS B CA  1 
ATOM 6163  C C   . CYS B  1 372 ? 130.547 113.920  60.711  1.00 68.26  ?  380 CYS B C   1 
ATOM 6164  O O   . CYS B  1 372 ? 131.662 113.431  60.912  1.00 70.10  ?  380 CYS B O   1 
ATOM 6165  C CB  . CYS B  1 372 ? 129.025 112.916  58.999  1.00 66.44  ?  380 CYS B CB  1 
ATOM 6166  S SG  . CYS B  1 372 ? 128.226 113.017  57.385  1.00 63.68  ?  380 CYS B SG  1 
ATOM 6167  N N   . LYS B  1 373 ? 129.748 114.346  61.688  1.00 67.24  ?  381 LYS B N   1 
ATOM 6168  C CA  . LYS B  1 373 ? 130.073 114.226  63.101  1.00 71.19  ?  381 LYS B CA  1 
ATOM 6169  C C   . LYS B  1 373 ? 129.164 113.195  63.756  1.00 70.59  ?  381 LYS B C   1 
ATOM 6170  O O   . LYS B  1 373 ? 128.019 113.000  63.340  1.00 66.40  ?  381 LYS B O   1 
ATOM 6171  C CB  . LYS B  1 373 ? 129.898 115.558  63.837  1.00 68.50  ?  381 LYS B CB  1 
ATOM 6172  C CG  . LYS B  1 373 ? 130.503 116.768  63.161  1.00 69.01  ?  381 LYS B CG  1 
ATOM 6173  C CD  . LYS B  1 373 ? 130.220 118.018  63.983  1.00 70.74  ?  381 LYS B CD  1 
ATOM 6174  C CE  . LYS B  1 373 ? 130.430 119.281  63.168  1.00 70.80  ?  381 LYS B CE  1 
ATOM 6175  N NZ  . LYS B  1 373 ? 130.123 120.508  63.953  1.00 72.53  1  381 LYS B NZ  1 
ATOM 6176  N N   . ILE B  1 374 ? 129.686 112.536  64.789  1.00 70.07  ?  382 ILE B N   1 
ATOM 6177  C CA  . ILE B  1 374 ? 128.907 111.617  65.614  1.00 70.09  ?  382 ILE B CA  1 
ATOM 6178  C C   . ILE B  1 374 ? 129.251 111.921  67.066  1.00 74.79  ?  382 ILE B C   1 
ATOM 6179  O O   . ILE B  1 374 ? 130.344 111.577  67.531  1.00 78.01  ?  382 ILE B O   1 
ATOM 6180  C CB  . ILE B  1 374 ? 129.189 110.142  65.294  1.00 73.03  ?  382 ILE B CB  1 
ATOM 6181  C CG1 . ILE B  1 374 ? 128.776 109.813  63.860  1.00 68.06  ?  382 ILE B CG1 1 
ATOM 6182  C CG2 . ILE B  1 374 ? 128.453 109.238  66.274  1.00 73.75  ?  382 ILE B CG2 1 
ATOM 6183  C CD1 . ILE B  1 374 ? 129.030 108.374  63.474  1.00 66.35  ?  382 ILE B CD1 1 
ATOM 6184  N N   . THR B  1 375 ? 128.332 112.564  67.781  1.00 73.13  ?  383 THR B N   1 
ATOM 6185  C CA  . THR B  1 375 ? 128.540 112.856  69.196  1.00 76.51  ?  383 THR B CA  1 
ATOM 6186  C C   . THR B  1 375 ? 128.361 111.574  70.001  1.00 77.07  ?  383 THR B C   1 
ATOM 6187  O O   . THR B  1 375 ? 127.253 111.035  70.087  1.00 74.91  ?  383 THR B O   1 
ATOM 6188  C CB  . THR B  1 375 ? 127.577 113.942  69.663  1.00 70.65  ?  383 THR B CB  1 
ATOM 6189  O OG1 . THR B  1 375 ? 127.783 115.128  68.885  1.00 70.13  ?  383 THR B OG1 1 
ATOM 6190  C CG2 . THR B  1 375 ? 127.814 114.262  71.130  1.00 75.65  ?  383 THR B CG2 1 
ATOM 6191  N N   . LEU B  1 376 ? 129.452 111.080  70.589  1.00 74.92  ?  384 LEU B N   1 
ATOM 6192  C CA  . LEU B  1 376 ? 129.453 109.784  71.267  1.00 75.75  ?  384 LEU B CA  1 
ATOM 6193  C C   . LEU B  1 376 ? 128.828 109.929  72.652  1.00 78.98  ?  384 LEU B C   1 
ATOM 6194  O O   . LEU B  1 376 ? 129.502 109.980  73.683  1.00 83.94  ?  384 LEU B O   1 
ATOM 6195  C CB  . LEU B  1 376 ? 130.867 109.224  71.347  1.00 84.28  ?  384 LEU B CB  1 
ATOM 6196  C CG  . LEU B  1 376 ? 131.500 108.835  70.010  1.00 79.72  ?  384 LEU B CG  1 
ATOM 6197  C CD1 . LEU B  1 376 ? 132.911 108.304  70.217  1.00 91.53  ?  384 LEU B CD1 1 
ATOM 6198  C CD2 . LEU B  1 376 ? 130.634 107.812  69.292  1.00 75.00  ?  384 LEU B CD2 1 
ATOM 6199  N N   . THR B  1 377 ? 127.501 110.001  72.663  1.00 82.63  ?  385 THR B N   1 
ATOM 6200  C CA  . THR B  1 377 ? 126.727 109.980  73.892  1.00 80.39  ?  385 THR B CA  1 
ATOM 6201  C C   . THR B  1 377 ? 126.582 108.535  74.370  1.00 81.02  ?  385 THR B C   1 
ATOM 6202  O O   . THR B  1 377 ? 127.063 107.593  73.736  1.00 79.18  ?  385 THR B O   1 
ATOM 6203  C CB  . THR B  1 377 ? 125.359 110.621  73.657  1.00 75.28  ?  385 THR B CB  1 
ATOM 6204  O OG1 . THR B  1 377 ? 125.486 111.680  72.701  1.00 73.90  ?  385 THR B OG1 1 
ATOM 6205  C CG2 . THR B  1 377 ? 124.794 111.200  74.943  1.00 77.62  ?  385 THR B CG2 1 
ATOM 6206  N N   . THR B  1 378 ? 125.926 108.350  75.512  1.00 95.80  ?  386 THR B N   1 
ATOM 6207  C CA  . THR B  1 378 ? 125.334 107.054  75.801  1.00 91.97  ?  386 THR B CA  1 
ATOM 6208  C C   . THR B  1 378 ? 124.105 106.878  74.906  1.00 91.07  ?  386 THR B C   1 
ATOM 6209  O O   . THR B  1 378 ? 123.779 107.742  74.086  1.00 83.71  ?  386 THR B O   1 
ATOM 6210  C CB  . THR B  1 378 ? 125.000 106.932  77.287  1.00 90.41  ?  386 THR B CB  1 
ATOM 6211  O OG1 . THR B  1 378 ? 124.111 107.986  77.672  1.00 90.99  ?  386 THR B OG1 1 
ATOM 6212  C CG2 . THR B  1 378 ? 126.269 107.013  78.125  1.00 95.85  ?  386 THR B CG2 1 
ATOM 6213  N N   . GLU B  1 379 ? 123.422 105.737  75.042  1.00 96.01  ?  387 GLU B N   1 
ATOM 6214  C CA  . GLU B  1 379 ? 122.363 105.359  74.105  1.00 93.61  ?  387 GLU B CA  1 
ATOM 6215  C C   . GLU B  1 379 ? 122.946 105.236  72.700  1.00 91.33  ?  387 GLU B C   1 
ATOM 6216  O O   . GLU B  1 379 ? 122.915 104.156  72.102  1.00 87.02  ?  387 GLU B O   1 
ATOM 6217  C CB  . GLU B  1 379 ? 121.198 106.356  74.133  1.00 94.51  ?  387 GLU B CB  1 
ATOM 6218  C CG  . GLU B  1 379 ? 120.562 106.528  75.501  1.00 103.00 ?  387 GLU B CG  1 
ATOM 6219  C CD  . GLU B  1 379 ? 119.607 105.400  75.837  1.00 108.27 ?  387 GLU B CD  1 
ATOM 6220  O OE1 . GLU B  1 379 ? 118.380 105.607  75.728  1.00 112.37 ?  387 GLU B OE1 1 
ATOM 6221  O OE2 . GLU B  1 379 ? 120.082 104.302  76.196  1.00 107.45 -1 387 GLU B OE2 1 
ATOM 6222  N N   . VAL B  1 380 ? 123.477 106.338  72.166  1.00 87.91  ?  388 VAL B N   1 
ATOM 6223  C CA  . VAL B  1 380 ? 124.418 106.282  71.053  1.00 83.30  ?  388 VAL B CA  1 
ATOM 6224  C C   . VAL B  1 380 ? 125.646 105.535  71.565  1.00 87.01  ?  388 VAL B C   1 
ATOM 6225  O O   . VAL B  1 380 ? 125.783 105.311  72.773  1.00 95.02  ?  388 VAL B O   1 
ATOM 6226  C CB  . VAL B  1 380 ? 124.774 107.694  70.546  1.00 77.90  ?  388 VAL B CB  1 
ATOM 6227  C CG1 . VAL B  1 380 ? 125.430 107.642  69.168  1.00 75.93  ?  388 VAL B CG1 1 
ATOM 6228  C CG2 . VAL B  1 380 ? 123.537 108.581  70.523  1.00 77.06  ?  388 VAL B CG2 1 
ATOM 6229  N N   . MET B  1 381 ? 126.532 105.124  70.656  1.00 80.06  ?  389 MET B N   1 
ATOM 6230  C CA  . MET B  1 381 ? 127.738 104.370  70.995  1.00 86.03  ?  389 MET B CA  1 
ATOM 6231  C C   . MET B  1 381 ? 127.383 102.978  71.512  1.00 87.80  ?  389 MET B C   1 
ATOM 6232  O O   . MET B  1 381 ? 127.936 101.982  71.036  1.00 87.80  ?  389 MET B O   1 
ATOM 6233  C CB  . MET B  1 381 ? 128.600 105.132  72.010  1.00 89.03  ?  389 MET B CB  1 
ATOM 6234  C CG  . MET B  1 381 ? 129.435 104.249  72.923  1.00 96.51  ?  389 MET B CG  1 
ATOM 6235  S SD  . MET B  1 381 ? 130.459 105.211  74.053  1.00 105.10 ?  389 MET B SD  1 
ATOM 6236  C CE  . MET B  1 381 ? 131.690 105.856  72.923  1.00 104.91 ?  389 MET B CE  1 
ATOM 6237  N N   . SER B  1 382 ? 126.464 102.890  72.479  1.00 90.74  ?  390 SER B N   1 
ATOM 6238  C CA  . SER B  1 382 ? 125.908 101.589  72.839  1.00 90.87  ?  390 SER B CA  1 
ATOM 6239  C C   . SER B  1 382 ? 125.060 101.030  71.703  1.00 81.89  ?  390 SER B C   1 
ATOM 6240  O O   . SER B  1 382 ? 125.073 99.820   71.444  1.00 76.05  ?  390 SER B O   1 
ATOM 6241  C CB  . SER B  1 382 ? 125.089 101.702  74.123  1.00 96.33  ?  390 SER B CB  1 
ATOM 6242  O OG  . SER B  1 382 ? 123.823 102.285  73.870  1.00 96.56  ?  390 SER B OG  1 
ATOM 6243  N N   . TYR B  1 383 ? 124.313 101.899  71.018  1.00 86.55  ?  391 TYR B N   1 
ATOM 6244  C CA  . TYR B  1 383 ? 123.647 101.496  69.785  1.00 81.31  ?  391 TYR B CA  1 
ATOM 6245  C C   . TYR B  1 383 ? 124.666 101.141  68.711  1.00 79.33  ?  391 TYR B C   1 
ATOM 6246  O O   . TYR B  1 383 ? 124.491 100.163  67.973  1.00 76.57  ?  391 TYR B O   1 
ATOM 6247  C CB  . TYR B  1 383 ? 122.718 102.613  69.307  1.00 82.94  ?  391 TYR B CB  1 
ATOM 6248  C CG  . TYR B  1 383 ? 122.203 102.442  67.897  1.00 77.77  ?  391 TYR B CG  1 
ATOM 6249  C CD1 . TYR B  1 383 ? 121.102 101.639  67.632  1.00 75.38  ?  391 TYR B CD1 1 
ATOM 6250  C CD2 . TYR B  1 383 ? 122.806 103.099  66.834  1.00 75.53  ?  391 TYR B CD2 1 
ATOM 6251  C CE1 . TYR B  1 383 ? 120.625 101.485  66.345  1.00 70.91  ?  391 TYR B CE1 1 
ATOM 6252  C CE2 . TYR B  1 383 ? 122.337 102.950  65.545  1.00 71.06  ?  391 TYR B CE2 1 
ATOM 6253  C CZ  . TYR B  1 383 ? 121.246 102.144  65.305  1.00 68.77  ?  391 TYR B CZ  1 
ATOM 6254  O OH  . TYR B  1 383 ? 120.779 101.998  64.020  1.00 67.01  ?  391 TYR B OH  1 
ATOM 6255  N N   . ILE B  1 384 ? 125.736 101.931  68.605  1.00 78.16  ?  392 ILE B N   1 
ATOM 6256  C CA  . ILE B  1 384 ? 126.813 101.618  67.671  1.00 77.00  ?  392 ILE B CA  1 
ATOM 6257  C C   . ILE B  1 384 ? 127.503 100.320  68.071  1.00 84.72  ?  392 ILE B C   1 
ATOM 6258  O O   . ILE B  1 384 ? 127.904 99.522   67.215  1.00 86.21  ?  392 ILE B O   1 
ATOM 6259  C CB  . ILE B  1 384 ? 127.806 102.793  67.596  1.00 72.56  ?  392 ILE B CB  1 
ATOM 6260  C CG1 . ILE B  1 384 ? 127.115 104.036  67.032  1.00 71.01  ?  392 ILE B CG1 1 
ATOM 6261  C CG2 . ILE B  1 384 ? 129.016 102.422  66.758  1.00 72.35  ?  392 ILE B CG2 1 
ATOM 6262  C CD1 . ILE B  1 384 ? 128.038 105.225  66.859  1.00 71.93  ?  392 ILE B CD1 1 
ATOM 6263  N N   . HIS B  1 385 ? 127.647 100.084  69.378  1.00 85.58  ?  393 HIS B N   1 
ATOM 6264  C CA  . HIS B  1 385 ? 128.247 98.840   69.850  1.00 88.26  ?  393 HIS B CA  1 
ATOM 6265  C C   . HIS B  1 385 ? 127.393 97.641   69.458  1.00 85.30  ?  393 HIS B C   1 
ATOM 6266  O O   . HIS B  1 385 ? 127.909 96.626   68.975  1.00 84.75  ?  393 HIS B O   1 
ATOM 6267  C CB  . HIS B  1 385 ? 128.434 98.891   71.367  1.00 86.04  ?  393 HIS B CB  1 
ATOM 6268  C CG  . HIS B  1 385 ? 129.050 97.655   71.945  1.00 96.15  ?  393 HIS B CG  1 
ATOM 6269  N ND1 . HIS B  1 385 ? 128.303 96.566   72.339  1.00 98.72  ?  393 HIS B ND1 1 
ATOM 6270  C CD2 . HIS B  1 385 ? 130.339 97.348   72.225  1.00 100.43 ?  393 HIS B CD2 1 
ATOM 6271  C CE1 . HIS B  1 385 ? 129.106 95.633   72.817  1.00 101.88 ?  393 HIS B CE1 1 
ATOM 6272  N NE2 . HIS B  1 385 ? 130.346 96.084   72.764  1.00 103.57 ?  393 HIS B NE2 1 
ATOM 6273  N N   . ASN B  1 386 ? 126.077 97.738   69.664  1.00 95.03  ?  394 ASN B N   1 
ATOM 6274  C CA  . ASN B  1 386 ? 125.188 96.661   69.243  1.00 92.49  ?  394 ASN B CA  1 
ATOM 6275  C C   . ASN B  1 386 ? 125.166 96.515   67.726  1.00 87.75  ?  394 ASN B C   1 
ATOM 6276  O O   . ASN B  1 386 ? 124.896 95.424   67.212  1.00 86.20  ?  394 ASN B O   1 
ATOM 6277  C CB  . ASN B  1 386 ? 123.777 96.905   69.779  1.00 95.22  ?  394 ASN B CB  1 
ATOM 6278  C CG  . ASN B  1 386 ? 122.897 95.674   69.681  1.00 94.78  ?  394 ASN B CG  1 
ATOM 6279  O OD1 . ASN B  1 386 ? 122.825 94.873   70.613  1.00 98.04  ?  394 ASN B OD1 1 
ATOM 6280  N ND2 . ASN B  1 386 ? 122.219 95.519   68.549  1.00 91.23  ?  394 ASN B ND2 1 
ATOM 6281  N N   . MET B  1 387 ? 125.441 97.598   66.998  1.00 90.53  ?  395 MET B N   1 
ATOM 6282  C CA  . MET B  1 387 ? 125.518 97.523   65.543  1.00 82.92  ?  395 MET B CA  1 
ATOM 6283  C C   . MET B  1 387 ? 126.796 96.822   65.100  1.00 79.16  ?  395 MET B C   1 
ATOM 6284  O O   . MET B  1 387 ? 126.754 95.759   64.469  1.00 73.70  ?  395 MET B O   1 
ATOM 6285  C CB  . MET B  1 387 ? 125.433 98.931   64.952  1.00 83.93  ?  395 MET B CB  1 
ATOM 6286  C CG  . MET B  1 387 ? 125.505 98.993   63.438  1.00 79.65  ?  395 MET B CG  1 
ATOM 6287  S SD  . MET B  1 387 ? 125.244 100.669  62.821  1.00 77.65  ?  395 MET B SD  1 
ATOM 6288  C CE  . MET B  1 387 ? 125.395 100.405  61.055  1.00 76.01  ?  395 MET B CE  1 
ATOM 6289  N N   . ASN B  1 388 ? 127.946 97.402   65.435  1.00 78.00  ?  396 ASN B N   1 
ATOM 6290  C CA  . ASN B  1 388 ? 129.243 96.825   65.094  1.00 79.42  ?  396 ASN B CA  1 
ATOM 6291  C C   . ASN B  1 388 ? 130.231 97.259   66.166  1.00 87.68  ?  396 ASN B C   1 
ATOM 6292  O O   . ASN B  1 388 ? 130.606 98.436   66.225  1.00 95.55  ?  396 ASN B O   1 
ATOM 6293  C CB  . ASN B  1 388 ? 129.708 97.270   63.710  1.00 82.07  ?  396 ASN B CB  1 
ATOM 6294  C CG  . ASN B  1 388 ? 129.588 96.169   62.669  1.00 79.78  ?  396 ASN B CG  1 
ATOM 6295  O OD1 . ASN B  1 388 ? 128.835 96.293   61.701  1.00 76.52  ?  396 ASN B OD1 1 
ATOM 6296  N ND2 . ASN B  1 388 ? 130.336 95.089   62.859  1.00 79.56  ?  396 ASN B ND2 1 
ATOM 6297  N N   . THR B  1 389 ? 130.637 96.314   67.018  1.00 83.33  ?  397 THR B N   1 
ATOM 6298  C CA  . THR B  1 389 ? 131.623 96.614   68.050  1.00 92.21  ?  397 THR B CA  1 
ATOM 6299  C C   . THR B  1 389 ? 132.917 97.139   67.449  1.00 93.07  ?  397 THR B C   1 
ATOM 6300  O O   . THR B  1 389 ? 133.582 97.996   68.046  1.00 95.72  ?  397 THR B O   1 
ATOM 6301  C CB  . THR B  1 389 ? 131.906 95.355   68.864  1.00 104.88 ?  397 THR B CB  1 
ATOM 6302  O OG1 . THR B  1 389 ? 132.051 94.245   67.967  1.00 102.04 ?  397 THR B OG1 1 
ATOM 6303  C CG2 . THR B  1 389 ? 130.751 95.083   69.803  1.00 107.30 ?  397 THR B CG2 1 
ATOM 6304  N N   . THR B  1 390 ? 133.266 96.655   66.257  1.00 89.73  ?  398 THR B N   1 
ATOM 6305  C CA  . THR B  1 390 ? 134.499 97.042   65.591  1.00 85.64  ?  398 THR B CA  1 
ATOM 6306  C C   . THR B  1 390 ? 134.489 98.493   65.127  1.00 82.97  ?  398 THR B C   1 
ATOM 6307  O O   . THR B  1 390 ? 135.553 99.031   64.805  1.00 84.58  ?  398 THR B O   1 
ATOM 6308  C CB  . THR B  1 390 ? 134.753 96.107   64.408  1.00 85.41  ?  398 THR B CB  1 
ATOM 6309  O OG1 . THR B  1 390 ? 135.854 96.596   63.632  1.00 93.36  ?  398 THR B OG1 1 
ATOM 6310  C CG2 . THR B  1 390 ? 133.508 96.002   63.531  1.00 77.30  ?  398 THR B CG2 1 
ATOM 6311  N N   . ILE B  1 391 ? 133.320 99.134   65.060  1.00 82.74  ?  399 ILE B N   1 
ATOM 6312  C CA  . ILE B  1 391 ? 133.281 100.561  64.753  1.00 80.10  ?  399 ILE B CA  1 
ATOM 6313  C C   . ILE B  1 391 ? 133.904 101.357  65.891  1.00 86.06  ?  399 ILE B C   1 
ATOM 6314  O O   . ILE B  1 391 ? 134.786 102.197  65.678  1.00 85.61  ?  399 ILE B O   1 
ATOM 6315  C CB  . ILE B  1 391 ? 131.839 101.019  64.474  1.00 80.91  ?  399 ILE B CB  1 
ATOM 6316  C CG1 . ILE B  1 391 ? 131.329 100.424  63.163  1.00 75.27  ?  399 ILE B CG1 1 
ATOM 6317  C CG2 . ILE B  1 391 ? 131.772 102.536  64.418  1.00 82.20  ?  399 ILE B CG2 1 
ATOM 6318  C CD1 . ILE B  1 391 ? 129.908 100.827  62.828  1.00 71.38  ?  399 ILE B CD1 1 
ATOM 6319  N N   . LEU B  1 392 ? 133.448 101.104  67.120  1.00 80.25  ?  400 LEU B N   1 
ATOM 6320  C CA  . LEU B  1 392 ? 134.061 101.732  68.284  1.00 89.23  ?  400 LEU B CA  1 
ATOM 6321  C C   . LEU B  1 392 ? 135.494 101.254  68.468  1.00 96.53  ?  400 LEU B C   1 
ATOM 6322  O O   . LEU B  1 392 ? 136.371 102.037  68.850  1.00 96.29  ?  400 LEU B O   1 
ATOM 6323  C CB  . LEU B  1 392 ? 133.240 101.436  69.537  1.00 93.53  ?  400 LEU B CB  1 
ATOM 6324  C CG  . LEU B  1 392 ? 131.831 102.021  69.606  1.00 91.21  ?  400 LEU B CG  1 
ATOM 6325  C CD1 . LEU B  1 392 ? 131.129 101.531  70.859  1.00 95.77  ?  400 LEU B CD1 1 
ATOM 6326  C CD2 . LEU B  1 392 ? 131.883 103.540  69.571  1.00 89.41  ?  400 LEU B CD2 1 
ATOM 6327  N N   . GLU B  1 393 ? 135.744 99.965   68.217  1.00 94.14  ?  401 GLU B N   1 
ATOM 6328  C CA  . GLU B  1 393 ? 137.097 99.435   68.354  1.00 101.67 ?  401 GLU B CA  1 
ATOM 6329  C C   . GLU B  1 393 ? 138.078 100.153  67.430  1.00 98.27  ?  401 GLU B C   1 
ATOM 6330  O O   . GLU B  1 393 ? 139.198 100.474  67.839  1.00 102.97 ?  401 GLU B O   1 
ATOM 6331  C CB  . GLU B  1 393 ? 137.102 97.931   68.082  1.00 104.80 ?  401 GLU B CB  1 
ATOM 6332  C CG  . GLU B  1 393 ? 138.467 97.270   68.220  1.00 114.30 ?  401 GLU B CG  1 
ATOM 6333  C CD  . GLU B  1 393 ? 138.931 97.167   69.663  1.00 124.91 ?  401 GLU B CD  1 
ATOM 6334  O OE1 . GLU B  1 393 ? 138.967 96.036   70.193  1.00 129.06 ?  401 GLU B OE1 1 
ATOM 6335  O OE2 . GLU B  1 393 ? 139.242 98.212   70.273  1.00 129.03 -1 401 GLU B OE2 1 
ATOM 6336  N N   . ASP B  1 394 ? 137.681 100.422  66.183  1.00 95.20  ?  402 ASP B N   1 
ATOM 6337  C CA  . ASP B  1 394 ? 138.578 101.139  65.282  1.00 92.64  ?  402 ASP B CA  1 
ATOM 6338  C C   . ASP B  1 394 ? 138.688 102.614  65.639  1.00 92.82  ?  402 ASP B C   1 
ATOM 6339  O O   . ASP B  1 394 ? 139.659 103.263  65.241  1.00 94.52  ?  402 ASP B O   1 
ATOM 6340  C CB  . ASP B  1 394 ? 138.122 100.987  63.831  1.00 93.63  ?  402 ASP B CB  1 
ATOM 6341  C CG  . ASP B  1 394 ? 138.402 99.606   63.280  1.00 91.17  ?  402 ASP B CG  1 
ATOM 6342  O OD1 . ASP B  1 394 ? 138.803 98.731   64.084  1.00 94.12  ?  402 ASP B OD1 1 
ATOM 6343  O OD2 . ASP B  1 394 ? 138.196 99.397   62.058  1.00 85.43  -1 402 ASP B OD2 1 
ATOM 6344  N N   . TRP B  1 395 ? 137.714 103.157  66.369  1.00 89.83  ?  403 TRP B N   1 
ATOM 6345  C CA  . TRP B  1 395 ? 137.817 104.516  66.882  1.00 91.20  ?  403 TRP B CA  1 
ATOM 6346  C C   . TRP B  1 395 ? 138.584 104.499  68.196  1.00 98.29  ?  403 TRP B C   1 
ATOM 6347  O O   . TRP B  1 395 ? 139.512 103.701  68.366  1.00 100.43 ?  403 TRP B O   1 
ATOM 6348  C CB  . TRP B  1 395 ? 136.428 105.130  67.084  1.00 95.87  ?  403 TRP B CB  1 
ATOM 6349  C CG  . TRP B  1 395 ? 135.729 105.546  65.821  1.00 86.97  ?  403 TRP B CG  1 
ATOM 6350  C CD1 . TRP B  1 395 ? 136.301 105.792  64.606  1.00 80.84  ?  403 TRP B CD1 1 
ATOM 6351  C CD2 . TRP B  1 395 ? 134.320 105.752  65.650  1.00 81.95  ?  403 TRP B CD2 1 
ATOM 6352  N NE1 . TRP B  1 395 ? 135.337 106.147  63.692  1.00 75.90  ?  403 TRP B NE1 1 
ATOM 6353  C CE2 . TRP B  1 395 ? 134.112 106.129  64.308  1.00 77.06  ?  403 TRP B CE2 1 
ATOM 6354  C CE3 . TRP B  1 395 ? 133.215 105.658  66.502  1.00 83.06  ?  403 TRP B CE3 1 
ATOM 6355  C CZ2 . TRP B  1 395 ? 132.845 106.410  63.800  1.00 75.36  ?  403 TRP B CZ2 1 
ATOM 6356  C CZ3 . TRP B  1 395 ? 131.958 105.938  65.995  1.00 74.37  ?  403 TRP B CZ3 1 
ATOM 6357  C CH2 . TRP B  1 395 ? 131.783 106.309  64.657  1.00 70.19  ?  403 TRP B CH2 1 
ATOM 6358  N N   . ASN B  1 396 ? 138.201 105.360  69.132  1.00 89.29  ?  404 ASN B N   1 
ATOM 6359  C CA  . ASN B  1 396 ? 138.865 105.433  70.428  1.00 96.29  ?  404 ASN B CA  1 
ATOM 6360  C C   . ASN B  1 396 ? 137.893 105.885  71.516  1.00 94.12  ?  404 ASN B C   1 
ATOM 6361  O O   . ASN B  1 396 ? 136.694 105.609  71.448  1.00 90.57  ?  404 ASN B O   1 
ATOM 6362  C CB  . ASN B  1 396 ? 140.067 106.382  70.368  1.00 104.84 ?  404 ASN B CB  1 
ATOM 6363  C CG  . ASN B  1 396 ? 141.240 105.795  69.603  1.00 105.27 ?  404 ASN B CG  1 
ATOM 6364  O OD1 . ASN B  1 396 ? 141.644 104.656  69.839  1.00 108.19 ?  404 ASN B OD1 1 
ATOM 6365  N ND2 . ASN B  1 396 ? 141.791 106.573  68.677  1.00 102.37 ?  404 ASN B ND2 1 
ATOM 6366  N N   . GLN B  1 431 ? 142.582 92.943   62.124  1.00 124.76 ?  439 GLN B N   1 
ATOM 6367  C CA  . GLN B  1 431 ? 142.191 91.961   61.119  1.00 121.02 ?  439 GLN B CA  1 
ATOM 6368  C C   . GLN B  1 431 ? 140.910 92.385   60.399  1.00 111.90 ?  439 GLN B C   1 
ATOM 6369  O O   . GLN B  1 431 ? 140.235 93.325   60.819  1.00 107.22 ?  439 GLN B O   1 
ATOM 6370  C CB  . GLN B  1 431 ? 142.021 90.584   61.764  1.00 130.65 ?  439 GLN B CB  1 
ATOM 6371  C CG  . GLN B  1 431 ? 140.953 90.524   62.839  1.00 129.49 ?  439 GLN B CG  1 
ATOM 6372  C CD  . GLN B  1 431 ? 140.942 89.196   63.569  1.00 131.66 ?  439 GLN B CD  1 
ATOM 6373  O OE1 . GLN B  1 431 ? 141.778 88.328   63.315  1.00 133.59 ?  439 GLN B OE1 1 
ATOM 6374  N NE2 . GLN B  1 431 ? 139.998 89.033   64.488  1.00 131.78 ?  439 GLN B NE2 1 
ATOM 6375  N N   . ASP B  1 432 ? 140.577 91.678   59.316  1.00 107.88 ?  440 ASP B N   1 
ATOM 6376  C CA  . ASP B  1 432 ? 139.460 92.047   58.457  1.00 98.71  ?  440 ASP B CA  1 
ATOM 6377  C C   . ASP B  1 432 ? 138.836 90.805   57.834  1.00 96.69  ?  440 ASP B C   1 
ATOM 6378  O O   . ASP B  1 432 ? 139.559 90.007   57.216  1.00 97.75  ?  440 ASP B O   1 
ATOM 6379  C CB  . ASP B  1 432 ? 139.913 93.008   57.357  1.00 96.74  ?  440 ASP B CB  1 
ATOM 6380  C CG  . ASP B  1 432 ? 138.866 93.198   56.278  1.00 91.34  ?  440 ASP B CG  1 
ATOM 6381  O OD1 . ASP B  1 432 ? 137.713 93.535   56.615  1.00 91.49  ?  440 ASP B OD1 1 
ATOM 6382  O OD2 . ASP B  1 432 ? 139.200 93.013   55.088  1.00 88.99  -1 440 ASP B OD2 1 
ATOM 6383  N N   . PRO B  1 433 ? 137.519 90.619   57.966  1.00 95.79  ?  441 PRO B N   1 
ATOM 6384  C CA  . PRO B  1 433 ? 136.878 89.418   57.410  1.00 93.60  ?  441 PRO B CA  1 
ATOM 6385  C C   . PRO B  1 433 ? 136.675 89.451   55.904  1.00 89.35  ?  441 PRO B C   1 
ATOM 6386  O O   . PRO B  1 433 ? 136.291 88.422   55.332  1.00 90.25  ?  441 PRO B O   1 
ATOM 6387  C CB  . PRO B  1 433 ? 135.529 89.383   58.139  1.00 87.53  ?  441 PRO B CB  1 
ATOM 6388  C CG  . PRO B  1 433 ? 135.232 90.820   58.410  1.00 86.86  ?  441 PRO B CG  1 
ATOM 6389  C CD  . PRO B  1 433 ? 136.565 91.464   58.706  1.00 91.28  ?  441 PRO B CD  1 
ATOM 6390  N N   . TYR B  1 434 ? 136.920 90.582   55.243  1.00 84.46  ?  442 TYR B N   1 
ATOM 6391  C CA  . TYR B  1 434 ? 136.608 90.722   53.828  1.00 80.06  ?  442 TYR B CA  1 
ATOM 6392  C C   . TYR B  1 434 ? 137.797 90.463   52.912  1.00 86.90  ?  442 TYR B C   1 
ATOM 6393  O O   . TYR B  1 434 ? 137.616 90.428   51.690  1.00 84.88  ?  442 TYR B O   1 
ATOM 6394  C CB  . TYR B  1 434 ? 136.049 92.121   53.545  1.00 78.74  ?  442 TYR B CB  1 
ATOM 6395  C CG  . TYR B  1 434 ? 134.717 92.389   54.206  1.00 72.37  ?  442 TYR B CG  1 
ATOM 6396  C CD1 . TYR B  1 434 ? 133.823 91.355   54.450  1.00 69.01  ?  442 TYR B CD1 1 
ATOM 6397  C CD2 . TYR B  1 434 ? 134.354 93.673   54.585  1.00 70.23  ?  442 TYR B CD2 1 
ATOM 6398  C CE1 . TYR B  1 434 ? 132.605 91.592   55.053  1.00 65.10  ?  442 TYR B CE1 1 
ATOM 6399  C CE2 . TYR B  1 434 ? 133.138 93.920   55.189  1.00 66.84  ?  442 TYR B CE2 1 
ATOM 6400  C CZ  . TYR B  1 434 ? 132.267 92.876   55.420  1.00 65.70  ?  442 TYR B CZ  1 
ATOM 6401  O OH  . TYR B  1 434 ? 131.053 93.118   56.022  1.00 67.74  ?  442 TYR B OH  1 
ATOM 6402  N N   . ASP B  1 435 ? 139.001 90.279   53.457  1.00 95.17  ?  443 ASP B N   1 
ATOM 6403  C CA  . ASP B  1 435 ? 140.138 89.942   52.610  1.00 100.00 ?  443 ASP B CA  1 
ATOM 6404  C C   . ASP B  1 435 ? 140.109 88.489   52.158  1.00 95.49  ?  443 ASP B C   1 
ATOM 6405  O O   . ASP B  1 435 ? 140.905 88.108   51.293  1.00 98.25  ?  443 ASP B O   1 
ATOM 6406  C CB  . ASP B  1 435 ? 141.457 90.238   53.327  1.00 114.97 ?  443 ASP B CB  1 
ATOM 6407  C CG  . ASP B  1 435 ? 142.626 90.363   52.362  1.00 119.17 ?  443 ASP B CG  1 
ATOM 6408  O OD1 . ASP B  1 435 ? 142.393 90.744   51.194  1.00 116.88 ?  443 ASP B OD1 1 
ATOM 6409  O OD2 . ASP B  1 435 ? 143.774 90.081   52.766  1.00 122.84 -1 443 ASP B OD2 1 
ATOM 6410  N N   . LYS B  1 436 ? 139.209 87.678   52.716  1.00 89.06  ?  444 LYS B N   1 
ATOM 6411  C CA  . LYS B  1 436 ? 139.003 86.327   52.215  1.00 86.39  ?  444 LYS B CA  1 
ATOM 6412  C C   . LYS B  1 436 ? 138.300 86.332   50.864  1.00 76.65  ?  444 LYS B C   1 
ATOM 6413  O O   . LYS B  1 436 ? 138.333 85.321   50.153  1.00 74.95  ?  444 LYS B O   1 
ATOM 6414  C CB  . LYS B  1 436 ? 138.205 85.516   53.238  1.00 100.40 ?  444 LYS B CB  1 
ATOM 6415  C CG  . LYS B  1 436 ? 138.279 84.009   53.063  1.00 106.67 ?  444 LYS B CG  1 
ATOM 6416  C CD  . LYS B  1 436 ? 137.754 83.291   54.300  1.00 114.07 ?  444 LYS B CD  1 
ATOM 6417  C CE  . LYS B  1 436 ? 136.376 83.801   54.699  1.00 112.93 ?  444 LYS B CE  1 
ATOM 6418  N NZ  . LYS B  1 436 ? 135.908 83.205   55.981  1.00 115.54 1  444 LYS B NZ  1 
ATOM 6419  N N   . LEU B  1 437 ? 137.678 87.447   50.497  1.00 76.22  ?  445 LEU B N   1 
ATOM 6420  C CA  . LEU B  1 437 ? 136.998 87.611   49.223  1.00 69.66  ?  445 LEU B CA  1 
ATOM 6421  C C   . LEU B  1 437 ? 137.877 88.428   48.285  1.00 69.98  ?  445 LEU B C   1 
ATOM 6422  O O   . LEU B  1 437 ? 138.758 89.174   48.718  1.00 75.08  ?  445 LEU B O   1 
ATOM 6423  C CB  . LEU B  1 437 ? 135.647 88.305   49.415  1.00 67.89  ?  445 LEU B CB  1 
ATOM 6424  C CG  . LEU B  1 437 ? 134.727 87.726   50.491  1.00 67.96  ?  445 LEU B CG  1 
ATOM 6425  C CD1 . LEU B  1 437 ? 133.644 88.724   50.871  1.00 65.84  ?  445 LEU B CD1 1 
ATOM 6426  C CD2 . LEU B  1 437 ? 134.111 86.424   50.007  1.00 65.81  ?  445 LEU B CD2 1 
ATOM 6427  N N   . LYS B  1 438 ? 137.626 88.288   46.988  1.00 66.69  ?  446 LYS B N   1 
ATOM 6428  C CA  . LYS B  1 438 ? 138.432 88.952   45.972  1.00 65.84  ?  446 LYS B CA  1 
ATOM 6429  C C   . LYS B  1 438 ? 137.720 90.217   45.509  1.00 61.98  ?  446 LYS B C   1 
ATOM 6430  O O   . LYS B  1 438 ? 136.586 90.153   45.022  1.00 56.89  ?  446 LYS B O   1 
ATOM 6431  C CB  . LYS B  1 438 ? 138.704 88.027   44.787  1.00 63.09  ?  446 LYS B CB  1 
ATOM 6432  C CG  . LYS B  1 438 ? 139.707 88.610   43.810  1.00 68.00  ?  446 LYS B CG  1 
ATOM 6433  C CD  . LYS B  1 438 ? 141.003 88.931   44.545  1.00 75.10  ?  446 LYS B CD  1 
ATOM 6434  C CE  . LYS B  1 438 ? 141.793 90.031   43.864  1.00 72.51  ?  446 LYS B CE  1 
ATOM 6435  N NZ  . LYS B  1 438 ? 142.806 90.609   44.791  1.00 73.86  1  446 LYS B NZ  1 
ATOM 6436  N N   . PHE B  1 439 ? 138.388 91.359   45.652  1.00 58.95  ?  447 PHE B N   1 
ATOM 6437  C CA  . PHE B  1 439 ? 137.855 92.638   45.209  1.00 59.94  ?  447 PHE B CA  1 
ATOM 6438  C C   . PHE B  1 439 ? 138.894 93.352   44.355  1.00 63.36  ?  447 PHE B C   1 
ATOM 6439  O O   . PHE B  1 439 ? 140.073 92.988   44.334  1.00 68.97  ?  447 PHE B O   1 
ATOM 6440  C CB  . PHE B  1 439 ? 137.459 93.527   46.397  1.00 66.44  ?  447 PHE B CB  1 
ATOM 6441  C CG  . PHE B  1 439 ? 136.454 92.899   47.319  1.00 65.98  ?  447 PHE B CG  1 
ATOM 6442  C CD1 . PHE B  1 439 ? 135.121 92.818   46.961  1.00 58.14  ?  447 PHE B CD1 1 
ATOM 6443  C CD2 . PHE B  1 439 ? 136.843 92.405   48.553  1.00 69.86  ?  447 PHE B CD2 1 
ATOM 6444  C CE1 . PHE B  1 439 ? 134.195 92.244   47.811  1.00 54.62  ?  447 PHE B CE1 1 
ATOM 6445  C CE2 . PHE B  1 439 ? 135.921 91.832   49.407  1.00 65.92  ?  447 PHE B CE2 1 
ATOM 6446  C CZ  . PHE B  1 439 ? 134.596 91.752   49.036  1.00 55.38  ?  447 PHE B CZ  1 
ATOM 6447  N N   . TRP B  1 440 ? 138.439 94.383   43.643  1.00 54.85  ?  448 TRP B N   1 
ATOM 6448  C CA  . TRP B  1 440 ? 139.338 95.278   42.928  1.00 56.61  ?  448 TRP B CA  1 
ATOM 6449  C C   . TRP B  1 440 ? 139.680 96.442   43.848  1.00 63.64  ?  448 TRP B C   1 
ATOM 6450  O O   . TRP B  1 440 ? 138.814 97.297   44.094  1.00 67.49  ?  448 TRP B O   1 
ATOM 6451  C CB  . TRP B  1 440 ? 138.691 95.778   41.641  1.00 50.89  ?  448 TRP B CB  1 
ATOM 6452  C CG  . TRP B  1 440 ? 139.613 96.534   40.716  1.00 52.65  ?  448 TRP B CG  1 
ATOM 6453  C CD1 . TRP B  1 440 ? 140.683 97.308   41.066  1.00 56.43  ?  448 TRP B CD1 1 
ATOM 6454  C CD2 . TRP B  1 440 ? 139.539 96.581   39.285  1.00 51.01  ?  448 TRP B CD2 1 
ATOM 6455  N NE1 . TRP B  1 440 ? 141.275 97.835   39.945  1.00 57.21  ?  448 TRP B NE1 1 
ATOM 6456  C CE2 . TRP B  1 440 ? 140.593 97.403   38.838  1.00 54.21  ?  448 TRP B CE2 1 
ATOM 6457  C CE3 . TRP B  1 440 ? 138.683 96.008   38.339  1.00 55.94  ?  448 TRP B CE3 1 
ATOM 6458  C CZ2 . TRP B  1 440 ? 140.814 97.665   37.487  1.00 53.58  ?  448 TRP B CZ2 1 
ATOM 6459  C CZ3 . TRP B  1 440 ? 138.905 96.269   36.998  1.00 47.24  ?  448 TRP B CZ3 1 
ATOM 6460  C CH2 . TRP B  1 440 ? 139.962 97.091   36.586  1.00 50.21  ?  448 TRP B CH2 1 
ATOM 6461  N N   . PRO B  1 441 ? 140.902 96.524   44.374  1.00 55.57  ?  449 PRO B N   1 
ATOM 6462  C CA  . PRO B  1 441 ? 141.218 97.583   45.342  1.00 65.61  ?  449 PRO B CA  1 
ATOM 6463  C C   . PRO B  1 441 ? 141.371 98.933   44.655  1.00 62.21  ?  449 PRO B C   1 
ATOM 6464  O O   . PRO B  1 441 ? 142.034 99.051   43.623  1.00 58.96  ?  449 PRO B O   1 
ATOM 6465  C CB  . PRO B  1 441 ? 142.537 97.110   45.962  1.00 54.26  ?  449 PRO B CB  1 
ATOM 6466  C CG  . PRO B  1 441 ? 143.168 96.292   44.891  1.00 54.26  ?  449 PRO B CG  1 
ATOM 6467  C CD  . PRO B  1 441 ? 142.042 95.620   44.148  1.00 52.98  ?  449 PRO B CD  1 
ATOM 6468  N N   . VAL B  1 442 ? 140.743 99.953   45.237  1.00 66.22  ?  450 VAL B N   1 
ATOM 6469  C CA  . VAL B  1 442 ? 140.840 101.328  44.755  1.00 63.46  ?  450 VAL B CA  1 
ATOM 6470  C C   . VAL B  1 442 ? 141.169 102.205  45.955  1.00 63.95  ?  450 VAL B C   1 
ATOM 6471  O O   . VAL B  1 442 ? 140.306 102.448  46.808  1.00 62.48  ?  450 VAL B O   1 
ATOM 6472  C CB  . VAL B  1 442 ? 139.554 101.801  44.063  1.00 63.16  ?  450 VAL B CB  1 
ATOM 6473  C CG1 . VAL B  1 442 ? 139.631 103.291  43.764  1.00 62.27  ?  450 VAL B CG1 1 
ATOM 6474  C CG2 . VAL B  1 442 ? 139.322 101.012  42.782  1.00 59.86  ?  450 VAL B CG2 1 
ATOM 6475  N N   . ASP B  1 443 ? 142.412 102.678  46.023  1.00 60.65  ?  451 ASP B N   1 
ATOM 6476  C CA  . ASP B  1 443 ? 142.886 103.482  47.145  1.00 62.82  ?  451 ASP B CA  1 
ATOM 6477  C C   . ASP B  1 443 ? 142.693 104.958  46.818  1.00 63.61  ?  451 ASP B C   1 
ATOM 6478  O O   . ASP B  1 443 ? 143.331 105.489  45.904  1.00 63.36  ?  451 ASP B O   1 
ATOM 6479  C CB  . ASP B  1 443 ? 144.350 103.171  47.443  1.00 66.62  ?  451 ASP B CB  1 
ATOM 6480  C CG  . ASP B  1 443 ? 144.862 103.892  48.678  1.00 77.23  ?  451 ASP B CG  1 
ATOM 6481  O OD1 . ASP B  1 443 ? 145.644 103.282  49.437  1.00 87.80  ?  451 ASP B OD1 1 
ATOM 6482  O OD2 . ASP B  1 443 ? 144.455 105.051  48.914  1.00 75.64  -1 451 ASP B OD2 1 
ATOM 6483  N N   . LEU B  1 444 ? 141.816 105.622  47.570  1.00 69.82  ?  452 LEU B N   1 
ATOM 6484  C CA  . LEU B  1 444 ? 141.539 107.037  47.376  1.00 65.56  ?  452 LEU B CA  1 
ATOM 6485  C C   . LEU B  1 444 ? 142.007 107.891  48.547  1.00 69.60  ?  452 LEU B C   1 
ATOM 6486  O O   . LEU B  1 444 ? 141.617 109.059  48.642  1.00 69.65  ?  452 LEU B O   1 
ATOM 6487  C CB  . LEU B  1 444 ? 140.044 107.255  47.135  1.00 60.52  ?  452 LEU B CB  1 
ATOM 6488  C CG  . LEU B  1 444 ? 139.466 106.659  45.849  1.00 59.56  ?  452 LEU B CG  1 
ATOM 6489  C CD1 . LEU B  1 444 ? 138.071 107.198  45.585  1.00 58.62  ?  452 LEU B CD1 1 
ATOM 6490  C CD2 . LEU B  1 444 ? 140.381 106.938  44.666  1.00 59.95  ?  452 LEU B CD2 1 
ATOM 6491  N N   . LYS B  1 445 ? 142.843 107.343  49.435  1.00 67.38  ?  453 LYS B N   1 
ATOM 6492  C CA  . LYS B  1 445 ? 143.359 108.132  50.549  1.00 69.85  ?  453 LYS B CA  1 
ATOM 6493  C C   . LYS B  1 445 ? 144.218 109.291  50.064  1.00 71.63  ?  453 LYS B C   1 
ATOM 6494  O O   . LYS B  1 445 ? 144.267 110.342  50.713  1.00 72.91  ?  453 LYS B O   1 
ATOM 6495  C CB  . LYS B  1 445 ? 144.169 107.246  51.494  1.00 70.50  ?  453 LYS B CB  1 
ATOM 6496  C CG  . LYS B  1 445 ? 143.394 106.086  52.090  1.00 68.47  ?  453 LYS B CG  1 
ATOM 6497  C CD  . LYS B  1 445 ? 144.280 105.277  53.019  1.00 72.68  ?  453 LYS B CD  1 
ATOM 6498  C CE  . LYS B  1 445 ? 145.480 104.725  52.269  1.00 75.01  ?  453 LYS B CE  1 
ATOM 6499  N NZ  . LYS B  1 445 ? 146.369 103.905  53.136  1.00 81.93  1  453 LYS B NZ  1 
ATOM 6500  N N   . GLU B  1 446 ? 144.891 109.123  48.929  1.00 79.28  ?  454 GLU B N   1 
ATOM 6501  C CA  . GLU B  1 446 ? 145.758 110.147  48.366  1.00 87.83  ?  454 GLU B CA  1 
ATOM 6502  C C   . GLU B  1 446 ? 145.084 110.932  47.249  1.00 82.36  ?  454 GLU B C   1 
ATOM 6503  O O   . GLU B  1 446 ? 145.759 111.684  46.538  1.00 82.91  ?  454 GLU B O   1 
ATOM 6504  C CB  . GLU B  1 446 ? 147.047 109.503  47.850  1.00 101.99 ?  454 GLU B CB  1 
ATOM 6505  C CG  . GLU B  1 446 ? 146.806 108.434  46.788  1.00 105.32 ?  454 GLU B CG  1 
ATOM 6506  C CD  . GLU B  1 446 ? 148.074 107.710  46.374  1.00 114.07 ?  454 GLU B CD  1 
ATOM 6507  O OE1 . GLU B  1 446 ? 149.177 108.208  46.685  1.00 122.49 ?  454 GLU B OE1 1 
ATOM 6508  O OE2 . GLU B  1 446 ? 147.966 106.640  45.736  1.00 111.46 -1 454 GLU B OE2 1 
ATOM 6509  N N   . ARG B  1 447 ? 143.771 110.776  47.078  1.00 87.53  ?  455 ARG B N   1 
ATOM 6510  C CA  . ARG B  1 447 ? 143.051 111.395  45.972  1.00 78.23  ?  455 ARG B CA  1 
ATOM 6511  C C   . ARG B  1 447 ? 141.901 112.283  46.435  1.00 74.18  ?  455 ARG B C   1 
ATOM 6512  O O   . ARG B  1 447 ? 141.147 112.789  45.595  1.00 70.08  ?  455 ARG B O   1 
ATOM 6513  C CB  . ARG B  1 447 ? 142.561 110.329  44.988  1.00 70.59  ?  455 ARG B CB  1 
ATOM 6514  C CG  . ARG B  1 447 ? 143.679 109.414  44.504  1.00 73.95  ?  455 ARG B CG  1 
ATOM 6515  C CD  . ARG B  1 447 ? 143.395 108.858  43.119  1.00 77.27  ?  455 ARG B CD  1 
ATOM 6516  N NE  . ARG B  1 447 ? 144.595 108.320  42.479  1.00 84.64  ?  455 ARG B NE  1 
ATOM 6517  C CZ  . ARG B  1 447 ? 144.762 108.224  41.163  1.00 81.97  ?  455 ARG B CZ  1 
ATOM 6518  N NH1 . ARG B  1 447 ? 143.807 108.633  40.339  1.00 75.45  1  455 ARG B NH1 1 
ATOM 6519  N NH2 . ARG B  1 447 ? 145.887 107.724  40.669  1.00 84.66  ?  455 ARG B NH2 1 
ATOM 6520  N N   . PHE B  1 448 ? 141.744 112.484  47.742  1.00 66.11  ?  456 PHE B N   1 
ATOM 6521  C CA  . PHE B  1 448 ? 140.719 113.394  48.236  1.00 65.30  ?  456 PHE B CA  1 
ATOM 6522  C C   . PHE B  1 448 ? 141.143 114.836  47.990  1.00 67.69  ?  456 PHE B C   1 
ATOM 6523  O O   . PHE B  1 448 ? 142.309 115.197  48.171  1.00 71.94  ?  456 PHE B O   1 
ATOM 6524  C CB  . PHE B  1 448 ? 140.479 113.174  49.730  1.00 70.83  ?  456 PHE B CB  1 
ATOM 6525  C CG  . PHE B  1 448 ? 139.392 112.185  50.039  1.00 67.01  ?  456 PHE B CG  1 
ATOM 6526  C CD1 . PHE B  1 448 ? 139.401 110.921  49.479  1.00 67.39  ?  456 PHE B CD1 1 
ATOM 6527  C CD2 . PHE B  1 448 ? 138.366 112.519  50.906  1.00 66.03  ?  456 PHE B CD2 1 
ATOM 6528  C CE1 . PHE B  1 448 ? 138.400 110.011  49.767  1.00 64.53  ?  456 PHE B CE1 1 
ATOM 6529  C CE2 . PHE B  1 448 ? 137.365 111.614  51.200  1.00 66.79  ?  456 PHE B CE2 1 
ATOM 6530  C CZ  . PHE B  1 448 ? 137.383 110.357  50.630  1.00 63.77  ?  456 PHE B CZ  1 
ATOM 6531  N N   . SER B  1 449 ? 140.186 115.665  47.582  1.00 66.55  ?  457 SER B N   1 
ATOM 6532  C CA  . SER B  1 449 ? 140.458 117.070  47.317  1.00 74.48  ?  457 SER B CA  1 
ATOM 6533  C C   . SER B  1 449 ? 139.215 117.894  47.618  1.00 72.50  ?  457 SER B C   1 
ATOM 6534  O O   . SER B  1 449 ? 138.100 117.499  47.267  1.00 72.62  ?  457 SER B O   1 
ATOM 6535  C CB  . SER B  1 449 ? 140.897 117.293  45.866  1.00 72.56  ?  457 SER B CB  1 
ATOM 6536  O OG  . SER B  1 449 ? 141.054 118.674  45.589  1.00 68.19  ?  457 SER B OG  1 
ATOM 6537  N N   . ALA B  1 450 ? 139.416 119.036  48.273  1.00 73.83  ?  458 ALA B N   1 
ATOM 6538  C CA  . ALA B  1 450 ? 138.319 119.937  48.599  1.00 73.10  ?  458 ALA B CA  1 
ATOM 6539  C C   . ALA B  1 450 ? 138.013 120.929  47.486  1.00 71.39  ?  458 ALA B C   1 
ATOM 6540  O O   . ALA B  1 450 ? 136.966 121.584  47.532  1.00 68.62  ?  458 ALA B O   1 
ATOM 6541  C CB  . ALA B  1 450 ? 138.625 120.698  49.893  1.00 70.92  ?  458 ALA B CB  1 
ATOM 6542  N N   . ASP B  1 451 ? 138.891 121.053  46.489  1.00 74.34  ?  459 ASP B N   1 
ATOM 6543  C CA  . ASP B  1 451 ? 138.662 121.945  45.352  1.00 74.77  ?  459 ASP B CA  1 
ATOM 6544  C C   . ASP B  1 451 ? 137.751 121.225  44.363  1.00 68.38  ?  459 ASP B C   1 
ATOM 6545  O O   . ASP B  1 451 ? 138.190 120.616  43.384  1.00 66.97  ?  459 ASP B O   1 
ATOM 6546  C CB  . ASP B  1 451 ? 139.980 122.356  44.707  1.00 71.43  ?  459 ASP B CB  1 
ATOM 6547  C CG  . ASP B  1 451 ? 140.953 122.967  45.697  1.00 82.20  ?  459 ASP B CG  1 
ATOM 6548  O OD1 . ASP B  1 451 ? 140.532 123.834  46.491  1.00 86.87  ?  459 ASP B OD1 1 
ATOM 6549  O OD2 . ASP B  1 451 ? 142.142 122.582  45.679  1.00 86.84  -1 459 ASP B OD2 1 
ATOM 6550  N N   . LEU B  1 452 ? 136.446 121.300  44.636  1.00 68.19  ?  460 LEU B N   1 
ATOM 6551  C CA  . LEU B  1 452 ? 135.477 120.560  43.834  1.00 71.01  ?  460 LEU B CA  1 
ATOM 6552  C C   . LEU B  1 452 ? 135.418 121.067  42.399  1.00 68.51  ?  460 LEU B C   1 
ATOM 6553  O O   . LEU B  1 452 ? 135.203 120.276  41.475  1.00 68.72  ?  460 LEU B O   1 
ATOM 6554  C CB  . LEU B  1 452 ? 134.093 120.632  44.482  1.00 69.45  ?  460 LEU B CB  1 
ATOM 6555  C CG  . LEU B  1 452 ? 133.987 120.077  45.905  1.00 67.50  ?  460 LEU B CG  1 
ATOM 6556  C CD1 . LEU B  1 452 ? 132.534 119.967  46.336  1.00 62.52  ?  460 LEU B CD1 1 
ATOM 6557  C CD2 . LEU B  1 452 ? 134.681 118.730  46.015  1.00 67.73  ?  460 LEU B CD2 1 
ATOM 6558  N N   . ASP B  1 453 ? 135.616 122.369  42.187  1.00 67.68  ?  461 ASP B N   1 
ATOM 6559  C CA  . ASP B  1 453 ? 135.535 122.932  40.843  1.00 67.98  ?  461 ASP B CA  1 
ATOM 6560  C C   . ASP B  1 453 ? 136.660 122.464  39.926  1.00 69.89  ?  461 ASP B C   1 
ATOM 6561  O O   . ASP B  1 453 ? 136.646 122.805  38.738  1.00 69.63  ?  461 ASP B O   1 
ATOM 6562  C CB  . ASP B  1 453 ? 135.528 124.461  40.918  1.00 68.24  ?  461 ASP B CB  1 
ATOM 6563  C CG  . ASP B  1 453 ? 136.786 125.020  41.552  1.00 75.39  ?  461 ASP B CG  1 
ATOM 6564  O OD1 . ASP B  1 453 ? 137.390 124.323  42.395  1.00 77.71  ?  461 ASP B OD1 1 
ATOM 6565  O OD2 . ASP B  1 453 ? 137.168 126.159  41.211  1.00 79.77  -1 461 ASP B OD2 1 
ATOM 6566  N N   . GLN B  1 454 ? 137.618 121.693  40.435  1.00 70.36  ?  462 GLN B N   1 
ATOM 6567  C CA  . GLN B  1 454 ? 138.718 121.174  39.635  1.00 71.99  ?  462 GLN B CA  1 
ATOM 6568  C C   . GLN B  1 454 ? 138.402 119.833  38.987  1.00 70.53  ?  462 GLN B C   1 
ATOM 6569  O O   . GLN B  1 454 ? 139.240 119.306  38.249  1.00 77.33  ?  462 GLN B O   1 
ATOM 6570  C CB  . GLN B  1 454 ? 139.972 121.032  40.504  1.00 66.48  ?  462 GLN B CB  1 
ATOM 6571  C CG  . GLN B  1 454 ? 140.399 122.315  41.193  1.00 72.98  ?  462 GLN B CG  1 
ATOM 6572  C CD  . GLN B  1 454 ? 141.095 123.278  40.259  1.00 78.32  ?  462 GLN B CD  1 
ATOM 6573  O OE1 . GLN B  1 454 ? 142.220 123.031  39.825  1.00 84.49  ?  462 GLN B OE1 1 
ATOM 6574  N NE2 . GLN B  1 454 ? 140.430 124.383  39.941  1.00 76.28  ?  462 GLN B NE2 1 
ATOM 6575  N N   . PHE B  1 455 ? 137.224 119.272  39.237  1.00 75.40  ?  463 PHE B N   1 
ATOM 6576  C CA  . PHE B  1 455 ? 136.859 117.954  38.747  1.00 73.74  ?  463 PHE B CA  1 
ATOM 6577  C C   . PHE B  1 455 ? 135.474 117.987  38.118  1.00 71.86  ?  463 PHE B C   1 
ATOM 6578  O O   . PHE B  1 455 ? 134.622 118.785  38.524  1.00 72.68  ?  463 PHE B O   1 
ATOM 6579  C CB  . PHE B  1 455 ? 136.890 116.918  39.880  1.00 68.49  ?  463 PHE B CB  1 
ATOM 6580  C CG  . PHE B  1 455 ? 138.164 116.928  40.673  1.00 67.95  ?  463 PHE B CG  1 
ATOM 6581  C CD1 . PHE B  1 455 ? 138.221 117.540  41.914  1.00 69.40  ?  463 PHE B CD1 1 
ATOM 6582  C CD2 . PHE B  1 455 ? 139.309 116.333  40.171  1.00 68.83  ?  463 PHE B CD2 1 
ATOM 6583  C CE1 . PHE B  1 455 ? 139.394 117.547  42.642  1.00 74.75  ?  463 PHE B CE1 1 
ATOM 6584  C CE2 . PHE B  1 455 ? 140.484 116.337  40.894  1.00 74.96  ?  463 PHE B CE2 1 
ATOM 6585  C CZ  . PHE B  1 455 ? 140.527 116.945  42.131  1.00 77.00  ?  463 PHE B CZ  1 
ATOM 6586  N N   . PRO B  1 456 ? 135.226 117.137  37.114  1.00 72.03  ?  464 PRO B N   1 
ATOM 6587  C CA  . PRO B  1 456 ? 133.900 117.154  36.464  1.00 70.06  ?  464 PRO B CA  1 
ATOM 6588  C C   . PRO B  1 456 ? 132.758 116.871  37.427  1.00 67.75  ?  464 PRO B C   1 
ATOM 6589  O O   . PRO B  1 456 ? 131.818 117.675  37.524  1.00 66.20  ?  464 PRO B O   1 
ATOM 6590  C CB  . PRO B  1 456 ? 134.033 116.074  35.378  1.00 65.97  ?  464 PRO B CB  1 
ATOM 6591  C CG  . PRO B  1 456 ? 135.185 115.224  35.802  1.00 65.63  ?  464 PRO B CG  1 
ATOM 6592  C CD  . PRO B  1 456 ? 136.128 116.145  36.508  1.00 66.88  ?  464 PRO B CD  1 
ATOM 6593  N N   . LEU B  1 457 ? 132.816 115.751  38.155  1.00 73.59  ?  465 LEU B N   1 
ATOM 6594  C CA  . LEU B  1 457 ? 131.785 115.459  39.147  1.00 69.80  ?  465 LEU B CA  1 
ATOM 6595  C C   . LEU B  1 457 ? 131.707 116.549  40.205  1.00 65.50  ?  465 LEU B C   1 
ATOM 6596  O O   . LEU B  1 457 ? 130.630 116.806  40.755  1.00 61.03  ?  465 LEU B O   1 
ATOM 6597  C CB  . LEU B  1 457 ? 132.051 114.108  39.810  1.00 69.36  ?  465 LEU B CB  1 
ATOM 6598  C CG  . LEU B  1 457 ? 130.966 113.624  40.775  1.00 61.81  ?  465 LEU B CG  1 
ATOM 6599  C CD1 . LEU B  1 457 ? 129.682 113.336  40.014  1.00 55.39  ?  465 LEU B CD1 1 
ATOM 6600  C CD2 . LEU B  1 457 ? 131.432 112.399  41.538  1.00 63.59  ?  465 LEU B CD2 1 
ATOM 6601  N N   . GLY B  1 458 ? 132.836 117.190  40.513  1.00 68.05  ?  466 GLY B N   1 
ATOM 6602  C CA  . GLY B  1 458 ? 132.812 118.293  41.457  1.00 71.75  ?  466 GLY B CA  1 
ATOM 6603  C C   . GLY B  1 458 ? 132.019 119.481  40.949  1.00 71.43  ?  466 GLY B C   1 
ATOM 6604  O O   . GLY B  1 458 ? 131.278 120.108  41.707  1.00 69.44  ?  466 GLY B O   1 
ATOM 6605  N N   . ARG B  1 459 ? 132.173 119.818  39.665  1.00 68.81  ?  467 ARG B N   1 
ATOM 6606  C CA  . ARG B  1 459 ? 131.397 120.908  39.078  1.00 67.43  ?  467 ARG B CA  1 
ATOM 6607  C C   . ARG B  1 459 ? 129.916 120.550  39.006  1.00 64.56  ?  467 ARG B C   1 
ATOM 6608  O O   . ARG B  1 459 ? 129.046 121.345  39.398  1.00 65.64  ?  467 ARG B O   1 
ATOM 6609  C CB  . ARG B  1 459 ? 131.943 121.249  37.690  1.00 59.23  ?  467 ARG B CB  1 
ATOM 6610  C CG  . ARG B  1 459 ? 133.389 121.727  37.695  1.00 62.85  ?  467 ARG B CG  1 
ATOM 6611  C CD  . ARG B  1 459 ? 133.844 122.180  36.315  1.00 64.56  ?  467 ARG B CD  1 
ATOM 6612  N NE  . ARG B  1 459 ? 134.128 121.063  35.417  1.00 70.82  ?  467 ARG B NE  1 
ATOM 6613  C CZ  . ARG B  1 459 ? 135.289 120.417  35.373  1.00 73.71  ?  467 ARG B CZ  1 
ATOM 6614  N NH1 . ARG B  1 459 ? 135.464 119.415  34.520  1.00 71.03  1  467 ARG B NH1 1 
ATOM 6615  N NH2 . ARG B  1 459 ? 136.278 120.769  36.184  1.00 79.36  ?  467 ARG B NH2 1 
ATOM 6616  N N   . LYS B  1 460 ? 129.612 119.348  38.503  1.00 71.53  ?  468 LYS B N   1 
ATOM 6617  C CA  . LYS B  1 460 ? 128.228 118.889  38.463  1.00 69.64  ?  468 LYS B CA  1 
ATOM 6618  C C   . LYS B  1 460 ? 127.602 118.906  39.851  1.00 71.14  ?  468 LYS B C   1 
ATOM 6619  O O   . LYS B  1 460 ? 126.398 119.153  39.989  1.00 70.10  ?  468 LYS B O   1 
ATOM 6620  C CB  . LYS B  1 460 ? 128.161 117.484  37.864  1.00 64.51  ?  468 LYS B CB  1 
ATOM 6621  C CG  . LYS B  1 460 ? 128.738 117.383  36.463  1.00 64.88  ?  468 LYS B CG  1 
ATOM 6622  C CD  . LYS B  1 460 ? 128.443 116.029  35.848  1.00 63.32  ?  468 LYS B CD  1 
ATOM 6623  C CE  . LYS B  1 460 ? 129.290 115.790  34.612  1.00 65.17  ?  468 LYS B CE  1 
ATOM 6624  N NZ  . LYS B  1 460 ? 130.266 114.685  34.829  1.00 61.77  1  468 LYS B NZ  1 
ATOM 6625  N N   . PHE B  1 461 ? 128.404 118.651  40.888  1.00 67.28  ?  469 PHE B N   1 
ATOM 6626  C CA  . PHE B  1 461 ? 127.922 118.779  42.257  1.00 69.82  ?  469 PHE B CA  1 
ATOM 6627  C C   . PHE B  1 461 ? 127.810 120.238  42.672  1.00 75.18  ?  469 PHE B C   1 
ATOM 6628  O O   . PHE B  1 461 ? 126.998 120.570  43.541  1.00 78.84  ?  469 PHE B O   1 
ATOM 6629  C CB  . PHE B  1 461 ? 128.837 118.027  43.223  1.00 68.72  ?  469 PHE B CB  1 
ATOM 6630  C CG  . PHE B  1 461 ? 128.449 118.185  44.664  1.00 59.70  ?  469 PHE B CG  1 
ATOM 6631  C CD1 . PHE B  1 461 ? 127.301 117.587  45.153  1.00 57.67  ?  469 PHE B CD1 1 
ATOM 6632  C CD2 . PHE B  1 461 ? 129.224 118.941  45.527  1.00 62.96  ?  469 PHE B CD2 1 
ATOM 6633  C CE1 . PHE B  1 461 ? 126.936 117.733  46.477  1.00 58.25  ?  469 PHE B CE1 1 
ATOM 6634  C CE2 . PHE B  1 461 ? 128.866 119.090  46.851  1.00 63.85  ?  469 PHE B CE2 1 
ATOM 6635  C CZ  . PHE B  1 461 ? 127.720 118.485  47.327  1.00 61.50  ?  469 PHE B CZ  1 
ATOM 6636  N N   . LEU B  1 462 ? 128.622 121.119  42.081  1.00 74.59  ?  470 LEU B N   1 
ATOM 6637  C CA  . LEU B  1 462 ? 128.468 122.540  42.353  1.00 74.58  ?  470 LEU B CA  1 
ATOM 6638  C C   . LEU B  1 462 ? 127.166 123.071  41.782  1.00 71.56  ?  470 LEU B C   1 
ATOM 6639  O O   . LEU B  1 462 ? 126.685 124.116  42.234  1.00 78.16  ?  470 LEU B O   1 
ATOM 6640  C CB  . LEU B  1 462 ? 129.648 123.335  41.793  1.00 72.54  ?  470 LEU B CB  1 
ATOM 6641  C CG  . LEU B  1 462 ? 130.994 123.166  42.500  1.00 71.60  ?  470 LEU B CG  1 
ATOM 6642  C CD1 . LEU B  1 462 ? 132.011 124.167  41.970  1.00 74.84  ?  470 LEU B CD1 1 
ATOM 6643  C CD2 . LEU B  1 462 ? 130.835 123.294  44.007  1.00 68.85  ?  470 LEU B CD2 1 
ATOM 6644  N N   . LEU B  1 463 ? 126.581 122.377  40.805  1.00 74.73  ?  471 LEU B N   1 
ATOM 6645  C CA  . LEU B  1 463 ? 125.212 122.701  40.416  1.00 78.59  ?  471 LEU B CA  1 
ATOM 6646  C C   . LEU B  1 463 ? 124.204 122.062  41.371  1.00 77.77  ?  471 LEU B C   1 
ATOM 6647  O O   . LEU B  1 463 ? 123.243 121.425  40.926  1.00 73.20  ?  471 LEU B O   1 
ATOM 6648  C CB  . LEU B  1 463 ? 124.936 122.243  38.980  1.00 75.90  ?  471 LEU B CB  1 
ATOM 6649  C CG  . LEU B  1 463 ? 125.070 123.280  37.861  1.00 77.24  ?  471 LEU B CG  1 
ATOM 6650  C CD1 . LEU B  1 463 ? 126.525 123.670  37.639  1.00 75.33  ?  471 LEU B CD1 1 
ATOM 6651  C CD2 . LEU B  1 463 ? 124.446 122.764  36.570  1.00 77.00  ?  471 LEU B CD2 1 
ATOM 6652  N N   . GLN B  1 464 ? 124.414 122.214  42.685  1.00 82.02  ?  472 GLN B N   1 
ATOM 6653  C CA  . GLN B  1 464 ? 123.473 121.695  43.676  1.00 80.42  ?  472 GLN B CA  1 
ATOM 6654  C C   . GLN B  1 464 ? 123.197 122.628  44.845  1.00 81.03  ?  472 GLN B C   1 
ATOM 6655  O O   . GLN B  1 464 ? 122.234 122.373  45.577  1.00 78.78  ?  472 GLN B O   1 
ATOM 6656  C CB  . GLN B  1 464 ? 123.970 120.356  44.241  1.00 82.33  ?  472 GLN B CB  1 
ATOM 6657  C CG  . GLN B  1 464 ? 124.088 119.236  43.227  1.00 76.18  ?  472 GLN B CG  1 
ATOM 6658  C CD  . GLN B  1 464 ? 122.736 118.726  42.779  1.00 76.53  ?  472 GLN B CD  1 
ATOM 6659  O OE1 . GLN B  1 464 ? 122.120 117.902  43.458  1.00 74.68  ?  472 GLN B OE1 1 
ATOM 6660  N NE2 . GLN B  1 464 ? 122.262 119.214  41.639  1.00 79.82  ?  472 GLN B NE2 1 
ATOM 6661  N N   . LEU B  1 465 ? 124.021 123.648  45.082  1.00 83.44  ?  473 LEU B N   1 
ATOM 6662  C CA  . LEU B  1 465 ? 123.763 124.674  46.096  1.00 89.91  ?  473 LEU B CA  1 
ATOM 6663  C C   . LEU B  1 465 ? 122.288 125.061  46.209  1.00 92.76  ?  473 LEU B C   1 
ATOM 6664  O O   . LEU B  1 465 ? 121.576 124.578  47.088  1.00 91.78  ?  473 LEU B O   1 
ATOM 6665  C CB  . LEU B  1 465 ? 124.600 125.926  45.820  1.00 85.33  ?  473 LEU B CB  1 
ATOM 6666  C CG  . LEU B  1 465 ? 124.361 127.083  46.793  1.00 85.36  ?  473 LEU B CG  1 
ATOM 6667  C CD1 . LEU B  1 465 ? 124.822 126.693  48.184  1.00 82.92  ?  473 LEU B CD1 1 
ATOM 6668  C CD2 . LEU B  1 465 ? 125.054 128.358  46.333  1.00 87.22  ?  473 LEU B CD2 1 
ATOM 6669  N N   . LYS C  1 12  ? 119.738 144.614  2.362   1.00 72.02  ?  20  LYS C N   1 
ATOM 6670  C CA  . LYS C  1 12  ? 119.344 143.873  3.554   1.00 68.96  ?  20  LYS C CA  1 
ATOM 6671  C C   . LYS C  1 12  ? 117.865 143.501  3.516   1.00 65.34  ?  20  LYS C C   1 
ATOM 6672  O O   . LYS C  1 12  ? 117.002 144.362  3.345   1.00 66.89  ?  20  LYS C O   1 
ATOM 6673  C CB  . LYS C  1 12  ? 119.643 144.685  4.816   1.00 71.02  ?  20  LYS C CB  1 
ATOM 6674  C CG  . LYS C  1 12  ? 119.215 143.997  6.103   1.00 68.57  ?  20  LYS C CG  1 
ATOM 6675  C CD  . LYS C  1 12  ? 119.668 144.764  7.335   1.00 72.23  ?  20  LYS C CD  1 
ATOM 6676  C CE  . LYS C  1 12  ? 119.191 144.082  8.609   1.00 72.34  ?  20  LYS C CE  1 
ATOM 6677  N NZ  . LYS C  1 12  ? 119.623 144.811  9.833   1.00 79.80  1  20  LYS C NZ  1 
ATOM 6678  N N   . VAL C  1 13  ? 117.581 142.213  3.683   1.00 65.03  ?  21  VAL C N   1 
ATOM 6679  C CA  . VAL C  1 13  ? 116.210 141.719  3.649   1.00 62.14  ?  21  VAL C CA  1 
ATOM 6680  C C   . VAL C  1 13  ? 115.570 141.925  5.017   1.00 61.68  ?  21  VAL C C   1 
ATOM 6681  O O   . VAL C  1 13  ? 116.225 141.786  6.057   1.00 62.41  ?  21  VAL C O   1 
ATOM 6682  C CB  . VAL C  1 13  ? 116.183 140.242  3.213   1.00 63.83  ?  21  VAL C CB  1 
ATOM 6683  C CG1 . VAL C  1 13  ? 117.031 139.385  4.141   1.00 67.43  ?  21  VAL C CG1 1 
ATOM 6684  C CG2 . VAL C  1 13  ? 114.759 139.722  3.146   1.00 61.52  ?  21  VAL C CG2 1 
ATOM 6685  N N   . VAL C  1 14  ? 114.283 142.269  5.019   1.00 65.73  ?  22  VAL C N   1 
ATOM 6686  C CA  . VAL C  1 14  ? 113.564 142.655  6.227   1.00 65.35  ?  22  VAL C CA  1 
ATOM 6687  C C   . VAL C  1 14  ? 112.432 141.667  6.467   1.00 61.20  ?  22  VAL C C   1 
ATOM 6688  O O   . VAL C  1 14  ? 111.794 141.197  5.518   1.00 60.05  ?  22  VAL C O   1 
ATOM 6689  C CB  . VAL C  1 14  ? 113.020 144.096  6.118   1.00 63.66  ?  22  VAL C CB  1 
ATOM 6690  C CG1 . VAL C  1 14  ? 112.329 144.516  7.407   1.00 64.58  ?  22  VAL C CG1 1 
ATOM 6691  C CG2 . VAL C  1 14  ? 114.145 145.060  5.772   1.00 72.43  ?  22  VAL C CG2 1 
ATOM 6692  N N   . SER C  1 15  ? 112.188 141.355  7.739   1.00 58.63  ?  23  SER C N   1 
ATOM 6693  C CA  . SER C  1 15  ? 111.095 140.465  8.102   1.00 57.94  ?  23  SER C CA  1 
ATOM 6694  C C   . SER C  1 15  ? 109.762 141.031  7.631   1.00 63.10  ?  23  SER C C   1 
ATOM 6695  O O   . SER C  1 15  ? 109.540 142.245  7.649   1.00 70.61  ?  23  SER C O   1 
ATOM 6696  C CB  . SER C  1 15  ? 111.068 140.254  9.617   1.00 65.03  ?  23  SER C CB  1 
ATOM 6697  O OG  . SER C  1 15  ? 109.852 139.654  10.031  1.00 60.37  ?  23  SER C OG  1 
ATOM 6698  N N   . THR C  1 16  ? 108.868 140.137  7.203   1.00 64.46  ?  24  THR C N   1 
ATOM 6699  C CA  . THR C  1 16  ? 107.561 140.572  6.728   1.00 63.36  ?  24  THR C CA  1 
ATOM 6700  C C   . THR C  1 16  ? 106.670 141.061  7.859   1.00 64.63  ?  24  THR C C   1 
ATOM 6701  O O   . THR C  1 16  ? 105.662 141.724  7.593   1.00 65.86  ?  24  THR C O   1 
ATOM 6702  C CB  . THR C  1 16  ? 106.865 139.441  5.972   1.00 61.47  ?  24  THR C CB  1 
ATOM 6703  O OG1 . THR C  1 16  ? 106.687 138.317  6.843   1.00 56.99  ?  24  THR C OG1 1 
ATOM 6704  C CG2 . THR C  1 16  ? 107.683 139.027  4.762   1.00 65.75  ?  24  THR C CG2 1 
ATOM 6705  N N   . ASP C  1 17  ? 107.018 140.757  9.109   1.00 62.77  ?  25  ASP C N   1 
ATOM 6706  C CA  . ASP C  1 17  ? 106.254 141.267  10.239  1.00 65.41  ?  25  ASP C CA  1 
ATOM 6707  C C   . ASP C  1 17  ? 106.506 142.743  10.497  1.00 71.57  ?  25  ASP C C   1 
ATOM 6708  O O   . ASP C  1 17  ? 105.877 143.310  11.397  1.00 77.96  ?  25  ASP C O   1 
ATOM 6709  C CB  . ASP C  1 17  ? 106.575 140.459  11.497  1.00 74.95  ?  25  ASP C CB  1 
ATOM 6710  C CG  . ASP C  1 17  ? 106.347 138.972  11.308  1.00 77.87  ?  25  ASP C CG  1 
ATOM 6711  O OD1 . ASP C  1 17  ? 105.543 138.600  10.427  1.00 79.31  ?  25  ASP C OD1 1 
ATOM 6712  O OD2 . ASP C  1 17  ? 106.971 138.176  12.041  1.00 77.87  -1 25  ASP C OD2 1 
ATOM 6713  N N   . GLU C  1 18  ? 107.403 143.376  9.739   1.00 65.70  ?  26  GLU C N   1 
ATOM 6714  C CA  . GLU C  1 18  ? 107.701 144.789  9.914   1.00 66.96  ?  26  GLU C CA  1 
ATOM 6715  C C   . GLU C  1 18  ? 107.046 145.683  8.869   1.00 65.76  ?  26  GLU C C   1 
ATOM 6716  O O   . GLU C  1 18  ? 106.961 146.896  9.088   1.00 67.50  ?  26  GLU C O   1 
ATOM 6717  C CB  . GLU C  1 18  ? 109.217 145.021  9.893   1.00 67.83  ?  26  GLU C CB  1 
ATOM 6718  C CG  . GLU C  1 18  ? 109.971 144.256  10.967  1.00 73.72  ?  26  GLU C CG  1 
ATOM 6719  C CD  . GLU C  1 18  ? 111.408 144.717  11.108  1.00 85.53  ?  26  GLU C CD  1 
ATOM 6720  O OE1 . GLU C  1 18  ? 111.658 145.933  10.972  1.00 92.78  ?  26  GLU C OE1 1 
ATOM 6721  O OE2 . GLU C  1 18  ? 112.288 143.863  11.353  1.00 87.29  -1 26  GLU C OE2 1 
ATOM 6722  N N   . TYR C  1 19  ? 106.586 145.125  7.744   1.00 61.39  ?  27  TYR C N   1 
ATOM 6723  C CA  . TYR C  1 19  ? 105.937 145.928  6.715   1.00 60.56  ?  27  TYR C CA  1 
ATOM 6724  C C   . TYR C  1 19  ? 104.632 145.314  6.221   1.00 58.38  ?  27  TYR C C   1 
ATOM 6725  O O   . TYR C  1 19  ? 104.099 145.763  5.199   1.00 59.92  ?  27  TYR C O   1 
ATOM 6726  C CB  . TYR C  1 19  ? 106.882 146.162  5.527   1.00 61.04  ?  27  TYR C CB  1 
ATOM 6727  C CG  . TYR C  1 19  ? 107.275 144.914  4.763   1.00 58.77  ?  27  TYR C CG  1 
ATOM 6728  C CD1 . TYR C  1 19  ? 108.348 144.132  5.172   1.00 59.59  ?  27  TYR C CD1 1 
ATOM 6729  C CD2 . TYR C  1 19  ? 106.592 144.537  3.612   1.00 57.88  ?  27  TYR C CD2 1 
ATOM 6730  C CE1 . TYR C  1 19  ? 108.715 142.998  4.469   1.00 57.56  ?  27  TYR C CE1 1 
ATOM 6731  C CE2 . TYR C  1 19  ? 106.952 143.405  2.904   1.00 56.18  ?  27  TYR C CE2 1 
ATOM 6732  C CZ  . TYR C  1 19  ? 108.013 142.640  3.337   1.00 54.72  ?  27  TYR C CZ  1 
ATOM 6733  O OH  . TYR C  1 19  ? 108.375 141.513  2.636   1.00 53.10  ?  27  TYR C OH  1 
ATOM 6734  N N   . VAL C  1 20  ? 104.105 144.302  6.907   1.00 58.95  ?  28  VAL C N   1 
ATOM 6735  C CA  . VAL C  1 20  ? 102.823 143.693  6.564   1.00 57.43  ?  28  VAL C CA  1 
ATOM 6736  C C   . VAL C  1 20  ? 102.035 143.554  7.860   1.00 56.93  ?  28  VAL C C   1 
ATOM 6737  O O   . VAL C  1 20  ? 102.239 142.600  8.620   1.00 59.17  ?  28  VAL C O   1 
ATOM 6738  C CB  . VAL C  1 20  ? 102.976 142.338  5.866   1.00 58.79  ?  28  VAL C CB  1 
ATOM 6739  C CG1 . VAL C  1 20  ? 101.609 141.790  5.493   1.00 57.26  ?  28  VAL C CG1 1 
ATOM 6740  C CG2 . VAL C  1 20  ? 103.853 142.467  4.632   1.00 59.68  ?  28  VAL C CG2 1 
ATOM 6741  N N   . THR C  1 21  ? 101.137 144.499  8.120   1.00 58.90  ?  29  THR C N   1 
ATOM 6742  C CA  . THR C  1 21  ? 100.301 144.440  9.309   1.00 58.16  ?  29  THR C CA  1 
ATOM 6743  C C   . THR C  1 21  ? 99.142  143.476  9.085   1.00 57.01  ?  29  THR C C   1 
ATOM 6744  O O   . THR C  1 21  ? 98.560  143.422  7.997   1.00 57.68  ?  29  THR C O   1 
ATOM 6745  C CB  . THR C  1 21  ? 99.771  145.829  9.666   1.00 52.52  ?  29  THR C CB  1 
ATOM 6746  O OG1 . THR C  1 21  ? 99.103  146.395  8.532   1.00 54.86  ?  29  THR C OG1 1 
ATOM 6747  C CG2 . THR C  1 21  ? 100.915 146.744  10.075  1.00 54.32  ?  29  THR C CG2 1 
ATOM 6748  N N   . ARG C  1 22  ? 98.809  142.713  10.122  1.00 53.94  ?  30  ARG C N   1 
ATOM 6749  C CA  . ARG C  1 22  ? 97.794  141.675  10.031  1.00 51.42  ?  30  ARG C CA  1 
ATOM 6750  C C   . ARG C  1 22  ? 96.479  142.161  10.627  1.00 52.72  ?  30  ARG C C   1 
ATOM 6751  O O   . ARG C  1 22  ? 96.442  143.060  11.471  1.00 60.86  ?  30  ARG C O   1 
ATOM 6752  C CB  . ARG C  1 22  ? 98.251  140.398  10.742  1.00 54.36  ?  30  ARG C CB  1 
ATOM 6753  C CG  . ARG C  1 22  ? 99.460  139.727  10.107  1.00 55.23  ?  30  ARG C CG  1 
ATOM 6754  C CD  . ARG C  1 22  ? 99.892  138.497  10.892  1.00 54.44  ?  30  ARG C CD  1 
ATOM 6755  N NE  . ARG C  1 22  ? 101.088 137.882  10.325  1.00 54.01  ?  30  ARG C NE  1 
ATOM 6756  C CZ  . ARG C  1 22  ? 101.069 136.904  9.424   1.00 53.97  ?  30  ARG C CZ  1 
ATOM 6757  N NH1 . ARG C  1 22  ? 99.912  136.429  8.985   1.00 52.87  1  30  ARG C NH1 1 
ATOM 6758  N NH2 . ARG C  1 22  ? 102.205 136.403  8.960   1.00 54.91  ?  30  ARG C NH2 1 
ATOM 6759  N N   . THR C  1 23  ? 95.393  141.546  10.173  1.00 49.31  ?  31  THR C N   1 
ATOM 6760  C CA  . THR C  1 23  ? 94.047  141.886  10.606  1.00 52.46  ?  31  THR C CA  1 
ATOM 6761  C C   . THR C  1 23  ? 93.404  140.685  11.288  1.00 54.26  ?  31  THR C C   1 
ATOM 6762  O O   . THR C  1 23  ? 93.955  139.582  11.311  1.00 57.58  ?  31  THR C O   1 
ATOM 6763  C CB  . THR C  1 23  ? 93.189  142.342  9.417   1.00 53.80  ?  31  THR C CB  1 
ATOM 6764  O OG1 . THR C  1 23  ? 92.850  141.211  8.607   1.00 52.43  ?  31  THR C OG1 1 
ATOM 6765  C CG2 . THR C  1 23  ? 93.949  143.344  8.564   1.00 55.58  ?  31  THR C CG2 1 
ATOM 6766  N N   . SER C  1 24  ? 92.217  140.910  11.846  1.00 58.03  ?  32  SER C N   1 
ATOM 6767  C CA  . SER C  1 24  ? 91.434  139.845  12.458  1.00 57.39  ?  32  SER C CA  1 
ATOM 6768  C C   . SER C  1 24  ? 90.498  139.169  11.465  1.00 57.87  ?  32  SER C C   1 
ATOM 6769  O O   . SER C  1 24  ? 89.682  138.334  11.867  1.00 58.68  ?  32  SER C O   1 
ATOM 6770  C CB  . SER C  1 24  ? 90.633  140.388  13.644  1.00 56.84  ?  32  SER C CB  1 
ATOM 6771  O OG  . SER C  1 24  ? 89.778  141.445  13.244  1.00 59.47  ?  32  SER C OG  1 
ATOM 6772  N N   . ILE C  1 25  ? 90.594  139.517  10.186  1.00 54.43  ?  33  ILE C N   1 
ATOM 6773  C CA  . ILE C  1 25  ? 89.776  138.895  9.151   1.00 52.92  ?  33  ILE C CA  1 
ATOM 6774  C C   . ILE C  1 25  ? 90.393  137.549  8.795   1.00 54.68  ?  33  ILE C C   1 
ATOM 6775  O O   . ILE C  1 25  ? 91.523  137.483  8.301   1.00 57.54  ?  33  ILE C O   1 
ATOM 6776  C CB  . ILE C  1 25  ? 89.673  139.797  7.914   1.00 51.23  ?  33  ILE C CB  1 
ATOM 6777  C CG1 . ILE C  1 25  ? 89.246  141.209  8.318   1.00 51.91  ?  33  ILE C CG1 1 
ATOM 6778  C CG2 . ILE C  1 25  ? 88.700  139.207  6.909   1.00 54.14  ?  33  ILE C CG2 1 
ATOM 6779  C CD1 . ILE C  1 25  ? 87.810  141.306  8.773   1.00 53.07  ?  33  ILE C CD1 1 
ATOM 6780  N N   . PHE C  1 26  ? 89.651  136.473  9.040   1.00 59.70  ?  34  PHE C N   1 
ATOM 6781  C CA  . PHE C  1 26  ? 90.115  135.123  8.761   1.00 54.01  ?  34  PHE C CA  1 
ATOM 6782  C C   . PHE C  1 26  ? 89.130  134.422  7.838   1.00 54.95  ?  34  PHE C C   1 
ATOM 6783  O O   . PHE C  1 26  ? 87.914  134.592  7.970   1.00 62.03  ?  34  PHE C O   1 
ATOM 6784  C CB  . PHE C  1 26  ? 90.272  134.320  10.055  1.00 53.03  ?  34  PHE C CB  1 
ATOM 6785  C CG  . PHE C  1 26  ? 91.360  134.826  10.954  1.00 51.99  ?  34  PHE C CG  1 
ATOM 6786  C CD1 . PHE C  1 26  ? 92.689  134.554  10.681  1.00 51.53  ?  34  PHE C CD1 1 
ATOM 6787  C CD2 . PHE C  1 26  ? 91.052  135.580  12.074  1.00 53.04  ?  34  PHE C CD2 1 
ATOM 6788  C CE1 . PHE C  1 26  ? 93.691  135.023  11.511  1.00 51.64  ?  34  PHE C CE1 1 
ATOM 6789  C CE2 . PHE C  1 26  ? 92.049  136.052  12.905  1.00 52.72  ?  34  PHE C CE2 1 
ATOM 6790  C CZ  . PHE C  1 26  ? 93.369  135.773  12.624  1.00 50.84  ?  34  PHE C CZ  1 
ATOM 6791  N N   . TYR C  1 27  ? 89.659  133.629  6.908   1.00 52.43  ?  35  TYR C N   1 
ATOM 6792  C CA  . TYR C  1 27  ? 88.842  132.854  5.987   1.00 50.99  ?  35  TYR C CA  1 
ATOM 6793  C C   . TYR C  1 27  ? 89.296  131.403  5.998   1.00 49.82  ?  35  TYR C C   1 
ATOM 6794  O O   . TYR C  1 27  ? 90.473  131.104  6.214   1.00 48.88  ?  35  TYR C O   1 
ATOM 6795  C CB  . TYR C  1 27  ? 88.910  133.384  4.544   1.00 50.77  ?  35  TYR C CB  1 
ATOM 6796  C CG  . TYR C  1 27  ? 88.042  134.588  4.251   1.00 53.91  ?  35  TYR C CG  1 
ATOM 6797  C CD1 . TYR C  1 27  ? 87.180  134.591  3.162   1.00 56.16  ?  35  TYR C CD1 1 
ATOM 6798  C CD2 . TYR C  1 27  ? 88.044  135.698  5.082   1.00 54.74  ?  35  TYR C CD2 1 
ATOM 6799  C CE1 . TYR C  1 27  ? 86.373  135.677  2.890   1.00 59.00  ?  35  TYR C CE1 1 
ATOM 6800  C CE2 . TYR C  1 27  ? 87.245  136.791  4.816   1.00 57.60  ?  35  TYR C CE2 1 
ATOM 6801  C CZ  . TYR C  1 27  ? 86.410  136.774  3.720   1.00 59.74  ?  35  TYR C CZ  1 
ATOM 6802  O OH  . TYR C  1 27  ? 85.606  137.858  3.454   1.00 65.18  ?  35  TYR C OH  1 
ATOM 6803  N N   . HIS C  1 28  ? 88.347  130.501  5.766   1.00 50.66  ?  36  HIS C N   1 
ATOM 6804  C CA  . HIS C  1 28  ? 88.644  129.089  5.572   1.00 48.79  ?  36  HIS C CA  1 
ATOM 6805  C C   . HIS C  1 28  ? 88.562  128.770  4.087   1.00 50.41  ?  36  HIS C C   1 
ATOM 6806  O O   . HIS C  1 28  ? 87.603  129.161  3.413   1.00 52.33  ?  36  HIS C O   1 
ATOM 6807  C CB  . HIS C  1 28  ? 87.681  128.196  6.355   1.00 53.10  ?  36  HIS C CB  1 
ATOM 6808  C CG  . HIS C  1 28  ? 87.792  126.743  6.005   1.00 51.94  ?  36  HIS C CG  1 
ATOM 6809  N ND1 . HIS C  1 28  ? 87.138  126.182  4.929   1.00 54.12  ?  36  HIS C ND1 1 
ATOM 6810  C CD2 . HIS C  1 28  ? 88.490  125.738  6.585   1.00 50.76  ?  36  HIS C CD2 1 
ATOM 6811  C CE1 . HIS C  1 28  ? 87.424  124.894  4.864   1.00 51.83  ?  36  HIS C CE1 1 
ATOM 6812  N NE2 . HIS C  1 28  ? 88.243  124.599  5.858   1.00 49.29  ?  36  HIS C NE2 1 
ATOM 6813  N N   . ALA C  1 29  ? 89.563  128.058  3.583   1.00 53.12  ?  37  ALA C N   1 
ATOM 6814  C CA  . ALA C  1 29  ? 89.600  127.641  2.191   1.00 58.05  ?  37  ALA C CA  1 
ATOM 6815  C C   . ALA C  1 29  ? 89.908  126.156  2.130   1.00 49.52  ?  37  ALA C C   1 
ATOM 6816  O O   . ALA C  1 29  ? 90.753  125.663  2.878   1.00 46.14  ?  37  ALA C O   1 
ATOM 6817  C CB  . ALA C  1 29  ? 90.648  128.428  1.400   1.00 54.59  ?  37  ALA C CB  1 
ATOM 6818  N N   . GLY C  1 30  ? 89.220  125.443  1.247   1.00 51.11  ?  38  GLY C N   1 
ATOM 6819  C CA  . GLY C  1 30  ? 89.436  124.015  1.167   1.00 49.07  ?  38  GLY C CA  1 
ATOM 6820  C C   . GLY C  1 30  ? 89.038  123.380  -0.146  1.00 49.81  ?  38  GLY C C   1 
ATOM 6821  O O   . GLY C  1 30  ? 87.967  123.663  -0.691  1.00 52.66  ?  38  GLY C O   1 
ATOM 6822  N N   . SER C  1 31  ? 89.911  122.528  -0.670  1.00 54.44  ?  39  SER C N   1 
ATOM 6823  C CA  . SER C  1 31  ? 89.561  121.716  -1.820  1.00 54.85  ?  39  SER C CA  1 
ATOM 6824  C C   . SER C  1 31  ? 88.604  120.609  -1.398  1.00 58.19  ?  39  SER C C   1 
ATOM 6825  O O   . SER C  1 31  ? 88.536  120.221  -0.228  1.00 59.04  ?  39  SER C O   1 
ATOM 6826  C CB  . SER C  1 31  ? 90.809  121.101  -2.449  1.00 49.19  ?  39  SER C CB  1 
ATOM 6827  O OG  . SER C  1 31  ? 91.451  120.221  -1.540  1.00 48.82  ?  39  SER C OG  1 
ATOM 6828  N N   . SER C  1 32  ? 87.852  120.102  -2.364  1.00 56.74  ?  40  SER C N   1 
ATOM 6829  C CA  . SER C  1 32  ? 87.058  118.906  -2.127  1.00 60.70  ?  40  SER C CA  1 
ATOM 6830  C C   . SER C  1 32  ? 88.004  117.709  -2.062  1.00 59.31  ?  40  SER C C   1 
ATOM 6831  O O   . SER C  1 32  ? 89.231  117.846  -2.035  1.00 60.26  ?  40  SER C O   1 
ATOM 6832  C CB  . SER C  1 32  ? 85.994  118.750  -3.208  1.00 70.90  ?  40  SER C CB  1 
ATOM 6833  O OG  . SER C  1 32  ? 85.181  117.616  -2.961  1.00 75.59  ?  40  SER C OG  1 
ATOM 6834  N N   . ARG C  1 33  ? 87.439  116.508  -2.040  1.00 59.73  ?  41  ARG C N   1 
ATOM 6835  C CA  . ARG C  1 33  ? 88.264  115.312  -2.072  1.00 50.56  ?  41  ARG C CA  1 
ATOM 6836  C C   . ARG C  1 33  ? 88.992  115.228  -3.406  1.00 49.77  ?  41  ARG C C   1 
ATOM 6837  O O   . ARG C  1 33  ? 88.370  115.298  -4.470  1.00 57.00  ?  41  ARG C O   1 
ATOM 6838  C CB  . ARG C  1 33  ? 87.408  114.069  -1.845  1.00 49.12  ?  41  ARG C CB  1 
ATOM 6839  C CG  . ARG C  1 33  ? 88.152  112.757  -1.995  1.00 46.78  ?  41  ARG C CG  1 
ATOM 6840  C CD  . ARG C  1 33  ? 87.427  111.655  -1.249  1.00 49.83  ?  41  ARG C CD  1 
ATOM 6841  N NE  . ARG C  1 33  ? 85.997  111.657  -1.539  1.00 55.73  ?  41  ARG C NE  1 
ATOM 6842  C CZ  . ARG C  1 33  ? 85.106  110.912  -0.895  1.00 56.16  ?  41  ARG C CZ  1 
ATOM 6843  N NH1 . ARG C  1 33  ? 85.498  110.103  0.080   1.00 55.31  1  41  ARG C NH1 1 
ATOM 6844  N NH2 . ARG C  1 33  ? 83.822  110.978  -1.224  1.00 57.17  ?  41  ARG C NH2 1 
ATOM 6845  N N   . LEU C  1 34  ? 90.313  115.100  -3.348  1.00 48.75  ?  42  LEU C N   1 
ATOM 6846  C CA  . LEU C  1 34  ? 91.138  114.912  -4.533  1.00 47.47  ?  42  LEU C CA  1 
ATOM 6847  C C   . LEU C  1 34  ? 91.620  113.471  -4.560  1.00 45.92  ?  42  LEU C C   1 
ATOM 6848  O O   . LEU C  1 34  ? 92.067  112.950  -3.539  1.00 43.85  ?  42  LEU C O   1 
ATOM 6849  C CB  . LEU C  1 34  ? 92.332  115.867  -4.528  1.00 47.18  ?  42  LEU C CB  1 
ATOM 6850  C CG  . LEU C  1 34  ? 92.009  117.352  -4.368  1.00 48.69  ?  42  LEU C CG  1 
ATOM 6851  C CD1 . LEU C  1 34  ? 93.266  118.137  -4.025  1.00 47.19  ?  42  LEU C CD1 1 
ATOM 6852  C CD2 . LEU C  1 34  ? 91.364  117.894  -5.631  1.00 51.15  ?  42  LEU C CD2 1 
ATOM 6853  N N   . LEU C  1 35  ? 91.518  112.818  -5.712  1.00 46.45  ?  43  LEU C N   1 
ATOM 6854  C CA  . LEU C  1 35  ? 92.012  111.454  -5.809  1.00 45.73  ?  43  LEU C CA  1 
ATOM 6855  C C   . LEU C  1 35  ? 92.592  111.215  -7.192  1.00 47.60  ?  43  LEU C C   1 
ATOM 6856  O O   . LEU C  1 35  ? 92.176  111.832  -8.176  1.00 51.25  ?  43  LEU C O   1 
ATOM 6857  C CB  . LEU C  1 35  ? 90.918  110.417  -5.495  1.00 41.41  ?  43  LEU C CB  1 
ATOM 6858  C CG  . LEU C  1 35  ? 89.541  110.501  -6.154  1.00 43.24  ?  43  LEU C CG  1 
ATOM 6859  C CD1 . LEU C  1 35  ? 89.547  109.911  -7.557  1.00 44.24  ?  43  LEU C CD1 1 
ATOM 6860  C CD2 . LEU C  1 35  ? 88.516  109.795  -5.284  1.00 44.07  ?  43  LEU C CD2 1 
ATOM 6861  N N   . THR C  1 36  ? 93.566  110.312  -7.249  1.00 46.79  ?  44  THR C N   1 
ATOM 6862  C CA  . THR C  1 36  ? 94.176  109.922  -8.511  1.00 44.61  ?  44  THR C CA  1 
ATOM 6863  C C   . THR C  1 36  ? 94.542  108.449  -8.437  1.00 43.64  ?  44  THR C C   1 
ATOM 6864  O O   . THR C  1 36  ? 95.098  107.993  -7.433  1.00 47.77  ?  44  THR C O   1 
ATOM 6865  C CB  . THR C  1 36  ? 95.412  110.775  -8.821  1.00 43.82  ?  44  THR C CB  1 
ATOM 6866  O OG1 . THR C  1 36  ? 96.110  110.222  -9.945  1.00 46.72  ?  44  THR C OG1 1 
ATOM 6867  C CG2 . THR C  1 36  ? 96.346  110.844  -7.618  1.00 39.85  ?  44  THR C CG2 1 
ATOM 6868  N N   . VAL C  1 37  ? 94.201  107.708  -9.487  1.00 41.56  ?  45  VAL C N   1 
ATOM 6869  C CA  . VAL C  1 37  ? 94.542  106.298  -9.595  1.00 41.69  ?  45  VAL C CA  1 
ATOM 6870  C C   . VAL C  1 37  ? 95.449  106.130  -10.804 1.00 41.88  ?  45  VAL C C   1 
ATOM 6871  O O   . VAL C  1 37  ? 95.452  106.949  -11.727 1.00 43.78  ?  45  VAL C O   1 
ATOM 6872  C CB  . VAL C  1 37  ? 93.293  105.400  -9.716  1.00 38.16  ?  45  VAL C CB  1 
ATOM 6873  C CG1 . VAL C  1 37  ? 92.235  105.833  -8.718  1.00 38.21  ?  45  VAL C CG1 1 
ATOM 6874  C CG2 . VAL C  1 37  ? 92.741  105.434  -11.131 1.00 38.70  ?  45  VAL C CG2 1 
ATOM 6875  N N   . GLY C  1 38  ? 96.234  105.062  -10.791 1.00 41.35  ?  46  GLY C N   1 
ATOM 6876  C CA  . GLY C  1 38  ? 97.092  104.799  -11.929 1.00 45.90  ?  46  GLY C CA  1 
ATOM 6877  C C   . GLY C  1 38  ? 97.981  103.603  -11.701 1.00 46.52  ?  46  GLY C C   1 
ATOM 6878  O O   . GLY C  1 38  ? 97.732  102.785  -10.816 1.00 47.06  ?  46  GLY C O   1 
ATOM 6879  N N   . HIS C  1 39  ? 99.021  103.503  -12.521 1.00 45.39  ?  47  HIS C N   1 
ATOM 6880  C CA  . HIS C  1 39  ? 99.905  102.371  -12.279 1.00 42.74  ?  47  HIS C CA  1 
ATOM 6881  C C   . HIS C  1 39  ? 101.039 102.784  -11.345 1.00 42.62  ?  47  HIS C C   1 
ATOM 6882  O O   . HIS C  1 39  ? 101.576 103.888  -11.473 1.00 43.66  ?  47  HIS C O   1 
ATOM 6883  C CB  . HIS C  1 39  ? 100.478 101.843  -13.589 1.00 38.60  ?  47  HIS C CB  1 
ATOM 6884  C CG  . HIS C  1 39  ? 101.083 100.479  -13.478 1.00 38.44  ?  47  HIS C CG  1 
ATOM 6885  N ND1 . HIS C  1 39  ? 102.397 100.274  -13.117 1.00 37.53  ?  47  HIS C ND1 1 
ATOM 6886  C CD2 . HIS C  1 39  ? 100.553 99.250   -13.681 1.00 47.93  ?  47  HIS C CD2 1 
ATOM 6887  C CE1 . HIS C  1 39  ? 102.650 98.978   -13.100 1.00 45.80  ?  47  HIS C CE1 1 
ATOM 6888  N NE2 . HIS C  1 39  ? 101.548 98.333   -13.439 1.00 45.30  ?  47  HIS C NE2 1 
ATOM 6889  N N   . PRO C  1 40  ? 101.413 101.931  -10.389 1.00 38.87  ?  48  PRO C N   1 
ATOM 6890  C CA  . PRO C  1 40  ? 102.421 102.342  -9.401  1.00 38.45  ?  48  PRO C CA  1 
ATOM 6891  C C   . PRO C  1 40  ? 103.839 102.383  -9.942  1.00 38.34  ?  48  PRO C C   1 
ATOM 6892  O O   . PRO C  1 40  ? 104.695 103.027  -9.324  1.00 38.07  ?  48  PRO C O   1 
ATOM 6893  C CB  . PRO C  1 40  ? 102.281 101.283  -8.301  1.00 38.88  ?  48  PRO C CB  1 
ATOM 6894  C CG  . PRO C  1 40  ? 101.794 100.073  -9.028  1.00 42.17  ?  48  PRO C CG  1 
ATOM 6895  C CD  . PRO C  1 40  ? 100.884 100.584  -10.113 1.00 40.83  ?  48  PRO C CD  1 
ATOM 6896  N N   . TYR C  1 41  ? 104.121 101.731  -11.067 1.00 40.67  ?  49  TYR C N   1 
ATOM 6897  C CA  . TYR C  1 41  ? 105.489 101.591  -11.553 1.00 41.80  ?  49  TYR C CA  1 
ATOM 6898  C C   . TYR C  1 41  ? 105.785 102.406  -12.802 1.00 47.80  ?  49  TYR C C   1 
ATOM 6899  O O   . TYR C  1 41  ? 106.886 102.945  -12.927 1.00 52.88  ?  49  TYR C O   1 
ATOM 6900  C CB  . TYR C  1 41  ? 105.804 100.116  -11.837 1.00 43.76  ?  49  TYR C CB  1 
ATOM 6901  C CG  . TYR C  1 41  ? 105.622 99.190   -10.653 1.00 42.52  ?  49  TYR C CG  1 
ATOM 6902  C CD1 . TYR C  1 41  ? 105.744 99.655   -9.351  1.00 44.15  ?  49  TYR C CD1 1 
ATOM 6903  C CD2 . TYR C  1 41  ? 105.324 97.847   -10.842 1.00 48.38  ?  49  TYR C CD2 1 
ATOM 6904  C CE1 . TYR C  1 41  ? 105.576 98.811   -8.269  1.00 46.19  ?  49  TYR C CE1 1 
ATOM 6905  C CE2 . TYR C  1 41  ? 105.154 96.995   -9.767  1.00 54.30  ?  49  TYR C CE2 1 
ATOM 6906  C CZ  . TYR C  1 41  ? 105.281 97.482   -8.483  1.00 53.36  ?  49  TYR C CZ  1 
ATOM 6907  O OH  . TYR C  1 41  ? 105.112 96.637   -7.411  1.00 57.26  ?  49  TYR C OH  1 
ATOM 6908  N N   . PHE C  1 42  ? 104.837 102.519  -13.729 1.00 39.83  ?  50  PHE C N   1 
ATOM 6909  C CA  . PHE C  1 42  ? 105.112 103.160  -15.008 1.00 41.58  ?  50  PHE C CA  1 
ATOM 6910  C C   . PHE C  1 42  ? 103.799 103.528  -15.679 1.00 44.14  ?  50  PHE C C   1 
ATOM 6911  O O   . PHE C  1 42  ? 102.755 102.930  -15.412 1.00 49.14  ?  50  PHE C O   1 
ATOM 6912  C CB  . PHE C  1 42  ? 105.936 102.248  -15.925 1.00 45.38  ?  50  PHE C CB  1 
ATOM 6913  C CG  . PHE C  1 42  ? 105.431 100.832  -15.983 1.00 43.70  ?  50  PHE C CG  1 
ATOM 6914  C CD1 . PHE C  1 42  ? 104.313 100.507  -16.737 1.00 44.49  ?  50  PHE C CD1 1 
ATOM 6915  C CD2 . PHE C  1 42  ? 106.075 99.824   -15.286 1.00 41.30  ?  50  PHE C CD2 1 
ATOM 6916  C CE1 . PHE C  1 42  ? 103.848 99.205   -16.791 1.00 45.12  ?  50  PHE C CE1 1 
ATOM 6917  C CE2 . PHE C  1 42  ? 105.613 98.521   -15.335 1.00 41.72  ?  50  PHE C CE2 1 
ATOM 6918  C CZ  . PHE C  1 42  ? 104.499 98.212   -16.090 1.00 43.71  ?  50  PHE C CZ  1 
ATOM 6919  N N   . LYS C  1 43  ? 103.871 104.519  -16.563 1.00 41.47  ?  51  LYS C N   1 
ATOM 6920  C CA  . LYS C  1 43  ? 102.734 104.864  -17.405 1.00 43.08  ?  51  LYS C CA  1 
ATOM 6921  C C   . LYS C  1 43  ? 102.441 103.728  -18.377 1.00 49.56  ?  51  LYS C C   1 
ATOM 6922  O O   . LYS C  1 43  ? 103.341 103.241  -19.067 1.00 50.63  ?  51  LYS C O   1 
ATOM 6923  C CB  . LYS C  1 43  ? 103.012 106.153  -18.175 1.00 41.63  ?  51  LYS C CB  1 
ATOM 6924  C CG  . LYS C  1 43  ? 101.893 106.560  -19.120 1.00 45.68  ?  51  LYS C CG  1 
ATOM 6925  C CD  . LYS C  1 43  ? 102.382 107.558  -20.158 1.00 56.22  ?  51  LYS C CD  1 
ATOM 6926  C CE  . LYS C  1 43  ? 102.847 108.857  -19.522 1.00 59.95  ?  51  LYS C CE  1 
ATOM 6927  N NZ  . LYS C  1 43  ? 103.287 109.846  -20.550 1.00 63.50  1  51  LYS C NZ  1 
ATOM 6928  N N   . VAL C  1 44  ? 101.186 103.292  -18.420 1.00 50.94  ?  52  VAL C N   1 
ATOM 6929  C CA  . VAL C  1 44  ? 100.792 102.209  -19.318 1.00 52.52  ?  52  VAL C CA  1 
ATOM 6930  C C   . VAL C  1 44  ? 99.979  102.793  -20.467 1.00 55.50  ?  52  VAL C C   1 
ATOM 6931  O O   . VAL C  1 44  ? 98.797  103.120  -20.285 1.00 55.28  ?  52  VAL C O   1 
ATOM 6932  C CB  . VAL C  1 44  ? 99.996  101.125  -18.575 1.00 49.54  ?  52  VAL C CB  1 
ATOM 6933  C CG1 . VAL C  1 44  ? 99.744  99.934   -19.483 1.00 54.30  ?  52  VAL C CG1 1 
ATOM 6934  C CG2 . VAL C  1 44  ? 100.728 100.699  -17.316 1.00 47.75  ?  52  VAL C CG2 1 
ATOM 6935  N N   . PRO C  1 45  ? 100.561 102.945  -21.656 1.00 57.93  ?  53  PRO C N   1 
ATOM 6936  C CA  . PRO C  1 45  ? 99.793  103.469  -22.791 1.00 61.74  ?  53  PRO C CA  1 
ATOM 6937  C C   . PRO C  1 45  ? 98.877  102.408  -23.378 1.00 68.10  ?  53  PRO C C   1 
ATOM 6938  O O   . PRO C  1 45  ? 99.262  101.249  -23.553 1.00 70.67  ?  53  PRO C O   1 
ATOM 6939  C CB  . PRO C  1 45  ? 100.881 103.881  -23.790 1.00 57.53  ?  53  PRO C CB  1 
ATOM 6940  C CG  . PRO C  1 45  ? 102.010 102.957  -23.492 1.00 58.58  ?  53  PRO C CG  1 
ATOM 6941  C CD  . PRO C  1 45  ? 101.973 102.709  -22.004 1.00 58.26  ?  53  PRO C CD  1 
ATOM 6942  N N   . LYS C  1 46  ? 97.648  102.820  -23.687 1.00 65.65  ?  54  LYS C N   1 
ATOM 6943  C CA  . LYS C  1 46  ? 96.677  101.962  -24.355 1.00 74.18  ?  54  LYS C CA  1 
ATOM 6944  C C   . LYS C  1 46  ? 96.176  102.674  -25.601 1.00 77.22  ?  54  LYS C C   1 
ATOM 6945  O O   . LYS C  1 46  ? 95.603  103.765  -25.505 1.00 81.17  ?  54  LYS C O   1 
ATOM 6946  C CB  . LYS C  1 46  ? 95.509  101.626  -23.422 1.00 58.87  ?  54  LYS C CB  1 
ATOM 6947  C CG  . LYS C  1 46  ? 95.919  101.255  -22.001 1.00 65.68  ?  54  LYS C CG  1 
ATOM 6948  C CD  . LYS C  1 46  ? 96.774  99.998   -21.974 1.00 66.54  ?  54  LYS C CD  1 
ATOM 6949  C CE  . LYS C  1 46  ? 96.096  98.873   -21.207 1.00 63.92  ?  54  LYS C CE  1 
ATOM 6950  N NZ  . LYS C  1 46  ? 95.913  99.206   -19.769 1.00 59.14  1  54  LYS C NZ  1 
ATOM 6951  N N   . GLY C  1 47  ? 96.389  102.060  -26.763 1.00 78.06  ?  55  GLY C N   1 
ATOM 6952  C CA  . GLY C  1 47  ? 95.981  102.650  -28.023 1.00 80.89  ?  55  GLY C CA  1 
ATOM 6953  C C   . GLY C  1 47  ? 94.483  102.837  -28.143 1.00 85.04  ?  55  GLY C C   1 
ATOM 6954  O O   . GLY C  1 47  ? 93.727  101.862  -28.094 1.00 86.32  ?  55  GLY C O   1 
ATOM 6955  N N   . GLY C  1 48  ? 94.038  104.081  -28.304 1.00 95.47  ?  56  GLY C N   1 
ATOM 6956  C CA  . GLY C  1 48  ? 92.621  104.354  -28.438 1.00 106.17 ?  56  GLY C CA  1 
ATOM 6957  C C   . GLY C  1 48  ? 92.213  104.810  -29.827 1.00 115.30 ?  56  GLY C C   1 
ATOM 6958  O O   . GLY C  1 48  ? 92.791  104.314  -30.799 1.00 118.73 ?  56  GLY C O   1 
ATOM 6959  N N   . ASN C  1 49  ? 91.251  105.734  -29.980 1.00 123.85 ?  57  ASN C N   1 
ATOM 6960  C CA  . ASN C  1 49  ? 90.496  106.444  -28.928 1.00 122.33 ?  57  ASN C CA  1 
ATOM 6961  C C   . ASN C  1 49  ? 91.399  107.129  -27.897 1.00 115.55 ?  57  ASN C C   1 
ATOM 6962  O O   . ASN C  1 49  ? 91.201  107.001  -26.688 1.00 111.52 ?  57  ASN C O   1 
ATOM 6963  C CB  . ASN C  1 49  ? 89.511  105.491  -28.232 1.00 123.61 ?  57  ASN C CB  1 
ATOM 6964  C CG  . ASN C  1 49  ? 88.417  106.226  -27.478 1.00 127.37 ?  57  ASN C CG  1 
ATOM 6965  O OD1 . ASN C  1 49  ? 88.285  107.445  -27.583 1.00 129.78 ?  57  ASN C OD1 1 
ATOM 6966  N ND2 . ASN C  1 49  ? 87.622  105.482  -26.715 1.00 126.56 ?  57  ASN C ND2 1 
ATOM 6967  N N   . GLY C  1 50  ? 92.394  107.852  -28.401 1.00 117.80 ?  58  GLY C N   1 
ATOM 6968  C CA  . GLY C  1 50  ? 93.387  108.501  -27.570 1.00 114.63 ?  58  GLY C CA  1 
ATOM 6969  C C   . GLY C  1 50  ? 92.873  109.584  -26.641 1.00 114.34 ?  58  GLY C C   1 
ATOM 6970  O O   . GLY C  1 50  ? 92.293  110.571  -27.104 1.00 116.14 ?  58  GLY C O   1 
ATOM 6971  N N   . ARG C  1 51  ? 93.070  109.421  -25.332 1.00 111.55 ?  59  ARG C N   1 
ATOM 6972  C CA  . ARG C  1 51  ? 93.741  108.255  -24.757 1.00 104.41 ?  59  ARG C CA  1 
ATOM 6973  C C   . ARG C  1 51  ? 93.027  107.781  -23.492 1.00 93.51  ?  59  ARG C C   1 
ATOM 6974  O O   . ARG C  1 51  ? 92.580  108.591  -22.679 1.00 86.85  ?  59  ARG C O   1 
ATOM 6975  C CB  . ARG C  1 51  ? 95.212  108.558  -24.428 1.00 99.99  ?  59  ARG C CB  1 
ATOM 6976  C CG  . ARG C  1 51  ? 96.126  108.692  -25.637 1.00 106.15 ?  59  ARG C CG  1 
ATOM 6977  C CD  . ARG C  1 51  ? 97.594  108.625  -25.261 1.00 107.59 ?  59  ARG C CD  1 
ATOM 6978  N NE  . ARG C  1 51  ? 98.435  108.406  -26.435 1.00 110.66 ?  59  ARG C NE  1 
ATOM 6979  C CZ  . ARG C  1 51  ? 98.615  107.223  -27.017 1.00 109.44 ?  59  ARG C CZ  1 
ATOM 6980  N NH1 . ARG C  1 51  ? 98.012  106.144  -26.535 1.00 107.42 1  59  ARG C NH1 1 
ATOM 6981  N NH2 . ARG C  1 51  ? 99.398  107.119  -28.083 1.00 110.35 ?  59  ARG C NH2 1 
ATOM 6982  N N   . GLN C  1 52  ? 92.916  106.464  -23.335 1.00 90.93  ?  60  GLN C N   1 
ATOM 6983  C CA  . GLN C  1 52  ? 92.496  105.851  -22.078 1.00 80.36  ?  60  GLN C CA  1 
ATOM 6984  C C   . GLN C  1 52  ? 93.677  105.258  -21.322 1.00 71.44  ?  60  GLN C C   1 
ATOM 6985  O O   . GLN C  1 52  ? 93.549  104.218  -20.672 1.00 72.09  ?  60  GLN C O   1 
ATOM 6986  C CB  . GLN C  1 52  ? 91.436  104.783  -22.328 1.00 81.37  ?  60  GLN C CB  1 
ATOM 6987  C CG  . GLN C  1 52  ? 90.506  105.073  -23.492 1.00 90.38  ?  60  GLN C CG  1 
ATOM 6988  C CD  . GLN C  1 52  ? 90.849  104.257  -24.724 1.00 99.24  ?  60  GLN C CD  1 
ATOM 6989  O OE1 . GLN C  1 52  ? 92.021  104.054  -25.042 1.00 99.47  ?  60  GLN C OE1 1 
ATOM 6990  N NE2 . GLN C  1 52  ? 89.825  103.778  -25.420 1.00 104.69 ?  60  GLN C NE2 1 
ATOM 6991  N N   . ASP C  1 53  ? 94.845  105.889  -21.406 1.00 64.19  ?  61  ASP C N   1 
ATOM 6992  C CA  . ASP C  1 53  ? 96.023  105.369  -20.729 1.00 65.19  ?  61  ASP C CA  1 
ATOM 6993  C C   . ASP C  1 53  ? 95.933  105.622  -19.228 1.00 67.94  ?  61  ASP C C   1 
ATOM 6994  O O   . ASP C  1 53  ? 95.259  106.549  -18.771 1.00 71.89  ?  61  ASP C O   1 
ATOM 6995  C CB  . ASP C  1 53  ? 97.287  106.023  -21.285 1.00 67.14  ?  61  ASP C CB  1 
ATOM 6996  C CG  . ASP C  1 53  ? 97.369  105.945  -22.798 1.00 82.90  ?  61  ASP C CG  1 
ATOM 6997  O OD1 . ASP C  1 53  ? 96.348  105.602  -23.432 1.00 90.24  ?  61  ASP C OD1 1 
ATOM 6998  O OD2 . ASP C  1 53  ? 98.451  106.227  -23.354 1.00 87.13  -1 61  ASP C OD2 1 
ATOM 6999  N N   . VAL C  1 54  ? 96.624  104.788  -18.458 1.00 54.04  ?  62  VAL C N   1 
ATOM 7000  C CA  . VAL C  1 54  ? 96.749  105.017  -17.020 1.00 52.16  ?  62  VAL C CA  1 
ATOM 7001  C C   . VAL C  1 54  ? 98.091  105.693  -16.761 1.00 50.72  ?  62  VAL C C   1 
ATOM 7002  O O   . VAL C  1 54  ? 99.106  105.317  -17.367 1.00 53.74  ?  62  VAL C O   1 
ATOM 7003  C CB  . VAL C  1 54  ? 96.589  103.716  -16.212 1.00 52.01  ?  62  VAL C CB  1 
ATOM 7004  C CG1 . VAL C  1 54  ? 95.307  103.000  -16.606 1.00 55.38  ?  62  VAL C CG1 1 
ATOM 7005  C CG2 . VAL C  1 54  ? 97.783  102.801  -16.382 1.00 51.75  ?  62  VAL C CG2 1 
ATOM 7006  N N   . PRO C  1 55  ? 98.139  106.715  -15.917 1.00 47.06  ?  63  PRO C N   1 
ATOM 7007  C CA  . PRO C  1 55  ? 99.401  107.398  -15.639 1.00 45.47  ?  63  PRO C CA  1 
ATOM 7008  C C   . PRO C  1 55  ? 100.165 106.695  -14.523 1.00 44.37  ?  63  PRO C C   1 
ATOM 7009  O O   . PRO C  1 55  ? 99.672  105.765  -13.881 1.00 44.98  ?  63  PRO C O   1 
ATOM 7010  C CB  . PRO C  1 55  ? 98.944  108.792  -15.197 1.00 46.70  ?  63  PRO C CB  1 
ATOM 7011  C CG  . PRO C  1 55  ? 97.637  108.530  -14.523 1.00 46.71  ?  63  PRO C CG  1 
ATOM 7012  C CD  . PRO C  1 55  ? 96.995  107.387  -15.277 1.00 48.52  ?  63  PRO C CD  1 
ATOM 7013  N N   . LYS C  1 56  ? 101.391 107.159  -14.305 1.00 39.99  ?  64  LYS C N   1 
ATOM 7014  C CA  . LYS C  1 56  ? 102.210 106.646  -13.215 1.00 39.53  ?  64  LYS C CA  1 
ATOM 7015  C C   . LYS C  1 56  ? 101.774 107.325  -11.925 1.00 39.27  ?  64  LYS C C   1 
ATOM 7016  O O   . LYS C  1 56  ? 102.010 108.522  -11.733 1.00 39.21  ?  64  LYS C O   1 
ATOM 7017  C CB  . LYS C  1 56  ? 103.692 106.883  -13.488 1.00 42.60  ?  64  LYS C CB  1 
ATOM 7018  C CG  . LYS C  1 56  ? 104.613 106.257  -12.451 1.00 41.52  ?  64  LYS C CG  1 
ATOM 7019  C CD  . LYS C  1 56  ? 106.068 106.601  -12.717 1.00 41.44  ?  64  LYS C CD  1 
ATOM 7020  C CE  . LYS C  1 56  ? 106.978 105.963  -11.684 1.00 40.57  ?  64  LYS C CE  1 
ATOM 7021  N NZ  . LYS C  1 56  ? 108.403 106.332  -11.897 1.00 41.42  1  64  LYS C NZ  1 
ATOM 7022  N N   . VAL C  1 57  ? 101.122 106.569  -11.049 1.00 42.14  ?  65  VAL C N   1 
ATOM 7023  C CA  . VAL C  1 57  ? 100.656 107.066  -9.761  1.00 40.20  ?  65  VAL C CA  1 
ATOM 7024  C C   . VAL C  1 57  ? 101.300 106.183  -8.702  1.00 38.32  ?  65  VAL C C   1 
ATOM 7025  O O   . VAL C  1 57  ? 100.812 105.086  -8.410  1.00 39.18  ?  65  VAL C O   1 
ATOM 7026  C CB  . VAL C  1 57  ? 99.129  107.057  -9.650  1.00 39.77  ?  65  VAL C CB  1 
ATOM 7027  C CG1 . VAL C  1 57  ? 98.698  107.565  -8.283  1.00 38.26  ?  65  VAL C CG1 1 
ATOM 7028  C CG2 . VAL C  1 57  ? 98.522  107.903  -10.755 1.00 48.30  ?  65  VAL C CG2 1 
ATOM 7029  N N   . SER C  1 58  ? 102.408 106.648  -8.137  1.00 41.62  ?  66  SER C N   1 
ATOM 7030  C CA  . SER C  1 58  ? 103.150 105.908  -7.130  1.00 41.07  ?  66  SER C CA  1 
ATOM 7031  C C   . SER C  1 58  ? 103.046 106.605  -5.780  1.00 45.05  ?  66  SER C C   1 
ATOM 7032  O O   . SER C  1 58  ? 102.975 107.835  -5.699  1.00 51.47  ?  66  SER C O   1 
ATOM 7033  C CB  . SER C  1 58  ? 104.625 105.770  -7.526  1.00 42.04  ?  66  SER C CB  1 
ATOM 7034  O OG  . SER C  1 58  ? 105.274 104.775  -6.753  1.00 40.31  ?  66  SER C OG  1 
ATOM 7035  N N   . ALA C  1 59  ? 103.027 105.802  -4.715  1.00 43.12  ?  67  ALA C N   1 
ATOM 7036  C CA  . ALA C  1 59  ? 103.052 106.365  -3.373  1.00 40.30  ?  67  ALA C CA  1 
ATOM 7037  C C   . ALA C  1 59  ? 104.375 107.048  -3.065  1.00 39.56  ?  67  ALA C C   1 
ATOM 7038  O O   . ALA C  1 59  ? 104.457 107.812  -2.098  1.00 44.36  ?  67  ALA C O   1 
ATOM 7039  C CB  . ALA C  1 59  ? 102.779 105.276  -2.338  1.00 45.61  ?  67  ALA C CB  1 
ATOM 7040  N N   . TYR C  1 60  ? 105.408 106.790  -3.863  1.00 37.22  ?  68  TYR C N   1 
ATOM 7041  C CA  . TYR C  1 60  ? 106.716 107.420  -3.709  1.00 42.00  ?  68  TYR C CA  1 
ATOM 7042  C C   . TYR C  1 60  ? 106.906 108.562  -4.697  1.00 48.83  ?  68  TYR C C   1 
ATOM 7043  O O   . TYR C  1 60  ? 108.001 108.778  -5.224  1.00 53.46  ?  68  TYR C O   1 
ATOM 7044  C CB  . TYR C  1 60  ? 107.817 106.375  -3.848  1.00 38.84  ?  68  TYR C CB  1 
ATOM 7045  C CG  . TYR C  1 60  ? 107.608 105.203  -2.918  1.00 38.05  ?  68  TYR C CG  1 
ATOM 7046  C CD1 . TYR C  1 60  ? 108.017 105.263  -1.594  1.00 37.37  ?  68  TYR C CD1 1 
ATOM 7047  C CD2 . TYR C  1 60  ? 106.985 104.044  -3.359  1.00 38.28  ?  68  TYR C CD2 1 
ATOM 7048  C CE1 . TYR C  1 60  ? 107.815 104.205  -0.735  1.00 37.19  ?  68  TYR C CE1 1 
ATOM 7049  C CE2 . TYR C  1 60  ? 106.783 102.976  -2.510  1.00 46.64  ?  68  TYR C CE2 1 
ATOM 7050  C CZ  . TYR C  1 60  ? 107.201 103.060  -1.199  1.00 48.99  ?  68  TYR C CZ  1 
ATOM 7051  O OH  . TYR C  1 60  ? 107.000 101.994  -0.351  1.00 51.10  ?  68  TYR C OH  1 
ATOM 7052  N N   . GLN C  1 61  ? 105.831 109.294  -4.971  1.00 47.22  ?  69  GLN C N   1 
ATOM 7053  C CA  . GLN C  1 61  ? 105.853 110.466  -5.833  1.00 47.80  ?  69  GLN C CA  1 
ATOM 7054  C C   . GLN C  1 61  ? 105.630 111.725  -5.007  1.00 43.88  ?  69  GLN C C   1 
ATOM 7055  O O   . GLN C  1 61  ? 104.859 111.718  -4.043  1.00 43.24  ?  69  GLN C O   1 
ATOM 7056  C CB  . GLN C  1 61  ? 104.774 110.375  -6.917  1.00 41.79  ?  69  GLN C CB  1 
ATOM 7057  C CG  . GLN C  1 61  ? 105.193 109.645  -8.178  1.00 41.71  ?  69  GLN C CG  1 
ATOM 7058  C CD  . GLN C  1 61  ? 104.068 109.560  -9.189  1.00 42.49  ?  69  GLN C CD  1 
ATOM 7059  O OE1 . GLN C  1 61  ? 102.890 109.578  -8.830  1.00 42.53  ?  69  GLN C OE1 1 
ATOM 7060  N NE2 . GLN C  1 61  ? 104.426 109.480  -10.463 1.00 43.31  ?  69  GLN C NE2 1 
ATOM 7061  N N   . TYR C  1 62  ? 106.309 112.804  -5.389  1.00 46.09  ?  70  TYR C N   1 
ATOM 7062  C CA  . TYR C  1 62  ? 106.043 114.105  -4.791  1.00 42.90  ?  70  TYR C CA  1 
ATOM 7063  C C   . TYR C  1 62  ? 104.676 114.611  -5.232  1.00 45.48  ?  70  TYR C C   1 
ATOM 7064  O O   . TYR C  1 62  ? 104.340 114.567  -6.420  1.00 46.71  ?  70  TYR C O   1 
ATOM 7065  C CB  . TYR C  1 62  ? 107.122 115.111  -5.189  1.00 37.79  ?  70  TYR C CB  1 
ATOM 7066  C CG  . TYR C  1 62  ? 108.403 115.021  -4.396  1.00 37.69  ?  70  TYR C CG  1 
ATOM 7067  C CD1 . TYR C  1 62  ? 108.541 115.699  -3.194  1.00 37.50  ?  70  TYR C CD1 1 
ATOM 7068  C CD2 . TYR C  1 62  ? 109.482 114.282  -4.858  1.00 37.94  ?  70  TYR C CD2 1 
ATOM 7069  C CE1 . TYR C  1 62  ? 109.709 115.631  -2.465  1.00 37.64  ?  70  TYR C CE1 1 
ATOM 7070  C CE2 . TYR C  1 62  ? 110.656 114.210  -4.136  1.00 38.05  ?  70  TYR C CE2 1 
ATOM 7071  C CZ  . TYR C  1 62  ? 110.763 114.886  -2.940  1.00 37.93  ?  70  TYR C CZ  1 
ATOM 7072  O OH  . TYR C  1 62  ? 111.928 114.818  -2.213  1.00 38.24  ?  70  TYR C OH  1 
ATOM 7073  N N   . ARG C  1 63  ? 103.884 115.090  -4.278  1.00 43.53  ?  71  ARG C N   1 
ATOM 7074  C CA  . ARG C  1 63  ? 102.613 115.742  -4.574  1.00 42.92  ?  71  ARG C CA  1 
ATOM 7075  C C   . ARG C  1 63  ? 102.799 117.238  -4.353  1.00 44.11  ?  71  ARG C C   1 
ATOM 7076  O O   . ARG C  1 63  ? 102.920 117.690  -3.211  1.00 43.58  ?  71  ARG C O   1 
ATOM 7077  C CB  . ARG C  1 63  ? 101.493 115.187  -3.699  1.00 44.48  ?  71  ARG C CB  1 
ATOM 7078  C CG  . ARG C  1 63  ? 101.177 113.720  -3.935  1.00 47.31  ?  71  ARG C CG  1 
ATOM 7079  C CD  . ARG C  1 63  ? 100.135 113.537  -5.024  1.00 51.91  ?  71  ARG C CD  1 
ATOM 7080  N NE  . ARG C  1 63  ? 100.727 113.543  -6.357  1.00 54.35  ?  71  ARG C NE  1 
ATOM 7081  C CZ  . ARG C  1 63  ? 101.250 112.471  -6.940  1.00 56.23  ?  71  ARG C CZ  1 
ATOM 7082  N NH1 . ARG C  1 63  ? 101.254 111.305  -6.305  1.00 51.77  1  71  ARG C NH1 1 
ATOM 7083  N NH2 . ARG C  1 63  ? 101.767 112.563  -8.159  1.00 59.93  ?  71  ARG C NH2 1 
ATOM 7084  N N   . VAL C  1 64  ? 102.835 118.003  -5.440  1.00 40.31  ?  72  VAL C N   1 
ATOM 7085  C CA  . VAL C  1 64  ? 103.080 119.440  -5.378  1.00 41.54  ?  72  VAL C CA  1 
ATOM 7086  C C   . VAL C  1 64  ? 101.830 120.133  -5.903  1.00 45.60  ?  72  VAL C C   1 
ATOM 7087  O O   . VAL C  1 64  ? 101.589 120.176  -7.116  1.00 46.85  ?  72  VAL C O   1 
ATOM 7088  C CB  . VAL C  1 64  ? 104.326 119.854  -6.166  1.00 42.81  ?  72  VAL C CB  1 
ATOM 7089  C CG1 . VAL C  1 64  ? 104.636 121.321  -5.922  1.00 44.45  ?  72  VAL C CG1 1 
ATOM 7090  C CG2 . VAL C  1 64  ? 105.507 118.987  -5.769  1.00 44.34  ?  72  VAL C CG2 1 
ATOM 7091  N N   . PHE C  1 65  ? 101.031 120.675  -4.989  1.00 46.37  ?  73  PHE C N   1 
ATOM 7092  C CA  . PHE C  1 65  ? 99.805  121.379  -5.332  1.00 47.06  ?  73  PHE C CA  1 
ATOM 7093  C C   . PHE C  1 65  ? 100.084 122.865  -5.506  1.00 49.31  ?  73  PHE C C   1 
ATOM 7094  O O   . PHE C  1 65  ? 100.710 123.493  -4.643  1.00 49.90  ?  73  PHE C O   1 
ATOM 7095  C CB  . PHE C  1 65  ? 98.743  121.179  -4.250  1.00 44.99  ?  73  PHE C CB  1 
ATOM 7096  C CG  . PHE C  1 65  ? 98.428  119.742  -3.964  1.00 42.79  ?  73  PHE C CG  1 
ATOM 7097  C CD1 . PHE C  1 65  ? 99.094  119.061  -2.959  1.00 40.61  ?  73  PHE C CD1 1 
ATOM 7098  C CD2 . PHE C  1 65  ? 97.458  119.075  -4.692  1.00 43.55  ?  73  PHE C CD2 1 
ATOM 7099  C CE1 . PHE C  1 65  ? 98.803  117.738  -2.689  1.00 39.25  ?  73  PHE C CE1 1 
ATOM 7100  C CE2 . PHE C  1 65  ? 97.162  117.752  -4.426  1.00 42.23  ?  73  PHE C CE2 1 
ATOM 7101  C CZ  . PHE C  1 65  ? 97.836  117.082  -3.424  1.00 40.08  ?  73  PHE C CZ  1 
ATOM 7102  N N   . ARG C  1 66  ? 99.621  123.418  -6.626  1.00 45.98  ?  74  ARG C N   1 
ATOM 7103  C CA  . ARG C  1 66  ? 99.621  124.860  -6.856  1.00 48.71  ?  74  ARG C CA  1 
ATOM 7104  C C   . ARG C  1 66  ? 98.227  125.364  -6.508  1.00 53.11  ?  74  ARG C C   1 
ATOM 7105  O O   . ARG C  1 66  ? 97.288  125.232  -7.299  1.00 56.71  ?  74  ARG C O   1 
ATOM 7106  C CB  . ARG C  1 66  ? 99.998  125.204  -8.292  1.00 53.68  ?  74  ARG C CB  1 
ATOM 7107  C CG  . ARG C  1 66  ? 99.953  126.700  -8.578  1.00 57.09  ?  74  ARG C CG  1 
ATOM 7108  C CD  . ARG C  1 66  ? 100.622 127.057  -9.898  1.00 64.18  ?  74  ARG C CD  1 
ATOM 7109  N NE  . ARG C  1 66  ? 100.795 128.502  -10.034 1.00 70.09  ?  74  ARG C NE  1 
ATOM 7110  C CZ  . ARG C  1 66  ? 101.471 129.089  -11.017 1.00 70.96  ?  74  ARG C CZ  1 
ATOM 7111  N NH1 . ARG C  1 66  ? 102.045 128.357  -11.960 1.00 69.67  1  74  ARG C NH1 1 
ATOM 7112  N NH2 . ARG C  1 66  ? 101.573 130.412  -11.055 1.00 72.93  ?  74  ARG C NH2 1 
ATOM 7113  N N   . VAL C  1 67  ? 98.097  125.924  -5.311  1.00 52.77  ?  75  VAL C N   1 
ATOM 7114  C CA  . VAL C  1 67  ? 96.827  126.428  -4.806  1.00 49.44  ?  75  VAL C CA  1 
ATOM 7115  C C   . VAL C  1 67  ? 96.729  127.901  -5.179  1.00 52.48  ?  75  VAL C C   1 
ATOM 7116  O O   . VAL C  1 67  ? 97.476  128.732  -4.658  1.00 52.28  ?  75  VAL C O   1 
ATOM 7117  C CB  . VAL C  1 67  ? 96.712  126.231  -3.291  1.00 49.19  ?  75  VAL C CB  1 
ATOM 7118  C CG1 . VAL C  1 67  ? 95.373  126.728  -2.795  1.00 55.57  ?  75  VAL C CG1 1 
ATOM 7119  C CG2 . VAL C  1 67  ? 96.910  124.766  -2.929  1.00 46.20  ?  75  VAL C CG2 1 
ATOM 7120  N N   . LYS C  1 68  ? 95.805  128.229  -6.075  1.00 51.98  ?  76  LYS C N   1 
ATOM 7121  C CA  . LYS C  1 68  ? 95.572  129.613  -6.460  1.00 56.97  ?  76  LYS C CA  1 
ATOM 7122  C C   . LYS C  1 68  ? 94.469  130.202  -5.592  1.00 53.85  ?  76  LYS C C   1 
ATOM 7123  O O   . LYS C  1 68  ? 93.386  129.621  -5.469  1.00 54.01  ?  76  LYS C O   1 
ATOM 7124  C CB  . LYS C  1 68  ? 95.216  129.718  -7.943  1.00 64.33  ?  76  LYS C CB  1 
ATOM 7125  C CG  . LYS C  1 68  ? 96.435  129.637  -8.853  1.00 69.11  ?  76  LYS C CG  1 
ATOM 7126  C CD  . LYS C  1 68  ? 96.069  129.766  -10.323 1.00 74.37  ?  76  LYS C CD  1 
ATOM 7127  C CE  . LYS C  1 68  ? 97.279  129.498  -11.211 1.00 68.82  ?  76  LYS C CE  1 
ATOM 7128  N NZ  . LYS C  1 68  ? 96.990  129.753  -12.650 1.00 66.65  1  76  LYS C NZ  1 
ATOM 7129  N N   . LEU C  1 69  ? 94.753  131.336  -4.989  1.00 51.52  ?  77  LEU C N   1 
ATOM 7130  C CA  . LEU C  1 69  ? 93.868  132.051  -4.089  1.00 51.59  ?  77  LEU C CA  1 
ATOM 7131  C C   . LEU C  1 69  ? 93.250  133.253  -4.792  1.00 52.07  ?  77  LEU C C   1 
ATOM 7132  O O   . LEU C  1 69  ? 93.841  133.806  -5.723  1.00 52.31  ?  77  LEU C O   1 
ATOM 7133  C CB  . LEU C  1 69  ? 94.639  132.522  -2.854  1.00 53.19  ?  77  LEU C CB  1 
ATOM 7134  C CG  . LEU C  1 69  ? 95.420  131.427  -2.125  1.00 50.08  ?  77  LEU C CG  1 
ATOM 7135  C CD1 . LEU C  1 69  ? 96.146  131.992  -0.914  1.00 49.03  ?  77  LEU C CD1 1 
ATOM 7136  C CD2 . LEU C  1 69  ? 94.501  130.284  -1.728  1.00 52.44  ?  77  LEU C CD2 1 
ATOM 7137  N N   . PRO C  1 70  ? 92.058  133.683  -4.382  1.00 53.41  ?  78  PRO C N   1 
ATOM 7138  C CA  . PRO C  1 70  ? 91.466  134.876  -4.995  1.00 53.89  ?  78  PRO C CA  1 
ATOM 7139  C C   . PRO C  1 70  ? 92.228  136.127  -4.593  1.00 53.97  ?  78  PRO C C   1 
ATOM 7140  O O   . PRO C  1 70  ? 92.729  136.237  -3.471  1.00 53.70  ?  78  PRO C O   1 
ATOM 7141  C CB  . PRO C  1 70  ? 90.037  134.887  -4.442  1.00 62.00  ?  78  PRO C CB  1 
ATOM 7142  C CG  . PRO C  1 70  ? 90.147  134.180  -3.137  1.00 59.17  ?  78  PRO C CG  1 
ATOM 7143  C CD  . PRO C  1 70  ? 91.195  133.119  -3.331  1.00 56.50  ?  78  PRO C CD  1 
ATOM 7144  N N   . ASP C  1 71  ? 92.316  137.067  -5.522  1.00 62.47  ?  79  ASP C N   1 
ATOM 7145  C CA  . ASP C  1 71  ? 92.990  138.328  -5.259  1.00 64.25  ?  79  ASP C CA  1 
ATOM 7146  C C   . ASP C  1 71  ? 92.229  139.097  -4.187  1.00 64.43  ?  79  ASP C C   1 
ATOM 7147  O O   . ASP C  1 71  ? 91.065  139.463  -4.409  1.00 67.70  ?  79  ASP C O   1 
ATOM 7148  C CB  . ASP C  1 71  ? 93.096  139.156  -6.538  1.00 68.78  ?  79  ASP C CB  1 
ATOM 7149  C CG  . ASP C  1 71  ? 94.088  140.306  -6.420  1.00 79.37  ?  79  ASP C CG  1 
ATOM 7150  O OD1 . ASP C  1 71  ? 94.385  140.743  -5.288  1.00 80.50  ?  79  ASP C OD1 1 
ATOM 7151  O OD2 . ASP C  1 71  ? 94.573  140.779  -7.470  1.00 86.16  -1 79  ASP C OD2 1 
ATOM 7152  N N   . PRO C  1 72  ? 92.828  139.353  -3.020  1.00 65.62  ?  80  PRO C N   1 
ATOM 7153  C CA  . PRO C  1 72  ? 92.100  140.086  -1.974  1.00 66.06  ?  80  PRO C CA  1 
ATOM 7154  C C   . PRO C  1 72  ? 91.774  141.516  -2.362  1.00 71.94  ?  80  PRO C C   1 
ATOM 7155  O O   . PRO C  1 72  ? 90.817  142.084  -1.822  1.00 74.37  ?  80  PRO C O   1 
ATOM 7156  C CB  . PRO C  1 72  ? 93.058  140.030  -0.777  1.00 61.94  ?  80  PRO C CB  1 
ATOM 7157  C CG  . PRO C  1 72  ? 94.412  139.874  -1.393  1.00 61.43  ?  80  PRO C CG  1 
ATOM 7158  C CD  . PRO C  1 72  ? 94.206  139.029  -2.617  1.00 61.72  ?  80  PRO C CD  1 
ATOM 7159  N N   . ASN C  1 73  ? 92.540  142.116  -3.273  1.00 67.74  ?  81  ASN C N   1 
ATOM 7160  C CA  . ASN C  1 73  ? 92.184  143.434  -3.783  1.00 69.08  ?  81  ASN C CA  1 
ATOM 7161  C C   . ASN C  1 73  ? 91.018  143.337  -4.757  1.00 73.67  ?  81  ASN C C   1 
ATOM 7162  O O   . ASN C  1 73  ? 90.127  144.194  -4.761  1.00 77.58  ?  81  ASN C O   1 
ATOM 7163  C CB  . ASN C  1 73  ? 93.398  144.078  -4.448  1.00 70.96  ?  81  ASN C CB  1 
ATOM 7164  C CG  . ASN C  1 73  ? 94.631  144.032  -3.570  1.00 69.96  ?  81  ASN C CG  1 
ATOM 7165  O OD1 . ASN C  1 73  ? 94.834  144.895  -2.716  1.00 72.12  ?  81  ASN C OD1 1 
ATOM 7166  N ND2 . ASN C  1 73  ? 95.460  143.014  -3.771  1.00 67.06  ?  81  ASN C ND2 1 
ATOM 7167  N N   . LYS C  1 74  ? 91.010  142.295  -5.591  1.00 78.25  ?  82  LYS C N   1 
ATOM 7168  C CA  . LYS C  1 74  ? 89.887  142.013  -6.474  1.00 90.11  ?  82  LYS C CA  1 
ATOM 7169  C C   . LYS C  1 74  ? 88.706  141.408  -5.723  1.00 96.29  ?  82  LYS C C   1 
ATOM 7170  O O   . LYS C  1 74  ? 87.589  141.387  -6.255  1.00 102.75 ?  82  LYS C O   1 
ATOM 7171  C CB  . LYS C  1 74  ? 90.340  141.066  -7.590  1.00 95.55  ?  82  LYS C CB  1 
ATOM 7172  C CG  . LYS C  1 74  ? 89.473  141.045  -8.838  1.00 97.25  ?  82  LYS C CG  1 
ATOM 7173  C CD  . LYS C  1 74  ? 89.604  142.343  -9.617  1.00 99.89  ?  82  LYS C CD  1 
ATOM 7174  C CE  . LYS C  1 74  ? 88.955  142.232  -10.986 1.00 104.66 ?  82  LYS C CE  1 
ATOM 7175  N NZ  . LYS C  1 74  ? 87.507  141.902  -10.891 1.00 108.24 1  82  LYS C NZ  1 
ATOM 7176  N N   . PHE C  1 75  ? 88.935  140.918  -4.504  1.00 99.08  ?  83  PHE C N   1 
ATOM 7177  C CA  . PHE C  1 75  ? 87.871  140.360  -3.677  1.00 98.26  ?  83  PHE C CA  1 
ATOM 7178  C C   . PHE C  1 75  ? 86.816  141.415  -3.369  1.00 105.66 ?  83  PHE C C   1 
ATOM 7179  O O   . PHE C  1 75  ? 87.136  142.516  -2.912  1.00 108.99 ?  83  PHE C O   1 
ATOM 7180  C CB  . PHE C  1 75  ? 88.457  139.809  -2.376  1.00 96.84  ?  83  PHE C CB  1 
ATOM 7181  C CG  . PHE C  1 75  ? 87.802  138.546  -1.896  1.00 90.05  ?  83  PHE C CG  1 
ATOM 7182  C CD1 . PHE C  1 75  ? 87.075  137.749  -2.763  1.00 89.64  ?  83  PHE C CD1 1 
ATOM 7183  C CD2 . PHE C  1 75  ? 87.917  138.156  -0.571  1.00 86.22  ?  83  PHE C CD2 1 
ATOM 7184  C CE1 . PHE C  1 75  ? 86.476  136.584  -2.318  1.00 87.17  ?  83  PHE C CE1 1 
ATOM 7185  C CE2 . PHE C  1 75  ? 87.320  136.996  -0.120  1.00 84.70  ?  83  PHE C CE2 1 
ATOM 7186  C CZ  . PHE C  1 75  ? 86.598  136.209  -0.994  1.00 84.62  ?  83  PHE C CZ  1 
ATOM 7187  N N   . GLY C  1 76  ? 85.555  141.079  -3.625  1.00 117.41 ?  84  GLY C N   1 
ATOM 7188  C CA  . GLY C  1 76  ? 84.481  142.035  -3.447  1.00 122.38 ?  84  GLY C CA  1 
ATOM 7189  C C   . GLY C  1 76  ? 83.653  141.785  -2.203  1.00 124.77 ?  84  GLY C C   1 
ATOM 7190  O O   . GLY C  1 76  ? 82.537  142.298  -2.079  1.00 130.30 ?  84  GLY C O   1 
ATOM 7191  N N   . LEU C  1 77  ? 84.188  140.993  -1.274  1.00 127.15 ?  85  LEU C N   1 
ATOM 7192  C CA  . LEU C  1 77  ? 83.504  140.693  -0.020  1.00 127.44 ?  85  LEU C CA  1 
ATOM 7193  C C   . LEU C  1 77  ? 83.819  141.717  1.073   1.00 132.75 ?  85  LEU C C   1 
ATOM 7194  O O   . LEU C  1 77  ? 82.892  142.174  1.754   1.00 134.12 ?  85  LEU C O   1 
ATOM 7195  C CB  . LEU C  1 77  ? 83.842  139.278  0.465   1.00 120.85 ?  85  LEU C CB  1 
ATOM 7196  C CG  . LEU C  1 77  ? 83.026  138.106  -0.091  1.00 113.56 ?  85  LEU C CG  1 
ATOM 7197  C CD1 . LEU C  1 77  ? 81.541  138.322  0.169   1.00 113.67 ?  85  LEU C CD1 1 
ATOM 7198  C CD2 . LEU C  1 77  ? 83.288  137.882  -1.574  1.00 112.61 ?  85  LEU C CD2 1 
ATOM 7199  N N   . PRO C  1 78  ? 85.081  142.107  1.292   1.00 133.53 ?  86  PRO C N   1 
ATOM 7200  C CA  . PRO C  1 78  ? 85.346  143.133  2.307   1.00 135.23 ?  86  PRO C CA  1 
ATOM 7201  C C   . PRO C  1 78  ? 84.917  144.521  1.855   1.00 140.76 ?  86  PRO C C   1 
ATOM 7202  O O   . PRO C  1 78  ? 84.978  144.868  0.673   1.00 142.15 ?  86  PRO C O   1 
ATOM 7203  C CB  . PRO C  1 78  ? 86.866  143.063  2.495   1.00 118.74 ?  86  PRO C CB  1 
ATOM 7204  C CG  . PRO C  1 78  ? 87.371  142.549  1.208   1.00 120.12 ?  86  PRO C CG  1 
ATOM 7205  C CD  . PRO C  1 78  ? 86.341  141.566  0.744   1.00 117.07 ?  86  PRO C CD  1 
ATOM 7206  N N   . ASP C  1 79  ? 84.480  145.317  2.828   1.00 142.68 ?  87  ASP C N   1 
ATOM 7207  C CA  . ASP C  1 79  ? 84.070  146.692  2.596   1.00 142.81 ?  87  ASP C CA  1 
ATOM 7208  C C   . ASP C  1 79  ? 85.285  147.616  2.617   1.00 139.48 ?  87  ASP C C   1 
ATOM 7209  O O   . ASP C  1 79  ? 86.360  147.260  3.106   1.00 137.93 ?  87  ASP C O   1 
ATOM 7210  C CB  . ASP C  1 79  ? 83.050  147.138  3.645   1.00 147.38 ?  87  ASP C CB  1 
ATOM 7211  C CG  . ASP C  1 79  ? 83.519  146.872  5.063   1.00 146.25 ?  87  ASP C CG  1 
ATOM 7212  O OD1 . ASP C  1 79  ? 84.336  145.948  5.257   1.00 144.43 ?  87  ASP C OD1 1 
ATOM 7213  O OD2 . ASP C  1 79  ? 83.068  147.587  5.984   1.00 147.28 -1 87  ASP C OD2 1 
ATOM 7214  N N   . ASN C  1 80  ? 85.104  148.820  2.076   1.00 137.34 ?  88  ASN C N   1 
ATOM 7215  C CA  . ASN C  1 80  ? 86.208  149.781  2.024   1.00 137.15 ?  88  ASN C CA  1 
ATOM 7216  C C   . ASN C  1 80  ? 86.626  150.307  3.408   1.00 135.20 ?  88  ASN C C   1 
ATOM 7217  O O   . ASN C  1 80  ? 87.472  151.211  3.467   1.00 135.38 ?  88  ASN C O   1 
ATOM 7218  C CB  . ASN C  1 80  ? 85.835  150.954  1.116   1.00 142.72 ?  88  ASN C CB  1 
ATOM 7219  C CG  . ASN C  1 80  ? 85.805  150.570  -0.351  1.00 141.29 ?  88  ASN C CG  1 
ATOM 7220  O OD1 . ASN C  1 80  ? 84.814  150.799  -1.044  1.00 143.76 ?  88  ASN C OD1 1 
ATOM 7221  N ND2 . ASN C  1 80  ? 86.896  149.982  -0.831  1.00 136.74 ?  88  ASN C ND2 1 
ATOM 7222  N N   . THR C  1 81  ? 86.070  149.787  4.506   1.00 130.32 ?  89  THR C N   1 
ATOM 7223  C CA  . THR C  1 81  ? 86.523  150.177  5.836   1.00 126.60 ?  89  THR C CA  1 
ATOM 7224  C C   . THR C  1 81  ? 87.784  149.429  6.254   1.00 114.96 ?  89  THR C C   1 
ATOM 7225  O O   . THR C  1 81  ? 88.558  149.937  7.073   1.00 115.62 ?  89  THR C O   1 
ATOM 7226  C CB  . THR C  1 81  ? 85.408  149.940  6.859   1.00 136.24 ?  89  THR C CB  1 
ATOM 7227  O OG1 . THR C  1 81  ? 84.176  150.469  6.356   1.00 141.78 ?  89  THR C OG1 1 
ATOM 7228  C CG2 . THR C  1 81  ? 85.733  150.620  8.183   1.00 136.57 ?  89  THR C CG2 1 
ATOM 7229  N N   . VAL C  1 82  ? 88.020  148.240  5.694   1.00 108.35 ?  90  VAL C N   1 
ATOM 7230  C CA  . VAL C  1 82  ? 89.185  147.458  6.097   1.00 101.60 ?  90  VAL C CA  1 
ATOM 7231  C C   . VAL C  1 82  ? 90.470  148.059  5.537   1.00 100.73 ?  90  VAL C C   1 
ATOM 7232  O O   . VAL C  1 82  ? 91.536  147.936  6.152   1.00 101.69 ?  90  VAL C O   1 
ATOM 7233  C CB  . VAL C  1 82  ? 89.019  145.983  5.681   1.00 103.35 ?  90  VAL C CB  1 
ATOM 7234  C CG1 . VAL C  1 82  ? 87.741  145.408  6.272   1.00 101.43 ?  90  VAL C CG1 1 
ATOM 7235  C CG2 . VAL C  1 82  ? 89.028  145.837  4.166   1.00 103.38 ?  90  VAL C CG2 1 
ATOM 7236  N N   . TYR C  1 83  ? 90.401  148.716  4.382   1.00 91.34  ?  91  TYR C N   1 
ATOM 7237  C CA  . TYR C  1 83  ? 91.586  149.309  3.778   1.00 91.03  ?  91  TYR C CA  1 
ATOM 7238  C C   . TYR C  1 83  ? 91.157  150.315  2.722   1.00 99.13  ?  91  TYR C C   1 
ATOM 7239  O O   . TYR C  1 83  ? 90.007  150.326  2.276   1.00 104.86 ?  91  TYR C O   1 
ATOM 7240  C CB  . TYR C  1 83  ? 92.503  148.242  3.169   1.00 81.08  ?  91  TYR C CB  1 
ATOM 7241  C CG  . TYR C  1 83  ? 92.292  147.997  1.691   1.00 79.09  ?  91  TYR C CG  1 
ATOM 7242  C CD1 . TYR C  1 83  ? 93.230  148.421  0.758   1.00 77.92  ?  91  TYR C CD1 1 
ATOM 7243  C CD2 . TYR C  1 83  ? 91.161  147.334  1.228   1.00 76.32  ?  91  TYR C CD2 1 
ATOM 7244  C CE1 . TYR C  1 83  ? 93.047  148.195  -0.594  1.00 78.13  ?  91  TYR C CE1 1 
ATOM 7245  C CE2 . TYR C  1 83  ? 90.970  147.105  -0.123  1.00 76.86  ?  91  TYR C CE2 1 
ATOM 7246  C CZ  . TYR C  1 83  ? 91.916  147.538  -1.029  1.00 78.03  ?  91  TYR C CZ  1 
ATOM 7247  O OH  . TYR C  1 83  ? 91.732  147.314  -2.375  1.00 79.27  ?  91  TYR C OH  1 
ATOM 7248  N N   . ASP C  1 84  ? 92.105  151.162  2.330   1.00 82.40  ?  92  ASP C N   1 
ATOM 7249  C CA  . ASP C  1 84  ? 91.900  152.146  1.286   1.00 85.75  ?  92  ASP C CA  1 
ATOM 7250  C C   . ASP C  1 84  ? 92.834  151.858  0.118   1.00 80.87  ?  92  ASP C C   1 
ATOM 7251  O O   . ASP C  1 84  ? 94.050  151.732  0.320   1.00 79.56  ?  92  ASP C O   1 
ATOM 7252  C CB  . ASP C  1 84  ? 92.149  153.563  1.822   1.00 91.02  ?  92  ASP C CB  1 
ATOM 7253  C CG  . ASP C  1 84  ? 93.524  153.716  2.438   1.00 92.65  ?  92  ASP C CG  1 
ATOM 7254  O OD1 . ASP C  1 84  ? 94.039  152.722  2.991   1.00 91.75  ?  92  ASP C OD1 1 
ATOM 7255  O OD2 . ASP C  1 84  ? 94.089  154.827  2.371   1.00 92.28  -1 92  ASP C OD2 1 
ATOM 7256  N N   . PRO C  1 85  ? 92.317  151.737  -1.104  1.00 83.30  ?  93  PRO C N   1 
ATOM 7257  C CA  . PRO C  1 85  ? 93.189  151.409  -2.241  1.00 87.09  ?  93  PRO C CA  1 
ATOM 7258  C C   . PRO C  1 85  ? 94.015  152.589  -2.733  1.00 87.23  ?  93  PRO C C   1 
ATOM 7259  O O   . PRO C  1 85  ? 94.367  152.653  -3.915  1.00 88.45  ?  93  PRO C O   1 
ATOM 7260  C CB  . PRO C  1 85  ? 92.196  150.940  -3.311  1.00 92.04  ?  93  PRO C CB  1 
ATOM 7261  C CG  . PRO C  1 85  ? 90.931  151.668  -2.980  1.00 92.00  ?  93  PRO C CG  1 
ATOM 7262  C CD  . PRO C  1 85  ? 90.893  151.772  -1.481  1.00 84.61  ?  93  PRO C CD  1 
ATOM 7263  N N   . ASN C  1 86  ? 94.340  153.520  -1.838  1.00 79.73  ?  94  ASN C N   1 
ATOM 7264  C CA  . ASN C  1 86  ? 95.163  154.677  -2.168  1.00 85.87  ?  94  ASN C CA  1 
ATOM 7265  C C   . ASN C  1 86  ? 96.608  154.503  -1.721  1.00 84.71  ?  94  ASN C C   1 
ATOM 7266  O O   . ASN C  1 86  ? 97.532  154.803  -2.481  1.00 87.32  ?  94  ASN C O   1 
ATOM 7267  C CB  . ASN C  1 86  ? 94.572  155.949  -1.548  1.00 87.90  ?  94  ASN C CB  1 
ATOM 7268  C CG  . ASN C  1 86  ? 93.170  156.242  -2.041  1.00 91.59  ?  94  ASN C CG  1 
ATOM 7269  O OD1 . ASN C  1 86  ? 92.818  155.916  -3.175  1.00 95.35  ?  94  ASN C OD1 1 
ATOM 7270  N ND2 . ASN C  1 86  ? 92.361  156.867  -1.193  1.00 91.74  ?  94  ASN C ND2 1 
ATOM 7271  N N   . SER C  1 87  ? 96.819  154.026  -0.492  1.00 85.09  ?  95  SER C N   1 
ATOM 7272  C CA  . SER C  1 87  ? 98.160  153.787  0.026   1.00 81.98  ?  95  SER C CA  1 
ATOM 7273  C C   . SER C  1 87  ? 98.313  152.405  0.653   1.00 74.63  ?  95  SER C C   1 
ATOM 7274  O O   . SER C  1 87  ? 99.346  152.134  1.277   1.00 73.93  ?  95  SER C O   1 
ATOM 7275  C CB  . SER C  1 87  ? 98.538  154.864  1.051   1.00 75.07  ?  95  SER C CB  1 
ATOM 7276  O OG  . SER C  1 87  ? 98.432  156.164  0.496   1.00 77.50  ?  95  SER C OG  1 
ATOM 7277  N N   . GLN C  1 88  ? 97.320  151.528  0.512   1.00 73.81  ?  96  GLN C N   1 
ATOM 7278  C CA  . GLN C  1 88  ? 97.370  150.198  1.099   1.00 69.38  ?  96  GLN C CA  1 
ATOM 7279  C C   . GLN C  1 88  ? 96.958  149.146  0.079   1.00 67.42  ?  96  GLN C C   1 
ATOM 7280  O O   . GLN C  1 88  ? 96.119  149.393  -0.793  1.00 69.12  ?  96  GLN C O   1 
ATOM 7281  C CB  . GLN C  1 88  ? 96.470  150.095  2.336   1.00 73.62  ?  96  GLN C CB  1 
ATOM 7282  C CG  . GLN C  1 88  ? 96.934  150.926  3.518   1.00 74.27  ?  96  GLN C CG  1 
ATOM 7283  C CD  . GLN C  1 88  ? 96.043  150.752  4.731   1.00 74.04  ?  96  GLN C CD  1 
ATOM 7284  O OE1 . GLN C  1 88  ? 94.843  150.510  4.602   1.00 73.77  ?  96  GLN C OE1 1 
ATOM 7285  N NE2 . GLN C  1 88  ? 96.628  150.865  5.917   1.00 74.62  ?  96  GLN C NE2 1 
ATOM 7286  N N   . ARG C  1 89  ? 97.560  147.965  0.204   1.00 66.26  ?  97  ARG C N   1 
ATOM 7287  C CA  . ARG C  1 89  ? 97.222  146.808  -0.611  1.00 64.60  ?  97  ARG C CA  1 
ATOM 7288  C C   . ARG C  1 89  ? 97.089  145.579  0.274   1.00 61.90  ?  97  ARG C C   1 
ATOM 7289  O O   . ARG C  1 89  ? 97.688  145.498  1.349   1.00 63.06  ?  97  ARG C O   1 
ATOM 7290  C CB  . ARG C  1 89  ? 98.278  146.543  -1.693  1.00 62.97  ?  97  ARG C CB  1 
ATOM 7291  C CG  . ARG C  1 89  ? 98.283  147.543  -2.828  1.00 66.42  ?  97  ARG C CG  1 
ATOM 7292  C CD  . ARG C  1 89  ? 96.994  147.446  -3.622  1.00 67.36  ?  97  ARG C CD  1 
ATOM 7293  N NE  . ARG C  1 89  ? 96.813  148.580  -4.520  1.00 73.20  ?  97  ARG C NE  1 
ATOM 7294  C CZ  . ARG C  1 89  ? 95.698  148.817  -5.201  1.00 77.03  ?  97  ARG C CZ  1 
ATOM 7295  N NH1 . ARG C  1 89  ? 94.663  147.996  -5.087  1.00 72.74  1  97  ARG C NH1 1 
ATOM 7296  N NH2 . ARG C  1 89  ? 95.619  149.875  -5.996  1.00 83.31  ?  97  ARG C NH2 1 
ATOM 7297  N N   . LEU C  1 90  ? 96.292  144.623  -0.192  1.00 64.38  ?  98  LEU C N   1 
ATOM 7298  C CA  . LEU C  1 90  ? 95.977  143.422  0.566   1.00 61.30  ?  98  LEU C CA  1 
ATOM 7299  C C   . LEU C  1 90  ? 96.766  142.228  0.046   1.00 60.42  ?  98  LEU C C   1 
ATOM 7300  O O   . LEU C  1 90  ? 97.141  142.166  -1.127  1.00 65.00  ?  98  LEU C O   1 
ATOM 7301  C CB  . LEU C  1 90  ? 94.478  143.120  0.514   1.00 59.72  ?  98  LEU C CB  1 
ATOM 7302  C CG  . LEU C  1 90  ? 93.576  143.753  1.577   1.00 60.26  ?  98  LEU C CG  1 
ATOM 7303  C CD1 . LEU C  1 90  ? 94.019  145.154  1.941   1.00 61.68  ?  98  LEU C CD1 1 
ATOM 7304  C CD2 . LEU C  1 90  ? 92.131  143.757  1.100   1.00 60.88  ?  98  LEU C CD2 1 
ATOM 7305  N N   . VAL C  1 91  ? 97.010  141.275  0.939   1.00 61.77  ?  99  VAL C N   1 
ATOM 7306  C CA  . VAL C  1 91  ? 97.693  140.036  0.588   1.00 61.16  ?  99  VAL C CA  1 
ATOM 7307  C C   . VAL C  1 91  ? 97.271  138.967  1.586   1.00 57.30  ?  99  VAL C C   1 
ATOM 7308  O O   . VAL C  1 91  ? 97.091  139.247  2.775   1.00 58.10  ?  99  VAL C O   1 
ATOM 7309  C CB  . VAL C  1 91  ? 99.227  140.223  0.559   1.00 56.88  ?  99  VAL C CB  1 
ATOM 7310  C CG1 . VAL C  1 91  ? 99.751  140.629  1.929   1.00 56.45  ?  99  VAL C CG1 1 
ATOM 7311  C CG2 . VAL C  1 91  ? 99.914  138.957  0.065   1.00 56.36  ?  99  VAL C CG2 1 
ATOM 7312  N N   . TRP C  1 92  ? 97.097  137.743  1.096   1.00 54.80  ?  100 TRP C N   1 
ATOM 7313  C CA  . TRP C  1 92  ? 96.698  136.647  1.964   1.00 52.00  ?  100 TRP C CA  1 
ATOM 7314  C C   . TRP C  1 92  ? 97.912  136.094  2.697   1.00 53.75  ?  100 TRP C C   1 
ATOM 7315  O O   . TRP C  1 92  ? 99.009  136.008  2.138   1.00 57.16  ?  100 TRP C O   1 
ATOM 7316  C CB  . TRP C  1 92  ? 96.022  135.532  1.166   1.00 48.00  ?  100 TRP C CB  1 
ATOM 7317  C CG  . TRP C  1 92  ? 94.670  135.894  0.635   1.00 48.83  ?  100 TRP C CG  1 
ATOM 7318  C CD1 . TRP C  1 92  ? 94.311  136.013  -0.675  1.00 49.55  ?  100 TRP C CD1 1 
ATOM 7319  C CD2 . TRP C  1 92  ? 93.500  136.208  1.401   1.00 49.26  ?  100 TRP C CD2 1 
ATOM 7320  N NE1 . TRP C  1 92  ? 92.986  136.363  -0.773  1.00 50.40  ?  100 TRP C NE1 1 
ATOM 7321  C CE2 . TRP C  1 92  ? 92.466  136.493  0.488   1.00 50.22  ?  100 TRP C CE2 1 
ATOM 7322  C CE3 . TRP C  1 92  ? 93.225  136.271  2.771   1.00 49.06  ?  100 TRP C CE3 1 
ATOM 7323  C CZ2 . TRP C  1 92  ? 91.180  136.836  0.898   1.00 50.99  ?  100 TRP C CZ2 1 
ATOM 7324  C CZ3 . TRP C  1 92  ? 91.946  136.612  3.177   1.00 49.78  ?  100 TRP C CZ3 1 
ATOM 7325  C CH2 . TRP C  1 92  ? 90.940  136.890  2.244   1.00 50.74  ?  100 TRP C CH2 1 
ATOM 7326  N N   . ALA C  1 93  ? 97.708  135.722  3.956   1.00 57.18  ?  101 ALA C N   1 
ATOM 7327  C CA  . ALA C  1 93  ? 98.745  135.119  4.779   1.00 53.85  ?  101 ALA C CA  1 
ATOM 7328  C C   . ALA C  1 93  ? 98.239  133.788  5.309   1.00 51.71  ?  101 ALA C C   1 
ATOM 7329  O O   . ALA C  1 93  ? 97.154  133.721  5.895   1.00 52.45  ?  101 ALA C O   1 
ATOM 7330  C CB  . ALA C  1 93  ? 99.142  136.034  5.939   1.00 49.57  ?  101 ALA C CB  1 
ATOM 7331  N N   . CYS C  1 94  ? 99.021  132.735  5.098   1.00 51.66  ?  102 CYS C N   1 
ATOM 7332  C CA  . CYS C  1 94  ? 98.623  131.407  5.533   1.00 49.27  ?  102 CYS C CA  1 
ATOM 7333  C C   . CYS C  1 94  ? 98.845  131.267  7.031   1.00 51.67  ?  102 CYS C C   1 
ATOM 7334  O O   . CYS C  1 94  ? 99.924  131.586  7.541   1.00 58.16  ?  102 CYS C O   1 
ATOM 7335  C CB  . CYS C  1 94  ? 99.411  130.340  4.780   1.00 50.34  ?  102 CYS C CB  1 
ATOM 7336  S SG  . CYS C  1 94  ? 98.965  128.665  5.247   1.00 57.03  ?  102 CYS C SG  1 
ATOM 7337  N N   . VAL C  1 95  ? 97.823  130.782  7.736   1.00 52.64  ?  103 VAL C N   1 
ATOM 7338  C CA  . VAL C  1 95  ? 97.872  130.622  9.180   1.00 50.62  ?  103 VAL C CA  1 
ATOM 7339  C C   . VAL C  1 95  ? 97.701  129.168  9.597   1.00 52.77  ?  103 VAL C C   1 
ATOM 7340  O O   . VAL C  1 95  ? 98.453  128.669  10.442  1.00 56.37  ?  103 VAL C O   1 
ATOM 7341  C CB  . VAL C  1 95  ? 96.819  131.512  9.874   1.00 47.54  ?  103 VAL C CB  1 
ATOM 7342  C CG1 . VAL C  1 95  ? 96.613  131.073  11.312  1.00 50.01  ?  103 VAL C CG1 1 
ATOM 7343  C CG2 . VAL C  1 95  ? 97.244  132.969  9.815   1.00 49.26  ?  103 VAL C CG2 1 
ATOM 7344  N N   . GLY C  1 96  ? 96.742  128.463  9.009   1.00 48.76  ?  104 GLY C N   1 
ATOM 7345  C CA  . GLY C  1 96  ? 96.487  127.084  9.375   1.00 43.92  ?  104 GLY C CA  1 
ATOM 7346  C C   . GLY C  1 96  ? 96.449  126.182  8.161   1.00 42.88  ?  104 GLY C C   1 
ATOM 7347  O O   . GLY C  1 96  ? 96.038  126.584  7.074   1.00 43.54  ?  104 GLY C O   1 
ATOM 7348  N N   . VAL C  1 97  ? 96.896  124.944  8.361   1.00 46.01  ?  105 VAL C N   1 
ATOM 7349  C CA  . VAL C  1 97  ? 96.923  123.940  7.300   1.00 45.07  ?  105 VAL C CA  1 
ATOM 7350  C C   . VAL C  1 97  ? 96.578  122.587  7.899   1.00 46.63  ?  105 VAL C C   1 
ATOM 7351  O O   . VAL C  1 97  ? 97.140  122.199  8.926   1.00 44.47  ?  105 VAL C O   1 
ATOM 7352  C CB  . VAL C  1 97  ? 98.295  123.867  6.598   1.00 40.85  ?  105 VAL C CB  1 
ATOM 7353  C CG1 . VAL C  1 97  ? 98.337  122.688  5.645   1.00 40.73  ?  105 VAL C CG1 1 
ATOM 7354  C CG2 . VAL C  1 97  ? 98.584  125.146  5.842   1.00 41.05  ?  105 VAL C CG2 1 
ATOM 7355  N N   . GLU C  1 98  ? 95.666  121.863  7.255   1.00 48.89  ?  106 GLU C N   1 
ATOM 7356  C CA  . GLU C  1 98  ? 95.408  120.466  7.583   1.00 52.13  ?  106 GLU C CA  1 
ATOM 7357  C C   . GLU C  1 98  ? 95.364  119.681  6.282   1.00 48.95  ?  106 GLU C C   1 
ATOM 7358  O O   . GLU C  1 98  ? 94.535  119.966  5.410   1.00 51.66  ?  106 GLU C O   1 
ATOM 7359  C CB  . GLU C  1 98  ? 94.106  120.296  8.371   1.00 51.88  ?  106 GLU C CB  1 
ATOM 7360  C CG  . GLU C  1 98  ? 93.890  118.877  8.888   1.00 61.62  ?  106 GLU C CG  1 
ATOM 7361  C CD  . GLU C  1 98  ? 92.639  118.738  9.742   1.00 74.08  ?  106 GLU C CD  1 
ATOM 7362  O OE1 . GLU C  1 98  ? 92.220  119.744  10.355  1.00 79.18  ?  106 GLU C OE1 1 
ATOM 7363  O OE2 . GLU C  1 98  ? 92.081  117.620  9.810   1.00 77.45  -1 106 GLU C OE2 1 
ATOM 7364  N N   . ILE C  1 99  ? 96.265  118.712  6.149   1.00 47.20  ?  107 ILE C N   1 
ATOM 7365  C CA  . ILE C  1 99  ? 96.377  117.883  4.954   1.00 43.94  ?  107 ILE C CA  1 
ATOM 7366  C C   . ILE C  1 99  ? 95.648  116.577  5.228   1.00 43.06  ?  107 ILE C C   1 
ATOM 7367  O O   . ILE C  1 99  ? 96.058  115.795  6.093   1.00 42.59  ?  107 ILE C O   1 
ATOM 7368  C CB  . ILE C  1 99  ? 97.840  117.628  4.573   1.00 41.83  ?  107 ILE C CB  1 
ATOM 7369  C CG1 . ILE C  1 99  ? 98.562  118.943  4.293   1.00 41.78  ?  107 ILE C CG1 1 
ATOM 7370  C CG2 . ILE C  1 99  ? 97.921  116.712  3.362   1.00 41.64  ?  107 ILE C CG2 1 
ATOM 7371  C CD1 . ILE C  1 99  ? 100.029 118.766  4.019   1.00 41.37  ?  107 ILE C CD1 1 
ATOM 7372  N N   . GLY C  1 100 ? 94.568  116.334  4.491   1.00 43.64  ?  108 GLY C N   1 
ATOM 7373  C CA  . GLY C  1 100 ? 93.777  115.135  4.680   1.00 45.17  ?  108 GLY C CA  1 
ATOM 7374  C C   . GLY C  1 100 ? 94.271  114.011  3.794   1.00 43.91  ?  108 GLY C C   1 
ATOM 7375  O O   . GLY C  1 100 ? 94.474  114.196  2.592   1.00 50.25  ?  108 GLY C O   1 
ATOM 7376  N N   . ARG C  1 101 ? 94.459  112.841  4.396   1.00 42.80  ?  109 ARG C N   1 
ATOM 7377  C CA  . ARG C  1 101 ? 94.816  111.626  3.683   1.00 41.80  ?  109 ARG C CA  1 
ATOM 7378  C C   . ARG C  1 101 ? 93.683  110.625  3.845   1.00 43.59  ?  109 ARG C C   1 
ATOM 7379  O O   . ARG C  1 101 ? 93.135  110.472  4.940   1.00 46.06  ?  109 ARG C O   1 
ATOM 7380  C CB  . ARG C  1 101 ? 96.129  111.044  4.214   1.00 46.91  ?  109 ARG C CB  1 
ATOM 7381  C CG  . ARG C  1 101 ? 97.351  111.911  3.941   1.00 45.06  ?  109 ARG C CG  1 
ATOM 7382  C CD  . ARG C  1 101 ? 97.639  112.024  2.452   1.00 44.86  ?  109 ARG C CD  1 
ATOM 7383  N NE  . ARG C  1 101 ? 98.491  110.937  1.979   1.00 43.29  ?  109 ARG C NE  1 
ATOM 7384  C CZ  . ARG C  1 101 ? 98.089  109.968  1.164   1.00 44.89  ?  109 ARG C CZ  1 
ATOM 7385  N NH1 . ARG C  1 101 ? 96.838  109.939  0.728   1.00 45.71  1  109 ARG C NH1 1 
ATOM 7386  N NH2 . ARG C  1 101 ? 98.939  109.023  0.790   1.00 52.32  ?  109 ARG C NH2 1 
ATOM 7387  N N   . GLY C  1 102 ? 93.329  109.947  2.755   1.00 46.31  ?  110 GLY C N   1 
ATOM 7388  C CA  . GLY C  1 102 ? 92.108  109.164  2.746   1.00 49.04  ?  110 GLY C CA  1 
ATOM 7389  C C   . GLY C  1 102 ? 92.243  107.665  2.923   1.00 49.14  ?  110 GLY C C   1 
ATOM 7390  O O   . GLY C  1 102 ? 91.612  107.084  3.810   1.00 61.96  ?  110 GLY C O   1 
ATOM 7391  N N   . GLN C  1 103 ? 93.056  107.028  2.090   1.00 42.35  ?  111 GLN C N   1 
ATOM 7392  C CA  . GLN C  1 103 ? 93.108  105.576  2.051   1.00 42.41  ?  111 GLN C CA  1 
ATOM 7393  C C   . GLN C  1 103 ? 93.699  105.014  3.345   1.00 42.18  ?  111 GLN C C   1 
ATOM 7394  O O   . GLN C  1 103 ? 94.339  105.737  4.112   1.00 41.93  ?  111 GLN C O   1 
ATOM 7395  C CB  . GLN C  1 103 ? 93.919  105.120  0.841   1.00 48.88  ?  111 GLN C CB  1 
ATOM 7396  C CG  . GLN C  1 103 ? 93.326  105.555  -0.493  1.00 49.84  ?  111 GLN C CG  1 
ATOM 7397  C CD  . GLN C  1 103 ? 91.935  104.996  -0.734  1.00 48.31  ?  111 GLN C CD  1 
ATOM 7398  O OE1 . GLN C  1 103 ? 91.781  103.896  -1.264  1.00 49.09  ?  111 GLN C OE1 1 
ATOM 7399  N NE2 . GLN C  1 103 ? 90.914  105.760  -0.359  1.00 50.39  ?  111 GLN C NE2 1 
ATOM 7400  N N   . PRO C  1 104 ? 93.472  103.729  3.621   1.00 45.16  ?  112 PRO C N   1 
ATOM 7401  C CA  . PRO C  1 104 ? 94.037  103.123  4.832   1.00 44.63  ?  112 PRO C CA  1 
ATOM 7402  C C   . PRO C  1 104 ? 95.544  102.946  4.735   1.00 41.46  ?  112 PRO C C   1 
ATOM 7403  O O   . PRO C  1 104 ? 96.139  102.946  3.655   1.00 43.13  ?  112 PRO C O   1 
ATOM 7404  C CB  . PRO C  1 104 ? 93.334  101.764  4.914   1.00 43.13  ?  112 PRO C CB  1 
ATOM 7405  C CG  . PRO C  1 104 ? 92.933  101.468  3.513   1.00 43.68  ?  112 PRO C CG  1 
ATOM 7406  C CD  . PRO C  1 104 ? 92.575  102.796  2.916   1.00 43.42  ?  112 PRO C CD  1 
ATOM 7407  N N   . LEU C  1 105 ? 96.159  102.783  5.903   1.00 43.74  ?  113 LEU C N   1 
ATOM 7408  C CA  . LEU C  1 105 ? 97.598  102.579  5.975   1.00 43.45  ?  113 LEU C CA  1 
ATOM 7409  C C   . LEU C  1 105 ? 97.973  101.213  5.416   1.00 43.48  ?  113 LEU C C   1 
ATOM 7410  O O   . LEU C  1 105 ? 97.326  100.204  5.709   1.00 43.69  ?  113 LEU C O   1 
ATOM 7411  C CB  . LEU C  1 105 ? 98.079  102.700  7.419   1.00 46.60  ?  113 LEU C CB  1 
ATOM 7412  C CG  . LEU C  1 105 ? 97.831  104.043  8.104   1.00 48.21  ?  113 LEU C CG  1 
ATOM 7413  C CD1 . LEU C  1 105 ? 98.471  104.062  9.483   1.00 46.49  ?  113 LEU C CD1 1 
ATOM 7414  C CD2 . LEU C  1 105 ? 98.347  105.189  7.247   1.00 52.45  ?  113 LEU C CD2 1 
ATOM 7415  N N   . GLY C  1 106 ? 99.023  101.185  4.603   1.00 50.81  ?  114 GLY C N   1 
ATOM 7416  C CA  . GLY C  1 106 ? 99.482  99.937   4.025   1.00 52.24  ?  114 GLY C CA  1 
ATOM 7417  C C   . GLY C  1 106 ? 100.896 100.062  3.512   1.00 48.41  ?  114 GLY C C   1 
ATOM 7418  O O   . GLY C  1 106 ? 101.417 101.167  3.322   1.00 49.12  ?  114 GLY C O   1 
ATOM 7419  N N   . VAL C  1 107 ? 101.517 98.908   3.291   1.00 45.39  ?  115 VAL C N   1 
ATOM 7420  C CA  . VAL C  1 107 ? 102.867 98.825   2.748   1.00 45.57  ?  115 VAL C CA  1 
ATOM 7421  C C   . VAL C  1 107 ? 102.790 98.179   1.374   1.00 50.70  ?  115 VAL C C   1 
ATOM 7422  O O   . VAL C  1 107 ? 102.083 97.183   1.183   1.00 58.31  ?  115 VAL C O   1 
ATOM 7423  C CB  . VAL C  1 107 ? 103.805 98.034   3.679   1.00 47.37  ?  115 VAL C CB  1 
ATOM 7424  C CG1 . VAL C  1 107 ? 105.246 98.153   3.206   1.00 45.62  ?  115 VAL C CG1 1 
ATOM 7425  C CG2 . VAL C  1 107 ? 103.669 98.534   5.107   1.00 52.60  ?  115 VAL C CG2 1 
ATOM 7426  N N   . GLY C  1 108 ? 103.517 98.745   0.420   1.00 46.59  ?  116 GLY C N   1 
ATOM 7427  C CA  . GLY C  1 108 ? 103.494 98.253   -0.942  1.00 51.01  ?  116 GLY C CA  1 
ATOM 7428  C C   . GLY C  1 108 ? 104.891 98.007   -1.469  1.00 56.09  ?  116 GLY C C   1 
ATOM 7429  O O   . GLY C  1 108 ? 105.863 98.626   -1.037  1.00 60.35  ?  116 GLY C O   1 
ATOM 7430  N N   . LEU C  1 109 ? 104.975 97.080   -2.415  1.00 55.66  ?  117 LEU C N   1 
ATOM 7431  C CA  . LEU C  1 109 ? 106.247 96.656   -2.976  1.00 48.75  ?  117 LEU C CA  1 
ATOM 7432  C C   . LEU C  1 109 ? 106.509 97.313   -4.323  1.00 43.78  ?  117 LEU C C   1 
ATOM 7433  O O   . LEU C  1 109 ? 105.586 97.656   -5.067  1.00 41.71  ?  117 LEU C O   1 
ATOM 7434  C CB  . LEU C  1 109 ? 106.291 95.138   -3.132  1.00 41.75  ?  117 LEU C CB  1 
ATOM 7435  C CG  . LEU C  1 109 ? 106.066 94.378   -1.832  1.00 41.70  ?  117 LEU C CG  1 
ATOM 7436  C CD1 . LEU C  1 109 ? 106.180 92.888   -2.070  1.00 41.86  ?  117 LEU C CD1 1 
ATOM 7437  C CD2 . LEU C  1 109 ? 107.068 94.847   -0.797  1.00 41.44  ?  117 LEU C CD2 1 
ATOM 7438  N N   . SER C  1 110 ? 107.792 97.483   -4.622  1.00 45.52  ?  118 SER C N   1 
ATOM 7439  C CA  . SER C  1 110 ? 108.270 97.903   -5.930  1.00 48.15  ?  118 SER C CA  1 
ATOM 7440  C C   . SER C  1 110 ? 109.415 96.981   -6.312  1.00 48.90  ?  118 SER C C   1 
ATOM 7441  O O   . SER C  1 110 ? 110.296 96.711   -5.489  1.00 45.70  ?  118 SER C O   1 
ATOM 7442  C CB  . SER C  1 110 ? 108.734 99.362   -5.914  1.00 49.71  ?  118 SER C CB  1 
ATOM 7443  O OG  . SER C  1 110 ? 107.756 100.200  -5.324  1.00 50.49  ?  118 SER C OG  1 
ATOM 7444  N N   . GLY C  1 111 ? 109.400 96.489   -7.546  1.00 46.88  ?  119 GLY C N   1 
ATOM 7445  C CA  . GLY C  1 111 ? 110.398 95.514   -7.930  1.00 46.85  ?  119 GLY C CA  1 
ATOM 7446  C C   . GLY C  1 111 ? 110.895 95.606   -9.355  1.00 45.33  ?  119 GLY C C   1 
ATOM 7447  O O   . GLY C  1 111 ? 110.638 96.584   -10.065 1.00 42.26  ?  119 GLY C O   1 
ATOM 7448  N N   . HIS C  1 112 ? 111.614 94.573   -9.775  1.00 46.30  ?  120 HIS C N   1 
ATOM 7449  C CA  . HIS C  1 112 ? 112.228 94.488   -11.090 1.00 47.30  ?  120 HIS C CA  1 
ATOM 7450  C C   . HIS C  1 112 ? 112.445 93.020   -11.434 1.00 47.24  ?  120 HIS C C   1 
ATOM 7451  O O   . HIS C  1 112 ? 113.003 92.264   -10.625 1.00 49.12  ?  120 HIS C O   1 
ATOM 7452  C CB  . HIS C  1 112 ? 113.549 95.258   -11.122 1.00 46.24  ?  120 HIS C CB  1 
ATOM 7453  C CG  . HIS C  1 112 ? 113.987 95.655   -12.497 1.00 47.63  ?  120 HIS C CG  1 
ATOM 7454  N ND1 . HIS C  1 112 ? 114.192 94.740   -13.507 1.00 49.77  ?  120 HIS C ND1 1 
ATOM 7455  C CD2 . HIS C  1 112 ? 114.259 96.870   -13.030 1.00 48.67  ?  120 HIS C CD2 1 
ATOM 7456  C CE1 . HIS C  1 112 ? 114.572 95.373   -14.603 1.00 52.89  ?  120 HIS C CE1 1 
ATOM 7457  N NE2 . HIS C  1 112 ? 114.619 96.667   -14.341 1.00 52.08  ?  120 HIS C NE2 1 
ATOM 7458  N N   . PRO C  1 113 ? 111.998 92.576   -12.611 1.00 46.05  ?  121 PRO C N   1 
ATOM 7459  C CA  . PRO C  1 113 ? 112.228 91.175   -12.988 1.00 47.09  ?  121 PRO C CA  1 
ATOM 7460  C C   . PRO C  1 113 ? 113.692 90.859   -13.216 1.00 47.53  ?  121 PRO C C   1 
ATOM 7461  O O   . PRO C  1 113 ? 114.115 89.721   -12.978 1.00 48.08  ?  121 PRO C O   1 
ATOM 7462  C CB  . PRO C  1 113 ? 111.412 91.018   -14.281 1.00 50.64  ?  121 PRO C CB  1 
ATOM 7463  C CG  . PRO C  1 113 ? 110.441 92.163   -14.271 1.00 49.49  ?  121 PRO C CG  1 
ATOM 7464  C CD  . PRO C  1 113 ? 111.160 93.283   -13.591 1.00 46.99  ?  121 PRO C CD  1 
ATOM 7465  N N   . LEU C  1 114 ? 114.478 91.830   -13.677 1.00 54.30  ?  122 LEU C N   1 
ATOM 7466  C CA  . LEU C  1 114 ? 115.898 91.616   -13.919 1.00 53.86  ?  122 LEU C CA  1 
ATOM 7467  C C   . LEU C  1 114 ? 116.741 92.508   -13.015 1.00 50.27  ?  122 LEU C C   1 
ATOM 7468  O O   . LEU C  1 114 ? 117.532 93.323   -13.499 1.00 49.91  ?  122 LEU C O   1 
ATOM 7469  C CB  . LEU C  1 114 ? 116.219 91.867   -15.392 1.00 46.20  ?  122 LEU C CB  1 
ATOM 7470  C CG  . LEU C  1 114 ? 115.313 91.098   -16.358 1.00 47.14  ?  122 LEU C CG  1 
ATOM 7471  C CD1 . LEU C  1 114 ? 115.700 91.362   -17.806 1.00 56.14  ?  122 LEU C CD1 1 
ATOM 7472  C CD2 . LEU C  1 114 ? 115.350 89.608   -16.052 1.00 47.97  ?  122 LEU C CD2 1 
ATOM 7473  N N   . TYR C  1 115 ? 116.574 92.362   -11.702 1.00 50.40  ?  123 TYR C N   1 
ATOM 7474  C CA  . TYR C  1 115 ? 117.346 93.134   -10.739 1.00 47.40  ?  123 TYR C CA  1 
ATOM 7475  C C   . TYR C  1 115 ? 118.765 92.586   -10.662 1.00 46.31  ?  123 TYR C C   1 
ATOM 7476  O O   . TYR C  1 115 ? 118.978 91.371   -10.695 1.00 49.81  ?  123 TYR C O   1 
ATOM 7477  C CB  . TYR C  1 115 ? 116.678 93.086   -9.363  1.00 47.44  ?  123 TYR C CB  1 
ATOM 7478  C CG  . TYR C  1 115 ? 117.271 94.021   -8.328  1.00 45.00  ?  123 TYR C CG  1 
ATOM 7479  C CD1 . TYR C  1 115 ? 116.756 95.299   -8.144  1.00 44.20  ?  123 TYR C CD1 1 
ATOM 7480  C CD2 . TYR C  1 115 ? 118.333 93.621   -7.528  1.00 45.42  ?  123 TYR C CD2 1 
ATOM 7481  C CE1 . TYR C  1 115 ? 117.290 96.156   -7.198  1.00 43.82  ?  123 TYR C CE1 1 
ATOM 7482  C CE2 . TYR C  1 115 ? 118.873 94.470   -6.581  1.00 45.11  ?  123 TYR C CE2 1 
ATOM 7483  C CZ  . TYR C  1 115 ? 118.348 95.737   -6.419  1.00 44.30  ?  123 TYR C CZ  1 
ATOM 7484  O OH  . TYR C  1 115 ? 118.884 96.584   -5.474  1.00 44.13  ?  123 TYR C OH  1 
ATOM 7485  N N   . ASN C  1 116 ? 119.741 93.489   -10.561 1.00 46.01  ?  124 ASN C N   1 
ATOM 7486  C CA  . ASN C  1 116 ? 121.150 93.096   -10.562 1.00 49.84  ?  124 ASN C CA  1 
ATOM 7487  C C   . ASN C  1 116 ? 121.532 92.618   -9.164  1.00 47.78  ?  124 ASN C C   1 
ATOM 7488  O O   . ASN C  1 116 ? 122.096 93.347   -8.344  1.00 46.76  ?  124 ASN C O   1 
ATOM 7489  C CB  . ASN C  1 116 ? 122.036 94.244   -11.027 1.00 55.41  ?  124 ASN C CB  1 
ATOM 7490  C CG  . ASN C  1 116 ? 123.497 93.847   -11.128 1.00 59.86  ?  124 ASN C CG  1 
ATOM 7491  O OD1 . ASN C  1 116 ? 123.826 92.663   -11.199 1.00 62.97  ?  124 ASN C OD1 1 
ATOM 7492  N ND2 . ASN C  1 116 ? 124.382 94.838   -11.140 1.00 59.46  ?  124 ASN C ND2 1 
ATOM 7493  N N   . LYS C  1 117 ? 121.212 91.354   -8.897  1.00 53.29  ?  125 LYS C N   1 
ATOM 7494  C CA  . LYS C  1 117 ? 121.541 90.689   -7.641  1.00 55.25  ?  125 LYS C CA  1 
ATOM 7495  C C   . LYS C  1 117 ? 122.440 89.504   -7.968  1.00 59.53  ?  125 LYS C C   1 
ATOM 7496  O O   . LYS C  1 117 ? 121.985 88.517   -8.559  1.00 62.65  ?  125 LYS C O   1 
ATOM 7497  C CB  . LYS C  1 117 ? 120.278 90.232   -6.913  1.00 54.24  ?  125 LYS C CB  1 
ATOM 7498  C CG  . LYS C  1 117 ? 120.540 89.307   -5.733  1.00 58.93  ?  125 LYS C CG  1 
ATOM 7499  C CD  . LYS C  1 117 ? 119.241 88.755   -5.165  1.00 60.11  ?  125 LYS C CD  1 
ATOM 7500  C CE  . LYS C  1 117 ? 119.441 87.369   -4.568  1.00 60.19  ?  125 LYS C CE  1 
ATOM 7501  N NZ  . LYS C  1 117 ? 118.146 86.659   -4.363  1.00 59.31  1  125 LYS C NZ  1 
ATOM 7502  N N   . LEU C  1 118 ? 123.712 89.594   -7.588  1.00 53.85  ?  126 LEU C N   1 
ATOM 7503  C CA  . LEU C  1 118 ? 124.644 88.515   -7.879  1.00 56.58  ?  126 LEU C CA  1 
ATOM 7504  C C   . LEU C  1 118 ? 124.601 87.463   -6.779  1.00 57.92  ?  126 LEU C C   1 
ATOM 7505  O O   . LEU C  1 118 ? 124.036 86.381   -6.966  1.00 59.26  ?  126 LEU C O   1 
ATOM 7506  C CB  . LEU C  1 118 ? 126.061 89.063   -8.048  1.00 58.84  ?  126 LEU C CB  1 
ATOM 7507  C CG  . LEU C  1 118 ? 127.164 88.048   -8.343  1.00 61.92  ?  126 LEU C CG  1 
ATOM 7508  C CD1 . LEU C  1 118 ? 126.871 87.288   -9.626  1.00 63.69  ?  126 LEU C CD1 1 
ATOM 7509  C CD2 . LEU C  1 118 ? 128.493 88.762   -8.437  1.00 66.74  ?  126 LEU C CD2 1 
ATOM 7510  N N   . ASP C  1 119 ? 125.195 87.774   -5.630  1.00 53.43  ?  127 ASP C N   1 
ATOM 7511  C CA  . ASP C  1 119 ? 125.290 86.838   -4.522  1.00 60.38  ?  127 ASP C CA  1 
ATOM 7512  C C   . ASP C  1 119 ? 124.768 87.474   -3.243  1.00 61.63  ?  127 ASP C C   1 
ATOM 7513  O O   . ASP C  1 119 ? 124.876 88.686   -3.037  1.00 63.10  ?  127 ASP C O   1 
ATOM 7514  C CB  . ASP C  1 119 ? 126.731 86.361   -4.307  1.00 69.26  ?  127 ASP C CB  1 
ATOM 7515  C CG  . ASP C  1 119 ? 127.174 85.363   -5.353  1.00 79.05  ?  127 ASP C CG  1 
ATOM 7516  O OD1 . ASP C  1 119 ? 126.297 84.694   -5.939  1.00 79.04  ?  127 ASP C OD1 1 
ATOM 7517  O OD2 . ASP C  1 119 ? 128.395 85.238   -5.584  1.00 88.75  -1 127 ASP C OD2 1 
ATOM 7518  N N   . ASP C  1 120 ? 124.203 86.633   -2.384  1.00 59.74  ?  128 ASP C N   1 
ATOM 7519  C CA  . ASP C  1 120 ? 123.813 87.040   -1.042  1.00 55.90  ?  128 ASP C CA  1 
ATOM 7520  C C   . ASP C  1 120 ? 125.059 87.093   -0.165  1.00 54.60  ?  128 ASP C C   1 
ATOM 7521  O O   . ASP C  1 120 ? 125.752 86.085   -0.000  1.00 56.95  ?  128 ASP C O   1 
ATOM 7522  C CB  . ASP C  1 120 ? 122.778 86.065   -0.484  1.00 59.89  ?  128 ASP C CB  1 
ATOM 7523  C CG  . ASP C  1 120 ? 122.220 86.496   0.864   1.00 66.09  ?  128 ASP C CG  1 
ATOM 7524  O OD1 . ASP C  1 120 ? 123.001 86.837   1.777   1.00 65.61  ?  128 ASP C OD1 1 
ATOM 7525  O OD2 . ASP C  1 120 ? 120.981 86.483   1.011   1.00 73.50  -1 128 ASP C OD2 1 
ATOM 7526  N N   . THR C  1 121 ? 125.368 88.276   0.362   1.00 53.11  ?  129 THR C N   1 
ATOM 7527  C CA  . THR C  1 121 ? 126.542 88.482   1.199   1.00 56.11  ?  129 THR C CA  1 
ATOM 7528  C C   . THR C  1 121 ? 126.197 88.588   2.682   1.00 56.94  ?  129 THR C C   1 
ATOM 7529  O O   . THR C  1 121 ? 127.063 88.944   3.487   1.00 58.04  ?  129 THR C O   1 
ATOM 7530  C CB  . THR C  1 121 ? 127.292 89.733   0.742   1.00 54.81  ?  129 THR C CB  1 
ATOM 7531  O OG1 . THR C  1 121 ? 126.418 90.865   0.802   1.00 50.18  ?  129 THR C OG1 1 
ATOM 7532  C CG2 . THR C  1 121 ? 127.779 89.559   -0.690  1.00 54.38  ?  129 THR C CG2 1 
ATOM 7533  N N   . GLU C  1 122 ? 124.960 88.282   3.053   1.00 55.13  ?  130 GLU C N   1 
ATOM 7534  C CA  . GLU C  1 122 ? 124.457 88.412   4.423   1.00 59.16  ?  130 GLU C CA  1 
ATOM 7535  C C   . GLU C  1 122 ? 124.390 87.052   5.109   1.00 66.31  ?  130 GLU C C   1 
ATOM 7536  O O   . GLU C  1 122 ? 123.325 86.624   5.562   1.00 75.08  ?  130 GLU C O   1 
ATOM 7537  C CB  . GLU C  1 122 ? 123.094 89.095   4.424   1.00 59.81  ?  130 GLU C CB  1 
ATOM 7538  C CG  . GLU C  1 122 ? 122.582 89.467   5.808   1.00 61.24  ?  130 GLU C CG  1 
ATOM 7539  C CD  . GLU C  1 122 ? 121.081 89.642   5.846   1.00 63.59  ?  130 GLU C CD  1 
ATOM 7540  O OE1 . GLU C  1 122 ? 120.570 90.094   6.892   1.00 65.88  ?  130 GLU C OE1 1 
ATOM 7541  O OE2 . GLU C  1 122 ? 120.413 89.319   4.838   1.00 63.15  -1 130 GLU C OE2 1 
ATOM 7542  N N   . ASN C  1 123 ? 125.507 86.318   5.084   1.00 62.74  ?  131 ASN C N   1 
ATOM 7543  C CA  . ASN C  1 123 ? 125.658 85.031   5.763   1.00 67.44  ?  131 ASN C CA  1 
ATOM 7544  C C   . ASN C  1 123 ? 124.999 83.944   4.921   1.00 70.91  ?  131 ASN C C   1 
ATOM 7545  O O   . ASN C  1 123 ? 124.182 83.161   5.416   1.00 72.51  ?  131 ASN C O   1 
ATOM 7546  C CB  . ASN C  1 123 ? 125.081 85.076   7.191   1.00 52.87  ?  131 ASN C CB  1 
ATOM 7547  C CG  . ASN C  1 123 ? 125.237 83.760   7.944   1.00 53.78  ?  131 ASN C CG  1 
ATOM 7548  O OD1 . ASN C  1 123 ? 126.285 83.118   7.904   1.00 54.26  ?  131 ASN C OD1 1 
ATOM 7549  N ND2 . ASN C  1 123 ? 124.167 83.344   8.620   1.00 54.05  ?  131 ASN C ND2 1 
ATOM 7550  N N   . SER C  1 124 ? 125.322 83.926   3.631   1.00 76.56  ?  132 SER C N   1 
ATOM 7551  C CA  . SER C  1 124 ? 124.783 82.948   2.693   1.00 86.01  ?  132 SER C CA  1 
ATOM 7552  C C   . SER C  1 124 ? 125.670 81.709   2.633   1.00 99.60  ?  132 SER C C   1 
ATOM 7553  O O   . SER C  1 124 ? 126.842 81.795   2.252   1.00 103.78 ?  132 SER C O   1 
ATOM 7554  C CB  . SER C  1 124 ? 124.638 83.552   1.297   1.00 90.38  ?  132 SER C CB  1 
ATOM 7555  O OG  . SER C  1 124 ? 124.023 82.641   0.399   1.00 88.14  ?  132 SER C OG  1 
ATOM 7556  N N   . HIS C  1 125 ? 125.107 80.560   3.006   1.00 117.69 ?  133 HIS C N   1 
ATOM 7557  C CA  . HIS C  1 125 ? 125.722 79.261   2.767   1.00 125.99 ?  133 HIS C CA  1 
ATOM 7558  C C   . HIS C  1 125 ? 124.927 78.473   1.731   1.00 123.66 ?  133 HIS C C   1 
ATOM 7559  O O   . HIS C  1 125 ? 125.103 77.258   1.596   1.00 128.10 ?  133 HIS C O   1 
ATOM 7560  C CB  . HIS C  1 125 ? 125.855 78.466   4.068   1.00 134.42 ?  133 HIS C CB  1 
ATOM 7561  C CG  . HIS C  1 125 ? 126.793 77.299   3.974   1.00 144.55 ?  133 HIS C CG  1 
ATOM 7562  N ND1 . HIS C  1 125 ? 127.896 77.292   3.146   1.00 147.45 ?  133 HIS C ND1 1 
ATOM 7563  C CD2 . HIS C  1 125 ? 126.788 76.098   4.601   1.00 149.76 ?  133 HIS C CD2 1 
ATOM 7564  C CE1 . HIS C  1 125 ? 128.531 76.140   3.270   1.00 152.14 ?  133 HIS C CE1 1 
ATOM 7565  N NE2 . HIS C  1 125 ? 127.879 75.397   4.146   1.00 153.45 ?  133 HIS C NE2 1 
ATOM 7566  N N   . VAL C  1 126 ? 124.052 79.160   0.994   1.00 125.09 ?  134 VAL C N   1 
ATOM 7567  C CA  . VAL C  1 126 ? 123.190 78.494   0.024   1.00 124.01 ?  134 VAL C CA  1 
ATOM 7568  C C   . VAL C  1 126 ? 124.002 78.031   -1.179  1.00 123.77 ?  134 VAL C C   1 
ATOM 7569  O O   . VAL C  1 126 ? 124.132 76.828   -1.435  1.00 131.33 ?  134 VAL C O   1 
ATOM 7570  C CB  . VAL C  1 126 ? 122.045 79.432   -0.399  1.00 125.34 ?  134 VAL C CB  1 
ATOM 7571  C CG1 . VAL C  1 126 ? 121.047 78.697   -1.278  1.00 127.83 ?  134 VAL C CG1 1 
ATOM 7572  C CG2 . VAL C  1 126 ? 121.363 80.029   0.826   1.00 122.79 ?  134 VAL C CG2 1 
ATOM 7573  N N   . ALA C  1 127 ? 124.572 78.972   -1.919  1.00 118.66 ?  135 ALA C N   1 
ATOM 7574  C CA  . ALA C  1 127 ? 125.356 78.659   -3.111  1.00 122.48 ?  135 ALA C CA  1 
ATOM 7575  C C   . ALA C  1 127 ? 126.096 79.922   -3.538  1.00 124.50 ?  135 ALA C C   1 
ATOM 7576  O O   . ALA C  1 127 ? 126.085 80.939   -2.833  1.00 126.11 ?  135 ALA C O   1 
ATOM 7577  C CB  . ALA C  1 127 ? 124.468 78.120   -4.235  1.00 124.91 ?  135 ALA C CB  1 
ATOM 7578  N N   . SER C  1 128 ? 126.742 79.849   -4.698  1.00 113.76 ?  136 SER C N   1 
ATOM 7579  C CA  . SER C  1 128 ? 127.415 80.980   -5.317  1.00 111.04 ?  136 SER C CA  1 
ATOM 7580  C C   . SER C  1 128 ? 127.044 81.004   -6.791  1.00 112.21 ?  136 SER C C   1 
ATOM 7581  O O   . SER C  1 128 ? 127.040 79.962   -7.454  1.00 116.14 ?  136 SER C O   1 
ATOM 7582  C CB  . SER C  1 128 ? 128.939 80.893   -5.153  1.00 99.48  ?  136 SER C CB  1 
ATOM 7583  O OG  . SER C  1 128 ? 129.587 81.963   -5.820  1.00 97.73  ?  136 SER C OG  1 
ATOM 7584  N N   . ALA C  1 129 ? 126.736 82.190   -7.301  1.00 108.51 ?  137 ALA C N   1 
ATOM 7585  C CA  . ALA C  1 129 ? 126.237 82.327   -8.660  1.00 109.08 ?  137 ALA C CA  1 
ATOM 7586  C C   . ALA C  1 129 ? 127.389 82.496   -9.639  1.00 112.46 ?  137 ALA C C   1 
ATOM 7587  O O   . ALA C  1 129 ? 128.418 83.102   -9.324  1.00 110.67 ?  137 ALA C O   1 
ATOM 7588  C CB  . ALA C  1 129 ? 125.279 83.514   -8.771  1.00 101.70 ?  137 ALA C CB  1 
ATOM 7589  N N   . VAL C  1 130 ? 127.206 81.950   -10.837 1.00 113.14 ?  138 VAL C N   1 
ATOM 7590  C CA  . VAL C  1 130 ? 128.199 82.094   -11.894 1.00 123.94 ?  138 VAL C CA  1 
ATOM 7591  C C   . VAL C  1 130 ? 127.986 83.437   -12.575 1.00 135.22 ?  138 VAL C C   1 
ATOM 7592  O O   . VAL C  1 130 ? 126.849 83.844   -12.844 1.00 136.45 ?  138 VAL C O   1 
ATOM 7593  C CB  . VAL C  1 130 ? 128.093 80.930   -12.895 1.00 120.94 ?  138 VAL C CB  1 
ATOM 7594  C CG1 . VAL C  1 130 ? 129.129 81.076   -14.001 1.00 120.39 ?  138 VAL C CG1 1 
ATOM 7595  C CG2 . VAL C  1 130 ? 128.250 79.597   -12.177 1.00 123.62 ?  138 VAL C CG2 1 
ATOM 7596  N N   . ASP C  1 131 ? 129.086 84.136   -12.854 1.00 135.42 ?  139 ASP C N   1 
ATOM 7597  C CA  . ASP C  1 131 ? 128.987 85.493   -13.375 1.00 132.28 ?  139 ASP C CA  1 
ATOM 7598  C C   . ASP C  1 131 ? 128.771 85.536   -14.882 1.00 133.09 ?  139 ASP C C   1 
ATOM 7599  O O   . ASP C  1 131 ? 128.288 86.551   -15.391 1.00 130.87 ?  139 ASP C O   1 
ATOM 7600  C CB  . ASP C  1 131 ? 130.247 86.280   -13.000 1.00 131.36 ?  139 ASP C CB  1 
ATOM 7601  C CG  . ASP C  1 131 ? 130.193 87.726   -13.453 1.00 125.20 ?  139 ASP C CG  1 
ATOM 7602  O OD1 . ASP C  1 131 ? 129.538 88.540   -12.767 1.00 117.43 ?  139 ASP C OD1 1 
ATOM 7603  O OD2 . ASP C  1 131 ? 130.811 88.049   -14.489 1.00 126.89 -1 139 ASP C OD2 1 
ATOM 7604  N N   . THR C  1 132 ? 129.094 84.457   -15.599 1.00 140.02 ?  140 THR C N   1 
ATOM 7605  C CA  . THR C  1 132 ? 129.055 84.482   -17.059 1.00 134.56 ?  140 THR C CA  1 
ATOM 7606  C C   . THR C  1 132 ? 127.655 84.800   -17.576 1.00 131.47 ?  140 THR C C   1 
ATOM 7607  O O   . THR C  1 132 ? 127.446 85.799   -18.274 1.00 132.47 ?  140 THR C O   1 
ATOM 7608  C CB  . THR C  1 132 ? 129.549 83.149   -17.623 1.00 133.80 ?  140 THR C CB  1 
ATOM 7609  O OG1 . THR C  1 132 ? 130.908 82.932   -17.222 1.00 137.87 ?  140 THR C OG1 1 
ATOM 7610  C CG2 . THR C  1 132 ? 129.471 83.154   -19.144 1.00 133.37 ?  140 THR C CG2 1 
ATOM 7611  N N   . LYS C  1 133 ? 126.682 83.955   -17.245 1.00 129.58 ?  141 LYS C N   1 
ATOM 7612  C CA  . LYS C  1 133 ? 125.350 84.050   -17.827 1.00 118.23 ?  141 LYS C CA  1 
ATOM 7613  C C   . LYS C  1 133 ? 124.574 85.187   -17.160 1.00 109.77 ?  141 LYS C C   1 
ATOM 7614  O O   . LYS C  1 133 ? 125.109 85.951   -16.352 1.00 106.10 ?  141 LYS C O   1 
ATOM 7615  C CB  . LYS C  1 133 ? 124.632 82.708   -17.712 1.00 115.04 ?  141 LYS C CB  1 
ATOM 7616  C CG  . LYS C  1 133 ? 125.489 81.516   -18.128 1.00 114.89 ?  141 LYS C CG  1 
ATOM 7617  C CD  . LYS C  1 133 ? 125.993 81.638   -19.562 1.00 110.74 ?  141 LYS C CD  1 
ATOM 7618  C CE  . LYS C  1 133 ? 124.864 81.574   -20.577 1.00 101.18 ?  141 LYS C CE  1 
ATOM 7619  N NZ  . LYS C  1 133 ? 125.384 81.610   -21.974 1.00 98.49  1  141 LYS C NZ  1 
ATOM 7620  N N   . ASP C  1 134 ? 123.290 85.313   -17.497 1.00 101.65 ?  142 ASP C N   1 
ATOM 7621  C CA  . ASP C  1 134 ? 122.436 86.369   -16.952 1.00 94.23  ?  142 ASP C CA  1 
ATOM 7622  C C   . ASP C  1 134 ? 122.063 86.018   -15.516 1.00 86.69  ?  142 ASP C C   1 
ATOM 7623  O O   . ASP C  1 134 ? 121.059 85.355   -15.251 1.00 84.23  ?  142 ASP C O   1 
ATOM 7624  C CB  . ASP C  1 134 ? 121.194 86.554   -17.817 1.00 88.45  ?  142 ASP C CB  1 
ATOM 7625  C CG  . ASP C  1 134 ? 120.272 87.642   -17.295 1.00 79.11  ?  142 ASP C CG  1 
ATOM 7626  O OD1 . ASP C  1 134 ? 120.761 88.557   -16.601 1.00 76.61  ?  142 ASP C OD1 1 
ATOM 7627  O OD2 . ASP C  1 134 ? 119.055 87.579   -17.576 1.00 73.27  -1 142 ASP C OD2 1 
ATOM 7628  N N   . THR C  1 135 ? 122.888 86.473   -14.573 1.00 86.31  ?  143 THR C N   1 
ATOM 7629  C CA  . THR C  1 135 ? 122.659 86.216   -13.151 1.00 80.76  ?  143 THR C CA  1 
ATOM 7630  C C   . THR C  1 135 ? 121.885 87.377   -12.518 1.00 70.03  ?  143 THR C C   1 
ATOM 7631  O O   . THR C  1 135 ? 122.342 88.054   -11.596 1.00 69.19  ?  143 THR C O   1 
ATOM 7632  C CB  . THR C  1 135 ? 123.985 85.969   -12.440 1.00 81.26  ?  143 THR C CB  1 
ATOM 7633  O OG1 . THR C  1 135 ? 123.795 86.056   -11.022 1.00 86.03  ?  143 THR C OG1 1 
ATOM 7634  C CG2 . THR C  1 135 ? 125.034 86.987   -12.882 1.00 77.58  ?  143 THR C CG2 1 
ATOM 7635  N N   . ARG C  1 136 ? 120.679 87.592   -13.038 1.00 56.53  ?  144 ARG C N   1 
ATOM 7636  C CA  . ARG C  1 136 ? 119.784 88.645   -12.574 1.00 55.78  ?  144 ARG C CA  1 
ATOM 7637  C C   . ARG C  1 136 ? 118.496 88.008   -12.077 1.00 55.98  ?  144 ARG C C   1 
ATOM 7638  O O   . ARG C  1 136 ? 117.813 87.311   -12.835 1.00 56.22  ?  144 ARG C O   1 
ATOM 7639  C CB  . ARG C  1 136 ? 119.493 89.654   -13.686 1.00 52.46  ?  144 ARG C CB  1 
ATOM 7640  C CG  . ARG C  1 136 ? 120.636 90.613   -13.974 1.00 51.91  ?  144 ARG C CG  1 
ATOM 7641  C CD  . ARG C  1 136 ? 120.201 91.705   -14.938 1.00 50.53  ?  144 ARG C CD  1 
ATOM 7642  N NE  . ARG C  1 136 ? 119.730 91.147   -16.203 1.00 54.30  ?  144 ARG C NE  1 
ATOM 7643  C CZ  . ARG C  1 136 ? 119.406 91.872   -17.268 1.00 54.29  ?  144 ARG C CZ  1 
ATOM 7644  N NH1 . ARG C  1 136 ? 119.503 93.193   -17.227 1.00 53.15  1  144 ARG C NH1 1 
ATOM 7645  N NH2 . ARG C  1 136 ? 118.987 91.276   -18.376 1.00 53.15  ?  144 ARG C NH2 1 
ATOM 7646  N N   . ASP C  1 137 ? 118.171 88.239   -10.810 1.00 61.27  ?  145 ASP C N   1 
ATOM 7647  C CA  . ASP C  1 137 ? 116.997 87.649   -10.186 1.00 60.12  ?  145 ASP C CA  1 
ATOM 7648  C C   . ASP C  1 137 ? 115.834 88.636   -10.194 1.00 53.85  ?  145 ASP C C   1 
ATOM 7649  O O   . ASP C  1 137 ? 116.017 89.852   -10.283 1.00 49.27  ?  145 ASP C O   1 
ATOM 7650  C CB  . ASP C  1 137 ? 117.305 87.221   -8.748  1.00 55.11  ?  145 ASP C CB  1 
ATOM 7651  C CG  . ASP C  1 137 ? 118.532 86.337   -8.653  1.00 65.93  ?  145 ASP C CG  1 
ATOM 7652  O OD1 . ASP C  1 137 ? 119.289 86.258   -9.643  1.00 72.79  ?  145 ASP C OD1 1 
ATOM 7653  O OD2 . ASP C  1 137 ? 118.741 85.719   -7.587  1.00 71.94  -1 145 ASP C OD2 1 
ATOM 7654  N N   . ASN C  1 138 ? 114.624 88.089   -10.104 1.00 55.79  ?  146 ASN C N   1 
ATOM 7655  C CA  . ASN C  1 138 ? 113.413 88.898   -9.992  1.00 49.48  ?  146 ASN C CA  1 
ATOM 7656  C C   . ASN C  1 138 ? 113.256 89.306   -8.533  1.00 44.87  ?  146 ASN C C   1 
ATOM 7657  O O   . ASN C  1 138 ? 112.943 88.471   -7.679  1.00 46.95  ?  146 ASN C O   1 
ATOM 7658  C CB  . ASN C  1 138 ? 112.201 88.115   -10.490 1.00 48.53  ?  146 ASN C CB  1 
ATOM 7659  C CG  . ASN C  1 138 ? 110.972 88.986   -10.672 1.00 47.16  ?  146 ASN C CG  1 
ATOM 7660  O OD1 . ASN C  1 138 ? 110.821 90.017   -10.020 1.00 45.21  ?  146 ASN C OD1 1 
ATOM 7661  N ND2 . ASN C  1 138 ? 110.087 88.575   -11.570 1.00 48.37  ?  146 ASN C ND2 1 
ATOM 7662  N N   . VAL C  1 139 ? 113.474 90.585   -8.241  1.00 49.52  ?  147 VAL C N   1 
ATOM 7663  C CA  . VAL C  1 139 ? 113.581 91.056   -6.866  1.00 48.15  ?  147 VAL C CA  1 
ATOM 7664  C C   . VAL C  1 139 ? 112.601 92.199   -6.647  1.00 49.91  ?  147 VAL C C   1 
ATOM 7665  O O   . VAL C  1 139 ? 112.537 93.132   -7.454  1.00 53.62  ?  147 VAL C O   1 
ATOM 7666  C CB  . VAL C  1 139 ? 115.019 91.509   -6.539  1.00 47.68  ?  147 VAL C CB  1 
ATOM 7667  C CG1 . VAL C  1 139 ? 115.036 92.430   -5.329  1.00 47.43  ?  147 VAL C CG1 1 
ATOM 7668  C CG2 . VAL C  1 139 ? 115.920 90.303   -6.317  1.00 48.56  ?  147 VAL C CG2 1 
ATOM 7669  N N   . SER C  1 140 ? 111.845 92.129   -5.554  1.00 54.55  ?  148 SER C N   1 
ATOM 7670  C CA  . SER C  1 140 ? 111.007 93.231   -5.112  1.00 50.57  ?  148 SER C CA  1 
ATOM 7671  C C   . SER C  1 140 ? 111.473 93.696   -3.739  1.00 45.31  ?  148 SER C C   1 
ATOM 7672  O O   . SER C  1 140 ? 112.214 92.998   -3.041  1.00 45.63  ?  148 SER C O   1 
ATOM 7673  C CB  . SER C  1 140 ? 109.528 92.835   -5.051  1.00 48.00  ?  148 SER C CB  1 
ATOM 7674  O OG  . SER C  1 140 ? 109.274 91.965   -3.963  1.00 52.36  ?  148 SER C OG  1 
ATOM 7675  N N   . VAL C  1 141 ? 111.018 94.885   -3.350  1.00 47.27  ?  149 VAL C N   1 
ATOM 7676  C CA  . VAL C  1 141 ? 111.467 95.501   -2.109  1.00 46.18  ?  149 VAL C CA  1 
ATOM 7677  C C   . VAL C  1 141 ? 110.462 96.575   -1.727  1.00 45.13  ?  149 VAL C C   1 
ATOM 7678  O O   . VAL C  1 141 ? 109.840 97.198   -2.592  1.00 48.82  ?  149 VAL C O   1 
ATOM 7679  C CB  . VAL C  1 141 ? 112.903 96.069   -2.265  1.00 43.47  ?  149 VAL C CB  1 
ATOM 7680  C CG1 . VAL C  1 141 ? 112.908 97.309   -3.150  1.00 42.71  ?  149 VAL C CG1 1 
ATOM 7681  C CG2 . VAL C  1 141 ? 113.520 96.355   -0.915  1.00 43.70  ?  149 VAL C CG2 1 
ATOM 7682  N N   . ASP C  1 142 ? 110.283 96.775   -0.423  1.00 43.42  ?  150 ASP C N   1 
ATOM 7683  C CA  . ASP C  1 142 ? 109.498 97.895   0.078   1.00 45.79  ?  150 ASP C CA  1 
ATOM 7684  C C   . ASP C  1 142 ? 110.439 99.055   0.370   1.00 46.44  ?  150 ASP C C   1 
ATOM 7685  O O   . ASP C  1 142 ? 111.441 98.893   1.073   1.00 53.97  ?  150 ASP C O   1 
ATOM 7686  C CB  . ASP C  1 142 ? 108.703 97.509   1.329   1.00 49.99  ?  150 ASP C CB  1 
ATOM 7687  C CG  . ASP C  1 142 ? 109.588 97.239   2.529   1.00 55.84  ?  150 ASP C CG  1 
ATOM 7688  O OD1 . ASP C  1 142 ? 110.604 96.526   2.374   1.00 59.14  ?  150 ASP C OD1 1 
ATOM 7689  O OD2 . ASP C  1 142 ? 109.269 97.746   3.626   1.00 55.90  -1 150 ASP C OD2 1 
ATOM 7690  N N   . TYR C  1 143 ? 110.129 100.217  -0.193  1.00 48.05  ?  151 TYR C N   1 
ATOM 7691  C CA  . TYR C  1 143 ? 111.068 101.323  -0.157  1.00 43.28  ?  151 TYR C CA  1 
ATOM 7692  C C   . TYR C  1 143 ? 111.171 101.913  1.248   1.00 43.18  ?  151 TYR C C   1 
ATOM 7693  O O   . TYR C  1 143 ? 110.434 101.553  2.172   1.00 45.49  ?  151 TYR C O   1 
ATOM 7694  C CB  . TYR C  1 143 ? 110.654 102.411  -1.143  1.00 44.59  ?  151 TYR C CB  1 
ATOM 7695  C CG  . TYR C  1 143 ? 110.987 102.121  -2.586  1.00 48.22  ?  151 TYR C CG  1 
ATOM 7696  C CD1 . TYR C  1 143 ? 112.136 101.422  -2.931  1.00 50.57  ?  151 TYR C CD1 1 
ATOM 7697  C CD2 . TYR C  1 143 ? 110.161 102.569  -3.607  1.00 48.67  ?  151 TYR C CD2 1 
ATOM 7698  C CE1 . TYR C  1 143 ? 112.445 101.170  -4.254  1.00 52.15  ?  151 TYR C CE1 1 
ATOM 7699  C CE2 . TYR C  1 143 ? 110.461 102.322  -4.929  1.00 48.76  ?  151 TYR C CE2 1 
ATOM 7700  C CZ  . TYR C  1 143 ? 111.601 101.623  -5.247  1.00 53.11  ?  151 TYR C CZ  1 
ATOM 7701  O OH  . TYR C  1 143 ? 111.893 101.382  -6.568  1.00 58.55  ?  151 TYR C OH  1 
ATOM 7702  N N   . LYS C  1 144 ? 112.119 102.836  1.390   1.00 43.87  ?  152 LYS C N   1 
ATOM 7703  C CA  . LYS C  1 144 ? 112.260 103.611  2.613   1.00 43.14  ?  152 LYS C CA  1 
ATOM 7704  C C   . LYS C  1 144 ? 110.994 104.413  2.882   1.00 42.19  ?  152 LYS C C   1 
ATOM 7705  O O   . LYS C  1 144 ? 110.340 104.898  1.955   1.00 43.85  ?  152 LYS C O   1 
ATOM 7706  C CB  . LYS C  1 144 ? 113.468 104.540  2.485   1.00 39.39  ?  152 LYS C CB  1 
ATOM 7707  C CG  . LYS C  1 144 ? 113.395 105.815  3.290   1.00 38.64  ?  152 LYS C CG  1 
ATOM 7708  C CD  . LYS C  1 144 ? 114.601 106.685  3.011   1.00 42.45  ?  152 LYS C CD  1 
ATOM 7709  C CE  . LYS C  1 144 ? 114.461 108.032  3.680   1.00 50.22  ?  152 LYS C CE  1 
ATOM 7710  N NZ  . LYS C  1 144 ? 115.604 108.932  3.367   1.00 56.22  1  152 LYS C NZ  1 
ATOM 7711  N N   . GLN C  1 145 ? 110.643 104.546  4.159   1.00 40.26  ?  153 GLN C N   1 
ATOM 7712  C CA  . GLN C  1 145 ? 109.440 105.268  4.551   1.00 41.56  ?  153 GLN C CA  1 
ATOM 7713  C C   . GLN C  1 145 ? 109.755 106.752  4.693   1.00 39.80  ?  153 GLN C C   1 
ATOM 7714  O O   . GLN C  1 145 ? 110.711 107.126  5.379   1.00 39.58  ?  153 GLN C O   1 
ATOM 7715  C CB  . GLN C  1 145 ? 108.875 104.718  5.859   1.00 42.33  ?  153 GLN C CB  1 
ATOM 7716  C CG  . GLN C  1 145 ? 107.619 105.429  6.325   1.00 43.00  ?  153 GLN C CG  1 
ATOM 7717  C CD  . GLN C  1 145 ? 107.217 105.037  7.728   1.00 47.07  ?  153 GLN C CD  1 
ATOM 7718  O OE1 . GLN C  1 145 ? 106.873 105.887  8.549   1.00 52.35  ?  153 GLN C OE1 1 
ATOM 7719  N NE2 . GLN C  1 145 ? 107.254 103.740  8.011   1.00 45.38  ?  153 GLN C NE2 1 
ATOM 7720  N N   . THR C  1 146 ? 108.947 107.591  4.045   1.00 39.98  ?  154 THR C N   1 
ATOM 7721  C CA  . THR C  1 146 ? 109.188 109.028  4.016   1.00 42.59  ?  154 THR C CA  1 
ATOM 7722  C C   . THR C  1 146 ? 107.873 109.783  4.137   1.00 43.43  ?  154 THR C C   1 
ATOM 7723  O O   . THR C  1 146 ? 106.940 109.537  3.368   1.00 43.93  ?  154 THR C O   1 
ATOM 7724  C CB  . THR C  1 146 ? 109.903 109.442  2.721   1.00 46.07  ?  154 THR C CB  1 
ATOM 7725  O OG1 . THR C  1 146 ? 111.075 108.638  2.534   1.00 47.38  ?  154 THR C OG1 1 
ATOM 7726  C CG2 . THR C  1 146 ? 110.303 110.910  2.774   1.00 46.02  ?  154 THR C CG2 1 
ATOM 7727  N N   . GLN C  1 147 ? 107.810 110.701  5.102   1.00 45.46  ?  155 GLN C N   1 
ATOM 7728  C CA  . GLN C  1 147 ? 106.713 111.656  5.226   1.00 40.46  ?  155 GLN C CA  1 
ATOM 7729  C C   . GLN C  1 147 ? 107.311 113.051  5.262   1.00 38.44  ?  155 GLN C C   1 
ATOM 7730  O O   . GLN C  1 147 ? 108.135 113.346  6.132   1.00 38.94  ?  155 GLN C O   1 
ATOM 7731  C CB  . GLN C  1 147 ? 105.887 111.420  6.493   1.00 39.66  ?  155 GLN C CB  1 
ATOM 7732  C CG  . GLN C  1 147 ? 105.301 110.038  6.656   1.00 40.10  ?  155 GLN C CG  1 
ATOM 7733  C CD  . GLN C  1 147 ? 104.515 109.913  7.946   1.00 40.79  ?  155 GLN C CD  1 
ATOM 7734  O OE1 . GLN C  1 147 ? 103.384 110.388  8.043   1.00 41.60  ?  155 GLN C OE1 1 
ATOM 7735  N NE2 . GLN C  1 147 ? 105.120 109.291  8.951   1.00 41.81  ?  155 GLN C NE2 1 
ATOM 7736  N N   . LEU C  1 148 ? 106.900 113.911  4.334   1.00 40.01  ?  156 LEU C N   1 
ATOM 7737  C CA  . LEU C  1 148 ? 107.394 115.279  4.338   1.00 42.84  ?  156 LEU C CA  1 
ATOM 7738  C C   . LEU C  1 148 ? 106.296 116.226  3.881   1.00 46.98  ?  156 LEU C C   1 
ATOM 7739  O O   . LEU C  1 148 ? 105.378 115.839  3.153   1.00 48.08  ?  156 LEU C O   1 
ATOM 7740  C CB  . LEU C  1 148 ? 108.642 115.441  3.452   1.00 45.22  ?  156 LEU C CB  1 
ATOM 7741  C CG  . LEU C  1 148 ? 108.502 115.514  1.929   1.00 46.91  ?  156 LEU C CG  1 
ATOM 7742  C CD1 . LEU C  1 148 ? 108.403 116.958  1.448   1.00 44.23  ?  156 LEU C CD1 1 
ATOM 7743  C CD2 . LEU C  1 148 ? 109.669 114.805  1.257   1.00 49.55  ?  156 LEU C CD2 1 
ATOM 7744  N N   . CYS C  1 149 ? 106.407 117.475  4.327   1.00 51.48  ?  157 CYS C N   1 
ATOM 7745  C CA  . CYS C  1 149 ? 105.437 118.513  4.013   1.00 51.37  ?  157 CYS C CA  1 
ATOM 7746  C C   . CYS C  1 149 ? 106.140 119.860  4.054   1.00 48.68  ?  157 CYS C C   1 
ATOM 7747  O O   . CYS C  1 149 ? 106.772 120.199  5.058   1.00 51.03  ?  157 CYS C O   1 
ATOM 7748  C CB  . CYS C  1 149 ? 104.267 118.490  4.999   1.00 55.83  ?  157 CYS C CB  1 
ATOM 7749  S SG  . CYS C  1 149 ? 103.213 119.946  4.908   1.00 63.36  ?  157 CYS C SG  1 
ATOM 7750  N N   . ILE C  1 150 ? 106.019 120.624  2.973   1.00 51.02  ?  158 ILE C N   1 
ATOM 7751  C CA  . ILE C  1 150 ? 106.655 121.929  2.841   1.00 52.12  ?  158 ILE C CA  1 
ATOM 7752  C C   . ILE C  1 150 ? 105.639 122.886  2.240   1.00 50.30  ?  158 ILE C C   1 
ATOM 7753  O O   . ILE C  1 150 ? 105.014 122.574  1.220   1.00 49.51  ?  158 ILE C O   1 
ATOM 7754  C CB  . ILE C  1 150 ? 107.930 121.871  1.975   1.00 49.00  ?  158 ILE C CB  1 
ATOM 7755  C CG1 . ILE C  1 150 ? 108.993 121.001  2.649   1.00 50.69  ?  158 ILE C CG1 1 
ATOM 7756  C CG2 . ILE C  1 150 ? 108.469 123.270  1.713   1.00 46.21  ?  158 ILE C CG2 1 
ATOM 7757  C CD1 . ILE C  1 150 ? 110.290 120.916  1.882   1.00 52.31  ?  158 ILE C CD1 1 
ATOM 7758  N N   . ILE C  1 151 ? 105.466 124.046  2.871   1.00 46.76  ?  159 ILE C N   1 
ATOM 7759  C CA  . ILE C  1 151 ? 104.503 125.047  2.427   1.00 47.24  ?  159 ILE C CA  1 
ATOM 7760  C C   . ILE C  1 151 ? 105.252 126.321  2.068   1.00 49.24  ?  159 ILE C C   1 
ATOM 7761  O O   . ILE C  1 151 ? 106.109 126.779  2.834   1.00 55.40  ?  159 ILE C O   1 
ATOM 7762  C CB  . ILE C  1 151 ? 103.443 125.325  3.507   1.00 48.09  ?  159 ILE C CB  1 
ATOM 7763  C CG1 . ILE C  1 151 ? 102.915 124.008  4.077   1.00 54.01  ?  159 ILE C CG1 1 
ATOM 7764  C CG2 . ILE C  1 151 ? 102.306 126.160  2.938   1.00 47.40  ?  159 ILE C CG2 1 
ATOM 7765  C CD1 . ILE C  1 151 ? 101.972 124.183  5.236   1.00 57.67  ?  159 ILE C CD1 1 
ATOM 7766  N N   . GLY C  1 152 ? 104.926 126.893  0.915   1.00 50.18  ?  160 GLY C N   1 
ATOM 7767  C CA  . GLY C  1 152 ? 105.555 128.129  0.505   1.00 52.22  ?  160 GLY C CA  1 
ATOM 7768  C C   . GLY C  1 152 ? 104.686 128.893  -0.470  1.00 54.82  ?  160 GLY C C   1 
ATOM 7769  O O   . GLY C  1 152 ? 103.512 128.577  -0.665  1.00 61.62  ?  160 GLY C O   1 
ATOM 7770  N N   . CYS C  1 153 ? 105.271 129.938  -1.052  1.00 51.56  ?  161 CYS C N   1 
ATOM 7771  C CA  . CYS C  1 153 ? 104.675 130.630  -2.186  1.00 52.91  ?  161 CYS C CA  1 
ATOM 7772  C C   . CYS C  1 153 ? 105.527 130.510  -3.440  1.00 59.12  ?  161 CYS C C   1 
ATOM 7773  O O   . CYS C  1 153 ? 105.174 131.085  -4.477  1.00 62.10  ?  161 CYS C O   1 
ATOM 7774  C CB  . CYS C  1 153 ? 104.438 132.108  -1.852  1.00 60.17  ?  161 CYS C CB  1 
ATOM 7775  S SG  . CYS C  1 153 ? 105.910 132.991  -1.300  1.00 68.84  ?  161 CYS C SG  1 
ATOM 7776  N N   . VAL C  1 154 ? 106.632 129.775  -3.369  1.00 62.44  ?  162 VAL C N   1 
ATOM 7777  C CA  . VAL C  1 154 ? 107.543 129.522  -4.481  1.00 52.65  ?  162 VAL C CA  1 
ATOM 7778  C C   . VAL C  1 154 ? 107.799 128.020  -4.456  1.00 51.71  ?  162 VAL C C   1 
ATOM 7779  O O   . VAL C  1 154 ? 107.914 127.445  -3.363  1.00 56.63  ?  162 VAL C O   1 
ATOM 7780  C CB  . VAL C  1 154 ? 108.829 130.355  -4.335  1.00 53.34  ?  162 VAL C CB  1 
ATOM 7781  C CG1 . VAL C  1 154 ? 109.935 129.857  -5.255  1.00 52.53  ?  162 VAL C CG1 1 
ATOM 7782  C CG2 . VAL C  1 154 ? 108.535 131.823  -4.596  1.00 54.51  ?  162 VAL C CG2 1 
ATOM 7783  N N   . PRO C  1 155 ? 107.870 127.337  -5.602  1.00 44.25  ?  163 PRO C N   1 
ATOM 7784  C CA  . PRO C  1 155 ? 108.058 125.882  -5.571  1.00 44.31  ?  163 PRO C CA  1 
ATOM 7785  C C   . PRO C  1 155 ? 109.310 125.496  -4.798  1.00 44.68  ?  163 PRO C C   1 
ATOM 7786  O O   . PRO C  1 155 ? 110.332 126.183  -4.849  1.00 44.71  ?  163 PRO C O   1 
ATOM 7787  C CB  . PRO C  1 155 ? 108.169 125.503  -7.053  1.00 49.05  ?  163 PRO C CB  1 
ATOM 7788  C CG  . PRO C  1 155 ? 108.476 126.776  -7.762  1.00 50.70  ?  163 PRO C CG  1 
ATOM 7789  C CD  . PRO C  1 155 ? 107.801 127.847  -6.981  1.00 51.95  ?  163 PRO C CD  1 
ATOM 7790  N N   . ALA C  1 156 ? 109.208 124.394  -4.059  1.00 47.81  ?  164 ALA C N   1 
ATOM 7791  C CA  . ALA C  1 156 ? 110.298 123.960  -3.201  1.00 48.59  ?  164 ALA C CA  1 
ATOM 7792  C C   . ALA C  1 156 ? 111.510 123.560  -4.033  1.00 54.17  ?  164 ALA C C   1 
ATOM 7793  O O   . ALA C  1 156 ? 111.394 123.168  -5.198  1.00 59.97  ?  164 ALA C O   1 
ATOM 7794  C CB  . ALA C  1 156 ? 109.857 122.788  -2.326  1.00 45.91  ?  164 ALA C CB  1 
ATOM 7795  N N   . ILE C  1 157 ? 112.685 123.661  -3.419  1.00 53.38  ?  165 ILE C N   1 
ATOM 7796  C CA  . ILE C  1 157 ? 113.949 123.360  -4.079  1.00 49.53  ?  165 ILE C CA  1 
ATOM 7797  C C   . ILE C  1 157 ? 114.441 122.002  -3.598  1.00 48.79  ?  165 ILE C C   1 
ATOM 7798  O O   . ILE C  1 157 ? 114.568 121.767  -2.390  1.00 48.84  ?  165 ILE C O   1 
ATOM 7799  C CB  . ILE C  1 157 ? 114.994 124.458  -3.808  1.00 43.06  ?  165 ILE C CB  1 
ATOM 7800  C CG1 . ILE C  1 157 ? 114.797 125.640  -4.763  1.00 42.69  ?  165 ILE C CG1 1 
ATOM 7801  C CG2 . ILE C  1 157 ? 116.404 123.903  -3.935  1.00 43.26  ?  165 ILE C CG2 1 
ATOM 7802  C CD1 . ILE C  1 157 ? 113.621 126.537  -4.430  1.00 42.62  ?  165 ILE C CD1 1 
ATOM 7803  N N   . GLY C  1 158 ? 114.712 121.107  -4.543  1.00 45.71  ?  166 GLY C N   1 
ATOM 7804  C CA  . GLY C  1 158 ? 115.253 119.805  -4.216  1.00 49.27  ?  166 GLY C CA  1 
ATOM 7805  C C   . GLY C  1 158 ? 116.623 119.590  -4.826  1.00 55.48  ?  166 GLY C C   1 
ATOM 7806  O O   . GLY C  1 158 ? 117.001 120.285  -5.772  1.00 61.49  ?  166 GLY C O   1 
ATOM 7807  N N   . GLU C  1 159 ? 117.379 118.638  -4.292  1.00 47.73  ?  167 GLU C N   1 
ATOM 7808  C CA  . GLU C  1 159 ? 118.717 118.340  -4.774  1.00 46.07  ?  167 GLU C CA  1 
ATOM 7809  C C   . GLU C  1 159 ? 118.770 116.904  -5.269  1.00 51.67  ?  167 GLU C C   1 
ATOM 7810  O O   . GLU C  1 159 ? 118.034 116.038  -4.785  1.00 53.47  ?  167 GLU C O   1 
ATOM 7811  C CB  . GLU C  1 159 ? 119.764 118.545  -3.674  1.00 46.63  ?  167 GLU C CB  1 
ATOM 7812  C CG  . GLU C  1 159 ? 119.623 117.579  -2.508  1.00 45.70  ?  167 GLU C CG  1 
ATOM 7813  C CD  . GLU C  1 159 ? 120.584 117.880  -1.376  1.00 52.09  ?  167 GLU C CD  1 
ATOM 7814  O OE1 . GLU C  1 159 ? 120.232 117.604  -0.211  1.00 60.56  ?  167 GLU C OE1 1 
ATOM 7815  O OE2 . GLU C  1 159 ? 121.689 118.394  -1.647  1.00 50.29  -1 167 GLU C OE2 1 
ATOM 7816  N N   . HIS C  1 160 ? 119.638 116.657  -6.247  1.00 51.59  ?  168 HIS C N   1 
ATOM 7817  C CA  . HIS C  1 160 ? 119.895 115.292  -6.685  1.00 47.75  ?  168 HIS C CA  1 
ATOM 7818  C C   . HIS C  1 160 ? 121.205 115.256  -7.454  1.00 48.21  ?  168 HIS C C   1 
ATOM 7819  O O   . HIS C  1 160 ? 121.672 116.274  -7.974  1.00 51.99  ?  168 HIS C O   1 
ATOM 7820  C CB  . HIS C  1 160 ? 118.748 114.733  -7.536  1.00 49.23  ?  168 HIS C CB  1 
ATOM 7821  C CG  . HIS C  1 160 ? 118.729 115.239  -8.944  1.00 46.20  ?  168 HIS C CG  1 
ATOM 7822  N ND1 . HIS C  1 160 ? 118.102 116.412  -9.306  1.00 45.68  ?  168 HIS C ND1 1 
ATOM 7823  C CD2 . HIS C  1 160 ? 119.256 114.728  -10.082 1.00 47.42  ?  168 HIS C CD2 1 
ATOM 7824  C CE1 . HIS C  1 160 ? 118.243 116.600  -10.605 1.00 46.49  ?  168 HIS C CE1 1 
ATOM 7825  N NE2 . HIS C  1 160 ? 118.940 115.593  -11.100 1.00 49.33  ?  168 HIS C NE2 1 
ATOM 7826  N N   . TRP C  1 161 ? 121.791 114.065  -7.516  1.00 46.79  ?  169 TRP C N   1 
ATOM 7827  C CA  . TRP C  1 161 ? 123.057 113.860  -8.203  1.00 49.63  ?  169 TRP C CA  1 
ATOM 7828  C C   . TRP C  1 161 ? 122.810 113.453  -9.647  1.00 50.49  ?  169 TRP C C   1 
ATOM 7829  O O   . TRP C  1 161 ? 121.959 112.606  -9.932  1.00 55.25  ?  169 TRP C O   1 
ATOM 7830  C CB  . TRP C  1 161 ? 123.893 112.794  -7.494  1.00 45.32  ?  169 TRP C CB  1 
ATOM 7831  C CG  . TRP C  1 161 ? 124.446 113.268  -6.195  1.00 46.21  ?  169 TRP C CG  1 
ATOM 7832  C CD1 . TRP C  1 161 ? 123.931 113.045  -4.953  1.00 44.67  ?  169 TRP C CD1 1 
ATOM 7833  C CD2 . TRP C  1 161 ? 125.606 114.085  -6.009  1.00 50.83  ?  169 TRP C CD2 1 
ATOM 7834  N NE1 . TRP C  1 161 ? 124.710 113.657  -4.002  1.00 46.50  ?  169 TRP C NE1 1 
ATOM 7835  C CE2 . TRP C  1 161 ? 125.744 114.305  -4.626  1.00 50.70  ?  169 TRP C CE2 1 
ATOM 7836  C CE3 . TRP C  1 161 ? 126.546 114.646  -6.878  1.00 57.15  ?  169 TRP C CE3 1 
ATOM 7837  C CZ2 . TRP C  1 161 ? 126.782 115.064  -4.093  1.00 56.33  ?  169 TRP C CZ2 1 
ATOM 7838  C CZ3 . TRP C  1 161 ? 127.578 115.396  -6.346  1.00 63.10  ?  169 TRP C CZ3 1 
ATOM 7839  C CH2 . TRP C  1 161 ? 127.688 115.597  -4.965  1.00 62.47  ?  169 TRP C CH2 1 
ATOM 7840  N N   . THR C  1 162 ? 123.554 114.067  -10.558 1.00 50.01  ?  170 THR C N   1 
ATOM 7841  C CA  . THR C  1 162 ? 123.407 113.805  -11.979 1.00 52.79  ?  170 THR C CA  1 
ATOM 7842  C C   . THR C  1 162 ? 124.781 113.600  -12.601 1.00 56.94  ?  170 THR C C   1 
ATOM 7843  O O   . THR C  1 162 ? 125.816 113.902  -11.997 1.00 56.88  ?  170 THR C O   1 
ATOM 7844  C CB  . THR C  1 162 ? 122.672 114.952  -12.684 1.00 49.17  ?  170 THR C CB  1 
ATOM 7845  O OG1 . THR C  1 162 ? 122.127 114.486  -13.924 1.00 48.02  ?  170 THR C OG1 1 
ATOM 7846  C CG2 . THR C  1 162 ? 123.631 116.097  -12.960 1.00 50.18  ?  170 THR C CG2 1 
ATOM 7847  N N   . LYS C  1 163 ? 124.777 113.070  -13.825 1.00 58.64  ?  171 LYS C N   1 
ATOM 7848  C CA  . LYS C  1 163 ? 125.999 112.943  -14.607 1.00 64.39  ?  171 LYS C CA  1 
ATOM 7849  C C   . LYS C  1 163 ? 126.560 114.332  -14.858 1.00 64.15  ?  171 LYS C C   1 
ATOM 7850  O O   . LYS C  1 163 ? 126.058 115.066  -15.715 1.00 63.93  ?  171 LYS C O   1 
ATOM 7851  C CB  . LYS C  1 163 ? 125.738 112.218  -15.930 1.00 66.95  ?  171 LYS C CB  1 
ATOM 7852  C CG  . LYS C  1 163 ? 126.977 112.075  -16.806 1.00 70.85  ?  171 LYS C CG  1 
ATOM 7853  C CD  . LYS C  1 163 ? 126.649 111.479  -18.169 1.00 72.42  ?  171 LYS C CD  1 
ATOM 7854  C CE  . LYS C  1 163 ? 126.492 109.967  -18.102 1.00 72.30  ?  171 LYS C CE  1 
ATOM 7855  N NZ  . LYS C  1 163 ? 126.211 109.375  -19.442 1.00 70.70  1  171 LYS C NZ  1 
ATOM 7856  N N   . GLY C  1 164 ? 127.588 114.704  -14.102 1.00 66.84  ?  172 GLY C N   1 
ATOM 7857  C CA  . GLY C  1 164 ? 128.128 116.043  -14.220 1.00 73.22  ?  172 GLY C CA  1 
ATOM 7858  C C   . GLY C  1 164 ? 128.740 116.295  -15.583 1.00 81.58  ?  172 GLY C C   1 
ATOM 7859  O O   . GLY C  1 164 ? 129.151 115.373  -16.290 1.00 84.90  ?  172 GLY C O   1 
ATOM 7860  N N   . THR C  1 165 ? 128.778 117.573  -15.953 1.00 94.29  ?  173 THR C N   1 
ATOM 7861  C CA  . THR C  1 165 ? 129.432 117.982  -17.186 1.00 103.41 ?  173 THR C CA  1 
ATOM 7862  C C   . THR C  1 165 ? 130.881 117.509  -17.192 1.00 105.76 ?  173 THR C C   1 
ATOM 7863  O O   . THR C  1 165 ? 131.483 117.276  -16.139 1.00 104.83 ?  173 THR C O   1 
ATOM 7864  C CB  . THR C  1 165 ? 129.368 119.503  -17.339 1.00 110.79 ?  173 THR C CB  1 
ATOM 7865  O OG1 . THR C  1 165 ? 129.891 120.127  -16.160 1.00 111.49 ?  173 THR C OG1 1 
ATOM 7866  C CG2 . THR C  1 165 ? 127.929 119.956  -17.543 1.00 106.15 ?  173 THR C CG2 1 
ATOM 7867  N N   . ALA C  1 166 ? 131.427 117.333  -18.396 1.00 113.81 ?  174 ALA C N   1 
ATOM 7868  C CA  . ALA C  1 166 ? 132.803 116.871  -18.544 1.00 123.79 ?  174 ALA C CA  1 
ATOM 7869  C C   . ALA C  1 166 ? 133.744 117.700  -17.681 1.00 133.51 ?  174 ALA C C   1 
ATOM 7870  O O   . ALA C  1 166 ? 133.666 118.932  -17.663 1.00 135.14 ?  174 ALA C O   1 
ATOM 7871  C CB  . ALA C  1 166 ? 133.225 116.941  -20.013 1.00 122.45 ?  174 ALA C CB  1 
ATOM 7872  N N   . SER C  1 167 ? 134.630 117.010  -16.959 1.00 138.04 ?  175 SER C N   1 
ATOM 7873  C CA  . SER C  1 167 ? 135.500 117.675  -15.993 1.00 146.92 ?  175 SER C CA  1 
ATOM 7874  C C   . SER C  1 167 ? 136.345 118.753  -16.659 1.00 154.21 ?  175 SER C C   1 
ATOM 7875  O O   . SER C  1 167 ? 136.319 119.923  -16.261 1.00 156.27 ?  175 SER C O   1 
ATOM 7876  C CB  . SER C  1 167 ? 136.389 116.642  -15.298 1.00 152.35 ?  175 SER C CB  1 
ATOM 7877  O OG  . SER C  1 167 ? 137.207 117.249  -14.314 1.00 155.17 ?  175 SER C OG  1 
ATOM 7878  N N   . LYS C  1 168 ? 137.101 118.372  -17.682 1.00 160.22 ?  176 LYS C N   1 
ATOM 7879  C CA  . LYS C  1 168 ? 137.945 119.292  -18.430 1.00 165.91 ?  176 LYS C CA  1 
ATOM 7880  C C   . LYS C  1 168 ? 137.666 119.098  -19.915 1.00 169.54 ?  176 LYS C C   1 
ATOM 7881  O O   . LYS C  1 168 ? 136.885 118.210  -20.280 1.00 167.78 ?  176 LYS C O   1 
ATOM 7882  C CB  . LYS C  1 168 ? 139.421 119.032  -18.118 1.00 164.08 ?  176 LYS C CB  1 
ATOM 7883  C CG  . LYS C  1 168 ? 139.675 118.396  -16.760 1.00 159.77 ?  176 LYS C CG  1 
ATOM 7884  C CD  . LYS C  1 168 ? 141.138 118.027  -16.584 1.00 160.60 ?  176 LYS C CD  1 
ATOM 7885  C CE  . LYS C  1 168 ? 141.327 117.078  -15.411 1.00 153.52 ?  176 LYS C CE  1 
ATOM 7886  N NZ  . LYS C  1 168 ? 140.849 117.669  -14.132 1.00 147.06 1  176 LYS C NZ  1 
ATOM 7887  N N   . PRO C  1 169 ? 138.271 119.894  -20.808 1.00 173.90 ?  177 PRO C N   1 
ATOM 7888  C CA  . PRO C  1 169 ? 138.305 119.494  -22.222 1.00 175.26 ?  177 PRO C CA  1 
ATOM 7889  C C   . PRO C  1 169 ? 139.151 118.243  -22.408 1.00 175.60 ?  177 PRO C C   1 
ATOM 7890  O O   . PRO C  1 169 ? 140.164 118.263  -23.114 1.00 181.26 ?  177 PRO C O   1 
ATOM 7891  C CB  . PRO C  1 169 ? 138.918 120.713  -22.926 1.00 178.54 ?  177 PRO C CB  1 
ATOM 7892  C CG  . PRO C  1 169 ? 139.582 121.503  -21.841 1.00 181.91 ?  177 PRO C CG  1 
ATOM 7893  C CD  . PRO C  1 169 ? 138.756 121.271  -20.617 1.00 173.51 ?  177 PRO C CD  1 
ATOM 7894  N N   . THR C  1 170 ? 138.735 117.149  -21.774 1.00 168.32 ?  178 THR C N   1 
ATOM 7895  C CA  . THR C  1 170 ? 139.524 115.930  -21.671 1.00 169.03 ?  178 THR C CA  1 
ATOM 7896  C C   . THR C  1 170 ? 138.782 114.778  -22.330 1.00 163.34 ?  178 THR C C   1 
ATOM 7897  O O   . THR C  1 170 ? 137.589 114.576  -22.078 1.00 155.06 ?  178 THR C O   1 
ATOM 7898  C CB  . THR C  1 170 ? 139.815 115.592  -20.202 1.00 160.38 ?  178 THR C CB  1 
ATOM 7899  O OG1 . THR C  1 170 ? 140.753 116.533  -19.667 1.00 166.73 ?  178 THR C OG1 1 
ATOM 7900  C CG2 . THR C  1 170 ? 140.378 114.183  -20.067 1.00 160.18 ?  178 THR C CG2 1 
ATOM 7901  N N   . THR C  1 171 ? 139.488 114.032  -23.175 1.00 154.72 ?  179 THR C N   1 
ATOM 7902  C CA  . THR C  1 171 ? 138.948 112.810  -23.760 1.00 150.99 ?  179 THR C CA  1 
ATOM 7903  C C   . THR C  1 171 ? 139.060 111.693  -22.729 1.00 146.45 ?  179 THR C C   1 
ATOM 7904  O O   . THR C  1 171 ? 140.166 111.273  -22.375 1.00 147.36 ?  179 THR C O   1 
ATOM 7905  C CB  . THR C  1 171 ? 139.694 112.452  -25.041 1.00 153.65 ?  179 THR C CB  1 
ATOM 7906  O OG1 . THR C  1 171 ? 141.084 112.265  -24.749 1.00 159.60 ?  179 THR C OG1 1 
ATOM 7907  C CG2 . THR C  1 171 ? 139.541 113.561  -26.072 1.00 156.72 ?  179 THR C CG2 1 
ATOM 7908  N N   . VAL C  1 172 ? 137.918 111.217  -22.243 1.00 127.96 ?  180 VAL C N   1 
ATOM 7909  C CA  . VAL C  1 172 ? 137.873 110.159  -21.243 1.00 116.64 ?  180 VAL C CA  1 
ATOM 7910  C C   . VAL C  1 172 ? 137.456 108.866  -21.931 1.00 116.21 ?  180 VAL C C   1 
ATOM 7911  O O   . VAL C  1 172 ? 136.682 108.870  -22.896 1.00 118.25 ?  180 VAL C O   1 
ATOM 7912  C CB  . VAL C  1 172 ? 136.919 110.517  -20.080 1.00 104.96 ?  180 VAL C CB  1 
ATOM 7913  C CG1 . VAL C  1 172 ? 135.474 110.571  -20.557 1.00 97.45  ?  180 VAL C CG1 1 
ATOM 7914  C CG2 . VAL C  1 172 ? 137.079 109.538  -18.924 1.00 103.17 ?  180 VAL C CG2 1 
ATOM 7915  N N   . VAL C  1 173 ? 137.997 107.750  -21.440 1.00 99.53  ?  181 VAL C N   1 
ATOM 7916  C CA  . VAL C  1 173 ? 137.717 106.459  -22.054 1.00 97.16  ?  181 VAL C CA  1 
ATOM 7917  C C   . VAL C  1 173 ? 136.263 106.079  -21.802 1.00 92.08  ?  181 VAL C C   1 
ATOM 7918  O O   . VAL C  1 173 ? 135.683 106.395  -20.755 1.00 90.72  ?  181 VAL C O   1 
ATOM 7919  C CB  . VAL C  1 173 ? 138.674 105.382  -21.508 1.00 91.46  ?  181 VAL C CB  1 
ATOM 7920  C CG1 . VAL C  1 173 ? 138.628 104.132  -22.376 1.00 92.49  ?  181 VAL C CG1 1 
ATOM 7921  C CG2 . VAL C  1 173 ? 140.091 105.926  -21.415 1.00 96.44  ?  181 VAL C CG2 1 
ATOM 7922  N N   . GLN C  1 174 ? 135.664 105.397  -22.774 1.00 90.14  ?  182 GLN C N   1 
ATOM 7923  C CA  . GLN C  1 174 ? 134.306 104.905  -22.601 1.00 84.39  ?  182 GLN C CA  1 
ATOM 7924  C C   . GLN C  1 174 ? 134.280 103.803  -21.551 1.00 79.30  ?  182 GLN C C   1 
ATOM 7925  O O   . GLN C  1 174 ? 135.129 102.907  -21.544 1.00 80.20  ?  182 GLN C O   1 
ATOM 7926  C CB  . GLN C  1 174 ? 133.751 104.387  -23.927 1.00 89.50  ?  182 GLN C CB  1 
ATOM 7927  C CG  . GLN C  1 174 ? 132.335 103.846  -23.830 1.00 87.46  ?  182 GLN C CG  1 
ATOM 7928  C CD  . GLN C  1 174 ? 131.340 104.904  -23.390 1.00 89.07  ?  182 GLN C CD  1 
ATOM 7929  O OE1 . GLN C  1 174 ? 131.373 106.039  -23.865 1.00 94.44  ?  182 GLN C OE1 1 
ATOM 7930  N NE2 . GLN C  1 174 ? 130.449 104.535  -22.475 1.00 83.15  ?  182 GLN C NE2 1 
ATOM 7931  N N   . GLY C  1 175 ? 133.299 103.877  -20.655 1.00 78.70  ?  183 GLY C N   1 
ATOM 7932  C CA  . GLY C  1 175 ? 133.182 102.949  -19.552 1.00 73.39  ?  183 GLY C CA  1 
ATOM 7933  C C   . GLY C  1 175 ? 133.737 103.453  -18.239 1.00 72.03  ?  183 GLY C C   1 
ATOM 7934  O O   . GLY C  1 175 ? 133.513 102.812  -17.205 1.00 69.06  ?  183 GLY C O   1 
ATOM 7935  N N   . ASP C  1 176 ? 134.457 104.572  -18.246 1.00 76.86  ?  184 ASP C N   1 
ATOM 7936  C CA  . ASP C  1 176 ? 134.934 105.159  -17.005 1.00 76.57  ?  184 ASP C CA  1 
ATOM 7937  C C   . ASP C  1 176 ? 133.775 105.793  -16.241 1.00 71.14  ?  184 ASP C C   1 
ATOM 7938  O O   . ASP C  1 176 ? 132.710 106.078  -16.795 1.00 71.70  ?  184 ASP C O   1 
ATOM 7939  C CB  . ASP C  1 176 ? 136.026 106.192  -17.283 1.00 78.50  ?  184 ASP C CB  1 
ATOM 7940  C CG  . ASP C  1 176 ? 137.293 105.565  -17.835 1.00 84.42  ?  184 ASP C CG  1 
ATOM 7941  O OD1 . ASP C  1 176 ? 137.244 104.384  -18.242 1.00 81.90  ?  184 ASP C OD1 1 
ATOM 7942  O OD2 . ASP C  1 176 ? 138.339 106.248  -17.859 1.00 89.65  -1 184 ASP C OD2 1 
ATOM 7943  N N   . CYS C  1 177 ? 133.995 106.013  -14.953 1.00 64.78  ?  185 CYS C N   1 
ATOM 7944  C CA  . CYS C  1 177 ? 132.956 106.590  -14.110 1.00 63.09  ?  185 CYS C CA  1 
ATOM 7945  C C   . CYS C  1 177 ? 132.787 108.070  -14.428 1.00 64.12  ?  185 CYS C C   1 
ATOM 7946  O O   . CYS C  1 177 ? 133.765 108.826  -14.355 1.00 65.62  ?  185 CYS C O   1 
ATOM 7947  C CB  . CYS C  1 177 ? 133.300 106.399  -12.637 1.00 72.15  ?  185 CYS C CB  1 
ATOM 7948  S SG  . CYS C  1 177 ? 132.006 106.947  -11.498 1.00 73.31  ?  185 CYS C SG  1 
ATOM 7949  N N   . PRO C  1 178 ? 131.592 108.522  -14.792 1.00 62.81  ?  186 PRO C N   1 
ATOM 7950  C CA  . PRO C  1 178 ? 131.390 109.939  -15.102 1.00 63.21  ?  186 PRO C CA  1 
ATOM 7951  C C   . PRO C  1 178 ? 131.435 110.787  -13.845 1.00 63.00  ?  186 PRO C C   1 
ATOM 7952  O O   . PRO C  1 178 ? 131.221 110.280  -12.733 1.00 62.42  ?  186 PRO C O   1 
ATOM 7953  C CB  . PRO C  1 178 ? 129.994 109.961  -15.741 1.00 72.61  ?  186 PRO C CB  1 
ATOM 7954  C CG  . PRO C  1 178 ? 129.297 108.793  -15.129 1.00 70.29  ?  186 PRO C CG  1 
ATOM 7955  C CD  . PRO C  1 178 ? 130.355 107.736  -14.952 1.00 69.26  ?  186 PRO C CD  1 
ATOM 7956  N N   . PRO C  1 179 ? 131.717 112.083  -13.977 1.00 64.89  ?  187 PRO C N   1 
ATOM 7957  C CA  . PRO C  1 179 ? 131.703 112.963  -12.802 1.00 64.32  ?  187 PRO C CA  1 
ATOM 7958  C C   . PRO C  1 179 ? 130.292 113.162  -12.268 1.00 62.46  ?  187 PRO C C   1 
ATOM 7959  O O   . PRO C  1 179 ? 129.325 113.246  -13.028 1.00 62.26  ?  187 PRO C O   1 
ATOM 7960  C CB  . PRO C  1 179 ? 132.291 114.279  -13.330 1.00 67.07  ?  187 PRO C CB  1 
ATOM 7961  C CG  . PRO C  1 179 ? 132.926 113.938  -14.646 1.00 68.90  ?  187 PRO C CG  1 
ATOM 7962  C CD  . PRO C  1 179 ? 132.148 112.789  -15.193 1.00 67.79  ?  187 PRO C CD  1 
ATOM 7963  N N   . LEU C  1 180 ? 130.186 113.235  -10.945 1.00 62.83  ?  188 LEU C N   1 
ATOM 7964  C CA  . LEU C  1 180 ? 128.914 113.439  -10.263 1.00 60.16  ?  188 LEU C CA  1 
ATOM 7965  C C   . LEU C  1 180 ? 128.745 114.914  -9.925  1.00 61.57  ?  188 LEU C C   1 
ATOM 7966  O O   . LEU C  1 180 ? 129.651 115.532  -9.355  1.00 63.40  ?  188 LEU C O   1 
ATOM 7967  C CB  . LEU C  1 180 ? 128.835 112.596  -8.988  1.00 55.14  ?  188 LEU C CB  1 
ATOM 7968  C CG  . LEU C  1 180 ? 129.025 111.086  -9.139  1.00 54.46  ?  188 LEU C CG  1 
ATOM 7969  C CD1 . LEU C  1 180 ? 128.800 110.384  -7.810  1.00 52.85  ?  188 LEU C CD1 1 
ATOM 7970  C CD2 . LEU C  1 180 ? 128.093 110.534  -10.203 1.00 54.05  ?  188 LEU C CD2 1 
ATOM 7971  N N   . GLU C  1 181 ? 127.593 115.477  -10.284 1.00 57.72  ?  189 GLU C N   1 
ATOM 7972  C CA  . GLU C  1 181 ? 127.295 116.879  -10.028 1.00 59.43  ?  189 GLU C CA  1 
ATOM 7973  C C   . GLU C  1 181 ? 125.995 116.987  -9.245  1.00 59.53  ?  189 GLU C C   1 
ATOM 7974  O O   . GLU C  1 181 ? 124.975 116.413  -9.643  1.00 57.58  ?  189 GLU C O   1 
ATOM 7975  C CB  . GLU C  1 181 ? 127.188 117.673  -11.332 1.00 58.63  ?  189 GLU C CB  1 
ATOM 7976  C CG  . GLU C  1 181 ? 126.848 119.146  -11.150 1.00 66.51  ?  189 GLU C CG  1 
ATOM 7977  C CD  . GLU C  1 181 ? 126.785 119.901  -12.468 1.00 78.11  ?  189 GLU C CD  1 
ATOM 7978  O OE1 . GLU C  1 181 ? 127.147 119.315  -13.512 1.00 83.88  ?  189 GLU C OE1 1 
ATOM 7979  O OE2 . GLU C  1 181 ? 126.378 121.082  -12.459 1.00 81.14  -1 189 GLU C OE2 1 
ATOM 7980  N N   . LEU C  1 182 ? 126.037 117.717  -8.133  1.00 53.96  ?  190 LEU C N   1 
ATOM 7981  C CA  . LEU C  1 182 ? 124.838 117.986  -7.355  1.00 52.56  ?  190 LEU C CA  1 
ATOM 7982  C C   . LEU C  1 182 ? 124.066 119.134  -7.992  1.00 53.21  ?  190 LEU C C   1 
ATOM 7983  O O   . LEU C  1 182 ? 124.648 120.149  -8.387  1.00 54.79  ?  190 LEU C O   1 
ATOM 7984  C CB  . LEU C  1 182 ? 125.202 118.324  -5.909  1.00 56.24  ?  190 LEU C CB  1 
ATOM 7985  C CG  . LEU C  1 182 ? 124.047 118.388  -4.907  1.00 54.24  ?  190 LEU C CG  1 
ATOM 7986  C CD1 . LEU C  1 182 ? 123.373 117.029  -4.788  1.00 49.74  ?  190 LEU C CD1 1 
ATOM 7987  C CD2 . LEU C  1 182 ? 124.531 118.873  -3.549  1.00 53.35  ?  190 LEU C CD2 1 
ATOM 7988  N N   . ILE C  1 183 ? 122.751 118.970  -8.097  1.00 51.52  ?  191 ILE C N   1 
ATOM 7989  C CA  . ILE C  1 183 ? 121.904 119.909  -8.821  1.00 52.85  ?  191 ILE C CA  1 
ATOM 7990  C C   . ILE C  1 183 ? 120.661 120.216  -7.996  1.00 50.63  ?  191 ILE C C   1 
ATOM 7991  O O   . ILE C  1 183 ? 120.038 119.311  -7.426  1.00 52.10  ?  191 ILE C O   1 
ATOM 7992  C CB  . ILE C  1 183 ? 121.515 119.354  -10.209 1.00 51.25  ?  191 ILE C CB  1 
ATOM 7993  C CG1 . ILE C  1 183 ? 122.655 119.561  -11.205 1.00 54.59  ?  191 ILE C CG1 1 
ATOM 7994  C CG2 . ILE C  1 183 ? 120.238 119.998  -10.725 1.00 51.59  ?  191 ILE C CG2 1 
ATOM 7995  C CD1 . ILE C  1 183 ? 122.233 119.383  -12.644 1.00 58.53  ?  191 ILE C CD1 1 
ATOM 7996  N N   . ASN C  1 184 ? 120.312 121.501  -7.925  1.00 46.58  ?  192 ASN C N   1 
ATOM 7997  C CA  . ASN C  1 184 ? 119.054 121.952  -7.347  1.00 46.25  ?  192 ASN C CA  1 
ATOM 7998  C C   . ASN C  1 184 ? 118.051 122.186  -8.469  1.00 46.40  ?  192 ASN C C   1 
ATOM 7999  O O   . ASN C  1 184 ? 118.379 122.812  -9.482  1.00 46.97  ?  192 ASN C O   1 
ATOM 8000  C CB  . ASN C  1 184 ? 119.243 123.235  -6.538  1.00 48.52  ?  192 ASN C CB  1 
ATOM 8001  C CG  . ASN C  1 184 ? 119.968 122.999  -5.231  1.00 48.30  ?  192 ASN C CG  1 
ATOM 8002  O OD1 . ASN C  1 184 ? 120.945 123.681  -4.916  1.00 48.68  ?  192 ASN C OD1 1 
ATOM 8003  N ND2 . ASN C  1 184 ? 119.491 122.031  -4.457  1.00 47.71  ?  192 ASN C ND2 1 
ATOM 8004  N N   . THR C  1 185 ? 116.834 121.693  -8.280  1.00 50.38  ?  193 THR C N   1 
ATOM 8005  C CA  . THR C  1 185 ? 115.758 121.828  -9.246  1.00 50.58  ?  193 THR C CA  1 
ATOM 8006  C C   . THR C  1 185 ? 114.450 122.016  -8.497  1.00 49.41  ?  193 THR C C   1 
ATOM 8007  O O   . THR C  1 185 ? 114.293 121.505  -7.381  1.00 48.13  ?  193 THR C O   1 
ATOM 8008  C CB  . THR C  1 185 ? 115.653 120.595  -10.158 1.00 52.54  ?  193 THR C CB  1 
ATOM 8009  O OG1 . THR C  1 185 ? 115.850 119.407  -9.380  1.00 54.89  ?  193 THR C OG1 1 
ATOM 8010  C CG2 . THR C  1 185 ? 116.687 120.658  -11.270 1.00 56.89  ?  193 THR C CG2 1 
ATOM 8011  N N   . PRO C  1 186 ? 113.494 122.735  -9.082  1.00 52.91  ?  194 PRO C N   1 
ATOM 8012  C CA  . PRO C  1 186 ? 112.179 122.847  -8.446  1.00 51.44  ?  194 PRO C CA  1 
ATOM 8013  C C   . PRO C  1 186 ? 111.481 121.499  -8.427  1.00 49.64  ?  194 PRO C C   1 
ATOM 8014  O O   . PRO C  1 186 ? 111.475 120.767  -9.419  1.00 56.40  ?  194 PRO C O   1 
ATOM 8015  C CB  . PRO C  1 186 ? 111.437 123.853  -9.332  1.00 48.53  ?  194 PRO C CB  1 
ATOM 8016  C CG  . PRO C  1 186 ? 112.120 123.756  -10.655 1.00 49.02  ?  194 PRO C CG  1 
ATOM 8017  C CD  . PRO C  1 186 ? 113.562 123.487  -10.346 1.00 49.10  ?  194 PRO C CD  1 
ATOM 8018  N N   . ILE C  1 187 ? 110.896 121.171  -7.279  1.00 44.31  ?  195 ILE C N   1 
ATOM 8019  C CA  . ILE C  1 187 ? 110.228 119.888  -7.100  1.00 43.76  ?  195 ILE C CA  1 
ATOM 8020  C C   . ILE C  1 187 ? 108.825 119.998  -7.686  1.00 43.72  ?  195 ILE C C   1 
ATOM 8021  O O   . ILE C  1 187 ? 107.989 120.754  -7.185  1.00 43.71  ?  195 ILE C O   1 
ATOM 8022  C CB  . ILE C  1 187 ? 110.187 119.476  -5.626  1.00 44.52  ?  195 ILE C CB  1 
ATOM 8023  C CG1 . ILE C  1 187 ? 111.607 119.389  -5.063  1.00 49.22  ?  195 ILE C CG1 1 
ATOM 8024  C CG2 . ILE C  1 187 ? 109.478 118.149  -5.473  1.00 43.24  ?  195 ILE C CG2 1 
ATOM 8025  C CD1 . ILE C  1 187 ? 111.663 118.914  -3.630  1.00 54.22  ?  195 ILE C CD1 1 
ATOM 8026  N N   . GLU C  1 188 ? 108.569 119.254  -8.756  1.00 46.30  ?  196 GLU C N   1 
ATOM 8027  C CA  . GLU C  1 188 ? 107.282 119.264  -9.431  1.00 46.31  ?  196 GLU C CA  1 
ATOM 8028  C C   . GLU C  1 188 ? 106.443 118.067  -9.001  1.00 45.71  ?  196 GLU C C   1 
ATOM 8029  O O   . GLU C  1 188 ? 106.956 117.067  -8.496  1.00 45.34  ?  196 GLU C O   1 
ATOM 8030  C CB  . GLU C  1 188 ? 107.468 119.243  -10.950 1.00 48.96  ?  196 GLU C CB  1 
ATOM 8031  C CG  . GLU C  1 188 ? 108.601 120.112  -11.453 1.00 57.26  ?  196 GLU C CG  1 
ATOM 8032  C CD  . GLU C  1 188 ? 108.806 119.971  -12.945 1.00 74.45  ?  196 GLU C CD  1 
ATOM 8033  O OE1 . GLU C  1 188 ? 107.800 119.826  -13.670 1.00 80.58  ?  196 GLU C OE1 1 
ATOM 8034  O OE2 . GLU C  1 188 ? 109.973 119.996  -13.392 1.00 82.63  -1 196 GLU C OE2 1 
ATOM 8035  N N   . ASP C  1 189 ? 105.134 118.182  -9.216  1.00 48.61  ?  197 ASP C N   1 
ATOM 8036  C CA  . ASP C  1 189 ? 104.231 117.079  -8.916  1.00 48.82  ?  197 ASP C CA  1 
ATOM 8037  C C   . ASP C  1 189 ? 104.503 115.915  -9.859  1.00 48.21  ?  197 ASP C C   1 
ATOM 8038  O O   . ASP C  1 189 ? 104.505 116.079  -11.083 1.00 51.38  ?  197 ASP C O   1 
ATOM 8039  C CB  . ASP C  1 189 ? 102.777 117.529  -9.033  1.00 52.40  ?  197 ASP C CB  1 
ATOM 8040  C CG  . ASP C  1 189 ? 101.798 116.390  -8.820  1.00 56.19  ?  197 ASP C CG  1 
ATOM 8041  O OD1 . ASP C  1 189 ? 101.557 116.022  -7.651  1.00 52.82  ?  197 ASP C OD1 1 
ATOM 8042  O OD2 . ASP C  1 189 ? 101.271 115.860  -9.822  1.00 62.85  -1 197 ASP C OD2 1 
ATOM 8043  N N   . GLY C  1 190 ? 104.729 114.737  -9.286  1.00 49.18  ?  198 GLY C N   1 
ATOM 8044  C CA  . GLY C  1 190 ? 105.060 113.549  -10.045 1.00 45.70  ?  198 GLY C CA  1 
ATOM 8045  C C   . GLY C  1 190 ? 106.511 113.138  -9.946  1.00 46.09  ?  198 GLY C C   1 
ATOM 8046  O O   . GLY C  1 190 ? 106.847 112.016  -10.344 1.00 52.70  ?  198 GLY C O   1 
ATOM 8047  N N   . ASP C  1 191 ? 107.380 114.008  -9.435  1.00 44.04  ?  199 ASP C N   1 
ATOM 8048  C CA  . ASP C  1 191 ? 108.776 113.647  -9.241  1.00 44.19  ?  199 ASP C CA  1 
ATOM 8049  C C   . ASP C  1 191 ? 108.893 112.499  -8.245  1.00 43.28  ?  199 ASP C C   1 
ATOM 8050  O O   . ASP C  1 191 ? 108.032 112.302  -7.384  1.00 48.79  ?  199 ASP C O   1 
ATOM 8051  C CB  . ASP C  1 191 ? 109.573 114.854  -8.741  1.00 45.99  ?  199 ASP C CB  1 
ATOM 8052  C CG  . ASP C  1 191 ? 109.634 115.976  -9.760  1.00 56.23  ?  199 ASP C CG  1 
ATOM 8053  O OD1 . ASP C  1 191 ? 108.853 115.939  -10.735 1.00 68.00  ?  199 ASP C OD1 1 
ATOM 8054  O OD2 . ASP C  1 191 ? 110.463 116.896  -9.588  1.00 52.93  -1 199 ASP C OD2 1 
ATOM 8055  N N   . MET C  1 192 ? 109.974 111.735  -8.365  1.00 42.55  ?  200 MET C N   1 
ATOM 8056  C CA  . MET C  1 192 ? 110.198 110.589  -7.495  1.00 41.41  ?  200 MET C CA  1 
ATOM 8057  C C   . MET C  1 192 ? 110.986 111.010  -6.263  1.00 42.94  ?  200 MET C C   1 
ATOM 8058  O O   . MET C  1 192 ? 111.895 111.841  -6.343  1.00 50.60  ?  200 MET C O   1 
ATOM 8059  C CB  . MET C  1 192 ? 110.941 109.479  -8.239  1.00 46.48  ?  200 MET C CB  1 
ATOM 8060  C CG  . MET C  1 192 ? 110.180 108.931  -9.430  1.00 53.54  ?  200 MET C CG  1 
ATOM 8061  S SD  . MET C  1 192 ? 108.560 108.296  -8.955  1.00 50.30  ?  200 MET C SD  1 
ATOM 8062  C CE  . MET C  1 192 ? 109.032 106.957  -7.863  1.00 44.78  ?  200 MET C CE  1 
ATOM 8063  N N   . VAL C  1 193 ? 110.627 110.434  -5.125  1.00 43.89  ?  201 VAL C N   1 
ATOM 8064  C CA  . VAL C  1 193 ? 111.279 110.747  -3.865  1.00 41.40  ?  201 VAL C CA  1 
ATOM 8065  C C   . VAL C  1 193 ? 112.450 109.796  -3.663  1.00 43.56  ?  201 VAL C C   1 
ATOM 8066  O O   . VAL C  1 193 ? 112.570 108.766  -4.330  1.00 48.86  ?  201 VAL C O   1 
ATOM 8067  C CB  . VAL C  1 193 ? 110.291 110.663  -2.684  1.00 39.55  ?  201 VAL C CB  1 
ATOM 8068  C CG1 . VAL C  1 193 ? 110.743 111.556  -1.535  1.00 39.67  ?  201 VAL C CG1 1 
ATOM 8069  C CG2 . VAL C  1 193 ? 108.890 111.026  -3.137  1.00 39.49  ?  201 VAL C CG2 1 
ATOM 8070  N N   . ASP C  1 194 ? 113.338 110.158  -2.742  1.00 46.00  ?  202 ASP C N   1 
ATOM 8071  C CA  . ASP C  1 194 ? 114.344 109.217  -2.279  1.00 47.09  ?  202 ASP C CA  1 
ATOM 8072  C C   . ASP C  1 194 ? 113.657 107.980  -1.718  1.00 45.01  ?  202 ASP C C   1 
ATOM 8073  O O   . ASP C  1 194 ? 112.758 108.080  -0.879  1.00 49.25  ?  202 ASP C O   1 
ATOM 8074  C CB  . ASP C  1 194 ? 115.226 109.866  -1.215  1.00 45.96  ?  202 ASP C CB  1 
ATOM 8075  C CG  . ASP C  1 194 ? 116.050 108.852  -0.448  1.00 60.05  ?  202 ASP C CG  1 
ATOM 8076  O OD1 . ASP C  1 194 ? 116.763 108.049  -1.088  1.00 65.33  ?  202 ASP C OD1 1 
ATOM 8077  O OD2 . ASP C  1 194 ? 115.975 108.854  0.799   1.00 65.08  -1 202 ASP C OD2 1 
ATOM 8078  N N   . THR C  1 195 ? 114.069 106.810  -2.197  1.00 43.36  ?  203 THR C N   1 
ATOM 8079  C CA  . THR C  1 195 ? 113.417 105.559  -1.833  1.00 42.38  ?  203 THR C CA  1 
ATOM 8080  C C   . THR C  1 195 ? 114.329 104.623  -1.053  1.00 42.19  ?  203 THR C C   1 
ATOM 8081  O O   . THR C  1 195 ? 113.942 103.480  -0.786  1.00 41.46  ?  203 THR C O   1 
ATOM 8082  C CB  . THR C  1 195 ? 112.899 104.851  -3.085  1.00 49.22  ?  203 THR C CB  1 
ATOM 8083  O OG1 . THR C  1 195 ? 113.990 104.609  -3.980  1.00 59.97  ?  203 THR C OG1 1 
ATOM 8084  C CG2 . THR C  1 195 ? 111.848 105.702  -3.782  1.00 49.26  ?  203 THR C CG2 1 
ATOM 8085  N N   . GLY C  1 196 ? 115.529 105.067  -0.694  1.00 46.32  ?  204 GLY C N   1 
ATOM 8086  C CA  . GLY C  1 196 ? 116.482 104.240  0.016   1.00 46.64  ?  204 GLY C CA  1 
ATOM 8087  C C   . GLY C  1 196 ? 117.711 103.892  -0.786  1.00 47.88  ?  204 GLY C C   1 
ATOM 8088  O O   . GLY C  1 196 ? 118.652 103.314  -0.228  1.00 49.29  ?  204 GLY C O   1 
ATOM 8089  N N   . TYR C  1 197 ? 117.734 104.221  -2.075  1.00 47.00  ?  205 TYR C N   1 
ATOM 8090  C CA  . TYR C  1 197 ? 118.900 104.020  -2.920  1.00 49.76  ?  205 TYR C CA  1 
ATOM 8091  C C   . TYR C  1 197 ? 119.662 105.311  -3.178  1.00 57.41  ?  205 TYR C C   1 
ATOM 8092  O O   . TYR C  1 197 ? 120.626 105.303  -3.950  1.00 66.57  ?  205 TYR C O   1 
ATOM 8093  C CB  . TYR C  1 197 ? 118.486 103.404  -4.261  1.00 51.67  ?  205 TYR C CB  1 
ATOM 8094  C CG  . TYR C  1 197 ? 117.998 101.974  -4.193  1.00 52.73  ?  205 TYR C CG  1 
ATOM 8095  C CD1 . TYR C  1 197 ? 118.896 100.917  -4.124  1.00 56.30  ?  205 TYR C CD1 1 
ATOM 8096  C CD2 . TYR C  1 197 ? 116.641 101.679  -4.231  1.00 47.70  ?  205 TYR C CD2 1 
ATOM 8097  C CE1 . TYR C  1 197 ? 118.458 99.607   -4.076  1.00 52.27  ?  205 TYR C CE1 1 
ATOM 8098  C CE2 . TYR C  1 197 ? 116.192 100.371  -4.183  1.00 41.54  ?  205 TYR C CE2 1 
ATOM 8099  C CZ  . TYR C  1 197 ? 117.106 99.340   -4.106  1.00 43.68  ?  205 TYR C CZ  1 
ATOM 8100  O OH  . TYR C  1 197 ? 116.668 98.037   -4.059  1.00 41.66  ?  205 TYR C OH  1 
ATOM 8101  N N   . GLY C  1 198 ? 119.260 106.411  -2.554  1.00 51.83  ?  206 GLY C N   1 
ATOM 8102  C CA  . GLY C  1 198 ? 119.890 107.696  -2.769  1.00 50.76  ?  206 GLY C CA  1 
ATOM 8103  C C   . GLY C  1 198 ? 119.080 108.581  -3.701  1.00 48.32  ?  206 GLY C C   1 
ATOM 8104  O O   . GLY C  1 198 ? 118.144 108.150  -4.378  1.00 51.86  ?  206 GLY C O   1 
ATOM 8105  N N   . ALA C  1 199 ? 119.467 109.851  -3.732  1.00 45.13  ?  207 ALA C N   1 
ATOM 8106  C CA  . ALA C  1 199 ? 118.815 110.862  -4.561  1.00 45.39  ?  207 ALA C CA  1 
ATOM 8107  C C   . ALA C  1 199 ? 119.723 111.168  -5.748  1.00 47.27  ?  207 ALA C C   1 
ATOM 8108  O O   . ALA C  1 199 ? 120.645 111.982  -5.640  1.00 52.51  ?  207 ALA C O   1 
ATOM 8109  C CB  . ALA C  1 199 ? 118.512 112.118  -3.751  1.00 47.51  ?  207 ALA C CB  1 
ATOM 8110  N N   . MET C  1 200 ? 119.457 110.520  -6.881  1.00 46.77  ?  208 MET C N   1 
ATOM 8111  C CA  . MET C  1 200 ? 120.293 110.681  -8.060  1.00 48.48  ?  208 MET C CA  1 
ATOM 8112  C C   . MET C  1 200 ? 119.468 110.434  -9.315  1.00 48.27  ?  208 MET C C   1 
ATOM 8113  O O   . MET C  1 200 ? 118.304 110.033  -9.256  1.00 47.22  ?  208 MET C O   1 
ATOM 8114  C CB  . MET C  1 200 ? 121.496 109.732  -8.027  1.00 49.56  ?  208 MET C CB  1 
ATOM 8115  C CG  . MET C  1 200 ? 121.148 108.319  -7.583  1.00 56.48  ?  208 MET C CG  1 
ATOM 8116  S SD  . MET C  1 200 ? 122.399 107.104  -8.042  1.00 63.90  ?  208 MET C SD  1 
ATOM 8117  C CE  . MET C  1 200 ? 122.218 107.109  -9.821  1.00 67.67  ?  208 MET C CE  1 
ATOM 8118  N N   . ASP C  1 201 ? 120.097 110.689  -10.461 1.00 50.68  ?  209 ASP C N   1 
ATOM 8119  C CA  . ASP C  1 201 ? 119.489 110.457  -11.770 1.00 51.38  ?  209 ASP C CA  1 
ATOM 8120  C C   . ASP C  1 201 ? 119.870 109.048  -12.199 1.00 51.22  ?  209 ASP C C   1 
ATOM 8121  O O   . ASP C  1 201 ? 120.944 108.825  -12.763 1.00 56.79  ?  209 ASP C O   1 
ATOM 8122  C CB  . ASP C  1 201 ? 119.957 111.502  -12.778 1.00 49.98  ?  209 ASP C CB  1 
ATOM 8123  C CG  . ASP C  1 201 ? 119.153 111.478  -14.070 1.00 52.27  ?  209 ASP C CG  1 
ATOM 8124  O OD1 . ASP C  1 201 ? 118.532 110.440  -14.383 1.00 50.05  ?  209 ASP C OD1 1 
ATOM 8125  O OD2 . ASP C  1 201 ? 119.140 112.509  -14.776 1.00 57.10  -1 209 ASP C OD2 1 
ATOM 8126  N N   . PHE C  1 202 ? 118.983 108.090  -11.929 1.00 49.64  ?  210 PHE C N   1 
ATOM 8127  C CA  . PHE C  1 202 ? 119.275 106.698  -12.249 1.00 49.52  ?  210 PHE C CA  1 
ATOM 8128  C C   . PHE C  1 202 ? 119.308 106.458  -13.752 1.00 53.19  ?  210 PHE C C   1 
ATOM 8129  O O   . PHE C  1 202 ? 119.973 105.523  -14.213 1.00 53.87  ?  210 PHE C O   1 
ATOM 8130  C CB  . PHE C  1 202 ? 118.250 105.788  -11.575 1.00 51.42  ?  210 PHE C CB  1 
ATOM 8131  C CG  . PHE C  1 202 ? 118.355 105.775  -10.080 1.00 48.71  ?  210 PHE C CG  1 
ATOM 8132  C CD1 . PHE C  1 202 ? 119.274 104.959  -9.444  1.00 48.28  ?  210 PHE C CD1 1 
ATOM 8133  C CD2 . PHE C  1 202 ? 117.547 106.591  -9.311  1.00 47.60  ?  210 PHE C CD2 1 
ATOM 8134  C CE1 . PHE C  1 202 ? 119.379 104.952  -8.068  1.00 50.43  ?  210 PHE C CE1 1 
ATOM 8135  C CE2 . PHE C  1 202 ? 117.646 106.589  -7.933  1.00 51.32  ?  210 PHE C CE2 1 
ATOM 8136  C CZ  . PHE C  1 202 ? 118.563 105.768  -7.311  1.00 52.35  ?  210 PHE C CZ  1 
ATOM 8137  N N   . LYS C  1 203 ? 118.597 107.279  -14.529 1.00 49.81  ?  211 LYS C N   1 
ATOM 8138  C CA  . LYS C  1 203 ? 118.594 107.104  -15.978 1.00 53.70  ?  211 LYS C CA  1 
ATOM 8139  C C   . LYS C  1 203 ? 119.942 107.475  -16.586 1.00 57.52  ?  211 LYS C C   1 
ATOM 8140  O O   . LYS C  1 203 ? 120.387 106.843  -17.550 1.00 65.30  ?  211 LYS C O   1 
ATOM 8141  C CB  . LYS C  1 203 ? 117.468 107.929  -16.601 1.00 50.60  ?  211 LYS C CB  1 
ATOM 8142  C CG  . LYS C  1 203 ? 117.293 107.718  -18.094 1.00 54.94  ?  211 LYS C CG  1 
ATOM 8143  C CD  . LYS C  1 203 ? 116.121 108.525  -18.622 1.00 58.34  ?  211 LYS C CD  1 
ATOM 8144  C CE  . LYS C  1 203 ? 115.877 108.243  -20.093 1.00 64.49  ?  211 LYS C CE  1 
ATOM 8145  N NZ  . LYS C  1 203 ? 114.708 109.004  -20.613 1.00 68.53  1  211 LYS C NZ  1 
ATOM 8146  N N   . LEU C  1 204 ? 120.605 108.495  -16.040 1.00 52.56  ?  212 LEU C N   1 
ATOM 8147  C CA  . LEU C  1 204 ? 121.859 108.979  -16.607 1.00 54.08  ?  212 LEU C CA  1 
ATOM 8148  C C   . LEU C  1 204 ? 123.086 108.317  -15.996 1.00 53.72  ?  212 LEU C C   1 
ATOM 8149  O O   . LEU C  1 204 ? 124.120 108.211  -16.667 1.00 57.45  ?  212 LEU C O   1 
ATOM 8150  C CB  . LEU C  1 204 ? 121.977 110.496  -16.433 1.00 46.35  ?  212 LEU C CB  1 
ATOM 8151  C CG  . LEU C  1 204 ? 121.514 111.397  -17.580 1.00 46.92  ?  212 LEU C CG  1 
ATOM 8152  C CD1 . LEU C  1 204 ? 120.094 111.069  -18.007 1.00 46.61  ?  212 LEU C CD1 1 
ATOM 8153  C CD2 . LEU C  1 204 ? 121.627 112.856  -17.176 1.00 47.21  ?  212 LEU C CD2 1 
ATOM 8154  N N   . LEU C  1 205 ? 123.002 107.870  -14.745 1.00 51.88  ?  213 LEU C N   1 
ATOM 8155  C CA  . LEU C  1 205 ? 124.148 107.304  -14.046 1.00 51.77  ?  213 LEU C CA  1 
ATOM 8156  C C   . LEU C  1 205 ? 124.121 105.783  -13.975 1.00 50.81  ?  213 LEU C C   1 
ATOM 8157  O O   . LEU C  1 205 ? 125.053 105.187  -13.427 1.00 50.74  ?  213 LEU C O   1 
ATOM 8158  C CB  . LEU C  1 205 ? 124.238 107.886  -12.634 1.00 47.49  ?  213 LEU C CB  1 
ATOM 8159  C CG  . LEU C  1 205 ? 124.624 109.361  -12.540 1.00 47.95  ?  213 LEU C CG  1 
ATOM 8160  C CD1 . LEU C  1 205 ? 124.615 109.819  -11.096 1.00 47.62  ?  213 LEU C CD1 1 
ATOM 8161  C CD2 . LEU C  1 205 ? 125.993 109.580  -13.157 1.00 48.63  ?  213 LEU C CD2 1 
ATOM 8162  N N   . GLN C  1 206 ? 123.078 105.138  -14.497 1.00 56.84  ?  214 GLN C N   1 
ATOM 8163  C CA  . GLN C  1 206 ? 122.991 103.675  -14.503 1.00 56.00  ?  214 GLN C CA  1 
ATOM 8164  C C   . GLN C  1 206 ? 122.486 103.237  -15.878 1.00 58.27  ?  214 GLN C C   1 
ATOM 8165  O O   . GLN C  1 206 ? 121.278 103.110  -16.097 1.00 56.11  ?  214 GLN C O   1 
ATOM 8166  C CB  . GLN C  1 206 ? 122.094 103.173  -13.381 1.00 54.46  ?  214 GLN C CB  1 
ATOM 8167  C CG  . GLN C  1 206 ? 122.633 103.464  -11.990 1.00 56.56  ?  214 GLN C CG  1 
ATOM 8168  C CD  . GLN C  1 206 ? 121.687 103.022  -10.895 1.00 59.19  ?  214 GLN C CD  1 
ATOM 8169  O OE1 . GLN C  1 206 ? 120.555 102.618  -11.164 1.00 65.89  ?  214 GLN C OE1 1 
ATOM 8170  N NE2 . GLN C  1 206 ? 122.145 103.095  -9.650  1.00 51.71  ?  214 GLN C NE2 1 
ATOM 8171  N N   . ASP C  1 207 ? 123.423 103.004  -16.800 1.00 55.06  ?  215 ASP C N   1 
ATOM 8172  C CA  . ASP C  1 207 ? 123.085 102.432  -18.098 1.00 61.59  ?  215 ASP C CA  1 
ATOM 8173  C C   . ASP C  1 207 ? 122.612 100.989  -17.991 1.00 55.37  ?  215 ASP C C   1 
ATOM 8174  O O   . ASP C  1 207 ? 122.065 100.461  -18.965 1.00 54.24  ?  215 ASP C O   1 
ATOM 8175  C CB  . ASP C  1 207 ? 124.288 102.504  -19.041 1.00 64.94  ?  215 ASP C CB  1 
ATOM 8176  C CG  . ASP C  1 207 ? 124.918 103.883  -19.081 1.00 74.58  ?  215 ASP C CG  1 
ATOM 8177  O OD1 . ASP C  1 207 ? 124.257 104.858  -18.660 1.00 76.93  ?  215 ASP C OD1 1 
ATOM 8178  O OD2 . ASP C  1 207 ? 126.074 103.992  -19.541 1.00 79.00  -1 215 ASP C OD2 1 
ATOM 8179  N N   . ASN C  1 208 ? 122.820 100.348  -16.839 1.00 58.32  ?  216 ASN C N   1 
ATOM 8180  C CA  . ASN C  1 208 ? 122.432 98.952   -16.664 1.00 57.61  ?  216 ASN C CA  1 
ATOM 8181  C C   . ASN C  1 208 ? 120.927 98.758   -16.811 1.00 59.46  ?  216 ASN C C   1 
ATOM 8182  O O   . ASN C  1 208 ? 120.478 97.728   -17.328 1.00 47.99  ?  216 ASN C O   1 
ATOM 8183  C CB  . ASN C  1 208 ? 122.896 98.462   -15.294 1.00 57.36  ?  216 ASN C CB  1 
ATOM 8184  C CG  . ASN C  1 208 ? 123.023 96.965   -15.226 1.00 69.39  ?  216 ASN C CG  1 
ATOM 8185  O OD1 . ASN C  1 208 ? 122.627 96.256   -16.150 1.00 78.76  ?  216 ASN C OD1 1 
ATOM 8186  N ND2 . ASN C  1 208 ? 123.581 96.470   -14.128 1.00 72.76  ?  216 ASN C ND2 1 
ATOM 8187  N N   . LYS C  1 209 ? 120.136 99.736   -16.363 1.00 62.35  ?  217 LYS C N   1 
ATOM 8188  C CA  . LYS C  1 209 ? 118.683 99.590   -16.246 1.00 54.45  ?  217 LYS C CA  1 
ATOM 8189  C C   . LYS C  1 209 ? 118.326 98.377   -15.391 1.00 48.39  ?  217 LYS C C   1 
ATOM 8190  O O   . LYS C  1 209 ? 117.343 97.678   -15.646 1.00 49.26  ?  217 LYS C O   1 
ATOM 8191  C CB  . LYS C  1 209 ? 117.999 99.510   -17.615 1.00 48.36  ?  217 LYS C CB  1 
ATOM 8192  C CG  . LYS C  1 209 ? 118.124 100.772  -18.446 1.00 49.00  ?  217 LYS C CG  1 
ATOM 8193  C CD  . LYS C  1 209 ? 117.238 100.707  -19.678 1.00 49.29  ?  217 LYS C CD  1 
ATOM 8194  C CE  . LYS C  1 209 ? 117.316 101.997  -20.477 1.00 50.97  ?  217 LYS C CE  1 
ATOM 8195  N NZ  . LYS C  1 209 ? 116.474 101.946  -21.704 1.00 52.03  1  217 LYS C NZ  1 
ATOM 8196  N N   . SER C  1 210 ? 119.140 98.120   -14.366 1.00 49.89  ?  218 SER C N   1 
ATOM 8197  C CA  . SER C  1 210 ? 118.939 96.929   -13.549 1.00 48.57  ?  218 SER C CA  1 
ATOM 8198  C C   . SER C  1 210 ? 119.445 97.095   -12.120 1.00 47.77  ?  218 SER C C   1 
ATOM 8199  O O   . SER C  1 210 ? 119.516 96.095   -11.395 1.00 46.90  ?  218 SER C O   1 
ATOM 8200  C CB  . SER C  1 210 ? 119.628 95.721   -14.200 1.00 50.33  ?  218 SER C CB  1 
ATOM 8201  O OG  . SER C  1 210 ? 119.073 95.436   -15.472 1.00 52.46  ?  218 SER C OG  1 
ATOM 8202  N N   . GLU C  1 211 ? 119.779 98.306   -11.678 1.00 50.00  ?  219 GLU C N   1 
ATOM 8203  C CA  . GLU C  1 211 ? 120.297 98.505   -10.332 1.00 49.42  ?  219 GLU C CA  1 
ATOM 8204  C C   . GLU C  1 211 ? 119.198 98.790   -9.319  1.00 48.34  ?  219 GLU C C   1 
ATOM 8205  O O   . GLU C  1 211 ? 119.358 98.471   -8.135  1.00 49.58  ?  219 GLU C O   1 
ATOM 8206  C CB  . GLU C  1 211 ? 121.297 99.662   -10.321 1.00 50.50  ?  219 GLU C CB  1 
ATOM 8207  C CG  . GLU C  1 211 ? 122.395 99.553   -11.368 1.00 62.95  ?  219 GLU C CG  1 
ATOM 8208  C CD  . GLU C  1 211 ? 123.509 98.616   -10.957 1.00 71.04  ?  219 GLU C CD  1 
ATOM 8209  O OE1 . GLU C  1 211 ? 123.884 98.627   -9.765  1.00 76.77  ?  219 GLU C OE1 1 
ATOM 8210  O OE2 . GLU C  1 211 ? 124.012 97.872   -11.826 1.00 71.24  -1 219 GLU C OE2 1 
ATOM 8211  N N   . VAL C  1 212 ? 118.094 99.386   -9.757  1.00 51.71  ?  220 VAL C N   1 
ATOM 8212  C CA  . VAL C  1 212 ? 116.994 99.758   -8.869  1.00 47.82  ?  220 VAL C CA  1 
ATOM 8213  C C   . VAL C  1 212 ? 115.688 99.314   -9.514  1.00 45.61  ?  220 VAL C C   1 
ATOM 8214  O O   . VAL C  1 212 ? 115.633 99.074   -10.731 1.00 46.02  ?  220 VAL C O   1 
ATOM 8215  C CB  . VAL C  1 212 ? 116.991 101.276  -8.575  1.00 46.72  ?  220 VAL C CB  1 
ATOM 8216  C CG1 . VAL C  1 212 ? 118.101 101.621  -7.602  1.00 49.07  ?  220 VAL C CG1 1 
ATOM 8217  C CG2 . VAL C  1 212 ? 117.159 102.059  -9.858  1.00 48.83  ?  220 VAL C CG2 1 
ATOM 8218  N N   . PRO C  1 213 ? 114.618 99.181   -8.726  1.00 43.32  ?  221 PRO C N   1 
ATOM 8219  C CA  . PRO C  1 213 ? 113.346 98.696   -9.280  1.00 42.89  ?  221 PRO C CA  1 
ATOM 8220  C C   . PRO C  1 213 ? 112.809 99.605   -10.376 1.00 43.72  ?  221 PRO C C   1 
ATOM 8221  O O   . PRO C  1 213 ? 113.290 100.715  -10.613 1.00 44.55  ?  221 PRO C O   1 
ATOM 8222  C CB  . PRO C  1 213 ? 112.413 98.674   -8.065  1.00 44.09  ?  221 PRO C CB  1 
ATOM 8223  C CG  . PRO C  1 213 ? 113.322 98.516   -6.902  1.00 44.28  ?  221 PRO C CG  1 
ATOM 8224  C CD  . PRO C  1 213 ? 114.567 99.277   -7.254  1.00 47.16  ?  221 PRO C CD  1 
ATOM 8225  N N   . LEU C  1 214 ? 111.775 99.098   -11.056 1.00 41.62  ?  222 LEU C N   1 
ATOM 8226  C CA  . LEU C  1 214 ? 111.201 99.798   -12.202 1.00 43.91  ?  222 LEU C CA  1 
ATOM 8227  C C   . LEU C  1 214 ? 110.668 101.176  -11.828 1.00 46.74  ?  222 LEU C C   1 
ATOM 8228  O O   . LEU C  1 214 ? 110.571 102.055  -12.692 1.00 50.01  ?  222 LEU C O   1 
ATOM 8229  C CB  . LEU C  1 214 ? 110.085 98.955   -12.819 1.00 43.57  ?  222 LEU C CB  1 
ATOM 8230  C CG  . LEU C  1 214 ? 110.468 97.565   -13.330 1.00 44.12  ?  222 LEU C CG  1 
ATOM 8231  C CD1 . LEU C  1 214 ? 109.225 96.716   -13.525 1.00 43.01  ?  222 LEU C CD1 1 
ATOM 8232  C CD2 . LEU C  1 214 ? 111.263 97.660   -14.624 1.00 47.08  ?  222 LEU C CD2 1 
ATOM 8233  N N   . ASP C  1 215 ? 110.302 101.373  -10.557 1.00 46.12  ?  223 ASP C N   1 
ATOM 8234  C CA  . ASP C  1 215 ? 109.810 102.671  -10.100 1.00 46.90  ?  223 ASP C CA  1 
ATOM 8235  C C   . ASP C  1 215 ? 110.749 103.807  -10.476 1.00 52.48  ?  223 ASP C C   1 
ATOM 8236  O O   . ASP C  1 215 ? 110.301 104.881  -10.894 1.00 56.11  ?  223 ASP C O   1 
ATOM 8237  C CB  . ASP C  1 215 ? 109.619 102.652  -8.584  1.00 43.76  ?  223 ASP C CB  1 
ATOM 8238  C CG  . ASP C  1 215 ? 108.223 102.269  -8.183  1.00 62.82  ?  223 ASP C CG  1 
ATOM 8239  O OD1 . ASP C  1 215 ? 107.353 102.228  -9.073  1.00 73.02  ?  223 ASP C OD1 1 
ATOM 8240  O OD2 . ASP C  1 215 ? 107.994 102.021  -6.979  1.00 68.79  -1 223 ASP C OD2 1 
ATOM 8241  N N   . ILE C  1 216 ? 112.058 103.591  -10.332 1.00 48.05  ?  224 ILE C N   1 
ATOM 8242  C CA  . ILE C  1 216 ? 113.032 104.672  -10.386 1.00 47.18  ?  224 ILE C CA  1 
ATOM 8243  C C   . ILE C  1 216 ? 114.173 104.405  -11.355 1.00 48.09  ?  224 ILE C C   1 
ATOM 8244  O O   . ILE C  1 216 ? 115.029 105.273  -11.532 1.00 49.87  ?  224 ILE C O   1 
ATOM 8245  C CB  . ILE C  1 216 ? 113.591 104.971  -8.980  1.00 44.57  ?  224 ILE C CB  1 
ATOM 8246  C CG1 . ILE C  1 216 ? 114.207 103.707  -8.380  1.00 44.26  ?  224 ILE C CG1 1 
ATOM 8247  C CG2 . ILE C  1 216 ? 112.493 105.498  -8.069  1.00 44.26  ?  224 ILE C CG2 1 
ATOM 8248  C CD1 . ILE C  1 216 ? 114.670 103.869  -6.954  1.00 44.09  ?  224 ILE C CD1 1 
ATOM 8249  N N   . CYS C  1 217 ? 114.219 103.230  -11.992 1.00 46.61  ?  225 CYS C N   1 
ATOM 8250  C CA  . CYS C  1 217 ? 115.370 102.873  -12.818 1.00 48.62  ?  225 CYS C CA  1 
ATOM 8251  C C   . CYS C  1 217 ? 115.563 103.814  -14.001 1.00 52.87  ?  225 CYS C C   1 
ATOM 8252  O O   . CYS C  1 217 ? 116.658 103.854  -14.572 1.00 62.49  ?  225 CYS C O   1 
ATOM 8253  C CB  . CYS C  1 217 ? 115.241 101.435  -13.324 1.00 44.18  ?  225 CYS C CB  1 
ATOM 8254  S SG  . CYS C  1 217 ? 114.133 101.240  -14.733 1.00 45.86  ?  225 CYS C SG  1 
ATOM 8255  N N   . GLN C  1 218 ? 114.532 104.568  -14.382 1.00 45.77  ?  226 GLN C N   1 
ATOM 8256  C CA  . GLN C  1 218 ? 114.635 105.532  -15.471 1.00 50.33  ?  226 GLN C CA  1 
ATOM 8257  C C   . GLN C  1 218 ? 114.044 106.877  -15.067 1.00 54.73  ?  226 GLN C C   1 
ATOM 8258  O O   . GLN C  1 218 ? 113.485 107.593  -15.902 1.00 55.70  ?  226 GLN C O   1 
ATOM 8259  C CB  . GLN C  1 218 ? 113.953 105.002  -16.733 1.00 49.38  ?  226 GLN C CB  1 
ATOM 8260  C CG  . GLN C  1 218 ? 114.667 103.826  -17.388 1.00 50.58  ?  226 GLN C CG  1 
ATOM 8261  C CD  . GLN C  1 218 ? 115.917 104.242  -18.142 1.00 56.46  ?  226 GLN C CD  1 
ATOM 8262  O OE1 . GLN C  1 218 ? 115.838 104.885  -19.189 1.00 60.64  ?  226 GLN C OE1 1 
ATOM 8263  N NE2 . GLN C  1 218 ? 117.080 103.874  -17.612 1.00 55.25  ?  226 GLN C NE2 1 
ATOM 8264  N N   . SER C  1 219 ? 114.168 107.236  -13.790 1.00 57.67  ?  227 SER C N   1 
ATOM 8265  C CA  . SER C  1 219 ? 113.623 108.474  -13.250 1.00 55.22  ?  227 SER C CA  1 
ATOM 8266  C C   . SER C  1 219 ? 114.678 109.150  -12.382 1.00 47.26  ?  227 SER C C   1 
ATOM 8267  O O   . SER C  1 219 ? 115.813 108.679  -12.261 1.00 48.08  ?  227 SER C O   1 
ATOM 8268  C CB  . SER C  1 219 ? 112.342 108.219  -12.444 1.00 50.59  ?  227 SER C CB  1 
ATOM 8269  O OG  . SER C  1 219 ? 111.288 107.763  -13.275 1.00 55.92  ?  227 SER C OG  1 
ATOM 8270  N N   . ILE C  1 220 ? 114.292 110.264  -11.767 1.00 43.82  ?  228 ILE C N   1 
ATOM 8271  C CA  . ILE C  1 220 ? 115.166 111.031  -10.889 1.00 43.95  ?  228 ILE C CA  1 
ATOM 8272  C C   . ILE C  1 220 ? 114.554 111.049  -9.497  1.00 43.44  ?  228 ILE C C   1 
ATOM 8273  O O   . ILE C  1 220 ? 113.371 111.370  -9.336  1.00 43.24  ?  228 ILE C O   1 
ATOM 8274  C CB  . ILE C  1 220 ? 115.379 112.464  -11.408 1.00 44.41  ?  228 ILE C CB  1 
ATOM 8275  C CG1 . ILE C  1 220 ? 116.129 112.444  -12.739 1.00 44.98  ?  228 ILE C CG1 1 
ATOM 8276  C CG2 . ILE C  1 220 ? 116.126 113.298  -10.380 1.00 44.50  ?  228 ILE C CG2 1 
ATOM 8277  C CD1 . ILE C  1 220 ? 116.528 113.816  -13.235 1.00 46.49  ?  228 ILE C CD1 1 
ATOM 8278  N N   . CYS C  1 221 ? 115.358 110.701  -8.497  1.00 41.19  ?  229 CYS C N   1 
ATOM 8279  C CA  . CYS C  1 221 ? 114.955 110.777  -7.100  1.00 40.78  ?  229 CYS C CA  1 
ATOM 8280  C C   . CYS C  1 221 ? 115.503 112.069  -6.507  1.00 41.10  ?  229 CYS C C   1 
ATOM 8281  O O   . CYS C  1 221 ? 116.719 112.285  -6.498  1.00 41.42  ?  229 CYS C O   1 
ATOM 8282  C CB  . CYS C  1 221 ? 115.459 109.564  -6.319  1.00 40.91  ?  229 CYS C CB  1 
ATOM 8283  S SG  . CYS C  1 221 ? 114.605 108.026  -6.723  1.00 39.86  ?  229 CYS C SG  1 
ATOM 8284  N N   . LYS C  1 222 ? 114.609 112.926  -6.025  1.00 42.74  ?  230 LYS C N   1 
ATOM 8285  C CA  . LYS C  1 222 ? 114.980 114.216  -5.465  1.00 43.96  ?  230 LYS C CA  1 
ATOM 8286  C C   . LYS C  1 222 ? 114.757 114.226  -3.960  1.00 42.50  ?  230 LYS C C   1 
ATOM 8287  O O   . LYS C  1 222 ? 113.788 113.646  -3.460  1.00 41.44  ?  230 LYS C O   1 
ATOM 8288  C CB  . LYS C  1 222 ? 114.182 115.355  -6.107  1.00 44.13  ?  230 LYS C CB  1 
ATOM 8289  C CG  . LYS C  1 222 ? 114.414 115.528  -7.595  1.00 46.64  ?  230 LYS C CG  1 
ATOM 8290  C CD  . LYS C  1 222 ? 113.702 116.767  -8.112  1.00 48.31  ?  230 LYS C CD  1 
ATOM 8291  C CE  . LYS C  1 222 ? 113.836 116.893  -9.619  1.00 55.42  ?  230 LYS C CE  1 
ATOM 8292  N NZ  . LYS C  1 222 ? 113.189 118.133  -10.131 1.00 60.48  1  230 LYS C NZ  1 
ATOM 8293  N N   . TYR C  1 223 ? 115.668 114.879  -3.247  1.00 42.14  ?  231 TYR C N   1 
ATOM 8294  C CA  . TYR C  1 223 ? 115.550 115.105  -1.823  1.00 41.93  ?  231 TYR C CA  1 
ATOM 8295  C C   . TYR C  1 223 ? 115.492 116.603  -1.562  1.00 42.28  ?  231 TYR C C   1 
ATOM 8296  O O   . TYR C  1 223 ? 116.276 117.360  -2.155  1.00 42.74  ?  231 TYR C O   1 
ATOM 8297  C CB  . TYR C  1 223 ? 116.731 114.479  -1.063  1.00 43.89  ?  231 TYR C CB  1 
ATOM 8298  C CG  . TYR C  1 223 ? 116.583 114.502  0.444   1.00 48.66  ?  231 TYR C CG  1 
ATOM 8299  C CD1 . TYR C  1 223 ? 115.591 113.763  1.076   1.00 48.40  ?  231 TYR C CD1 1 
ATOM 8300  C CD2 . TYR C  1 223 ? 117.447 115.248  1.234   1.00 54.52  ?  231 TYR C CD2 1 
ATOM 8301  C CE1 . TYR C  1 223 ? 115.455 113.779  2.453   1.00 50.12  ?  231 TYR C CE1 1 
ATOM 8302  C CE2 . TYR C  1 223 ? 117.321 115.269  2.611   1.00 56.92  ?  231 TYR C CE2 1 
ATOM 8303  C CZ  . TYR C  1 223 ? 116.323 114.533  3.216   1.00 56.89  ?  231 TYR C CZ  1 
ATOM 8304  O OH  . TYR C  1 223 ? 116.192 114.549  4.586   1.00 63.55  ?  231 TYR C OH  1 
ATOM 8305  N N   . PRO C  1 224 ? 114.582 117.072  -0.711  1.00 45.79  ?  232 PRO C N   1 
ATOM 8306  C CA  . PRO C  1 224 ? 114.458 118.517  -0.480  1.00 47.53  ?  232 PRO C CA  1 
ATOM 8307  C C   . PRO C  1 224 ? 115.739 119.098  0.098   1.00 53.87  ?  232 PRO C C   1 
ATOM 8308  O O   . PRO C  1 224 ? 116.315 118.562  1.048   1.00 58.39  ?  232 PRO C O   1 
ATOM 8309  C CB  . PRO C  1 224 ? 113.290 118.618  0.508   1.00 42.48  ?  232 PRO C CB  1 
ATOM 8310  C CG  . PRO C  1 224 ? 112.534 117.336  0.339   1.00 42.01  ?  232 PRO C CG  1 
ATOM 8311  C CD  . PRO C  1 224 ? 113.568 116.305  0.031   1.00 41.97  ?  232 PRO C CD  1 
ATOM 8312  N N   . ASP C  1 225 ? 116.187 120.208  -0.489  1.00 50.41  ?  233 ASP C N   1 
ATOM 8313  C CA  . ASP C  1 225 ? 117.411 120.872  -0.046  1.00 52.11  ?  233 ASP C CA  1 
ATOM 8314  C C   . ASP C  1 225 ? 117.054 121.805  1.107   1.00 51.42  ?  233 ASP C C   1 
ATOM 8315  O O   . ASP C  1 225 ? 116.949 123.026  0.961   1.00 49.20  ?  233 ASP C O   1 
ATOM 8316  C CB  . ASP C  1 225 ? 118.066 121.617  -1.201  1.00 50.33  ?  233 ASP C CB  1 
ATOM 8317  C CG  . ASP C  1 225 ? 119.538 121.880  -0.960  1.00 58.76  ?  233 ASP C CG  1 
ATOM 8318  O OD1 . ASP C  1 225 ? 120.000 121.685  0.185   1.00 57.08  ?  233 ASP C OD1 1 
ATOM 8319  O OD2 . ASP C  1 225 ? 120.234 122.283  -1.916  1.00 68.14  -1 233 ASP C OD2 1 
ATOM 8320  N N   . TYR C  1 226 ? 116.851 121.198  2.281   1.00 53.97  ?  234 TYR C N   1 
ATOM 8321  C CA  . TYR C  1 226 ? 116.541 121.972  3.481   1.00 57.46  ?  234 TYR C CA  1 
ATOM 8322  C C   . TYR C  1 226 ? 117.654 122.961  3.804   1.00 60.43  ?  234 TYR C C   1 
ATOM 8323  O O   . TYR C  1 226 ? 117.392 124.072  4.282   1.00 63.54  ?  234 TYR C O   1 
ATOM 8324  C CB  . TYR C  1 226 ? 116.314 121.035  4.669   1.00 57.32  ?  234 TYR C CB  1 
ATOM 8325  C CG  . TYR C  1 226 ? 115.319 119.922  4.427   1.00 56.16  ?  234 TYR C CG  1 
ATOM 8326  C CD1 . TYR C  1 226 ? 113.971 120.196  4.242   1.00 58.63  ?  234 TYR C CD1 1 
ATOM 8327  C CD2 . TYR C  1 226 ? 115.727 118.594  4.403   1.00 57.43  ?  234 TYR C CD2 1 
ATOM 8328  C CE1 . TYR C  1 226 ? 113.056 119.177  4.030   1.00 59.75  ?  234 TYR C CE1 1 
ATOM 8329  C CE2 . TYR C  1 226 ? 114.821 117.569  4.191   1.00 57.22  ?  234 TYR C CE2 1 
ATOM 8330  C CZ  . TYR C  1 226 ? 113.487 117.866  4.006   1.00 56.75  ?  234 TYR C CZ  1 
ATOM 8331  O OH  . TYR C  1 226 ? 112.578 116.852  3.796   1.00 50.86  ?  234 TYR C OH  1 
ATOM 8332  N N   . LEU C  1 227 ? 118.904 122.573  3.542   1.00 49.04  ?  235 LEU C N   1 
ATOM 8333  C CA  . LEU C  1 227 ? 120.034 123.448  3.831   1.00 49.52  ?  235 LEU C CA  1 
ATOM 8334  C C   . LEU C  1 227 ? 119.976 124.717  2.992   1.00 49.97  ?  235 LEU C C   1 
ATOM 8335  O O   . LEU C  1 227 ? 120.246 125.816  3.493   1.00 50.30  ?  235 LEU C O   1 
ATOM 8336  C CB  . LEU C  1 227 ? 121.344 122.696  3.589   1.00 52.89  ?  235 LEU C CB  1 
ATOM 8337  C CG  . LEU C  1 227 ? 121.982 121.939  4.760   1.00 52.91  ?  235 LEU C CG  1 
ATOM 8338  C CD1 . LEU C  1 227 ? 120.964 121.099  5.514   1.00 56.94  ?  235 LEU C CD1 1 
ATOM 8339  C CD2 . LEU C  1 227 ? 123.122 121.064  4.266   1.00 52.32  ?  235 LEU C CD2 1 
ATOM 8340  N N   . GLN C  1 228 ? 119.617 124.587  1.713   1.00 53.66  ?  236 GLN C N   1 
ATOM 8341  C CA  . GLN C  1 228 ? 119.559 125.744  0.826   1.00 57.00  ?  236 GLN C CA  1 
ATOM 8342  C C   . GLN C  1 228 ? 118.303 126.574  1.066   1.00 55.17  ?  236 GLN C C   1 
ATOM 8343  O O   . GLN C  1 228 ? 118.368 127.808  1.089   1.00 56.78  ?  236 GLN C O   1 
ATOM 8344  C CB  . GLN C  1 228 ? 119.641 125.285  -0.632  1.00 53.50  ?  236 GLN C CB  1 
ATOM 8345  C CG  . GLN C  1 228 ? 119.780 126.408  -1.649  1.00 58.62  ?  236 GLN C CG  1 
ATOM 8346  C CD  . GLN C  1 228 ? 118.455 126.801  -2.274  1.00 64.00  ?  236 GLN C CD  1 
ATOM 8347  O OE1 . GLN C  1 228 ? 117.389 126.404  -1.802  1.00 67.45  ?  236 GLN C OE1 1 
ATOM 8348  N NE2 . GLN C  1 228 ? 118.516 127.582  -3.346  1.00 64.99  ?  236 GLN C NE2 1 
ATOM 8349  N N   . MET C  1 229 ? 117.153 125.919  1.248   1.00 55.60  ?  237 MET C N   1 
ATOM 8350  C CA  . MET C  1 229 ? 115.912 126.658  1.458   1.00 55.50  ?  237 MET C CA  1 
ATOM 8351  C C   . MET C  1 229 ? 115.899 127.379  2.800   1.00 55.12  ?  237 MET C C   1 
ATOM 8352  O O   . MET C  1 229 ? 115.251 128.425  2.931   1.00 55.62  ?  237 MET C O   1 
ATOM 8353  C CB  . MET C  1 229 ? 114.711 125.724  1.343   1.00 57.57  ?  237 MET C CB  1 
ATOM 8354  C CG  . MET C  1 229 ? 114.460 125.212  -0.058  1.00 58.27  ?  237 MET C CG  1 
ATOM 8355  S SD  . MET C  1 229 ? 112.941 124.252  -0.128  1.00 58.68  ?  237 MET C SD  1 
ATOM 8356  C CE  . MET C  1 229 ? 113.302 122.976  1.076   1.00 54.57  ?  237 MET C CE  1 
ATOM 8357  N N   . SER C  1 230 ? 116.587 126.840  3.809   1.00 52.95  ?  238 SER C N   1 
ATOM 8358  C CA  . SER C  1 230 ? 116.658 127.535  5.089   1.00 54.60  ?  238 SER C CA  1 
ATOM 8359  C C   . SER C  1 230 ? 117.624 128.711  5.030   1.00 58.97  ?  238 SER C C   1 
ATOM 8360  O O   . SER C  1 230 ? 117.445 129.695  5.757   1.00 56.16  ?  238 SER C O   1 
ATOM 8361  C CB  . SER C  1 230 ? 117.070 126.570  6.200   1.00 56.98  ?  238 SER C CB  1 
ATOM 8362  O OG  . SER C  1 230 ? 118.478 126.549  6.357   1.00 59.02  ?  238 SER C OG  1 
ATOM 8363  N N   . ALA C  1 231 ? 118.648 128.622  4.181   1.00 56.93  ?  239 ALA C N   1 
ATOM 8364  C CA  . ALA C  1 231 ? 119.576 129.720  3.946   1.00 58.71  ?  239 ALA C CA  1 
ATOM 8365  C C   . ALA C  1 231 ? 119.066 130.719  2.915   1.00 57.32  ?  239 ALA C C   1 
ATOM 8366  O O   . ALA C  1 231 ? 119.807 131.636  2.547   1.00 60.09  ?  239 ALA C O   1 
ATOM 8367  C CB  . ALA C  1 231 ? 120.936 129.172  3.506   1.00 57.95  ?  239 ALA C CB  1 
ATOM 8368  N N   . ASP C  1 232 ? 117.835 130.554  2.435   1.00 54.50  ?  240 ASP C N   1 
ATOM 8369  C CA  . ASP C  1 232 ? 117.259 131.486  1.476   1.00 55.24  ?  240 ASP C CA  1 
ATOM 8370  C C   . ASP C  1 232 ? 117.216 132.894  2.059   1.00 56.33  ?  240 ASP C C   1 
ATOM 8371  O O   . ASP C  1 232 ? 117.062 133.087  3.267   1.00 57.60  ?  240 ASP C O   1 
ATOM 8372  C CB  . ASP C  1 232 ? 115.850 131.035  1.082   1.00 56.14  ?  240 ASP C CB  1 
ATOM 8373  C CG  . ASP C  1 232 ? 115.332 131.729  -0.167  1.00 60.73  ?  240 ASP C CG  1 
ATOM 8374  O OD1 . ASP C  1 232 ? 115.764 132.864  -0.454  1.00 67.94  ?  240 ASP C OD1 1 
ATOM 8375  O OD2 . ASP C  1 232 ? 114.486 131.132  -0.866  1.00 58.97  -1 240 ASP C OD2 1 
ATOM 8376  N N   . ALA C  1 233 ? 117.367 133.886  1.181   1.00 60.34  ?  241 ALA C N   1 
ATOM 8377  C CA  . ALA C  1 233 ? 117.349 135.276  1.624   1.00 64.72  ?  241 ALA C CA  1 
ATOM 8378  C C   . ALA C  1 233 ? 115.971 135.666  2.143   1.00 63.03  ?  241 ALA C C   1 
ATOM 8379  O O   . ALA C  1 233 ? 115.825 136.102  3.291   1.00 65.30  ?  241 ALA C O   1 
ATOM 8380  C CB  . ALA C  1 233 ? 117.777 136.196  0.479   1.00 67.35  ?  241 ALA C CB  1 
ATOM 8381  N N   . TYR C  1 234 ? 114.943 135.513  1.309   1.00 63.01  ?  242 TYR C N   1 
ATOM 8382  C CA  . TYR C  1 234 ? 113.594 135.908  1.691   1.00 65.12  ?  242 TYR C CA  1 
ATOM 8383  C C   . TYR C  1 234 ? 112.826 134.807  2.407   1.00 63.41  ?  242 TYR C C   1 
ATOM 8384  O O   . TYR C  1 234 ? 111.945 135.107  3.220   1.00 62.86  ?  242 TYR C O   1 
ATOM 8385  C CB  . TYR C  1 234 ? 112.804 136.355  0.457   1.00 66.49  ?  242 TYR C CB  1 
ATOM 8386  C CG  . TYR C  1 234 ? 113.307 137.642  -0.154  1.00 68.41  ?  242 TYR C CG  1 
ATOM 8387  C CD1 . TYR C  1 234 ? 112.916 138.871  0.359   1.00 69.05  ?  242 TYR C CD1 1 
ATOM 8388  C CD2 . TYR C  1 234 ? 114.168 137.631  -1.243  1.00 68.90  ?  242 TYR C CD2 1 
ATOM 8389  C CE1 . TYR C  1 234 ? 113.372 140.052  -0.186  1.00 71.03  ?  242 TYR C CE1 1 
ATOM 8390  C CE2 . TYR C  1 234 ? 114.627 138.809  -1.799  1.00 73.80  ?  242 TYR C CE2 1 
ATOM 8391  C CZ  . TYR C  1 234 ? 114.224 140.017  -1.266  1.00 76.95  ?  242 TYR C CZ  1 
ATOM 8392  O OH  . TYR C  1 234 ? 114.674 141.197  -1.812  1.00 88.78  ?  242 TYR C OH  1 
ATOM 8393  N N   . GLY C  1 235 ? 113.136 133.544  2.129   1.00 62.72  ?  243 GLY C N   1 
ATOM 8394  C CA  . GLY C  1 235 ? 112.408 132.452  2.742   1.00 60.51  ?  243 GLY C CA  1 
ATOM 8395  C C   . GLY C  1 235 ? 111.067 132.173  2.105   1.00 59.80  ?  243 GLY C C   1 
ATOM 8396  O O   . GLY C  1 235 ? 110.166 131.652  2.771   1.00 58.82  ?  243 GLY C O   1 
ATOM 8397  N N   . ASP C  1 236 ? 110.908 132.507  0.823   1.00 58.63  ?  244 ASP C N   1 
ATOM 8398  C CA  . ASP C  1 236 ? 109.650 132.259  0.130   1.00 64.84  ?  244 ASP C CA  1 
ATOM 8399  C C   . ASP C  1 236 ? 109.490 130.793  -0.248  1.00 65.74  ?  244 ASP C C   1 
ATOM 8400  O O   . ASP C  1 236 ? 108.360 130.295  -0.322  1.00 66.25  ?  244 ASP C O   1 
ATOM 8401  C CB  . ASP C  1 236 ? 109.561 133.132  -1.124  1.00 65.81  ?  244 ASP C CB  1 
ATOM 8402  C CG  . ASP C  1 236 ? 109.554 134.617  -0.805  1.00 71.71  ?  244 ASP C CG  1 
ATOM 8403  O OD1 . ASP C  1 236 ? 109.163 134.987  0.322   1.00 73.13  ?  244 ASP C OD1 1 
ATOM 8404  O OD2 . ASP C  1 236 ? 109.938 135.417  -1.685  1.00 76.04  -1 244 ASP C OD2 1 
ATOM 8405  N N   . SER C  1 237 ? 110.602 130.094  -0.493  1.00 68.67  ?  245 SER C N   1 
ATOM 8406  C CA  . SER C  1 237 ? 110.531 128.710  -0.953  1.00 64.21  ?  245 SER C CA  1 
ATOM 8407  C C   . SER C  1 237 ? 109.930 127.801  0.110   1.00 61.77  ?  245 SER C C   1 
ATOM 8408  O O   . SER C  1 237 ? 109.200 126.856  -0.213  1.00 63.05  ?  245 SER C O   1 
ATOM 8409  C CB  . SER C  1 237 ? 111.922 128.219  -1.349  1.00 64.75  ?  245 SER C CB  1 
ATOM 8410  O OG  . SER C  1 237 ? 112.479 129.025  -2.372  1.00 72.48  ?  245 SER C OG  1 
ATOM 8411  N N   . MET C  1 238 ? 110.226 128.066  1.380   1.00 61.77  ?  246 MET C N   1 
ATOM 8412  C CA  . MET C  1 238 ? 109.803 127.185  2.464   1.00 54.63  ?  246 MET C CA  1 
ATOM 8413  C C   . MET C  1 238 ? 109.711 127.999  3.744   1.00 54.77  ?  246 MET C C   1 
ATOM 8414  O O   . MET C  1 238 ? 110.737 128.435  4.276   1.00 62.07  ?  246 MET C O   1 
ATOM 8415  C CB  . MET C  1 238 ? 110.779 126.024  2.637   1.00 54.54  ?  246 MET C CB  1 
ATOM 8416  C CG  . MET C  1 238 ? 110.604 125.267  3.943   1.00 55.12  ?  246 MET C CG  1 
ATOM 8417  S SD  . MET C  1 238 ? 112.053 124.292  4.387   1.00 59.31  ?  246 MET C SD  1 
ATOM 8418  C CE  . MET C  1 238 ? 113.252 125.588  4.682   1.00 63.95  ?  246 MET C CE  1 
ATOM 8419  N N   . PHE C  1 239 ? 108.493 128.209  4.237   1.00 54.46  ?  247 PHE C N   1 
ATOM 8420  C CA  . PHE C  1 239 ? 108.305 128.764  5.570   1.00 55.82  ?  247 PHE C CA  1 
ATOM 8421  C C   . PHE C  1 239 ? 107.605 127.785  6.504   1.00 53.67  ?  247 PHE C C   1 
ATOM 8422  O O   . PHE C  1 239 ? 107.205 128.176  7.607   1.00 60.65  ?  247 PHE C O   1 
ATOM 8423  C CB  . PHE C  1 239 ? 107.541 130.094  5.515   1.00 53.79  ?  247 PHE C CB  1 
ATOM 8424  C CG  . PHE C  1 239 ? 106.316 130.077  4.639   1.00 49.40  ?  247 PHE C CG  1 
ATOM 8425  C CD1 . PHE C  1 239 ? 105.229 129.279  4.948   1.00 47.45  ?  247 PHE C CD1 1 
ATOM 8426  C CD2 . PHE C  1 239 ? 106.238 130.901  3.529   1.00 52.12  ?  247 PHE C CD2 1 
ATOM 8427  C CE1 . PHE C  1 239 ? 104.102 129.279  4.150   1.00 50.78  ?  247 PHE C CE1 1 
ATOM 8428  C CE2 . PHE C  1 239 ? 105.113 130.907  2.729   1.00 52.85  ?  247 PHE C CE2 1 
ATOM 8429  C CZ  . PHE C  1 239 ? 104.044 130.097  3.040   1.00 50.84  ?  247 PHE C CZ  1 
ATOM 8430  N N   . PHE C  1 240 ? 107.464 126.523  6.101   1.00 52.41  ?  248 PHE C N   1 
ATOM 8431  C CA  . PHE C  1 240 ? 106.921 125.495  6.981   1.00 51.52  ?  248 PHE C CA  1 
ATOM 8432  C C   . PHE C  1 240 ? 107.350 124.131  6.467   1.00 51.04  ?  248 PHE C C   1 
ATOM 8433  O O   . PHE C  1 240 ? 107.152 123.821  5.285   1.00 51.00  ?  248 PHE C O   1 
ATOM 8434  C CB  . PHE C  1 240 ? 105.395 125.575  7.065   1.00 54.56  ?  248 PHE C CB  1 
ATOM 8435  C CG  . PHE C  1 240 ? 104.806 124.692  8.124   1.00 58.66  ?  248 PHE C CG  1 
ATOM 8436  C CD1 . PHE C  1 240 ? 104.779 125.102  9.448   1.00 67.31  ?  248 PHE C CD1 1 
ATOM 8437  C CD2 . PHE C  1 240 ? 104.292 123.448  7.801   1.00 60.14  ?  248 PHE C CD2 1 
ATOM 8438  C CE1 . PHE C  1 240 ? 104.241 124.290  10.430  1.00 73.69  ?  248 PHE C CE1 1 
ATOM 8439  C CE2 . PHE C  1 240 ? 103.752 122.631  8.776   1.00 66.90  ?  248 PHE C CE2 1 
ATOM 8440  C CZ  . PHE C  1 240 ? 103.726 123.053  10.094  1.00 73.18  ?  248 PHE C CZ  1 
ATOM 8441  N N   . CYS C  1 241 ? 107.916 123.318  7.361   1.00 52.31  ?  249 CYS C N   1 
ATOM 8442  C CA  . CYS C  1 241 ? 108.552 122.061  6.988   1.00 52.38  ?  249 CYS C CA  1 
ATOM 8443  C C   . CYS C  1 241 ? 108.360 121.026  8.087   1.00 52.09  ?  249 CYS C C   1 
ATOM 8444  O O   . CYS C  1 241 ? 108.696 121.281  9.247   1.00 59.53  ?  249 CYS C O   1 
ATOM 8445  C CB  . CYS C  1 241 ? 110.047 122.271  6.726   1.00 58.45  ?  249 CYS C CB  1 
ATOM 8446  S SG  . CYS C  1 241 ? 110.992 120.745  6.550   1.00 60.88  ?  249 CYS C SG  1 
ATOM 8447  N N   . LEU C  1 242 ? 107.823 119.864  7.715   1.00 50.40  ?  250 LEU C N   1 
ATOM 8448  C CA  . LEU C  1 242 ? 107.680 118.720  8.612   1.00 51.50  ?  250 LEU C CA  1 
ATOM 8449  C C   . LEU C  1 242 ? 108.219 117.491  7.895   1.00 50.90  ?  250 LEU C C   1 
ATOM 8450  O O   . LEU C  1 242 ? 107.637 117.044  6.902   1.00 52.65  ?  250 LEU C O   1 
ATOM 8451  C CB  . LEU C  1 242 ? 106.223 118.497  9.019   1.00 56.07  ?  250 LEU C CB  1 
ATOM 8452  C CG  . LEU C  1 242 ? 105.462 119.613  9.727   1.00 53.27  ?  250 LEU C CG  1 
ATOM 8453  C CD1 . LEU C  1 242 ? 104.002 119.225  9.859   1.00 50.03  ?  250 LEU C CD1 1 
ATOM 8454  C CD2 . LEU C  1 242 ? 106.071 119.878  11.092  1.00 51.85  ?  250 LEU C CD2 1 
ATOM 8455  N N   . ARG C  1 243 ? 109.314 116.938  8.402   1.00 44.66  ?  251 ARG C N   1 
ATOM 8456  C CA  . ARG C  1 243 ? 109.916 115.740  7.842   1.00 44.07  ?  251 ARG C CA  1 
ATOM 8457  C C   . ARG C  1 243 ? 110.017 114.637  8.886   1.00 43.71  ?  251 ARG C C   1 
ATOM 8458  O O   . ARG C  1 243 ? 110.176 114.894  10.083  1.00 45.13  ?  251 ARG C O   1 
ATOM 8459  C CB  . ARG C  1 243 ? 111.279 116.064  7.222   1.00 49.19  ?  251 ARG C CB  1 
ATOM 8460  C CG  . ARG C  1 243 ? 112.334 116.536  8.193   1.00 55.81  ?  251 ARG C CG  1 
ATOM 8461  C CD  . ARG C  1 243 ? 113.638 116.757  7.456   1.00 64.98  ?  251 ARG C CD  1 
ATOM 8462  N NE  . ARG C  1 243 ? 114.643 117.371  8.311   1.00 69.95  ?  251 ARG C NE  1 
ATOM 8463  C CZ  . ARG C  1 243 ? 114.740 118.689  8.454   1.00 71.26  ?  251 ARG C CZ  1 
ATOM 8464  N NH1 . ARG C  1 243 ? 113.894 119.477  7.802   1.00 71.38  1  251 ARG C NH1 1 
ATOM 8465  N NH2 . ARG C  1 243 ? 115.665 119.224  9.239   1.00 72.03  ?  251 ARG C NH2 1 
ATOM 8466  N N   . ARG C  1 244 ? 109.916 113.400  8.401   1.00 39.16  ?  252 ARG C N   1 
ATOM 8467  C CA  . ARG C  1 244 ? 109.945 112.199  9.223   1.00 38.90  ?  252 ARG C CA  1 
ATOM 8468  C C   . ARG C  1 244 ? 110.167 110.982  8.333   1.00 38.65  ?  252 ARG C C   1 
ATOM 8469  O O   . ARG C  1 244 ? 109.251 110.541  7.630   1.00 38.41  ?  252 ARG C O   1 
ATOM 8470  C CB  . ARG C  1 244 ? 108.652 112.069  10.032  1.00 41.23  ?  252 ARG C CB  1 
ATOM 8471  C CG  . ARG C  1 244 ? 108.753 111.144  11.235  1.00 41.24  ?  252 ARG C CG  1 
ATOM 8472  C CD  . ARG C  1 244 ? 108.460 109.708  10.830  1.00 47.57  ?  252 ARG C CD  1 
ATOM 8473  N NE  . ARG C  1 244 ? 108.772 108.746  11.880  1.00 52.81  ?  252 ARG C NE  1 
ATOM 8474  C CZ  . ARG C  1 244 ? 108.684 107.429  11.727  1.00 54.54  ?  252 ARG C CZ  1 
ATOM 8475  N NH1 . ARG C  1 244 ? 108.289 106.921  10.567  1.00 54.45  1  252 ARG C NH1 1 
ATOM 8476  N NH2 . ARG C  1 244 ? 108.989 106.619  12.732  1.00 54.17  ?  252 ARG C NH2 1 
ATOM 8477  N N   . GLU C  1 245 ? 111.385 110.448  8.343   1.00 41.66  ?  253 GLU C N   1 
ATOM 8478  C CA  . GLU C  1 245 ? 111.778 109.353  7.470   1.00 41.49  ?  253 GLU C CA  1 
ATOM 8479  C C   . GLU C  1 245 ? 112.429 108.250  8.292   1.00 41.38  ?  253 GLU C C   1 
ATOM 8480  O O   . GLU C  1 245 ? 113.035 108.508  9.335   1.00 41.57  ?  253 GLU C O   1 
ATOM 8481  C CB  . GLU C  1 245 ? 112.746 109.843  6.379   1.00 44.93  ?  253 GLU C CB  1 
ATOM 8482  C CG  . GLU C  1 245 ? 113.749 110.878  6.881   1.00 57.42  ?  253 GLU C CG  1 
ATOM 8483  C CD  . GLU C  1 245 ? 114.541 111.540  5.765   1.00 63.79  ?  253 GLU C CD  1 
ATOM 8484  O OE1 . GLU C  1 245 ? 115.038 110.824  4.872   1.00 62.09  ?  253 GLU C OE1 1 
ATOM 8485  O OE2 . GLU C  1 245 ? 114.666 112.785  5.780   1.00 68.40  -1 253 GLU C OE2 1 
ATOM 8486  N N   . GLN C  1 246 ? 112.288 107.011  7.819   1.00 46.78  ?  254 GLN C N   1 
ATOM 8487  C CA  . GLN C  1 246 ? 112.925 105.879  8.476   1.00 44.45  ?  254 GLN C CA  1 
ATOM 8488  C C   . GLN C  1 246 ? 113.197 104.784  7.454   1.00 40.52  ?  254 GLN C C   1 
ATOM 8489  O O   . GLN C  1 246 ? 112.450 104.614  6.483   1.00 38.78  ?  254 GLN C O   1 
ATOM 8490  C CB  . GLN C  1 246 ? 112.078 105.339  9.637   1.00 44.17  ?  254 GLN C CB  1 
ATOM 8491  C CG  . GLN C  1 246 ? 110.869 104.518  9.221   1.00 44.60  ?  254 GLN C CG  1 
ATOM 8492  C CD  . GLN C  1 246 ? 110.135 103.927  10.410  1.00 46.75  ?  254 GLN C CD  1 
ATOM 8493  O OE1 . GLN C  1 246 ? 110.293 104.384  11.542  1.00 47.19  ?  254 GLN C OE1 1 
ATOM 8494  N NE2 . GLN C  1 246 ? 109.330 102.902  10.158  1.00 48.18  ?  254 GLN C NE2 1 
ATOM 8495  N N   . VAL C  1 247 ? 114.283 104.044  7.690   1.00 41.42  ?  255 VAL C N   1 
ATOM 8496  C CA  . VAL C  1 247 ? 114.763 103.016  6.773   1.00 41.73  ?  255 VAL C CA  1 
ATOM 8497  C C   . VAL C  1 247 ? 115.801 102.153  7.482   1.00 43.38  ?  255 VAL C C   1 
ATOM 8498  O O   . VAL C  1 247 ? 116.481 102.615  8.406   1.00 44.83  ?  255 VAL C O   1 
ATOM 8499  C CB  . VAL C  1 247 ? 115.346 103.646  5.492   1.00 40.11  ?  255 VAL C CB  1 
ATOM 8500  C CG1 . VAL C  1 247 ? 116.573 104.484  5.818   1.00 40.53  ?  255 VAL C CG1 1 
ATOM 8501  C CG2 . VAL C  1 247 ? 115.672 102.578  4.452   1.00 40.01  ?  255 VAL C CG2 1 
ATOM 8502  N N   . PHE C  1 248 ? 115.919 100.893  7.066   1.00 43.63  ?  256 PHE C N   1 
ATOM 8503  C CA  . PHE C  1 248 ? 116.990 100.020  7.524   1.00 44.00  ?  256 PHE C CA  1 
ATOM 8504  C C   . PHE C  1 248 ? 117.337 99.058   6.397   1.00 43.67  ?  256 PHE C C   1 
ATOM 8505  O O   . PHE C  1 248 ? 116.584 98.906   5.429   1.00 43.09  ?  256 PHE C O   1 
ATOM 8506  C CB  . PHE C  1 248 ? 116.607 99.255   8.799   1.00 49.13  ?  256 PHE C CB  1 
ATOM 8507  C CG  . PHE C  1 248 ? 115.698 98.077   8.564   1.00 49.84  ?  256 PHE C CG  1 
ATOM 8508  C CD1 . PHE C  1 248 ? 114.331 98.250   8.432   1.00 49.48  ?  256 PHE C CD1 1 
ATOM 8509  C CD2 . PHE C  1 248 ? 116.212 96.789   8.507   1.00 48.01  ?  256 PHE C CD2 1 
ATOM 8510  C CE1 . PHE C  1 248 ? 113.498 97.163   8.227   1.00 45.94  ?  256 PHE C CE1 1 
ATOM 8511  C CE2 . PHE C  1 248 ? 115.384 95.701   8.302   1.00 43.37  ?  256 PHE C CE2 1 
ATOM 8512  C CZ  . PHE C  1 248 ? 114.026 95.888   8.161   1.00 42.00  ?  256 PHE C CZ  1 
ATOM 8513  N N   . ALA C  1 249 ? 118.495 98.413   6.533   1.00 43.62  ?  257 ALA C N   1 
ATOM 8514  C CA  . ALA C  1 249 ? 119.005 97.502   5.514   1.00 43.68  ?  257 ALA C CA  1 
ATOM 8515  C C   . ALA C  1 249 ? 118.456 96.102   5.761   1.00 42.87  ?  257 ALA C C   1 
ATOM 8516  O O   . ALA C  1 249 ? 118.767 95.476   6.782   1.00 43.10  ?  257 ALA C O   1 
ATOM 8517  C CB  . ALA C  1 249 ? 120.533 97.489   5.519   1.00 44.36  ?  257 ALA C CB  1 
ATOM 8518  N N   . ARG C  1 250 ? 117.646 95.610   4.824   1.00 42.63  ?  258 ARG C N   1 
ATOM 8519  C CA  . ARG C  1 250 ? 116.977 94.327   4.997   1.00 43.03  ?  258 ARG C CA  1 
ATOM 8520  C C   . ARG C  1 250 ? 117.813 93.161   4.480   1.00 47.27  ?  258 ARG C C   1 
ATOM 8521  O O   . ARG C  1 250 ? 117.986 92.163   5.185   1.00 53.11  ?  258 ARG C O   1 
ATOM 8522  C CB  . ARG C  1 250 ? 115.610 94.354   4.309   1.00 45.82  ?  258 ARG C CB  1 
ATOM 8523  C CG  . ARG C  1 250 ? 114.677 93.248   4.764   1.00 45.24  ?  258 ARG C CG  1 
ATOM 8524  C CD  . ARG C  1 250 ? 113.243 93.546   4.373   1.00 44.65  ?  258 ARG C CD  1 
ATOM 8525  N NE  . ARG C  1 250 ? 112.347 92.443   4.705   1.00 44.16  ?  258 ARG C NE  1 
ATOM 8526  C CZ  . ARG C  1 250 ? 111.029 92.563   4.816   1.00 43.74  ?  258 ARG C CZ  1 
ATOM 8527  N NH1 . ARG C  1 250 ? 110.451 93.740   4.624   1.00 43.75  1  258 ARG C NH1 1 
ATOM 8528  N NH2 . ARG C  1 250 ? 110.288 91.507   5.121   1.00 43.42  ?  258 ARG C NH2 1 
ATOM 8529  N N   . HIS C  1 251 ? 118.332 93.262   3.257   1.00 47.08  ?  259 HIS C N   1 
ATOM 8530  C CA  . HIS C  1 251 ? 119.147 92.206   2.673   1.00 48.25  ?  259 HIS C CA  1 
ATOM 8531  C C   . HIS C  1 251 ? 120.386 92.799   2.018   1.00 49.68  ?  259 HIS C C   1 
ATOM 8532  O O   . HIS C  1 251 ? 120.348 93.895   1.452   1.00 49.46  ?  259 HIS C O   1 
ATOM 8533  C CB  . HIS C  1 251 ? 118.354 91.390   1.645   1.00 50.75  ?  259 HIS C CB  1 
ATOM 8534  C CG  . HIS C  1 251 ? 117.247 90.581   2.244   1.00 48.59  ?  259 HIS C CG  1 
ATOM 8535  N ND1 . HIS C  1 251 ? 117.469 89.391   2.904   1.00 46.92  ?  259 HIS C ND1 1 
ATOM 8536  C CD2 . HIS C  1 251 ? 115.911 90.793   2.290   1.00 46.32  ?  259 HIS C CD2 1 
ATOM 8537  C CE1 . HIS C  1 251 ? 116.316 88.904   3.326   1.00 46.32  ?  259 HIS C CE1 1 
ATOM 8538  N NE2 . HIS C  1 251 ? 115.354 89.735   2.967   1.00 45.94  ?  259 HIS C NE2 1 
ATOM 8539  N N   . PHE C  1 252 ? 121.485 92.055   2.098   1.00 45.88  ?  260 PHE C N   1 
ATOM 8540  C CA  . PHE C  1 252 ? 122.778 92.481   1.580   1.00 47.48  ?  260 PHE C CA  1 
ATOM 8541  C C   . PHE C  1 252 ? 123.078 91.684   0.318   1.00 50.09  ?  260 PHE C C   1 
ATOM 8542  O O   . PHE C  1 252 ? 122.965 90.454   0.323   1.00 51.12  ?  260 PHE C O   1 
ATOM 8543  C CB  . PHE C  1 252 ? 123.883 92.260   2.616   1.00 46.85  ?  260 PHE C CB  1 
ATOM 8544  C CG  . PHE C  1 252 ? 123.590 92.851   3.975   1.00 46.80  ?  260 PHE C CG  1 
ATOM 8545  C CD1 . PHE C  1 252 ? 122.632 93.837   4.143   1.00 46.34  ?  260 PHE C CD1 1 
ATOM 8546  C CD2 . PHE C  1 252 ? 124.281 92.407   5.090   1.00 47.34  ?  260 PHE C CD2 1 
ATOM 8547  C CE1 . PHE C  1 252 ? 122.369 94.362   5.390   1.00 46.41  ?  260 PHE C CE1 1 
ATOM 8548  C CE2 . PHE C  1 252 ? 124.022 92.930   6.339   1.00 47.44  ?  260 PHE C CE2 1 
ATOM 8549  C CZ  . PHE C  1 252 ? 123.066 93.909   6.488   1.00 46.98  ?  260 PHE C CZ  1 
ATOM 8550  N N   . TRP C  1 253 ? 123.480 92.374   -0.751  1.00 48.44  ?  261 TRP C N   1 
ATOM 8551  C CA  . TRP C  1 253 ? 123.619 91.733   -2.052  1.00 47.02  ?  261 TRP C CA  1 
ATOM 8552  C C   . TRP C  1 253 ? 124.913 92.150   -2.736  1.00 50.02  ?  261 TRP C C   1 
ATOM 8553  O O   . TRP C  1 253 ? 125.635 93.042   -2.282  1.00 59.04  ?  261 TRP C O   1 
ATOM 8554  C CB  . TRP C  1 253 ? 122.425 92.047   -2.956  1.00 53.69  ?  261 TRP C CB  1 
ATOM 8555  C CG  . TRP C  1 253 ? 121.195 91.329   -2.540  1.00 52.69  ?  261 TRP C CG  1 
ATOM 8556  C CD1 . TRP C  1 253 ? 121.125 90.094   -1.970  1.00 53.27  ?  261 TRP C CD1 1 
ATOM 8557  C CD2 . TRP C  1 253 ? 119.851 91.802   -2.642  1.00 50.43  ?  261 TRP C CD2 1 
ATOM 8558  N NE1 . TRP C  1 253 ? 119.819 89.766   -1.713  1.00 51.38  ?  261 TRP C NE1 1 
ATOM 8559  C CE2 . TRP C  1 253 ? 119.016 90.798   -2.118  1.00 49.52  ?  261 TRP C CE2 1 
ATOM 8560  C CE3 . TRP C  1 253 ? 119.272 92.976   -3.129  1.00 50.68  ?  261 TRP C CE3 1 
ATOM 8561  C CZ2 . TRP C  1 253 ? 117.633 90.931   -2.067  1.00 54.26  ?  261 TRP C CZ2 1 
ATOM 8562  C CZ3 . TRP C  1 253 ? 117.900 93.107   -3.077  1.00 54.47  ?  261 TRP C CZ3 1 
ATOM 8563  C CH2 . TRP C  1 253 ? 117.095 92.090   -2.549  1.00 57.56  ?  261 TRP C CH2 1 
ATOM 8564  N N   . ASN C  1 254 ? 125.180 91.485   -3.858  1.00 50.65  ?  262 ASN C N   1 
ATOM 8565  C CA  . ASN C  1 254 ? 126.331 91.731   -4.710  1.00 51.29  ?  262 ASN C CA  1 
ATOM 8566  C C   . ASN C  1 254 ? 125.855 92.161   -6.089  1.00 55.99  ?  262 ASN C C   1 
ATOM 8567  O O   . ASN C  1 254 ? 124.776 91.766   -6.542  1.00 61.44  ?  262 ASN C O   1 
ATOM 8568  C CB  . ASN C  1 254 ? 127.199 90.472   -4.848  1.00 50.00  ?  262 ASN C CB  1 
ATOM 8569  C CG  . ASN C  1 254 ? 128.488 90.562   -4.070  1.00 52.74  ?  262 ASN C CG  1 
ATOM 8570  O OD1 . ASN C  1 254 ? 128.700 91.506   -3.311  1.00 56.31  ?  262 ASN C OD1 1 
ATOM 8571  N ND2 . ASN C  1 254 ? 129.360 89.575   -4.250  1.00 53.54  ?  262 ASN C ND2 1 
ATOM 8572  N N   . ARG C  1 255 ? 126.668 92.970   -6.756  1.00 51.66  ?  263 ARG C N   1 
ATOM 8573  C CA  . ARG C  1 255 ? 126.355 93.473   -8.086  1.00 51.90  ?  263 ARG C CA  1 
ATOM 8574  C C   . ARG C  1 255 ? 127.237 92.778   -9.112  1.00 53.00  ?  263 ARG C C   1 
ATOM 8575  O O   . ARG C  1 255 ? 128.461 92.727   -8.950  1.00 53.98  ?  263 ARG C O   1 
ATOM 8576  C CB  . ARG C  1 255 ? 126.555 94.987   -8.160  1.00 57.89  ?  263 ARG C CB  1 
ATOM 8577  C CG  . ARG C  1 255 ? 125.742 95.771   -7.150  1.00 58.51  ?  263 ARG C CG  1 
ATOM 8578  C CD  . ARG C  1 255 ? 124.299 95.922   -7.598  1.00 60.40  ?  263 ARG C CD  1 
ATOM 8579  N NE  . ARG C  1 255 ? 123.687 97.129   -7.051  1.00 59.56  ?  263 ARG C NE  1 
ATOM 8580  C CZ  . ARG C  1 255 ? 122.392 97.412   -7.132  1.00 56.63  ?  263 ARG C CZ  1 
ATOM 8581  N NH1 . ARG C  1 255 ? 121.565 96.572   -7.739  1.00 50.13  1  263 ARG C NH1 1 
ATOM 8582  N NH2 . ARG C  1 255 ? 121.923 98.536   -6.608  1.00 62.22  ?  263 ARG C NH2 1 
ATOM 8583  N N   . SER C  1 256 ? 126.617 92.238   -10.156 1.00 52.08  ?  264 SER C N   1 
ATOM 8584  C CA  . SER C  1 256 ? 127.390 91.651   -11.237 1.00 64.15  ?  264 SER C CA  1 
ATOM 8585  C C   . SER C  1 256 ? 127.866 92.741   -12.191 1.00 65.75  ?  264 SER C C   1 
ATOM 8586  O O   . SER C  1 256 ? 127.279 93.823   -12.288 1.00 65.35  ?  264 SER C O   1 
ATOM 8587  C CB  . SER C  1 256 ? 126.569 90.604   -11.992 1.00 73.80  ?  264 SER C CB  1 
ATOM 8588  O OG  . SER C  1 256 ? 125.428 91.186   -12.597 1.00 79.85  ?  264 SER C OG  1 
ATOM 8589  N N   . GLY C  1 257 ? 128.947 92.443   -12.902 1.00 58.19  ?  265 GLY C N   1 
ATOM 8590  C CA  . GLY C  1 257 ? 129.579 93.436   -13.745 1.00 59.02  ?  265 GLY C CA  1 
ATOM 8591  C C   . GLY C  1 257 ? 131.013 93.676   -13.329 1.00 61.27  ?  265 GLY C C   1 
ATOM 8592  O O   . GLY C  1 257 ? 131.350 93.544   -12.148 1.00 63.07  ?  265 GLY C O   1 
ATOM 8593  N N   . THR C  1 258 ? 131.866 94.024   -14.287 1.00 52.78  ?  266 THR C N   1 
ATOM 8594  C CA  . THR C  1 258 ? 133.285 94.185   -14.003 1.00 53.68  ?  266 THR C CA  1 
ATOM 8595  C C   . THR C  1 258 ? 133.523 95.396   -13.110 1.00 53.60  ?  266 THR C C   1 
ATOM 8596  O O   . THR C  1 258 ? 132.959 96.472   -13.327 1.00 53.61  ?  266 THR C O   1 
ATOM 8597  C CB  . THR C  1 258 ? 134.072 94.323   -15.304 1.00 55.46  ?  266 THR C CB  1 
ATOM 8598  O OG1 . THR C  1 258 ? 133.556 95.425   -16.060 1.00 56.59  ?  266 THR C OG1 1 
ATOM 8599  C CG2 . THR C  1 258 ? 133.952 93.051   -16.131 1.00 55.92  ?  266 THR C CG2 1 
ATOM 8600  N N   . MET C  1 259 ? 134.368 95.214   -12.098 1.00 51.98  ?  267 MET C N   1 
ATOM 8601  C CA  . MET C  1 259 ? 134.646 96.276   -11.140 1.00 52.22  ?  267 MET C CA  1 
ATOM 8602  C C   . MET C  1 259 ? 135.526 97.337   -11.791 1.00 55.89  ?  267 MET C C   1 
ATOM 8603  O O   . MET C  1 259 ? 136.658 97.052   -12.194 1.00 61.45  ?  267 MET C O   1 
ATOM 8604  C CB  . MET C  1 259 ? 135.325 95.701   -9.900  1.00 59.50  ?  267 MET C CB  1 
ATOM 8605  C CG  . MET C  1 259 ? 134.583 94.538   -9.250  1.00 56.82  ?  267 MET C CG  1 
ATOM 8606  S SD  . MET C  1 259 ? 133.230 95.023   -8.159  1.00 53.60  ?  267 MET C SD  1 
ATOM 8607  C CE  . MET C  1 259 ? 131.843 95.120   -9.290  1.00 51.89  ?  267 MET C CE  1 
ATOM 8608  N N   . GLY C  1 260 ? 135.006 98.561   -11.895 1.00 53.09  ?  268 GLY C N   1 
ATOM 8609  C CA  . GLY C  1 260 ? 135.760 99.621   -12.541 1.00 55.00  ?  268 GLY C CA  1 
ATOM 8610  C C   . GLY C  1 260 ? 136.940 100.112  -11.727 1.00 55.94  ?  268 GLY C C   1 
ATOM 8611  O O   . GLY C  1 260 ? 137.926 100.595  -12.290 1.00 57.85  ?  268 GLY C O   1 
ATOM 8612  N N   . ASP C  1 261 ? 136.860 100.003  -10.403 1.00 56.63  ?  269 ASP C N   1 
ATOM 8613  C CA  . ASP C  1 261 ? 137.937 100.412  -9.510  1.00 58.15  ?  269 ASP C CA  1 
ATOM 8614  C C   . ASP C  1 261 ? 138.707 99.176   -9.062  1.00 58.38  ?  269 ASP C C   1 
ATOM 8615  O O   . ASP C  1 261 ? 138.119 98.242   -8.508  1.00 55.99  ?  269 ASP C O   1 
ATOM 8616  C CB  . ASP C  1 261 ? 137.391 101.168  -8.299  1.00 57.28  ?  269 ASP C CB  1 
ATOM 8617  C CG  . ASP C  1 261 ? 136.665 102.439  -8.686  1.00 66.00  ?  269 ASP C CG  1 
ATOM 8618  O OD1 . ASP C  1 261 ? 137.106 103.104  -9.647  1.00 66.42  ?  269 ASP C OD1 1 
ATOM 8619  O OD2 . ASP C  1 261 ? 135.656 102.775  -8.027  1.00 72.99  -1 269 ASP C OD2 1 
ATOM 8620  N N   . GLN C  1 262 ? 140.016 99.176   -9.298  1.00 57.50  ?  270 GLN C N   1 
ATOM 8621  C CA  . GLN C  1 262 ? 140.844 98.039   -8.919  1.00 57.30  ?  270 GLN C CA  1 
ATOM 8622  C C   . GLN C  1 262 ? 140.977 97.959   -7.405  1.00 56.34  ?  270 GLN C C   1 
ATOM 8623  O O   . GLN C  1 262 ? 141.373 98.929   -6.753  1.00 57.35  ?  270 GLN C O   1 
ATOM 8624  C CB  . GLN C  1 262 ? 142.225 98.148   -9.564  1.00 57.98  ?  270 GLN C CB  1 
ATOM 8625  C CG  . GLN C  1 262 ? 143.111 96.930   -9.339  1.00 61.01  ?  270 GLN C CG  1 
ATOM 8626  C CD  . GLN C  1 262 ? 144.533 97.143   -9.821  1.00 66.15  ?  270 GLN C CD  1 
ATOM 8627  O OE1 . GLN C  1 262 ? 144.875 96.794   -10.950 1.00 71.02  ?  270 GLN C OE1 1 
ATOM 8628  N NE2 . GLN C  1 262 ? 145.370 97.718   -8.965  1.00 66.61  ?  270 GLN C NE2 1 
ATOM 8629  N N   . LEU C  1 263 ? 140.641 96.803   -6.849  1.00 55.80  ?  271 LEU C N   1 
ATOM 8630  C CA  . LEU C  1 263 ? 140.803 96.578   -5.422  1.00 55.15  ?  271 LEU C CA  1 
ATOM 8631  C C   . LEU C  1 263 ? 142.282 96.628   -5.062  1.00 56.94  ?  271 LEU C C   1 
ATOM 8632  O O   . LEU C  1 263 ? 143.061 95.803   -5.563  1.00 58.07  ?  271 LEU C O   1 
ATOM 8633  C CB  . LEU C  1 263 ? 140.211 95.229   -5.021  1.00 53.90  ?  271 LEU C CB  1 
ATOM 8634  C CG  . LEU C  1 263 ? 140.381 94.812   -3.559  1.00 53.68  ?  271 LEU C CG  1 
ATOM 8635  C CD1 . LEU C  1 263 ? 139.762 95.832   -2.623  1.00 53.43  ?  271 LEU C CD1 1 
ATOM 8636  C CD2 . LEU C  1 263 ? 139.787 93.434   -3.323  1.00 53.18  ?  271 LEU C CD2 1 
ATOM 8637  N N   . PRO C  1 264 ? 142.714 97.572   -4.228  1.00 55.35  ?  272 PRO C N   1 
ATOM 8638  C CA  . PRO C  1 264 ? 144.140 97.661   -3.892  1.00 58.00  ?  272 PRO C CA  1 
ATOM 8639  C C   . PRO C  1 264 ? 144.612 96.394   -3.196  1.00 58.02  ?  272 PRO C C   1 
ATOM 8640  O O   . PRO C  1 264 ? 144.008 95.934   -2.224  1.00 55.77  ?  272 PRO C O   1 
ATOM 8641  C CB  . PRO C  1 264 ? 144.213 98.881   -2.966  1.00 59.54  ?  272 PRO C CB  1 
ATOM 8642  C CG  . PRO C  1 264 ? 142.964 99.656   -3.248  1.00 57.77  ?  272 PRO C CG  1 
ATOM 8643  C CD  . PRO C  1 264 ? 141.927 98.634   -3.584  1.00 54.06  ?  272 PRO C CD  1 
ATOM 8644  N N   . GLU C  1 265 ? 145.714 95.839   -3.697  1.00 58.65  ?  273 GLU C N   1 
ATOM 8645  C CA  . GLU C  1 265 ? 146.236 94.588   -3.167  1.00 58.76  ?  273 GLU C CA  1 
ATOM 8646  C C   . GLU C  1 265 ? 146.797 94.732   -1.760  1.00 59.13  ?  273 GLU C C   1 
ATOM 8647  O O   . GLU C  1 265 ? 147.166 93.721   -1.152  1.00 59.18  ?  273 GLU C O   1 
ATOM 8648  C CB  . GLU C  1 265 ? 147.293 94.040   -4.122  1.00 63.69  ?  273 GLU C CB  1 
ATOM 8649  C CG  . GLU C  1 265 ? 146.861 94.144   -5.576  1.00 64.13  ?  273 GLU C CG  1 
ATOM 8650  C CD  . GLU C  1 265 ? 147.772 93.397   -6.521  1.00 66.18  ?  273 GLU C CD  1 
ATOM 8651  O OE1 . GLU C  1 265 ? 148.980 93.297   -6.228  1.00 68.97  ?  273 GLU C OE1 1 
ATOM 8652  O OE2 . GLU C  1 265 ? 147.280 92.917   -7.563  1.00 67.83  -1 273 GLU C OE2 1 
ATOM 8653  N N   . SER C  1 266 ? 146.867 95.954   -1.231  1.00 59.40  ?  274 SER C N   1 
ATOM 8654  C CA  . SER C  1 266 ? 147.264 96.164   0.153   1.00 62.03  ?  274 SER C CA  1 
ATOM 8655  C C   . SER C  1 266 ? 146.188 95.742   1.141   1.00 56.77  ?  274 SER C C   1 
ATOM 8656  O O   . SER C  1 266 ? 146.479 95.638   2.337   1.00 56.93  ?  274 SER C O   1 
ATOM 8657  C CB  . SER C  1 266 ? 147.608 97.637   0.380   1.00 62.85  ?  274 SER C CB  1 
ATOM 8658  O OG  . SER C  1 266 ? 148.319 98.168   -0.724  1.00 68.50  ?  274 SER C OG  1 
ATOM 8659  N N   . LEU C  1 267 ? 144.964 95.495   0.676   1.00 62.25  ?  275 LEU C N   1 
ATOM 8660  C CA  . LEU C  1 267 ? 143.823 95.273   1.552   1.00 59.55  ?  275 LEU C CA  1 
ATOM 8661  C C   . LEU C  1 267 ? 143.405 93.811   1.663   1.00 60.06  ?  275 LEU C C   1 
ATOM 8662  O O   . LEU C  1 267 ? 142.428 93.519   2.361   1.00 63.84  ?  275 LEU C O   1 
ATOM 8663  C CB  . LEU C  1 267 ? 142.628 96.106   1.072   1.00 49.36  ?  275 LEU C CB  1 
ATOM 8664  C CG  . LEU C  1 267 ? 142.869 97.606   0.896   1.00 50.15  ?  275 LEU C CG  1 
ATOM 8665  C CD1 . LEU C  1 267 ? 141.593 98.310   0.475   1.00 49.26  ?  275 LEU C CD1 1 
ATOM 8666  C CD2 . LEU C  1 267 ? 143.410 98.206   2.180   1.00 50.92  ?  275 LEU C CD2 1 
ATOM 8667  N N   . TYR C  1 268 ? 144.105 92.886   1.009   1.00 56.24  ?  276 TYR C N   1 
ATOM 8668  C CA  . TYR C  1 268 ? 143.730 91.480   1.103   1.00 55.36  ?  276 TYR C CA  1 
ATOM 8669  C C   . TYR C  1 268 ? 144.924 90.617   0.725   1.00 56.85  ?  276 TYR C C   1 
ATOM 8670  O O   . TYR C  1 268 ? 145.958 91.110   0.269   1.00 58.51  ?  276 TYR C O   1 
ATOM 8671  C CB  . TYR C  1 268 ? 142.528 91.139   0.211   1.00 55.93  ?  276 TYR C CB  1 
ATOM 8672  C CG  . TYR C  1 268 ? 142.781 91.212   -1.283  1.00 57.25  ?  276 TYR C CG  1 
ATOM 8673  C CD1 . TYR C  1 268 ? 142.433 90.151   -2.110  1.00 56.62  ?  276 TYR C CD1 1 
ATOM 8674  C CD2 . TYR C  1 268 ? 143.351 92.334   -1.870  1.00 61.36  ?  276 TYR C CD2 1 
ATOM 8675  C CE1 . TYR C  1 268 ? 142.655 90.200   -3.475  1.00 56.51  ?  276 TYR C CE1 1 
ATOM 8676  C CE2 . TYR C  1 268 ? 143.576 92.391   -3.235  1.00 63.33  ?  276 TYR C CE2 1 
ATOM 8677  C CZ  . TYR C  1 268 ? 143.226 91.322   -4.031  1.00 58.91  ?  276 TYR C CZ  1 
ATOM 8678  O OH  . TYR C  1 268 ? 143.447 91.378   -5.388  1.00 59.45  ?  276 TYR C OH  1 
ATOM 8679  N N   . ILE C  1 269 ? 144.762 89.312   0.933   1.00 60.96  ?  277 ILE C N   1 
ATOM 8680  C CA  . ILE C  1 269 ? 145.734 88.300   0.537   1.00 63.12  ?  277 ILE C CA  1 
ATOM 8681  C C   . ILE C  1 269 ? 145.029 87.313   -0.385  1.00 61.29  ?  277 ILE C C   1 
ATOM 8682  O O   . ILE C  1 269 ? 143.957 86.799   -0.046  1.00 61.77  ?  277 ILE C O   1 
ATOM 8683  C CB  . ILE C  1 269 ? 146.339 87.586   1.759   1.00 56.59  ?  277 ILE C CB  1 
ATOM 8684  C CG1 . ILE C  1 269 ? 146.967 88.605   2.712   1.00 56.97  ?  277 ILE C CG1 1 
ATOM 8685  C CG2 . ILE C  1 269 ? 147.369 86.565   1.318   1.00 57.04  ?  277 ILE C CG2 1 
ATOM 8686  C CD1 . ILE C  1 269 ? 147.549 87.993   3.967   1.00 57.17  ?  277 ILE C CD1 1 
ATOM 8687  N N   . LYS C  1 270 ? 145.637 87.039   -1.544  1.00 67.30  ?  278 LYS C N   1 
ATOM 8688  C CA  . LYS C  1 270 ? 144.918 86.387   -2.637  1.00 63.78  ?  278 LYS C CA  1 
ATOM 8689  C C   . LYS C  1 270 ? 144.668 84.903   -2.398  1.00 62.05  ?  278 LYS C C   1 
ATOM 8690  O O   . LYS C  1 270 ? 143.763 84.337   -3.023  1.00 60.28  ?  278 LYS C O   1 
ATOM 8691  C CB  . LYS C  1 270 ? 145.679 86.568   -3.951  1.00 66.10  ?  278 LYS C CB  1 
ATOM 8692  C CG  . LYS C  1 270 ? 144.964 87.446   -4.967  1.00 66.19  ?  278 LYS C CG  1 
ATOM 8693  C CD  . LYS C  1 270 ? 145.736 87.520   -6.276  1.00 68.24  ?  278 LYS C CD  1 
ATOM 8694  C CE  . LYS C  1 270 ? 145.094 88.500   -7.244  1.00 67.58  ?  278 LYS C CE  1 
ATOM 8695  N NZ  . LYS C  1 270 ? 145.773 88.493   -8.569  1.00 72.03  1  278 LYS C NZ  1 
ATOM 8696  N N   . GLY C  1 271 ? 145.436 84.261   -1.529  1.00 65.82  ?  279 GLY C N   1 
ATOM 8697  C CA  . GLY C  1 271 ? 145.300 82.834   -1.323  1.00 65.22  ?  279 GLY C CA  1 
ATOM 8698  C C   . GLY C  1 271 ? 146.156 82.019   -2.271  1.00 67.44  ?  279 GLY C C   1 
ATOM 8699  O O   . GLY C  1 271 ? 146.973 82.535   -3.039  1.00 75.36  ?  279 GLY C O   1 
ATOM 8700  N N   . THR C  1 272 ? 145.949 80.700   -2.211  1.00 65.65  ?  280 THR C N   1 
ATOM 8701  C CA  . THR C  1 272 ? 146.822 79.778   -2.933  1.00 74.57  ?  280 THR C CA  1 
ATOM 8702  C C   . THR C  1 272 ? 146.698 79.939   -4.443  1.00 79.64  ?  280 THR C C   1 
ATOM 8703  O O   . THR C  1 272 ? 147.707 79.937   -5.157  1.00 86.94  ?  280 THR C O   1 
ATOM 8704  C CB  . THR C  1 272 ? 146.512 78.336   -2.533  1.00 72.74  ?  280 THR C CB  1 
ATOM 8705  O OG1 . THR C  1 272 ? 145.135 78.048   -2.804  1.00 71.29  ?  280 THR C OG1 1 
ATOM 8706  C CG2 . THR C  1 272 ? 146.792 78.126   -1.056  1.00 71.61  ?  280 THR C CG2 1 
ATOM 8707  N N   . ASP C  1 273 ? 145.475 80.089   -4.947  1.00 76.73  ?  281 ASP C N   1 
ATOM 8708  C CA  . ASP C  1 273 ? 145.248 80.236   -6.383  1.00 76.99  ?  281 ASP C CA  1 
ATOM 8709  C C   . ASP C  1 273 ? 145.661 81.643   -6.807  1.00 78.88  ?  281 ASP C C   1 
ATOM 8710  O O   . ASP C  1 273 ? 144.834 82.527   -7.048  1.00 84.21  ?  281 ASP C O   1 
ATOM 8711  C CB  . ASP C  1 273 ? 143.794 79.941   -6.732  1.00 79.52  ?  281 ASP C CB  1 
ATOM 8712  C CG  . ASP C  1 273 ? 143.602 79.613   -8.201  1.00 80.32  ?  281 ASP C CG  1 
ATOM 8713  O OD1 . ASP C  1 273 ? 144.591 79.693   -8.962  1.00 81.69  ?  281 ASP C OD1 1 
ATOM 8714  O OD2 . ASP C  1 273 ? 142.467 79.265   -8.592  1.00 77.23  -1 281 ASP C OD2 1 
ATOM 8715  N N   . ILE C  1 274 ? 146.978 81.849   -6.908  1.00 72.33  ?  282 ILE C N   1 
ATOM 8716  C CA  . ILE C  1 274 ? 147.509 83.160   -7.264  1.00 74.84  ?  282 ILE C CA  1 
ATOM 8717  C C   . ILE C  1 274 ? 147.104 83.327   -8.718  1.00 78.83  ?  282 ILE C C   1 
ATOM 8718  O O   . ILE C  1 274 ? 147.848 82.976   -9.643  1.00 93.48  ?  282 ILE C O   1 
ATOM 8719  C CB  . ILE C  1 274 ? 149.031 83.255   -7.072  1.00 75.76  ?  282 ILE C CB  1 
ATOM 8720  C CG1 . ILE C  1 274 ? 149.368 83.394   -5.596  1.00 74.03  ?  282 ILE C CG1 1 
ATOM 8721  C CG2 . ILE C  1 274 ? 149.565 84.521   -7.730  1.00 83.73  ?  282 ILE C CG2 1 
ATOM 8722  C CD1 . ILE C  1 274 ? 150.853 83.447   -5.345  1.00 77.78  ?  282 ILE C CD1 1 
ATOM 8723  N N   . ARG C  1 275 ? 145.897 83.841   -8.906  1.00 70.66  ?  283 ARG C N   1 
ATOM 8724  C CA  . ARG C  1 275 ? 145.214 83.923   -10.183 1.00 70.32  ?  283 ARG C CA  1 
ATOM 8725  C C   . ARG C  1 275 ? 143.811 84.354   -9.812  1.00 68.15  ?  283 ARG C C   1 
ATOM 8726  O O   . ARG C  1 275 ? 142.965 84.613   -10.673 1.00 67.54  ?  283 ARG C O   1 
ATOM 8727  C CB  . ARG C  1 275 ? 145.188 82.557   -10.880 1.00 62.23  ?  283 ARG C CB  1 
ATOM 8728  C CG  . ARG C  1 275 ? 145.657 82.536   -12.312 1.00 64.00  ?  283 ARG C CG  1 
ATOM 8729  C CD  . ARG C  1 275 ? 146.917 81.704   -12.489 1.00 65.81  ?  283 ARG C CD  1 
ATOM 8730  N NE  . ARG C  1 275 ? 146.630 80.371   -13.012 1.00 65.63  ?  283 ARG C NE  1 
ATOM 8731  C CZ  . ARG C  1 275 ? 146.283 80.126   -14.271 1.00 66.14  ?  283 ARG C CZ  1 
ATOM 8732  N NH1 . ARG C  1 275 ? 146.170 81.126   -15.134 1.00 66.86  1  283 ARG C NH1 1 
ATOM 8733  N NH2 . ARG C  1 275 ? 146.041 78.885   -14.668 1.00 66.00  ?  283 ARG C NH2 1 
ATOM 8734  N N   . ALA C  1 276 ? 143.585 84.450   -8.504  1.00 71.75  ?  284 ALA C N   1 
ATOM 8735  C CA  . ALA C  1 276 ? 142.244 84.613   -7.969  1.00 70.18  ?  284 ALA C CA  1 
ATOM 8736  C C   . ALA C  1 276 ? 141.702 85.983   -8.328  1.00 67.01  ?  284 ALA C C   1 
ATOM 8737  O O   . ALA C  1 276 ? 142.262 87.011   -7.935  1.00 69.16  ?  284 ALA C O   1 
ATOM 8738  C CB  . ALA C  1 276 ? 142.257 84.422   -6.453  1.00 77.13  ?  284 ALA C CB  1 
ATOM 8739  N N   . ASN C  1 277 ? 140.613 85.988   -9.075  1.00 63.62  ?  285 ASN C N   1 
ATOM 8740  C CA  . ASN C  1 277 ? 139.894 87.214   -9.351  1.00 65.37  ?  285 ASN C CA  1 
ATOM 8741  C C   . ASN C  1 277 ? 139.140 87.610   -8.088  1.00 65.63  ?  285 ASN C C   1 
ATOM 8742  O O   . ASN C  1 277 ? 138.375 86.796   -7.557  1.00 68.58  ?  285 ASN C O   1 
ATOM 8743  C CB  . ASN C  1 277 ? 138.935 86.999   -10.517 1.00 64.13  ?  285 ASN C CB  1 
ATOM 8744  C CG  . ASN C  1 277 ? 138.325 88.288   -11.030 1.00 69.95  ?  285 ASN C CG  1 
ATOM 8745  O OD1 . ASN C  1 277 ? 138.565 89.367   -10.490 1.00 71.44  ?  285 ASN C OD1 1 
ATOM 8746  N ND2 . ASN C  1 277 ? 137.526 88.178   -12.086 1.00 73.40  ?  285 ASN C ND2 1 
ATOM 8747  N N   . PRO C  1 278 ? 139.331 88.818   -7.565  1.00 66.91  ?  286 PRO C N   1 
ATOM 8748  C CA  . PRO C  1 278 ? 138.561 89.224   -6.385  1.00 59.51  ?  286 PRO C CA  1 
ATOM 8749  C C   . PRO C  1 278 ? 137.077 89.281   -6.709  1.00 55.28  ?  286 PRO C C   1 
ATOM 8750  O O   . PRO C  1 278 ? 136.670 89.821   -7.740  1.00 55.32  ?  286 PRO C O   1 
ATOM 8751  C CB  . PRO C  1 278 ? 139.127 90.609   -6.051  1.00 56.35  ?  286 PRO C CB  1 
ATOM 8752  C CG  . PRO C  1 278 ? 140.495 90.603   -6.645  1.00 63.30  ?  286 PRO C CG  1 
ATOM 8753  C CD  . PRO C  1 278 ? 140.370 89.803   -7.908  1.00 68.12  ?  286 PRO C CD  1 
ATOM 8754  N N   . GLY C  1 279 ? 136.271 88.698   -5.829  1.00 54.81  ?  287 GLY C N   1 
ATOM 8755  C CA  . GLY C  1 279 ? 134.833 88.716   -6.006  1.00 53.30  ?  287 GLY C CA  1 
ATOM 8756  C C   . GLY C  1 279 ? 134.287 90.131   -6.047  1.00 53.05  ?  287 GLY C C   1 
ATOM 8757  O O   . GLY C  1 279 ? 134.956 91.109   -5.711  1.00 53.87  ?  287 GLY C O   1 
ATOM 8758  N N   . SER C  1 280 ? 133.037 90.236   -6.494  1.00 50.92  ?  288 SER C N   1 
ATOM 8759  C CA  . SER C  1 280 ? 132.389 91.539   -6.581  1.00 50.20  ?  288 SER C CA  1 
ATOM 8760  C C   . SER C  1 280 ? 132.384 92.210   -5.215  1.00 51.12  ?  288 SER C C   1 
ATOM 8761  O O   . SER C  1 280 ? 131.946 91.622   -4.223  1.00 53.58  ?  288 SER C O   1 
ATOM 8762  C CB  . SER C  1 280 ? 130.961 91.393   -7.103  1.00 44.74  ?  288 SER C CB  1 
ATOM 8763  O OG  . SER C  1 280 ? 130.331 92.657   -7.226  1.00 44.73  ?  288 SER C OG  1 
ATOM 8764  N N   . TYR C  1 281 ? 132.899 93.436   -5.163  1.00 48.61  ?  289 TYR C N   1 
ATOM 8765  C CA  . TYR C  1 281 ? 132.988 94.182   -3.917  1.00 48.41  ?  289 TYR C CA  1 
ATOM 8766  C C   . TYR C  1 281 ? 132.231 95.502   -4.017  1.00 48.07  ?  289 TYR C C   1 
ATOM 8767  O O   . TYR C  1 281 ? 132.633 96.509   -3.433  1.00 48.59  ?  289 TYR C O   1 
ATOM 8768  C CB  . TYR C  1 281 ? 134.451 94.387   -3.521  1.00 48.09  ?  289 TYR C CB  1 
ATOM 8769  C CG  . TYR C  1 281 ? 135.359 94.858   -4.638  1.00 55.16  ?  289 TYR C CG  1 
ATOM 8770  C CD1 . TYR C  1 281 ? 135.260 96.148   -5.144  1.00 55.99  ?  289 TYR C CD1 1 
ATOM 8771  C CD2 . TYR C  1 281 ? 136.259 93.984   -5.243  1.00 58.56  ?  289 TYR C CD2 1 
ATOM 8772  C CE1 . TYR C  1 281 ? 136.084 96.577   -6.168  1.00 56.84  ?  289 TYR C CE1 1 
ATOM 8773  C CE2 . TYR C  1 281 ? 137.075 94.398   -6.278  1.00 59.62  ?  289 TYR C CE2 1 
ATOM 8774  C CZ  . TYR C  1 281 ? 136.985 95.695   -6.737  1.00 60.38  ?  289 TYR C CZ  1 
ATOM 8775  O OH  . TYR C  1 281 ? 137.801 96.108   -7.766  1.00 68.08  ?  289 TYR C OH  1 
ATOM 8776  N N   . LEU C  1 282 ? 131.141 95.500   -4.783  1.00 50.04  ?  290 LEU C N   1 
ATOM 8777  C CA  . LEU C  1 282 ? 130.197 96.612   -4.866  1.00 48.84  ?  290 LEU C CA  1 
ATOM 8778  C C   . LEU C  1 282 ? 128.902 96.125   -4.225  1.00 50.47  ?  290 LEU C C   1 
ATOM 8779  O O   . LEU C  1 282 ? 128.124 95.396   -4.849  1.00 55.70  ?  290 LEU C O   1 
ATOM 8780  C CB  . LEU C  1 282 ? 129.981 97.049   -6.312  1.00 51.48  ?  290 LEU C CB  1 
ATOM 8781  C CG  . LEU C  1 282 ? 129.435 98.464   -6.515  1.00 51.60  ?  290 LEU C CG  1 
ATOM 8782  C CD1 . LEU C  1 282 ? 129.895 99.005   -7.850  1.00 59.27  ?  290 LEU C CD1 1 
ATOM 8783  C CD2 . LEU C  1 282 ? 127.918 98.505   -6.423  1.00 50.18  ?  290 LEU C CD2 1 
ATOM 8784  N N   . TYR C  1 283 ? 128.675 96.526   -2.979  1.00 45.36  ?  291 TYR C N   1 
ATOM 8785  C CA  . TYR C  1 283 ? 127.560 96.026   -2.187  1.00 44.80  ?  291 TYR C CA  1 
ATOM 8786  C C   . TYR C  1 283 ? 126.459 97.074   -2.116  1.00 44.60  ?  291 TYR C C   1 
ATOM 8787  O O   . TYR C  1 283 ? 126.725 98.243   -1.817  1.00 44.85  ?  291 TYR C O   1 
ATOM 8788  C CB  . TYR C  1 283 ? 128.031 95.646   -0.783  1.00 46.93  ?  291 TYR C CB  1 
ATOM 8789  C CG  . TYR C  1 283 ? 129.303 94.828   -0.779  1.00 47.83  ?  291 TYR C CG  1 
ATOM 8790  C CD1 . TYR C  1 283 ? 129.266 93.454   -0.972  1.00 47.46  ?  291 TYR C CD1 1 
ATOM 8791  C CD2 . TYR C  1 283 ? 130.539 95.429   -0.585  1.00 49.13  ?  291 TYR C CD2 1 
ATOM 8792  C CE1 . TYR C  1 283 ? 130.423 92.700   -0.971  1.00 48.35  ?  291 TYR C CE1 1 
ATOM 8793  C CE2 . TYR C  1 283 ? 131.703 94.683   -0.582  1.00 50.05  ?  291 TYR C CE2 1 
ATOM 8794  C CZ  . TYR C  1 283 ? 131.638 93.319   -0.776  1.00 49.65  ?  291 TYR C CZ  1 
ATOM 8795  O OH  . TYR C  1 283 ? 132.792 92.569   -0.775  1.00 53.13  ?  291 TYR C OH  1 
ATOM 8796  N N   . SER C  1 284 ? 125.227 96.652   -2.393  1.00 44.15  ?  292 SER C N   1 
ATOM 8797  C CA  . SER C  1 284 ? 124.065 97.533   -2.355  1.00 43.94  ?  292 SER C CA  1 
ATOM 8798  C C   . SER C  1 284 ? 122.970 96.842   -1.555  1.00 43.41  ?  292 SER C C   1 
ATOM 8799  O O   . SER C  1 284 ? 122.540 95.731   -1.928  1.00 43.14  ?  292 SER C O   1 
ATOM 8800  C CB  . SER C  1 284 ? 123.582 97.870   -3.768  1.00 48.83  ?  292 SER C CB  1 
ATOM 8801  O OG  . SER C  1 284 ? 122.312 98.499   -3.740  1.00 51.67  ?  292 SER C OG  1 
ATOM 8802  N N   . PRO C  1 285 ? 122.490 97.439   -0.469  1.00 42.00  ?  293 PRO C N   1 
ATOM 8803  C CA  . PRO C  1 285 ? 121.451 96.803   0.341   1.00 41.54  ?  293 PRO C CA  1 
ATOM 8804  C C   . PRO C  1 285 ? 120.048 97.090   -0.177  1.00 41.26  ?  293 PRO C C   1 
ATOM 8805  O O   . PRO C  1 285 ? 119.797 98.073   -0.877  1.00 41.42  ?  293 PRO C O   1 
ATOM 8806  C CB  . PRO C  1 285 ? 121.658 97.447   1.718   1.00 44.48  ?  293 PRO C CB  1 
ATOM 8807  C CG  . PRO C  1 285 ? 122.133 98.823   1.387   1.00 44.86  ?  293 PRO C CG  1 
ATOM 8808  C CD  . PRO C  1 285 ? 122.962 98.700   0.131   1.00 45.17  ?  293 PRO C CD  1 
ATOM 8809  N N   . SER C  1 286 ? 119.130 96.198   0.187   1.00 40.66  ?  294 SER C N   1 
ATOM 8810  C CA  . SER C  1 286 ? 117.713 96.414   -0.074  1.00 39.86  ?  294 SER C CA  1 
ATOM 8811  C C   . SER C  1 286 ? 117.110 97.225   1.065   1.00 44.76  ?  294 SER C C   1 
ATOM 8812  O O   . SER C  1 286 ? 117.118 96.758   2.212   1.00 53.01  ?  294 SER C O   1 
ATOM 8813  C CB  . SER C  1 286 ? 116.981 95.090   -0.223  1.00 45.61  ?  294 SER C CB  1 
ATOM 8814  O OG  . SER C  1 286 ? 117.033 94.331   0.972   1.00 45.34  ?  294 SER C OG  1 
ATOM 8815  N N   . PRO C  1 287 ? 116.599 98.426   0.811   1.00 43.80  ?  295 PRO C N   1 
ATOM 8816  C CA  . PRO C  1 287 ? 116.034 99.235   1.895   1.00 46.49  ?  295 PRO C CA  1 
ATOM 8817  C C   . PRO C  1 287 ? 114.717 98.665   2.399   1.00 46.03  ?  295 PRO C C   1 
ATOM 8818  O O   . PRO C  1 287 ? 114.078 97.831   1.756   1.00 50.57  ?  295 PRO C O   1 
ATOM 8819  C CB  . PRO C  1 287 ? 115.826 100.603  1.239   1.00 47.64  ?  295 PRO C CB  1 
ATOM 8820  C CG  . PRO C  1 287 ? 115.615 100.281  -0.204  1.00 48.18  ?  295 PRO C CG  1 
ATOM 8821  C CD  . PRO C  1 287 ? 116.506 99.103   -0.493  1.00 44.53  ?  295 PRO C CD  1 
ATOM 8822  N N   . SER C  1 288 ? 114.316 99.127   3.581   1.00 42.86  ?  296 SER C N   1 
ATOM 8823  C CA  . SER C  1 288 ? 113.028 98.730   4.134   1.00 43.96  ?  296 SER C CA  1 
ATOM 8824  C C   . SER C  1 288 ? 112.555 99.802   5.103   1.00 47.79  ?  296 SER C C   1 
ATOM 8825  O O   . SER C  1 288 ? 113.345 100.329  5.888   1.00 54.52  ?  296 SER C O   1 
ATOM 8826  C CB  . SER C  1 288 ? 113.116 97.370   4.836   1.00 48.74  ?  296 SER C CB  1 
ATOM 8827  O OG  . SER C  1 288 ? 111.861 96.988   5.371   1.00 48.11  ?  296 SER C OG  1 
ATOM 8828  N N   . GLY C  1 289 ? 111.264 100.110  5.048   1.00 49.01  ?  297 GLY C N   1 
ATOM 8829  C CA  . GLY C  1 289 ? 110.681 101.153  5.863   1.00 46.87  ?  297 GLY C CA  1 
ATOM 8830  C C   . GLY C  1 289 ? 110.123 100.711  7.197   1.00 45.83  ?  297 GLY C C   1 
ATOM 8831  O O   . GLY C  1 289 ? 109.434 101.502  7.852   1.00 51.43  ?  297 GLY C O   1 
ATOM 8832  N N   . SER C  1 290 ? 110.402 99.483   7.619   1.00 40.64  ?  298 SER C N   1 
ATOM 8833  C CA  . SER C  1 290 ? 109.966 98.945   8.915   1.00 41.31  ?  298 SER C CA  1 
ATOM 8834  C C   . SER C  1 290 ? 108.443 99.071   9.034   1.00 43.17  ?  298 SER C C   1 
ATOM 8835  O O   . SER C  1 290 ? 107.719 99.002   8.033   1.00 46.22  ?  298 SER C O   1 
ATOM 8836  C CB  . SER C  1 290 ? 110.741 99.629   10.026  1.00 43.49  ?  298 SER C CB  1 
ATOM 8837  O OG  . SER C  1 290 ? 110.324 99.157   11.294  1.00 52.14  ?  298 SER C OG  1 
ATOM 8838  N N   . VAL C  1 291 ? 107.951 99.252   10.257  1.00 40.55  ?  299 VAL C N   1 
ATOM 8839  C CA  . VAL C  1 291 ? 106.518 99.251   10.530  1.00 40.37  ?  299 VAL C CA  1 
ATOM 8840  C C   . VAL C  1 291 ? 105.926 100.618  10.221  1.00 42.46  ?  299 VAL C C   1 
ATOM 8841  O O   . VAL C  1 291 ? 106.519 101.658  10.533  1.00 50.07  ?  299 VAL C O   1 
ATOM 8842  C CB  . VAL C  1 291 ? 106.255 98.851   11.993  1.00 42.18  ?  299 VAL C CB  1 
ATOM 8843  C CG1 . VAL C  1 291 ? 104.762 98.759   12.262  1.00 43.92  ?  299 VAL C CG1 1 
ATOM 8844  C CG2 . VAL C  1 291 ? 106.944 97.534   12.316  1.00 44.74  ?  299 VAL C CG2 1 
ATOM 8845  N N   . VAL C  1 292 ? 104.745 100.619  9.611   1.00 43.05  ?  300 VAL C N   1 
ATOM 8846  C CA  . VAL C  1 292 ? 103.957 101.830  9.413   1.00 42.66  ?  300 VAL C CA  1 
ATOM 8847  C C   . VAL C  1 292 ? 102.856 101.839  10.461  1.00 42.98  ?  300 VAL C C   1 
ATOM 8848  O O   . VAL C  1 292 ? 101.997 100.950  10.476  1.00 42.70  ?  300 VAL C O   1 
ATOM 8849  C CB  . VAL C  1 292 ? 103.367 101.894  7.997   1.00 42.98  ?  300 VAL C CB  1 
ATOM 8850  C CG1 . VAL C  1 292 ? 102.303 102.976  7.919   1.00 41.63  ?  300 VAL C CG1 1 
ATOM 8851  C CG2 . VAL C  1 292 ? 104.463 102.144  6.972   1.00 47.79  ?  300 VAL C CG2 1 
ATOM 8852  N N   . THR C  1 293 ? 102.879 102.837  11.339  1.00 44.08  ?  301 THR C N   1 
ATOM 8853  C CA  . THR C  1 293 ? 101.892 102.955  12.401  1.00 46.70  ?  301 THR C CA  1 
ATOM 8854  C C   . THR C  1 293 ? 101.314 104.362  12.410  1.00 47.12  ?  301 THR C C   1 
ATOM 8855  O O   . THR C  1 293 ? 101.995 105.334  12.070  1.00 53.95  ?  301 THR C O   1 
ATOM 8856  C CB  . THR C  1 293 ? 102.494 102.635  13.777  1.00 50.71  ?  301 THR C CB  1 
ATOM 8857  O OG1 . THR C  1 293 ? 101.534 102.931  14.798  1.00 59.10  ?  301 THR C OG1 1 
ATOM 8858  C CG2 . THR C  1 293 ? 103.751 103.459  14.020  1.00 49.29  ?  301 THR C CG2 1 
ATOM 8859  N N   . SER C  1 294 ? 100.046 104.461  12.808  1.00 46.69  ?  302 SER C N   1 
ATOM 8860  C CA  . SER C  1 294 ? 99.396  105.761  12.902  1.00 46.90  ?  302 SER C CA  1 
ATOM 8861  C C   . SER C  1 294 ? 99.917  106.595  14.066  1.00 47.22  ?  302 SER C C   1 
ATOM 8862  O O   . SER C  1 294 ? 99.614  107.791  14.129  1.00 47.43  ?  302 SER C O   1 
ATOM 8863  C CB  . SER C  1 294 ? 97.877  105.587  13.009  1.00 43.70  ?  302 SER C CB  1 
ATOM 8864  O OG  . SER C  1 294 ? 97.533  104.612  13.977  1.00 43.63  ?  302 SER C OG  1 
ATOM 8865  N N   . ASP C  1 295 ? 100.681 106.001  14.986  1.00 47.77  ?  303 ASP C N   1 
ATOM 8866  C CA  . ASP C  1 295 ? 101.301 106.792  16.045  1.00 53.75  ?  303 ASP C CA  1 
ATOM 8867  C C   . ASP C  1 295 ? 102.339 107.751  15.478  1.00 59.61  ?  303 ASP C C   1 
ATOM 8868  O O   . ASP C  1 295 ? 102.457 108.893  15.939  1.00 63.61  ?  303 ASP C O   1 
ATOM 8869  C CB  . ASP C  1 295 ? 101.937 105.873  17.088  1.00 56.20  ?  303 ASP C CB  1 
ATOM 8870  C CG  . ASP C  1 295 ? 100.917 105.019  17.815  1.00 63.74  ?  303 ASP C CG  1 
ATOM 8871  O OD1 . ASP C  1 295 ? 99.738  105.428  17.885  1.00 69.17  ?  303 ASP C OD1 1 
ATOM 8872  O OD2 . ASP C  1 295 ? 101.295 103.938  18.317  1.00 63.88  -1 303 ASP C OD2 1 
ATOM 8873  N N   . SER C  1 296 ? 103.098 107.307  14.479  1.00 62.02  ?  304 SER C N   1 
ATOM 8874  C CA  . SER C  1 296 ? 104.069 108.146  13.792  1.00 55.14  ?  304 SER C CA  1 
ATOM 8875  C C   . SER C  1 296 ? 103.446 108.959  12.667  1.00 49.31  ?  304 SER C C   1 
ATOM 8876  O O   . SER C  1 296 ? 104.177 109.617  11.919  1.00 48.31  ?  304 SER C O   1 
ATOM 8877  C CB  . SER C  1 296 ? 105.215 107.291  13.245  1.00 54.77  ?  304 SER C CB  1 
ATOM 8878  O OG  . SER C  1 296 ? 105.899 106.623  14.291  1.00 57.46  ?  304 SER C OG  1 
ATOM 8879  N N   . GLN C  1 297 ? 102.123 108.922  12.528  1.00 47.48  ?  305 GLN C N   1 
ATOM 8880  C CA  . GLN C  1 297 ? 101.459 109.633  11.446  1.00 51.35  ?  305 GLN C CA  1 
ATOM 8881  C C   . GLN C  1 297 ? 101.692 111.134  11.572  1.00 53.10  ?  305 GLN C C   1 
ATOM 8882  O O   . GLN C  1 297 ? 101.809 111.682  12.672  1.00 55.92  ?  305 GLN C O   1 
ATOM 8883  C CB  . GLN C  1 297 ? 99.958  109.331  11.447  1.00 55.17  ?  305 GLN C CB  1 
ATOM 8884  C CG  . GLN C  1 297 ? 99.256  109.584  10.120  1.00 49.66  ?  305 GLN C CG  1 
ATOM 8885  C CD  . GLN C  1 297 ? 99.768  108.689  9.005   1.00 48.45  ?  305 GLN C CD  1 
ATOM 8886  O OE1 . GLN C  1 297 ? 99.786  109.080  7.839   1.00 52.69  ?  305 GLN C OE1 1 
ATOM 8887  N NE2 . GLN C  1 297 ? 100.175 107.475  9.359   1.00 45.36  ?  305 GLN C NE2 1 
ATOM 8888  N N   . LEU C  1 298 ? 101.775 111.797  10.422  1.00 52.99  ?  306 LEU C N   1 
ATOM 8889  C CA  . LEU C  1 298 ? 102.130 113.203  10.359  1.00 52.04  ?  306 LEU C CA  1 
ATOM 8890  C C   . LEU C  1 298 ? 101.053 114.068  9.720   1.00 52.13  ?  306 LEU C C   1 
ATOM 8891  O O   . LEU C  1 298 ? 101.158 115.298  9.776   1.00 53.01  ?  306 LEU C O   1 
ATOM 8892  C CB  . LEU C  1 298 ? 103.452 113.369  9.590   1.00 49.55  ?  306 LEU C CB  1 
ATOM 8893  C CG  . LEU C  1 298 ? 104.247 114.668  9.689   1.00 49.95  ?  306 LEU C CG  1 
ATOM 8894  C CD1 . LEU C  1 298 ? 105.684 114.371  10.077  1.00 43.04  ?  306 LEU C CD1 1 
ATOM 8895  C CD2 . LEU C  1 298 ? 104.196 115.407  8.363   1.00 55.84  ?  306 LEU C CD2 1 
ATOM 8896  N N   . PHE C  1 299 ? 100.015 113.472  9.144   1.00 53.45  ?  307 PHE C N   1 
ATOM 8897  C CA  . PHE C  1 299 ? 98.946  114.205  8.482   1.00 55.74  ?  307 PHE C CA  1 
ATOM 8898  C C   . PHE C  1 299 ? 97.632  113.974  9.228   1.00 58.30  ?  307 PHE C C   1 
ATOM 8899  O O   . PHE C  1 299 ? 97.607  113.406  10.324  1.00 64.12  ?  307 PHE C O   1 
ATOM 8900  C CB  . PHE C  1 299 ? 98.853  113.793  7.012   1.00 50.77  ?  307 PHE C CB  1 
ATOM 8901  C CG  . PHE C  1 299 ? 100.129 113.994  6.253   1.00 52.75  ?  307 PHE C CG  1 
ATOM 8902  C CD1 . PHE C  1 299 ? 100.628 115.268  6.039   1.00 51.87  ?  307 PHE C CD1 1 
ATOM 8903  C CD2 . PHE C  1 299 ? 100.836 112.910  5.764   1.00 53.95  ?  307 PHE C CD2 1 
ATOM 8904  C CE1 . PHE C  1 299 ? 101.806 115.457  5.347   1.00 52.31  ?  307 PHE C CE1 1 
ATOM 8905  C CE2 . PHE C  1 299 ? 102.015 113.092  5.070   1.00 54.69  ?  307 PHE C CE2 1 
ATOM 8906  C CZ  . PHE C  1 299 ? 102.501 114.368  4.863   1.00 52.84  ?  307 PHE C CZ  1 
ATOM 8907  N N   . ASN C  1 300 ? 96.535  114.435  8.624   1.00 52.40  ?  308 ASN C N   1 
ATOM 8908  C CA  . ASN C  1 300 ? 95.208  114.432  9.237   1.00 47.62  ?  308 ASN C CA  1 
ATOM 8909  C C   . ASN C  1 300 ? 95.178  115.197  10.557  1.00 50.45  ?  308 ASN C C   1 
ATOM 8910  O O   . ASN C  1 300 ? 94.277  114.994  11.376  1.00 50.11  ?  308 ASN C O   1 
ATOM 8911  C CB  . ASN C  1 300 ? 94.693  113.002  9.436   1.00 44.90  ?  308 ASN C CB  1 
ATOM 8912  C CG  . ASN C  1 300 ? 94.233  112.367  8.140   1.00 45.00  ?  308 ASN C CG  1 
ATOM 8913  O OD1 . ASN C  1 300 ? 94.313  112.980  7.077   1.00 46.53  ?  308 ASN C OD1 1 
ATOM 8914  N ND2 . ASN C  1 300 ? 93.767  111.126  8.218   1.00 44.62  ?  308 ASN C ND2 1 
ATOM 8915  N N   . LYS C  1 301 ? 96.150  116.082  10.771  1.00 53.73  ?  309 LYS C N   1 
ATOM 8916  C CA  . LYS C  1 301 ? 96.256  116.914  11.955  1.00 54.54  ?  309 LYS C CA  1 
ATOM 8917  C C   . LYS C  1 301 ? 96.325  118.382  11.558  1.00 55.53  ?  309 LYS C C   1 
ATOM 8918  O O   . LYS C  1 301 ? 96.899  118.722  10.519  1.00 56.03  ?  309 LYS C O   1 
ATOM 8919  C CB  . LYS C  1 301 ? 97.497  116.568  12.787  1.00 54.15  ?  309 LYS C CB  1 
ATOM 8920  C CG  . LYS C  1 301 ? 97.597  115.120  13.221  1.00 60.03  ?  309 LYS C CG  1 
ATOM 8921  C CD  . LYS C  1 301 ? 98.961  114.843  13.833  1.00 63.10  ?  309 LYS C CD  1 
ATOM 8922  C CE  . LYS C  1 301 ? 99.285  115.857  14.923  1.00 65.80  ?  309 LYS C CE  1 
ATOM 8923  N NZ  . LYS C  1 301 ? 100.668 115.701  15.452  1.00 67.06  1  309 LYS C NZ  1 
ATOM 8924  N N   . PRO C  1 302 ? 95.746  119.273  12.357  1.00 49.31  ?  310 PRO C N   1 
ATOM 8925  C CA  . PRO C  1 302 ? 95.901  120.705  12.088  1.00 50.31  ?  310 PRO C CA  1 
ATOM 8926  C C   . PRO C  1 302 ? 97.275  121.192  12.520  1.00 54.20  ?  310 PRO C C   1 
ATOM 8927  O O   . PRO C  1 302 ? 97.791  120.813  13.574  1.00 57.76  ?  310 PRO C O   1 
ATOM 8928  C CB  . PRO C  1 302 ? 94.792  121.342  12.932  1.00 54.09  ?  310 PRO C CB  1 
ATOM 8929  C CG  . PRO C  1 302 ? 94.608  120.393  14.062  1.00 54.11  ?  310 PRO C CG  1 
ATOM 8930  C CD  . PRO C  1 302 ? 94.843  119.018  13.492  1.00 53.02  ?  310 PRO C CD  1 
ATOM 8931  N N   . TYR C  1 303 ? 97.867  122.040  11.683  1.00 51.43  ?  311 TYR C N   1 
ATOM 8932  C CA  . TYR C  1 303 ? 99.157  122.661  11.957  1.00 56.06  ?  311 TYR C CA  1 
ATOM 8933  C C   . TYR C  1 303 ? 98.992  124.166  11.815  1.00 60.56  ?  311 TYR C C   1 
ATOM 8934  O O   . TYR C  1 303 ? 98.541  124.648  10.769  1.00 64.39  ?  311 TYR C O   1 
ATOM 8935  C CB  . TYR C  1 303 ? 100.238 122.137  11.008  1.00 57.89  ?  311 TYR C CB  1 
ATOM 8936  C CG  . TYR C  1 303 ? 100.532 120.665  11.187  1.00 60.92  ?  311 TYR C CG  1 
ATOM 8937  C CD1 . TYR C  1 303 ? 101.329 120.215  12.233  1.00 64.49  ?  311 TYR C CD1 1 
ATOM 8938  C CD2 . TYR C  1 303 ? 100.007 119.722  10.311  1.00 62.31  ?  311 TYR C CD2 1 
ATOM 8939  C CE1 . TYR C  1 303 ? 101.596 118.865  12.400  1.00 68.26  ?  311 TYR C CE1 1 
ATOM 8940  C CE2 . TYR C  1 303 ? 100.270 118.372  10.468  1.00 64.59  ?  311 TYR C CE2 1 
ATOM 8941  C CZ  . TYR C  1 303 ? 101.064 117.949  11.513  1.00 68.50  ?  311 TYR C CZ  1 
ATOM 8942  O OH  . TYR C  1 303 ? 101.324 116.606  11.670  1.00 69.91  ?  311 TYR C OH  1 
ATOM 8943  N N   . TRP C  1 304 ? 99.357  124.899  12.862  1.00 58.84  ?  312 TRP C N   1 
ATOM 8944  C CA  . TRP C  1 304 ? 99.182  126.344  12.926  1.00 56.16  ?  312 TRP C CA  1 
ATOM 8945  C C   . TRP C  1 304 ? 100.530 127.025  12.747  1.00 56.10  ?  312 TRP C C   1 
ATOM 8946  O O   . TRP C  1 304 ? 101.464 126.777  13.518  1.00 54.08  ?  312 TRP C O   1 
ATOM 8947  C CB  . TRP C  1 304 ? 98.543  126.748  14.253  1.00 50.18  ?  312 TRP C CB  1 
ATOM 8948  C CG  . TRP C  1 304 ? 97.383  125.883  14.615  1.00 49.81  ?  312 TRP C CG  1 
ATOM 8949  C CD1 . TRP C  1 304 ? 97.307  125.011  15.659  1.00 49.80  ?  312 TRP C CD1 1 
ATOM 8950  C CD2 . TRP C  1 304 ? 96.128  125.800  13.929  1.00 49.52  ?  312 TRP C CD2 1 
ATOM 8951  N NE1 . TRP C  1 304 ? 96.081  124.389  15.668  1.00 49.51  ?  312 TRP C NE1 1 
ATOM 8952  C CE2 . TRP C  1 304 ? 95.339  124.857  14.616  1.00 49.32  ?  312 TRP C CE2 1 
ATOM 8953  C CE3 . TRP C  1 304 ? 95.594  126.433  12.803  1.00 49.52  ?  312 TRP C CE3 1 
ATOM 8954  C CZ2 . TRP C  1 304 ? 94.046  124.532  14.213  1.00 49.09  ?  312 TRP C CZ2 1 
ATOM 8955  C CZ3 . TRP C  1 304 ? 94.311  126.108  12.404  1.00 49.30  ?  312 TRP C CZ3 1 
ATOM 8956  C CH2 . TRP C  1 304 ? 93.553  125.165  13.107  1.00 49.08  ?  312 TRP C CH2 1 
ATOM 8957  N N   . LEU C  1 305 ? 100.631 127.872  11.727  1.00 61.29  ?  313 LEU C N   1 
ATOM 8958  C CA  . LEU C  1 305 ? 101.850 128.621  11.453  1.00 63.02  ?  313 LEU C CA  1 
ATOM 8959  C C   . LEU C  1 305 ? 101.781 129.945  12.206  1.00 63.61  ?  313 LEU C C   1 
ATOM 8960  O O   . LEU C  1 305 ? 100.948 130.804  11.895  1.00 62.65  ?  313 LEU C O   1 
ATOM 8961  C CB  . LEU C  1 305 ? 102.020 128.842  9.952   1.00 59.34  ?  313 LEU C CB  1 
ATOM 8962  C CG  . LEU C  1 305 ? 103.290 129.550  9.476   1.00 61.42  ?  313 LEU C CG  1 
ATOM 8963  C CD1 . LEU C  1 305 ? 103.768 128.934  8.175   1.00 56.15  ?  313 LEU C CD1 1 
ATOM 8964  C CD2 . LEU C  1 305 ? 103.053 131.045  9.296   1.00 68.80  ?  313 LEU C CD2 1 
ATOM 8965  N N   . HIS C  1 306 ? 102.654 130.111  13.196  1.00 65.00  ?  314 HIS C N   1 
ATOM 8966  C CA  . HIS C  1 306 ? 102.746 131.377  13.909  1.00 66.49  ?  314 HIS C CA  1 
ATOM 8967  C C   . HIS C  1 306 ? 103.992 132.124  13.460  1.00 70.04  ?  314 HIS C C   1 
ATOM 8968  O O   . HIS C  1 306 ? 103.895 133.169  12.807  1.00 72.94  ?  314 HIS C O   1 
ATOM 8969  C CB  . HIS C  1 306 ? 102.756 131.148  15.420  1.00 67.30  ?  314 HIS C CB  1 
ATOM 8970  C CG  . HIS C  1 306 ? 101.458 130.631  15.956  1.00 77.12  ?  314 HIS C CG  1 
ATOM 8971  N ND1 . HIS C  1 306 ? 101.255 129.304  16.267  1.00 76.86  ?  314 HIS C ND1 1 
ATOM 8972  C CD2 . HIS C  1 306 ? 100.294 131.265  16.233  1.00 81.79  ?  314 HIS C CD2 1 
ATOM 8973  C CE1 . HIS C  1 306 ? 100.022 129.142  16.712  1.00 78.70  ?  314 HIS C CE1 1 
ATOM 8974  N NE2 . HIS C  1 306 ? 99.417  130.316  16.702  1.00 82.38  ?  314 HIS C NE2 1 
ATOM 8975  N N   . LYS C  1 307 ? 105.161 131.600  13.816  1.00 72.01  ?  315 LYS C N   1 
ATOM 8976  C CA  . LYS C  1 307 ? 106.440 132.130  13.365  1.00 72.57  ?  315 LYS C CA  1 
ATOM 8977  C C   . LYS C  1 307 ? 107.030 131.186  12.329  1.00 67.35  ?  315 LYS C C   1 
ATOM 8978  O O   . LYS C  1 307 ? 107.163 129.984  12.584  1.00 66.83  ?  315 LYS C O   1 
ATOM 8979  C CB  . LYS C  1 307 ? 107.408 132.307  14.537  1.00 82.66  ?  315 LYS C CB  1 
ATOM 8980  C CG  . LYS C  1 307 ? 106.742 132.768  15.822  1.00 92.82  ?  315 LYS C CG  1 
ATOM 8981  C CD  . LYS C  1 307 ? 107.737 132.841  16.969  1.00 97.54  ?  315 LYS C CD  1 
ATOM 8982  C CE  . LYS C  1 307 ? 107.031 133.005  18.305  1.00 100.08 ?  315 LYS C CE  1 
ATOM 8983  N NZ  . LYS C  1 307 ? 106.294 131.772  18.686  1.00 99.64  1  315 LYS C NZ  1 
ATOM 8984  N N   . ALA C  1 308 ? 107.379 131.729  11.167  1.00 64.19  ?  316 ALA C N   1 
ATOM 8985  C CA  . ALA C  1 308 ? 107.993 130.938  10.115  1.00 61.33  ?  316 ALA C CA  1 
ATOM 8986  C C   . ALA C  1 308 ? 109.496 130.807  10.348  1.00 60.35  ?  316 ALA C C   1 
ATOM 8987  O O   . ALA C  1 308 ? 110.095 131.517  11.159  1.00 60.21  ?  316 ALA C O   1 
ATOM 8988  C CB  . ALA C  1 308 ? 107.717 131.563  8.751   1.00 58.77  ?  316 ALA C CB  1 
ATOM 8989  N N   . GLN C  1 309 ? 110.109 129.876  9.613   1.00 60.22  ?  317 GLN C N   1 
ATOM 8990  C CA  . GLN C  1 309 ? 111.552 129.683  9.726   1.00 61.55  ?  317 GLN C CA  1 
ATOM 8991  C C   . GLN C  1 309 ? 112.327 130.800  9.036   1.00 61.33  ?  317 GLN C C   1 
ATOM 8992  O O   . GLN C  1 309 ? 113.415 131.170  9.491   1.00 57.33  ?  317 GLN C O   1 
ATOM 8993  C CB  . GLN C  1 309 ? 111.944 128.311  9.165   1.00 56.93  ?  317 GLN C CB  1 
ATOM 8994  C CG  . GLN C  1 309 ? 111.768 128.143  7.655   1.00 61.78  ?  317 GLN C CG  1 
ATOM 8995  C CD  . GLN C  1 309 ? 112.956 128.647  6.854   1.00 65.88  ?  317 GLN C CD  1 
ATOM 8996  O OE1 . GLN C  1 309 ? 114.063 128.776  7.376   1.00 65.43  ?  317 GLN C OE1 1 
ATOM 8997  N NE2 . GLN C  1 309 ? 112.727 128.940  5.580   1.00 71.89  ?  317 GLN C NE2 1 
ATOM 8998  N N   . GLY C  1 310 ? 111.787 131.349  7.947   1.00 63.01  ?  318 GLY C N   1 
ATOM 8999  C CA  . GLY C  1 310 ? 112.426 132.424  7.223   1.00 62.66  ?  318 GLY C CA  1 
ATOM 9000  C C   . GLY C  1 310 ? 111.796 133.772  7.524   1.00 59.64  ?  318 GLY C C   1 
ATOM 9001  O O   . GLY C  1 310 ? 110.954 133.921  8.411   1.00 58.75  ?  318 GLY C O   1 
ATOM 9002  N N   . LEU C  1 311 ? 112.221 134.777  6.754   1.00 56.35  ?  319 LEU C N   1 
ATOM 9003  C CA  . LEU C  1 311 ? 111.694 136.120  6.970   1.00 57.49  ?  319 LEU C CA  1 
ATOM 9004  C C   . LEU C  1 311 ? 110.271 136.255  6.445   1.00 62.76  ?  319 LEU C C   1 
ATOM 9005  O O   . LEU C  1 311 ? 109.463 136.981  7.034   1.00 69.01  ?  319 LEU C O   1 
ATOM 9006  C CB  . LEU C  1 311 ? 112.609 137.163  6.328   1.00 59.00  ?  319 LEU C CB  1 
ATOM 9007  C CG  . LEU C  1 311 ? 113.648 137.778  7.275   1.00 58.63  ?  319 LEU C CG  1 
ATOM 9008  C CD1 . LEU C  1 311 ? 114.560 136.716  7.857   1.00 56.96  ?  319 LEU C CD1 1 
ATOM 9009  C CD2 . LEU C  1 311 ? 114.463 138.856  6.592   1.00 60.75  ?  319 LEU C CD2 1 
ATOM 9010  N N   . ASN C  1 312 ? 109.943 135.570  5.351   1.00 57.39  ?  320 ASN C N   1 
ATOM 9011  C CA  . ASN C  1 312 ? 108.562 135.514  4.885   1.00 57.88  ?  320 ASN C CA  1 
ATOM 9012  C C   . ASN C  1 312 ? 107.757 134.674  5.866   1.00 55.91  ?  320 ASN C C   1 
ATOM 9013  O O   . ASN C  1 312 ? 107.956 133.459  5.964   1.00 60.47  ?  320 ASN C O   1 
ATOM 9014  C CB  . ASN C  1 312 ? 108.494 134.932  3.477   1.00 56.52  ?  320 ASN C CB  1 
ATOM 9015  C CG  . ASN C  1 312 ? 107.120 135.087  2.844   1.00 58.33  ?  320 ASN C CG  1 
ATOM 9016  O OD1 . ASN C  1 312 ? 106.098 135.091  3.531   1.00 57.48  ?  320 ASN C OD1 1 
ATOM 9017  N ND2 . ASN C  1 312 ? 107.091 135.212  1.522   1.00 62.87  ?  320 ASN C ND2 1 
ATOM 9018  N N   . ASN C  1 313 ? 106.845 135.313  6.590   1.00 54.64  ?  321 ASN C N   1 
ATOM 9019  C CA  . ASN C  1 313 ? 106.098 134.643  7.653   1.00 53.86  ?  321 ASN C CA  1 
ATOM 9020  C C   . ASN C  1 313 ? 104.739 134.172  7.137   1.00 54.10  ?  321 ASN C C   1 
ATOM 9021  O O   . ASN C  1 313 ? 103.677 134.579  7.610   1.00 54.06  ?  321 ASN C O   1 
ATOM 9022  C CB  . ASN C  1 313 ? 105.951 135.569  8.855   1.00 64.62  ?  321 ASN C CB  1 
ATOM 9023  C CG  . ASN C  1 313 ? 105.505 134.836  10.101  1.00 63.84  ?  321 ASN C CG  1 
ATOM 9024  O OD1 . ASN C  1 313 ? 106.103 133.835  10.495  1.00 62.60  ?  321 ASN C OD1 1 
ATOM 9025  N ND2 . ASN C  1 313 ? 104.452 135.336  10.735  1.00 64.43  ?  321 ASN C ND2 1 
ATOM 9026  N N   . GLY C  1 314 ? 104.796 133.284  6.148   1.00 53.04  ?  322 GLY C N   1 
ATOM 9027  C CA  . GLY C  1 314 ? 103.592 132.685  5.604   1.00 55.81  ?  322 GLY C CA  1 
ATOM 9028  C C   . GLY C  1 314 ? 102.754 133.607  4.751   1.00 56.61  ?  322 GLY C C   1 
ATOM 9029  O O   . GLY C  1 314 ? 101.527 133.470  4.724   1.00 59.23  ?  322 GLY C O   1 
ATOM 9030  N N   . ILE C  1 315 ? 103.380 134.545  4.051   1.00 47.98  ?  323 ILE C N   1 
ATOM 9031  C CA  . ILE C  1 315 ? 102.661 135.483  3.198   1.00 50.63  ?  323 ILE C CA  1 
ATOM 9032  C C   . ILE C  1 315 ? 102.649 134.944  1.773   1.00 53.13  ?  323 ILE C C   1 
ATOM 9033  O O   . ILE C  1 315 ? 103.704 134.662  1.195   1.00 52.73  ?  323 ILE C O   1 
ATOM 9034  C CB  . ILE C  1 315 ? 103.289 136.879  3.261   1.00 49.64  ?  323 ILE C CB  1 
ATOM 9035  C CG1 . ILE C  1 315 ? 103.109 137.454  4.662   1.00 48.28  ?  323 ILE C CG1 1 
ATOM 9036  C CG2 . ILE C  1 315 ? 102.662 137.791  2.223   1.00 52.93  ?  323 ILE C CG2 1 
ATOM 9037  C CD1 . ILE C  1 315 ? 103.563 138.869  4.790   1.00 55.90  ?  323 ILE C CD1 1 
ATOM 9038  N N   . CYS C  1 316 ? 101.450 134.812  1.204   1.00 48.67  ?  324 CYS C N   1 
ATOM 9039  C CA  . CYS C  1 316 ? 101.273 134.200  -0.112  1.00 49.57  ?  324 CYS C CA  1 
ATOM 9040  C C   . CYS C  1 316 ? 101.300 135.294  -1.174  1.00 50.86  ?  324 CYS C C   1 
ATOM 9041  O O   . CYS C  1 316 ? 100.270 135.798  -1.624  1.00 52.07  ?  324 CYS C O   1 
ATOM 9042  C CB  . CYS C  1 316 ? 99.974  133.407  -0.157  1.00 60.59  ?  324 CYS C CB  1 
ATOM 9043  S SG  . CYS C  1 316 ? 99.764  132.242  1.208   1.00 61.94  ?  324 CYS C SG  1 
ATOM 9044  N N   . TRP C  1 317 ? 102.515 135.665  -1.575  1.00 52.33  ?  325 TRP C N   1 
ATOM 9045  C CA  . TRP C  1 317 ? 102.680 136.632  -2.651  1.00 56.46  ?  325 TRP C CA  1 
ATOM 9046  C C   . TRP C  1 317 ? 102.052 136.108  -3.938  1.00 58.83  ?  325 TRP C C   1 
ATOM 9047  O O   . TRP C  1 317 ? 102.058 134.905  -4.215  1.00 60.91  ?  325 TRP C O   1 
ATOM 9048  C CB  . TRP C  1 317 ? 104.161 136.943  -2.875  1.00 56.93  ?  325 TRP C CB  1 
ATOM 9049  C CG  . TRP C  1 317 ? 104.846 137.553  -1.685  1.00 56.69  ?  325 TRP C CG  1 
ATOM 9050  C CD1 . TRP C  1 317 ? 105.823 136.983  -0.920  1.00 56.80  ?  325 TRP C CD1 1 
ATOM 9051  C CD2 . TRP C  1 317 ? 104.613 138.856  -1.132  1.00 55.75  ?  325 TRP C CD2 1 
ATOM 9052  N NE1 . TRP C  1 317 ? 106.209 137.847  0.077   1.00 54.09  ?  325 TRP C NE1 1 
ATOM 9053  C CE2 . TRP C  1 317 ? 105.482 139.003  -0.031  1.00 53.45  ?  325 TRP C CE2 1 
ATOM 9054  C CE3 . TRP C  1 317 ? 103.754 139.909  -1.458  1.00 58.09  ?  325 TRP C CE3 1 
ATOM 9055  C CZ2 . TRP C  1 317 ? 105.517 140.161  0.743   1.00 52.25  ?  325 TRP C CZ2 1 
ATOM 9056  C CZ3 . TRP C  1 317 ? 103.790 141.059  -0.688  1.00 57.72  ?  325 TRP C CZ3 1 
ATOM 9057  C CH2 . TRP C  1 317 ? 104.666 141.175  0.400   1.00 54.79  ?  325 TRP C CH2 1 
ATOM 9058  N N   . HIS C  1 318 ? 101.506 137.033  -4.727  1.00 52.72  ?  326 HIS C N   1 
ATOM 9059  C CA  . HIS C  1 318 ? 100.787 136.734  -5.965  1.00 55.39  ?  326 HIS C CA  1 
ATOM 9060  C C   . HIS C  1 318 ? 99.574  135.840  -5.731  1.00 54.82  ?  326 HIS C C   1 
ATOM 9061  O O   . HIS C  1 318 ? 99.060  135.232  -6.676  1.00 57.63  ?  326 HIS C O   1 
ATOM 9062  C CB  . HIS C  1 318 ? 101.710 136.108  -7.017  1.00 58.51  ?  326 HIS C CB  1 
ATOM 9063  C CG  . HIS C  1 318 ? 102.715 137.064  -7.578  1.00 60.47  ?  326 HIS C CG  1 
ATOM 9064  N ND1 . HIS C  1 318 ? 104.033 137.078  -7.177  1.00 58.86  ?  326 HIS C ND1 1 
ATOM 9065  C CD2 . HIS C  1 318 ? 102.593 138.043  -8.505  1.00 63.86  ?  326 HIS C CD2 1 
ATOM 9066  C CE1 . HIS C  1 318 ? 104.681 138.023  -7.835  1.00 61.20  ?  326 HIS C CE1 1 
ATOM 9067  N NE2 . HIS C  1 318 ? 103.830 138.623  -8.647  1.00 64.12  ?  326 HIS C NE2 1 
ATOM 9068  N N   . ASN C  1 319 ? 99.108  135.760  -4.482  1.00 55.77  ?  327 ASN C N   1 
ATOM 9069  C CA  . ASN C  1 319 ? 97.886  135.035  -4.129  1.00 56.18  ?  327 ASN C CA  1 
ATOM 9070  C C   . ASN C  1 319 ? 97.947  133.573  -4.567  1.00 55.68  ?  327 ASN C C   1 
ATOM 9071  O O   . ASN C  1 319 ? 96.993  133.033  -5.131  1.00 55.97  ?  327 ASN C O   1 
ATOM 9072  C CB  . ASN C  1 319 ? 96.651  135.729  -4.706  1.00 61.04  ?  327 ASN C CB  1 
ATOM 9073  C CG  . ASN C  1 319 ? 96.679  137.229  -4.491  1.00 62.75  ?  327 ASN C CG  1 
ATOM 9074  O OD1 . ASN C  1 319 ? 96.373  138.003  -5.397  1.00 63.45  ?  327 ASN C OD1 1 
ATOM 9075  N ND2 . ASN C  1 319 ? 97.057  137.647  -3.287  1.00 63.03  ?  327 ASN C ND2 1 
ATOM 9076  N N   . GLN C  1 320 ? 99.083  132.930  -4.313  1.00 59.66  ?  328 GLN C N   1 
ATOM 9077  C CA  . GLN C  1 320 ? 99.259  131.519  -4.617  1.00 57.66  ?  328 GLN C CA  1 
ATOM 9078  C C   . GLN C  1 320 ? 100.038 130.866  -3.486  1.00 53.59  ?  328 GLN C C   1 
ATOM 9079  O O   . GLN C  1 320 ? 100.707 131.537  -2.696  1.00 51.85  ?  328 GLN C O   1 
ATOM 9080  C CB  . GLN C  1 320 ? 99.981  131.308  -5.954  1.00 60.00  ?  328 GLN C CB  1 
ATOM 9081  C CG  . GLN C  1 320 ? 101.421 131.784  -5.963  1.00 58.43  ?  328 GLN C CG  1 
ATOM 9082  C CD  . GLN C  1 320 ? 102.092 131.564  -7.301  1.00 60.63  ?  328 GLN C CD  1 
ATOM 9083  O OE1 . GLN C  1 320 ? 101.482 131.045  -8.236  1.00 58.95  ?  328 GLN C OE1 1 
ATOM 9084  N NE2 . GLN C  1 320 ? 103.357 131.953  -7.399  1.00 66.73  ?  328 GLN C NE2 1 
ATOM 9085  N N   . LEU C  1 321 ? 99.950  129.540  -3.421  1.00 55.83  ?  329 LEU C N   1 
ATOM 9086  C CA  . LEU C  1 321 ? 100.563 128.785  -2.338  1.00 51.69  ?  329 LEU C CA  1 
ATOM 9087  C C   . LEU C  1 321 ? 100.927 127.401  -2.846  1.00 51.59  ?  329 LEU C C   1 
ATOM 9088  O O   . LEU C  1 321 ? 100.072 126.685  -3.374  1.00 53.44  ?  329 LEU C O   1 
ATOM 9089  C CB  . LEU C  1 321 ? 99.620  128.689  -1.130  1.00 53.79  ?  329 LEU C CB  1 
ATOM 9090  C CG  . LEU C  1 321 ? 100.065 127.869  0.084   1.00 53.40  ?  329 LEU C CG  1 
ATOM 9091  C CD1 . LEU C  1 321 ? 99.609  128.551  1.362   1.00 51.92  ?  329 LEU C CD1 1 
ATOM 9092  C CD2 . LEU C  1 321 ? 99.523  126.444  0.028   1.00 56.83  ?  329 LEU C CD2 1 
ATOM 9093  N N   . PHE C  1 322 ? 102.191 127.035  -2.678  1.00 57.69  ?  330 PHE C N   1 
ATOM 9094  C CA  . PHE C  1 322 ? 102.728 125.762  -3.135  1.00 55.36  ?  330 PHE C CA  1 
ATOM 9095  C C   . PHE C  1 322 ? 102.831 124.803  -1.958  1.00 50.78  ?  330 PHE C C   1 
ATOM 9096  O O   . PHE C  1 322 ? 103.435 125.133  -0.929  1.00 50.17  ?  330 PHE C O   1 
ATOM 9097  C CB  . PHE C  1 322 ? 104.092 125.979  -3.789  1.00 48.97  ?  330 PHE C CB  1 
ATOM 9098  C CG  . PHE C  1 322 ? 104.002 126.485  -5.196  1.00 52.13  ?  330 PHE C CG  1 
ATOM 9099  C CD1 . PHE C  1 322 ? 103.220 125.828  -6.128  1.00 53.87  ?  330 PHE C CD1 1 
ATOM 9100  C CD2 . PHE C  1 322 ? 104.618 127.667  -5.562  1.00 57.34  ?  330 PHE C CD2 1 
ATOM 9101  C CE1 . PHE C  1 322 ? 103.120 126.298  -7.419  1.00 59.99  ?  330 PHE C CE1 1 
ATOM 9102  C CE2 . PHE C  1 322 ? 104.504 128.152  -6.851  1.00 62.04  ?  330 PHE C CE2 1 
ATOM 9103  C CZ  . PHE C  1 322 ? 103.756 127.465  -7.780  1.00 62.94  ?  330 PHE C CZ  1 
ATOM 9104  N N   . LEU C  1 323 ? 102.226 123.624  -2.108  1.00 45.97  ?  331 LEU C N   1 
ATOM 9105  C CA  . LEU C  1 323 ? 102.187 122.616  -1.053  1.00 46.36  ?  331 LEU C CA  1 
ATOM 9106  C C   . LEU C  1 323 ? 102.854 121.350  -1.574  1.00 46.40  ?  331 LEU C C   1 
ATOM 9107  O O   . LEU C  1 323 ? 102.278 120.636  -2.401  1.00 46.87  ?  331 LEU C O   1 
ATOM 9108  C CB  . LEU C  1 323 ? 100.744 122.341  -0.621  1.00 50.95  ?  331 LEU C CB  1 
ATOM 9109  C CG  . LEU C  1 323 ? 100.426 121.732  0.752   1.00 48.13  ?  331 LEU C CG  1 
ATOM 9110  C CD1 . LEU C  1 323 ? 98.923  121.578  0.909   1.00 48.91  ?  331 LEU C CD1 1 
ATOM 9111  C CD2 . LEU C  1 323 ? 101.111 120.393  0.984   1.00 47.50  ?  331 LEU C CD2 1 
ATOM 9112  N N   . THR C  1 324 ? 104.053 121.061  -1.077  1.00 50.93  ?  332 THR C N   1 
ATOM 9113  C CA  . THR C  1 324 ? 104.755 119.824  -1.397  1.00 48.66  ?  332 THR C CA  1 
ATOM 9114  C C   . THR C  1 324 ? 104.536 118.823  -0.269  1.00 45.00  ?  332 THR C C   1 
ATOM 9115  O O   . THR C  1 324 ? 104.656 119.174  0.907   1.00 47.80  ?  332 THR C O   1 
ATOM 9116  C CB  . THR C  1 324 ? 106.250 120.080  -1.606  1.00 46.11  ?  332 THR C CB  1 
ATOM 9117  O OG1 . THR C  1 324 ? 106.430 121.043  -2.653  1.00 48.54  ?  332 THR C OG1 1 
ATOM 9118  C CG2 . THR C  1 324 ? 106.960 118.794  -1.991  1.00 45.18  ?  332 THR C CG2 1 
ATOM 9119  N N   . VAL C  1 325 ? 104.193 117.588  -0.626  1.00 41.52  ?  333 VAL C N   1 
ATOM 9120  C CA  . VAL C  1 325 ? 103.870 116.568  0.367   1.00 41.17  ?  333 VAL C CA  1 
ATOM 9121  C C   . VAL C  1 325 ? 104.265 115.202  -0.177  1.00 41.12  ?  333 VAL C C   1 
ATOM 9122  O O   . VAL C  1 325 ? 104.057 114.901  -1.357  1.00 41.47  ?  333 VAL C O   1 
ATOM 9123  C CB  . VAL C  1 325 ? 102.374 116.617  0.755   1.00 43.04  ?  333 VAL C CB  1 
ATOM 9124  C CG1 . VAL C  1 325 ? 101.501 116.706  -0.478  1.00 43.58  ?  333 VAL C CG1 1 
ATOM 9125  C CG2 . VAL C  1 325 ? 101.988 115.398  1.574   1.00 42.75  ?  333 VAL C CG2 1 
ATOM 9126  N N   . VAL C  1 326 ? 104.873 114.391  0.690   1.00 42.26  ?  334 VAL C N   1 
ATOM 9127  C CA  . VAL C  1 326 ? 105.190 112.996  0.408   1.00 45.03  ?  334 VAL C CA  1 
ATOM 9128  C C   . VAL C  1 326 ? 104.675 112.149  1.563   1.00 46.51  ?  334 VAL C C   1 
ATOM 9129  O O   . VAL C  1 326 ? 104.960 112.445  2.729   1.00 46.51  ?  334 VAL C O   1 
ATOM 9130  C CB  . VAL C  1 326 ? 106.701 112.772  0.209   1.00 39.63  ?  334 VAL C CB  1 
ATOM 9131  C CG1 . VAL C  1 326 ? 107.007 111.285  0.116   1.00 39.46  ?  334 VAL C CG1 1 
ATOM 9132  C CG2 . VAL C  1 326 ? 107.171 113.485  -1.034  1.00 39.99  ?  334 VAL C CG2 1 
ATOM 9133  N N   . ASP C  1 327 ? 103.923 111.099  1.239   1.00 45.19  ?  335 ASP C N   1 
ATOM 9134  C CA  . ASP C  1 327 ? 103.360 110.198  2.241   1.00 44.75  ?  335 ASP C CA  1 
ATOM 9135  C C   . ASP C  1 327 ? 103.444 108.779  1.700   1.00 47.68  ?  335 ASP C C   1 
ATOM 9136  O O   . ASP C  1 327 ? 102.657 108.398  0.828   1.00 55.31  ?  335 ASP C O   1 
ATOM 9137  C CB  . ASP C  1 327 ? 101.916 110.570  2.576   1.00 47.01  ?  335 ASP C CB  1 
ATOM 9138  C CG  . ASP C  1 327 ? 101.309 109.667  3.636   1.00 54.49  ?  335 ASP C CG  1 
ATOM 9139  O OD1 . ASP C  1 327 ? 102.073 108.975  4.343   1.00 54.23  ?  335 ASP C OD1 1 
ATOM 9140  O OD2 . ASP C  1 327 ? 100.066 109.650  3.762   1.00 61.79  -1 335 ASP C OD2 1 
ATOM 9141  N N   . THR C  1 328 ? 104.385 107.997  2.223   1.00 47.17  ?  336 THR C N   1 
ATOM 9142  C CA  . THR C  1 328 ? 104.577 106.618  1.803   1.00 45.81  ?  336 THR C CA  1 
ATOM 9143  C C   . THR C  1 328 ? 103.961 105.626  2.780   1.00 46.04  ?  336 THR C C   1 
ATOM 9144  O O   . THR C  1 328 ? 104.197 104.419  2.658   1.00 44.90  ?  336 THR C O   1 
ATOM 9145  C CB  . THR C  1 328 ? 106.066 106.320  1.627   1.00 41.00  ?  336 THR C CB  1 
ATOM 9146  O OG1 . THR C  1 328 ? 106.694 106.238  2.913   1.00 40.36  ?  336 THR C OG1 1 
ATOM 9147  C CG2 . THR C  1 328 ? 106.727 107.421  0.816   1.00 41.41  ?  336 THR C CG2 1 
ATOM 9148  N N   . THR C  1 329 ? 103.172 106.108  3.739   1.00 47.81  ?  337 THR C N   1 
ATOM 9149  C CA  . THR C  1 329 ? 102.527 105.249  4.722   1.00 46.61  ?  337 THR C CA  1 
ATOM 9150  C C   . THR C  1 329 ? 101.235 104.636  4.203   1.00 54.09  ?  337 THR C C   1 
ATOM 9151  O O   . THR C  1 329 ? 100.566 103.911  4.948   1.00 53.42  ?  337 THR C O   1 
ATOM 9152  C CB  . THR C  1 329 ? 102.243 106.040  6.001   1.00 39.40  ?  337 THR C CB  1 
ATOM 9153  O OG1 . THR C  1 329 ? 101.358 107.126  5.703   1.00 39.73  ?  337 THR C OG1 1 
ATOM 9154  C CG2 . THR C  1 329 ? 103.535 106.596  6.577   1.00 39.06  ?  337 THR C CG2 1 
ATOM 9155  N N   . ARG C  1 330 ? 100.877 104.907  2.950   1.00 50.59  ?  338 ARG C N   1 
ATOM 9156  C CA  . ARG C  1 330 ? 99.704  104.351  2.285   1.00 48.95  ?  338 ARG C CA  1 
ATOM 9157  C C   . ARG C  1 330 ? 100.101 103.786  0.932   1.00 49.83  ?  338 ARG C C   1 
ATOM 9158  O O   . ARG C  1 330 ? 99.475  104.052  -0.096  1.00 55.01  ?  338 ARG C O   1 
ATOM 9159  C CB  . ARG C  1 330 ? 98.609  105.403  2.126   1.00 47.95  ?  338 ARG C CB  1 
ATOM 9160  C CG  . ARG C  1 330 ? 97.955  105.832  3.427   1.00 50.39  ?  338 ARG C CG  1 
ATOM 9161  C CD  . ARG C  1 330 ? 97.193  107.138  3.261   1.00 51.69  ?  338 ARG C CD  1 
ATOM 9162  N NE  . ARG C  1 330 ? 96.384  107.445  4.437   1.00 49.38  ?  338 ARG C NE  1 
ATOM 9163  C CZ  . ARG C  1 330 ? 96.848  108.050  5.525   1.00 47.03  ?  338 ARG C CZ  1 
ATOM 9164  N NH1 . ARG C  1 330 ? 98.122  108.414  5.590   1.00 42.63  1  338 ARG C NH1 1 
ATOM 9165  N NH2 . ARG C  1 330 ? 96.040  108.292  6.548   1.00 50.47  ?  338 ARG C NH2 1 
ATOM 9166  N N   . SER C  1 331 ? 101.165 102.987  0.922   1.00 50.74  ?  339 SER C N   1 
ATOM 9167  C CA  . SER C  1 331 ? 101.763 102.498  -0.311  1.00 45.95  ?  339 SER C CA  1 
ATOM 9168  C C   . SER C  1 331 ? 101.164 101.182  -0.786  1.00 45.03  ?  339 SER C C   1 
ATOM 9169  O O   . SER C  1 331 ? 101.672 100.600  -1.748  1.00 45.28  ?  339 SER C O   1 
ATOM 9170  C CB  . SER C  1 331 ? 103.277 102.343  -0.136  1.00 44.21  ?  339 SER C CB  1 
ATOM 9171  O OG  . SER C  1 331 ? 103.585 101.446  0.916   1.00 43.80  ?  339 SER C OG  1 
ATOM 9172  N N   . THR C  1 332 ? 100.096 100.710  -0.149  1.00 44.93  ?  340 THR C N   1 
ATOM 9173  C CA  . THR C  1 332 ? 99.468  99.467   -0.572  1.00 45.09  ?  340 THR C CA  1 
ATOM 9174  C C   . THR C  1 332 ? 98.995  99.574   -2.017  1.00 46.92  ?  340 THR C C   1 
ATOM 9175  O O   . THR C  1 332 ? 98.574  100.635  -2.483  1.00 48.41  ?  340 THR C O   1 
ATOM 9176  C CB  . THR C  1 332 ? 98.294  99.123   0.349   1.00 43.64  ?  340 THR C CB  1 
ATOM 9177  O OG1 . THR C  1 332 ? 97.569  98.010   -0.189  1.00 44.05  ?  340 THR C OG1 1 
ATOM 9178  C CG2 . THR C  1 332 ? 97.358  100.318  0.501   1.00 43.88  ?  340 THR C CG2 1 
ATOM 9179  N N   . ASN C  1 333 ? 99.082  98.458   -2.734  1.00 48.13  ?  341 ASN C N   1 
ATOM 9180  C CA  . ASN C  1 333 ? 98.754  98.405   -4.151  1.00 50.43  ?  341 ASN C CA  1 
ATOM 9181  C C   . ASN C  1 333 ? 97.580  97.461   -4.356  1.00 53.57  ?  341 ASN C C   1 
ATOM 9182  O O   . ASN C  1 333 ? 97.606  96.319   -3.884  1.00 59.17  ?  341 ASN C O   1 
ATOM 9183  C CB  . ASN C  1 333 ? 99.951  97.937   -4.986  1.00 48.41  ?  341 ASN C CB  1 
ATOM 9184  C CG  . ASN C  1 333 ? 101.011 99.008   -5.143  1.00 46.94  ?  341 ASN C CG  1 
ATOM 9185  O OD1 . ASN C  1 333 ? 100.699 100.175  -5.383  1.00 50.30  ?  341 ASN C OD1 1 
ATOM 9186  N ND2 . ASN C  1 333 ? 102.274 98.615   -5.015  1.00 40.18  ?  341 ASN C ND2 1 
ATOM 9187  N N   . LEU C  1 334 ? 96.555  97.941   -5.052  1.00 43.51  ?  342 LEU C N   1 
ATOM 9188  C CA  . LEU C  1 334 ? 95.423  97.099   -5.404  1.00 46.19  ?  342 LEU C CA  1 
ATOM 9189  C C   . LEU C  1 334 ? 95.800  96.196   -6.570  1.00 53.27  ?  342 LEU C C   1 
ATOM 9190  O O   . LEU C  1 334 ? 96.359  96.658   -7.569  1.00 56.25  ?  342 LEU C O   1 
ATOM 9191  C CB  . LEU C  1 334 ? 94.214  97.953   -5.778  1.00 43.94  ?  342 LEU C CB  1 
ATOM 9192  C CG  . LEU C  1 334 ? 93.779  99.006   -4.766  1.00 43.82  ?  342 LEU C CG  1 
ATOM 9193  C CD1 . LEU C  1 334 ? 92.559  99.751   -5.283  1.00 44.29  ?  342 LEU C CD1 1 
ATOM 9194  C CD2 . LEU C  1 334 ? 93.505  98.370   -3.414  1.00 44.40  ?  342 LEU C CD2 1 
ATOM 9195  N N   . SER C  1 335 ? 95.492  94.910   -6.443  1.00 54.77  ?  343 SER C N   1 
ATOM 9196  C CA  . SER C  1 335 ? 95.689  93.943   -7.516  1.00 51.20  ?  343 SER C CA  1 
ATOM 9197  C C   . SER C  1 335 ? 94.310  93.544   -8.023  1.00 53.30  ?  343 SER C C   1 
ATOM 9198  O O   . SER C  1 335 ? 93.557  92.860   -7.322  1.00 57.68  ?  343 SER C O   1 
ATOM 9199  C CB  . SER C  1 335 ? 96.484  92.728   -7.040  1.00 53.38  ?  343 SER C CB  1 
ATOM 9200  O OG  . SER C  1 335 ? 95.851  92.089   -5.946  1.00 56.49  ?  343 SER C OG  1 
ATOM 9201  N N   . VAL C  1 336 ? 93.979  93.986   -9.232  1.00 48.72  ?  344 VAL C N   1 
ATOM 9202  C CA  . VAL C  1 336 ? 92.711  93.672   -9.880  1.00 50.98  ?  344 VAL C CA  1 
ATOM 9203  C C   . VAL C  1 336 ? 92.989  92.658   -10.976 1.00 59.07  ?  344 VAL C C   1 
ATOM 9204  O O   . VAL C  1 336 ? 93.899  92.856   -11.785 1.00 68.46  ?  344 VAL C O   1 
ATOM 9205  C CB  . VAL C  1 336 ? 92.057  94.937   -10.459 1.00 51.05  ?  344 VAL C CB  1 
ATOM 9206  C CG1 . VAL C  1 336 ? 90.834  94.581   -11.288 1.00 54.23  ?  344 VAL C CG1 1 
ATOM 9207  C CG2 . VAL C  1 336 ? 91.702  95.907   -9.342  1.00 50.21  ?  344 VAL C CG2 1 
ATOM 9208  N N   . CYS C  1 337 ? 92.199  91.591   -11.026 1.00 56.91  ?  345 CYS C N   1 
ATOM 9209  C CA  . CYS C  1 337 ? 92.380  90.567   -12.045 1.00 62.53  ?  345 CYS C CA  1 
ATOM 9210  C C   . CYS C  1 337 ? 91.039  90.252   -12.688 1.00 60.75  ?  345 CYS C C   1 
ATOM 9211  O O   . CYS C  1 337 ? 90.002  90.248   -12.017 1.00 58.67  ?  345 CYS C O   1 
ATOM 9212  C CB  . CYS C  1 337 ? 93.013  89.297   -11.464 1.00 63.28  ?  345 CYS C CB  1 
ATOM 9213  S SG  . CYS C  1 337 ? 91.857  88.157   -10.702 1.00 69.17  ?  345 CYS C SG  1 
ATOM 9214  N N   . ALA C  1 338 ? 91.064  90.005   -13.996 1.00 57.55  ?  346 ALA C N   1 
ATOM 9215  C CA  . ALA C  1 338 ? 89.853  89.759   -14.765 1.00 59.93  ?  346 ALA C CA  1 
ATOM 9216  C C   . ALA C  1 338 ? 90.016  88.504   -15.605 1.00 59.70  ?  346 ALA C C   1 
ATOM 9217  O O   . ALA C  1 338 ? 91.068  88.287   -16.212 1.00 59.00  ?  346 ALA C O   1 
ATOM 9218  C CB  . ALA C  1 338 ? 89.515  90.950   -15.672 1.00 61.26  ?  346 ALA C CB  1 
ATOM 9219  N N   . SER C  1 339 ? 88.973  87.681   -15.636 1.00 60.91  ?  347 SER C N   1 
ATOM 9220  C CA  . SER C  1 339 ? 89.033  86.440   -16.393 1.00 66.21  ?  347 SER C CA  1 
ATOM 9221  C C   . SER C  1 339 ? 89.074  86.735   -17.886 1.00 74.09  ?  347 SER C C   1 
ATOM 9222  O O   . SER C  1 339 ? 88.433  87.672   -18.370 1.00 77.53  ?  347 SER C O   1 
ATOM 9223  C CB  . SER C  1 339 ? 87.831  85.555   -16.064 1.00 77.96  ?  347 SER C CB  1 
ATOM 9224  O OG  . SER C  1 339 ? 86.613  86.229   -16.328 1.00 85.58  ?  347 SER C OG  1 
ATOM 9225  N N   . THR C  1 340 ? 89.836  85.922   -18.619 1.00 69.76  ?  348 THR C N   1 
ATOM 9226  C CA  . THR C  1 340 ? 89.933  86.080   -20.063 1.00 79.69  ?  348 THR C CA  1 
ATOM 9227  C C   . THR C  1 340 ? 88.741  85.482   -20.795 1.00 92.22  ?  348 THR C C   1 
ATOM 9228  O O   . THR C  1 340 ? 88.451  85.898   -21.922 1.00 95.03  ?  348 THR C O   1 
ATOM 9229  C CB  . THR C  1 340 ? 91.224  85.441   -20.573 1.00 65.63  ?  348 THR C CB  1 
ATOM 9230  O OG1 . THR C  1 340 ? 91.198  84.034   -20.299 1.00 65.20  ?  348 THR C OG1 1 
ATOM 9231  C CG2 . THR C  1 340 ? 92.426  86.062   -19.882 1.00 64.21  ?  348 THR C CG2 1 
ATOM 9232  N N   . THR C  1 341 ? 88.055  84.518   -20.187 1.00 100.01 ?  349 THR C N   1 
ATOM 9233  C CA  . THR C  1 341 ? 86.799  84.018   -20.722 1.00 104.52 ?  349 THR C CA  1 
ATOM 9234  C C   . THR C  1 341 ? 85.651  84.919   -20.273 1.00 107.28 ?  349 THR C C   1 
ATOM 9235  O O   . THR C  1 341 ? 85.690  85.511   -19.189 1.00 105.04 ?  349 THR C O   1 
ATOM 9236  C CB  . THR C  1 341 ? 86.555  82.577   -20.264 1.00 107.53 ?  349 THR C CB  1 
ATOM 9237  O OG1 . THR C  1 341 ? 87.768  81.821   -20.384 1.00 101.52 ?  349 THR C OG1 1 
ATOM 9238  C CG2 . THR C  1 341 ? 85.476  81.915   -21.111 1.00 112.25 ?  349 THR C CG2 1 
ATOM 9239  N N   . SER C  1 342 ? 84.632  85.035   -21.133 1.00 115.13 ?  350 SER C N   1 
ATOM 9240  C CA  . SER C  1 342 ? 83.498  85.913   -20.845 1.00 112.94 ?  350 SER C CA  1 
ATOM 9241  C C   . SER C  1 342 ? 82.871  85.591   -19.495 1.00 109.53 ?  350 SER C C   1 
ATOM 9242  O O   . SER C  1 342 ? 82.572  86.496   -18.706 1.00 106.51 ?  350 SER C O   1 
ATOM 9243  C CB  . SER C  1 342 ? 82.455  85.806   -21.958 1.00 119.28 ?  350 SER C CB  1 
ATOM 9244  O OG  . SER C  1 342 ? 81.388  86.714   -21.738 1.00 115.66 ?  350 SER C OG  1 
ATOM 9245  N N   . SER C  1 343 ? 82.669  84.307   -19.212 1.00 120.61 ?  351 SER C N   1 
ATOM 9246  C CA  . SER C  1 343 ? 82.276  83.835   -17.894 1.00 119.89 ?  351 SER C CA  1 
ATOM 9247  C C   . SER C  1 343 ? 83.275  82.775   -17.458 1.00 117.65 ?  351 SER C C   1 
ATOM 9248  O O   . SER C  1 343 ? 83.769  82.003   -18.285 1.00 120.82 ?  351 SER C O   1 
ATOM 9249  C CB  . SER C  1 343 ? 80.850  83.266   -17.897 1.00 121.71 ?  351 SER C CB  1 
ATOM 9250  O OG  . SER C  1 343 ? 80.413  82.976   -16.580 1.00 122.75 ?  351 SER C OG  1 
ATOM 9251  N N   . ILE C  1 344 ? 83.574  82.745   -16.167 1.00 117.21 ?  352 ILE C N   1 
ATOM 9252  C CA  . ILE C  1 344 ? 84.668  81.898   -15.678 1.00 109.08 ?  352 ILE C CA  1 
ATOM 9253  C C   . ILE C  1 344 ? 84.281  80.426   -15.803 1.00 112.51 ?  352 ILE C C   1 
ATOM 9254  O O   . ILE C  1 344 ? 83.162  80.040   -15.415 1.00 115.77 ?  352 ILE C O   1 
ATOM 9255  C CB  . ILE C  1 344 ? 85.038  82.276   -14.230 1.00 103.62 ?  352 ILE C CB  1 
ATOM 9256  C CG1 . ILE C  1 344 ? 84.184  81.539   -13.191 1.00 103.57 ?  352 ILE C CG1 1 
ATOM 9257  C CG2 . ILE C  1 344 ? 84.930  83.780   -14.025 1.00 99.71  ?  352 ILE C CG2 1 
ATOM 9258  C CD1 . ILE C  1 344 ? 84.627  81.744   -11.757 1.00 99.74  ?  352 ILE C CD1 1 
ATOM 9259  N N   . PRO C  1 345 ? 85.110  79.594   -16.434 1.00 109.68 ?  353 PRO C N   1 
ATOM 9260  C CA  . PRO C  1 345 ? 85.015  78.150   -16.196 1.00 106.46 ?  353 PRO C CA  1 
ATOM 9261  C C   . PRO C  1 345 ? 85.588  77.843   -14.822 1.00 104.64 ?  353 PRO C C   1 
ATOM 9262  O O   . PRO C  1 345 ? 86.657  78.341   -14.460 1.00 101.86 ?  353 PRO C O   1 
ATOM 9263  C CB  . PRO C  1 345 ? 85.865  77.539   -17.318 1.00 103.29 ?  353 PRO C CB  1 
ATOM 9264  C CG  . PRO C  1 345 ? 86.049  78.643   -18.324 1.00 108.14 ?  353 PRO C CG  1 
ATOM 9265  C CD  . PRO C  1 345 ? 86.051  79.906   -17.520 1.00 106.60 ?  353 PRO C CD  1 
ATOM 9266  N N   . ASN C  1 346 ? 84.874  77.029   -14.048 1.00 100.19 ?  354 ASN C N   1 
ATOM 9267  C CA  . ASN C  1 346 ? 85.277  76.796   -12.665 1.00 90.59  ?  354 ASN C CA  1 
ATOM 9268  C C   . ASN C  1 346 ? 86.574  75.995   -12.588 1.00 76.34  ?  354 ASN C C   1 
ATOM 9269  O O   . ASN C  1 346 ? 86.654  74.998   -11.864 1.00 71.87  ?  354 ASN C O   1 
ATOM 9270  C CB  . ASN C  1 346 ? 84.157  76.088   -11.903 1.00 91.87  ?  354 ASN C CB  1 
ATOM 9271  C CG  . ASN C  1 346 ? 82.979  77.002   -11.624 1.00 94.55  ?  354 ASN C CG  1 
ATOM 9272  O OD1 . ASN C  1 346 ? 82.855  77.559   -10.533 1.00 95.15  ?  354 ASN C OD1 1 
ATOM 9273  N ND2 . ASN C  1 346 ? 82.108  77.164   -12.613 1.00 96.38  ?  354 ASN C ND2 1 
ATOM 9274  N N   . VAL C  1 347 ? 87.598  76.441   -13.314 1.00 81.81  ?  355 VAL C N   1 
ATOM 9275  C CA  . VAL C  1 347 ? 88.919  75.822   -13.320 1.00 72.10  ?  355 VAL C CA  1 
ATOM 9276  C C   . VAL C  1 347 ? 89.956  76.928   -13.459 1.00 67.68  ?  355 VAL C C   1 
ATOM 9277  O O   . VAL C  1 347 ? 89.827  77.803   -14.322 1.00 68.33  ?  355 VAL C O   1 
ATOM 9278  C CB  . VAL C  1 347 ? 89.071  74.790   -14.456 1.00 70.32  ?  355 VAL C CB  1 
ATOM 9279  C CG1 . VAL C  1 347 ? 88.376  73.487   -14.095 1.00 74.46  ?  355 VAL C CG1 1 
ATOM 9280  C CG2 . VAL C  1 347 ? 88.509  75.341   -15.757 1.00 71.74  ?  355 VAL C CG2 1 
ATOM 9281  N N   . TYR C  1 348 ? 90.974  76.900   -12.604 1.00 64.45  ?  356 TYR C N   1 
ATOM 9282  C CA  . TYR C  1 348 ? 92.001  77.933   -12.594 1.00 63.29  ?  356 TYR C CA  1 
ATOM 9283  C C   . TYR C  1 348 ? 93.190  77.524   -13.455 1.00 61.27  ?  356 TYR C C   1 
ATOM 9284  O O   . TYR C  1 348 ? 93.742  76.431   -13.289 1.00 60.55  ?  356 TYR C O   1 
ATOM 9285  C CB  . TYR C  1 348 ? 92.470  78.221   -11.168 1.00 62.80  ?  356 TYR C CB  1 
ATOM 9286  C CG  . TYR C  1 348 ? 93.695  79.110   -11.105 1.00 61.23  ?  356 TYR C CG  1 
ATOM 9287  C CD1 . TYR C  1 348 ? 93.587  80.485   -11.261 1.00 64.90  ?  356 TYR C CD1 1 
ATOM 9288  C CD2 . TYR C  1 348 ? 94.960  78.571   -10.899 1.00 60.79  ?  356 TYR C CD2 1 
ATOM 9289  C CE1 . TYR C  1 348 ? 94.702  81.301   -11.208 1.00 67.93  ?  356 TYR C CE1 1 
ATOM 9290  C CE2 . TYR C  1 348 ? 96.082  79.379   -10.845 1.00 64.27  ?  356 TYR C CE2 1 
ATOM 9291  C CZ  . TYR C  1 348 ? 95.946  80.743   -10.999 1.00 68.78  ?  356 TYR C CZ  1 
ATOM 9292  O OH  . TYR C  1 348 ? 97.058  81.554   -10.947 1.00 70.99  ?  356 TYR C OH  1 
ATOM 9293  N N   . THR C  1 349 ? 93.581  78.412   -14.368 1.00 63.52  ?  357 THR C N   1 
ATOM 9294  C CA  . THR C  1 349 ? 94.823  78.321   -15.118 1.00 62.66  ?  357 THR C CA  1 
ATOM 9295  C C   . THR C  1 349 ? 95.388  79.732   -15.162 1.00 61.66  ?  357 THR C C   1 
ATOM 9296  O O   . THR C  1 349 ? 94.633  80.693   -15.374 1.00 63.07  ?  357 THR C O   1 
ATOM 9297  C CB  . THR C  1 349 ? 94.642  77.793   -16.549 1.00 62.41  ?  357 THR C CB  1 
ATOM 9298  O OG1 . THR C  1 349 ? 93.697  78.613   -17.247 1.00 64.92  ?  357 THR C OG1 1 
ATOM 9299  C CG2 . THR C  1 349 ? 94.158  76.351   -16.537 1.00 63.49  ?  357 THR C CG2 1 
ATOM 9300  N N   . PRO C  1 350 ? 96.698  79.894   -14.961 1.00 59.49  ?  358 PRO C N   1 
ATOM 9301  C CA  . PRO C  1 350 ? 97.269  81.251   -14.944 1.00 59.57  ?  358 PRO C CA  1 
ATOM 9302  C C   . PRO C  1 350 ? 97.050  82.016   -16.236 1.00 63.45  ?  358 PRO C C   1 
ATOM 9303  O O   . PRO C  1 350 ? 97.036  83.252   -16.211 1.00 65.38  ?  358 PRO C O   1 
ATOM 9304  C CB  . PRO C  1 350 ? 98.761  81.002   -14.679 1.00 66.37  ?  358 PRO C CB  1 
ATOM 9305  C CG  . PRO C  1 350 ? 98.992  79.577   -15.069 1.00 66.38  ?  358 PRO C CG  1 
ATOM 9306  C CD  . PRO C  1 350 ? 97.720  78.856   -14.755 1.00 65.58  ?  358 PRO C CD  1 
ATOM 9307  N N   . THR C  1 351 ? 96.856  81.325   -17.359 1.00 59.20  ?  359 THR C N   1 
ATOM 9308  C CA  . THR C  1 351 ? 96.624  81.993   -18.632 1.00 63.43  ?  359 THR C CA  1 
ATOM 9309  C C   . THR C  1 351 ? 95.210  82.541   -18.766 1.00 65.54  ?  359 THR C C   1 
ATOM 9310  O O   . THR C  1 351 ? 94.948  83.300   -19.705 1.00 66.89  ?  359 THR C O   1 
ATOM 9311  C CB  . THR C  1 351 ? 96.903  81.034   -19.792 1.00 57.18  ?  359 THR C CB  1 
ATOM 9312  O OG1 . THR C  1 351 ? 95.889  80.022   -19.831 1.00 57.67  ?  359 THR C OG1 1 
ATOM 9313  C CG2 . THR C  1 351 ? 98.264  80.377   -19.620 1.00 56.27  ?  359 THR C CG2 1 
ATOM 9314  N N   . SER C  1 352 ? 94.299  82.183   -17.858 1.00 59.76  ?  360 SER C N   1 
ATOM 9315  C CA  . SER C  1 352 ? 92.902  82.586   -17.948 1.00 62.79  ?  360 SER C CA  1 
ATOM 9316  C C   . SER C  1 352 ? 92.558  83.731   -17.000 1.00 58.11  ?  360 SER C C   1 
ATOM 9317  O O   . SER C  1 352 ? 91.379  83.939   -16.692 1.00 56.28  ?  360 SER C O   1 
ATOM 9318  C CB  . SER C  1 352 ? 91.989  81.389   -17.679 1.00 59.39  ?  360 SER C CB  1 
ATOM 9319  O OG  . SER C  1 352 ? 92.427  80.652   -16.551 1.00 58.12  ?  360 SER C OG  1 
ATOM 9320  N N   . PHE C  1 353 ? 93.557  84.477   -16.538 1.00 53.08  ?  361 PHE C N   1 
ATOM 9321  C CA  . PHE C  1 353 ? 93.320  85.625   -15.675 1.00 56.59  ?  361 PHE C CA  1 
ATOM 9322  C C   . PHE C  1 353 ? 94.374  86.681   -15.969 1.00 56.79  ?  361 PHE C C   1 
ATOM 9323  O O   . PHE C  1 353 ? 95.573  86.386   -15.944 1.00 58.38  ?  361 PHE C O   1 
ATOM 9324  C CB  . PHE C  1 353 ? 93.359  85.228   -14.194 1.00 56.14  ?  361 PHE C CB  1 
ATOM 9325  C CG  . PHE C  1 353 ? 92.155  84.448   -13.740 1.00 61.50  ?  361 PHE C CG  1 
ATOM 9326  C CD1 . PHE C  1 353 ? 90.953  85.087   -13.480 1.00 62.34  ?  361 PHE C CD1 1 
ATOM 9327  C CD2 . PHE C  1 353 ? 92.226  83.074   -13.568 1.00 62.57  ?  361 PHE C CD2 1 
ATOM 9328  C CE1 . PHE C  1 353 ? 89.843  84.371   -13.059 1.00 60.62  ?  361 PHE C CE1 1 
ATOM 9329  C CE2 . PHE C  1 353 ? 91.121  82.352   -13.148 1.00 59.22  ?  361 PHE C CE2 1 
ATOM 9330  C CZ  . PHE C  1 353 ? 89.928  83.002   -12.894 1.00 59.90  ?  361 PHE C CZ  1 
ATOM 9331  N N   . LYS C  1 354 ? 93.926  87.902   -16.242 1.00 50.20  ?  362 LYS C N   1 
ATOM 9332  C CA  . LYS C  1 354 ? 94.811  89.041   -16.437 1.00 50.15  ?  362 LYS C CA  1 
ATOM 9333  C C   . LYS C  1 354 ? 94.959  89.806   -15.129 1.00 49.75  ?  362 LYS C C   1 
ATOM 9334  O O   . LYS C  1 354 ? 93.962  90.109   -14.462 1.00 49.78  ?  362 LYS C O   1 
ATOM 9335  C CB  . LYS C  1 354 ? 94.293  89.971   -17.534 1.00 50.61  ?  362 LYS C CB  1 
ATOM 9336  C CG  . LYS C  1 354 ? 94.435  89.424   -18.941 1.00 52.94  ?  362 LYS C CG  1 
ATOM 9337  C CD  . LYS C  1 354 ? 95.183  90.417   -19.814 1.00 57.32  ?  362 LYS C CD  1 
ATOM 9338  C CE  . LYS C  1 354 ? 94.762  90.327   -21.269 1.00 61.76  ?  362 LYS C CE  1 
ATOM 9339  N NZ  . LYS C  1 354 ? 95.314  91.465   -22.059 1.00 64.00  1  362 LYS C NZ  1 
ATOM 9340  N N   . GLU C  1 355 ? 96.202  90.114   -14.772 1.00 50.48  ?  363 GLU C N   1 
ATOM 9341  C CA  . GLU C  1 355 ? 96.537  90.773   -13.519 1.00 54.84  ?  363 GLU C CA  1 
ATOM 9342  C C   . GLU C  1 355 ? 96.982  92.202   -13.796 1.00 53.05  ?  363 GLU C C   1 
ATOM 9343  O O   . GLU C  1 355 ? 97.830  92.439   -14.663 1.00 56.48  ?  363 GLU C O   1 
ATOM 9344  C CB  . GLU C  1 355 ? 97.640  90.016   -12.777 1.00 56.86  ?  363 GLU C CB  1 
ATOM 9345  C CG  . GLU C  1 355 ? 97.310  88.569   -12.453 1.00 66.67  ?  363 GLU C CG  1 
ATOM 9346  C CD  . GLU C  1 355 ? 96.416  88.436   -11.237 1.00 74.31  ?  363 GLU C CD  1 
ATOM 9347  O OE1 . GLU C  1 355 ? 96.354  89.393   -10.435 1.00 73.54  ?  363 GLU C OE1 1 
ATOM 9348  O OE2 . GLU C  1 355 ? 95.778  87.372   -11.081 1.00 81.54  -1 363 GLU C OE2 1 
ATOM 9349  N N   . TYR C  1 356 ? 96.410  93.141   -13.052 1.00 45.33  ?  364 TYR C N   1 
ATOM 9350  C CA  . TYR C  1 356 ? 96.708  94.561   -13.151 1.00 45.41  ?  364 TYR C CA  1 
ATOM 9351  C C   . TYR C  1 356 ? 96.978  95.096   -11.755 1.00 44.95  ?  364 TYR C C   1 
ATOM 9352  O O   . TYR C  1 356 ? 96.334  94.680   -10.788 1.00 44.75  ?  364 TYR C O   1 
ATOM 9353  C CB  . TYR C  1 356 ? 95.553  95.353   -13.783 1.00 46.26  ?  364 TYR C CB  1 
ATOM 9354  C CG  . TYR C  1 356 ? 95.120  94.878   -15.151 1.00 49.71  ?  364 TYR C CG  1 
ATOM 9355  C CD1 . TYR C  1 356 ? 94.276  93.784   -15.294 1.00 52.65  ?  364 TYR C CD1 1 
ATOM 9356  C CD2 . TYR C  1 356 ? 95.533  95.540   -16.298 1.00 52.91  ?  364 TYR C CD2 1 
ATOM 9357  C CE1 . TYR C  1 356 ? 93.872  93.353   -16.542 1.00 55.52  ?  364 TYR C CE1 1 
ATOM 9358  C CE2 . TYR C  1 356 ? 95.132  95.117   -17.552 1.00 57.50  ?  364 TYR C CE2 1 
ATOM 9359  C CZ  . TYR C  1 356 ? 94.303  94.023   -17.667 1.00 57.33  ?  364 TYR C CZ  1 
ATOM 9360  O OH  . TYR C  1 356 ? 93.902  93.597   -18.912 1.00 63.47  ?  364 TYR C OH  1 
ATOM 9361  N N   . ALA C  1 357 ? 97.929  96.017   -11.655 1.00 44.39  ?  365 ALA C N   1 
ATOM 9362  C CA  . ALA C  1 357 ? 98.274  96.659   -10.395 1.00 44.65  ?  365 ALA C CA  1 
ATOM 9363  C C   . ALA C  1 357 ? 97.929  98.138   -10.496 1.00 47.20  ?  365 ALA C C   1 
ATOM 9364  O O   . ALA C  1 357 ? 98.448  98.844   -11.367 1.00 43.91  ?  365 ALA C O   1 
ATOM 9365  C CB  . ALA C  1 357 ? 99.754  96.465   -10.065 1.00 42.99  ?  365 ALA C CB  1 
ATOM 9366  N N   . ARG C  1 358 ? 97.057  98.600   -9.607  1.00 46.52  ?  366 ARG C N   1 
ATOM 9367  C CA  . ARG C  1 358 ? 96.622  99.987   -9.579  1.00 45.88  ?  366 ARG C CA  1 
ATOM 9368  C C   . ARG C  1 358 ? 96.889  100.567  -8.200  1.00 44.36  ?  366 ARG C C   1 
ATOM 9369  O O   . ARG C  1 358 ? 96.762  99.870   -7.189  1.00 43.62  ?  366 ARG C O   1 
ATOM 9370  C CB  . ARG C  1 358 ? 95.133  100.113  -9.926  1.00 43.69  ?  366 ARG C CB  1 
ATOM 9371  C CG  . ARG C  1 358 ? 94.801  99.749   -11.364 1.00 44.19  ?  366 ARG C CG  1 
ATOM 9372  C CD  . ARG C  1 358 ? 95.572  100.624  -12.335 1.00 44.42  ?  366 ARG C CD  1 
ATOM 9373  N NE  . ARG C  1 358 ? 96.178  99.847   -13.413 1.00 44.58  ?  366 ARG C NE  1 
ATOM 9374  C CZ  . ARG C  1 358 ? 95.617  99.652   -14.602 1.00 45.08  ?  366 ARG C CZ  1 
ATOM 9375  N NH1 . ARG C  1 358 ? 94.433  100.184  -14.873 1.00 45.48  1  366 ARG C NH1 1 
ATOM 9376  N NH2 . ARG C  1 358 ? 96.242  98.929   -15.521 1.00 45.20  ?  366 ARG C NH2 1 
ATOM 9377  N N   . HIS C  1 359 ? 97.271  101.839  -8.166  1.00 41.77  ?  367 HIS C N   1 
ATOM 9378  C CA  . HIS C  1 359 ? 97.513  102.555  -6.927  1.00 41.40  ?  367 HIS C CA  1 
ATOM 9379  C C   . HIS C  1 359 ? 96.625  103.789  -6.876  1.00 41.68  ?  367 HIS C C   1 
ATOM 9380  O O   . HIS C  1 359 ? 96.241  104.348  -7.912  1.00 44.99  ?  367 HIS C O   1 
ATOM 9381  C CB  . HIS C  1 359 ? 98.980  102.962  -6.781  1.00 41.96  ?  367 HIS C CB  1 
ATOM 9382  C CG  . HIS C  1 359 ? 99.301  103.571  -5.453  1.00 49.69  ?  367 HIS C CG  1 
ATOM 9383  N ND1 . HIS C  1 359 ? 99.247  102.857  -4.275  1.00 52.52  ?  367 HIS C ND1 1 
ATOM 9384  C CD2 . HIS C  1 359 ? 99.660  104.831  -5.112  1.00 53.03  ?  367 HIS C CD2 1 
ATOM 9385  C CE1 . HIS C  1 359 ? 99.569  103.648  -3.267  1.00 52.08  ?  367 HIS C CE1 1 
ATOM 9386  N NE2 . HIS C  1 359 ? 99.823  104.852  -3.748  1.00 52.20  ?  367 HIS C NE2 1 
ATOM 9387  N N   . VAL C  1 360 ? 96.332  104.219  -5.650  1.00 47.75  ?  368 VAL C N   1 
ATOM 9388  C CA  . VAL C  1 360 ? 95.312  105.219  -5.370  1.00 48.12  ?  368 VAL C CA  1 
ATOM 9389  C C   . VAL C  1 360 ? 95.867  106.227  -4.373  1.00 48.10  ?  368 VAL C C   1 
ATOM 9390  O O   . VAL C  1 360 ? 96.523  105.851  -3.395  1.00 49.60  ?  368 VAL C O   1 
ATOM 9391  C CB  . VAL C  1 360 ? 94.036  104.554  -4.814  1.00 45.00  ?  368 VAL C CB  1 
ATOM 9392  C CG1 . VAL C  1 360 ? 93.168  105.571  -4.104  1.00 48.03  ?  368 VAL C CG1 1 
ATOM 9393  C CG2 . VAL C  1 360 ? 93.270  103.852  -5.925  1.00 48.23  ?  368 VAL C CG2 1 
ATOM 9394  N N   . GLU C  1 361 ? 95.599  107.508  -4.618  1.00 44.69  ?  369 GLU C N   1 
ATOM 9395  C CA  . GLU C  1 361 ? 95.953  108.578  -3.695  1.00 48.21  ?  369 GLU C CA  1 
ATOM 9396  C C   . GLU C  1 361 ? 94.744  109.470  -3.460  1.00 49.24  ?  369 GLU C C   1 
ATOM 9397  O O   . GLU C  1 361 ? 94.041  109.841  -4.406  1.00 51.24  ?  369 GLU C O   1 
ATOM 9398  C CB  . GLU C  1 361 ? 97.129  109.411  -4.220  1.00 48.67  ?  369 GLU C CB  1 
ATOM 9399  C CG  . GLU C  1 361 ? 98.451  108.662  -4.257  1.00 53.56  ?  369 GLU C CG  1 
ATOM 9400  C CD  . GLU C  1 361 ? 99.008  108.392  -2.867  1.00 60.25  ?  369 GLU C CD  1 
ATOM 9401  O OE1 . GLU C  1 361 ? 99.167  109.359  -2.089  1.00 63.56  ?  369 GLU C OE1 1 
ATOM 9402  O OE2 . GLU C  1 361 ? 99.287  107.215  -2.551  1.00 61.83  -1 369 GLU C OE2 1 
ATOM 9403  N N   . GLU C  1 362 ? 94.507  109.811  -2.194  1.00 46.93  ?  370 GLU C N   1 
ATOM 9404  C CA  . GLU C  1 362 ? 93.358  110.615  -1.799  1.00 48.16  ?  370 GLU C CA  1 
ATOM 9405  C C   . GLU C  1 362 ? 93.803  111.680  -0.807  1.00 43.55  ?  370 GLU C C   1 
ATOM 9406  O O   . GLU C  1 362 ? 94.455  111.369  0.194   1.00 43.10  ?  370 GLU C O   1 
ATOM 9407  C CB  . GLU C  1 362 ? 92.262  109.734  -1.189  1.00 50.75  ?  370 GLU C CB  1 
ATOM 9408  C CG  . GLU C  1 362 ? 91.107  110.492  -0.558  1.00 56.77  ?  370 GLU C CG  1 
ATOM 9409  C CD  . GLU C  1 362 ? 90.051  109.562  0.014   1.00 61.86  ?  370 GLU C CD  1 
ATOM 9410  O OE1 . GLU C  1 362 ? 89.223  110.024  0.830   1.00 64.76  ?  370 GLU C OE1 1 
ATOM 9411  O OE2 . GLU C  1 362 ? 90.053  108.366  -0.347  1.00 61.82  -1 370 GLU C OE2 1 
ATOM 9412  N N   . PHE C  1 363 ? 93.453  112.931  -1.093  1.00 41.81  ?  371 PHE C N   1 
ATOM 9413  C CA  . PHE C  1 363 ? 93.832  114.080  -0.289  1.00 41.60  ?  371 PHE C CA  1 
ATOM 9414  C C   . PHE C  1 363 ? 92.608  114.949  -0.034  1.00 48.19  ?  371 PHE C C   1 
ATOM 9415  O O   . PHE C  1 363 ? 91.581  114.836  -0.711  1.00 55.14  ?  371 PHE C O   1 
ATOM 9416  C CB  . PHE C  1 363 ? 94.917  114.930  -0.968  1.00 43.56  ?  371 PHE C CB  1 
ATOM 9417  C CG  . PHE C  1 363 ? 96.233  114.229  -1.130  1.00 45.72  ?  371 PHE C CG  1 
ATOM 9418  C CD1 . PHE C  1 363 ? 97.295  114.532  -0.295  1.00 47.27  ?  371 PHE C CD1 1 
ATOM 9419  C CD2 . PHE C  1 363 ? 96.409  113.264  -2.107  1.00 47.01  ?  371 PHE C CD2 1 
ATOM 9420  C CE1 . PHE C  1 363 ? 98.513  113.891  -0.438  1.00 49.21  ?  371 PHE C CE1 1 
ATOM 9421  C CE2 . PHE C  1 363 ? 97.623  112.619  -2.256  1.00 47.45  ?  371 PHE C CE2 1 
ATOM 9422  C CZ  . PHE C  1 363 ? 98.676  112.932  -1.419  1.00 48.30  ?  371 PHE C CZ  1 
ATOM 9423  N N   . ASP C  1 364 ? 92.751  115.847  0.945   1.00 53.89  ?  372 ASP C N   1 
ATOM 9424  C CA  . ASP C  1 364 ? 91.731  116.845  1.276   1.00 56.45  ?  372 ASP C CA  1 
ATOM 9425  C C   . ASP C  1 364 ? 92.465  118.024  1.919   1.00 51.02  ?  372 ASP C C   1 
ATOM 9426  O O   . ASP C  1 364 ? 92.693  118.044  3.130   1.00 47.28  ?  372 ASP C O   1 
ATOM 9427  C CB  . ASP C  1 364 ? 90.660  116.277  2.196   1.00 52.86  ?  372 ASP C CB  1 
ATOM 9428  C CG  . ASP C  1 364 ? 89.589  117.297  2.553   1.00 62.82  ?  372 ASP C CG  1 
ATOM 9429  O OD1 . ASP C  1 364 ? 89.492  118.335  1.867   1.00 69.60  ?  372 ASP C OD1 1 
ATOM 9430  O OD2 . ASP C  1 364 ? 88.841  117.059  3.526   1.00 64.53  -1 372 ASP C OD2 1 
ATOM 9431  N N   . LEU C  1 365 ? 92.814  119.007  1.095   1.00 50.41  ?  373 LEU C N   1 
ATOM 9432  C CA  . LEU C  1 365 ? 93.609  120.134  1.559   1.00 48.25  ?  373 LEU C CA  1 
ATOM 9433  C C   . LEU C  1 365 ? 92.713  121.147  2.259   1.00 53.43  ?  373 LEU C C   1 
ATOM 9434  O O   . LEU C  1 365 ? 91.652  121.512  1.742   1.00 58.38  ?  373 LEU C O   1 
ATOM 9435  C CB  . LEU C  1 365 ? 94.330  120.787  0.381   1.00 46.39  ?  373 LEU C CB  1 
ATOM 9436  C CG  . LEU C  1 365 ? 95.146  119.843  -0.506  1.00 45.26  ?  373 LEU C CG  1 
ATOM 9437  C CD1 . LEU C  1 365 ? 95.811  120.608  -1.639  1.00 46.41  ?  373 LEU C CD1 1 
ATOM 9438  C CD2 . LEU C  1 365 ? 96.178  119.086  0.313   1.00 41.67  ?  373 LEU C CD2 1 
ATOM 9439  N N   . GLN C  1 366 ? 93.144  121.609  3.432   1.00 52.52  ?  374 GLN C N   1 
ATOM 9440  C CA  . GLN C  1 366 ? 92.389  122.586  4.204   1.00 48.54  ?  374 GLN C CA  1 
ATOM 9441  C C   . GLN C  1 366 ? 93.324  123.676  4.705   1.00 46.84  ?  374 GLN C C   1 
ATOM 9442  O O   . GLN C  1 366 ? 94.452  123.398  5.122   1.00 44.98  ?  374 GLN C O   1 
ATOM 9443  C CB  . GLN C  1 366 ? 91.667  121.919  5.378   1.00 52.70  ?  374 GLN C CB  1 
ATOM 9444  C CG  . GLN C  1 366 ? 90.705  120.819  4.956   1.00 57.87  ?  374 GLN C CG  1 
ATOM 9445  C CD  . GLN C  1 366 ? 90.239  119.973  6.120   1.00 66.96  ?  374 GLN C CD  1 
ATOM 9446  O OE1 . GLN C  1 366 ? 89.741  120.492  7.122   1.00 72.38  ?  374 GLN C OE1 1 
ATOM 9447  N NE2 . GLN C  1 366 ? 90.403  118.660  5.999   1.00 67.79  ?  374 GLN C NE2 1 
ATOM 9448  N N   . PHE C  1 367 ? 92.840  124.916  4.673   1.00 47.66  ?  375 PHE C N   1 
ATOM 9449  C CA  . PHE C  1 367 ? 93.654  126.083  4.973   1.00 47.12  ?  375 PHE C CA  1 
ATOM 9450  C C   . PHE C  1 367 ? 92.833  127.123  5.720   1.00 48.10  ?  375 PHE C C   1 
ATOM 9451  O O   . PHE C  1 367 ? 91.628  127.273  5.497   1.00 50.55  ?  375 PHE C O   1 
ATOM 9452  C CB  . PHE C  1 367 ? 94.211  126.736  3.701   1.00 48.24  ?  375 PHE C CB  1 
ATOM 9453  C CG  . PHE C  1 367 ? 95.043  125.822  2.860   1.00 46.89  ?  375 PHE C CG  1 
ATOM 9454  C CD1 . PHE C  1 367 ? 96.391  125.658  3.118   1.00 44.54  ?  375 PHE C CD1 1 
ATOM 9455  C CD2 . PHE C  1 367 ? 94.479  125.141  1.795   1.00 48.39  ?  375 PHE C CD2 1 
ATOM 9456  C CE1 . PHE C  1 367 ? 97.159  124.819  2.338   1.00 45.33  ?  375 PHE C CE1 1 
ATOM 9457  C CE2 . PHE C  1 367 ? 95.241  124.302  1.012   1.00 47.38  ?  375 PHE C CE2 1 
ATOM 9458  C CZ  . PHE C  1 367 ? 96.583  124.141  1.283   1.00 46.46  ?  375 PHE C CZ  1 
ATOM 9459  N N   . ILE C  1 368 ? 93.514  127.852  6.597   1.00 48.69  ?  376 ILE C N   1 
ATOM 9460  C CA  . ILE C  1 368 ? 92.978  129.032  7.259   1.00 49.64  ?  376 ILE C CA  1 
ATOM 9461  C C   . ILE C  1 368 ? 93.898  130.187  6.892   1.00 50.34  ?  376 ILE C C   1 
ATOM 9462  O O   . ILE C  1 368 ? 95.075  130.198  7.281   1.00 49.27  ?  376 ILE C O   1 
ATOM 9463  C CB  . ILE C  1 368 ? 92.889  128.855  8.780   1.00 46.65  ?  376 ILE C CB  1 
ATOM 9464  C CG1 . ILE C  1 368 ? 91.868  127.773  9.130   1.00 50.00  ?  376 ILE C CG1 1 
ATOM 9465  C CG2 . ILE C  1 368 ? 92.526  130.171  9.449   1.00 47.06  ?  376 ILE C CG2 1 
ATOM 9466  C CD1 . ILE C  1 368 ? 90.456  128.116  8.716   1.00 56.51  ?  376 ILE C CD1 1 
ATOM 9467  N N   . PHE C  1 369 ? 93.368  131.150  6.140   1.00 48.41  ?  377 PHE C N   1 
ATOM 9468  C CA  . PHE C  1 369 ? 94.120  132.303  5.671   1.00 49.79  ?  377 PHE C CA  1 
ATOM 9469  C C   . PHE C  1 369 ? 93.706  133.551  6.438   1.00 53.38  ?  377 PHE C C   1 
ATOM 9470  O O   . PHE C  1 369 ? 92.572  133.665  6.914   1.00 60.62  ?  377 PHE C O   1 
ATOM 9471  C CB  . PHE C  1 369 ? 93.910  132.541  4.172   1.00 51.50  ?  377 PHE C CB  1 
ATOM 9472  C CG  . PHE C  1 369 ? 94.474  131.459  3.299   1.00 52.00  ?  377 PHE C CG  1 
ATOM 9473  C CD1 . PHE C  1 369 ? 95.841  131.339  3.119   1.00 52.78  ?  377 PHE C CD1 1 
ATOM 9474  C CD2 . PHE C  1 369 ? 93.636  130.575  2.644   1.00 52.44  ?  377 PHE C CD2 1 
ATOM 9475  C CE1 . PHE C  1 369 ? 96.362  130.346  2.313   1.00 50.90  ?  377 PHE C CE1 1 
ATOM 9476  C CE2 . PHE C  1 369 ? 94.149  129.585  1.833   1.00 51.85  ?  377 PHE C CE2 1 
ATOM 9477  C CZ  . PHE C  1 369 ? 95.514  129.468  1.669   1.00 50.62  ?  377 PHE C CZ  1 
ATOM 9478  N N   . GLN C  1 370 ? 94.638  134.494  6.538   1.00 53.53  ?  378 GLN C N   1 
ATOM 9479  C CA  . GLN C  1 370 ? 94.437  135.742  7.258   1.00 50.85  ?  378 GLN C CA  1 
ATOM 9480  C C   . GLN C  1 370 ? 94.675  136.911  6.314   1.00 53.42  ?  378 GLN C C   1 
ATOM 9481  O O   . GLN C  1 370 ? 95.687  136.946  5.607   1.00 54.06  ?  378 GLN C O   1 
ATOM 9482  C CB  . GLN C  1 370 ? 95.375  135.822  8.464   1.00 49.84  ?  378 GLN C CB  1 
ATOM 9483  C CG  . GLN C  1 370 ? 95.343  137.133  9.216   1.00 49.94  ?  378 GLN C CG  1 
ATOM 9484  C CD  . GLN C  1 370 ? 96.244  137.106  10.433  1.00 47.55  ?  378 GLN C CD  1 
ATOM 9485  O OE1 . GLN C  1 370 ? 97.279  136.440  10.437  1.00 45.74  ?  378 GLN C OE1 1 
ATOM 9486  N NE2 . GLN C  1 370 ? 95.851  137.823  11.478  1.00 48.87  ?  378 GLN C NE2 1 
ATOM 9487  N N   . LEU C  1 371 ? 93.740  137.857  6.298   1.00 54.39  ?  379 LEU C N   1 
ATOM 9488  C CA  . LEU C  1 371 ? 93.871  139.034  5.451   1.00 59.06  ?  379 LEU C CA  1 
ATOM 9489  C C   . LEU C  1 371 ? 94.843  140.026  6.079   1.00 61.52  ?  379 LEU C C   1 
ATOM 9490  O O   . LEU C  1 371 ? 94.829  140.246  7.294   1.00 61.43  ?  379 LEU C O   1 
ATOM 9491  C CB  . LEU C  1 371 ? 92.506  139.688  5.236   1.00 51.94  ?  379 LEU C CB  1 
ATOM 9492  C CG  . LEU C  1 371 ? 92.448  140.830  4.223   1.00 51.19  ?  379 LEU C CG  1 
ATOM 9493  C CD1 . LEU C  1 371 ? 92.987  140.366  2.882   1.00 52.42  ?  379 LEU C CD1 1 
ATOM 9494  C CD2 . LEU C  1 371 ? 91.025  141.343  4.080   1.00 53.24  ?  379 LEU C CD2 1 
ATOM 9495  N N   . CYS C  1 372 ? 95.685  140.632  5.242   1.00 62.71  ?  380 CYS C N   1 
ATOM 9496  C CA  . CYS C  1 372 ? 96.740  141.516  5.717   1.00 57.67  ?  380 CYS C CA  1 
ATOM 9497  C C   . CYS C  1 372 ? 96.789  142.781  4.872   1.00 59.32  ?  380 CYS C C   1 
ATOM 9498  O O   . CYS C  1 372 ? 96.359  142.804  3.717   1.00 62.13  ?  380 CYS C O   1 
ATOM 9499  C CB  . CYS C  1 372 ? 98.110  140.829  5.694   1.00 56.74  ?  380 CYS C CB  1 
ATOM 9500  S SG  . CYS C  1 372 ? 98.219  139.359  6.722   1.00 53.79  ?  380 CYS C SG  1 
ATOM 9501  N N   . LYS C  1 373 ? 97.327  143.837  5.475   1.00 55.48  ?  381 LYS C N   1 
ATOM 9502  C CA  . LYS C  1 373 ? 97.520  145.119  4.819   1.00 57.98  ?  381 LYS C CA  1 
ATOM 9503  C C   . LYS C  1 373 ? 99.004  145.361  4.586   1.00 57.31  ?  381 LYS C C   1 
ATOM 9504  O O   . LYS C  1 373 ? 99.856  144.883  5.341   1.00 55.96  ?  381 LYS C O   1 
ATOM 9505  C CB  . LYS C  1 373 ? 96.964  146.270  5.661   1.00 60.31  ?  381 LYS C CB  1 
ATOM 9506  C CG  . LYS C  1 373 ? 95.571  146.061  6.209   1.00 60.18  ?  381 LYS C CG  1 
ATOM 9507  C CD  . LYS C  1 373 ? 95.164  147.258  7.051   1.00 60.13  ?  381 LYS C CD  1 
ATOM 9508  C CE  . LYS C  1 373 ? 93.975  146.939  7.936   1.00 62.51  ?  381 LYS C CE  1 
ATOM 9509  N NZ  . LYS C  1 373 ? 93.602  148.099  8.789   1.00 67.29  1  381 LYS C NZ  1 
ATOM 9510  N N   . ILE C  1 374 ? 99.307  146.108  3.529   1.00 58.49  ?  382 ILE C N   1 
ATOM 9511  C CA  . ILE C  1 374 ? 100.662 146.557  3.236   1.00 58.39  ?  382 ILE C CA  1 
ATOM 9512  C C   . ILE C  1 374 ? 100.564 148.032  2.877   1.00 60.87  ?  382 ILE C C   1 
ATOM 9513  O O   . ILE C  1 374 ? 100.093 148.380  1.788   1.00 65.74  ?  382 ILE C O   1 
ATOM 9514  C CB  . ILE C  1 374 ? 101.317 145.757  2.103   1.00 59.23  ?  382 ILE C CB  1 
ATOM 9515  C CG1 . ILE C  1 374 ? 101.480 144.292  2.506   1.00 59.47  ?  382 ILE C CG1 1 
ATOM 9516  C CG2 . ILE C  1 374 ? 102.670 146.352  1.744   1.00 61.15  ?  382 ILE C CG2 1 
ATOM 9517  C CD1 . ILE C  1 374 ? 102.120 143.437  1.439   1.00 64.94  ?  382 ILE C CD1 1 
ATOM 9518  N N   . THR C  1 375 ? 100.991 148.896  3.793   1.00 62.04  ?  383 THR C N   1 
ATOM 9519  C CA  . THR C  1 375 ? 100.991 150.335  3.554   1.00 65.87  ?  383 THR C CA  1 
ATOM 9520  C C   . THR C  1 375 ? 102.140 150.678  2.613   1.00 67.02  ?  383 THR C C   1 
ATOM 9521  O O   . THR C  1 375 ? 103.313 150.531  2.971   1.00 63.82  ?  383 THR C O   1 
ATOM 9522  C CB  . THR C  1 375 ? 101.102 151.099  4.868   1.00 68.29  ?  383 THR C CB  1 
ATOM 9523  O OG1 . THR C  1 375 ? 100.005 150.741  5.718   1.00 64.35  ?  383 THR C OG1 1 
ATOM 9524  C CG2 . THR C  1 375 ? 101.053 152.589  4.602   1.00 77.24  ?  383 THR C CG2 1 
ATOM 9525  N N   . LEU C  1 376 ? 101.804 151.134  1.407   1.00 67.84  ?  384 LEU C N   1 
ATOM 9526  C CA  . LEU C  1 376 ? 102.790 151.367  0.353   1.00 69.32  ?  384 LEU C CA  1 
ATOM 9527  C C   . LEU C  1 376 ? 103.511 152.684  0.628   1.00 71.66  ?  384 LEU C C   1 
ATOM 9528  O O   . LEU C  1 376 ? 103.250 153.723  0.017   1.00 75.89  ?  384 LEU C O   1 
ATOM 9529  C CB  . LEU C  1 376 ? 102.115 151.372  -1.011  1.00 71.08  ?  384 LEU C CB  1 
ATOM 9530  C CG  . LEU C  1 376 ? 101.515 150.038  -1.452  1.00 71.46  ?  384 LEU C CG  1 
ATOM 9531  C CD1 . LEU C  1 376 ? 100.862 150.178  -2.816  1.00 73.01  ?  384 LEU C CD1 1 
ATOM 9532  C CD2 . LEU C  1 376 ? 102.573 148.946  -1.462  1.00 70.21  ?  384 LEU C CD2 1 
ATOM 9533  N N   . THR C  1 377 ? 104.440 152.628  1.577   1.00 71.55  ?  385 THR C N   1 
ATOM 9534  C CA  . THR C  1 377 ? 105.311 153.749  1.887   1.00 75.26  ?  385 THR C CA  1 
ATOM 9535  C C   . THR C  1 377 ? 106.457 153.810  0.877   1.00 82.38  ?  385 THR C C   1 
ATOM 9536  O O   . THR C  1 377 ? 106.585 152.961  -0.009  1.00 91.08  ?  385 THR C O   1 
ATOM 9537  C CB  . THR C  1 377 ? 105.847 153.604  3.312   1.00 81.14  ?  385 THR C CB  1 
ATOM 9538  O OG1 . THR C  1 377 ? 104.849 152.991  4.137   1.00 81.30  ?  385 THR C OG1 1 
ATOM 9539  C CG2 . THR C  1 377 ? 106.207 154.954  3.909   1.00 85.12  ?  385 THR C CG2 1 
ATOM 9540  N N   . THR C  1 378 ? 107.299 154.834  1.001   1.00 90.43  ?  386 THR C N   1 
ATOM 9541  C CA  . THR C  1 378 ? 108.641 154.751  0.450   1.00 89.47  ?  386 THR C CA  1 
ATOM 9542  C C   . THR C  1 378 ? 109.467 153.818  1.334   1.00 86.89  ?  386 THR C C   1 
ATOM 9543  O O   . THR C  1 378 ? 108.971 153.260  2.317   1.00 90.38  ?  386 THR C O   1 
ATOM 9544  C CB  . THR C  1 378 ? 109.272 156.138  0.343   1.00 86.34  ?  386 THR C CB  1 
ATOM 9545  O OG1 . THR C  1 378 ? 109.311 156.749  1.638   1.00 89.19  ?  386 THR C OG1 1 
ATOM 9546  C CG2 . THR C  1 378 ? 108.468 157.016  -0.606  1.00 87.69  ?  386 THR C CG2 1 
ATOM 9547  N N   . GLU C  1 379 ? 110.739 153.627  0.978   1.00 80.63  ?  387 GLU C N   1 
ATOM 9548  C CA  . GLU C  1 379 ? 111.579 152.621  1.628   1.00 81.68  ?  387 GLU C CA  1 
ATOM 9549  C C   . GLU C  1 379 ? 110.952 151.244  1.426   1.00 82.83  ?  387 GLU C C   1 
ATOM 9550  O O   . GLU C  1 379 ? 111.560 150.357  0.817   1.00 88.43  ?  387 GLU C O   1 
ATOM 9551  C CB  . GLU C  1 379 ? 111.768 152.927  3.120   1.00 93.40  ?  387 GLU C CB  1 
ATOM 9552  C CG  . GLU C  1 379 ? 112.328 154.313  3.423   1.00 101.87 ?  387 GLU C CG  1 
ATOM 9553  C CD  . GLU C  1 379 ? 113.832 154.413  3.239   1.00 109.76 ?  387 GLU C CD  1 
ATOM 9554  O OE1 . GLU C  1 379 ? 114.435 153.489  2.651   1.00 114.31 ?  387 GLU C OE1 1 
ATOM 9555  O OE2 . GLU C  1 379 ? 114.414 155.424  3.687   1.00 110.79 -1 387 GLU C OE2 1 
ATOM 9556  N N   . VAL C  1 380 ? 109.738 151.058  1.947   1.00 79.70  ?  388 VAL C N   1 
ATOM 9557  C CA  . VAL C  1 380 ? 108.838 149.997  1.510   1.00 77.00  ?  388 VAL C CA  1 
ATOM 9558  C C   . VAL C  1 380 ? 108.511 150.272  0.045   1.00 79.24  ?  388 VAL C C   1 
ATOM 9559  O O   . VAL C  1 380 ? 108.835 151.346  -0.477  1.00 81.14  ?  388 VAL C O   1 
ATOM 9560  C CB  . VAL C  1 380 ? 107.566 149.951  2.380   1.00 78.82  ?  388 VAL C CB  1 
ATOM 9561  C CG1 . VAL C  1 380 ? 106.817 148.631  2.204   1.00 70.81  ?  388 VAL C CG1 1 
ATOM 9562  C CG2 . VAL C  1 380 ? 107.911 150.192  3.843   1.00 81.46  ?  388 VAL C CG2 1 
ATOM 9563  N N   . MET C  1 381 ? 107.895 149.301  -0.634  1.00 70.02  ?  389 MET C N   1 
ATOM 9564  C CA  . MET C  1 381 ? 107.540 149.408  -2.048  1.00 72.93  ?  389 MET C CA  1 
ATOM 9565  C C   . MET C  1 381 ? 108.789 149.414  -2.926  1.00 75.83  ?  389 MET C C   1 
ATOM 9566  O O   . MET C  1 381 ? 108.866 148.650  -3.892  1.00 84.92  ?  389 MET C O   1 
ATOM 9567  C CB  . MET C  1 381 ? 106.671 150.646  -2.299  1.00 65.98  ?  389 MET C CB  1 
ATOM 9568  C CG  . MET C  1 381 ? 106.804 151.265  -3.675  1.00 69.53  ?  389 MET C CG  1 
ATOM 9569  S SD  . MET C  1 381 ? 105.696 152.678  -3.857  1.00 72.63  ?  389 MET C SD  1 
ATOM 9570  C CE  . MET C  1 381 ? 104.113 151.850  -3.967  1.00 73.69  ?  389 MET C CE  1 
ATOM 9571  N N   . SER C  1 382 ? 109.775 150.255  -2.607  1.00 70.23  ?  390 SER C N   1 
ATOM 9572  C CA  . SER C  1 382 ? 111.078 150.107  -3.248  1.00 72.52  ?  390 SER C CA  1 
ATOM 9573  C C   . SER C  1 382 ? 111.751 148.814  -2.804  1.00 74.07  ?  390 SER C C   1 
ATOM 9574  O O   . SER C  1 382 ? 112.416 148.142  -3.602  1.00 83.53  ?  390 SER C O   1 
ATOM 9575  C CB  . SER C  1 382 ? 111.966 151.309  -2.937  1.00 74.82  ?  390 SER C CB  1 
ATOM 9576  O OG  . SER C  1 382 ? 112.504 151.217  -1.630  1.00 72.44  ?  390 SER C OG  1 
ATOM 9577  N N   . TYR C  1 383 ? 111.580 148.451  -1.529  1.00 73.89  ?  391 TYR C N   1 
ATOM 9578  C CA  . TYR C  1 383 ? 112.020 147.144  -1.051  1.00 69.98  ?  391 TYR C CA  1 
ATOM 9579  C C   . TYR C  1 383 ? 111.252 146.022  -1.740  1.00 70.56  ?  391 TYR C C   1 
ATOM 9580  O O   . TYR C  1 383 ? 111.840 145.007  -2.136  1.00 73.99  ?  391 TYR C O   1 
ATOM 9581  C CB  . TYR C  1 383 ? 111.846 147.077  0.468   1.00 68.39  ?  391 TYR C CB  1 
ATOM 9582  C CG  . TYR C  1 383 ? 111.982 145.702  1.081   1.00 65.17  ?  391 TYR C CG  1 
ATOM 9583  C CD1 . TYR C  1 383 ? 113.229 145.178  1.395   1.00 64.03  ?  391 TYR C CD1 1 
ATOM 9584  C CD2 . TYR C  1 383 ? 110.860 144.937  1.368   1.00 63.73  ?  391 TYR C CD2 1 
ATOM 9585  C CE1 . TYR C  1 383 ? 113.354 143.924  1.967   1.00 61.39  ?  391 TYR C CE1 1 
ATOM 9586  C CE2 . TYR C  1 383 ? 110.974 143.684  1.936   1.00 61.14  ?  391 TYR C CE2 1 
ATOM 9587  C CZ  . TYR C  1 383 ? 112.222 143.182  2.235   1.00 59.90  ?  391 TYR C CZ  1 
ATOM 9588  O OH  . TYR C  1 383 ? 112.331 141.932  2.804   1.00 57.35  ?  391 TYR C OH  1 
ATOM 9589  N N   . ILE C  1 384 ? 109.938 146.192  -1.900  1.00 63.58  ?  392 ILE C N   1 
ATOM 9590  C CA  . ILE C  1 384 ? 109.141 145.213  -2.633  1.00 63.72  ?  392 ILE C CA  1 
ATOM 9591  C C   . ILE C  1 384 ? 109.560 145.174  -4.098  1.00 70.14  ?  392 ILE C C   1 
ATOM 9592  O O   . ILE C  1 384 ? 109.581 144.108  -4.725  1.00 74.36  ?  392 ILE C O   1 
ATOM 9593  C CB  . ILE C  1 384 ? 107.642 145.528  -2.477  1.00 59.94  ?  392 ILE C CB  1 
ATOM 9594  C CG1 . ILE C  1 384 ? 107.219 145.402  -1.014  1.00 59.45  ?  392 ILE C CG1 1 
ATOM 9595  C CG2 . ILE C  1 384 ? 106.805 144.604  -3.345  1.00 60.21  ?  392 ILE C CG2 1 
ATOM 9596  C CD1 . ILE C  1 384 ? 105.737 145.624  -0.784  1.00 61.74  ?  392 ILE C CD1 1 
ATOM 9597  N N   . HIS C  1 385 ? 109.903 146.333  -4.666  1.00 67.68  ?  393 HIS C N   1 
ATOM 9598  C CA  . HIS C  1 385 ? 110.353 146.377  -6.053  1.00 73.06  ?  393 HIS C CA  1 
ATOM 9599  C C   . HIS C  1 385 ? 111.651 145.600  -6.234  1.00 77.35  ?  393 HIS C C   1 
ATOM 9600  O O   . HIS C  1 385 ? 111.788 144.809  -7.175  1.00 85.34  ?  393 HIS C O   1 
ATOM 9601  C CB  . HIS C  1 385 ? 110.528 147.830  -6.496  1.00 75.09  ?  393 HIS C CB  1 
ATOM 9602  C CG  . HIS C  1 385 ? 110.991 147.983  -7.911  1.00 83.00  ?  393 HIS C CG  1 
ATOM 9603  N ND1 . HIS C  1 385 ? 112.325 148.009  -8.258  1.00 87.03  ?  393 HIS C ND1 1 
ATOM 9604  C CD2 . HIS C  1 385 ? 110.300 148.139  -9.065  1.00 89.44  ?  393 HIS C CD2 1 
ATOM 9605  C CE1 . HIS C  1 385 ? 112.436 148.162  -9.565  1.00 94.11  ?  393 HIS C CE1 1 
ATOM 9606  N NE2 . HIS C  1 385 ? 111.221 148.247  -10.078 1.00 95.58  ?  393 HIS C NE2 1 
ATOM 9607  N N   . ASN C  1 386 ? 112.620 145.815  -5.341  1.00 79.87  ?  394 ASN C N   1 
ATOM 9608  C CA  . ASN C  1 386 ? 113.858 145.047  -5.415  1.00 77.69  ?  394 ASN C CA  1 
ATOM 9609  C C   . ASN C  1 386 ? 113.622 143.572  -5.119  1.00 76.66  ?  394 ASN C C   1 
ATOM 9610  O O   . ASN C  1 386 ? 114.383 142.718  -5.587  1.00 80.09  ?  394 ASN C O   1 
ATOM 9611  C CB  . ASN C  1 386 ? 114.900 145.624  -4.458  1.00 83.84  ?  394 ASN C CB  1 
ATOM 9612  C CG  . ASN C  1 386 ? 116.296 145.103  -4.742  1.00 86.50  ?  394 ASN C CG  1 
ATOM 9613  O OD1 . ASN C  1 386 ? 117.050 145.704  -5.507  1.00 92.23  ?  394 ASN C OD1 1 
ATOM 9614  N ND2 . ASN C  1 386 ? 116.645 143.978  -4.129  1.00 83.49  ?  394 ASN C ND2 1 
ATOM 9615  N N   . MET C  1 387 ? 112.583 143.255  -4.346  1.00 73.95  ?  395 MET C N   1 
ATOM 9616  C CA  . MET C  1 387 ? 112.246 141.859  -4.084  1.00 69.47  ?  395 MET C CA  1 
ATOM 9617  C C   . MET C  1 387 ? 111.632 141.209  -5.318  1.00 66.33  ?  395 MET C C   1 
ATOM 9618  O O   . MET C  1 387 ? 112.163 140.228  -5.852  1.00 66.28  ?  395 MET C O   1 
ATOM 9619  C CB  . MET C  1 387 ? 111.298 141.771  -2.888  1.00 73.07  ?  395 MET C CB  1 
ATOM 9620  C CG  . MET C  1 387 ? 110.872 140.363  -2.518  1.00 69.02  ?  395 MET C CG  1 
ATOM 9621  S SD  . MET C  1 387 ? 109.891 140.342  -1.005  1.00 65.86  ?  395 MET C SD  1 
ATOM 9622  C CE  . MET C  1 387 ? 109.544 138.591  -0.851  1.00 65.81  ?  395 MET C CE  1 
ATOM 9623  N N   . ASN C  1 388 ? 110.505 141.742  -5.778  1.00 57.23  ?  396 ASN C N   1 
ATOM 9624  C CA  . ASN C  1 388 ? 109.836 141.239  -6.973  1.00 62.31  ?  396 ASN C CA  1 
ATOM 9625  C C   . ASN C  1 388 ? 109.104 142.407  -7.615  1.00 73.64  ?  396 ASN C C   1 
ATOM 9626  O O   . ASN C  1 388 ? 108.103 142.884  -7.071  1.00 82.78  ?  396 ASN C O   1 
ATOM 9627  C CB  . ASN C  1 388 ? 108.871 140.107  -6.642  1.00 69.76  ?  396 ASN C CB  1 
ATOM 9628  C CG  . ASN C  1 388 ? 109.395 138.749  -7.067  1.00 77.59  ?  396 ASN C CG  1 
ATOM 9629  O OD1 . ASN C  1 388 ? 109.362 138.401  -8.246  1.00 85.41  ?  396 ASN C OD1 1 
ATOM 9630  N ND2 . ASN C  1 388 ? 109.877 137.969  -6.103  1.00 76.29  ?  396 ASN C ND2 1 
ATOM 9631  N N   . THR C  1 389 ? 109.616 142.877  -8.755  1.00 75.49  ?  397 THR C N   1 
ATOM 9632  C CA  . THR C  1 389 ? 108.943 143.946  -9.484  1.00 79.62  ?  397 THR C CA  1 
ATOM 9633  C C   . THR C  1 389 ? 107.521 143.555  -9.852  1.00 79.82  ?  397 THR C C   1 
ATOM 9634  O O   . THR C  1 389 ? 106.626 144.410  -9.885  1.00 83.14  ?  397 THR C O   1 
ATOM 9635  C CB  . THR C  1 389 ? 109.733 144.281  -10.748 1.00 75.20  ?  397 THR C CB  1 
ATOM 9636  O OG1 . THR C  1 389 ? 110.155 143.062  -11.374 1.00 76.45  ?  397 THR C OG1 1 
ATOM 9637  C CG2 . THR C  1 389 ? 110.945 145.121  -10.396 1.00 75.81  ?  397 THR C CG2 1 
ATOM 9638  N N   . THR C  1 390 ? 107.299 142.267  -10.104 1.00 71.09  ?  398 THR C N   1 
ATOM 9639  C CA  . THR C  1 390 ? 105.997 141.763  -10.508 1.00 73.07  ?  398 THR C CA  1 
ATOM 9640  C C   . THR C  1 390 ? 104.957 141.824  -9.393  1.00 73.53  ?  398 THR C C   1 
ATOM 9641  O O   . THR C  1 390 ? 103.766 141.668  -9.675  1.00 77.80  ?  398 THR C O   1 
ATOM 9642  C CB  . THR C  1 390 ? 106.147 140.327  -11.018 1.00 74.57  ?  398 THR C CB  1 
ATOM 9643  O OG1 . THR C  1 390 ? 104.855 139.751  -11.242 1.00 81.41  ?  398 THR C OG1 1 
ATOM 9644  C CG2 . THR C  1 390 ? 106.922 139.480  -10.012 1.00 66.34  ?  398 THR C CG2 1 
ATOM 9645  N N   . ILE C  1 391 ? 105.368 142.001  -8.135  1.00 74.17  ?  399 ILE C N   1 
ATOM 9646  C CA  . ILE C  1 391 ? 104.388 142.172  -7.064  1.00 67.31  ?  399 ILE C CA  1 
ATOM 9647  C C   . ILE C  1 391 ? 103.661 143.504  -7.213  1.00 69.85  ?  399 ILE C C   1 
ATOM 9648  O O   . ILE C  1 391 ? 102.426 143.556  -7.248  1.00 69.64  ?  399 ILE C O   1 
ATOM 9649  C CB  . ILE C  1 391 ? 105.061 142.053  -5.684  1.00 59.10  ?  399 ILE C CB  1 
ATOM 9650  C CG1 . ILE C  1 391 ? 105.506 140.614  -5.422  1.00 58.69  ?  399 ILE C CG1 1 
ATOM 9651  C CG2 . ILE C  1 391 ? 104.114 142.517  -4.592  1.00 58.91  ?  399 ILE C CG2 1 
ATOM 9652  C CD1 . ILE C  1 391 ? 106.183 140.421  -4.081  1.00 58.07  ?  399 ILE C CD1 1 
ATOM 9653  N N   . LEU C  1 392 ? 104.417 144.603  -7.301  1.00 68.56  ?  400 LEU C N   1 
ATOM 9654  C CA  . LEU C  1 392 ? 103.803 145.906  -7.533  1.00 69.72  ?  400 LEU C CA  1 
ATOM 9655  C C   . LEU C  1 392 ? 103.199 145.995  -8.927  1.00 74.95  ?  400 LEU C C   1 
ATOM 9656  O O   . LEU C  1 392 ? 102.115 146.564  -9.104  1.00 71.48  ?  400 LEU C O   1 
ATOM 9657  C CB  . LEU C  1 392 ? 104.830 147.016  -7.329  1.00 69.92  ?  400 LEU C CB  1 
ATOM 9658  C CG  . LEU C  1 392 ? 105.363 147.189  -5.909  1.00 68.18  ?  400 LEU C CG  1 
ATOM 9659  C CD1 . LEU C  1 392 ? 106.449 148.245  -5.892  1.00 73.16  ?  400 LEU C CD1 1 
ATOM 9660  C CD2 . LEU C  1 392 ? 104.238 147.557  -4.959  1.00 67.82  ?  400 LEU C CD2 1 
ATOM 9661  N N   . GLU C  1 393 ? 103.893 145.451  -9.931  1.00 79.21  ?  401 GLU C N   1 
ATOM 9662  C CA  . GLU C  1 393 ? 103.363 145.462  -11.291 1.00 89.34  ?  401 GLU C CA  1 
ATOM 9663  C C   . GLU C  1 393 ? 102.030 144.730  -11.362 1.00 85.60  ?  401 GLU C C   1 
ATOM 9664  O O   . GLU C  1 393 ? 101.107 145.164  -12.061 1.00 87.04  ?  401 GLU C O   1 
ATOM 9665  C CB  . GLU C  1 393 ? 104.374 144.846  -12.257 1.00 96.27  ?  401 GLU C CB  1 
ATOM 9666  C CG  . GLU C  1 393 ? 103.907 144.833  -13.701 1.00 106.79 ?  401 GLU C CG  1 
ATOM 9667  C CD  . GLU C  1 393 ? 103.878 146.223  -14.310 1.00 116.95 ?  401 GLU C CD  1 
ATOM 9668  O OE1 . GLU C  1 393 ? 104.726 146.509  -15.182 1.00 124.00 ?  401 GLU C OE1 1 
ATOM 9669  O OE2 . GLU C  1 393 ? 103.021 147.035  -13.901 1.00 118.03 -1 401 GLU C OE2 1 
ATOM 9670  N N   . ASP C  1 394 ? 101.912 143.614  -10.639 1.00 83.23  ?  402 ASP C N   1 
ATOM 9671  C CA  . ASP C  1 394 ? 100.666 142.861  -10.607 1.00 81.35  ?  402 ASP C CA  1 
ATOM 9672  C C   . ASP C  1 394 ? 99.589  143.606  -9.836  1.00 75.30  ?  402 ASP C C   1 
ATOM 9673  O O   . ASP C  1 394 ? 98.399  143.344  -10.039 1.00 76.14  ?  402 ASP C O   1 
ATOM 9674  C CB  . ASP C  1 394 ? 100.910 141.482  -9.991  1.00 84.95  ?  402 ASP C CB  1 
ATOM 9675  C CG  . ASP C  1 394 ? 99.868  140.462  -10.404 1.00 91.43  ?  402 ASP C CG  1 
ATOM 9676  O OD1 . ASP C  1 394 ? 99.072  140.761  -11.320 1.00 96.93  ?  402 ASP C OD1 1 
ATOM 9677  O OD2 . ASP C  1 394 ? 99.849  139.359  -9.818  1.00 89.38  -1 402 ASP C OD2 1 
ATOM 9678  N N   . TRP C  1 395 ? 99.983  144.527  -8.957  1.00 76.35  ?  403 TRP C N   1 
ATOM 9679  C CA  . TRP C  1 395 ? 99.045  145.444  -8.327  1.00 76.92  ?  403 TRP C CA  1 
ATOM 9680  C C   . TRP C  1 395 ? 98.882  146.642  -9.252  1.00 83.55  ?  403 TRP C C   1 
ATOM 9681  O O   . TRP C  1 395 ? 98.804  146.473  -10.473 1.00 88.48  ?  403 TRP C O   1 
ATOM 9682  C CB  . TRP C  1 395 ? 99.542  145.867  -6.942  1.00 75.06  ?  403 TRP C CB  1 
ATOM 9683  C CG  . TRP C  1 395 ? 99.388  144.801  -5.895  1.00 69.15  ?  403 TRP C CG  1 
ATOM 9684  C CD1 . TRP C  1 395 ? 98.548  143.728  -5.940  1.00 69.70  ?  403 TRP C CD1 1 
ATOM 9685  C CD2 . TRP C  1 395 ? 100.114 144.691  -4.663  1.00 65.40  ?  403 TRP C CD2 1 
ATOM 9686  N NE1 . TRP C  1 395 ? 98.691  142.966  -4.805  1.00 66.73  ?  403 TRP C NE1 1 
ATOM 9687  C CE2 . TRP C  1 395 ? 99.649  143.534  -4.007  1.00 63.05  ?  403 TRP C CE2 1 
ATOM 9688  C CE3 . TRP C  1 395 ? 101.107 145.460  -4.050  1.00 64.02  ?  403 TRP C CE3 1 
ATOM 9689  C CZ2 . TRP C  1 395 ? 100.141 143.128  -2.768  1.00 59.31  ?  403 TRP C CZ2 1 
ATOM 9690  C CZ3 . TRP C  1 395 ? 101.595 145.055  -2.819  1.00 60.37  ?  403 TRP C CZ3 1 
ATOM 9691  C CH2 . TRP C  1 395 ? 101.112 143.900  -2.192  1.00 58.04  ?  403 TRP C CH2 1 
ATOM 9692  N N   . ASN C  1 396 ? 98.868  147.858  -8.697  1.00 82.07  ?  404 ASN C N   1 
ATOM 9693  C CA  . ASN C  1 396 ? 98.717  149.070  -9.501  1.00 87.50  ?  404 ASN C CA  1 
ATOM 9694  C C   . ASN C  1 396 ? 99.356  150.233  -8.737  1.00 91.14  ?  404 ASN C C   1 
ATOM 9695  O O   . ASN C  1 396 ? 98.679  151.102  -8.188  1.00 97.84  ?  404 ASN C O   1 
ATOM 9696  C CB  . ASN C  1 396 ? 97.251  149.357  -9.836  1.00 91.87  ?  404 ASN C CB  1 
ATOM 9697  C CG  . ASN C  1 396 ? 96.690  148.402  -10.875 1.00 96.08  ?  404 ASN C CG  1 
ATOM 9698  O OD1 . ASN C  1 396 ? 95.548  147.954  -10.772 1.00 95.80  ?  404 ASN C OD1 1 
ATOM 9699  N ND2 . ASN C  1 396 ? 97.499  148.079  -11.878 1.00 99.14  ?  404 ASN C ND2 1 
ATOM 9700  N N   . PHE C  1 397 ? 100.689 150.241  -8.715  1.00 89.14  ?  405 PHE C N   1 
ATOM 9701  C CA  . PHE C  1 397 ? 101.471 151.261  -8.014  1.00 88.76  ?  405 PHE C CA  1 
ATOM 9702  C C   . PHE C  1 397 ? 101.061 151.400  -6.549  1.00 85.11  ?  405 PHE C C   1 
ATOM 9703  O O   . PHE C  1 397 ? 100.518 150.470  -5.955  1.00 79.87  ?  405 PHE C O   1 
ATOM 9704  C CB  . PHE C  1 397 ? 101.349 152.615  -8.721  1.00 92.43  ?  405 PHE C CB  1 
ATOM 9705  C CG  . PHE C  1 397 ? 102.294 152.786  -9.879  1.00 98.70  ?  405 PHE C CG  1 
ATOM 9706  C CD1 . PHE C  1 397 ? 103.495 153.460  -9.715  1.00 98.59  ?  405 PHE C CD1 1 
ATOM 9707  C CD2 . PHE C  1 397 ? 101.983 152.276  -11.129 1.00 102.76 ?  405 PHE C CD2 1 
ATOM 9708  C CE1 . PHE C  1 397 ? 104.368 153.622  -10.776 1.00 99.46  ?  405 PHE C CE1 1 
ATOM 9709  C CE2 . PHE C  1 397 ? 102.853 152.435  -12.195 1.00 104.07 ?  405 PHE C CE2 1 
ATOM 9710  C CZ  . PHE C  1 397 ? 104.046 153.109  -12.017 1.00 101.66 ?  405 PHE C CZ  1 
ATOM 9711  N N   . GLN C  1 431 ? 102.278 136.971  -17.870 1.00 117.94 ?  439 GLN C N   1 
ATOM 9712  C CA  . GLN C  1 431 ? 103.161 135.820  -18.015 1.00 118.06 ?  439 GLN C CA  1 
ATOM 9713  C C   . GLN C  1 431 ? 103.393 135.136  -16.671 1.00 117.08 ?  439 GLN C C   1 
ATOM 9714  O O   . GLN C  1 431 ? 103.043 135.677  -15.622 1.00 117.60 ?  439 GLN C O   1 
ATOM 9715  C CB  . GLN C  1 431 ? 104.498 136.249  -18.621 1.00 118.94 ?  439 GLN C CB  1 
ATOM 9716  C CG  . GLN C  1 431 ? 105.260 137.249  -17.767 1.00 119.37 ?  439 GLN C CG  1 
ATOM 9717  C CD  . GLN C  1 431 ? 106.495 137.788  -18.459 1.00 123.70 ?  439 GLN C CD  1 
ATOM 9718  O OE1 . GLN C  1 431 ? 106.764 137.465  -19.615 1.00 129.45 ?  439 GLN C OE1 1 
ATOM 9719  N NE2 . GLN C  1 431 ? 107.253 138.621  -17.753 1.00 121.19 ?  439 GLN C NE2 1 
ATOM 9720  N N   . ASP C  1 432 ? 103.990 133.942  -16.708 1.00 107.79 ?  440 ASP C N   1 
ATOM 9721  C CA  . ASP C  1 432 ? 104.191 133.152  -15.506 1.00 96.19  ?  440 ASP C CA  1 
ATOM 9722  C C   . ASP C  1 432 ? 105.441 132.299  -15.674 1.00 85.44  ?  440 ASP C C   1 
ATOM 9723  O O   . ASP C  1 432 ? 105.535 131.548  -16.659 1.00 85.42  ?  440 ASP C O   1 
ATOM 9724  C CB  . ASP C  1 432 ? 102.982 132.261  -15.214 1.00 94.82  ?  440 ASP C CB  1 
ATOM 9725  C CG  . ASP C  1 432 ? 103.260 131.230  -14.136 1.00 91.61  ?  440 ASP C CG  1 
ATOM 9726  O OD1 . ASP C  1 432 ? 103.711 131.622  -13.039 1.00 90.74  ?  440 ASP C OD1 1 
ATOM 9727  O OD2 . ASP C  1 432 ? 103.023 130.028  -14.385 1.00 89.10  -1 440 ASP C OD2 1 
ATOM 9728  N N   . PRO C  1 433 ? 106.406 132.389  -14.753 1.00 82.17  ?  441 PRO C N   1 
ATOM 9729  C CA  . PRO C  1 433 ? 107.631 131.588  -14.884 1.00 81.61  ?  441 PRO C CA  1 
ATOM 9730  C C   . PRO C  1 433 ? 107.465 130.139  -14.464 1.00 79.92  ?  441 PRO C C   1 
ATOM 9731  O O   . PRO C  1 433 ? 108.366 129.330  -14.724 1.00 77.57  ?  441 PRO C O   1 
ATOM 9732  C CB  . PRO C  1 433 ? 108.611 132.309  -13.952 1.00 75.87  ?  441 PRO C CB  1 
ATOM 9733  C CG  . PRO C  1 433 ? 107.731 132.886  -12.894 1.00 70.62  ?  441 PRO C CG  1 
ATOM 9734  C CD  . PRO C  1 433 ? 106.460 133.297  -13.595 1.00 72.54  ?  441 PRO C CD  1 
ATOM 9735  N N   . TYR C  1 434 ? 106.346 129.792  -13.835 1.00 79.31  ?  442 TYR C N   1 
ATOM 9736  C CA  . TYR C  1 434 ? 106.132 128.473  -13.258 1.00 74.26  ?  442 TYR C CA  1 
ATOM 9737  C C   . TYR C  1 434 ? 105.314 127.552  -14.151 1.00 81.11  ?  442 TYR C C   1 
ATOM 9738  O O   . TYR C  1 434 ? 105.145 126.377  -13.813 1.00 78.08  ?  442 TYR C O   1 
ATOM 9739  C CB  . TYR C  1 434 ? 105.456 128.610  -11.891 1.00 64.84  ?  442 TYR C CB  1 
ATOM 9740  C CG  . TYR C  1 434 ? 106.319 129.310  -10.868 1.00 58.99  ?  442 TYR C CG  1 
ATOM 9741  C CD1 . TYR C  1 434 ? 107.703 129.226  -10.930 1.00 59.01  ?  442 TYR C CD1 1 
ATOM 9742  C CD2 . TYR C  1 434 ? 105.754 130.061  -9.848  1.00 58.14  ?  442 TYR C CD2 1 
ATOM 9743  C CE1 . TYR C  1 434 ? 108.500 129.864  -10.001 1.00 59.85  ?  442 TYR C CE1 1 
ATOM 9744  C CE2 . TYR C  1 434 ? 106.543 130.704  -8.914  1.00 57.33  ?  442 TYR C CE2 1 
ATOM 9745  C CZ  . TYR C  1 434 ? 107.916 130.602  -8.996  1.00 57.71  ?  442 TYR C CZ  1 
ATOM 9746  O OH  . TYR C  1 434 ? 108.709 131.239  -8.068  1.00 56.65  ?  442 TYR C OH  1 
ATOM 9747  N N   . ASP C  1 435 ? 104.811 128.046  -15.284 1.00 82.04  ?  443 ASP C N   1 
ATOM 9748  C CA  . ASP C  1 435 ? 104.044 127.196  -16.185 1.00 94.07  ?  443 ASP C CA  1 
ATOM 9749  C C   . ASP C  1 435 ? 104.917 126.212  -16.951 1.00 93.12  ?  443 ASP C C   1 
ATOM 9750  O O   . ASP C  1 435 ? 104.380 125.313  -17.608 1.00 91.23  ?  443 ASP C O   1 
ATOM 9751  C CB  . ASP C  1 435 ? 103.246 128.056  -17.167 1.00 110.50 ?  443 ASP C CB  1 
ATOM 9752  C CG  . ASP C  1 435 ? 102.092 127.301  -17.799 1.00 120.46 ?  443 ASP C CG  1 
ATOM 9753  O OD1 . ASP C  1 435 ? 101.574 126.362  -17.157 1.00 120.56 ?  443 ASP C OD1 1 
ATOM 9754  O OD2 . ASP C  1 435 ? 101.703 127.646  -18.934 1.00 126.48 -1 443 ASP C OD2 1 
ATOM 9755  N N   . LYS C  1 436 ? 106.242 126.353  -16.878 1.00 98.30  ?  444 LYS C N   1 
ATOM 9756  C CA  . LYS C  1 436 ? 107.129 125.345  -17.441 1.00 93.31  ?  444 LYS C CA  1 
ATOM 9757  C C   . LYS C  1 436 ? 107.149 124.068  -16.609 1.00 77.25  ?  444 LYS C C   1 
ATOM 9758  O O   . LYS C  1 436 ? 107.547 123.016  -17.119 1.00 75.50  ?  444 LYS C O   1 
ATOM 9759  C CB  . LYS C  1 436 ? 108.548 125.908  -17.550 1.00 101.14 ?  444 LYS C CB  1 
ATOM 9760  C CG  . LYS C  1 436 ? 109.474 125.144  -18.483 1.00 107.73 ?  444 LYS C CG  1 
ATOM 9761  C CD  . LYS C  1 436 ? 110.741 125.938  -18.766 1.00 110.19 ?  444 LYS C CD  1 
ATOM 9762  C CE  . LYS C  1 436 ? 111.405 126.387  -17.471 1.00 107.28 ?  444 LYS C CE  1 
ATOM 9763  N NZ  . LYS C  1 436 ? 112.574 127.276  -17.714 1.00 108.20 1  444 LYS C NZ  1 
ATOM 9764  N N   . LEU C  1 437 ? 106.710 124.133  -15.357 1.00 73.64  ?  445 LEU C N   1 
ATOM 9765  C CA  . LEU C  1 437 ? 106.709 122.991  -14.458 1.00 67.78  ?  445 LEU C CA  1 
ATOM 9766  C C   . LEU C  1 437 ? 105.304 122.413  -14.318 1.00 70.46  ?  445 LEU C C   1 
ATOM 9767  O O   . LEU C  1 437 ? 104.300 123.088  -14.559 1.00 75.23  ?  445 LEU C O   1 
ATOM 9768  C CB  . LEU C  1 437 ? 107.251 123.399  -13.086 1.00 67.70  ?  445 LEU C CB  1 
ATOM 9769  C CG  . LEU C  1 437 ? 108.574 124.170  -13.113 1.00 63.10  ?  445 LEU C CG  1 
ATOM 9770  C CD1 . LEU C  1 437 ? 108.819 124.879  -11.789 1.00 59.62  ?  445 LEU C CD1 1 
ATOM 9771  C CD2 . LEU C  1 437 ? 109.735 123.251  -13.454 1.00 60.04  ?  445 LEU C CD2 1 
ATOM 9772  N N   . LYS C  1 438 ? 105.247 121.147  -13.912 1.00 66.93  ?  446 LYS C N   1 
ATOM 9773  C CA  . LYS C  1 438 ? 103.992 120.417  -13.778 1.00 62.12  ?  446 LYS C CA  1 
ATOM 9774  C C   . LYS C  1 438 ? 103.567 120.413  -12.314 1.00 57.54  ?  446 LYS C C   1 
ATOM 9775  O O   . LYS C  1 438 ? 104.312 119.939  -11.450 1.00 52.45  ?  446 LYS C O   1 
ATOM 9776  C CB  . LYS C  1 438 ? 104.132 118.988  -14.303 1.00 53.15  ?  446 LYS C CB  1 
ATOM 9777  C CG  . LYS C  1 438 ? 102.817 118.229  -14.370 1.00 58.37  ?  446 LYS C CG  1 
ATOM 9778  C CD  . LYS C  1 438 ? 101.803 118.980  -15.225 1.00 67.19  ?  446 LYS C CD  1 
ATOM 9779  C CE  . LYS C  1 438 ? 100.373 118.627  -14.846 1.00 70.50  ?  446 LYS C CE  1 
ATOM 9780  N NZ  . LYS C  1 438 ? 99.400  119.632  -15.363 1.00 75.08  1  446 LYS C NZ  1 
ATOM 9781  N N   . PHE C  1 439 ? 102.369 120.927  -12.040 1.00 53.88  ?  447 PHE C N   1 
ATOM 9782  C CA  . PHE C  1 439 ? 101.818 120.953  -10.693 1.00 51.35  ?  447 PHE C CA  1 
ATOM 9783  C C   . PHE C  1 439 ? 100.411 120.370  -10.694 1.00 52.33  ?  447 PHE C C   1 
ATOM 9784  O O   . PHE C  1 439 ? 99.788  120.181  -11.743 1.00 55.15  ?  447 PHE C O   1 
ATOM 9785  C CB  . PHE C  1 439 ? 101.786 122.378  -10.121 1.00 52.16  ?  447 PHE C CB  1 
ATOM 9786  C CG  . PHE C  1 439 ? 103.129 123.046  -10.070 1.00 51.85  ?  447 PHE C CG  1 
ATOM 9787  C CD1 . PHE C  1 439 ? 104.053 122.699  -9.100  1.00 53.34  ?  447 PHE C CD1 1 
ATOM 9788  C CD