data_5YDJ
# 
_entry.id   5YDJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5YDJ         
WWPDB D_1300005090 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5X61 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5YDJ 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Han, Q.'      1 ? 
'Guan, H.'     2 ? 
'Ding, H.'     3 ? 
'Liao, C.'     4 ? 
'Robinson, H.' 5 ? 
'Li, J.'       6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Crystal structures of acetylcholinesterase of the malaria vector Anopheles gambiae reveal a polymerization interface,  ligand binding residues and post translational modifications
;
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Han, Q.'      1 ? 
primary 'Guan, H.'     2 ? 
primary 'Ding, H.'     3 ? 
primary 'Liao, C.'     4 ? 
primary 'Robinson, H.' 5 ? 
primary 'Li, J.'       6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5YDJ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     147.650 
_cell.length_a_esd                 ? 
_cell.length_b                     147.650 
_cell.length_b_esd                 ? 
_cell.length_c                     224.180 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5YDJ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                                      81143.398 2  3.1.1.7 ? 
? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2  ?       ? 
? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   2  ?       ? 
? ? 
4 non-polymer syn 'SULFATE ION'                                                                             96.063    29 ?       ? 
? ? 
5 non-polymer syn 'COBALT (II) ION'                                                                         58.933    2  ?       ? 
? ? 
6 water       nat water                                                                                     18.015    48 ?       ? 
? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MEIRGLLMGRLRLGRRMVPLGLLGVTALLLILPPFALVQGRHHELNNGAAIGSHQLSAAAGVGLASQSAQSGSLASGVMS
SVPAAGASSSSSSSLLSSSAEDDVARITLSKDADAFFTPYIGHGESVRIIDAELGTLEHVHSGATPRRRGLTRRESNSDA
NDNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFP
GATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLG
TPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGE(SEB)AGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALV
SREEATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKT
EILTGSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVG
DYHFTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNF
AKTGNPNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESSAFF
YRPDLIVLLVSLLTATVRFIQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEIRGLLMGRLRLGRRMVPLGLLGVTALLLILPPFALVQGRHHELNNGAAIGSHQLSAAAGVGLASQSAQSGSLASGVMS
SVPAAGASSSSSSSLLSSSAEDDVARITLSKDADAFFTPYIGHGESVRIIDAELGTLEHVHSGATPRRRGLTRRESNSDA
NDNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFP
GATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLG
TPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREE
ATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILT
GSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHF
TCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTG
NPNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESSAFFYRPD
LIVLLVSLLTATVRFIQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ILE n 
1 4   ARG n 
1 5   GLY n 
1 6   LEU n 
1 7   LEU n 
1 8   MET n 
1 9   GLY n 
1 10  ARG n 
1 11  LEU n 
1 12  ARG n 
1 13  LEU n 
1 14  GLY n 
1 15  ARG n 
1 16  ARG n 
1 17  MET n 
1 18  VAL n 
1 19  PRO n 
1 20  LEU n 
1 21  GLY n 
1 22  LEU n 
1 23  LEU n 
1 24  GLY n 
1 25  VAL n 
1 26  THR n 
1 27  ALA n 
1 28  LEU n 
1 29  LEU n 
1 30  LEU n 
1 31  ILE n 
1 32  LEU n 
1 33  PRO n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  LEU n 
1 38  VAL n 
1 39  GLN n 
1 40  GLY n 
1 41  ARG n 
1 42  HIS n 
1 43  HIS n 
1 44  GLU n 
1 45  LEU n 
1 46  ASN n 
1 47  ASN n 
1 48  GLY n 
1 49  ALA n 
1 50  ALA n 
1 51  ILE n 
1 52  GLY n 
1 53  SER n 
1 54  HIS n 
1 55  GLN n 
1 56  LEU n 
1 57  SER n 
1 58  ALA n 
1 59  ALA n 
1 60  ALA n 
1 61  GLY n 
1 62  VAL n 
1 63  GLY n 
1 64  LEU n 
1 65  ALA n 
1 66  SER n 
1 67  GLN n 
1 68  SER n 
1 69  ALA n 
1 70  GLN n 
1 71  SER n 
1 72  GLY n 
1 73  SER n 
1 74  LEU n 
1 75  ALA n 
1 76  SER n 
1 77  GLY n 
1 78  VAL n 
1 79  MET n 
1 80  SER n 
1 81  SER n 
1 82  VAL n 
1 83  PRO n 
1 84  ALA n 
1 85  ALA n 
1 86  GLY n 
1 87  ALA n 
1 88  SER n 
1 89  SER n 
1 90  SER n 
1 91  SER n 
1 92  SER n 
1 93  SER n 
1 94  SER n 
1 95  LEU n 
1 96  LEU n 
1 97  SER n 
1 98  SER n 
1 99  SER n 
1 100 ALA n 
1 101 GLU n 
1 102 ASP n 
1 103 ASP n 
1 104 VAL n 
1 105 ALA n 
1 106 ARG n 
1 107 ILE n 
1 108 THR n 
1 109 LEU n 
1 110 SER n 
1 111 LYS n 
1 112 ASP n 
1 113 ALA n 
1 114 ASP n 
1 115 ALA n 
1 116 PHE n 
1 117 PHE n 
1 118 THR n 
1 119 PRO n 
1 120 TYR n 
1 121 ILE n 
1 122 GLY n 
1 123 HIS n 
1 124 GLY n 
1 125 GLU n 
1 126 SER n 
1 127 VAL n 
1 128 ARG n 
1 129 ILE n 
1 130 ILE n 
1 131 ASP n 
1 132 ALA n 
1 133 GLU n 
1 134 LEU n 
1 135 GLY n 
1 136 THR n 
1 137 LEU n 
1 138 GLU n 
1 139 HIS n 
1 140 VAL n 
1 141 HIS n 
1 142 SER n 
1 143 GLY n 
1 144 ALA n 
1 145 THR n 
1 146 PRO n 
1 147 ARG n 
1 148 ARG n 
1 149 ARG n 
1 150 GLY n 
1 151 LEU n 
1 152 THR n 
1 153 ARG n 
1 154 ARG n 
1 155 GLU n 
1 156 SER n 
1 157 ASN n 
1 158 SER n 
1 159 ASP n 
1 160 ALA n 
1 161 ASN n 
1 162 ASP n 
1 163 ASN n 
1 164 ASP n 
1 165 PRO n 
1 166 LEU n 
1 167 VAL n 
1 168 VAL n 
1 169 ASN n 
1 170 THR n 
1 171 ASP n 
1 172 LYS n 
1 173 GLY n 
1 174 ARG n 
1 175 ILE n 
1 176 ARG n 
1 177 GLY n 
1 178 ILE n 
1 179 THR n 
1 180 VAL n 
1 181 ASP n 
1 182 ALA n 
1 183 PRO n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LYS n 
1 188 VAL n 
1 189 ASP n 
1 190 VAL n 
1 191 TRP n 
1 192 LEU n 
1 193 GLY n 
1 194 ILE n 
1 195 PRO n 
1 196 TYR n 
1 197 ALA n 
1 198 GLN n 
1 199 PRO n 
1 200 PRO n 
1 201 VAL n 
1 202 GLY n 
1 203 PRO n 
1 204 LEU n 
1 205 ARG n 
1 206 PHE n 
1 207 ARG n 
1 208 HIS n 
1 209 PRO n 
1 210 ARG n 
1 211 PRO n 
1 212 ALA n 
1 213 GLU n 
1 214 LYS n 
1 215 TRP n 
1 216 THR n 
1 217 GLY n 
1 218 VAL n 
1 219 LEU n 
1 220 ASN n 
1 221 THR n 
1 222 THR n 
1 223 THR n 
1 224 PRO n 
1 225 PRO n 
1 226 ASN n 
1 227 SER n 
1 228 CYS n 
1 229 VAL n 
1 230 GLN n 
1 231 ILE n 
1 232 VAL n 
1 233 ASP n 
1 234 THR n 
1 235 VAL n 
1 236 PHE n 
1 237 GLY n 
1 238 ASP n 
1 239 PHE n 
1 240 PRO n 
1 241 GLY n 
1 242 ALA n 
1 243 THR n 
1 244 MET n 
1 245 TRP n 
1 246 ASN n 
1 247 PRO n 
1 248 ASN n 
1 249 THR n 
1 250 PRO n 
1 251 LEU n 
1 252 SER n 
1 253 GLU n 
1 254 ASP n 
1 255 CYS n 
1 256 LEU n 
1 257 TYR n 
1 258 ILE n 
1 259 ASN n 
1 260 VAL n 
1 261 VAL n 
1 262 ALA n 
1 263 PRO n 
1 264 ARG n 
1 265 PRO n 
1 266 ARG n 
1 267 PRO n 
1 268 LYS n 
1 269 ASN n 
1 270 ALA n 
1 271 ALA n 
1 272 VAL n 
1 273 MET n 
1 274 LEU n 
1 275 TRP n 
1 276 ILE n 
1 277 PHE n 
1 278 GLY n 
1 279 GLY n 
1 280 GLY n 
1 281 PHE n 
1 282 TYR n 
1 283 SER n 
1 284 GLY n 
1 285 THR n 
1 286 ALA n 
1 287 THR n 
1 288 LEU n 
1 289 ASP n 
1 290 VAL n 
1 291 TYR n 
1 292 ASP n 
1 293 HIS n 
1 294 ARG n 
1 295 ALA n 
1 296 LEU n 
1 297 ALA n 
1 298 SER n 
1 299 GLU n 
1 300 GLU n 
1 301 ASN n 
1 302 VAL n 
1 303 ILE n 
1 304 VAL n 
1 305 VAL n 
1 306 SER n 
1 307 LEU n 
1 308 GLN n 
1 309 TYR n 
1 310 ARG n 
1 311 VAL n 
1 312 ALA n 
1 313 SER n 
1 314 LEU n 
1 315 GLY n 
1 316 PHE n 
1 317 LEU n 
1 318 PHE n 
1 319 LEU n 
1 320 GLY n 
1 321 THR n 
1 322 PRO n 
1 323 GLU n 
1 324 ALA n 
1 325 PRO n 
1 326 GLY n 
1 327 ASN n 
1 328 ALA n 
1 329 GLY n 
1 330 LEU n 
1 331 PHE n 
1 332 ASP n 
1 333 GLN n 
1 334 ASN n 
1 335 LEU n 
1 336 ALA n 
1 337 LEU n 
1 338 ARG n 
1 339 TRP n 
1 340 VAL n 
1 341 ARG n 
1 342 ASP n 
1 343 ASN n 
1 344 ILE n 
1 345 HIS n 
1 346 ARG n 
1 347 PHE n 
1 348 GLY n 
1 349 GLY n 
1 350 ASP n 
1 351 PRO n 
1 352 SER n 
1 353 ARG n 
1 354 VAL n 
1 355 THR n 
1 356 LEU n 
1 357 PHE n 
1 358 GLY n 
1 359 GLU n 
1 360 SEB n 
1 361 ALA n 
1 362 GLY n 
1 363 ALA n 
1 364 VAL n 
1 365 SER n 
1 366 VAL n 
1 367 SER n 
1 368 LEU n 
1 369 HIS n 
1 370 LEU n 
1 371 LEU n 
1 372 SER n 
1 373 ALA n 
1 374 LEU n 
1 375 SER n 
1 376 ARG n 
1 377 ASP n 
1 378 LEU n 
1 379 PHE n 
1 380 GLN n 
1 381 ARG n 
1 382 ALA n 
1 383 ILE n 
1 384 LEU n 
1 385 GLN n 
1 386 SER n 
1 387 GLY n 
1 388 SER n 
1 389 PRO n 
1 390 THR n 
1 391 ALA n 
1 392 PRO n 
1 393 TRP n 
1 394 ALA n 
1 395 LEU n 
1 396 VAL n 
1 397 SER n 
1 398 ARG n 
1 399 GLU n 
1 400 GLU n 
1 401 ALA n 
1 402 THR n 
1 403 LEU n 
1 404 ARG n 
1 405 ALA n 
1 406 LEU n 
1 407 ARG n 
1 408 LEU n 
1 409 ALA n 
1 410 GLU n 
1 411 ALA n 
1 412 VAL n 
1 413 GLY n 
1 414 CYS n 
1 415 PRO n 
1 416 HIS n 
1 417 GLU n 
1 418 PRO n 
1 419 SER n 
1 420 LYS n 
1 421 LEU n 
1 422 SER n 
1 423 ASP n 
1 424 ALA n 
1 425 VAL n 
1 426 GLU n 
1 427 CYS n 
1 428 LEU n 
1 429 ARG n 
1 430 GLY n 
1 431 LYS n 
1 432 ASP n 
1 433 PRO n 
1 434 HIS n 
1 435 VAL n 
1 436 LEU n 
1 437 VAL n 
1 438 ASN n 
1 439 ASN n 
1 440 GLU n 
1 441 TRP n 
1 442 GLY n 
1 443 THR n 
1 444 LEU n 
1 445 GLY n 
1 446 ILE n 
1 447 CYS n 
1 448 GLU n 
1 449 PHE n 
1 450 PRO n 
1 451 PHE n 
1 452 VAL n 
1 453 PRO n 
1 454 VAL n 
1 455 VAL n 
1 456 ASP n 
1 457 GLY n 
1 458 ALA n 
1 459 PHE n 
1 460 LEU n 
1 461 ASP n 
1 462 GLU n 
1 463 THR n 
1 464 PRO n 
1 465 GLN n 
1 466 ARG n 
1 467 SER n 
1 468 LEU n 
1 469 ALA n 
1 470 SER n 
1 471 GLY n 
1 472 ARG n 
1 473 PHE n 
1 474 LYS n 
1 475 LYS n 
1 476 THR n 
1 477 GLU n 
1 478 ILE n 
1 479 LEU n 
1 480 THR n 
1 481 GLY n 
1 482 SER n 
1 483 ASN n 
1 484 THR n 
1 485 GLU n 
1 486 GLU n 
1 487 GLY n 
1 488 TYR n 
1 489 TYR n 
1 490 PHE n 
1 491 ILE n 
1 492 ILE n 
1 493 TYR n 
1 494 TYR n 
1 495 LEU n 
1 496 THR n 
1 497 GLU n 
1 498 LEU n 
1 499 LEU n 
1 500 ARG n 
1 501 LYS n 
1 502 GLU n 
1 503 GLU n 
1 504 GLY n 
1 505 VAL n 
1 506 THR n 
1 507 VAL n 
1 508 THR n 
1 509 ARG n 
1 510 GLU n 
1 511 GLU n 
1 512 PHE n 
1 513 LEU n 
1 514 GLN n 
1 515 ALA n 
1 516 VAL n 
1 517 ARG n 
1 518 GLU n 
1 519 LEU n 
1 520 ASN n 
1 521 PRO n 
1 522 TYR n 
1 523 VAL n 
1 524 ASN n 
1 525 GLY n 
1 526 ALA n 
1 527 ALA n 
1 528 ARG n 
1 529 GLN n 
1 530 ALA n 
1 531 ILE n 
1 532 VAL n 
1 533 PHE n 
1 534 GLU n 
1 535 TYR n 
1 536 THR n 
1 537 ASP n 
1 538 TRP n 
1 539 THR n 
1 540 GLU n 
1 541 PRO n 
1 542 ASP n 
1 543 ASN n 
1 544 PRO n 
1 545 ASN n 
1 546 SER n 
1 547 ASN n 
1 548 ARG n 
1 549 ASP n 
1 550 ALA n 
1 551 LEU n 
1 552 ASP n 
1 553 LYS n 
1 554 MET n 
1 555 VAL n 
1 556 GLY n 
1 557 ASP n 
1 558 TYR n 
1 559 HIS n 
1 560 PHE n 
1 561 THR n 
1 562 CYS n 
1 563 ASN n 
1 564 VAL n 
1 565 ASN n 
1 566 GLU n 
1 567 PHE n 
1 568 ALA n 
1 569 GLN n 
1 570 ARG n 
1 571 TYR n 
1 572 ALA n 
1 573 GLU n 
1 574 GLU n 
1 575 GLY n 
1 576 ASN n 
1 577 ASN n 
1 578 VAL n 
1 579 TYR n 
1 580 MET n 
1 581 TYR n 
1 582 LEU n 
1 583 TYR n 
1 584 THR n 
1 585 HIS n 
1 586 ARG n 
1 587 SER n 
1 588 LYS n 
1 589 GLY n 
1 590 ASN n 
1 591 PRO n 
1 592 TRP n 
1 593 PRO n 
1 594 ARG n 
1 595 TRP n 
1 596 THR n 
1 597 GLY n 
1 598 VAL n 
1 599 MET n 
1 600 HIS n 
1 601 GLY n 
1 602 ASP n 
1 603 GLU n 
1 604 ILE n 
1 605 ASN n 
1 606 TYR n 
1 607 VAL n 
1 608 PHE n 
1 609 GLY n 
1 610 GLU n 
1 611 PRO n 
1 612 LEU n 
1 613 ASN n 
1 614 PRO n 
1 615 THR n 
1 616 LEU n 
1 617 GLY n 
1 618 TYR n 
1 619 THR n 
1 620 GLU n 
1 621 ASP n 
1 622 GLU n 
1 623 LYS n 
1 624 ASP n 
1 625 PHE n 
1 626 SER n 
1 627 ARG n 
1 628 LYS n 
1 629 ILE n 
1 630 MET n 
1 631 ARG n 
1 632 TYR n 
1 633 TRP n 
1 634 SER n 
1 635 ASN n 
1 636 PHE n 
1 637 ALA n 
1 638 LYS n 
1 639 THR n 
1 640 GLY n 
1 641 ASN n 
1 642 PRO n 
1 643 ASN n 
1 644 PRO n 
1 645 ASN n 
1 646 THR n 
1 647 ALA n 
1 648 SER n 
1 649 SER n 
1 650 GLU n 
1 651 PHE n 
1 652 PRO n 
1 653 GLU n 
1 654 TRP n 
1 655 PRO n 
1 656 LYS n 
1 657 HIS n 
1 658 THR n 
1 659 ALA n 
1 660 HIS n 
1 661 GLY n 
1 662 ARG n 
1 663 HIS n 
1 664 TYR n 
1 665 LEU n 
1 666 GLU n 
1 667 LEU n 
1 668 GLY n 
1 669 LEU n 
1 670 ASN n 
1 671 THR n 
1 672 SER n 
1 673 PHE n 
1 674 VAL n 
1 675 GLY n 
1 676 ARG n 
1 677 GLY n 
1 678 PRO n 
1 679 ARG n 
1 680 LEU n 
1 681 ARG n 
1 682 GLN n 
1 683 CYS n 
1 684 ALA n 
1 685 PHE n 
1 686 TRP n 
1 687 LYS n 
1 688 LYS n 
1 689 TYR n 
1 690 LEU n 
1 691 PRO n 
1 692 GLN n 
1 693 LEU n 
1 694 VAL n 
1 695 ALA n 
1 696 ALA n 
1 697 THR n 
1 698 SER n 
1 699 ASN n 
1 700 LEU n 
1 701 PRO n 
1 702 GLY n 
1 703 PRO n 
1 704 ALA n 
1 705 PRO n 
1 706 PRO n 
1 707 SER n 
1 708 GLU n 
1 709 PRO n 
1 710 CYS n 
1 711 GLU n 
1 712 SER n 
1 713 SER n 
1 714 ALA n 
1 715 PHE n 
1 716 PHE n 
1 717 TYR n 
1 718 ARG n 
1 719 PRO n 
1 720 ASP n 
1 721 LEU n 
1 722 ILE n 
1 723 VAL n 
1 724 LEU n 
1 725 LEU n 
1 726 VAL n 
1 727 SER n 
1 728 LEU n 
1 729 LEU n 
1 730 THR n 
1 731 ALA n 
1 732 THR n 
1 733 VAL n 
1 734 ARG n 
1 735 PHE n 
1 736 ILE n 
1 737 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   737 
_entity_src_gen.gene_src_common_name               'African malaria mosquito' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Ace, ACE1, ACHE1, AGAP001356' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Anopheles gambiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7165 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Komagataella pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPICZ*A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_ANOGA 
_struct_ref.pdbx_db_accession          Q869C3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MEIRGLLMGRLRLGRRMVPLGLLGVTALLLILPPFALVQGRHHELNNGAAIGSHQLSAAAGVGLASQSAQSGSLASGVMS
SVPAAGASSSSSSSLLSSSAEDDVARITLSKDADAFFTPYIGHGESVRIIDAELGTLEHVHSGATPRRRGLTRRESNSDA
NDNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFP
GATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLG
TPEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREE
ATLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILT
GSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHF
TCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTG
NPNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESSAFFYRPD
LIVLLVSLLTATVRFIQ
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5YDJ A 1 ? 737 ? Q869C3 1 ? 737 ? 1 737 
2 1 5YDJ B 1 ? 737 ? Q869C3 1 ? 737 ? 1 737 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CO  non-polymer                  . 'COBALT (II) ION'                        ? 'Co 2'           58.933  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SEB 'L-peptide linking'          n O-BENZYLSULFONYL-SERINE                  ? 'C10 H13 N O5 S' 259.279 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'                            ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5YDJ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.70 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES BUFFER, 1.6M AMMONIUM SULFATE, PH 7.5, 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-05-25 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5YDJ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.04 
_reflns.d_resolution_low                 61.48 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       51171 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  22.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            24.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.04 
_reflns_shell.d_res_low                   3.12 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.01 
_refine.aniso_B[1][2]                            0.01 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.01 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -0.04 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               58.244 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.850 
_refine.correlation_coeff_Fo_to_Fc_free          0.804 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5YDJ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.04 
_refine.ls_d_res_low                             61.48 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     50417 
_refine.ls_number_reflns_R_free                  2701 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.25280 
_refine.ls_R_factor_R_free                       0.28638 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.25100 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5X61 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.592 
_refine.pdbx_overall_ESU_R_Free                  0.370 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        8534 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         231 
_refine_hist.number_atoms_solvent             48 
_refine_hist.number_atoms_total               8813 
_refine_hist.d_res_high                       3.04 
_refine_hist.d_res_low                        61.48 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  0.019  9002  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  7936  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.172  1.975  12304 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 3.819  3.000  18384 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.577  5.000  1074  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 32.087 23.333 426   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 14.311 15.000 1324  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 13.064 15.000 70    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.066  0.200  1331  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  9948  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.011  0.020  1924  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 3.750  5.780  4302  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.740  5.779  4301  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 5.811  8.669  5374  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.811  8.670  5375  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.406  6.137  4700  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.260  6.137  4700  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.823  9.117  6931  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 8.343  67.201 9647  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 8.354  67.195 9648  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.040 
_refine_ls_shell.d_res_low                        3.119 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             215 
_refine_ls_shell.number_reflns_R_work             3703 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.371 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.334 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5YDJ 
_struct.title                        'Crystal structure of anopheles gambiae acetylcholinesterase in complex with PMSF' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5YDJ 
_struct_keywords.text            'ACETYLCHOLINESTERASE PMSF, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 5 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
GA N N 4 ? 
HA N N 4 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 5 ? 
LA N N 6 ? 
MA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 201 ? ARG A 205 ? VAL A 201 ARG A 205 5 ? 5  
HELX_P HELX_P2  AA2 PHE A 239 ? MET A 244 ? PHE A 239 MET A 244 1 ? 6  
HELX_P HELX_P3  AA3 LEU A 288 ? TYR A 291 ? LEU A 288 TYR A 291 5 ? 4  
HELX_P HELX_P4  AA4 ASP A 292 ? ASN A 301 ? ASP A 292 ASN A 301 1 ? 10 
HELX_P HELX_P5  AA5 ALA A 312 ? LEU A 317 ? ALA A 312 LEU A 317 1 ? 6  
HELX_P HELX_P6  AA6 ASN A 327 ? ILE A 344 ? ASN A 327 ILE A 344 1 ? 18 
HELX_P HELX_P7  AA7 HIS A 345 ? PHE A 347 ? HIS A 345 PHE A 347 5 ? 3  
HELX_P HELX_P8  AA8 SEB A 360 ? SER A 372 ? SEB A 360 SER A 372 1 ? 13 
HELX_P HELX_P9  AA9 SER A 397 ? GLY A 413 ? SER A 397 GLY A 413 1 ? 17 
HELX_P HELX_P10 AB1 LEU A 421 ? LYS A 431 ? LEU A 421 LYS A 431 1 ? 11 
HELX_P HELX_P11 AB2 ASP A 432 ? ASN A 439 ? ASP A 432 ASN A 439 1 ? 8  
HELX_P HELX_P12 AB3 THR A 463 ? GLY A 471 ? THR A 463 GLY A 471 1 ? 9  
HELX_P HELX_P13 AB4 GLY A 487 ? TYR A 494 ? GLY A 487 TYR A 494 1 ? 8  
HELX_P HELX_P14 AB5 THR A 508 ? ASN A 520 ? THR A 508 ASN A 520 1 ? 13 
HELX_P HELX_P15 AB6 GLY A 525 ? TYR A 535 ? GLY A 525 TYR A 535 1 ? 11 
HELX_P HELX_P16 AB7 ASN A 543 ? PHE A 560 ? ASN A 543 PHE A 560 1 ? 18 
HELX_P HELX_P17 AB8 PHE A 560 ? GLU A 573 ? PHE A 560 GLU A 573 1 ? 14 
HELX_P HELX_P18 AB9 PRO A 593 ? GLY A 597 ? PRO A 593 GLY A 597 5 ? 5  
HELX_P HELX_P19 AC1 ASP A 602 ? PHE A 608 ? ASP A 602 PHE A 608 1 ? 7  
HELX_P HELX_P20 AC2 THR A 619 ? GLY A 640 ? THR A 619 GLY A 640 1 ? 22 
HELX_P HELX_P21 AC3 ARG A 679 ? LYS A 688 ? ARG A 679 LYS A 688 1 ? 10 
HELX_P HELX_P22 AC4 LYS A 688 ? SER A 698 ? LYS A 688 SER A 698 1 ? 11 
HELX_P HELX_P23 AC5 VAL B 201 ? ARG B 205 ? VAL B 201 ARG B 205 5 ? 5  
HELX_P HELX_P24 AC6 PHE B 239 ? MET B 244 ? PHE B 239 MET B 244 1 ? 6  
HELX_P HELX_P25 AC7 LEU B 288 ? TYR B 291 ? LEU B 288 TYR B 291 5 ? 4  
HELX_P HELX_P26 AC8 ASP B 292 ? ASN B 301 ? ASP B 292 ASN B 301 1 ? 10 
HELX_P HELX_P27 AC9 VAL B 311 ? LEU B 317 ? VAL B 311 LEU B 317 1 ? 7  
HELX_P HELX_P28 AD1 ASN B 327 ? ILE B 344 ? ASN B 327 ILE B 344 1 ? 18 
HELX_P HELX_P29 AD2 HIS B 345 ? PHE B 347 ? HIS B 345 PHE B 347 5 ? 3  
HELX_P HELX_P30 AD3 SEB B 360 ? SER B 372 ? SEB B 360 SER B 372 1 ? 13 
HELX_P HELX_P31 AD4 SER B 397 ? GLY B 413 ? SER B 397 GLY B 413 1 ? 17 
HELX_P HELX_P32 AD5 LEU B 421 ? LYS B 431 ? LEU B 421 LYS B 431 1 ? 11 
HELX_P HELX_P33 AD6 ASP B 432 ? ASN B 438 ? ASP B 432 ASN B 438 1 ? 7  
HELX_P HELX_P34 AD7 THR B 463 ? SER B 470 ? THR B 463 SER B 470 1 ? 8  
HELX_P HELX_P35 AD8 GLY B 487 ? TYR B 494 ? GLY B 487 TYR B 494 1 ? 8  
HELX_P HELX_P36 AD9 THR B 508 ? ASN B 520 ? THR B 508 ASN B 520 1 ? 13 
HELX_P HELX_P37 AE1 GLY B 525 ? TYR B 535 ? GLY B 525 TYR B 535 1 ? 11 
HELX_P HELX_P38 AE2 ASN B 543 ? PHE B 560 ? ASN B 543 PHE B 560 1 ? 18 
HELX_P HELX_P39 AE3 PHE B 560 ? GLU B 573 ? PHE B 560 GLU B 573 1 ? 14 
HELX_P HELX_P40 AE4 PRO B 593 ? GLY B 597 ? PRO B 593 GLY B 597 5 ? 5  
HELX_P HELX_P41 AE5 GLU B 603 ? PHE B 608 ? GLU B 603 PHE B 608 1 ? 6  
HELX_P HELX_P42 AE6 GLY B 609 ? ASN B 613 ? GLY B 609 ASN B 613 5 ? 5  
HELX_P HELX_P43 AE7 THR B 619 ? GLY B 640 ? THR B 619 GLY B 640 1 ? 22 
HELX_P HELX_P44 AE8 ARG B 679 ? LYS B 688 ? ARG B 679 LYS B 688 1 ? 10 
HELX_P HELX_P45 AE9 LYS B 688 ? SER B 698 ? LYS B 688 SER B 698 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A  CYS 228 SG  ? ? ? 1_555 A  CYS 255 SG ? ? A CYS 228 A CYS 255 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf2  disulf ?    ? A  CYS 414 SG  ? ? ? 1_555 A  CYS 427 SG ? ? A CYS 414 A CYS 427 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf3  disulf ?    ? A  CYS 562 SG  ? ? ? 1_555 A  CYS 683 SG ? ? A CYS 562 A CYS 683 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf4  disulf ?    ? B  CYS 228 SG  ? ? ? 1_555 B  CYS 255 SG ? ? B CYS 228 B CYS 255 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf5  disulf ?    ? B  CYS 414 SG  ? ? ? 1_555 B  CYS 427 SG ? ? B CYS 414 B CYS 427 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf6  disulf ?    ? B  CYS 562 SG  ? ? ? 1_555 B  CYS 683 SG ? ? B CYS 562 B CYS 683 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale1  covale one  ? A  ASN 220 ND2 ? ? ? 1_555 C  NAG .   C1 ? ? A ASN 220 C NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? 
N-Glycosylation 
covale2  covale both ? A  GLU 359 C   ? ? ? 1_555 A  SEB 360 N  ? ? A GLU 359 A SEB 360 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale3  covale both ? A  SEB 360 C   ? ? ? 1_555 A  ALA 361 N  ? ? A SEB 360 A ALA 361 1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale4  covale one  ? A  ASN 670 ND2 ? ? ? 1_555 E  NAG .   C1 ? ? A ASN 670 A NAG 801 1_555 ? ? ? ? ? ? ? 1.446 ? 
N-Glycosylation 
covale5  covale one  ? B  ASN 220 ND2 ? ? ? 1_555 D  NAG .   C1 ? ? B ASN 220 D NAG 1   1_555 ? ? ? ? ? ? ? 1.451 ? 
N-Glycosylation 
covale6  covale both ? B  GLU 359 C   ? ? ? 1_555 B  SEB 360 N  ? ? B GLU 359 B SEB 360 1_555 ? ? ? ? ? ? ? 1.336 ? ? 
covale7  covale both ? B  SEB 360 C   ? ? ? 1_555 B  ALA 361 N  ? ? B SEB 360 B ALA 361 1_555 ? ? ? ? ? ? ? 1.335 ? ? 
covale8  covale one  ? B  ASN 670 ND2 ? ? ? 1_555 T  NAG .   C1 ? ? B ASN 670 B NAG 801 1_555 ? ? ? ? ? ? ? 1.447 ? 
N-Glycosylation 
covale9  covale both ? C  NAG .   O4  ? ? ? 1_555 C  NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.520 ? ? 
covale10 covale both ? D  NAG .   O4  ? ? ? 1_555 D  NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.446 ? ? 
metalc1  metalc ?    ? A  HIS 416 NE2 ? ? ? 1_555 S  CO  .   CO ? ? A HIS 416 A CO  815 1_555 ? ? ? ? ? ? ? 1.819 ? ? 
metalc2  metalc ?    ? S  CO  .   CO  ? ? ? 1_555 LA HOH .   O  ? ? A CO  815 A HOH 906 1_555 ? ? ? ? ? ? ? 1.734 ? ? 
metalc3  metalc ?    ? S  CO  .   CO  ? ? ? 1_555 LA HOH .   O  ? ? A CO  815 A HOH 916 1_555 ? ? ? ? ? ? ? 1.753 ? ? 
metalc4  metalc ?    ? B  HIS 416 NE2 ? ? ? 1_555 KA CO  .   CO ? ? B HIS 416 B CO  818 1_555 ? ? ? ? ? ? ? 1.816 ? ? 
metalc5  metalc ?    ? KA CO  .   CO  ? ? ? 1_555 MA HOH .   O  ? ? B CO  818 B HOH 916 1_555 ? ? ? ? ? ? ? 1.735 ? ? 
metalc6  metalc ?    ? KA CO  .   CO  ? ? ? 1_555 MA HOH .   O  ? ? B CO  818 B HOH 917 1_555 ? ? ? ? ? ? ? 1.730 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 264 A . ? ARG 264 A PRO 265 A ? PRO 265 A 1 0.01 
2 GLY 677 A . ? GLY 677 A PRO 678 A ? PRO 678 A 1 1.91 
3 ARG 264 B . ? ARG 264 B PRO 265 B ? PRO 265 B 1 2.57 
4 GLY 677 B . ? GLY 677 B PRO 678 B ? PRO 678 B 1 5.52 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 3  ? 
AA5 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? parallel      
AA5 5  6  ? parallel      
AA5 6  7  ? parallel      
AA5 7  8  ? parallel      
AA5 8  9  ? parallel      
AA5 9  10 ? parallel      
AA5 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 167 ? THR A 170 ? VAL A 167 THR A 170 
AA1 2  GLY A 173 ? ARG A 176 ? GLY A 173 ARG A 176 
AA1 3  VAL A 218 ? ASN A 220 ? VAL A 218 ASN A 220 
AA2 1  ILE A 178 ? ASP A 181 ? ILE A 178 ASP A 181 
AA2 2  LYS A 187 ? PRO A 195 ? LYS A 187 PRO A 195 
AA2 3  TYR A 257 ? PRO A 263 ? TYR A 257 PRO A 263 
AA2 4  ILE A 303 ? LEU A 307 ? ILE A 303 LEU A 307 
AA2 5  ALA A 270 ? ILE A 276 ? ALA A 270 ILE A 276 
AA2 6  GLY A 349 ? GLU A 359 ? GLY A 349 GLU A 359 
AA2 7  ARG A 381 ? GLN A 385 ? ARG A 381 GLN A 385 
AA2 8  ILE A 478 ? ASN A 483 ? ILE A 478 ASN A 483 
AA2 9  VAL A 578 ? TYR A 583 ? VAL A 578 TYR A 583 
AA2 10 HIS A 663 ? LEU A 667 ? HIS A 663 LEU A 667 
AA2 11 VAL A 674 ? ARG A 676 ? VAL A 674 ARG A 676 
AA3 1  PHE A 318 ? THR A 321 ? PHE A 318 THR A 321 
AA3 2  ALA A 324 ? PRO A 325 ? ALA A 324 PRO A 325 
AA4 1  VAL B 167 ? THR B 170 ? VAL B 167 THR B 170 
AA4 2  GLY B 173 ? ARG B 176 ? GLY B 173 ARG B 176 
AA4 3  VAL B 218 ? ASN B 220 ? VAL B 218 ASN B 220 
AA5 1  ILE B 178 ? ASP B 181 ? ILE B 178 ASP B 181 
AA5 2  LYS B 187 ? PRO B 195 ? LYS B 187 PRO B 195 
AA5 3  TYR B 257 ? PRO B 263 ? TYR B 257 PRO B 263 
AA5 4  ILE B 303 ? LEU B 307 ? ILE B 303 LEU B 307 
AA5 5  ALA B 270 ? ILE B 276 ? ALA B 270 ILE B 276 
AA5 6  GLY B 349 ? GLU B 359 ? GLY B 349 GLU B 359 
AA5 7  ALA B 382 ? GLN B 385 ? ALA B 382 GLN B 385 
AA5 8  ILE B 478 ? ASN B 483 ? ILE B 478 ASN B 483 
AA5 9  VAL B 578 ? TYR B 583 ? VAL B 578 TYR B 583 
AA5 10 HIS B 663 ? LEU B 667 ? HIS B 663 LEU B 667 
AA5 11 VAL B 674 ? ARG B 676 ? VAL B 674 ARG B 676 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 168 ? N VAL A 168 O ILE A 175 ? O ILE A 175 
AA1 2  3  N ARG A 176 ? N ARG A 176 O LEU A 219 ? O LEU A 219 
AA2 1  2  N VAL A 180 ? N VAL A 180 O VAL A 188 ? O VAL A 188 
AA2 2  3  N ILE A 194 ? N ILE A 194 O ILE A 258 ? O ILE A 258 
AA2 3  4  N ASN A 259 ? N ASN A 259 O SER A 306 ? O SER A 306 
AA2 4  5  O VAL A 305 ? O VAL A 305 N TRP A 275 ? N TRP A 275 
AA2 5  6  N VAL A 272 ? N VAL A 272 O THR A 355 ? O THR A 355 
AA2 6  7  N LEU A 356 ? N LEU A 356 O ILE A 383 ? O ILE A 383 
AA2 7  8  N LEU A 384 ? N LEU A 384 O LEU A 479 ? O LEU A 479 
AA2 8  9  N SER A 482 ? N SER A 482 O TYR A 583 ? O TYR A 583 
AA2 9  10 N LEU A 582 ? N LEU A 582 O LEU A 667 ? O LEU A 667 
AA2 10 11 N TYR A 664 ? N TYR A 664 O GLY A 675 ? O GLY A 675 
AA3 1  2  N LEU A 319 ? N LEU A 319 O ALA A 324 ? O ALA A 324 
AA4 1  2  N THR B 170 ? N THR B 170 O GLY B 173 ? O GLY B 173 
AA4 2  3  N ARG B 174 ? N ARG B 174 O LEU B 219 ? O LEU B 219 
AA5 1  2  N ILE B 178 ? N ILE B 178 O VAL B 190 ? O VAL B 190 
AA5 2  3  N TRP B 191 ? N TRP B 191 O VAL B 260 ? O VAL B 260 
AA5 3  4  N ASN B 259 ? N ASN B 259 O SER B 306 ? O SER B 306 
AA5 4  5  O VAL B 305 ? O VAL B 305 N TRP B 275 ? N TRP B 275 
AA5 5  6  N ALA B 270 ? N ALA B 270 O ASP B 350 ? O ASP B 350 
AA5 6  7  N GLY B 358 ? N GLY B 358 O GLN B 385 ? O GLN B 385 
AA5 7  8  N LEU B 384 ? N LEU B 384 O LEU B 479 ? O LEU B 479 
AA5 8  9  N SER B 482 ? N SER B 482 O TYR B 583 ? O TYR B 583 
AA5 9  10 N LEU B 582 ? N LEU B 582 O LEU B 667 ? O LEU B 667 
AA5 10 11 N TYR B 664 ? N TYR B 664 O GLY B 675 ? O GLY B 675 
# 
_atom_sites.entry_id                    5YDJ 
_atom_sites.fract_transf_matrix[1][1]   0.006773 
_atom_sites.fract_transf_matrix[1][2]   0.003910 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007821 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004461 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CO 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A  1 162 ? 14.365  34.755  -16.925 1.00 96.19  ? 162 ASP A N   1 
ATOM   2    C  CA  . ASP A  1 162 ? 15.166  33.669  -17.583 1.00 95.51  ? 162 ASP A CA  1 
ATOM   3    C  C   . ASP A  1 162 ? 15.479  32.530  -16.609 1.00 97.74  ? 162 ASP A C   1 
ATOM   4    O  O   . ASP A  1 162 ? 15.749  32.772  -15.429 1.00 98.17  ? 162 ASP A O   1 
ATOM   5    C  CB  . ASP A  1 162 ? 16.482  34.218  -18.158 1.00 87.07  ? 162 ASP A CB  1 
ATOM   6    C  CG  . ASP A  1 162 ? 16.273  35.125  -19.364 1.00 85.85  ? 162 ASP A CG  1 
ATOM   7    O  OD1 . ASP A  1 162 ? 15.294  35.901  -19.375 1.00 96.65  ? 162 ASP A OD1 1 
ATOM   8    O  OD2 . ASP A  1 162 ? 17.102  35.068  -20.298 1.00 71.17  ? 162 ASP A OD2 1 
ATOM   9    N  N   . ASN A  1 163 ? 15.443  31.297  -17.116 1.00 95.55  ? 163 ASN A N   1 
ATOM   10   C  CA  . ASN A  1 163 ? 15.888  30.114  -16.356 1.00 87.12  ? 163 ASN A CA  1 
ATOM   11   C  C   . ASN A  1 163 ? 17.418  29.933  -16.406 1.00 81.48  ? 163 ASN A C   1 
ATOM   12   O  O   . ASN A  1 163 ? 17.979  29.154  -15.632 1.00 71.16  ? 163 ASN A O   1 
ATOM   13   C  CB  . ASN A  1 163 ? 15.151  28.833  -16.808 1.00 85.11  ? 163 ASN A CB  1 
ATOM   14   C  CG  . ASN A  1 163 ? 15.410  28.467  -18.263 1.00 82.43  ? 163 ASN A CG  1 
ATOM   15   O  OD1 . ASN A  1 163 ? 16.428  27.856  -18.593 1.00 85.48  ? 163 ASN A OD1 1 
ATOM   16   N  ND2 . ASN A  1 163 ? 14.473  28.818  -19.137 1.00 76.68  ? 163 ASN A ND2 1 
ATOM   17   N  N   . ASP A  1 164 ? 18.074  30.655  -17.317 1.00 78.52  ? 164 ASP A N   1 
ATOM   18   C  CA  . ASP A  1 164 ? 19.535  30.664  -17.448 1.00 77.40  ? 164 ASP A CA  1 
ATOM   19   C  C   . ASP A  1 164 ? 20.202  31.334  -16.230 1.00 72.01  ? 164 ASP A C   1 
ATOM   20   O  O   . ASP A  1 164 ? 19.861  32.475  -15.908 1.00 67.39  ? 164 ASP A O   1 
ATOM   21   C  CB  . ASP A  1 164 ? 19.925  31.401  -18.738 1.00 76.56  ? 164 ASP A CB  1 
ATOM   22   C  CG  . ASP A  1 164 ? 21.430  31.443  -18.969 1.00 78.85  ? 164 ASP A CG  1 
ATOM   23   O  OD1 . ASP A  1 164 ? 22.099  30.404  -18.784 1.00 85.81  ? 164 ASP A OD1 1 
ATOM   24   O  OD2 . ASP A  1 164 ? 21.941  32.519  -19.348 1.00 83.82  ? 164 ASP A OD2 1 
ATOM   25   N  N   . PRO A  1 165 ? 21.145  30.634  -15.549 1.00 70.04  ? 165 PRO A N   1 
ATOM   26   C  CA  . PRO A  1 165 ? 21.815  31.264  -14.396 1.00 69.58  ? 165 PRO A CA  1 
ATOM   27   C  C   . PRO A  1 165 ? 22.818  32.371  -14.753 1.00 68.60  ? 165 PRO A C   1 
ATOM   28   O  O   . PRO A  1 165 ? 23.002  33.296  -13.957 1.00 63.86  ? 165 PRO A O   1 
ATOM   29   C  CB  . PRO A  1 165 ? 22.539  30.090  -13.707 1.00 66.66  ? 165 PRO A CB  1 
ATOM   30   C  CG  . PRO A  1 165 ? 22.061  28.849  -14.377 1.00 68.84  ? 165 PRO A CG  1 
ATOM   31   C  CD  . PRO A  1 165 ? 21.622  29.253  -15.748 1.00 68.14  ? 165 PRO A CD  1 
ATOM   32   N  N   . LEU A  1 166 ? 23.473  32.257  -15.910 1.00 68.28  ? 166 LEU A N   1 
ATOM   33   C  CA  . LEU A  1 166 ? 24.440  33.270  -16.394 1.00 64.44  ? 166 LEU A CA  1 
ATOM   34   C  C   . LEU A  1 166 ? 23.876  34.693  -16.483 1.00 64.31  ? 166 LEU A C   1 
ATOM   35   O  O   . LEU A  1 166 ? 24.575  35.654  -16.141 1.00 58.06  ? 166 LEU A O   1 
ATOM   36   C  CB  . LEU A  1 166 ? 25.045  32.853  -17.747 1.00 61.23  ? 166 LEU A CB  1 
ATOM   37   C  CG  . LEU A  1 166 ? 26.378  32.092  -17.710 1.00 63.86  ? 166 LEU A CG  1 
ATOM   38   C  CD1 . LEU A  1 166 ? 26.395  30.943  -16.709 1.00 63.24  ? 166 LEU A CD1 1 
ATOM   39   C  CD2 . LEU A  1 166 ? 26.709  31.575  -19.103 1.00 68.56  ? 166 LEU A CD2 1 
ATOM   40   N  N   . VAL A  1 167 ? 22.633  34.824  -16.945 1.00 70.02  ? 167 VAL A N   1 
ATOM   41   C  CA  . VAL A  1 167 ? 21.949  36.134  -16.930 1.00 70.55  ? 167 VAL A CA  1 
ATOM   42   C  C   . VAL A  1 167 ? 21.515  36.510  -15.506 1.00 67.96  ? 167 VAL A C   1 
ATOM   43   O  O   . VAL A  1 167 ? 20.895  35.708  -14.804 1.00 60.58  ? 167 VAL A O   1 
ATOM   44   C  CB  . VAL A  1 167 ? 20.765  36.259  -17.928 1.00 67.33  ? 167 VAL A CB  1 
ATOM   45   C  CG1 . VAL A  1 167 ? 21.272  36.238  -19.363 1.00 66.33  ? 167 VAL A CG1 1 
ATOM   46   C  CG2 . VAL A  1 167 ? 19.701  35.193  -17.716 1.00 72.04  ? 167 VAL A CG2 1 
ATOM   47   N  N   . VAL A  1 168 ? 21.869  37.729  -15.096 1.00 65.27  ? 168 VAL A N   1 
ATOM   48   C  CA  . VAL A  1 168 ? 21.623  38.235  -13.739 1.00 61.17  ? 168 VAL A CA  1 
ATOM   49   C  C   . VAL A  1 168 ? 21.013  39.634  -13.846 1.00 62.81  ? 168 VAL A C   1 
ATOM   50   O  O   . VAL A  1 168 ? 21.600  40.521  -14.470 1.00 66.20  ? 168 VAL A O   1 
ATOM   51   C  CB  . VAL A  1 168 ? 22.933  38.297  -12.911 1.00 57.95  ? 168 VAL A CB  1 
ATOM   52   C  CG1 . VAL A  1 168 ? 22.677  38.780  -11.488 1.00 59.77  ? 168 VAL A CG1 1 
ATOM   53   C  CG2 . VAL A  1 168 ? 23.606  36.932  -12.862 1.00 57.05  ? 168 VAL A CG2 1 
ATOM   54   N  N   . ASN A  1 169 ? 19.842  39.822  -13.236 1.00 64.96  ? 169 ASN A N   1 
ATOM   55   C  CA  . ASN A  1 169 ? 19.145  41.115  -13.259 1.00 70.98  ? 169 ASN A CA  1 
ATOM   56   C  C   . ASN A  1 169 ? 19.684  42.059  -12.180 1.00 67.87  ? 169 ASN A C   1 
ATOM   57   O  O   . ASN A  1 169 ? 19.165  42.099  -11.063 1.00 63.27  ? 169 ASN A O   1 
ATOM   58   C  CB  . ASN A  1 169 ? 17.626  40.921  -13.112 1.00 75.27  ? 169 ASN A CB  1 
ATOM   59   C  CG  . ASN A  1 169 ? 16.843  42.215  -13.314 1.00 80.85  ? 169 ASN A CG  1 
ATOM   60   O  OD1 . ASN A  1 169 ? 16.681  43.012  -12.389 1.00 77.66  ? 169 ASN A OD1 1 
ATOM   61   N  ND2 . ASN A  1 169 ? 16.341  42.417  -14.526 1.00 86.67  ? 169 ASN A ND2 1 
ATOM   62   N  N   . THR A  1 170 ? 20.711  42.834  -12.533 1.00 64.40  ? 170 THR A N   1 
ATOM   63   C  CA  . THR A  1 170 ? 21.251  43.867  -11.639 1.00 64.11  ? 170 THR A CA  1 
ATOM   64   C  C   . THR A  1 170 ? 20.245  45.011  -11.518 1.00 61.71  ? 170 THR A C   1 
ATOM   65   O  O   . THR A  1 170 ? 19.268  45.072  -12.272 1.00 64.35  ? 170 THR A O   1 
ATOM   66   C  CB  . THR A  1 170 ? 22.613  44.417  -12.124 1.00 64.41  ? 170 THR A CB  1 
ATOM   67   O  OG1 . THR A  1 170 ? 22.463  45.062  -13.395 1.00 65.68  ? 170 THR A OG1 1 
ATOM   68   C  CG2 . THR A  1 170 ? 23.651  43.300  -12.235 1.00 61.52  ? 170 THR A CG2 1 
ATOM   69   N  N   . ASP A  1 171 ? 20.489  45.916  -10.576 1.00 63.97  ? 171 ASP A N   1 
ATOM   70   C  CA  . ASP A  1 171 ? 19.548  47.012  -10.306 1.00 67.24  ? 171 ASP A CA  1 
ATOM   71   C  C   . ASP A  1 171 ? 19.354  47.991  -11.487 1.00 68.45  ? 171 ASP A C   1 
ATOM   72   O  O   . ASP A  1 171 ? 18.298  48.618  -11.594 1.00 80.53  ? 171 ASP A O   1 
ATOM   73   C  CB  . ASP A  1 171 ? 19.932  47.763  -9.019  1.00 67.43  ? 171 ASP A CB  1 
ATOM   74   C  CG  . ASP A  1 171 ? 21.188  48.605  -9.174  1.00 69.65  ? 171 ASP A CG  1 
ATOM   75   O  OD1 . ASP A  1 171 ? 22.239  48.047  -9.563  1.00 72.77  ? 171 ASP A OD1 1 
ATOM   76   O  OD2 . ASP A  1 171 ? 21.124  49.825  -8.898  1.00 79.05  ? 171 ASP A OD2 1 
ATOM   77   N  N   . LYS A  1 172 ? 20.359  48.099  -12.362 1.00 66.80  ? 172 LYS A N   1 
ATOM   78   C  CA  . LYS A  1 172 ? 20.316  48.975  -13.553 1.00 63.92  ? 172 LYS A CA  1 
ATOM   79   C  C   . LYS A  1 172 ? 20.066  48.252  -14.890 1.00 58.10  ? 172 LYS A C   1 
ATOM   80   O  O   . LYS A  1 172 ? 19.849  48.903  -15.913 1.00 49.30  ? 172 LYS A O   1 
ATOM   81   C  CB  . LYS A  1 172 ? 21.617  49.781  -13.648 1.00 61.62  ? 172 LYS A CB  1 
ATOM   82   C  CG  . LYS A  1 172 ? 21.775  50.839  -12.566 1.00 60.39  ? 172 LYS A CG  1 
ATOM   83   C  CD  . LYS A  1 172 ? 20.905  52.056  -12.839 1.00 61.87  ? 172 LYS A CD  1 
ATOM   84   C  CE  . LYS A  1 172 ? 21.141  53.157  -11.821 1.00 62.54  ? 172 LYS A CE  1 
ATOM   85   N  NZ  . LYS A  1 172 ? 20.326  54.364  -12.130 1.00 59.23  ? 172 LYS A NZ  1 
ATOM   86   N  N   . GLY A  1 173 ? 20.109  46.921  -14.888 1.00 56.46  ? 173 GLY A N   1 
ATOM   87   C  CA  . GLY A  1 173 ? 19.800  46.138  -16.088 1.00 60.73  ? 173 GLY A CA  1 
ATOM   88   C  C   . GLY A  1 173 ? 20.193  44.676  -16.011 1.00 60.58  ? 173 GLY A C   1 
ATOM   89   O  O   . GLY A  1 173 ? 20.592  44.180  -14.956 1.00 65.20  ? 173 GLY A O   1 
ATOM   90   N  N   . ARG A  1 174 ? 20.063  43.992  -17.145 1.00 60.06  ? 174 ARG A N   1 
ATOM   91   C  CA  . ARG A  1 174 ? 20.423  42.576  -17.265 1.00 63.43  ? 174 ARG A CA  1 
ATOM   92   C  C   . ARG A  1 174 ? 21.845  42.429  -17.807 1.00 60.79  ? 174 ARG A C   1 
ATOM   93   O  O   . ARG A  1 174 ? 22.244  43.163  -18.715 1.00 55.97  ? 174 ARG A O   1 
ATOM   94   C  CB  . ARG A  1 174 ? 19.425  41.840  -18.167 1.00 66.85  ? 174 ARG A CB  1 
ATOM   95   C  CG  . ARG A  1 174 ? 18.103  41.519  -17.482 1.00 73.43  ? 174 ARG A CG  1 
ATOM   96   C  CD  . ARG A  1 174 ? 17.166  40.733  -18.389 1.00 79.00  ? 174 ARG A CD  1 
ATOM   97   N  NE  . ARG A  1 174 ? 16.521  41.575  -19.401 1.00 83.09  ? 174 ARG A NE  1 
ATOM   98   C  CZ  . ARG A  1 174 ? 15.795  41.129  -20.431 1.00 77.33  ? 174 ARG A CZ  1 
ATOM   99   N  NH1 . ARG A  1 174 ? 15.601  39.825  -20.629 1.00 74.49  ? 174 ARG A NH1 1 
ATOM   100  N  NH2 . ARG A  1 174 ? 15.260  42.002  -21.282 1.00 80.89  ? 174 ARG A NH2 1 
ATOM   101  N  N   . ILE A  1 175 ? 22.599  41.488  -17.233 1.00 57.89  ? 175 ILE A N   1 
ATOM   102  C  CA  . ILE A  1 175 ? 23.954  41.161  -17.699 1.00 59.05  ? 175 ILE A CA  1 
ATOM   103  C  C   . ILE A  1 175 ? 24.114  39.657  -17.909 1.00 60.29  ? 175 ILE A C   1 
ATOM   104  O  O   . ILE A  1 175 ? 23.627  38.865  -17.105 1.00 56.52  ? 175 ILE A O   1 
ATOM   105  C  CB  . ILE A  1 175 ? 25.067  41.670  -16.747 1.00 57.28  ? 175 ILE A CB  1 
ATOM   106  C  CG1 . ILE A  1 175 ? 24.860  41.186  -15.306 1.00 58.44  ? 175 ILE A CG1 1 
ATOM   107  C  CG2 . ILE A  1 175 ? 25.129  43.190  -16.773 1.00 55.29  ? 175 ILE A CG2 1 
ATOM   108  C  CD1 . ILE A  1 175 ? 26.116  41.260  -14.466 1.00 62.67  ? 175 ILE A CD1 1 
ATOM   109  N  N   . ARG A  1 176 ? 24.800  39.281  -18.988 1.00 62.46  ? 176 ARG A N   1 
ATOM   110  C  CA  . ARG A  1 176 ? 25.106  37.877  -19.289 1.00 61.60  ? 176 ARG A CA  1 
ATOM   111  C  C   . ARG A  1 176 ? 26.567  37.579  -18.961 1.00 58.53  ? 176 ARG A C   1 
ATOM   112  O  O   . ARG A  1 176 ? 27.475  38.157  -19.561 1.00 54.65  ? 176 ARG A O   1 
ATOM   113  C  CB  . ARG A  1 176 ? 24.826  37.546  -20.761 1.00 64.51  ? 176 ARG A CB  1 
ATOM   114  C  CG  . ARG A  1 176 ? 25.080  36.083  -21.121 1.00 63.93  ? 176 ARG A CG  1 
ATOM   115  C  CD  . ARG A  1 176 ? 24.729  35.759  -22.563 1.00 60.62  ? 176 ARG A CD  1 
ATOM   116  N  NE  . ARG A  1 176 ? 23.315  35.413  -22.726 1.00 56.52  ? 176 ARG A NE  1 
ATOM   117  C  CZ  . ARG A  1 176 ? 22.339  36.245  -23.102 1.00 55.43  ? 176 ARG A CZ  1 
ATOM   118  N  NH1 . ARG A  1 176 ? 22.573  37.529  -23.379 1.00 54.07  ? 176 ARG A NH1 1 
ATOM   119  N  NH2 . ARG A  1 176 ? 21.097  35.778  -23.206 1.00 59.36  ? 176 ARG A NH2 1 
ATOM   120  N  N   . GLY A  1 177 ? 26.777  36.668  -18.013 1.00 60.13  ? 177 GLY A N   1 
ATOM   121  C  CA  . GLY A  1 177 ? 28.113  36.188  -17.657 1.00 60.37  ? 177 GLY A CA  1 
ATOM   122  C  C   . GLY A  1 177 ? 28.577  35.055  -18.553 1.00 56.79  ? 177 GLY A C   1 
ATOM   123  O  O   . GLY A  1 177 ? 28.164  34.955  -19.711 1.00 60.83  ? 177 GLY A O   1 
ATOM   124  N  N   . ILE A  1 178 ? 29.442  34.201  -18.010 1.00 51.51  ? 178 ILE A N   1 
ATOM   125  C  CA  . ILE A  1 178 ? 30.016  33.083  -18.763 1.00 55.26  ? 178 ILE A CA  1 
ATOM   126  C  C   . ILE A  1 178 ? 30.661  32.083  -17.803 1.00 51.29  ? 178 ILE A C   1 
ATOM   127  O  O   . ILE A  1 178 ? 31.216  32.479  -16.775 1.00 50.74  ? 178 ILE A O   1 
ATOM   128  C  CB  . ILE A  1 178 ? 31.040  33.580  -19.824 1.00 59.56  ? 178 ILE A CB  1 
ATOM   129  C  CG1 . ILE A  1 178 ? 31.433  32.457  -20.789 1.00 66.01  ? 178 ILE A CG1 1 
ATOM   130  C  CG2 . ILE A  1 178 ? 32.280  34.189  -19.172 1.00 59.82  ? 178 ILE A CG2 1 
ATOM   131  C  CD1 . ILE A  1 178 ? 32.020  32.965  -22.092 1.00 68.39  ? 178 ILE A CD1 1 
ATOM   132  N  N   . THR A  1 179 ? 30.571  30.796  -18.129 1.00 55.37  ? 179 THR A N   1 
ATOM   133  C  CA  . THR A  1 179 ? 31.253  29.757  -17.353 1.00 61.19  ? 179 THR A CA  1 
ATOM   134  C  C   . THR A  1 179 ? 32.688  29.605  -17.867 1.00 61.11  ? 179 THR A C   1 
ATOM   135  O  O   . THR A  1 179 ? 32.911  29.499  -19.075 1.00 56.70  ? 179 THR A O   1 
ATOM   136  C  CB  . THR A  1 179 ? 30.524  28.400  -17.423 1.00 65.90  ? 179 THR A CB  1 
ATOM   137  O  OG1 . THR A  1 179 ? 29.116  28.595  -17.241 1.00 69.05  ? 179 THR A OG1 1 
ATOM   138  C  CG2 . THR A  1 179 ? 31.046  27.451  -16.339 1.00 65.62  ? 179 THR A CG2 1 
ATOM   139  N  N   . VAL A  1 180 ? 33.643  29.596  -16.936 1.00 64.42  ? 180 VAL A N   1 
ATOM   140  C  CA  . VAL A  1 180 ? 35.076  29.521  -17.247 1.00 65.25  ? 180 VAL A CA  1 
ATOM   141  C  C   . VAL A  1 180 ? 35.731  28.468  -16.357 1.00 64.95  ? 180 VAL A C   1 
ATOM   142  O  O   . VAL A  1 180 ? 35.373  28.321  -15.186 1.00 60.63  ? 180 VAL A O   1 
ATOM   143  C  CB  . VAL A  1 180 ? 35.792  30.878  -17.026 1.00 65.91  ? 180 VAL A CB  1 
ATOM   144  C  CG1 . VAL A  1 180 ? 37.242  30.820  -17.491 1.00 69.02  ? 180 VAL A CG1 1 
ATOM   145  C  CG2 . VAL A  1 180 ? 35.082  31.999  -17.769 1.00 66.19  ? 180 VAL A CG2 1 
ATOM   146  N  N   . ASP A  1 181 ? 36.692  27.744  -16.926 1.00 75.58  ? 181 ASP A N   1 
ATOM   147  C  CA  . ASP A  1 181 ? 37.508  26.793  -16.172 1.00 87.03  ? 181 ASP A CA  1 
ATOM   148  C  C   . ASP A  1 181 ? 38.537  27.529  -15.316 1.00 89.88  ? 181 ASP A C   1 
ATOM   149  O  O   . ASP A  1 181 ? 39.225  28.430  -15.801 1.00 91.38  ? 181 ASP A O   1 
ATOM   150  C  CB  . ASP A  1 181 ? 38.233  25.823  -17.119 1.00 87.10  ? 181 ASP A CB  1 
ATOM   151  C  CG  . ASP A  1 181 ? 37.401  24.600  -17.456 1.00 85.88  ? 181 ASP A CG  1 
ATOM   152  O  OD1 . ASP A  1 181 ? 37.282  23.713  -16.586 1.00 84.85  ? 181 ASP A OD1 1 
ATOM   153  O  OD2 . ASP A  1 181 ? 36.883  24.519  -18.590 1.00 94.90  ? 181 ASP A OD2 1 
ATOM   154  N  N   . ALA A  1 182 ? 38.638  27.139  -14.046 1.00 89.27  ? 182 ALA A N   1 
ATOM   155  C  CA  . ALA A  1 182 ? 39.776  27.525  -13.210 1.00 93.07  ? 182 ALA A CA  1 
ATOM   156  C  C   . ALA A  1 182 ? 41.016  26.739  -13.651 1.00 100.64 ? 182 ALA A C   1 
ATOM   157  O  O   . ALA A  1 182 ? 40.884  25.699  -14.306 1.00 113.67 ? 182 ALA A O   1 
ATOM   158  C  CB  . ALA A  1 182 ? 39.481  27.262  -11.742 1.00 85.93  ? 182 ALA A CB  1 
ATOM   159  N  N   . PRO A  1 183 ? 42.226  27.225  -13.300 1.00 93.87  ? 183 PRO A N   1 
ATOM   160  C  CA  . PRO A  1 183 ? 43.431  26.415  -13.536 1.00 85.33  ? 183 PRO A CA  1 
ATOM   161  C  C   . PRO A  1 183 ? 43.477  25.086  -12.753 1.00 87.59  ? 183 PRO A C   1 
ATOM   162  O  O   . PRO A  1 183 ? 44.178  24.159  -13.159 1.00 80.78  ? 183 PRO A O   1 
ATOM   163  C  CB  . PRO A  1 183 ? 44.575  27.341  -13.101 1.00 82.90  ? 183 PRO A CB  1 
ATOM   164  C  CG  . PRO A  1 183 ? 43.950  28.430  -12.307 1.00 85.87  ? 183 PRO A CG  1 
ATOM   165  C  CD  . PRO A  1 183 ? 42.564  28.583  -12.837 1.00 88.61  ? 183 PRO A CD  1 
ATOM   166  N  N   . SER A  1 184 ? 42.740  25.008  -11.645 1.00 93.42  ? 184 SER A N   1 
ATOM   167  C  CA  . SER A  1 184 ? 42.585  23.767  -10.872 1.00 94.69  ? 184 SER A CA  1 
ATOM   168  C  C   . SER A  1 184 ? 41.793  22.648  -11.575 1.00 98.31  ? 184 SER A C   1 
ATOM   169  O  O   . SER A  1 184 ? 41.912  21.480  -11.196 1.00 91.99  ? 184 SER A O   1 
ATOM   170  C  CB  . SER A  1 184 ? 41.917  24.078  -9.529  1.00 97.82  ? 184 SER A CB  1 
ATOM   171  O  OG  . SER A  1 184 ? 40.613  24.609  -9.713  1.00 99.95  ? 184 SER A OG  1 
ATOM   172  N  N   . GLY A  1 185 ? 40.995  23.009  -12.581 1.00 96.54  ? 185 GLY A N   1 
ATOM   173  C  CA  . GLY A  1 185 ? 40.092  22.076  -13.269 1.00 87.06  ? 185 GLY A CA  1 
ATOM   174  C  C   . GLY A  1 185 ? 38.685  22.055  -12.689 1.00 89.14  ? 185 GLY A C   1 
ATOM   175  O  O   . GLY A  1 185 ? 37.909  21.139  -12.973 1.00 84.91  ? 185 GLY A O   1 
ATOM   176  N  N   . LYS A  1 186 ? 38.364  23.065  -11.878 1.00 90.61  ? 186 LYS A N   1 
ATOM   177  C  CA  . LYS A  1 186 ? 37.053  23.211  -11.240 1.00 87.61  ? 186 LYS A CA  1 
ATOM   178  C  C   . LYS A  1 186 ? 36.363  24.439  -11.831 1.00 80.27  ? 186 LYS A C   1 
ATOM   179  O  O   . LYS A  1 186 ? 36.866  25.555  -11.691 1.00 87.92  ? 186 LYS A O   1 
ATOM   180  C  CB  . LYS A  1 186 ? 37.223  23.380  -9.726  1.00 89.40  ? 186 LYS A CB  1 
ATOM   181  C  CG  . LYS A  1 186 ? 37.993  22.250  -9.051  1.00 95.47  ? 186 LYS A CG  1 
ATOM   182  C  CD  . LYS A  1 186 ? 38.385  22.599  -7.622  1.00 100.08 ? 186 LYS A CD  1 
ATOM   183  C  CE  . LYS A  1 186 ? 39.252  21.513  -6.999  1.00 100.09 ? 186 LYS A CE  1 
ATOM   184  N  NZ  . LYS A  1 186 ? 39.646  21.819  -5.596  1.00 93.22  ? 186 LYS A NZ  1 
ATOM   185  N  N   . LYS A  1 187 ? 35.221  24.237  -12.488 1.00 74.54  ? 187 LYS A N   1 
ATOM   186  C  CA  . LYS A  1 187 ? 34.543  25.325  -13.211 1.00 73.64  ? 187 LYS A CA  1 
ATOM   187  C  C   . LYS A  1 187 ? 33.938  26.382  -12.283 1.00 65.47  ? 187 LYS A C   1 
ATOM   188  O  O   . LYS A  1 187 ? 33.612  26.094  -11.131 1.00 58.20  ? 187 LYS A O   1 
ATOM   189  C  CB  . LYS A  1 187 ? 33.468  24.767  -14.150 1.00 80.10  ? 187 LYS A CB  1 
ATOM   190  C  CG  . LYS A  1 187 ? 34.006  23.775  -15.174 1.00 83.55  ? 187 LYS A CG  1 
ATOM   191  C  CD  . LYS A  1 187 ? 33.262  23.843  -16.502 1.00 82.09  ? 187 LYS A CD  1 
ATOM   192  C  CE  . LYS A  1 187 ? 33.938  23.001  -17.575 1.00 77.11  ? 187 LYS A CE  1 
ATOM   193  N  NZ  . LYS A  1 187 ? 33.625  23.497  -18.944 1.00 75.86  ? 187 LYS A NZ  1 
ATOM   194  N  N   . VAL A  1 188 ? 33.829  27.607  -12.798 1.00 65.97  ? 188 VAL A N   1 
ATOM   195  C  CA  . VAL A  1 188 ? 33.284  28.762  -12.064 1.00 65.35  ? 188 VAL A CA  1 
ATOM   196  C  C   . VAL A  1 188 ? 32.531  29.687  -13.025 1.00 67.34  ? 188 VAL A C   1 
ATOM   197  O  O   . VAL A  1 188 ? 32.822  29.707  -14.225 1.00 65.23  ? 188 VAL A O   1 
ATOM   198  C  CB  . VAL A  1 188 ? 34.393  29.580  -11.344 1.00 67.32  ? 188 VAL A CB  1 
ATOM   199  C  CG1 . VAL A  1 188 ? 35.037  28.772  -10.227 1.00 66.02  ? 188 VAL A CG1 1 
ATOM   200  C  CG2 . VAL A  1 188 ? 35.463  30.069  -12.316 1.00 68.57  ? 188 VAL A CG2 1 
ATOM   201  N  N   . ASP A  1 189 ? 31.577  30.452  -12.492 1.00 69.70  ? 189 ASP A N   1 
ATOM   202  C  CA  . ASP A  1 189 ? 30.841  31.463  -13.267 1.00 66.82  ? 189 ASP A CA  1 
ATOM   203  C  C   . ASP A  1 189 ? 31.446  32.847  -13.034 1.00 63.84  ? 189 ASP A C   1 
ATOM   204  O  O   . ASP A  1 189 ? 31.613  33.265  -11.886 1.00 64.45  ? 189 ASP A O   1 
ATOM   205  C  CB  . ASP A  1 189 ? 29.360  31.483  -12.876 1.00 66.34  ? 189 ASP A CB  1 
ATOM   206  C  CG  . ASP A  1 189 ? 28.642  30.180  -13.202 1.00 70.63  ? 189 ASP A CG  1 
ATOM   207  O  OD1 . ASP A  1 189 ? 28.984  29.524  -14.210 1.00 71.00  ? 189 ASP A OD1 1 
ATOM   208  O  OD2 . ASP A  1 189 ? 27.716  29.815  -12.446 1.00 77.19  ? 189 ASP A OD2 1 
ATOM   209  N  N   . VAL A  1 190 ? 31.764  33.545  -14.127 1.00 62.31  ? 190 VAL A N   1 
ATOM   210  C  CA  . VAL A  1 190 ? 32.392  34.876  -14.075 1.00 62.22  ? 190 VAL A CA  1 
ATOM   211  C  C   . VAL A  1 190 ? 31.516  35.944  -14.749 1.00 57.36  ? 190 VAL A C   1 
ATOM   212  O  O   . VAL A  1 190 ? 30.806  35.656  -15.717 1.00 55.23  ? 190 VAL A O   1 
ATOM   213  C  CB  . VAL A  1 190 ? 33.821  34.874  -14.697 1.00 59.94  ? 190 VAL A CB  1 
ATOM   214  C  CG1 . VAL A  1 190 ? 34.664  33.738  -14.134 1.00 60.97  ? 190 VAL A CG1 1 
ATOM   215  C  CG2 . VAL A  1 190 ? 33.796  34.783  -16.219 1.00 57.19  ? 190 VAL A CG2 1 
ATOM   216  N  N   . TRP A  1 191 ? 31.571  37.163  -14.215 1.00 52.73  ? 191 TRP A N   1 
ATOM   217  C  CA  . TRP A  1 191 ? 30.961  38.346  -14.828 1.00 53.15  ? 191 TRP A CA  1 
ATOM   218  C  C   . TRP A  1 191 ? 32.014  39.448  -14.833 1.00 53.90  ? 191 TRP A C   1 
ATOM   219  O  O   . TRP A  1 191 ? 32.312  40.025  -13.788 1.00 57.39  ? 191 TRP A O   1 
ATOM   220  C  CB  . TRP A  1 191 ? 29.729  38.816  -14.048 1.00 53.11  ? 191 TRP A CB  1 
ATOM   221  C  CG  . TRP A  1 191 ? 28.585  37.854  -14.064 1.00 54.33  ? 191 TRP A CG  1 
ATOM   222  C  CD1 . TRP A  1 191 ? 27.493  37.888  -14.883 1.00 53.09  ? 191 TRP A CD1 1 
ATOM   223  C  CD2 . TRP A  1 191 ? 28.409  36.722  -13.207 1.00 53.73  ? 191 TRP A CD2 1 
ATOM   224  N  NE1 . TRP A  1 191 ? 26.652  36.839  -14.597 1.00 52.40  ? 191 TRP A NE1 1 
ATOM   225  C  CE2 . TRP A  1 191 ? 27.189  36.108  -13.571 1.00 50.57  ? 191 TRP A CE2 1 
ATOM   226  C  CE3 . TRP A  1 191 ? 29.166  36.162  -12.168 1.00 54.54  ? 191 TRP A CE3 1 
ATOM   227  C  CZ2 . TRP A  1 191 ? 26.707  34.960  -12.930 1.00 51.50  ? 191 TRP A CZ2 1 
ATOM   228  C  CZ3 . TRP A  1 191 ? 28.687  35.020  -11.530 1.00 55.69  ? 191 TRP A CZ3 1 
ATOM   229  C  CH2 . TRP A  1 191 ? 27.468  34.433  -11.915 1.00 54.22  ? 191 TRP A CH2 1 
ATOM   230  N  N   . LEU A  1 192 ? 32.586  39.712  -16.008 1.00 49.82  ? 192 LEU A N   1 
ATOM   231  C  CA  . LEU A  1 192 ? 33.681  40.679  -16.174 1.00 50.55  ? 192 LEU A CA  1 
ATOM   232  C  C   . LEU A  1 192 ? 33.250  41.935  -16.950 1.00 48.48  ? 192 LEU A C   1 
ATOM   233  O  O   . LEU A  1 192 ? 32.683  41.837  -18.043 1.00 50.55  ? 192 LEU A O   1 
ATOM   234  C  CB  . LEU A  1 192 ? 34.869  40.005  -16.872 1.00 52.62  ? 192 LEU A CB  1 
ATOM   235  C  CG  . LEU A  1 192 ? 35.874  39.264  -15.986 1.00 51.84  ? 192 LEU A CG  1 
ATOM   236  C  CD1 . LEU A  1 192 ? 35.216  38.161  -15.178 1.00 53.33  ? 192 LEU A CD1 1 
ATOM   237  C  CD2 . LEU A  1 192 ? 36.991  38.684  -16.837 1.00 55.00  ? 192 LEU A CD2 1 
ATOM   238  N  N   . GLY A  1 193 ? 33.534  43.103  -16.371 1.00 47.84  ? 193 GLY A N   1 
ATOM   239  C  CA  . GLY A  1 193 ? 33.212  44.400  -16.976 1.00 46.53  ? 193 GLY A CA  1 
ATOM   240  C  C   . GLY A  1 193 ? 31.790  44.875  -16.724 1.00 49.60  ? 193 GLY A C   1 
ATOM   241  O  O   . GLY A  1 193 ? 31.114  45.321  -17.652 1.00 57.08  ? 193 GLY A O   1 
ATOM   242  N  N   . ILE A  1 194 ? 31.343  44.789  -15.471 1.00 47.72  ? 194 ILE A N   1 
ATOM   243  C  CA  . ILE A  1 194 ? 30.001  45.249  -15.075 1.00 48.44  ? 194 ILE A CA  1 
ATOM   244  C  C   . ILE A  1 194 ? 30.046  46.764  -14.862 1.00 53.56  ? 194 ILE A C   1 
ATOM   245  O  O   . ILE A  1 194 ? 30.793  47.226  -14.000 1.00 58.73  ? 194 ILE A O   1 
ATOM   246  C  CB  . ILE A  1 194 ? 29.513  44.589  -13.762 1.00 47.14  ? 194 ILE A CB  1 
ATOM   247  C  CG1 . ILE A  1 194 ? 29.479  43.063  -13.896 1.00 52.17  ? 194 ILE A CG1 1 
ATOM   248  C  CG2 . ILE A  1 194 ? 28.115  45.083  -13.396 1.00 46.48  ? 194 ILE A CG2 1 
ATOM   249  C  CD1 . ILE A  1 194 ? 29.370  42.326  -12.577 1.00 53.00  ? 194 ILE A CD1 1 
ATOM   250  N  N   . PRO A  1 195 ? 29.249  47.544  -15.629 1.00 56.32  ? 195 PRO A N   1 
ATOM   251  C  CA  . PRO A  1 195 ? 29.246  48.998  -15.405 1.00 58.59  ? 195 PRO A CA  1 
ATOM   252  C  C   . PRO A  1 195 ? 28.520  49.411  -14.116 1.00 57.51  ? 195 PRO A C   1 
ATOM   253  O  O   . PRO A  1 195 ? 27.297  49.271  -14.021 1.00 57.83  ? 195 PRO A O   1 
ATOM   254  C  CB  . PRO A  1 195 ? 28.528  49.548  -16.644 1.00 57.88  ? 195 PRO A CB  1 
ATOM   255  C  CG  . PRO A  1 195 ? 27.673  48.430  -17.113 1.00 59.91  ? 195 PRO A CG  1 
ATOM   256  C  CD  . PRO A  1 195 ? 28.418  47.170  -16.790 1.00 57.66  ? 195 PRO A CD  1 
ATOM   257  N  N   . TYR A  1 196 ? 29.289  49.904  -13.145 1.00 53.60  ? 196 TYR A N   1 
ATOM   258  C  CA  . TYR A  1 196 ? 28.766  50.362  -11.846 1.00 50.18  ? 196 TYR A CA  1 
ATOM   259  C  C   . TYR A  1 196 ? 28.607  51.886  -11.743 1.00 49.76  ? 196 TYR A C   1 
ATOM   260  O  O   . TYR A  1 196 ? 28.039  52.379  -10.765 1.00 51.82  ? 196 TYR A O   1 
ATOM   261  C  CB  . TYR A  1 196 ? 29.653  49.834  -10.702 1.00 49.20  ? 196 TYR A CB  1 
ATOM   262  C  CG  . TYR A  1 196 ? 30.925  50.622  -10.416 1.00 48.33  ? 196 TYR A CG  1 
ATOM   263  C  CD1 . TYR A  1 196 ? 32.116  50.346  -11.092 1.00 47.71  ? 196 TYR A CD1 1 
ATOM   264  C  CD2 . TYR A  1 196 ? 30.941  51.628  -9.449  1.00 47.71  ? 196 TYR A CD2 1 
ATOM   265  C  CE1 . TYR A  1 196 ? 33.280  51.056  -10.820 1.00 43.67  ? 196 TYR A CE1 1 
ATOM   266  C  CE2 . TYR A  1 196 ? 32.096  52.346  -9.179  1.00 45.05  ? 196 TYR A CE2 1 
ATOM   267  C  CZ  . TYR A  1 196 ? 33.262  52.056  -9.864  1.00 41.72  ? 196 TYR A CZ  1 
ATOM   268  O  OH  . TYR A  1 196 ? 34.409  52.764  -9.596  1.00 35.75  ? 196 TYR A OH  1 
ATOM   269  N  N   . ALA A  1 197 ? 29.106  52.619  -12.739 1.00 50.97  ? 197 ALA A N   1 
ATOM   270  C  CA  . ALA A  1 197 ? 29.088  54.086  -12.721 1.00 56.97  ? 197 ALA A CA  1 
ATOM   271  C  C   . ALA A  1 197 ? 29.180  54.703  -14.122 1.00 63.11  ? 197 ALA A C   1 
ATOM   272  O  O   . ALA A  1 197 ? 29.550  54.030  -15.088 1.00 63.20  ? 197 ALA A O   1 
ATOM   273  C  CB  . ALA A  1 197 ? 30.219  54.597  -11.849 1.00 55.19  ? 197 ALA A CB  1 
ATOM   274  N  N   . GLN A  1 198 ? 28.824  55.985  -14.212 1.00 65.49  ? 198 GLN A N   1 
ATOM   275  C  CA  . GLN A  1 198 ? 28.947  56.761  -15.455 1.00 65.21  ? 198 GLN A CA  1 
ATOM   276  C  C   . GLN A  1 198 ? 30.420  56.937  -15.830 1.00 61.76  ? 198 GLN A C   1 
ATOM   277  O  O   . GLN A  1 198 ? 31.248  57.168  -14.941 1.00 67.25  ? 198 GLN A O   1 
ATOM   278  C  CB  . GLN A  1 198 ? 28.296  58.149  -15.325 1.00 64.25  ? 198 GLN A CB  1 
ATOM   279  C  CG  . GLN A  1 198 ? 26.820  58.201  -15.695 1.00 64.77  ? 198 GLN A CG  1 
ATOM   280  C  CD  . GLN A  1 198 ? 26.232  59.605  -15.623 1.00 64.84  ? 198 GLN A CD  1 
ATOM   281  O  OE1 . GLN A  1 198 ? 26.883  60.589  -15.977 1.00 59.95  ? 198 GLN A OE1 1 
ATOM   282  N  NE2 . GLN A  1 198 ? 24.987  59.698  -15.168 1.00 68.61  ? 198 GLN A NE2 1 
ATOM   283  N  N   . PRO A  1 199 ? 30.759  56.815  -17.135 1.00 53.89  ? 199 PRO A N   1 
ATOM   284  C  CA  . PRO A  1 199 ? 32.147  57.067  -17.524 1.00 49.83  ? 199 PRO A CA  1 
ATOM   285  C  C   . PRO A  1 199 ? 32.529  58.523  -17.235 1.00 45.54  ? 199 PRO A C   1 
ATOM   286  O  O   . PRO A  1 199 ? 31.905  59.430  -17.792 1.00 49.62  ? 199 PRO A O   1 
ATOM   287  C  CB  . PRO A  1 199 ? 32.163  56.772  -19.033 1.00 49.53  ? 199 PRO A CB  1 
ATOM   288  C  CG  . PRO A  1 199 ? 30.745  56.788  -19.469 1.00 51.34  ? 199 PRO A CG  1 
ATOM   289  C  CD  . PRO A  1 199 ? 29.940  56.374  -18.279 1.00 54.52  ? 199 PRO A CD  1 
ATOM   290  N  N   . PRO A  1 200 ? 33.534  58.750  -16.361 1.00 44.00  ? 200 PRO A N   1 
ATOM   291  C  CA  . PRO A  1 200 ? 33.880  60.107  -15.935 1.00 47.76  ? 200 PRO A CA  1 
ATOM   292  C  C   . PRO A  1 200 ? 34.677  60.852  -17.010 1.00 51.38  ? 200 PRO A C   1 
ATOM   293  O  O   . PRO A  1 200 ? 35.895  61.031  -16.891 1.00 61.60  ? 200 PRO A O   1 
ATOM   294  C  CB  . PRO A  1 200 ? 34.700  59.865  -14.664 1.00 43.86  ? 200 PRO A CB  1 
ATOM   295  C  CG  . PRO A  1 200 ? 35.377  58.564  -14.914 1.00 41.89  ? 200 PRO A CG  1 
ATOM   296  C  CD  . PRO A  1 200 ? 34.454  57.752  -15.780 1.00 43.13  ? 200 PRO A CD  1 
ATOM   297  N  N   . VAL A  1 201 ? 33.963  61.288  -18.047 1.00 53.27  ? 201 VAL A N   1 
ATOM   298  C  CA  . VAL A  1 201 ? 34.564  61.849  -19.263 1.00 52.72  ? 201 VAL A CA  1 
ATOM   299  C  C   . VAL A  1 201 ? 34.024  63.253  -19.513 1.00 49.91  ? 201 VAL A C   1 
ATOM   300  O  O   . VAL A  1 201 ? 32.868  63.550  -19.201 1.00 49.24  ? 201 VAL A O   1 
ATOM   301  C  CB  . VAL A  1 201 ? 34.280  60.968  -20.505 1.00 52.71  ? 201 VAL A CB  1 
ATOM   302  C  CG1 . VAL A  1 201 ? 35.114  61.416  -21.702 1.00 63.36  ? 201 VAL A CG1 1 
ATOM   303  C  CG2 . VAL A  1 201 ? 34.574  59.506  -20.209 1.00 49.37  ? 201 VAL A CG2 1 
ATOM   304  N  N   . GLY A  1 202 ? 34.874  64.103  -20.085 1.00 50.59  ? 202 GLY A N   1 
ATOM   305  C  CA  . GLY A  1 202 ? 34.507  65.471  -20.419 1.00 55.57  ? 202 GLY A CA  1 
ATOM   306  C  C   . GLY A  1 202 ? 34.507  66.332  -19.168 1.00 58.26  ? 202 GLY A C   1 
ATOM   307  O  O   . GLY A  1 202 ? 35.555  66.483  -18.536 1.00 67.72  ? 202 GLY A O   1 
ATOM   308  N  N   . PRO A  1 203 ? 33.340  66.897  -18.794 1.00 59.39  ? 203 PRO A N   1 
ATOM   309  C  CA  . PRO A  1 203 ? 33.270  67.719  -17.584 1.00 60.01  ? 203 PRO A CA  1 
ATOM   310  C  C   . PRO A  1 203 ? 33.317  66.909  -16.282 1.00 58.98  ? 203 PRO A C   1 
ATOM   311  O  O   . PRO A  1 203 ? 33.699  67.442  -15.238 1.00 56.69  ? 203 PRO A O   1 
ATOM   312  C  CB  . PRO A  1 203 ? 31.918  68.418  -17.728 1.00 63.87  ? 203 PRO A CB  1 
ATOM   313  C  CG  . PRO A  1 203 ? 31.086  67.423  -18.451 1.00 62.63  ? 203 PRO A CG  1 
ATOM   314  C  CD  . PRO A  1 203 ? 32.017  66.786  -19.442 1.00 62.54  ? 203 PRO A CD  1 
ATOM   315  N  N   . LEU A  1 204 ? 32.927  65.636  -16.354 1.00 54.33  ? 204 LEU A N   1 
ATOM   316  C  CA  . LEU A  1 204 ? 32.949  64.723  -15.204 1.00 55.37  ? 204 LEU A CA  1 
ATOM   317  C  C   . LEU A  1 204 ? 34.347  64.307  -14.712 1.00 51.93  ? 204 LEU A C   1 
ATOM   318  O  O   . LEU A  1 204 ? 34.463  63.734  -13.625 1.00 46.39  ? 204 LEU A O   1 
ATOM   319  C  CB  . LEU A  1 204 ? 32.126  63.469  -15.528 1.00 58.90  ? 204 LEU A CB  1 
ATOM   320  C  CG  . LEU A  1 204 ? 30.614  63.679  -15.674 1.00 62.53  ? 204 LEU A CG  1 
ATOM   321  C  CD1 . LEU A  1 204 ? 29.972  62.521  -16.425 1.00 62.85  ? 204 LEU A CD1 1 
ATOM   322  C  CD2 . LEU A  1 204 ? 29.950  63.867  -14.316 1.00 61.75  ? 204 LEU A CD2 1 
ATOM   323  N  N   . ARG A  1 205 ? 35.390  64.569  -15.505 1.00 53.61  ? 205 ARG A N   1 
ATOM   324  C  CA  . ARG A  1 205 ? 36.776  64.314  -15.089 1.00 53.48  ? 205 ARG A CA  1 
ATOM   325  C  C   . ARG A  1 205 ? 37.135  65.087  -13.821 1.00 54.59  ? 205 ARG A C   1 
ATOM   326  O  O   . ARG A  1 205 ? 36.718  66.234  -13.645 1.00 59.91  ? 205 ARG A O   1 
ATOM   327  C  CB  . ARG A  1 205 ? 37.763  64.678  -16.199 1.00 51.04  ? 205 ARG A CB  1 
ATOM   328  C  CG  . ARG A  1 205 ? 39.210  64.308  -15.878 1.00 54.85  ? 205 ARG A CG  1 
ATOM   329  C  CD  . ARG A  1 205 ? 40.170  64.895  -16.887 1.00 54.83  ? 205 ARG A CD  1 
ATOM   330  N  NE  . ARG A  1 205 ? 40.059  64.232  -18.181 1.00 59.48  ? 205 ARG A NE  1 
ATOM   331  C  CZ  . ARG A  1 205 ? 40.754  64.556  -19.269 1.00 63.62  ? 205 ARG A CZ  1 
ATOM   332  N  NH1 . ARG A  1 205 ? 41.630  65.559  -19.249 1.00 69.51  ? 205 ARG A NH1 1 
ATOM   333  N  NH2 . ARG A  1 205 ? 40.566  63.871  -20.394 1.00 62.98  ? 205 ARG A NH2 1 
ATOM   334  N  N   . PHE A  1 206 ? 37.903  64.422  -12.953 1.00 50.46  ? 206 PHE A N   1 
ATOM   335  C  CA  . PHE A  1 206 ? 38.277  64.896  -11.605 1.00 52.29  ? 206 PHE A CA  1 
ATOM   336  C  C   . PHE A  1 206 ? 37.162  64.859  -10.550 1.00 52.06  ? 206 PHE A C   1 
ATOM   337  O  O   . PHE A  1 206 ? 37.457  64.842  -9.353  1.00 60.87  ? 206 PHE A O   1 
ATOM   338  C  CB  . PHE A  1 206 ? 38.903  66.298  -11.635 1.00 55.60  ? 206 PHE A CB  1 
ATOM   339  C  CG  . PHE A  1 206 ? 40.052  66.433  -12.594 1.00 53.26  ? 206 PHE A CG  1 
ATOM   340  C  CD1 . PHE A  1 206 ? 41.206  65.675  -12.427 1.00 54.48  ? 206 PHE A CD1 1 
ATOM   341  C  CD2 . PHE A  1 206 ? 39.990  67.332  -13.655 1.00 51.80  ? 206 PHE A CD2 1 
ATOM   342  C  CE1 . PHE A  1 206 ? 42.271  65.799  -13.306 1.00 55.06  ? 206 PHE A CE1 1 
ATOM   343  C  CE2 . PHE A  1 206 ? 41.053  67.463  -14.534 1.00 52.29  ? 206 PHE A CE2 1 
ATOM   344  C  CZ  . PHE A  1 206 ? 42.194  66.697  -14.359 1.00 54.38  ? 206 PHE A CZ  1 
ATOM   345  N  N   . ARG A  1 207 ? 35.902  64.832  -10.981 1.00 50.31  ? 207 ARG A N   1 
ATOM   346  C  CA  . ARG A  1 207 ? 34.764  64.885  -10.071 1.00 55.55  ? 207 ARG A CA  1 
ATOM   347  C  C   . ARG A  1 207 ? 34.436  63.502  -9.533  1.00 52.62  ? 207 ARG A C   1 
ATOM   348  O  O   . ARG A  1 207 ? 34.955  62.494  -10.025 1.00 49.16  ? 207 ARG A O   1 
ATOM   349  C  CB  . ARG A  1 207 ? 33.546  65.459  -10.788 1.00 57.45  ? 207 ARG A CB  1 
ATOM   350  C  CG  . ARG A  1 207 ? 33.796  66.806  -11.446 1.00 58.67  ? 207 ARG A CG  1 
ATOM   351  C  CD  . ARG A  1 207 ? 32.484  67.446  -11.852 1.00 63.69  ? 207 ARG A CD  1 
ATOM   352  N  NE  . ARG A  1 207 ? 32.660  68.732  -12.522 1.00 66.96  ? 207 ARG A NE  1 
ATOM   353  C  CZ  . ARG A  1 207 ? 31.674  69.589  -12.793 1.00 78.08  ? 207 ARG A CZ  1 
ATOM   354  N  NH1 . ARG A  1 207 ? 30.413  69.320  -12.451 1.00 77.93  ? 207 ARG A NH1 1 
ATOM   355  N  NH2 . ARG A  1 207 ? 31.951  70.733  -13.413 1.00 88.77  ? 207 ARG A NH2 1 
ATOM   356  N  N   . HIS A  1 208 ? 33.574  63.463  -8.519  1.00 49.81  ? 208 HIS A N   1 
ATOM   357  C  CA  . HIS A  1 208 ? 33.121  62.193  -7.945  1.00 51.50  ? 208 HIS A CA  1 
ATOM   358  C  C   . HIS A  1 208 ? 32.169  61.516  -8.945  1.00 50.06  ? 208 HIS A C   1 
ATOM   359  O  O   . HIS A  1 208 ? 31.492  62.207  -9.714  1.00 56.80  ? 208 HIS A O   1 
ATOM   360  C  CB  . HIS A  1 208 ? 32.452  62.401  -6.576  1.00 52.32  ? 208 HIS A CB  1 
ATOM   361  C  CG  . HIS A  1 208 ? 33.359  62.997  -5.540  1.00 56.13  ? 208 HIS A CG  1 
ATOM   362  N  ND1 . HIS A  1 208 ? 32.889  63.538  -4.364  1.00 56.09  ? 208 HIS A ND1 1 
ATOM   363  C  CD2 . HIS A  1 208 ? 34.704  63.155  -5.514  1.00 58.54  ? 208 HIS A CD2 1 
ATOM   364  C  CE1 . HIS A  1 208 ? 33.904  64.003  -3.656  1.00 55.01  ? 208 HIS A CE1 1 
ATOM   365  N  NE2 . HIS A  1 208 ? 35.018  63.777  -4.329  1.00 53.31  ? 208 HIS A NE2 1 
ATOM   366  N  N   . PRO A  1 209 ? 32.125  60.169  -8.955  1.00 46.49  ? 209 PRO A N   1 
ATOM   367  C  CA  . PRO A  1 209 ? 31.365  59.450  -9.979  1.00 46.57  ? 209 PRO A CA  1 
ATOM   368  C  C   . PRO A  1 209 ? 29.852  59.563  -9.836  1.00 47.04  ? 209 PRO A C   1 
ATOM   369  O  O   . PRO A  1 209 ? 29.343  59.796  -8.736  1.00 43.99  ? 209 PRO A O   1 
ATOM   370  C  CB  . PRO A  1 209 ? 31.783  57.997  -9.756  1.00 46.60  ? 209 PRO A CB  1 
ATOM   371  C  CG  . PRO A  1 209 ? 32.049  57.935  -8.296  1.00 45.99  ? 209 PRO A CG  1 
ATOM   372  C  CD  . PRO A  1 209 ? 32.738  59.233  -7.995  1.00 46.78  ? 209 PRO A CD  1 
ATOM   373  N  N   . ARG A  1 210 ? 29.159  59.389  -10.959 1.00 49.10  ? 210 ARG A N   1 
ATOM   374  C  CA  . ARG A  1 210 ? 27.695  59.319  -10.999 1.00 50.63  ? 210 ARG A CA  1 
ATOM   375  C  C   . ARG A  1 210 ? 27.312  57.855  -11.230 1.00 56.53  ? 210 ARG A C   1 
ATOM   376  O  O   . ARG A  1 210 ? 28.058  57.139  -11.903 1.00 62.10  ? 210 ARG A O   1 
ATOM   377  C  CB  . ARG A  1 210 ? 27.124  60.198  -12.126 1.00 47.69  ? 210 ARG A CB  1 
ATOM   378  C  CG  . ARG A  1 210 ? 27.847  61.521  -12.377 1.00 46.19  ? 210 ARG A CG  1 
ATOM   379  C  CD  . ARG A  1 210 ? 28.114  62.285  -11.088 1.00 46.28  ? 210 ARG A CD  1 
ATOM   380  N  NE  . ARG A  1 210 ? 27.941  63.734  -11.227 1.00 45.52  ? 210 ARG A NE  1 
ATOM   381  C  CZ  . ARG A  1 210 ? 28.831  64.676  -10.893 1.00 41.01  ? 210 ARG A CZ  1 
ATOM   382  N  NH1 . ARG A  1 210 ? 30.027  64.382  -10.379 1.00 39.85  ? 210 ARG A NH1 1 
ATOM   383  N  NH2 . ARG A  1 210 ? 28.510  65.954  -11.075 1.00 42.63  ? 210 ARG A NH2 1 
ATOM   384  N  N   . PRO A  1 211 ? 26.165  57.395  -10.679 1.00 57.56  ? 211 PRO A N   1 
ATOM   385  C  CA  . PRO A  1 211 ? 25.766  56.015  -10.982 1.00 58.48  ? 211 PRO A CA  1 
ATOM   386  C  C   . PRO A  1 211 ? 25.418  55.834  -12.459 1.00 64.55  ? 211 PRO A C   1 
ATOM   387  O  O   . PRO A  1 211 ? 24.910  56.763  -13.092 1.00 72.91  ? 211 PRO A O   1 
ATOM   388  C  CB  . PRO A  1 211 ? 24.528  55.794  -10.101 1.00 56.80  ? 211 PRO A CB  1 
ATOM   389  C  CG  . PRO A  1 211 ? 24.614  56.837  -9.045  1.00 59.91  ? 211 PRO A CG  1 
ATOM   390  C  CD  . PRO A  1 211 ? 25.235  58.020  -9.723  1.00 59.38  ? 211 PRO A CD  1 
ATOM   391  N  N   . ALA A  1 212 ? 25.690  54.641  -12.982 1.00 69.78  ? 212 ALA A N   1 
ATOM   392  C  CA  . ALA A  1 212 ? 25.561  54.354  -14.413 1.00 69.68  ? 212 ALA A CA  1 
ATOM   393  C  C   . ALA A  1 212 ? 24.114  54.470  -14.880 1.00 63.69  ? 212 ALA A C   1 
ATOM   394  O  O   . ALA A  1 212 ? 23.196  54.080  -14.154 1.00 65.99  ? 212 ALA A O   1 
ATOM   395  C  CB  . ALA A  1 212 ? 26.094  52.962  -14.716 1.00 71.92  ? 212 ALA A CB  1 
ATOM   396  N  N   . GLU A  1 213 ? 23.915  55.020  -16.079 1.00 56.83  ? 213 GLU A N   1 
ATOM   397  C  CA  . GLU A  1 213 ? 22.577  55.102  -16.671 1.00 63.50  ? 213 GLU A CA  1 
ATOM   398  C  C   . GLU A  1 213 ? 22.076  53.685  -16.934 1.00 67.64  ? 213 GLU A C   1 
ATOM   399  O  O   . GLU A  1 213 ? 22.842  52.833  -17.406 1.00 72.86  ? 213 GLU A O   1 
ATOM   400  C  CB  . GLU A  1 213 ? 22.577  55.922  -17.969 1.00 62.26  ? 213 GLU A CB  1 
ATOM   401  C  CG  . GLU A  1 213 ? 22.725  57.424  -17.757 1.00 66.59  ? 213 GLU A CG  1 
ATOM   402  C  CD  . GLU A  1 213 ? 22.451  58.247  -19.008 1.00 68.84  ? 213 GLU A CD  1 
ATOM   403  O  OE1 . GLU A  1 213 ? 22.132  59.448  -18.867 1.00 64.71  ? 213 GLU A OE1 1 
ATOM   404  O  OE2 . GLU A  1 213 ? 22.554  57.705  -20.130 1.00 66.11  ? 213 GLU A OE2 1 
ATOM   405  N  N   . LYS A  1 214 ? 20.808  53.433  -16.611 1.00 70.96  ? 214 LYS A N   1 
ATOM   406  C  CA  . LYS A  1 214 ? 20.227  52.096  -16.777 1.00 74.30  ? 214 LYS A CA  1 
ATOM   407  C  C   . LYS A  1 214 ? 20.128  51.752  -18.265 1.00 80.42  ? 214 LYS A C   1 
ATOM   408  O  O   . LYS A  1 214 ? 19.879  52.634  -19.095 1.00 83.94  ? 214 LYS A O   1 
ATOM   409  C  CB  . LYS A  1 214 ? 18.865  51.966  -16.065 1.00 68.83  ? 214 LYS A CB  1 
ATOM   410  C  CG  . LYS A  1 214 ? 17.657  52.602  -16.748 1.00 67.28  ? 214 LYS A CG  1 
ATOM   411  C  CD  . LYS A  1 214 ? 16.356  52.027  -16.202 1.00 69.27  ? 214 LYS A CD  1 
ATOM   412  C  CE  . LYS A  1 214 ? 15.150  52.494  -17.001 1.00 74.59  ? 214 LYS A CE  1 
ATOM   413  N  NZ  . LYS A  1 214 ? 13.920  51.727  -16.656 1.00 73.29  ? 214 LYS A NZ  1 
ATOM   414  N  N   . TRP A  1 215 ? 20.331  50.476  -18.589 1.00 81.50  ? 215 TRP A N   1 
ATOM   415  C  CA  . TRP A  1 215 ? 20.352  50.016  -19.988 1.00 79.30  ? 215 TRP A CA  1 
ATOM   416  C  C   . TRP A  1 215 ? 19.169  49.111  -20.304 1.00 80.53  ? 215 TRP A C   1 
ATOM   417  O  O   . TRP A  1 215 ? 18.566  48.512  -19.408 1.00 77.11  ? 215 TRP A O   1 
ATOM   418  C  CB  . TRP A  1 215 ? 21.673  49.320  -20.345 1.00 79.75  ? 215 TRP A CB  1 
ATOM   419  C  CG  . TRP A  1 215 ? 22.007  48.140  -19.498 1.00 72.57  ? 215 TRP A CG  1 
ATOM   420  C  CD1 . TRP A  1 215 ? 21.657  46.840  -19.722 1.00 71.10  ? 215 TRP A CD1 1 
ATOM   421  C  CD2 . TRP A  1 215 ? 22.766  48.151  -18.288 1.00 74.55  ? 215 TRP A CD2 1 
ATOM   422  N  NE1 . TRP A  1 215 ? 22.150  46.039  -18.720 1.00 79.18  ? 215 TRP A NE1 1 
ATOM   423  C  CE2 . TRP A  1 215 ? 22.836  46.819  -17.826 1.00 78.72  ? 215 TRP A CE2 1 
ATOM   424  C  CE3 . TRP A  1 215 ? 23.392  49.161  -17.544 1.00 76.26  ? 215 TRP A CE3 1 
ATOM   425  C  CZ2 . TRP A  1 215 ? 23.507  46.469  -16.649 1.00 71.93  ? 215 TRP A CZ2 1 
ATOM   426  C  CZ3 . TRP A  1 215 ? 24.061  48.813  -16.373 1.00 73.83  ? 215 TRP A CZ3 1 
ATOM   427  C  CH2 . TRP A  1 215 ? 24.114  47.476  -15.940 1.00 70.92  ? 215 TRP A CH2 1 
ATOM   428  N  N   . THR A  1 216 ? 18.873  49.012  -21.598 1.00 77.53  ? 216 THR A N   1 
ATOM   429  C  CA  . THR A  1 216 ? 17.713  48.267  -22.113 1.00 74.52  ? 216 THR A CA  1 
ATOM   430  C  C   . THR A  1 216 ? 18.187  47.062  -22.939 1.00 75.58  ? 216 THR A C   1 
ATOM   431  O  O   . THR A  1 216 ? 18.826  47.222  -23.981 1.00 80.17  ? 216 THR A O   1 
ATOM   432  C  CB  . THR A  1 216 ? 16.731  49.166  -22.918 1.00 71.56  ? 216 THR A CB  1 
ATOM   433  O  OG1 . THR A  1 216 ? 15.731  48.352  -23.547 1.00 74.15  ? 216 THR A OG1 1 
ATOM   434  C  CG2 . THR A  1 216 ? 17.435  50.023  -23.986 1.00 68.93  ? 216 THR A CG2 1 
ATOM   435  N  N   . GLY A  1 217 ? 17.875  45.861  -22.449 1.00 74.74  ? 217 GLY A N   1 
ATOM   436  C  CA  . GLY A  1 217 ? 18.337  44.600  -23.048 1.00 72.86  ? 217 GLY A CA  1 
ATOM   437  C  C   . GLY A  1 217 ? 19.324  43.862  -22.157 1.00 70.58  ? 217 GLY A C   1 
ATOM   438  O  O   . GLY A  1 217 ? 19.382  44.108  -20.948 1.00 77.25  ? 217 GLY A O   1 
ATOM   439  N  N   . VAL A  1 218 ? 20.101  42.962  -22.764 1.00 62.90  ? 218 VAL A N   1 
ATOM   440  C  CA  . VAL A  1 218 ? 21.082  42.125  -22.050 1.00 58.38  ? 218 VAL A CA  1 
ATOM   441  C  C   . VAL A  1 218 ? 22.507  42.422  -22.541 1.00 58.67  ? 218 VAL A C   1 
ATOM   442  O  O   . VAL A  1 218 ? 22.831  42.178  -23.705 1.00 58.56  ? 218 VAL A O   1 
ATOM   443  C  CB  . VAL A  1 218 ? 20.780  40.616  -22.222 1.00 55.92  ? 218 VAL A CB  1 
ATOM   444  C  CG1 . VAL A  1 218 ? 21.682  39.776  -21.326 1.00 56.55  ? 218 VAL A CG1 1 
ATOM   445  C  CG2 . VAL A  1 218 ? 19.328  40.310  -21.886 1.00 58.31  ? 218 VAL A CG2 1 
ATOM   446  N  N   . LEU A  1 219 ? 23.342  42.941  -21.638 1.00 65.65  ? 219 LEU A N   1 
ATOM   447  C  CA  . LEU A  1 219 ? 24.756  43.252  -21.909 1.00 66.58  ? 219 LEU A CA  1 
ATOM   448  C  C   . LEU A  1 219 ? 25.664  42.083  -21.516 1.00 67.07  ? 219 LEU A C   1 
ATOM   449  O  O   . LEU A  1 219 ? 25.554  41.562  -20.410 1.00 64.50  ? 219 LEU A O   1 
ATOM   450  C  CB  . LEU A  1 219 ? 25.161  44.506  -21.124 1.00 65.54  ? 219 LEU A CB  1 
ATOM   451  C  CG  . LEU A  1 219 ? 26.637  44.920  -21.063 1.00 67.13  ? 219 LEU A CG  1 
ATOM   452  C  CD1 . LEU A  1 219 ? 27.203  45.209  -22.445 1.00 72.72  ? 219 LEU A CD1 1 
ATOM   453  C  CD2 . LEU A  1 219 ? 26.779  46.139  -20.168 1.00 68.35  ? 219 LEU A CD2 1 
ATOM   454  N  N   . ASN A  1 220 ? 26.572  41.690  -22.408 1.00 64.91  ? 220 ASN A N   1 
ATOM   455  C  CA  . ASN A  1 220 ? 27.468  40.556  -22.146 1.00 66.94  ? 220 ASN A CA  1 
ATOM   456  C  C   . ASN A  1 220 ? 28.686  40.997  -21.338 1.00 64.16  ? 220 ASN A C   1 
ATOM   457  O  O   . ASN A  1 220 ? 29.528  41.753  -21.833 1.00 62.50  ? 220 ASN A O   1 
ATOM   458  C  CB  . ASN A  1 220 ? 27.938  39.902  -23.444 1.00 72.38  ? 220 ASN A CB  1 
ATOM   459  C  CG  . ASN A  1 220 ? 26.795  39.464  -24.336 1.00 71.96  ? 220 ASN A CG  1 
ATOM   460  O  OD1 . ASN A  1 220 ? 25.614  39.590  -23.996 1.00 77.62  ? 220 ASN A OD1 1 
ATOM   461  N  ND2 . ASN A  1 220 ? 27.161  38.937  -25.499 1.00 82.59  ? 220 ASN A ND2 1 
ATOM   462  N  N   . THR A  1 221 ? 28.763  40.519  -20.097 1.00 62.40  ? 221 THR A N   1 
ATOM   463  C  CA  . THR A  1 221 ? 29.901  40.759  -19.211 1.00 58.45  ? 221 THR A CA  1 
ATOM   464  C  C   . THR A  1 221 ? 30.800  39.530  -19.253 1.00 58.96  ? 221 THR A C   1 
ATOM   465  O  O   . THR A  1 221 ? 30.863  38.747  -18.301 1.00 65.47  ? 221 THR A O   1 
ATOM   466  C  CB  . THR A  1 221 ? 29.446  41.034  -17.766 1.00 59.82  ? 221 THR A CB  1 
ATOM   467  O  OG1 . THR A  1 221 ? 28.588  39.976  -17.322 1.00 60.79  ? 221 THR A OG1 1 
ATOM   468  C  CG2 . THR A  1 221 ? 28.705  42.360  -17.683 1.00 60.56  ? 221 THR A CG2 1 
ATOM   469  N  N   . THR A  1 222 ? 31.477  39.374  -20.385 1.00 63.47  ? 222 THR A N   1 
ATOM   470  C  CA  . THR A  1 222 ? 32.347  38.220  -20.660 1.00 61.34  ? 222 THR A CA  1 
ATOM   471  C  C   . THR A  1 222 ? 33.829  38.576  -20.847 1.00 59.17  ? 222 THR A C   1 
ATOM   472  O  O   . THR A  1 222 ? 34.669  37.678  -20.945 1.00 61.06  ? 222 THR A O   1 
ATOM   473  C  CB  . THR A  1 222 ? 31.876  37.477  -21.930 1.00 65.73  ? 222 THR A CB  1 
ATOM   474  O  OG1 . THR A  1 222 ? 31.966  38.349  -23.066 1.00 58.92  ? 222 THR A OG1 1 
ATOM   475  C  CG2 . THR A  1 222 ? 30.435  36.999  -21.780 1.00 70.14  ? 222 THR A CG2 1 
ATOM   476  N  N   . THR A  1 223 ? 34.140  39.872  -20.882 1.00 58.43  ? 223 THR A N   1 
ATOM   477  C  CA  . THR A  1 223 ? 35.469  40.365  -21.248 1.00 61.33  ? 223 THR A CA  1 
ATOM   478  C  C   . THR A  1 223 ? 36.033  41.227  -20.120 1.00 59.77  ? 223 THR A C   1 
ATOM   479  O  O   . THR A  1 223 ? 35.289  42.019  -19.534 1.00 54.01  ? 223 THR A O   1 
ATOM   480  C  CB  . THR A  1 223 ? 35.409  41.231  -22.525 1.00 66.11  ? 223 THR A CB  1 
ATOM   481  O  OG1 . THR A  1 223 ? 34.493  40.653  -23.464 1.00 67.51  ? 223 THR A OG1 1 
ATOM   482  C  CG2 . THR A  1 223 ? 36.787  41.350  -23.170 1.00 70.64  ? 223 THR A CG2 1 
ATOM   483  N  N   . PRO A  1 224 ? 37.344  41.089  -19.816 1.00 60.69  ? 224 PRO A N   1 
ATOM   484  C  CA  . PRO A  1 224 ? 37.939  41.975  -18.810 1.00 59.84  ? 224 PRO A CA  1 
ATOM   485  C  C   . PRO A  1 224 ? 37.922  43.447  -19.250 1.00 53.85  ? 224 PRO A C   1 
ATOM   486  O  O   . PRO A  1 224 ? 38.284  43.739  -20.393 1.00 61.00  ? 224 PRO A O   1 
ATOM   487  C  CB  . PRO A  1 224 ? 39.380  41.458  -18.676 1.00 62.83  ? 224 PRO A CB  1 
ATOM   488  C  CG  . PRO A  1 224 ? 39.625  40.627  -19.885 1.00 65.20  ? 224 PRO A CG  1 
ATOM   489  C  CD  . PRO A  1 224 ? 38.297  40.056  -20.262 1.00 63.94  ? 224 PRO A CD  1 
ATOM   490  N  N   . PRO A  1 225 ? 37.501  44.363  -18.355 1.00 47.95  ? 225 PRO A N   1 
ATOM   491  C  CA  . PRO A  1 225 ? 37.301  45.758  -18.749 1.00 45.31  ? 225 PRO A CA  1 
ATOM   492  C  C   . PRO A  1 225 ? 38.578  46.542  -19.032 1.00 42.86  ? 225 PRO A C   1 
ATOM   493  O  O   . PRO A  1 225 ? 39.684  46.072  -18.763 1.00 39.35  ? 225 PRO A O   1 
ATOM   494  C  CB  . PRO A  1 225 ? 36.581  46.359  -17.537 1.00 46.98  ? 225 PRO A CB  1 
ATOM   495  C  CG  . PRO A  1 225 ? 37.033  45.529  -16.389 1.00 44.74  ? 225 PRO A CG  1 
ATOM   496  C  CD  . PRO A  1 225 ? 37.115  44.143  -16.949 1.00 46.91  ? 225 PRO A CD  1 
ATOM   497  N  N   . ASN A  1 226 ? 38.393  47.742  -19.571 1.00 44.39  ? 226 ASN A N   1 
ATOM   498  C  CA  . ASN A  1 226 ? 39.489  48.676  -19.814 1.00 47.10  ? 226 ASN A CA  1 
ATOM   499  C  C   . ASN A  1 226 ? 40.088  49.110  -18.486 1.00 47.58  ? 226 ASN A C   1 
ATOM   500  O  O   . ASN A  1 226 ? 39.355  49.321  -17.515 1.00 52.57  ? 226 ASN A O   1 
ATOM   501  C  CB  . ASN A  1 226 ? 38.986  49.934  -20.529 1.00 49.32  ? 226 ASN A CB  1 
ATOM   502  C  CG  . ASN A  1 226 ? 38.446  49.660  -21.920 1.00 47.79  ? 226 ASN A CG  1 
ATOM   503  O  OD1 . ASN A  1 226 ? 38.475  48.529  -22.409 1.00 53.32  ? 226 ASN A OD1 1 
ATOM   504  N  ND2 . ASN A  1 226 ? 37.943  50.706  -22.568 1.00 47.24  ? 226 ASN A ND2 1 
ATOM   505  N  N   . SER A  1 227 ? 41.409  49.247  -18.445 1.00 45.99  ? 227 SER A N   1 
ATOM   506  C  CA  . SER A  1 227 ? 42.084  49.793  -17.265 1.00 48.36  ? 227 SER A CA  1 
ATOM   507  C  C   . SER A  1 227 ? 42.116  51.323  -17.344 1.00 45.72  ? 227 SER A C   1 
ATOM   508  O  O   . SER A  1 227 ? 42.034  51.899  -18.431 1.00 46.58  ? 227 SER A O   1 
ATOM   509  C  CB  . SER A  1 227 ? 43.493  49.210  -17.115 1.00 47.12  ? 227 SER A CB  1 
ATOM   510  O  OG  . SER A  1 227 ? 44.219  49.284  -18.333 1.00 55.71  ? 227 SER A OG  1 
ATOM   511  N  N   . CYS A  1 228 ? 42.210  51.969  -16.182 1.00 47.04  ? 228 CYS A N   1 
ATOM   512  C  CA  . CYS A  1 228 ? 42.258  53.436  -16.096 1.00 48.54  ? 228 CYS A CA  1 
ATOM   513  C  C   . CYS A  1 228 ? 43.562  53.977  -16.673 1.00 47.68  ? 228 CYS A C   1 
ATOM   514  O  O   . CYS A  1 228 ? 44.585  53.285  -16.660 1.00 42.32  ? 228 CYS A O   1 
ATOM   515  C  CB  . CYS A  1 228 ? 42.097  53.907  -14.647 1.00 47.67  ? 228 CYS A CB  1 
ATOM   516  S  SG  . CYS A  1 228 ? 40.576  53.357  -13.834 1.00 54.29  ? 228 CYS A SG  1 
ATOM   517  N  N   . VAL A  1 229 ? 43.513  55.209  -17.181 1.00 48.40  ? 229 VAL A N   1 
ATOM   518  C  CA  . VAL A  1 229 ? 44.691  55.858  -17.764 1.00 47.18  ? 229 VAL A CA  1 
ATOM   519  C  C   . VAL A  1 229 ? 45.766  55.973  -16.686 1.00 49.24  ? 229 VAL A C   1 
ATOM   520  O  O   . VAL A  1 229 ? 45.521  56.507  -15.601 1.00 51.72  ? 229 VAL A O   1 
ATOM   521  C  CB  . VAL A  1 229 ? 44.379  57.257  -18.349 1.00 47.20  ? 229 VAL A CB  1 
ATOM   522  C  CG1 . VAL A  1 229 ? 45.654  57.964  -18.808 1.00 46.83  ? 229 VAL A CG1 1 
ATOM   523  C  CG2 . VAL A  1 229 ? 43.408  57.151  -19.516 1.00 48.66  ? 229 VAL A CG2 1 
ATOM   524  N  N   . GLN A  1 230 ? 46.946  55.454  -17.004 1.00 50.10  ? 230 GLN A N   1 
ATOM   525  C  CA  . GLN A  1 230 ? 48.067  55.414  -16.072 1.00 49.95  ? 230 GLN A CA  1 
ATOM   526  C  C   . GLN A  1 230 ? 49.365  55.303  -16.848 1.00 45.06  ? 230 GLN A C   1 
ATOM   527  O  O   . GLN A  1 230 ? 49.363  54.883  -18.011 1.00 47.34  ? 230 GLN A O   1 
ATOM   528  C  CB  . GLN A  1 230 ? 47.926  54.220  -15.126 1.00 52.97  ? 230 GLN A CB  1 
ATOM   529  C  CG  . GLN A  1 230 ? 47.878  52.864  -15.824 1.00 50.82  ? 230 GLN A CG  1 
ATOM   530  C  CD  . GLN A  1 230 ? 47.452  51.744  -14.899 1.00 48.43  ? 230 GLN A CD  1 
ATOM   531  O  OE1 . GLN A  1 230 ? 48.213  50.811  -14.644 1.00 53.41  ? 230 GLN A OE1 1 
ATOM   532  N  NE2 . GLN A  1 230 ? 46.230  51.832  -14.384 1.00 43.12  ? 230 GLN A NE2 1 
ATOM   533  N  N   . ILE A  1 231 ? 50.472  55.668  -16.205 1.00 44.76  ? 231 ILE A N   1 
ATOM   534  C  CA  . ILE A  1 231 ? 51.792  55.518  -16.822 1.00 49.30  ? 231 ILE A CA  1 
ATOM   535  C  C   . ILE A  1 231 ? 52.185  54.038  -16.876 1.00 53.82  ? 231 ILE A C   1 
ATOM   536  O  O   . ILE A  1 231 ? 51.746  53.240  -16.041 1.00 50.62  ? 231 ILE A O   1 
ATOM   537  C  CB  . ILE A  1 231 ? 52.896  56.360  -16.127 1.00 50.79  ? 231 ILE A CB  1 
ATOM   538  C  CG1 . ILE A  1 231 ? 53.181  55.892  -14.692 1.00 62.15  ? 231 ILE A CG1 1 
ATOM   539  C  CG2 . ILE A  1 231 ? 52.524  57.839  -16.143 1.00 46.71  ? 231 ILE A CG2 1 
ATOM   540  C  CD1 . ILE A  1 231 ? 54.551  56.309  -14.197 1.00 66.38  ? 231 ILE A CD1 1 
ATOM   541  N  N   . VAL A  1 232 ? 53.007  53.692  -17.865 1.00 60.04  ? 232 VAL A N   1 
ATOM   542  C  CA  . VAL A  1 232 ? 53.486  52.312  -18.046 1.00 57.89  ? 232 VAL A CA  1 
ATOM   543  C  C   . VAL A  1 232 ? 54.958  52.203  -17.641 1.00 58.16  ? 232 VAL A C   1 
ATOM   544  O  O   . VAL A  1 232 ? 55.790  53.028  -18.024 1.00 51.84  ? 232 VAL A O   1 
ATOM   545  C  CB  . VAL A  1 232 ? 53.247  51.751  -19.474 1.00 57.62  ? 232 VAL A CB  1 
ATOM   546  C  CG1 . VAL A  1 232 ? 51.754  51.597  -19.733 1.00 57.08  ? 232 VAL A CG1 1 
ATOM   547  C  CG2 . VAL A  1 232 ? 53.903  52.600  -20.560 1.00 62.76  ? 232 VAL A CG2 1 
ATOM   548  N  N   . ASP A  1 233 ? 55.243  51.189  -16.831 1.00 64.52  ? 233 ASP A N   1 
ATOM   549  C  CA  . ASP A  1 233 ? 56.584  50.898  -16.332 1.00 67.48  ? 233 ASP A CA  1 
ATOM   550  C  C   . ASP A  1 233 ? 57.451  50.317  -17.459 1.00 71.49  ? 233 ASP A C   1 
ATOM   551  O  O   . ASP A  1 233 ? 57.303  49.147  -17.822 1.00 71.00  ? 233 ASP A O   1 
ATOM   552  C  CB  . ASP A  1 233 ? 56.456  49.923  -15.146 1.00 73.53  ? 233 ASP A CB  1 
ATOM   553  C  CG  . ASP A  1 233 ? 57.784  49.533  -14.524 1.00 82.96  ? 233 ASP A CG  1 
ATOM   554  O  OD1 . ASP A  1 233 ? 58.861  49.879  -15.050 1.00 80.79  ? 233 ASP A OD1 1 
ATOM   555  O  OD2 . ASP A  1 233 ? 57.727  48.848  -13.486 1.00 82.89  ? 233 ASP A OD2 1 
ATOM   556  N  N   . THR A  1 234 ? 58.343  51.151  -17.999 1.00 71.08  ? 234 THR A N   1 
ATOM   557  C  CA  . THR A  1 234 ? 59.292  50.755  -19.058 1.00 67.89  ? 234 THR A CA  1 
ATOM   558  C  C   . THR A  1 234 ? 60.771  50.952  -18.669 1.00 68.52  ? 234 THR A C   1 
ATOM   559  O  O   . THR A  1 234 ? 61.647  50.866  -19.536 1.00 63.89  ? 234 THR A O   1 
ATOM   560  C  CB  . THR A  1 234 ? 59.048  51.543  -20.373 1.00 64.90  ? 234 THR A CB  1 
ATOM   561  O  OG1 . THR A  1 234 ? 59.471  52.904  -20.215 1.00 60.05  ? 234 THR A OG1 1 
ATOM   562  C  CG2 . THR A  1 234 ? 57.579  51.519  -20.780 1.00 67.76  ? 234 THR A CG2 1 
ATOM   563  N  N   . VAL A  1 235 ? 61.053  51.211  -17.388 1.00 66.37  ? 235 VAL A N   1 
ATOM   564  C  CA  . VAL A  1 235 ? 62.450  51.421  -16.925 1.00 63.96  ? 235 VAL A CA  1 
ATOM   565  C  C   . VAL A  1 235 ? 63.348  50.184  -17.086 1.00 59.75  ? 235 VAL A C   1 
ATOM   566  O  O   . VAL A  1 235 ? 64.547  50.322  -17.338 1.00 61.64  ? 235 VAL A O   1 
ATOM   567  C  CB  . VAL A  1 235 ? 62.567  51.945  -15.463 1.00 59.11  ? 235 VAL A CB  1 
ATOM   568  C  CG1 . VAL A  1 235 ? 61.980  53.341  -15.329 1.00 57.80  ? 235 VAL A CG1 1 
ATOM   569  C  CG2 . VAL A  1 235 ? 61.919  51.015  -14.460 1.00 63.91  ? 235 VAL A CG2 1 
ATOM   570  N  N   . PHE A  1 236 ? 62.760  48.996  -16.939 1.00 61.18  ? 236 PHE A N   1 
ATOM   571  C  CA  . PHE A  1 236 ? 63.470  47.720  -17.133 1.00 62.08  ? 236 PHE A CA  1 
ATOM   572  C  C   . PHE A  1 236 ? 62.998  46.970  -18.387 1.00 61.78  ? 236 PHE A C   1 
ATOM   573  O  O   . PHE A  1 236 ? 63.279  45.780  -18.551 1.00 65.97  ? 236 PHE A O   1 
ATOM   574  C  CB  . PHE A  1 236 ? 63.323  46.841  -15.883 1.00 61.03  ? 236 PHE A CB  1 
ATOM   575  C  CG  . PHE A  1 236 ? 63.876  47.474  -14.635 1.00 58.54  ? 236 PHE A CG  1 
ATOM   576  C  CD1 . PHE A  1 236 ? 65.239  47.743  -14.526 1.00 53.68  ? 236 PHE A CD1 1 
ATOM   577  C  CD2 . PHE A  1 236 ? 63.043  47.804  -13.568 1.00 53.84  ? 236 PHE A CD2 1 
ATOM   578  C  CE1 . PHE A  1 236 ? 65.760  48.332  -13.383 1.00 49.58  ? 236 PHE A CE1 1 
ATOM   579  C  CE2 . PHE A  1 236 ? 63.561  48.397  -12.424 1.00 52.30  ? 236 PHE A CE2 1 
ATOM   580  C  CZ  . PHE A  1 236 ? 64.919  48.659  -12.330 1.00 46.75  ? 236 PHE A CZ  1 
ATOM   581  N  N   . GLY A  1 237 ? 62.295  47.678  -19.272 1.00 58.69  ? 237 GLY A N   1 
ATOM   582  C  CA  . GLY A  1 237 ? 61.858  47.135  -20.555 1.00 65.18  ? 237 GLY A CA  1 
ATOM   583  C  C   . GLY A  1 237 ? 60.741  46.121  -20.406 1.00 66.33  ? 237 GLY A C   1 
ATOM   584  O  O   . GLY A  1 237 ? 59.714  46.410  -19.786 1.00 65.59  ? 237 GLY A O   1 
ATOM   585  N  N   . ASP A  1 238 ? 60.952  44.930  -20.968 1.00 67.22  ? 238 ASP A N   1 
ATOM   586  C  CA  . ASP A  1 238 ? 59.989  43.826  -20.892 1.00 68.53  ? 238 ASP A CA  1 
ATOM   587  C  C   . ASP A  1 238 ? 60.430  42.785  -19.855 1.00 65.35  ? 238 ASP A C   1 
ATOM   588  O  O   . ASP A  1 238 ? 60.472  41.582  -20.135 1.00 61.04  ? 238 ASP A O   1 
ATOM   589  C  CB  . ASP A  1 238 ? 59.814  43.184  -22.277 1.00 77.22  ? 238 ASP A CB  1 
ATOM   590  C  CG  . ASP A  1 238 ? 59.246  44.149  -23.312 1.00 83.35  ? 238 ASP A CG  1 
ATOM   591  O  OD1 . ASP A  1 238 ? 58.847  45.278  -22.952 1.00 80.34  ? 238 ASP A OD1 1 
ATOM   592  O  OD2 . ASP A  1 238 ? 59.194  43.769  -24.500 1.00 87.57  ? 238 ASP A OD2 1 
ATOM   593  N  N   . PHE A  1 239 ? 60.748  43.266  -18.655 1.00 66.46  ? 239 PHE A N   1 
ATOM   594  C  CA  . PHE A  1 239 ? 61.210  42.427  -17.556 1.00 63.22  ? 239 PHE A CA  1 
ATOM   595  C  C   . PHE A  1 239 ? 59.977  41.859  -16.835 1.00 59.79  ? 239 PHE A C   1 
ATOM   596  O  O   . PHE A  1 239 ? 59.225  42.633  -16.240 1.00 54.37  ? 239 PHE A O   1 
ATOM   597  C  CB  . PHE A  1 239 ? 62.070  43.265  -16.604 1.00 67.02  ? 239 PHE A CB  1 
ATOM   598  C  CG  . PHE A  1 239 ? 62.489  42.537  -15.359 1.00 68.52  ? 239 PHE A CG  1 
ATOM   599  C  CD1 . PHE A  1 239 ? 63.211  41.349  -15.440 1.00 68.62  ? 239 PHE A CD1 1 
ATOM   600  C  CD2 . PHE A  1 239 ? 62.170  43.040  -14.102 1.00 66.13  ? 239 PHE A CD2 1 
ATOM   601  C  CE1 . PHE A  1 239 ? 63.598  40.674  -14.290 1.00 72.10  ? 239 PHE A CE1 1 
ATOM   602  C  CE2 . PHE A  1 239 ? 62.552  42.370  -12.953 1.00 65.73  ? 239 PHE A CE2 1 
ATOM   603  C  CZ  . PHE A  1 239 ? 63.269  41.186  -13.044 1.00 68.26  ? 239 PHE A CZ  1 
ATOM   604  N  N   . PRO A  1 240 ? 59.761  40.518  -16.884 1.00 64.12  ? 240 PRO A N   1 
ATOM   605  C  CA  . PRO A  1 240 ? 58.526  39.894  -16.350 1.00 65.54  ? 240 PRO A CA  1 
ATOM   606  C  C   . PRO A  1 240 ? 58.076  40.305  -14.932 1.00 61.15  ? 240 PRO A C   1 
ATOM   607  O  O   . PRO A  1 240 ? 56.873  40.342  -14.663 1.00 53.43  ? 240 PRO A O   1 
ATOM   608  C  CB  . PRO A  1 240 ? 58.849  38.396  -16.396 1.00 64.08  ? 240 PRO A CB  1 
ATOM   609  C  CG  . PRO A  1 240 ? 59.808  38.262  -17.521 1.00 57.49  ? 240 PRO A CG  1 
ATOM   610  C  CD  . PRO A  1 240 ? 60.661  39.496  -17.461 1.00 59.61  ? 240 PRO A CD  1 
ATOM   611  N  N   . GLY A  1 241 ? 59.028  40.605  -14.050 1.00 59.82  ? 241 GLY A N   1 
ATOM   612  C  CA  . GLY A  1 241 ? 58.733  41.103  -12.697 1.00 56.55  ? 241 GLY A CA  1 
ATOM   613  C  C   . GLY A  1 241 ? 58.189  42.528  -12.646 1.00 57.95  ? 241 GLY A C   1 
ATOM   614  O  O   . GLY A  1 241 ? 57.408  42.865  -11.755 1.00 55.53  ? 241 GLY A O   1 
ATOM   615  N  N   . ALA A  1 242 ? 58.622  43.362  -13.592 1.00 55.35  ? 242 ALA A N   1 
ATOM   616  C  CA  . ALA A  1 242 ? 58.132  44.740  -13.740 1.00 55.10  ? 242 ALA A CA  1 
ATOM   617  C  C   . ALA A  1 242 ? 56.837  44.810  -14.553 1.00 59.17  ? 242 ALA A C   1 
ATOM   618  O  O   . ALA A  1 242 ? 55.931  45.579  -14.224 1.00 65.35  ? 242 ALA A O   1 
ATOM   619  C  CB  . ALA A  1 242 ? 59.198  45.605  -14.393 1.00 54.90  ? 242 ALA A CB  1 
ATOM   620  N  N   . THR A  1 243 ? 56.768  44.008  -15.615 1.00 57.31  ? 243 THR A N   1 
ATOM   621  C  CA  . THR A  1 243 ? 55.609  43.985  -16.518 1.00 54.71  ? 243 THR A CA  1 
ATOM   622  C  C   . THR A  1 243 ? 54.364  43.271  -15.974 1.00 54.22  ? 243 THR A C   1 
ATOM   623  O  O   . THR A  1 243 ? 53.271  43.461  -16.514 1.00 62.35  ? 243 THR A O   1 
ATOM   624  C  CB  . THR A  1 243 ? 55.962  43.349  -17.879 1.00 56.14  ? 243 THR A CB  1 
ATOM   625  O  OG1 . THR A  1 243 ? 56.348  41.981  -17.695 1.00 51.74  ? 243 THR A OG1 1 
ATOM   626  C  CG2 . THR A  1 243 ? 57.088  44.109  -18.563 1.00 55.52  ? 243 THR A CG2 1 
ATOM   627  N  N   . MET A  1 244 ? 54.517  42.450  -14.932 1.00 51.92  ? 244 MET A N   1 
ATOM   628  C  CA  . MET A  1 244 ? 53.359  41.778  -14.303 1.00 53.09  ? 244 MET A CA  1 
ATOM   629  C  C   . MET A  1 244 ? 52.373  42.744  -13.624 1.00 53.21  ? 244 MET A C   1 
ATOM   630  O  O   . MET A  1 244 ? 51.212  42.387  -13.404 1.00 54.38  ? 244 MET A O   1 
ATOM   631  C  CB  . MET A  1 244 ? 53.796  40.687  -13.309 1.00 56.04  ? 244 MET A CB  1 
ATOM   632  C  CG  . MET A  1 244 ? 54.625  41.158  -12.119 1.00 57.35  ? 244 MET A CG  1 
ATOM   633  S  SD  . MET A  1 244 ? 54.401  40.142  -10.642 1.00 58.74  ? 244 MET A SD  1 
ATOM   634  C  CE  . MET A  1 244 ? 55.025  38.551  -11.178 1.00 59.31  ? 244 MET A CE  1 
ATOM   635  N  N   . TRP A  1 245 ? 52.845  43.946  -13.291 1.00 51.99  ? 245 TRP A N   1 
ATOM   636  C  CA  . TRP A  1 245 ? 52.011  45.024  -12.730 1.00 48.46  ? 245 TRP A CA  1 
ATOM   637  C  C   . TRP A  1 245 ? 51.502  46.018  -13.778 1.00 45.18  ? 245 TRP A C   1 
ATOM   638  O  O   . TRP A  1 245 ? 50.513  46.715  -13.537 1.00 40.55  ? 245 TRP A O   1 
ATOM   639  C  CB  . TRP A  1 245 ? 52.789  45.782  -11.655 1.00 48.94  ? 245 TRP A CB  1 
ATOM   640  C  CG  . TRP A  1 245 ? 53.466  44.868  -10.702 1.00 47.29  ? 245 TRP A CG  1 
ATOM   641  C  CD1 . TRP A  1 245 ? 54.804  44.628  -10.610 1.00 47.68  ? 245 TRP A CD1 1 
ATOM   642  C  CD2 . TRP A  1 245 ? 52.836  44.025  -9.737  1.00 49.66  ? 245 TRP A CD2 1 
ATOM   643  N  NE1 . TRP A  1 245 ? 55.053  43.700  -9.628  1.00 51.58  ? 245 TRP A NE1 1 
ATOM   644  C  CE2 . TRP A  1 245 ? 53.861  43.313  -9.075  1.00 51.41  ? 245 TRP A CE2 1 
ATOM   645  C  CE3 . TRP A  1 245 ? 51.503  43.810  -9.357  1.00 53.53  ? 245 TRP A CE3 1 
ATOM   646  C  CZ2 . TRP A  1 245 ? 53.596  42.396  -8.050  1.00 53.93  ? 245 TRP A CZ2 1 
ATOM   647  C  CZ3 . TRP A  1 245 ? 51.237  42.897  -8.337  1.00 58.99  ? 245 TRP A CZ3 1 
ATOM   648  C  CH2 . TRP A  1 245 ? 52.283  42.201  -7.696  1.00 56.83  ? 245 TRP A CH2 1 
ATOM   649  N  N   . ASN A  1 246 ? 52.192  46.100  -14.917 1.00 50.17  ? 246 ASN A N   1 
ATOM   650  C  CA  . ASN A  1 246 ? 51.747  46.903  -16.064 1.00 49.42  ? 246 ASN A CA  1 
ATOM   651  C  C   . ASN A  1 246 ? 50.372  46.450  -16.575 1.00 52.82  ? 246 ASN A C   1 
ATOM   652  O  O   . ASN A  1 246 ? 50.068  45.254  -16.548 1.00 59.94  ? 246 ASN A O   1 
ATOM   653  C  CB  . ASN A  1 246 ? 52.768  46.840  -17.215 1.00 48.52  ? 246 ASN A CB  1 
ATOM   654  C  CG  . ASN A  1 246 ? 53.924  47.809  -17.039 1.00 48.32  ? 246 ASN A CG  1 
ATOM   655  O  OD1 . ASN A  1 246 ? 53.753  48.915  -16.526 1.00 47.84  ? 246 ASN A OD1 1 
ATOM   656  N  ND2 . ASN A  1 246 ? 55.106  47.410  -17.495 1.00 47.15  ? 246 ASN A ND2 1 
ATOM   657  N  N   . PRO A  1 247 ? 49.545  47.406  -17.049 1.00 48.05  ? 247 PRO A N   1 
ATOM   658  C  CA  . PRO A  1 247 ? 48.149  47.111  -17.393 1.00 49.37  ? 247 PRO A CA  1 
ATOM   659  C  C   . PRO A  1 247 ? 47.985  46.223  -18.630 1.00 44.87  ? 247 PRO A C   1 
ATOM   660  O  O   . PRO A  1 247 ? 48.632  46.464  -19.652 1.00 48.43  ? 247 PRO A O   1 
ATOM   661  C  CB  . PRO A  1 247 ? 47.535  48.498  -17.627 1.00 52.59  ? 247 PRO A CB  1 
ATOM   662  C  CG  . PRO A  1 247 ? 48.678  49.393  -17.940 1.00 51.02  ? 247 PRO A CG  1 
ATOM   663  C  CD  . PRO A  1 247 ? 49.884  48.826  -17.264 1.00 48.92  ? 247 PRO A CD  1 
ATOM   664  N  N   . ASN A  1 248 ? 47.110  45.220  -18.521 1.00 42.94  ? 248 ASN A N   1 
ATOM   665  C  CA  . ASN A  1 248 ? 46.888  44.220  -19.588 1.00 47.34  ? 248 ASN A CA  1 
ATOM   666  C  C   . ASN A  1 248 ? 45.545  44.364  -20.334 1.00 49.03  ? 248 ASN A C   1 
ATOM   667  O  O   . ASN A  1 248 ? 45.047  43.401  -20.928 1.00 46.49  ? 248 ASN A O   1 
ATOM   668  C  CB  . ASN A  1 248 ? 47.043  42.800  -19.020 1.00 46.34  ? 248 ASN A CB  1 
ATOM   669  C  CG  . ASN A  1 248 ? 45.985  42.454  -17.988 1.00 45.76  ? 248 ASN A CG  1 
ATOM   670  O  OD1 . ASN A  1 248 ? 45.521  43.317  -17.241 1.00 45.35  ? 248 ASN A OD1 1 
ATOM   671  N  ND2 . ASN A  1 248 ? 45.604  41.182  -17.936 1.00 49.76  ? 248 ASN A ND2 1 
ATOM   672  N  N   . THR A  1 249 ? 44.975  45.565  -20.295 1.00 51.75  ? 249 THR A N   1 
ATOM   673  C  CA  . THR A  1 249 ? 43.775  45.918  -21.058 1.00 48.71  ? 249 THR A CA  1 
ATOM   674  C  C   . THR A  1 249 ? 43.952  47.368  -21.527 1.00 50.77  ? 249 THR A C   1 
ATOM   675  O  O   . THR A  1 249 ? 44.688  48.122  -20.883 1.00 51.07  ? 249 THR A O   1 
ATOM   676  C  CB  . THR A  1 249 ? 42.498  45.795  -20.201 1.00 49.81  ? 249 THR A CB  1 
ATOM   677  O  OG1 . THR A  1 249 ? 42.625  46.602  -19.023 1.00 54.60  ? 249 THR A OG1 1 
ATOM   678  C  CG2 . THR A  1 249 ? 42.252  44.340  -19.794 1.00 46.54  ? 249 THR A CG2 1 
ATOM   679  N  N   . PRO A  1 250 ? 43.301  47.766  -22.646 1.00 55.06  ? 250 PRO A N   1 
ATOM   680  C  CA  . PRO A  1 250 ? 43.483  49.133  -23.173 1.00 55.80  ? 250 PRO A CA  1 
ATOM   681  C  C   . PRO A  1 250 ? 43.240  50.252  -22.147 1.00 58.31  ? 250 PRO A C   1 
ATOM   682  O  O   . PRO A  1 250 ? 42.288  50.175  -21.366 1.00 65.15  ? 250 PRO A O   1 
ATOM   683  C  CB  . PRO A  1 250 ? 42.461  49.220  -24.324 1.00 50.84  ? 250 PRO A CB  1 
ATOM   684  C  CG  . PRO A  1 250 ? 41.654  47.965  -24.271 1.00 48.61  ? 250 PRO A CG  1 
ATOM   685  C  CD  . PRO A  1 250 ? 42.475  46.946  -23.550 1.00 48.74  ? 250 PRO A CD  1 
ATOM   686  N  N   . LEU A  1 251 ? 44.109  51.265  -22.154 1.00 56.12  ? 251 LEU A N   1 
ATOM   687  C  CA  . LEU A  1 251 ? 43.987  52.413  -21.249 1.00 54.33  ? 251 LEU A CA  1 
ATOM   688  C  C   . LEU A  1 251 ? 42.873  53.337  -21.717 1.00 58.63  ? 251 LEU A C   1 
ATOM   689  O  O   . LEU A  1 251 ? 42.892  53.810  -22.856 1.00 57.75  ? 251 LEU A O   1 
ATOM   690  C  CB  . LEU A  1 251 ? 45.292  53.206  -21.182 1.00 49.74  ? 251 LEU A CB  1 
ATOM   691  C  CG  . LEU A  1 251 ? 46.530  52.480  -20.664 1.00 48.90  ? 251 LEU A CG  1 
ATOM   692  C  CD1 . LEU A  1 251 ? 47.737  53.395  -20.783 1.00 51.50  ? 251 LEU A CD1 1 
ATOM   693  C  CD2 . LEU A  1 251 ? 46.352  52.034  -19.223 1.00 51.17  ? 251 LEU A CD2 1 
ATOM   694  N  N   . SER A  1 252 ? 41.914  53.592  -20.830 1.00 58.58  ? 252 SER A N   1 
ATOM   695  C  CA  . SER A  1 252 ? 40.751  54.414  -21.147 1.00 59.62  ? 252 SER A CA  1 
ATOM   696  C  C   . SER A  1 252 ? 40.235  55.124  -19.900 1.00 57.18  ? 252 SER A C   1 
ATOM   697  O  O   . SER A  1 252 ? 40.322  54.586  -18.796 1.00 57.54  ? 252 SER A O   1 
ATOM   698  C  CB  . SER A  1 252 ? 39.647  53.538  -21.741 1.00 58.22  ? 252 SER A CB  1 
ATOM   699  O  OG  . SER A  1 252 ? 38.655  54.328  -22.374 1.00 62.71  ? 252 SER A OG  1 
ATOM   700  N  N   . GLU A  1 253 ? 39.707  56.335  -20.084 1.00 55.63  ? 253 GLU A N   1 
ATOM   701  C  CA  . GLU A  1 253 ? 39.031  57.059  -19.004 1.00 57.01  ? 253 GLU A CA  1 
ATOM   702  C  C   . GLU A  1 253 ? 37.763  56.327  -18.565 1.00 58.96  ? 253 GLU A C   1 
ATOM   703  O  O   . GLU A  1 253 ? 37.433  56.313  -17.376 1.00 63.32  ? 253 GLU A O   1 
ATOM   704  C  CB  . GLU A  1 253 ? 38.700  58.495  -19.418 1.00 55.60  ? 253 GLU A CB  1 
ATOM   705  C  CG  . GLU A  1 253 ? 39.884  59.449  -19.339 1.00 59.88  ? 253 GLU A CG  1 
ATOM   706  C  CD  . GLU A  1 253 ? 39.465  60.878  -19.064 1.00 65.33  ? 253 GLU A CD  1 
ATOM   707  O  OE1 . GLU A  1 253 ? 38.642  61.417  -19.835 1.00 71.79  ? 253 GLU A OE1 1 
ATOM   708  O  OE2 . GLU A  1 253 ? 39.962  61.470  -18.081 1.00 57.80  ? 253 GLU A OE2 1 
ATOM   709  N  N   . ASP A  1 254 ? 37.065  55.720  -19.524 1.00 55.09  ? 254 ASP A N   1 
ATOM   710  C  CA  . ASP A  1 254 ? 35.962  54.805  -19.233 1.00 55.34  ? 254 ASP A CA  1 
ATOM   711  C  C   . ASP A  1 254 ? 36.545  53.505  -18.668 1.00 55.62  ? 254 ASP A C   1 
ATOM   712  O  O   . ASP A  1 254 ? 36.696  52.506  -19.383 1.00 61.54  ? 254 ASP A O   1 
ATOM   713  C  CB  . ASP A  1 254 ? 35.123  54.545  -20.494 1.00 55.34  ? 254 ASP A CB  1 
ATOM   714  C  CG  . ASP A  1 254 ? 33.949  53.591  -20.250 1.00 59.52  ? 254 ASP A CG  1 
ATOM   715  O  OD1 . ASP A  1 254 ? 33.475  53.470  -19.097 1.00 67.69  ? 254 ASP A OD1 1 
ATOM   716  O  OD2 . ASP A  1 254 ? 33.494  52.958  -21.226 1.00 60.52  ? 254 ASP A OD2 1 
ATOM   717  N  N   . CYS A  1 255 ? 36.894  53.551  -17.384 1.00 52.74  ? 255 CYS A N   1 
ATOM   718  C  CA  . CYS A  1 255 ? 37.449  52.394  -16.669 1.00 52.82  ? 255 CYS A CA  1 
ATOM   719  C  C   . CYS A  1 255 ? 36.636  51.932  -15.453 1.00 48.19  ? 255 CYS A C   1 
ATOM   720  O  O   . CYS A  1 255 ? 36.980  50.923  -14.849 1.00 52.68  ? 255 CYS A O   1 
ATOM   721  C  CB  . CYS A  1 255 ? 38.890  52.689  -16.240 1.00 56.14  ? 255 CYS A CB  1 
ATOM   722  S  SG  . CYS A  1 255 ? 39.083  54.027  -15.039 1.00 53.57  ? 255 CYS A SG  1 
ATOM   723  N  N   . LEU A  1 256 ? 35.552  52.634  -15.123 1.00 46.45  ? 256 LEU A N   1 
ATOM   724  C  CA  . LEU A  1 256 ? 34.759  52.334  -13.923 1.00 45.75  ? 256 LEU A CA  1 
ATOM   725  C  C   . LEU A  1 256 ? 33.886  51.096  -14.150 1.00 44.24  ? 256 LEU A C   1 
ATOM   726  O  O   . LEU A  1 256 ? 32.744  51.201  -14.606 1.00 48.14  ? 256 LEU A O   1 
ATOM   727  C  CB  . LEU A  1 256 ? 33.903  53.545  -13.517 1.00 46.65  ? 256 LEU A CB  1 
ATOM   728  C  CG  . LEU A  1 256 ? 34.588  54.653  -12.703 1.00 49.48  ? 256 LEU A CG  1 
ATOM   729  C  CD1 . LEU A  1 256 ? 35.888  55.149  -13.318 1.00 53.16  ? 256 LEU A CD1 1 
ATOM   730  C  CD2 . LEU A  1 256 ? 33.632  55.820  -12.518 1.00 52.23  ? 256 LEU A CD2 1 
ATOM   731  N  N   . TYR A  1 257 ? 34.454  49.929  -13.848 1.00 43.42  ? 257 TYR A N   1 
ATOM   732  C  CA  . TYR A  1 257 ? 33.763  48.642  -13.974 1.00 45.31  ? 257 TYR A CA  1 
ATOM   733  C  C   . TYR A  1 257 ? 34.063  47.716  -12.794 1.00 49.98  ? 257 TYR A C   1 
ATOM   734  O  O   . TYR A  1 257 ? 35.034  47.918  -12.059 1.00 55.19  ? 257 TYR A O   1 
ATOM   735  C  CB  . TYR A  1 257 ? 34.140  47.958  -15.292 1.00 45.77  ? 257 TYR A CB  1 
ATOM   736  C  CG  . TYR A  1 257 ? 33.665  48.719  -16.513 1.00 49.79  ? 257 TYR A CG  1 
ATOM   737  C  CD1 . TYR A  1 257 ? 34.460  49.706  -17.096 1.00 49.86  ? 257 TYR A CD1 1 
ATOM   738  C  CD2 . TYR A  1 257 ? 32.413  48.469  -17.077 1.00 51.39  ? 257 TYR A CD2 1 
ATOM   739  C  CE1 . TYR A  1 257 ? 34.027  50.418  -18.207 1.00 50.53  ? 257 TYR A CE1 1 
ATOM   740  C  CE2 . TYR A  1 257 ? 31.971  49.173  -18.190 1.00 50.85  ? 257 TYR A CE2 1 
ATOM   741  C  CZ  . TYR A  1 257 ? 32.780  50.147  -18.752 1.00 49.05  ? 257 TYR A CZ  1 
ATOM   742  O  OH  . TYR A  1 257 ? 32.346  50.845  -19.856 1.00 46.45  ? 257 TYR A OH  1 
ATOM   743  N  N   . ILE A  1 258 ? 33.209  46.705  -12.635 1.00 52.07  ? 258 ILE A N   1 
ATOM   744  C  CA  . ILE A  1 258 ? 33.318  45.694  -11.569 1.00 53.86  ? 258 ILE A CA  1 
ATOM   745  C  C   . ILE A  1 258 ? 33.361  44.303  -12.204 1.00 52.22  ? 258 ILE A C   1 
ATOM   746  O  O   . ILE A  1 258 ? 32.724  44.061  -13.233 1.00 49.31  ? 258 ILE A O   1 
ATOM   747  C  CB  . ILE A  1 258 ? 32.142  45.781  -10.552 1.00 58.82  ? 258 ILE A CB  1 
ATOM   748  C  CG1 . ILE A  1 258 ? 32.249  47.071  -9.730  1.00 63.08  ? 258 ILE A CG1 1 
ATOM   749  C  CG2 . ILE A  1 258 ? 32.124  44.583  -9.596  1.00 61.34  ? 258 ILE A CG2 1 
ATOM   750  C  CD1 . ILE A  1 258 ? 31.067  47.361  -8.820  1.00 63.69  ? 258 ILE A CD1 1 
ATOM   751  N  N   . ASN A  1 259 ? 34.113  43.403  -11.572 1.00 49.16  ? 259 ASN A N   1 
ATOM   752  C  CA  . ASN A  1 259 ? 34.190  41.998  -11.973 1.00 49.56  ? 259 ASN A CA  1 
ATOM   753  C  C   . ASN A  1 259 ? 33.776  41.113  -10.798 1.00 52.09  ? 259 ASN A C   1 
ATOM   754  O  O   . ASN A  1 259 ? 34.293  41.275  -9.692  1.00 51.94  ? 259 ASN A O   1 
ATOM   755  C  CB  . ASN A  1 259 ? 35.610  41.637  -12.407 1.00 50.67  ? 259 ASN A CB  1 
ATOM   756  C  CG  . ASN A  1 259 ? 36.194  42.639  -13.386 1.00 51.13  ? 259 ASN A CG  1 
ATOM   757  O  OD1 . ASN A  1 259 ? 35.630  42.881  -14.452 1.00 48.84  ? 259 ASN A OD1 1 
ATOM   758  N  ND2 . ASN A  1 259 ? 37.331  43.226  -13.027 1.00 54.09  ? 259 ASN A ND2 1 
ATOM   759  N  N   . VAL A  1 260 ? 32.848  40.187  -11.049 1.00 56.62  ? 260 VAL A N   1 
ATOM   760  C  CA  . VAL A  1 260 ? 32.360  39.237  -10.037 1.00 54.22  ? 260 VAL A CA  1 
ATOM   761  C  C   . VAL A  1 260 ? 32.645  37.820  -10.534 1.00 51.46  ? 260 VAL A C   1 
ATOM   762  O  O   . VAL A  1 260 ? 32.411  37.510  -11.703 1.00 48.40  ? 260 VAL A O   1 
ATOM   763  C  CB  . VAL A  1 260 ? 30.839  39.382  -9.779  1.00 58.06  ? 260 VAL A CB  1 
ATOM   764  C  CG1 . VAL A  1 260 ? 30.375  38.448  -8.663  1.00 57.81  ? 260 VAL A CG1 1 
ATOM   765  C  CG2 . VAL A  1 260 ? 30.479  40.819  -9.428  1.00 57.78  ? 260 VAL A CG2 1 
ATOM   766  N  N   . VAL A  1 261 ? 33.155  36.976  -9.639  1.00 48.65  ? 261 VAL A N   1 
ATOM   767  C  CA  . VAL A  1 261 ? 33.465  35.573  -9.941  1.00 50.49  ? 261 VAL A CA  1 
ATOM   768  C  C   . VAL A  1 261 ? 32.933  34.687  -8.812  1.00 49.41  ? 261 VAL A C   1 
ATOM   769  O  O   . VAL A  1 261 ? 33.392  34.787  -7.671  1.00 46.53  ? 261 VAL A O   1 
ATOM   770  C  CB  . VAL A  1 261 ? 34.987  35.364  -10.135 1.00 53.62  ? 261 VAL A CB  1 
ATOM   771  C  CG1 . VAL A  1 261 ? 35.345  33.887  -10.280 1.00 57.87  ? 261 VAL A CG1 1 
ATOM   772  C  CG2 . VAL A  1 261 ? 35.468  36.131  -11.358 1.00 52.92  ? 261 VAL A CG2 1 
ATOM   773  N  N   . ALA A  1 262 ? 31.978  33.820  -9.152  1.00 50.65  ? 262 ALA A N   1 
ATOM   774  C  CA  . ALA A  1 262 ? 31.304  32.933  -8.196  1.00 48.91  ? 262 ALA A CA  1 
ATOM   775  C  C   . ALA A  1 262 ? 31.647  31.459  -8.461  1.00 52.46  ? 262 ALA A C   1 
ATOM   776  O  O   . ALA A  1 262 ? 31.807  31.069  -9.620  1.00 45.86  ? 262 ALA A O   1 
ATOM   777  C  CB  . ALA A  1 262 ? 29.802  33.135  -8.287  1.00 49.36  ? 262 ALA A CB  1 
ATOM   778  N  N   . PRO A  1 263 ? 31.743  30.633  -7.393  1.00 59.39  ? 263 PRO A N   1 
ATOM   779  C  CA  . PRO A  1 263 ? 32.049  29.210  -7.577  1.00 59.67  ? 263 PRO A CA  1 
ATOM   780  C  C   . PRO A  1 263 ? 30.854  28.384  -8.067  1.00 65.03  ? 263 PRO A C   1 
ATOM   781  O  O   . PRO A  1 263 ? 29.714  28.848  -8.013  1.00 63.74  ? 263 PRO A O   1 
ATOM   782  C  CB  . PRO A  1 263 ? 32.495  28.763  -6.180  1.00 59.51  ? 263 PRO A CB  1 
ATOM   783  C  CG  . PRO A  1 263 ? 31.779  29.669  -5.244  1.00 57.12  ? 263 PRO A CG  1 
ATOM   784  C  CD  . PRO A  1 263 ? 31.562  30.971  -5.965  1.00 59.29  ? 263 PRO A CD  1 
ATOM   785  N  N   . ARG A  1 264 ? 31.143  27.174  -8.546  1.00 75.82  ? 264 ARG A N   1 
ATOM   786  C  CA  . ARG A  1 264 ? 30.138  26.234  -9.063  1.00 76.61  ? 264 ARG A CA  1 
ATOM   787  C  C   . ARG A  1 264 ? 30.142  24.963  -8.188  1.00 76.27  ? 264 ARG A C   1 
ATOM   788  O  O   . ARG A  1 264 ? 31.218  24.403  -7.961  1.00 70.26  ? 264 ARG A O   1 
ATOM   789  C  CB  . ARG A  1 264 ? 30.465  25.881  -10.517 1.00 81.09  ? 264 ARG A CB  1 
ATOM   790  C  CG  . ARG A  1 264 ? 29.450  24.991  -11.225 1.00 92.56  ? 264 ARG A CG  1 
ATOM   791  C  CD  . ARG A  1 264 ? 29.750  24.897  -12.717 1.00 94.54  ? 264 ARG A CD  1 
ATOM   792  N  NE  . ARG A  1 264 ? 29.416  23.591  -13.295 1.00 94.03  ? 264 ARG A NE  1 
ATOM   793  C  CZ  . ARG A  1 264 ? 30.133  22.471  -13.154 1.00 90.84  ? 264 ARG A CZ  1 
ATOM   794  N  NH1 . ARG A  1 264 ? 31.251  22.445  -12.425 1.00 85.85  ? 264 ARG A NH1 1 
ATOM   795  N  NH2 . ARG A  1 264 ? 29.720  21.349  -13.742 1.00 91.42  ? 264 ARG A NH2 1 
ATOM   796  N  N   . PRO A  1 265 ? 28.987  24.491  -7.693  1.00 75.83  ? 265 PRO A N   1 
ATOM   797  C  CA  . PRO A  1 265 ? 27.660  25.089  -7.910  1.00 73.57  ? 265 PRO A CA  1 
ATOM   798  C  C   . PRO A  1 265 ? 27.501  26.444  -7.232  1.00 69.91  ? 265 PRO A C   1 
ATOM   799  O  O   . PRO A  1 265 ? 28.218  26.741  -6.271  1.00 67.07  ? 265 PRO A O   1 
ATOM   800  C  CB  . PRO A  1 265 ? 26.712  24.071  -7.266  1.00 73.60  ? 265 PRO A CB  1 
ATOM   801  C  CG  . PRO A  1 265 ? 27.530  23.412  -6.213  1.00 70.00  ? 265 PRO A CG  1 
ATOM   802  C  CD  . PRO A  1 265 ? 28.923  23.342  -6.769  1.00 70.99  ? 265 PRO A CD  1 
ATOM   803  N  N   . ARG A  1 266 ? 26.576  27.255  -7.743  1.00 66.58  ? 266 ARG A N   1 
ATOM   804  C  CA  . ARG A  1 266 ? 26.405  28.614  -7.240  1.00 69.01  ? 266 ARG A CA  1 
ATOM   805  C  C   . ARG A  1 266 ? 25.876  28.580  -5.813  1.00 65.57  ? 266 ARG A C   1 
ATOM   806  O  O   . ARG A  1 266 ? 24.832  27.974  -5.559  1.00 67.12  ? 266 ARG A O   1 
ATOM   807  C  CB  . ARG A  1 266 ? 25.466  29.444  -8.115  1.00 70.51  ? 266 ARG A CB  1 
ATOM   808  C  CG  . ARG A  1 266 ? 25.437  30.920  -7.719  1.00 68.41  ? 266 ARG A CG  1 
ATOM   809  C  CD  . ARG A  1 266 ? 24.582  31.742  -8.664  1.00 68.01  ? 266 ARG A CD  1 
ATOM   810  N  NE  . ARG A  1 266 ? 25.141  31.743  -10.012 1.00 69.12  ? 266 ARG A NE  1 
ATOM   811  C  CZ  . ARG A  1 266 ? 24.526  32.196  -11.105 1.00 77.22  ? 266 ARG A CZ  1 
ATOM   812  N  NH1 . ARG A  1 266 ? 25.157  32.129  -12.273 1.00 87.83  ? 266 ARG A NH1 1 
ATOM   813  N  NH2 . ARG A  1 266 ? 23.296  32.709  -11.049 1.00 75.82  ? 266 ARG A NH2 1 
ATOM   814  N  N   . PRO A  1 267 ? 26.596  29.232  -4.879  1.00 65.18  ? 267 PRO A N   1 
ATOM   815  C  CA  . PRO A  1 267 ? 26.131  29.271  -3.505  1.00 64.85  ? 267 PRO A CA  1 
ATOM   816  C  C   . PRO A  1 267 ? 24.931  30.215  -3.303  1.00 68.07  ? 267 PRO A C   1 
ATOM   817  O  O   . PRO A  1 267 ? 24.420  30.822  -4.248  1.00 64.12  ? 267 PRO A O   1 
ATOM   818  C  CB  . PRO A  1 267 ? 27.375  29.745  -2.739  1.00 61.17  ? 267 PRO A CB  1 
ATOM   819  C  CG  . PRO A  1 267 ? 28.091  30.600  -3.708  1.00 60.78  ? 267 PRO A CG  1 
ATOM   820  C  CD  . PRO A  1 267 ? 27.884  29.936  -5.035  1.00 63.21  ? 267 PRO A CD  1 
ATOM   821  N  N   . LYS A  1 268 ? 24.530  30.325  -2.045  1.00 69.46  ? 268 LYS A N   1 
ATOM   822  C  CA  . LYS A  1 268 ? 23.290  30.977  -1.601  1.00 69.11  ? 268 LYS A CA  1 
ATOM   823  C  C   . LYS A  1 268 ? 23.569  32.370  -1.015  1.00 65.97  ? 268 LYS A C   1 
ATOM   824  O  O   . LYS A  1 268 ? 23.177  33.392  -1.582  1.00 52.33  ? 268 LYS A O   1 
ATOM   825  C  CB  . LYS A  1 268 ? 22.528  30.091  -0.574  1.00 72.70  ? 268 LYS A CB  1 
ATOM   826  C  CG  . LYS A  1 268 ? 23.230  28.827  -0.040  1.00 72.16  ? 268 LYS A CG  1 
ATOM   827  C  CD  . LYS A  1 268 ? 24.432  29.059  0.883   1.00 70.15  ? 268 LYS A CD  1 
ATOM   828  C  CE  . LYS A  1 268 ? 25.298  27.820  1.021   1.00 72.95  ? 268 LYS A CE  1 
ATOM   829  N  NZ  . LYS A  1 268 ? 26.590  28.147  1.687   1.00 77.16  ? 268 LYS A NZ  1 
ATOM   830  N  N   . ASN A  1 269 ? 24.249  32.368  0.129   1.00 71.40  ? 269 ASN A N   1 
ATOM   831  C  CA  . ASN A  1 269 ? 24.642  33.553  0.889   1.00 70.72  ? 269 ASN A CA  1 
ATOM   832  C  C   . ASN A  1 269 ? 26.098  33.357  1.328   1.00 66.01  ? 269 ASN A C   1 
ATOM   833  O  O   . ASN A  1 269 ? 26.412  33.326  2.523   1.00 69.02  ? 269 ASN A O   1 
ATOM   834  C  CB  . ASN A  1 269 ? 23.718  33.730  2.107   1.00 70.74  ? 269 ASN A CB  1 
ATOM   835  C  CG  . ASN A  1 269 ? 22.484  34.556  1.794   1.00 72.17  ? 269 ASN A CG  1 
ATOM   836  O  OD1 . ASN A  1 269 ? 22.586  35.729  1.426   1.00 74.61  ? 269 ASN A OD1 1 
ATOM   837  N  ND2 . ASN A  1 269 ? 21.310  33.954  1.952   1.00 77.10  ? 269 ASN A ND2 1 
ATOM   838  N  N   . ALA A  1 270 ? 26.982  33.215  0.344   1.00 58.00  ? 270 ALA A N   1 
ATOM   839  C  CA  . ALA A  1 270 ? 28.399  32.966  0.606   1.00 54.85  ? 270 ALA A CA  1 
ATOM   840  C  C   . ALA A  1 270 ? 29.103  34.244  1.028   1.00 53.90  ? 270 ALA A C   1 
ATOM   841  O  O   . ALA A  1 270 ? 28.630  35.350  0.747   1.00 59.03  ? 270 ALA A O   1 
ATOM   842  C  CB  . ALA A  1 270 ? 29.076  32.384  -0.624  1.00 57.06  ? 270 ALA A CB  1 
ATOM   843  N  N   . ALA A  1 271 ? 30.230  34.077  1.713   1.00 50.24  ? 271 ALA A N   1 
ATOM   844  C  CA  . ALA A  1 271 ? 31.086  35.198  2.088   1.00 47.63  ? 271 ALA A CA  1 
ATOM   845  C  C   . ALA A  1 271 ? 31.636  35.875  0.834   1.00 47.18  ? 271 ALA A C   1 
ATOM   846  O  O   . ALA A  1 271 ? 32.054  35.193  -0.106  1.00 44.30  ? 271 ALA A O   1 
ATOM   847  C  CB  . ALA A  1 271 ? 32.228  34.714  2.966   1.00 46.74  ? 271 ALA A CB  1 
ATOM   848  N  N   . VAL A  1 272 ? 31.619  37.207  0.823   1.00 50.96  ? 272 VAL A N   1 
ATOM   849  C  CA  . VAL A  1 272 ? 32.138  37.996  -0.303  1.00 50.70  ? 272 VAL A CA  1 
ATOM   850  C  C   . VAL A  1 272 ? 33.502  38.581  0.068   1.00 45.64  ? 272 VAL A C   1 
ATOM   851  O  O   . VAL A  1 272 ? 33.612  39.343  1.029   1.00 43.83  ? 272 VAL A O   1 
ATOM   852  C  CB  . VAL A  1 272 ? 31.176  39.140  -0.715  1.00 51.20  ? 272 VAL A CB  1 
ATOM   853  C  CG1 . VAL A  1 272 ? 31.722  39.925  -1.908  1.00 49.56  ? 272 VAL A CG1 1 
ATOM   854  C  CG2 . VAL A  1 272 ? 29.795  38.591  -1.046  1.00 49.15  ? 272 VAL A CG2 1 
ATOM   855  N  N   . MET A  1 273 ? 34.529  38.207  -0.694  1.00 45.10  ? 273 MET A N   1 
ATOM   856  C  CA  . MET A  1 273 ? 35.865  38.799  -0.588  1.00 44.67  ? 273 MET A CA  1 
ATOM   857  C  C   . MET A  1 273 ? 36.052  39.811  -1.718  1.00 41.38  ? 273 MET A C   1 
ATOM   858  O  O   . MET A  1 273 ? 36.034  39.439  -2.891  1.00 42.52  ? 273 MET A O   1 
ATOM   859  C  CB  . MET A  1 273 ? 36.939  37.715  -0.674  1.00 45.88  ? 273 MET A CB  1 
ATOM   860  C  CG  . MET A  1 273 ? 36.898  36.718  0.474   1.00 48.95  ? 273 MET A CG  1 
ATOM   861  S  SD  . MET A  1 273 ? 38.279  35.556  0.481   1.00 47.94  ? 273 MET A SD  1 
ATOM   862  C  CE  . MET A  1 273 ? 39.645  36.615  0.948   1.00 50.31  ? 273 MET A CE  1 
ATOM   863  N  N   . LEU A  1 274 ? 36.238  41.081  -1.358  1.00 40.37  ? 274 LEU A N   1 
ATOM   864  C  CA  . LEU A  1 274 ? 36.309  42.181  -2.327  1.00 40.29  ? 274 LEU A CA  1 
ATOM   865  C  C   . LEU A  1 274 ? 37.732  42.742  -2.452  1.00 40.54  ? 274 LEU A C   1 
ATOM   866  O  O   . LEU A  1 274 ? 38.255  43.345  -1.511  1.00 40.45  ? 274 LEU A O   1 
ATOM   867  C  CB  . LEU A  1 274 ? 35.329  43.282  -1.918  1.00 40.33  ? 274 LEU A CB  1 
ATOM   868  C  CG  . LEU A  1 274 ? 34.960  44.323  -2.979  1.00 39.13  ? 274 LEU A CG  1 
ATOM   869  C  CD1 . LEU A  1 274 ? 33.596  44.925  -2.684  1.00 39.08  ? 274 LEU A CD1 1 
ATOM   870  C  CD2 . LEU A  1 274 ? 35.996  45.429  -3.062  1.00 43.57  ? 274 LEU A CD2 1 
ATOM   871  N  N   . TRP A  1 275 ? 38.334  42.556  -3.629  1.00 42.10  ? 275 TRP A N   1 
ATOM   872  C  CA  . TRP A  1 275 ? 39.706  42.995  -3.903  1.00 42.17  ? 275 TRP A CA  1 
ATOM   873  C  C   . TRP A  1 275 ? 39.769  44.431  -4.412  1.00 42.79  ? 275 TRP A C   1 
ATOM   874  O  O   . TRP A  1 275 ? 39.137  44.767  -5.416  1.00 52.00  ? 275 TRP A O   1 
ATOM   875  C  CB  . TRP A  1 275 ? 40.378  42.090  -4.936  1.00 44.01  ? 275 TRP A CB  1 
ATOM   876  C  CG  . TRP A  1 275 ? 41.764  42.558  -5.306  1.00 42.79  ? 275 TRP A CG  1 
ATOM   877  C  CD1 . TRP A  1 275 ? 42.153  43.137  -6.480  1.00 44.31  ? 275 TRP A CD1 1 
ATOM   878  C  CD2 . TRP A  1 275 ? 42.930  42.508  -4.480  1.00 40.90  ? 275 TRP A CD2 1 
ATOM   879  N  NE1 . TRP A  1 275 ? 43.494  43.436  -6.441  1.00 41.72  ? 275 TRP A NE1 1 
ATOM   880  C  CE2 . TRP A  1 275 ? 43.997  43.057  -5.224  1.00 42.57  ? 275 TRP A CE2 1 
ATOM   881  C  CE3 . TRP A  1 275 ? 43.183  42.030  -3.188  1.00 41.18  ? 275 TRP A CE3 1 
ATOM   882  C  CZ2 . TRP A  1 275 ? 45.297  43.154  -4.711  1.00 45.62  ? 275 TRP A CZ2 1 
ATOM   883  C  CZ3 . TRP A  1 275 ? 44.475  42.125  -2.677  1.00 45.11  ? 275 TRP A CZ3 1 
ATOM   884  C  CH2 . TRP A  1 275 ? 45.514  42.685  -3.440  1.00 46.67  ? 275 TRP A CH2 1 
ATOM   885  N  N   . ILE A  1 276 ? 40.553  45.258  -3.725  1.00 43.80  ? 276 ILE A N   1 
ATOM   886  C  CA  . ILE A  1 276 ? 40.882  46.610  -4.176  1.00 46.27  ? 276 ILE A CA  1 
ATOM   887  C  C   . ILE A  1 276 ? 42.379  46.601  -4.462  1.00 47.51  ? 276 ILE A C   1 
ATOM   888  O  O   . ILE A  1 276 ? 43.180  46.314  -3.569  1.00 50.59  ? 276 ILE A O   1 
ATOM   889  C  CB  . ILE A  1 276 ? 40.531  47.681  -3.118  1.00 49.08  ? 276 ILE A CB  1 
ATOM   890  C  CG1 . ILE A  1 276 ? 39.039  47.613  -2.767  1.00 54.62  ? 276 ILE A CG1 1 
ATOM   891  C  CG2 . ILE A  1 276 ? 40.876  49.082  -3.624  1.00 48.12  ? 276 ILE A CG2 1 
ATOM   892  C  CD1 . ILE A  1 276 ? 38.633  48.447  -1.569  1.00 63.83  ? 276 ILE A CD1 1 
ATOM   893  N  N   . PHE A  1 277 ? 42.748  46.900  -5.707  1.00 47.93  ? 277 PHE A N   1 
ATOM   894  C  CA  . PHE A  1 277 ? 44.152  46.824  -6.135  1.00 44.50  ? 277 PHE A CA  1 
ATOM   895  C  C   . PHE A  1 277 ? 44.999  47.965  -5.579  1.00 44.05  ? 277 PHE A C   1 
ATOM   896  O  O   . PHE A  1 277 ? 44.476  48.956  -5.061  1.00 41.51  ? 277 PHE A O   1 
ATOM   897  C  CB  . PHE A  1 277 ? 44.278  46.760  -7.670  1.00 44.61  ? 277 PHE A CB  1 
ATOM   898  C  CG  . PHE A  1 277 ? 43.898  48.033  -8.383  1.00 42.37  ? 277 PHE A CG  1 
ATOM   899  C  CD1 . PHE A  1 277 ? 44.791  49.102  -8.473  1.00 41.37  ? 277 PHE A CD1 1 
ATOM   900  C  CD2 . PHE A  1 277 ? 42.656  48.153  -8.993  1.00 43.64  ? 277 PHE A CD2 1 
ATOM   901  C  CE1 . PHE A  1 277 ? 44.436  50.269  -9.133  1.00 43.12  ? 277 PHE A CE1 1 
ATOM   902  C  CE2 . PHE A  1 277 ? 42.302  49.316  -9.659  1.00 44.60  ? 277 PHE A CE2 1 
ATOM   903  C  CZ  . PHE A  1 277 ? 43.192  50.376  -9.731  1.00 43.54  ? 277 PHE A CZ  1 
ATOM   904  N  N   . GLY A  1 278 ? 46.313  47.802  -5.716  1.00 46.68  ? 278 GLY A N   1 
ATOM   905  C  CA  . GLY A  1 278 ? 47.294  48.810  -5.319  1.00 46.12  ? 278 GLY A CA  1 
ATOM   906  C  C   . GLY A  1 278 ? 48.234  49.192  -6.448  1.00 45.45  ? 278 GLY A C   1 
ATOM   907  O  O   . GLY A  1 278 ? 48.591  48.361  -7.288  1.00 49.55  ? 278 GLY A O   1 
ATOM   908  N  N   . GLY A  1 279 ? 48.618  50.464  -6.473  1.00 43.87  ? 279 GLY A N   1 
ATOM   909  C  CA  . GLY A  1 279 ? 49.712  50.938  -7.322  1.00 44.72  ? 279 GLY A CA  1 
ATOM   910  C  C   . GLY A  1 279 ? 50.180  52.332  -6.944  1.00 46.75  ? 279 GLY A C   1 
ATOM   911  O  O   . GLY A  1 279 ? 50.407  53.166  -7.820  1.00 50.59  ? 279 GLY A O   1 
ATOM   912  N  N   . GLY A  1 280 ? 50.327  52.576  -5.640  1.00 46.01  ? 280 GLY A N   1 
ATOM   913  C  CA  . GLY A  1 280 ? 50.663  53.902  -5.096  1.00 45.18  ? 280 GLY A CA  1 
ATOM   914  C  C   . GLY A  1 280 ? 49.716  55.031  -5.469  1.00 45.23  ? 280 GLY A C   1 
ATOM   915  O  O   . GLY A  1 280 ? 50.120  56.195  -5.497  1.00 46.44  ? 280 GLY A O   1 
ATOM   916  N  N   . PHE A  1 281 ? 48.456  54.681  -5.740  1.00 44.00  ? 281 PHE A N   1 
ATOM   917  C  CA  . PHE A  1 281 ? 47.455  55.595  -6.320  1.00 43.12  ? 281 PHE A CA  1 
ATOM   918  C  C   . PHE A  1 281 ? 47.917  56.303  -7.614  1.00 44.70  ? 281 PHE A C   1 
ATOM   919  O  O   . PHE A  1 281 ? 47.534  57.449  -7.864  1.00 51.75  ? 281 PHE A O   1 
ATOM   920  C  CB  . PHE A  1 281 ? 46.996  56.638  -5.288  1.00 43.43  ? 281 PHE A CB  1 
ATOM   921  C  CG  . PHE A  1 281 ? 46.371  56.052  -4.050  1.00 41.82  ? 281 PHE A CG  1 
ATOM   922  C  CD1 . PHE A  1 281 ? 45.044  55.632  -4.058  1.00 43.57  ? 281 PHE A CD1 1 
ATOM   923  C  CD2 . PHE A  1 281 ? 47.094  55.949  -2.865  1.00 45.18  ? 281 PHE A CD2 1 
ATOM   924  C  CE1 . PHE A  1 281 ? 44.455  55.104  -2.916  1.00 43.36  ? 281 PHE A CE1 1 
ATOM   925  C  CE2 . PHE A  1 281 ? 46.511  55.422  -1.719  1.00 45.51  ? 281 PHE A CE2 1 
ATOM   926  C  CZ  . PHE A  1 281 ? 45.190  54.999  -1.745  1.00 43.80  ? 281 PHE A CZ  1 
ATOM   927  N  N   . TYR A  1 282 ? 48.742  55.629  -8.419  1.00 43.47  ? 282 TYR A N   1 
ATOM   928  C  CA  . TYR A  1 282 ? 49.116  56.108  -9.771  1.00 44.16  ? 282 TYR A CA  1 
ATOM   929  C  C   . TYR A  1 282 ? 48.989  55.055  -10.891 1.00 44.26  ? 282 TYR A C   1 
ATOM   930  O  O   . TYR A  1 282 ? 49.169  55.381  -12.070 1.00 44.40  ? 282 TYR A O   1 
ATOM   931  C  CB  . TYR A  1 282 ? 50.541  56.694  -9.763  1.00 43.75  ? 282 TYR A CB  1 
ATOM   932  C  CG  . TYR A  1 282 ? 51.645  55.700  -9.438  1.00 47.53  ? 282 TYR A CG  1 
ATOM   933  C  CD1 . TYR A  1 282 ? 52.158  54.842  -10.415 1.00 49.81  ? 282 TYR A CD1 1 
ATOM   934  C  CD2 . TYR A  1 282 ? 52.193  55.632  -8.158  1.00 53.21  ? 282 TYR A CD2 1 
ATOM   935  C  CE1 . TYR A  1 282 ? 53.166  53.932  -10.120 1.00 49.27  ? 282 TYR A CE1 1 
ATOM   936  C  CE2 . TYR A  1 282 ? 53.201  54.726  -7.855  1.00 53.82  ? 282 TYR A CE2 1 
ATOM   937  C  CZ  . TYR A  1 282 ? 53.684  53.879  -8.837  1.00 52.15  ? 282 TYR A CZ  1 
ATOM   938  O  OH  . TYR A  1 282 ? 54.685  52.983  -8.537  1.00 55.20  ? 282 TYR A OH  1 
ATOM   939  N  N   . SER A  1 283 ? 48.680  53.813  -10.525 1.00 40.63  ? 283 SER A N   1 
ATOM   940  C  CA  . SER A  1 283 ? 48.745  52.681  -11.445 1.00 44.32  ? 283 SER A CA  1 
ATOM   941  C  C   . SER A  1 283 ? 47.973  51.502  -10.874 1.00 44.71  ? 283 SER A C   1 
ATOM   942  O  O   . SER A  1 283 ? 47.438  51.574  -9.765  1.00 53.81  ? 283 SER A O   1 
ATOM   943  C  CB  . SER A  1 283 ? 50.205  52.278  -11.688 1.00 45.48  ? 283 SER A CB  1 
ATOM   944  O  OG  . SER A  1 283 ? 50.830  51.866  -10.483 1.00 43.35  ? 283 SER A OG  1 
ATOM   945  N  N   . GLY A  1 284 ? 47.920  50.427  -11.651 1.00 42.09  ? 284 GLY A N   1 
ATOM   946  C  CA  . GLY A  1 284 ? 47.283  49.183  -11.241 1.00 42.96  ? 284 GLY A CA  1 
ATOM   947  C  C   . GLY A  1 284 ? 45.920  49.012  -11.874 1.00 43.29  ? 284 GLY A C   1 
ATOM   948  O  O   . GLY A  1 284 ? 45.326  49.967  -12.383 1.00 41.10  ? 284 GLY A O   1 
ATOM   949  N  N   . THR A  1 285 ? 45.432  47.779  -11.829 1.00 50.04  ? 285 THR A N   1 
ATOM   950  C  CA  . THR A  1 285 ? 44.128  47.423  -12.382 1.00 51.44  ? 285 THR A CA  1 
ATOM   951  C  C   . THR A  1 285 ? 43.692  46.048  -11.878 1.00 49.32  ? 285 THR A C   1 
ATOM   952  O  O   . THR A  1 285 ? 44.524  45.178  -11.626 1.00 45.04  ? 285 THR A O   1 
ATOM   953  C  CB  . THR A  1 285 ? 44.130  47.448  -13.934 1.00 53.89  ? 285 THR A CB  1 
ATOM   954  O  OG1 . THR A  1 285 ? 42.887  46.935  -14.434 1.00 54.80  ? 285 THR A OG1 1 
ATOM   955  C  CG2 . THR A  1 285 ? 45.283  46.626  -14.519 1.00 54.13  ? 285 THR A CG2 1 
ATOM   956  N  N   . ALA A  1 286 ? 42.382  45.864  -11.743 1.00 49.46  ? 286 ALA A N   1 
ATOM   957  C  CA  . ALA A  1 286 ? 41.796  44.579  -11.335 1.00 51.75  ? 286 ALA A CA  1 
ATOM   958  C  C   . ALA A  1 286 ? 41.993  43.433  -12.346 1.00 52.19  ? 286 ALA A C   1 
ATOM   959  O  O   . ALA A  1 286 ? 41.967  42.260  -11.965 1.00 50.77  ? 286 ALA A O   1 
ATOM   960  C  CB  . ALA A  1 286 ? 40.314  44.763  -11.046 1.00 54.14  ? 286 ALA A CB  1 
ATOM   961  N  N   . THR A  1 287 ? 42.194  43.777  -13.619 1.00 51.15  ? 287 THR A N   1 
ATOM   962  C  CA  . THR A  1 287 ? 42.287  42.799  -14.714 1.00 50.64  ? 287 THR A CA  1 
ATOM   963  C  C   . THR A  1 287 ? 43.627  42.059  -14.865 1.00 52.40  ? 287 THR A C   1 
ATOM   964  O  O   . THR A  1 287 ? 43.746  41.186  -15.731 1.00 57.54  ? 287 THR A O   1 
ATOM   965  C  CB  . THR A  1 287 ? 41.962  43.472  -16.061 1.00 49.72  ? 287 THR A CB  1 
ATOM   966  O  OG1 . THR A  1 287 ? 42.862  44.564  -16.287 1.00 51.18  ? 287 THR A OG1 1 
ATOM   967  C  CG2 . THR A  1 287 ? 40.534  43.977  -16.061 1.00 47.04  ? 287 THR A CG2 1 
ATOM   968  N  N   . LEU A  1 288 ? 44.625  42.405  -14.049 1.00 53.41  ? 288 LEU A N   1 
ATOM   969  C  CA  . LEU A  1 288 ? 45.906  41.681  -14.029 1.00 49.50  ? 288 LEU A CA  1 
ATOM   970  C  C   . LEU A  1 288 ? 45.723  40.194  -13.731 1.00 52.17  ? 288 LEU A C   1 
ATOM   971  O  O   . LEU A  1 288 ? 44.815  39.804  -12.992 1.00 57.80  ? 288 LEU A O   1 
ATOM   972  C  CB  . LEU A  1 288 ? 46.856  42.268  -12.981 1.00 44.70  ? 288 LEU A CB  1 
ATOM   973  C  CG  . LEU A  1 288 ? 47.331  43.715  -13.113 1.00 43.49  ? 288 LEU A CG  1 
ATOM   974  C  CD1 . LEU A  1 288 ? 48.318  44.005  -11.995 1.00 44.15  ? 288 LEU A CD1 1 
ATOM   975  C  CD2 . LEU A  1 288 ? 47.969  44.006  -14.463 1.00 47.17  ? 288 LEU A CD2 1 
ATOM   976  N  N   . ASP A  1 289 ? 46.600  39.377  -14.309 1.00 50.91  ? 289 ASP A N   1 
ATOM   977  C  CA  . ASP A  1 289 ? 46.570  37.924  -14.111 1.00 50.96  ? 289 ASP A CA  1 
ATOM   978  C  C   . ASP A  1 289 ? 46.999  37.487  -12.705 1.00 50.62  ? 289 ASP A C   1 
ATOM   979  O  O   . ASP A  1 289 ? 46.623  36.401  -12.262 1.00 52.47  ? 289 ASP A O   1 
ATOM   980  C  CB  . ASP A  1 289 ? 47.442  37.225  -15.156 1.00 52.95  ? 289 ASP A CB  1 
ATOM   981  C  CG  . ASP A  1 289 ? 46.935  37.426  -16.573 1.00 51.21  ? 289 ASP A CG  1 
ATOM   982  O  OD1 . ASP A  1 289 ? 45.728  37.210  -16.819 1.00 54.81  ? 289 ASP A OD1 1 
ATOM   983  O  OD2 . ASP A  1 289 ? 47.747  37.791  -17.448 1.00 51.06  ? 289 ASP A OD2 1 
ATOM   984  N  N   . VAL A  1 290 ? 47.796  38.311  -12.022 1.00 48.18  ? 290 VAL A N   1 
ATOM   985  C  CA  . VAL A  1 290 ? 48.130  38.066  -10.599 1.00 51.79  ? 290 VAL A CA  1 
ATOM   986  C  C   . VAL A  1 290 ? 46.911  38.108  -9.668  1.00 52.35  ? 290 VAL A C   1 
ATOM   987  O  O   . VAL A  1 290 ? 46.903  37.437  -8.634  1.00 53.75  ? 290 VAL A O   1 
ATOM   988  C  CB  . VAL A  1 290 ? 49.229  39.012  -10.038 1.00 53.84  ? 290 VAL A CB  1 
ATOM   989  C  CG1 . VAL A  1 290 ? 50.574  38.699  -10.672 1.00 59.89  ? 290 VAL A CG1 1 
ATOM   990  C  CG2 . VAL A  1 290 ? 48.873  40.487  -10.202 1.00 56.44  ? 290 VAL A CG2 1 
ATOM   991  N  N   . TYR A  1 291 ? 45.894  38.887  -10.042 1.00 51.11  ? 291 TYR A N   1 
ATOM   992  C  CA  . TYR A  1 291 ? 44.644  38.980  -9.281  1.00 52.37  ? 291 TYR A CA  1 
ATOM   993  C  C   . TYR A  1 291 ? 43.544  38.051  -9.819  1.00 54.90  ? 291 TYR A C   1 
ATOM   994  O  O   . TYR A  1 291 ? 42.369  38.417  -9.786  1.00 58.77  ? 291 TYR A O   1 
ATOM   995  C  CB  . TYR A  1 291 ? 44.111  40.426  -9.288  1.00 50.39  ? 291 TYR A CB  1 
ATOM   996  C  CG  . TYR A  1 291 ? 45.097  41.513  -8.904  1.00 47.63  ? 291 TYR A CG  1 
ATOM   997  C  CD1 . TYR A  1 291 ? 46.042  41.317  -7.895  1.00 46.24  ? 291 TYR A CD1 1 
ATOM   998  C  CD2 . TYR A  1 291 ? 45.053  42.765  -9.526  1.00 47.34  ? 291 TYR A CD2 1 
ATOM   999  C  CE1 . TYR A  1 291 ? 46.933  42.325  -7.546  1.00 46.18  ? 291 TYR A CE1 1 
ATOM   1000 C  CE2 . TYR A  1 291 ? 45.938  43.776  -9.172  1.00 45.72  ? 291 TYR A CE2 1 
ATOM   1001 C  CZ  . TYR A  1 291 ? 46.875  43.551  -8.184  1.00 46.32  ? 291 TYR A CZ  1 
ATOM   1002 O  OH  . TYR A  1 291 ? 47.754  44.549  -7.832  1.00 46.05  ? 291 TYR A OH  1 
ATOM   1003 N  N   . ASP A  1 292 ? 43.902  36.862  -10.308 1.00 54.51  ? 292 ASP A N   1 
ATOM   1004 C  CA  . ASP A  1 292 ? 42.902  35.959  -10.892 1.00 61.18  ? 292 ASP A CA  1 
ATOM   1005 C  C   . ASP A  1 292 ? 42.023  35.378  -9.781  1.00 60.61  ? 292 ASP A C   1 
ATOM   1006 O  O   . ASP A  1 292 ? 42.530  34.839  -8.793  1.00 59.92  ? 292 ASP A O   1 
ATOM   1007 C  CB  . ASP A  1 292 ? 43.560  34.836  -11.709 1.00 69.68  ? 292 ASP A CB  1 
ATOM   1008 C  CG  . ASP A  1 292 ? 42.599  34.180  -12.709 1.00 76.17  ? 292 ASP A CG  1 
ATOM   1009 O  OD1 . ASP A  1 292 ? 41.433  34.617  -12.836 1.00 76.77  ? 292 ASP A OD1 1 
ATOM   1010 O  OD2 . ASP A  1 292 ? 43.024  33.217  -13.382 1.00 80.40  ? 292 ASP A OD2 1 
ATOM   1011 N  N   . HIS A  1 293 ? 40.709  35.497  -9.960  1.00 58.97  ? 293 HIS A N   1 
ATOM   1012 C  CA  . HIS A  1 293 ? 39.730  35.155  -8.918  1.00 56.01  ? 293 HIS A CA  1 
ATOM   1013 C  C   . HIS A  1 293 ? 39.326  33.681  -8.896  1.00 54.98  ? 293 HIS A C   1 
ATOM   1014 O  O   . HIS A  1 293 ? 38.784  33.207  -7.895  1.00 60.87  ? 293 HIS A O   1 
ATOM   1015 C  CB  . HIS A  1 293 ? 38.449  35.977  -9.087  1.00 54.40  ? 293 HIS A CB  1 
ATOM   1016 C  CG  . HIS A  1 293 ? 38.674  37.449  -9.235  1.00 49.72  ? 293 HIS A CG  1 
ATOM   1017 N  ND1 . HIS A  1 293 ? 39.777  38.094  -8.718  1.00 49.37  ? 293 HIS A ND1 1 
ATOM   1018 C  CD2 . HIS A  1 293 ? 37.924  38.404  -9.832  1.00 48.99  ? 293 HIS A CD2 1 
ATOM   1019 C  CE1 . HIS A  1 293 ? 39.701  39.382  -9.001  1.00 51.17  ? 293 HIS A CE1 1 
ATOM   1020 N  NE2 . HIS A  1 293 ? 38.588  39.596  -9.677  1.00 48.60  ? 293 HIS A NE2 1 
ATOM   1021 N  N   . ARG A  1 294 ? 39.576  32.972  -9.995  1.00 52.43  ? 294 ARG A N   1 
ATOM   1022 C  CA  . ARG A  1 294 ? 39.042  31.616  -10.198 1.00 51.88  ? 294 ARG A CA  1 
ATOM   1023 C  C   . ARG A  1 294 ? 39.533  30.609  -9.152  1.00 45.48  ? 294 ARG A C   1 
ATOM   1024 O  O   . ARG A  1 294 ? 38.786  29.716  -8.746  1.00 46.63  ? 294 ARG A O   1 
ATOM   1025 C  CB  . ARG A  1 294 ? 39.374  31.103  -11.604 1.00 55.14  ? 294 ARG A CB  1 
ATOM   1026 C  CG  . ARG A  1 294 ? 38.985  32.045  -12.740 1.00 56.06  ? 294 ARG A CG  1 
ATOM   1027 C  CD  . ARG A  1 294 ? 38.741  31.305  -14.045 1.00 61.56  ? 294 ARG A CD  1 
ATOM   1028 N  NE  . ARG A  1 294 ? 39.182  32.064  -15.219 1.00 69.77  ? 294 ARG A NE  1 
ATOM   1029 C  CZ  . ARG A  1 294 ? 40.367  31.949  -15.831 1.00 72.71  ? 294 ARG A CZ  1 
ATOM   1030 N  NH1 . ARG A  1 294 ? 41.302  31.097  -15.403 1.00 68.70  ? 294 ARG A NH1 1 
ATOM   1031 N  NH2 . ARG A  1 294 ? 40.623  32.705  -16.897 1.00 73.53  ? 294 ARG A NH2 1 
ATOM   1032 N  N   . ALA A  1 295 ? 40.783  30.769  -8.724  1.00 45.03  ? 295 ALA A N   1 
ATOM   1033 C  CA  . ALA A  1 295 ? 41.393  29.912  -7.706  1.00 43.83  ? 295 ALA A CA  1 
ATOM   1034 C  C   . ALA A  1 295 ? 40.797  30.170  -6.328  1.00 43.60  ? 295 ALA A C   1 
ATOM   1035 O  O   . ALA A  1 295 ? 40.338  29.244  -5.659  1.00 43.92  ? 295 ALA A O   1 
ATOM   1036 C  CB  . ALA A  1 295 ? 42.892  30.146  -7.666  1.00 44.27  ? 295 ALA A CB  1 
ATOM   1037 N  N   . LEU A  1 296 ? 40.819  31.434  -5.916  1.00 45.03  ? 296 LEU A N   1 
ATOM   1038 C  CA  . LEU A  1 296 ? 40.309  31.849  -4.606  1.00 42.00  ? 296 LEU A CA  1 
ATOM   1039 C  C   . LEU A  1 296 ? 38.809  31.586  -4.435  1.00 40.31  ? 296 LEU A C   1 
ATOM   1040 O  O   . LEU A  1 296 ? 38.359  31.277  -3.333  1.00 38.53  ? 296 LEU A O   1 
ATOM   1041 C  CB  . LEU A  1 296 ? 40.626  33.329  -4.359  1.00 41.86  ? 296 LEU A CB  1 
ATOM   1042 C  CG  . LEU A  1 296 ? 40.284  33.910  -2.980  1.00 43.55  ? 296 LEU A CG  1 
ATOM   1043 C  CD1 . LEU A  1 296 ? 41.082  33.242  -1.869  1.00 44.65  ? 296 LEU A CD1 1 
ATOM   1044 C  CD2 . LEU A  1 296 ? 40.524  35.411  -2.970  1.00 44.74  ? 296 LEU A CD2 1 
ATOM   1045 N  N   . ALA A  1 297 ? 38.051  31.708  -5.522  1.00 41.30  ? 297 ALA A N   1 
ATOM   1046 C  CA  . ALA A  1 297 ? 36.610  31.437  -5.512  1.00 43.65  ? 297 ALA A CA  1 
ATOM   1047 C  C   . ALA A  1 297 ? 36.295  29.947  -5.374  1.00 44.14  ? 297 ALA A C   1 
ATOM   1048 O  O   . ALA A  1 297 ? 35.542  29.543  -4.485  1.00 41.00  ? 297 ALA A O   1 
ATOM   1049 C  CB  . ALA A  1 297 ? 35.968  31.984  -6.777  1.00 45.04  ? 297 ALA A CB  1 
ATOM   1050 N  N   . SER A  1 298 ? 36.875  29.147  -6.265  1.00 45.32  ? 298 SER A N   1 
ATOM   1051 C  CA  . SER A  1 298 ? 36.589  27.710  -6.339  1.00 47.30  ? 298 SER A CA  1 
ATOM   1052 C  C   . SER A  1 298 ? 37.145  26.916  -5.156  1.00 49.92  ? 298 SER A C   1 
ATOM   1053 O  O   . SER A  1 298 ? 36.446  26.072  -4.592  1.00 59.65  ? 298 SER A O   1 
ATOM   1054 C  CB  . SER A  1 298 ? 37.134  27.126  -7.645  1.00 46.85  ? 298 SER A CB  1 
ATOM   1055 O  OG  . SER A  1 298 ? 38.546  27.228  -7.708  1.00 50.94  ? 298 SER A OG  1 
ATOM   1056 N  N   . GLU A  1 299 ? 38.397  27.188  -4.794  1.00 50.94  ? 299 GLU A N   1 
ATOM   1057 C  CA  . GLU A  1 299 ? 39.085  26.440  -3.733  1.00 51.37  ? 299 GLU A CA  1 
ATOM   1058 C  C   . GLU A  1 299 ? 38.556  26.730  -2.319  1.00 51.08  ? 299 GLU A C   1 
ATOM   1059 O  O   . GLU A  1 299 ? 38.616  25.858  -1.449  1.00 52.69  ? 299 GLU A O   1 
ATOM   1060 C  CB  . GLU A  1 299 ? 40.596  26.703  -3.780  1.00 49.92  ? 299 GLU A CB  1 
ATOM   1061 C  CG  . GLU A  1 299 ? 41.446  25.561  -3.225  1.00 51.47  ? 299 GLU A CG  1 
ATOM   1062 C  CD  . GLU A  1 299 ? 41.890  24.549  -4.274  1.00 52.36  ? 299 GLU A CD  1 
ATOM   1063 O  OE1 . GLU A  1 299 ? 41.241  24.430  -5.338  1.00 48.16  ? 299 GLU A OE1 1 
ATOM   1064 O  OE2 . GLU A  1 299 ? 42.898  23.854  -4.027  1.00 48.50  ? 299 GLU A OE2 1 
ATOM   1065 N  N   . GLU A  1 300 ? 38.045  27.943  -2.102  1.00 56.52  ? 300 GLU A N   1 
ATOM   1066 C  CA  . GLU A  1 300 ? 37.599  28.395  -0.768  1.00 57.05  ? 300 GLU A CA  1 
ATOM   1067 C  C   . GLU A  1 300 ? 36.089  28.630  -0.599  1.00 58.98  ? 300 GLU A C   1 
ATOM   1068 O  O   . GLU A  1 300 ? 35.639  28.898  0.518   1.00 62.81  ? 300 GLU A O   1 
ATOM   1069 C  CB  . GLU A  1 300 ? 38.343  29.678  -0.380  1.00 56.68  ? 300 GLU A CB  1 
ATOM   1070 C  CG  . GLU A  1 300 ? 39.862  29.611  -0.519  1.00 59.22  ? 300 GLU A CG  1 
ATOM   1071 C  CD  . GLU A  1 300 ? 40.490  28.486  0.285   1.00 59.52  ? 300 GLU A CD  1 
ATOM   1072 O  OE1 . GLU A  1 300 ? 39.993  28.189  1.389   1.00 59.30  ? 300 GLU A OE1 1 
ATOM   1073 O  OE2 . GLU A  1 300 ? 41.485  27.899  -0.189  1.00 57.08  ? 300 GLU A OE2 1 
ATOM   1074 N  N   . ASN A  1 301 ? 35.324  28.532  -1.688  1.00 60.47  ? 301 ASN A N   1 
ATOM   1075 C  CA  . ASN A  1 301 ? 33.864  28.754  -1.690  1.00 60.99  ? 301 ASN A CA  1 
ATOM   1076 C  C   . ASN A  1 301 ? 33.483  30.157  -1.199  1.00 56.71  ? 301 ASN A C   1 
ATOM   1077 O  O   . ASN A  1 301 ? 32.813  30.321  -0.175  1.00 65.00  ? 301 ASN A O   1 
ATOM   1078 C  CB  . ASN A  1 301 ? 33.124  27.651  -0.909  1.00 62.41  ? 301 ASN A CB  1 
ATOM   1079 C  CG  . ASN A  1 301 ? 33.138  26.318  -1.634  1.00 70.73  ? 301 ASN A CG  1 
ATOM   1080 O  OD1 . ASN A  1 301 ? 32.655  26.207  -2.761  1.00 77.47  ? 301 ASN A OD1 1 
ATOM   1081 N  ND2 . ASN A  1 301 ? 33.684  25.294  -0.986  1.00 71.78  ? 301 ASN A ND2 1 
ATOM   1082 N  N   . VAL A  1 302 ? 33.947  31.158  -1.944  1.00 49.36  ? 302 VAL A N   1 
ATOM   1083 C  CA  . VAL A  1 302 ? 33.612  32.566  -1.699  1.00 48.82  ? 302 VAL A CA  1 
ATOM   1084 C  C   . VAL A  1 302 ? 33.351  33.297  -3.012  1.00 46.32  ? 302 VAL A C   1 
ATOM   1085 O  O   . VAL A  1 302 ? 33.896  32.933  -4.057  1.00 42.19  ? 302 VAL A O   1 
ATOM   1086 C  CB  . VAL A  1 302 ? 34.728  33.317  -0.929  1.00 48.61  ? 302 VAL A CB  1 
ATOM   1087 C  CG1 . VAL A  1 302 ? 34.924  32.727  0.461   1.00 48.85  ? 302 VAL A CG1 1 
ATOM   1088 C  CG2 . VAL A  1 302 ? 36.042  33.326  -1.706  1.00 49.03  ? 302 VAL A CG2 1 
ATOM   1089 N  N   . ILE A  1 303 ? 32.529  34.339  -2.940  1.00 45.04  ? 303 ILE A N   1 
ATOM   1090 C  CA  . ILE A  1 303 ? 32.296  35.219  -4.081  1.00 46.03  ? 303 ILE A CA  1 
ATOM   1091 C  C   . ILE A  1 303 ? 33.449  36.219  -4.103  1.00 50.67  ? 303 ILE A C   1 
ATOM   1092 O  O   . ILE A  1 303 ? 33.492  37.144  -3.290  1.00 59.53  ? 303 ILE A O   1 
ATOM   1093 C  CB  . ILE A  1 303 ? 30.949  35.981  -3.976  1.00 47.48  ? 303 ILE A CB  1 
ATOM   1094 C  CG1 . ILE A  1 303 ? 29.771  35.027  -3.711  1.00 50.34  ? 303 ILE A CG1 1 
ATOM   1095 C  CG2 . ILE A  1 303 ? 30.694  36.813  -5.230  1.00 44.94  ? 303 ILE A CG2 1 
ATOM   1096 C  CD1 . ILE A  1 303 ? 29.589  33.912  -4.720  1.00 50.01  ? 303 ILE A CD1 1 
ATOM   1097 N  N   . VAL A  1 304 ? 34.392  36.018  -5.019  1.00 50.03  ? 304 VAL A N   1 
ATOM   1098 C  CA  . VAL A  1 304 ? 35.504  36.952  -5.184  1.00 49.62  ? 304 VAL A CA  1 
ATOM   1099 C  C   . VAL A  1 304 ? 35.060  38.081  -6.119  1.00 48.98  ? 304 VAL A C   1 
ATOM   1100 O  O   . VAL A  1 304 ? 34.606  37.827  -7.237  1.00 56.77  ? 304 VAL A O   1 
ATOM   1101 C  CB  . VAL A  1 304 ? 36.776  36.260  -5.715  1.00 50.59  ? 304 VAL A CB  1 
ATOM   1102 C  CG1 . VAL A  1 304 ? 37.941  37.242  -5.792  1.00 52.02  ? 304 VAL A CG1 1 
ATOM   1103 C  CG2 . VAL A  1 304 ? 37.166  35.091  -4.821  1.00 50.24  ? 304 VAL A CG2 1 
ATOM   1104 N  N   . VAL A  1 305 ? 35.191  39.316  -5.636  1.00 48.71  ? 305 VAL A N   1 
ATOM   1105 C  CA  . VAL A  1 305 ? 34.825  40.526  -6.376  1.00 48.33  ? 305 VAL A CA  1 
ATOM   1106 C  C   . VAL A  1 305 ? 36.070  41.401  -6.521  1.00 47.53  ? 305 VAL A C   1 
ATOM   1107 O  O   . VAL A  1 305 ? 36.966  41.361  -5.673  1.00 56.71  ? 305 VAL A O   1 
ATOM   1108 C  CB  . VAL A  1 305 ? 33.717  41.316  -5.633  1.00 51.57  ? 305 VAL A CB  1 
ATOM   1109 C  CG1 . VAL A  1 305 ? 33.309  42.578  -6.390  1.00 54.16  ? 305 VAL A CG1 1 
ATOM   1110 C  CG2 . VAL A  1 305 ? 32.495  40.436  -5.406  1.00 53.58  ? 305 VAL A CG2 1 
ATOM   1111 N  N   . SER A  1 306 ? 36.123  42.181  -7.600  1.00 42.55  ? 306 SER A N   1 
ATOM   1112 C  CA  . SER A  1 306 ? 37.168  43.191  -7.794  1.00 41.07  ? 306 SER A CA  1 
ATOM   1113 C  C   . SER A  1 306 ? 36.609  44.388  -8.544  1.00 43.57  ? 306 SER A C   1 
ATOM   1114 O  O   . SER A  1 306 ? 35.623  44.269  -9.276  1.00 46.64  ? 306 SER A O   1 
ATOM   1115 C  CB  . SER A  1 306 ? 38.372  42.618  -8.545  1.00 40.91  ? 306 SER A CB  1 
ATOM   1116 O  OG  . SER A  1 306 ? 38.032  42.241  -9.869  1.00 39.06  ? 306 SER A OG  1 
ATOM   1117 N  N   . LEU A  1 307 ? 37.257  45.535  -8.358  1.00 44.49  ? 307 LEU A N   1 
ATOM   1118 C  CA  . LEU A  1 307 ? 36.802  46.796  -8.939  1.00 44.01  ? 307 LEU A CA  1 
ATOM   1119 C  C   . LEU A  1 307 ? 37.952  47.611  -9.509  1.00 44.42  ? 307 LEU A C   1 
ATOM   1120 O  O   . LEU A  1 307 ? 39.099  47.491  -9.070  1.00 45.81  ? 307 LEU A O   1 
ATOM   1121 C  CB  . LEU A  1 307 ? 36.058  47.628  -7.889  1.00 46.55  ? 307 LEU A CB  1 
ATOM   1122 C  CG  . LEU A  1 307 ? 36.847  48.097  -6.654  1.00 46.34  ? 307 LEU A CG  1 
ATOM   1123 C  CD1 . LEU A  1 307 ? 37.405  49.504  -6.809  1.00 48.19  ? 307 LEU A CD1 1 
ATOM   1124 C  CD2 . LEU A  1 307 ? 35.965  48.056  -5.422  1.00 47.13  ? 307 LEU A CD2 1 
ATOM   1125 N  N   . GLN A  1 308 ? 37.613  48.447  -10.486 1.00 44.68  ? 308 GLN A N   1 
ATOM   1126 C  CA  . GLN A  1 308 ? 38.504  49.475  -11.002 1.00 43.56  ? 308 GLN A CA  1 
ATOM   1127 C  C   . GLN A  1 308 ? 38.124  50.791  -10.341 1.00 46.19  ? 308 GLN A C   1 
ATOM   1128 O  O   . GLN A  1 308 ? 36.937  51.106  -10.219 1.00 56.07  ? 308 GLN A O   1 
ATOM   1129 C  CB  . GLN A  1 308 ? 38.332  49.633  -12.506 1.00 43.42  ? 308 GLN A CB  1 
ATOM   1130 C  CG  . GLN A  1 308 ? 38.578  48.382  -13.336 1.00 48.26  ? 308 GLN A CG  1 
ATOM   1131 C  CD  . GLN A  1 308 ? 40.038  48.179  -13.694 1.00 52.36  ? 308 GLN A CD  1 
ATOM   1132 O  OE1 . GLN A  1 308 ? 40.932  48.415  -12.878 1.00 58.40  ? 308 GLN A OE1 1 
ATOM   1133 N  NE2 . GLN A  1 308 ? 40.287  47.728  -14.920 1.00 50.31  ? 308 GLN A NE2 1 
ATOM   1134 N  N   . TYR A  1 309 ? 39.129  51.549  -9.913  1.00 45.40  ? 309 TYR A N   1 
ATOM   1135 C  CA  . TYR A  1 309 ? 38.940  52.931  -9.465  1.00 46.42  ? 309 TYR A CA  1 
ATOM   1136 C  C   . TYR A  1 309 ? 39.936  53.836  -10.186 1.00 46.18  ? 309 TYR A C   1 
ATOM   1137 O  O   . TYR A  1 309 ? 41.016  53.382  -10.576 1.00 43.83  ? 309 TYR A O   1 
ATOM   1138 C  CB  . TYR A  1 309 ? 39.085  53.043  -7.939  1.00 43.58  ? 309 TYR A CB  1 
ATOM   1139 C  CG  . TYR A  1 309 ? 40.457  52.705  -7.382  1.00 40.41  ? 309 TYR A CG  1 
ATOM   1140 C  CD1 . TYR A  1 309 ? 40.831  51.383  -7.130  1.00 39.48  ? 309 TYR A CD1 1 
ATOM   1141 C  CD2 . TYR A  1 309 ? 41.377  53.712  -7.081  1.00 37.64  ? 309 TYR A CD2 1 
ATOM   1142 C  CE1 . TYR A  1 309 ? 42.084  51.073  -6.611  1.00 37.77  ? 309 TYR A CE1 1 
ATOM   1143 C  CE2 . TYR A  1 309 ? 42.632  53.413  -6.563  1.00 37.24  ? 309 TYR A CE2 1 
ATOM   1144 C  CZ  . TYR A  1 309 ? 42.983  52.094  -6.329  1.00 36.58  ? 309 TYR A CZ  1 
ATOM   1145 O  OH  . TYR A  1 309 ? 44.225  51.794  -5.815  1.00 32.17  ? 309 TYR A OH  1 
ATOM   1146 N  N   . ARG A  1 310 ? 39.566  55.105  -10.373 1.00 47.22  ? 310 ARG A N   1 
ATOM   1147 C  CA  . ARG A  1 310 ? 40.450  56.083  -11.022 1.00 44.99  ? 310 ARG A CA  1 
ATOM   1148 C  C   . ARG A  1 310 ? 41.710  56.304  -10.200 1.00 42.48  ? 310 ARG A C   1 
ATOM   1149 O  O   . ARG A  1 310 ? 41.653  56.452  -8.978  1.00 41.04  ? 310 ARG A O   1 
ATOM   1150 C  CB  . ARG A  1 310 ? 39.760  57.430  -11.240 1.00 45.41  ? 310 ARG A CB  1 
ATOM   1151 C  CG  . ARG A  1 310 ? 38.984  57.542  -12.538 1.00 44.47  ? 310 ARG A CG  1 
ATOM   1152 C  CD  . ARG A  1 310 ? 38.184  58.829  -12.551 1.00 46.01  ? 310 ARG A CD  1 
ATOM   1153 N  NE  . ARG A  1 310 ? 37.052  58.768  -11.628 1.00 47.66  ? 310 ARG A NE  1 
ATOM   1154 C  CZ  . ARG A  1 310 ? 36.306  59.809  -11.255 1.00 47.10  ? 310 ARG A CZ  1 
ATOM   1155 N  NH1 . ARG A  1 310 ? 36.560  61.035  -11.713 1.00 50.27  ? 310 ARG A NH1 1 
ATOM   1156 N  NH2 . ARG A  1 310 ? 35.294  59.625  -10.409 1.00 44.52  ? 310 ARG A NH2 1 
ATOM   1157 N  N   . VAL A  1 311 ? 42.835  56.353  -10.904 1.00 40.11  ? 311 VAL A N   1 
ATOM   1158 C  CA  . VAL A  1 311 ? 44.163  56.440  -10.301 1.00 37.04  ? 311 VAL A CA  1 
ATOM   1159 C  C   . VAL A  1 311 ? 44.879  57.686  -10.810 1.00 35.24  ? 311 VAL A C   1 
ATOM   1160 O  O   . VAL A  1 311 ? 44.428  58.329  -11.763 1.00 37.61  ? 311 VAL A O   1 
ATOM   1161 C  CB  . VAL A  1 311 ? 45.016  55.173  -10.573 1.00 36.16  ? 311 VAL A CB  1 
ATOM   1162 C  CG1 . VAL A  1 311 ? 44.494  54.003  -9.753  1.00 35.33  ? 311 VAL A CG1 1 
ATOM   1163 C  CG2 . VAL A  1 311 ? 45.055  54.813  -12.057 1.00 37.32  ? 311 VAL A CG2 1 
ATOM   1164 N  N   . ALA A  1 312 ? 45.983  58.017  -10.144 1.00 34.03  ? 312 ALA A N   1 
ATOM   1165 C  CA  . ALA A  1 312 ? 46.833  59.170  -10.478 1.00 35.77  ? 312 ALA A CA  1 
ATOM   1166 C  C   . ALA A  1 312 ? 46.071  60.505  -10.321 1.00 39.13  ? 312 ALA A C   1 
ATOM   1167 O  O   . ALA A  1 312 ? 45.139  60.586  -9.514  1.00 40.66  ? 312 ALA A O   1 
ATOM   1168 C  CB  . ALA A  1 312 ? 47.437  58.990  -11.872 1.00 36.84  ? 312 ALA A CB  1 
ATOM   1169 N  N   . SER A  1 313 ? 46.471  61.542  -11.061 1.00 38.80  ? 313 SER A N   1 
ATOM   1170 C  CA  . SER A  1 313 ? 45.812  62.851  -11.018 1.00 39.32  ? 313 SER A CA  1 
ATOM   1171 C  C   . SER A  1 313 ? 44.356  62.781  -11.460 1.00 39.71  ? 313 SER A C   1 
ATOM   1172 O  O   . SER A  1 313 ? 43.524  63.548  -10.983 1.00 38.54  ? 313 SER A O   1 
ATOM   1173 C  CB  . SER A  1 313 ? 46.556  63.851  -11.904 1.00 38.93  ? 313 SER A CB  1 
ATOM   1174 O  OG  . SER A  1 313 ? 46.587  63.415  -13.253 1.00 36.88  ? 313 SER A OG  1 
ATOM   1175 N  N   . LEU A  1 314 ? 44.054  61.853  -12.364 1.00 41.28  ? 314 LEU A N   1 
ATOM   1176 C  CA  . LEU A  1 314 ? 42.681  61.649  -12.826 1.00 43.70  ? 314 LEU A CA  1 
ATOM   1177 C  C   . LEU A  1 314 ? 41.691  61.215  -11.734 1.00 45.14  ? 314 LEU A C   1 
ATOM   1178 O  O   . LEU A  1 314 ? 40.495  61.480  -11.861 1.00 54.97  ? 314 LEU A O   1 
ATOM   1179 C  CB  . LEU A  1 314 ? 42.657  60.678  -14.013 1.00 37.85  ? 314 LEU A CB  1 
ATOM   1180 C  CG  . LEU A  1 314 ? 43.297  61.242  -15.289 1.00 35.13  ? 314 LEU A CG  1 
ATOM   1181 C  CD1 . LEU A  1 314 ? 43.399  60.166  -16.353 1.00 32.95  ? 314 LEU A CD1 1 
ATOM   1182 C  CD2 . LEU A  1 314 ? 42.536  62.436  -15.850 1.00 35.92  ? 314 LEU A CD2 1 
ATOM   1183 N  N   . GLY A  1 315 ? 42.186  60.574  -10.673 1.00 43.83  ? 315 GLY A N   1 
ATOM   1184 C  CA  . GLY A  1 315 ? 41.361  60.196  -9.514  1.00 41.17  ? 315 GLY A CA  1 
ATOM   1185 C  C   . GLY A  1 315 ? 41.627  60.928  -8.204  1.00 40.45  ? 315 GLY A C   1 
ATOM   1186 O  O   . GLY A  1 315 ? 40.867  60.752  -7.246  1.00 35.51  ? 315 GLY A O   1 
ATOM   1187 N  N   . PHE A  1 316 ? 42.687  61.739  -8.147  1.00 38.80  ? 316 PHE A N   1 
ATOM   1188 C  CA  . PHE A  1 316 ? 43.115  62.401  -6.895  1.00 37.94  ? 316 PHE A CA  1 
ATOM   1189 C  C   . PHE A  1 316 ? 43.662  63.831  -7.056  1.00 39.38  ? 316 PHE A C   1 
ATOM   1190 O  O   . PHE A  1 316 ? 44.474  64.283  -6.239  1.00 44.38  ? 316 PHE A O   1 
ATOM   1191 C  CB  . PHE A  1 316 ? 44.143  61.520  -6.171  1.00 36.77  ? 316 PHE A CB  1 
ATOM   1192 C  CG  . PHE A  1 316 ? 43.600  60.189  -5.751  1.00 35.82  ? 316 PHE A CG  1 
ATOM   1193 C  CD1 . PHE A  1 316 ? 42.789  60.086  -4.630  1.00 35.05  ? 316 PHE A CD1 1 
ATOM   1194 C  CD2 . PHE A  1 316 ? 43.871  59.042  -6.490  1.00 37.92  ? 316 PHE A CD2 1 
ATOM   1195 C  CE1 . PHE A  1 316 ? 42.269  58.861  -4.240  1.00 35.27  ? 316 PHE A CE1 1 
ATOM   1196 C  CE2 . PHE A  1 316 ? 43.352  57.813  -6.108  1.00 36.37  ? 316 PHE A CE2 1 
ATOM   1197 C  CZ  . PHE A  1 316 ? 42.551  57.723  -4.979  1.00 36.65  ? 316 PHE A CZ  1 
ATOM   1198 N  N   . LEU A  1 317 ? 43.207  64.550  -8.086  1.00 39.09  ? 317 LEU A N   1 
ATOM   1199 C  CA  . LEU A  1 317 ? 43.565  65.966  -8.256  1.00 42.23  ? 317 LEU A CA  1 
ATOM   1200 C  C   . LEU A  1 317 ? 42.786  66.772  -7.221  1.00 41.64  ? 317 LEU A C   1 
ATOM   1201 O  O   . LEU A  1 317 ? 41.601  66.510  -6.995  1.00 45.76  ? 317 LEU A O   1 
ATOM   1202 C  CB  . LEU A  1 317 ? 43.224  66.479  -9.663  1.00 46.48  ? 317 LEU A CB  1 
ATOM   1203 C  CG  . LEU A  1 317 ? 43.797  67.856  -10.050 1.00 45.85  ? 317 LEU A CG  1 
ATOM   1204 C  CD1 . LEU A  1 317 ? 45.194  67.722  -10.640 1.00 44.02  ? 317 LEU A CD1 1 
ATOM   1205 C  CD2 . LEU A  1 317 ? 42.894  68.594  -11.029 1.00 47.20  ? 317 LEU A CD2 1 
ATOM   1206 N  N   . PHE A  1 318 ? 43.451  67.747  -6.605  1.00 44.17  ? 318 PHE A N   1 
ATOM   1207 C  CA  . PHE A  1 318 ? 42.842  68.589  -5.568  1.00 48.96  ? 318 PHE A CA  1 
ATOM   1208 C  C   . PHE A  1 318 ? 43.230  70.050  -5.774  1.00 52.40  ? 318 PHE A C   1 
ATOM   1209 O  O   . PHE A  1 318 ? 44.405  70.360  -5.963  1.00 56.40  ? 318 PHE A O   1 
ATOM   1210 C  CB  . PHE A  1 318 ? 43.284  68.136  -4.174  1.00 48.63  ? 318 PHE A CB  1 
ATOM   1211 C  CG  . PHE A  1 318 ? 42.576  68.842  -3.044  1.00 50.75  ? 318 PHE A CG  1 
ATOM   1212 C  CD1 . PHE A  1 318 ? 41.346  68.386  -2.582  1.00 51.01  ? 318 PHE A CD1 1 
ATOM   1213 C  CD2 . PHE A  1 318 ? 43.140  69.961  -2.435  1.00 53.85  ? 318 PHE A CD2 1 
ATOM   1214 C  CE1 . PHE A  1 318 ? 40.690  69.029  -1.541  1.00 50.09  ? 318 PHE A CE1 1 
ATOM   1215 C  CE2 . PHE A  1 318 ? 42.488  70.611  -1.394  1.00 49.63  ? 318 PHE A CE2 1 
ATOM   1216 C  CZ  . PHE A  1 318 ? 41.261  70.143  -0.946  1.00 48.26  ? 318 PHE A CZ  1 
ATOM   1217 N  N   . LEU A  1 319 ? 42.228  70.928  -5.755  1.00 57.30  ? 319 LEU A N   1 
ATOM   1218 C  CA  . LEU A  1 319 ? 42.432  72.387  -5.730  1.00 55.25  ? 319 LEU A CA  1 
ATOM   1219 C  C   . LEU A  1 319 ? 41.609  73.128  -4.660  1.00 54.82  ? 319 LEU A C   1 
ATOM   1220 O  O   . LEU A  1 319 ? 41.631  74.362  -4.607  1.00 49.41  ? 319 LEU A O   1 
ATOM   1221 C  CB  . LEU A  1 319 ? 42.146  72.974  -7.118  1.00 52.98  ? 319 LEU A CB  1 
ATOM   1222 C  CG  . LEU A  1 319 ? 43.227  72.677  -8.163  1.00 56.11  ? 319 LEU A CG  1 
ATOM   1223 C  CD1 . LEU A  1 319 ? 42.706  72.960  -9.560  1.00 55.37  ? 319 LEU A CD1 1 
ATOM   1224 C  CD2 . LEU A  1 319 ? 44.499  73.472  -7.898  1.00 59.93  ? 319 LEU A CD2 1 
ATOM   1225 N  N   . GLY A  1 320 ? 40.926  72.385  -3.790  1.00 57.14  ? 320 GLY A N   1 
ATOM   1226 C  CA  . GLY A  1 320 ? 40.015  72.975  -2.809  1.00 64.94  ? 320 GLY A CA  1 
ATOM   1227 C  C   . GLY A  1 320 ? 38.809  73.661  -3.429  1.00 62.22  ? 320 GLY A C   1 
ATOM   1228 O  O   . GLY A  1 320 ? 38.305  74.646  -2.883  1.00 58.72  ? 320 GLY A O   1 
ATOM   1229 N  N   . THR A  1 321 ? 38.357  73.138  -4.569  1.00 61.21  ? 321 THR A N   1 
ATOM   1230 C  CA  . THR A  1 321 ? 37.185  73.649  -5.282  1.00 64.55  ? 321 THR A CA  1 
ATOM   1231 C  C   . THR A  1 321 ? 36.203  72.501  -5.543  1.00 62.67  ? 321 THR A C   1 
ATOM   1232 O  O   . THR A  1 321 ? 36.593  71.336  -5.461  1.00 55.72  ? 321 THR A O   1 
ATOM   1233 C  CB  . THR A  1 321 ? 37.581  74.287  -6.629  1.00 64.87  ? 321 THR A CB  1 
ATOM   1234 O  OG1 . THR A  1 321 ? 38.280  73.327  -7.434  1.00 70.94  ? 321 THR A OG1 1 
ATOM   1235 C  CG2 . THR A  1 321 ? 38.473  75.500  -6.410  1.00 66.05  ? 321 THR A CG2 1 
ATOM   1236 N  N   . PRO A  1 322 ? 34.925  72.820  -5.844  1.00 58.42  ? 322 PRO A N   1 
ATOM   1237 C  CA  . PRO A  1 322 ? 33.954  71.782  -6.215  1.00 54.78  ? 322 PRO A CA  1 
ATOM   1238 C  C   . PRO A  1 322 ? 34.347  70.958  -7.447  1.00 54.15  ? 322 PRO A C   1 
ATOM   1239 O  O   . PRO A  1 322 ? 34.148  69.746  -7.455  1.00 49.15  ? 322 PRO A O   1 
ATOM   1240 C  CB  . PRO A  1 322 ? 32.680  72.585  -6.499  1.00 53.77  ? 322 PRO A CB  1 
ATOM   1241 C  CG  . PRO A  1 322 ? 32.817  73.803  -5.664  1.00 56.36  ? 322 PRO A CG  1 
ATOM   1242 C  CD  . PRO A  1 322 ? 34.276  74.139  -5.725  1.00 57.06  ? 322 PRO A CD  1 
ATOM   1243 N  N   . GLU A  1 323 ? 34.914  71.616  -8.457  1.00 61.24  ? 323 GLU A N   1 
ATOM   1244 C  CA  . GLU A  1 323 ? 35.260  70.967  -9.729  1.00 63.54  ? 323 GLU A CA  1 
ATOM   1245 C  C   . GLU A  1 323 ? 36.520  70.090  -9.675  1.00 64.31  ? 323 GLU A C   1 
ATOM   1246 O  O   . GLU A  1 323 ? 36.758  69.295  -10.588 1.00 74.07  ? 323 GLU A O   1 
ATOM   1247 C  CB  . GLU A  1 323 ? 35.375  72.015  -10.838 1.00 68.79  ? 323 GLU A CB  1 
ATOM   1248 C  CG  . GLU A  1 323 ? 34.019  72.585  -11.243 1.00 75.16  ? 323 GLU A CG  1 
ATOM   1249 C  CD  . GLU A  1 323 ? 34.082  73.614  -12.361 1.00 77.29  ? 323 GLU A CD  1 
ATOM   1250 O  OE1 . GLU A  1 323 ? 35.113  73.697  -13.064 1.00 80.25  ? 323 GLU A OE1 1 
ATOM   1251 O  OE2 . GLU A  1 323 ? 33.083  74.340  -12.546 1.00 79.56  ? 323 GLU A OE2 1 
ATOM   1252 N  N   . ALA A  1 324 ? 37.323  70.256  -8.625  1.00 63.43  ? 324 ALA A N   1 
ATOM   1253 C  CA  . ALA A  1 324 ? 38.408  69.328  -8.296  1.00 62.50  ? 324 ALA A CA  1 
ATOM   1254 C  C   . ALA A  1 324 ? 38.395  69.070  -6.781  1.00 59.98  ? 324 ALA A C   1 
ATOM   1255 O  O   . ALA A  1 324 ? 39.294  69.514  -6.062  1.00 59.86  ? 324 ALA A O   1 
ATOM   1256 C  CB  . ALA A  1 324 ? 39.748  69.894  -8.745  1.00 62.58  ? 324 ALA A CB  1 
ATOM   1257 N  N   . PRO A  1 325 ? 37.369  68.342  -6.289  1.00 57.28  ? 325 PRO A N   1 
ATOM   1258 C  CA  . PRO A  1 325 ? 37.127  68.186  -4.849  1.00 56.29  ? 325 PRO A CA  1 
ATOM   1259 C  C   . PRO A  1 325 ? 38.074  67.226  -4.121  1.00 56.78  ? 325 PRO A C   1 
ATOM   1260 O  O   . PRO A  1 325 ? 38.134  67.247  -2.888  1.00 48.18  ? 325 PRO A O   1 
ATOM   1261 C  CB  . PRO A  1 325 ? 35.698  67.646  -4.808  1.00 57.84  ? 325 PRO A CB  1 
ATOM   1262 C  CG  . PRO A  1 325 ? 35.587  66.827  -6.047  1.00 57.31  ? 325 PRO A CG  1 
ATOM   1263 C  CD  . PRO A  1 325 ? 36.481  67.465  -7.078  1.00 57.29  ? 325 PRO A CD  1 
ATOM   1264 N  N   . GLY A  1 326 ? 38.788  66.393  -4.876  1.00 58.79  ? 326 GLY A N   1 
ATOM   1265 C  CA  . GLY A  1 326 ? 39.706  65.408  -4.321  1.00 56.28  ? 326 GLY A CA  1 
ATOM   1266 C  C   . GLY A  1 326 ? 39.007  64.115  -3.961  1.00 55.74  ? 326 GLY A C   1 
ATOM   1267 O  O   . GLY A  1 326 ? 37.776  64.062  -3.860  1.00 59.56  ? 326 GLY A O   1 
ATOM   1268 N  N   . ASN A  1 327 ? 39.815  63.071  -3.780  1.00 53.63  ? 327 ASN A N   1 
ATOM   1269 C  CA  . ASN A  1 327 ? 39.360  61.727  -3.387  1.00 49.19  ? 327 ASN A CA  1 
ATOM   1270 C  C   . ASN A  1 327 ? 38.387  61.049  -4.365  1.00 42.98  ? 327 ASN A C   1 
ATOM   1271 O  O   . ASN A  1 327 ? 37.659  60.135  -3.976  1.00 41.60  ? 327 ASN A O   1 
ATOM   1272 C  CB  . ASN A  1 327 ? 38.761  61.750  -1.965  1.00 53.84  ? 327 ASN A CB  1 
ATOM   1273 C  CG  . ASN A  1 327 ? 39.796  62.019  -0.893  1.00 52.06  ? 327 ASN A CG  1 
ATOM   1274 O  OD1 . ASN A  1 327 ? 40.965  62.281  -1.179  1.00 54.05  ? 327 ASN A OD1 1 
ATOM   1275 N  ND2 . ASN A  1 327 ? 39.368  61.942  0.362   1.00 53.95  ? 327 ASN A ND2 1 
ATOM   1276 N  N   . ALA A  1 328 ? 38.416  61.447  -5.636  1.00 39.98  ? 328 ALA A N   1 
ATOM   1277 C  CA  . ALA A  1 328 ? 37.501  60.891  -6.642  1.00 42.09  ? 328 ALA A CA  1 
ATOM   1278 C  C   . ALA A  1 328 ? 37.710  59.391  -6.853  1.00 42.28  ? 328 ALA A C   1 
ATOM   1279 O  O   . ALA A  1 328 ? 36.765  58.667  -7.169  1.00 41.64  ? 328 ALA A O   1 
ATOM   1280 C  CB  . ALA A  1 328 ? 37.642  61.635  -7.962  1.00 44.91  ? 328 ALA A CB  1 
ATOM   1281 N  N   . GLY A  1 329 ? 38.949  58.937  -6.671  1.00 41.35  ? 329 GLY A N   1 
ATOM   1282 C  CA  . GLY A  1 329 ? 39.281  57.515  -6.701  1.00 44.15  ? 329 GLY A CA  1 
ATOM   1283 C  C   . GLY A  1 329 ? 38.680  56.728  -5.547  1.00 46.28  ? 329 GLY A C   1 
ATOM   1284 O  O   . GLY A  1 329 ? 38.306  55.571  -5.712  1.00 47.48  ? 329 GLY A O   1 
ATOM   1285 N  N   . LEU A  1 330 ? 38.605  57.352  -4.374  1.00 49.65  ? 330 LEU A N   1 
ATOM   1286 C  CA  . LEU A  1 330 ? 37.978  56.737  -3.200  1.00 49.35  ? 330 LEU A CA  1 
ATOM   1287 C  C   . LEU A  1 330 ? 36.454  56.667  -3.305  1.00 49.78  ? 330 LEU A C   1 
ATOM   1288 O  O   . LEU A  1 330 ? 35.848  55.675  -2.888  1.00 46.88  ? 330 LEU A O   1 
ATOM   1289 C  CB  . LEU A  1 330 ? 38.399  57.471  -1.924  1.00 44.74  ? 330 LEU A CB  1 
ATOM   1290 C  CG  . LEU A  1 330 ? 39.863  57.232  -1.538  1.00 44.73  ? 330 LEU A CG  1 
ATOM   1291 C  CD1 . LEU A  1 330 ? 40.330  58.254  -0.517  1.00 45.34  ? 330 LEU A CD1 1 
ATOM   1292 C  CD2 . LEU A  1 330 ? 40.093  55.824  -1.006  1.00 44.55  ? 330 LEU A CD2 1 
ATOM   1293 N  N   . PHE A  1 331 ? 35.843  57.718  -3.846  1.00 51.14  ? 331 PHE A N   1 
ATOM   1294 C  CA  . PHE A  1 331 ? 34.400  57.720  -4.123  1.00 50.95  ? 331 PHE A CA  1 
ATOM   1295 C  C   . PHE A  1 331 ? 34.022  56.717  -5.221  1.00 52.22  ? 331 PHE A C   1 
ATOM   1296 O  O   . PHE A  1 331 ? 32.902  56.197  -5.224  1.00 54.00  ? 331 PHE A O   1 
ATOM   1297 C  CB  . PHE A  1 331 ? 33.910  59.128  -4.482  1.00 50.48  ? 331 PHE A CB  1 
ATOM   1298 C  CG  . PHE A  1 331 ? 33.730  60.031  -3.293  1.00 52.67  ? 331 PHE A CG  1 
ATOM   1299 C  CD1 . PHE A  1 331 ? 32.525  60.051  -2.597  1.00 54.16  ? 331 PHE A CD1 1 
ATOM   1300 C  CD2 . PHE A  1 331 ? 34.759  60.864  -2.865  1.00 49.17  ? 331 PHE A CD2 1 
ATOM   1301 C  CE1 . PHE A  1 331 ? 32.351  60.885  -1.501  1.00 50.61  ? 331 PHE A CE1 1 
ATOM   1302 C  CE2 . PHE A  1 331 ? 34.593  61.697  -1.768  1.00 49.28  ? 331 PHE A CE2 1 
ATOM   1303 C  CZ  . PHE A  1 331 ? 33.385  61.711  -1.088  1.00 50.29  ? 331 PHE A CZ  1 
ATOM   1304 N  N   . ASP A  1 332 ? 34.948  56.459  -6.147  1.00 51.74  ? 332 ASP A N   1 
ATOM   1305 C  CA  . ASP A  1 332 ? 34.811  55.358  -7.109  1.00 51.53  ? 332 ASP A CA  1 
ATOM   1306 C  C   . ASP A  1 332 ? 34.716  54.023  -6.384  1.00 51.97  ? 332 ASP A C   1 
ATOM   1307 O  O   . ASP A  1 332 ? 33.838  53.212  -6.682  1.00 48.82  ? 332 ASP A O   1 
ATOM   1308 C  CB  . ASP A  1 332 ? 35.990  55.325  -8.093  1.00 49.40  ? 332 ASP A CB  1 
ATOM   1309 C  CG  . ASP A  1 332 ? 35.901  56.393  -9.160  1.00 47.04  ? 332 ASP A CG  1 
ATOM   1310 O  OD1 . ASP A  1 332 ? 34.786  56.777  -9.559  1.00 48.27  ? 332 ASP A OD1 1 
ATOM   1311 O  OD2 . ASP A  1 332 ? 36.964  56.856  -9.616  1.00 38.76  ? 332 ASP A OD2 1 
ATOM   1312 N  N   . GLN A  1 333 ? 35.622  53.804  -5.437  1.00 53.55  ? 333 GLN A N   1 
ATOM   1313 C  CA  . GLN A  1 333 ? 35.600  52.592  -4.622  1.00 51.52  ? 333 GLN A CA  1 
ATOM   1314 C  C   . GLN A  1 333 ? 34.317  52.519  -3.796  1.00 55.46  ? 333 GLN A C   1 
ATOM   1315 O  O   . GLN A  1 333 ? 33.711  51.457  -3.691  1.00 66.96  ? 333 GLN A O   1 
ATOM   1316 C  CB  . GLN A  1 333 ? 36.811  52.535  -3.694  1.00 47.19  ? 333 GLN A CB  1 
ATOM   1317 C  CG  . GLN A  1 333 ? 38.154  52.422  -4.396  1.00 45.31  ? 333 GLN A CG  1 
ATOM   1318 C  CD  . GLN A  1 333 ? 39.317  52.602  -3.440  1.00 46.24  ? 333 GLN A CD  1 
ATOM   1319 O  OE1 . GLN A  1 333 ? 39.163  52.459  -2.226  1.00 45.48  ? 333 GLN A OE1 1 
ATOM   1320 N  NE2 . GLN A  1 333 ? 40.487  52.922  -3.984  1.00 47.36  ? 333 GLN A NE2 1 
ATOM   1321 N  N   . ASN A  1 334 ? 33.910  53.657  -3.238  1.00 53.41  ? 334 ASN A N   1 
ATOM   1322 C  CA  . ASN A  1 334 ? 32.706  53.757  -2.406  1.00 55.73  ? 334 ASN A CA  1 
ATOM   1323 C  C   . ASN A  1 334 ? 31.426  53.398  -3.163  1.00 56.71  ? 334 ASN A C   1 
ATOM   1324 O  O   . ASN A  1 334 ? 30.585  52.656  -2.649  1.00 56.64  ? 334 ASN A O   1 
ATOM   1325 C  CB  . ASN A  1 334 ? 32.586  55.176  -1.838  1.00 60.90  ? 334 ASN A CB  1 
ATOM   1326 C  CG  . ASN A  1 334 ? 31.511  55.302  -0.770  1.00 63.81  ? 334 ASN A CG  1 
ATOM   1327 O  OD1 . ASN A  1 334 ? 31.260  54.374  0.000   1.00 55.80  ? 334 ASN A OD1 1 
ATOM   1328 N  ND2 . ASN A  1 334 ? 30.886  56.470  -0.709  1.00 68.28  ? 334 ASN A ND2 1 
ATOM   1329 N  N   . LEU A  1 335 ? 31.283  53.934  -4.373  1.00 57.75  ? 335 LEU A N   1 
ATOM   1330 C  CA  . LEU A  1 335 ? 30.119  53.655  -5.223  1.00 53.17  ? 335 LEU A CA  1 
ATOM   1331 C  C   . LEU A  1 335 ? 30.036  52.179  -5.629  1.00 51.44  ? 335 LEU A C   1 
ATOM   1332 O  O   . LEU A  1 335 ? 28.942  51.634  -5.792  1.00 46.71  ? 335 LEU A O   1 
ATOM   1333 C  CB  . LEU A  1 335 ? 30.147  54.547  -6.468  1.00 49.55  ? 335 LEU A CB  1 
ATOM   1334 C  CG  . LEU A  1 335 ? 28.987  54.454  -7.469  1.00 51.06  ? 335 LEU A CG  1 
ATOM   1335 C  CD1 . LEU A  1 335 ? 27.626  54.684  -6.824  1.00 51.83  ? 335 LEU A CD1 1 
ATOM   1336 C  CD2 . LEU A  1 335 ? 29.218  55.466  -8.578  1.00 52.14  ? 335 LEU A CD2 1 
ATOM   1337 N  N   . ALA A  1 336 ? 31.198  51.551  -5.796  1.00 54.85  ? 336 ALA A N   1 
ATOM   1338 C  CA  . ALA A  1 336 ? 31.293  50.110  -6.037  1.00 53.66  ? 336 ALA A CA  1 
ATOM   1339 C  C   . ALA A  1 336 ? 30.879  49.289  -4.812  1.00 50.23  ? 336 ALA A C   1 
ATOM   1340 O  O   . ALA A  1 336 ? 30.230  48.254  -4.958  1.00 47.40  ? 336 ALA A O   1 
ATOM   1341 C  CB  . ALA A  1 336 ? 32.701  49.738  -6.471  1.00 52.86  ? 336 ALA A CB  1 
ATOM   1342 N  N   . LEU A  1 337 ? 31.259  49.742  -3.615  1.00 49.58  ? 337 LEU A N   1 
ATOM   1343 C  CA  . LEU A  1 337 ? 30.826  49.096  -2.363  1.00 56.31  ? 337 LEU A CA  1 
ATOM   1344 C  C   . LEU A  1 337 ? 29.303  49.141  -2.199  1.00 53.80  ? 337 LEU A C   1 
ATOM   1345 O  O   . LEU A  1 337 ? 28.693  48.172  -1.740  1.00 47.19  ? 337 LEU A O   1 
ATOM   1346 C  CB  . LEU A  1 337 ? 31.491  49.736  -1.133  1.00 54.86  ? 337 LEU A CB  1 
ATOM   1347 C  CG  . LEU A  1 337 ? 33.022  49.780  -1.014  1.00 55.00  ? 337 LEU A CG  1 
ATOM   1348 C  CD1 . LEU A  1 337 ? 33.426  50.089  0.421   1.00 55.03  ? 337 LEU A CD1 1 
ATOM   1349 C  CD2 . LEU A  1 337 ? 33.697  48.499  -1.486  1.00 56.90  ? 337 LEU A CD2 1 
ATOM   1350 N  N   . ARG A  1 338 ? 28.712  50.277  -2.570  1.00 53.68  ? 338 ARG A N   1 
ATOM   1351 C  CA  . ARG A  1 338 ? 27.251  50.434  -2.627  1.00 54.43  ? 338 ARG A CA  1 
ATOM   1352 C  C   . ARG A  1 338 ? 26.606  49.460  -3.617  1.00 53.05  ? 338 ARG A C   1 
ATOM   1353 O  O   . ARG A  1 338 ? 25.573  48.859  -3.312  1.00 50.72  ? 338 ARG A O   1 
ATOM   1354 C  CB  . ARG A  1 338 ? 26.860  51.876  -2.992  1.00 57.76  ? 338 ARG A CB  1 
ATOM   1355 C  CG  . ARG A  1 338 ? 26.745  52.822  -1.804  1.00 59.02  ? 338 ARG A CG  1 
ATOM   1356 C  CD  . ARG A  1 338 ? 26.020  54.104  -2.187  1.00 62.00  ? 338 ARG A CD  1 
ATOM   1357 N  NE  . ARG A  1 338 ? 26.851  54.951  -3.044  1.00 63.94  ? 338 ARG A NE  1 
ATOM   1358 C  CZ  . ARG A  1 338 ? 27.712  55.880  -2.619  1.00 70.71  ? 338 ARG A CZ  1 
ATOM   1359 N  NH1 . ARG A  1 338 ? 27.884  56.129  -1.320  1.00 79.36  ? 338 ARG A NH1 1 
ATOM   1360 N  NH2 . ARG A  1 338 ? 28.413  56.578  -3.510  1.00 66.44  ? 338 ARG A NH2 1 
ATOM   1361 N  N   . TRP A  1 339 ? 27.217  49.324  -4.795  1.00 58.15  ? 339 TRP A N   1 
ATOM   1362 C  CA  . TRP A  1 339 ? 26.752  48.390  -5.829  1.00 57.02  ? 339 TRP A CA  1 
ATOM   1363 C  C   . TRP A  1 339 ? 26.729  46.943  -5.340  1.00 54.48  ? 339 TRP A C   1 
ATOM   1364 O  O   . TRP A  1 339 ? 25.761  46.219  -5.584  1.00 52.30  ? 339 TRP A O   1 
ATOM   1365 C  CB  . TRP A  1 339 ? 27.626  48.482  -7.087  1.00 56.44  ? 339 TRP A CB  1 
ATOM   1366 C  CG  . TRP A  1 339 ? 27.095  47.654  -8.219  1.00 52.72  ? 339 TRP A CG  1 
ATOM   1367 C  CD1 . TRP A  1 339 ? 26.281  48.077  -9.225  1.00 52.29  ? 339 TRP A CD1 1 
ATOM   1368 C  CD2 . TRP A  1 339 ? 27.318  46.253  -8.442  1.00 54.67  ? 339 TRP A CD2 1 
ATOM   1369 N  NE1 . TRP A  1 339 ? 25.986  47.033  -10.067 1.00 58.99  ? 339 TRP A NE1 1 
ATOM   1370 C  CE2 . TRP A  1 339 ? 26.608  45.901  -9.609  1.00 54.99  ? 339 TRP A CE2 1 
ATOM   1371 C  CE3 . TRP A  1 339 ? 28.050  45.261  -7.769  1.00 56.59  ? 339 TRP A CE3 1 
ATOM   1372 C  CZ2 . TRP A  1 339 ? 26.607  44.598  -10.122 1.00 56.05  ? 339 TRP A CZ2 1 
ATOM   1373 C  CZ3 . TRP A  1 339 ? 28.049  43.964  -8.280  1.00 55.41  ? 339 TRP A CZ3 1 
ATOM   1374 C  CH2 . TRP A  1 339 ? 27.333  43.647  -9.447  1.00 55.82  ? 339 TRP A CH2 1 
ATOM   1375 N  N   . VAL A  1 340 ? 27.814  46.527  -4.688  1.00 54.13  ? 340 VAL A N   1 
ATOM   1376 C  CA  . VAL A  1 340 ? 27.942  45.173  -4.137  1.00 55.14  ? 340 VAL A CA  1 
ATOM   1377 C  C   . VAL A  1 340 ? 26.829  44.910  -3.121  1.00 57.42  ? 340 VAL A C   1 
ATOM   1378 O  O   . VAL A  1 340 ? 26.189  43.863  -3.166  1.00 52.35  ? 340 VAL A O   1 
ATOM   1379 C  CB  . VAL A  1 340 ? 29.348  44.957  -3.517  1.00 55.25  ? 340 VAL A CB  1 
ATOM   1380 C  CG1 . VAL A  1 340 ? 29.425  43.703  -2.648  1.00 53.40  ? 340 VAL A CG1 1 
ATOM   1381 C  CG2 . VAL A  1 340 ? 30.391  44.880  -4.622  1.00 54.85  ? 340 VAL A CG2 1 
ATOM   1382 N  N   . ARG A  1 341 ? 26.589  45.872  -2.231  1.00 62.28  ? 341 ARG A N   1 
ATOM   1383 C  CA  . ARG A  1 341 ? 25.505  45.781  -1.244  1.00 61.79  ? 341 ARG A CA  1 
ATOM   1384 C  C   . ARG A  1 341 ? 24.132  45.583  -1.896  1.00 62.45  ? 341 ARG A C   1 
ATOM   1385 O  O   . ARG A  1 341 ? 23.330  44.768  -1.433  1.00 69.29  ? 341 ARG A O   1 
ATOM   1386 C  CB  . ARG A  1 341 ? 25.482  47.025  -0.349  1.00 62.41  ? 341 ARG A CB  1 
ATOM   1387 C  CG  . ARG A  1 341 ? 24.630  46.848  0.901   1.00 68.69  ? 341 ARG A CG  1 
ATOM   1388 C  CD  . ARG A  1 341 ? 24.894  47.910  1.957   1.00 72.51  ? 341 ARG A CD  1 
ATOM   1389 N  NE  . ARG A  1 341 ? 24.234  47.575  3.223   1.00 73.18  ? 341 ARG A NE  1 
ATOM   1390 C  CZ  . ARG A  1 341 ? 24.689  46.709  4.134   1.00 69.52  ? 341 ARG A CZ  1 
ATOM   1391 N  NH1 . ARG A  1 341 ? 25.837  46.051  3.959   1.00 67.32  ? 341 ARG A NH1 1 
ATOM   1392 N  NH2 . ARG A  1 341 ? 23.984  46.494  5.243   1.00 70.58  ? 341 ARG A NH2 1 
ATOM   1393 N  N   . ASP A  1 342 ? 23.880  46.326  -2.972  1.00 63.94  ? 342 ASP A N   1 
ATOM   1394 C  CA  . ASP A  1 342 ? 22.618  46.248  -3.718  1.00 64.06  ? 342 ASP A CA  1 
ATOM   1395 C  C   . ASP A  1 342 ? 22.439  44.960  -4.535  1.00 62.45  ? 342 ASP A C   1 
ATOM   1396 O  O   . ASP A  1 342 ? 21.323  44.440  -4.627  1.00 67.33  ? 342 ASP A O   1 
ATOM   1397 C  CB  . ASP A  1 342 ? 22.491  47.454  -4.662  1.00 66.44  ? 342 ASP A CB  1 
ATOM   1398 C  CG  . ASP A  1 342 ? 22.307  48.772  -3.922  1.00 65.24  ? 342 ASP A CG  1 
ATOM   1399 O  OD1 . ASP A  1 342 ? 22.586  48.839  -2.703  1.00 66.05  ? 342 ASP A OD1 1 
ATOM   1400 O  OD2 . ASP A  1 342 ? 21.881  49.752  -4.569  1.00 59.65  ? 342 ASP A OD2 1 
ATOM   1401 N  N   . ASN A  1 343 ? 23.532  44.455  -5.114  1.00 58.79  ? 343 ASN A N   1 
ATOM   1402 C  CA  . ASN A  1 343 ? 23.473  43.421  -6.170  1.00 54.84  ? 343 ASN A CA  1 
ATOM   1403 C  C   . ASN A  1 343 ? 24.170  42.069  -5.933  1.00 53.10  ? 343 ASN A C   1 
ATOM   1404 O  O   . ASN A  1 343 ? 23.810  41.096  -6.596  1.00 55.13  ? 343 ASN A O   1 
ATOM   1405 C  CB  . ASN A  1 343 ? 24.008  44.009  -7.482  1.00 58.49  ? 343 ASN A CB  1 
ATOM   1406 C  CG  . ASN A  1 343 ? 23.242  45.242  -7.926  1.00 56.70  ? 343 ASN A CG  1 
ATOM   1407 O  OD1 . ASN A  1 343 ? 22.081  45.155  -8.325  1.00 56.69  ? 343 ASN A OD1 1 
ATOM   1408 N  ND2 . ASN A  1 343 ? 23.894  46.399  -7.864  1.00 56.99  ? 343 ASN A ND2 1 
ATOM   1409 N  N   . ILE A  1 344 ? 25.145  41.993  -5.023  1.00 53.96  ? 344 ILE A N   1 
ATOM   1410 C  CA  . ILE A  1 344 ? 25.960  40.763  -4.859  1.00 54.88  ? 344 ILE A CA  1 
ATOM   1411 C  C   . ILE A  1 344 ? 25.178  39.531  -4.362  1.00 56.69  ? 344 ILE A C   1 
ATOM   1412 O  O   . ILE A  1 344 ? 25.610  38.397  -4.584  1.00 53.01  ? 344 ILE A O   1 
ATOM   1413 C  CB  . ILE A  1 344 ? 27.233  41.003  -3.994  1.00 57.76  ? 344 ILE A CB  1 
ATOM   1414 C  CG1 . ILE A  1 344 ? 28.350  39.998  -4.334  1.00 57.86  ? 344 ILE A CG1 1 
ATOM   1415 C  CG2 . ILE A  1 344 ? 26.933  40.962  -2.494  1.00 59.53  ? 344 ILE A CG2 1 
ATOM   1416 C  CD1 . ILE A  1 344 ? 29.021  40.216  -5.676  1.00 55.86  ? 344 ILE A CD1 1 
ATOM   1417 N  N   . HIS A  1 345 ? 24.040  39.751  -3.702  1.00 64.87  ? 345 HIS A N   1 
ATOM   1418 C  CA  . HIS A  1 345 ? 23.140  38.652  -3.307  1.00 67.34  ? 345 HIS A CA  1 
ATOM   1419 C  C   . HIS A  1 345 ? 22.591  37.851  -4.500  1.00 63.24  ? 345 HIS A C   1 
ATOM   1420 O  O   . HIS A  1 345 ? 22.369  36.642  -4.396  1.00 64.04  ? 345 HIS A O   1 
ATOM   1421 C  CB  . HIS A  1 345 ? 21.978  39.176  -2.456  1.00 68.93  ? 345 HIS A CB  1 
ATOM   1422 C  CG  . HIS A  1 345 ? 21.038  38.103  -1.997  1.00 68.73  ? 345 HIS A CG  1 
ATOM   1423 N  ND1 . HIS A  1 345 ? 21.410  37.121  -1.104  1.00 63.80  ? 345 HIS A ND1 1 
ATOM   1424 C  CD2 . HIS A  1 345 ? 19.751  37.842  -2.328  1.00 69.77  ? 345 HIS A CD2 1 
ATOM   1425 C  CE1 . HIS A  1 345 ? 20.389  36.309  -0.895  1.00 67.12  ? 345 HIS A CE1 1 
ATOM   1426 N  NE2 . HIS A  1 345 ? 19.370  36.724  -1.626  1.00 67.77  ? 345 HIS A NE2 1 
ATOM   1427 N  N   . ARG A  1 346 ? 22.394  38.536  -5.624  1.00 63.15  ? 346 ARG A N   1 
ATOM   1428 C  CA  . ARG A  1 346 ? 21.893  37.923  -6.865  1.00 68.00  ? 346 ARG A CA  1 
ATOM   1429 C  C   . ARG A  1 346 ? 22.894  36.934  -7.487  1.00 68.09  ? 346 ARG A C   1 
ATOM   1430 O  O   . ARG A  1 346 ? 22.495  35.989  -8.171  1.00 70.69  ? 346 ARG A O   1 
ATOM   1431 C  CB  . ARG A  1 346 ? 21.567  39.007  -7.899  1.00 68.51  ? 346 ARG A CB  1 
ATOM   1432 C  CG  . ARG A  1 346 ? 20.586  40.085  -7.442  1.00 69.95  ? 346 ARG A CG  1 
ATOM   1433 C  CD  . ARG A  1 346 ? 20.641  41.284  -8.371  1.00 75.06  ? 346 ARG A CD  1 
ATOM   1434 N  NE  . ARG A  1 346 ? 20.097  42.505  -7.772  1.00 81.90  ? 346 ARG A NE  1 
ATOM   1435 C  CZ  . ARG A  1 346 ? 18.806  42.835  -7.692  1.00 80.30  ? 346 ARG A CZ  1 
ATOM   1436 N  NH1 . ARG A  1 346 ? 17.847  42.036  -8.163  1.00 78.99  ? 346 ARG A NH1 1 
ATOM   1437 N  NH2 . ARG A  1 346 ? 18.468  43.989  -7.119  1.00 82.27  ? 346 ARG A NH2 1 
ATOM   1438 N  N   . PHE A  1 347 ? 24.185  37.167  -7.237  1.00 63.65  ? 347 PHE A N   1 
ATOM   1439 C  CA  . PHE A  1 347 ? 25.287  36.314  -7.718  1.00 57.80  ? 347 PHE A CA  1 
ATOM   1440 C  C   . PHE A  1 347 ? 25.649  35.155  -6.769  1.00 58.15  ? 347 PHE A C   1 
ATOM   1441 O  O   . PHE A  1 347 ? 26.562  34.380  -7.069  1.00 58.27  ? 347 PHE A O   1 
ATOM   1442 C  CB  . PHE A  1 347 ? 26.545  37.164  -7.949  1.00 53.16  ? 347 PHE A CB  1 
ATOM   1443 C  CG  . PHE A  1 347 ? 26.354  38.290  -8.926  1.00 49.45  ? 347 PHE A CG  1 
ATOM   1444 C  CD1 . PHE A  1 347 ? 25.896  39.528  -8.493  1.00 45.68  ? 347 PHE A CD1 1 
ATOM   1445 C  CD2 . PHE A  1 347 ? 26.644  38.120  -10.276 1.00 44.98  ? 347 PHE A CD2 1 
ATOM   1446 C  CE1 . PHE A  1 347 ? 25.715  40.572  -9.382  1.00 47.44  ? 347 PHE A CE1 1 
ATOM   1447 C  CE2 . PHE A  1 347 ? 26.470  39.165  -11.174 1.00 45.26  ? 347 PHE A CE2 1 
ATOM   1448 C  CZ  . PHE A  1 347 ? 26.005  40.393  -10.725 1.00 48.34  ? 347 PHE A CZ  1 
ATOM   1449 N  N   . GLY A  1 348 ? 24.945  35.042  -5.641  1.00 58.95  ? 348 GLY A N   1 
ATOM   1450 C  CA  . GLY A  1 348 ? 25.198  34.005  -4.628  1.00 59.33  ? 348 GLY A CA  1 
ATOM   1451 C  C   . GLY A  1 348 ? 25.879  34.482  -3.352  1.00 60.30  ? 348 GLY A C   1 
ATOM   1452 O  O   . GLY A  1 348 ? 26.208  33.665  -2.489  1.00 58.14  ? 348 GLY A O   1 
ATOM   1453 N  N   . GLY A  1 349 ? 26.086  35.792  -3.226  1.00 60.56  ? 349 GLY A N   1 
ATOM   1454 C  CA  . GLY A  1 349 ? 26.767  36.373  -2.066  1.00 64.21  ? 349 GLY A CA  1 
ATOM   1455 C  C   . GLY A  1 349 ? 25.844  36.742  -0.919  1.00 63.15  ? 349 GLY A C   1 
ATOM   1456 O  O   . GLY A  1 349 ? 24.621  36.623  -1.020  1.00 65.99  ? 349 GLY A O   1 
ATOM   1457 N  N   . ASP A  1 350 ? 26.460  37.157  0.187   1.00 62.17  ? 350 ASP A N   1 
ATOM   1458 C  CA  . ASP A  1 350 ? 25.769  37.736  1.339   1.00 63.62  ? 350 ASP A CA  1 
ATOM   1459 C  C   . ASP A  1 350 ? 26.230  39.196  1.462   1.00 65.45  ? 350 ASP A C   1 
ATOM   1460 O  O   . ASP A  1 350 ? 27.431  39.440  1.621   1.00 73.81  ? 350 ASP A O   1 
ATOM   1461 C  CB  . ASP A  1 350 ? 26.111  36.955  2.616   1.00 65.62  ? 350 ASP A CB  1 
ATOM   1462 C  CG  . ASP A  1 350 ? 25.209  37.313  3.803   1.00 66.16  ? 350 ASP A CG  1 
ATOM   1463 O  OD1 . ASP A  1 350 ? 24.465  38.317  3.746   1.00 68.82  ? 350 ASP A OD1 1 
ATOM   1464 O  OD2 . ASP A  1 350 ? 25.238  36.572  4.809   1.00 67.17  ? 350 ASP A OD2 1 
ATOM   1465 N  N   . PRO A  1 351 ? 25.297  40.169  1.367   1.00 55.27  ? 351 PRO A N   1 
ATOM   1466 C  CA  . PRO A  1 351 ? 25.675  41.579  1.559   1.00 53.00  ? 351 PRO A CA  1 
ATOM   1467 C  C   . PRO A  1 351 ? 26.257  41.904  2.937   1.00 51.43  ? 351 PRO A C   1 
ATOM   1468 O  O   . PRO A  1 351 ? 27.127  42.771  3.047   1.00 49.83  ? 351 PRO A O   1 
ATOM   1469 C  CB  . PRO A  1 351 ? 24.352  42.327  1.363   1.00 54.09  ? 351 PRO A CB  1 
ATOM   1470 C  CG  . PRO A  1 351 ? 23.543  41.432  0.498   1.00 55.43  ? 351 PRO A CG  1 
ATOM   1471 C  CD  . PRO A  1 351 ? 23.888  40.047  0.948   1.00 54.12  ? 351 PRO A CD  1 
ATOM   1472 N  N   . SER A  1 352 ? 25.777  41.211  3.966   1.00 51.72  ? 352 SER A N   1 
ATOM   1473 C  CA  . SER A  1 352 ? 26.235  41.430  5.339   1.00 51.59  ? 352 SER A CA  1 
ATOM   1474 C  C   . SER A  1 352 ? 27.601  40.804  5.665   1.00 57.00  ? 352 SER A C   1 
ATOM   1475 O  O   . SER A  1 352 ? 28.149  41.077  6.735   1.00 66.12  ? 352 SER A O   1 
ATOM   1476 C  CB  . SER A  1 352 ? 25.179  40.930  6.330   1.00 45.63  ? 352 SER A CB  1 
ATOM   1477 O  OG  . SER A  1 352 ? 24.883  39.561  6.118   1.00 41.69  ? 352 SER A OG  1 
ATOM   1478 N  N   . ARG A  1 353 ? 28.138  39.972  4.766   1.00 57.98  ? 353 ARG A N   1 
ATOM   1479 C  CA  . ARG A  1 353 ? 29.461  39.343  4.945   1.00 55.04  ? 353 ARG A CA  1 
ATOM   1480 C  C   . ARG A  1 353 ? 30.466  39.744  3.854   1.00 50.15  ? 353 ARG A C   1 
ATOM   1481 O  O   . ARG A  1 353 ? 31.158  38.892  3.286   1.00 48.57  ? 353 ARG A O   1 
ATOM   1482 C  CB  . ARG A  1 353 ? 29.322  37.815  4.991   1.00 54.31  ? 353 ARG A CB  1 
ATOM   1483 C  CG  . ARG A  1 353 ? 28.394  37.293  6.077   1.00 54.53  ? 353 ARG A CG  1 
ATOM   1484 C  CD  . ARG A  1 353 ? 28.056  35.828  5.851   1.00 54.73  ? 353 ARG A CD  1 
ATOM   1485 N  NE  . ARG A  1 353 ? 29.194  34.941  6.098   1.00 60.35  ? 353 ARG A NE  1 
ATOM   1486 C  CZ  . ARG A  1 353 ? 29.250  33.648  5.766   1.00 63.01  ? 353 ARG A CZ  1 
ATOM   1487 N  NH1 . ARG A  1 353 ? 28.232  33.045  5.148   1.00 61.76  ? 353 ARG A NH1 1 
ATOM   1488 N  NH2 . ARG A  1 353 ? 30.345  32.945  6.049   1.00 61.39  ? 353 ARG A NH2 1 
ATOM   1489 N  N   . VAL A  1 354 ? 30.545  41.043  3.574   1.00 48.21  ? 354 VAL A N   1 
ATOM   1490 C  CA  . VAL A  1 354 ? 31.516  41.583  2.615   1.00 44.71  ? 354 VAL A CA  1 
ATOM   1491 C  C   . VAL A  1 354 ? 32.823  41.891  3.347   1.00 43.52  ? 354 VAL A C   1 
ATOM   1492 O  O   . VAL A  1 354 ? 32.855  42.733  4.246   1.00 43.95  ? 354 VAL A O   1 
ATOM   1493 C  CB  . VAL A  1 354 ? 30.975  42.842  1.892   1.00 45.49  ? 354 VAL A CB  1 
ATOM   1494 C  CG1 . VAL A  1 354 ? 32.055  43.534  1.062   1.00 43.50  ? 354 VAL A CG1 1 
ATOM   1495 C  CG2 . VAL A  1 354 ? 29.809  42.467  0.990   1.00 46.90  ? 354 VAL A CG2 1 
ATOM   1496 N  N   . THR A  1 355 ? 33.885  41.193  2.949   1.00 42.69  ? 355 THR A N   1 
ATOM   1497 C  CA  . THR A  1 355 ? 35.229  41.400  3.477   1.00 42.09  ? 355 THR A CA  1 
ATOM   1498 C  C   . THR A  1 355 ? 36.057  42.136  2.430   1.00 39.75  ? 355 THR A C   1 
ATOM   1499 O  O   . THR A  1 355 ? 36.213  41.649  1.310   1.00 37.08  ? 355 THR A O   1 
ATOM   1500 C  CB  . THR A  1 355 ? 35.907  40.055  3.802   1.00 45.16  ? 355 THR A CB  1 
ATOM   1501 O  OG1 . THR A  1 355 ? 35.055  39.283  4.658   1.00 46.85  ? 355 THR A OG1 1 
ATOM   1502 C  CG2 . THR A  1 355 ? 37.259  40.267  4.494   1.00 49.18  ? 355 THR A CG2 1 
ATOM   1503 N  N   . LEU A  1 356 ? 36.583  43.304  2.796   1.00 40.87  ? 356 LEU A N   1 
ATOM   1504 C  CA  . LEU A  1 356 ? 37.449  44.081  1.909   1.00 43.44  ? 356 LEU A CA  1 
ATOM   1505 C  C   . LEU A  1 356 ? 38.903  43.662  2.113   1.00 43.77  ? 356 LEU A C   1 
ATOM   1506 O  O   . LEU A  1 356 ? 39.395  43.675  3.240   1.00 43.88  ? 356 LEU A O   1 
ATOM   1507 C  CB  . LEU A  1 356 ? 37.299  45.581  2.181   1.00 45.38  ? 356 LEU A CB  1 
ATOM   1508 C  CG  . LEU A  1 356 ? 35.897  46.199  2.123   1.00 45.07  ? 356 LEU A CG  1 
ATOM   1509 C  CD1 . LEU A  1 356 ? 35.985  47.695  2.379   1.00 46.70  ? 356 LEU A CD1 1 
ATOM   1510 C  CD2 . LEU A  1 356 ? 35.207  45.948  0.792   1.00 43.91  ? 356 LEU A CD2 1 
ATOM   1511 N  N   . PHE A  1 357 ? 39.581  43.290  1.027   1.00 41.49  ? 357 PHE A N   1 
ATOM   1512 C  CA  . PHE A  1 357 ? 41.001  42.906  1.084   1.00 41.12  ? 357 PHE A CA  1 
ATOM   1513 C  C   . PHE A  1 357 ? 41.801  43.562  -0.040  1.00 39.83  ? 357 PHE A C   1 
ATOM   1514 O  O   . PHE A  1 357 ? 41.349  43.626  -1.178  1.00 40.74  ? 357 PHE A O   1 
ATOM   1515 C  CB  . PHE A  1 357 ? 41.193  41.371  1.154   1.00 43.16  ? 357 PHE A CB  1 
ATOM   1516 C  CG  . PHE A  1 357 ? 41.012  40.635  -0.151  1.00 42.47  ? 357 PHE A CG  1 
ATOM   1517 C  CD1 . PHE A  1 357 ? 39.796  40.642  -0.821  1.00 42.50  ? 357 PHE A CD1 1 
ATOM   1518 C  CD2 . PHE A  1 357 ? 42.055  39.868  -0.675  1.00 42.55  ? 357 PHE A CD2 1 
ATOM   1519 C  CE1 . PHE A  1 357 ? 39.634  39.940  -2.010  1.00 43.54  ? 357 PHE A CE1 1 
ATOM   1520 C  CE2 . PHE A  1 357 ? 41.898  39.163  -1.861  1.00 41.21  ? 357 PHE A CE2 1 
ATOM   1521 C  CZ  . PHE A  1 357 ? 40.685  39.201  -2.530  1.00 41.97  ? 357 PHE A CZ  1 
ATOM   1522 N  N   . GLY A  1 358 ? 42.977  44.075  0.310   1.00 40.67  ? 358 GLY A N   1 
ATOM   1523 C  CA  . GLY A  1 358 ? 43.808  44.847  -0.612  1.00 41.24  ? 358 GLY A CA  1 
ATOM   1524 C  C   . GLY A  1 358 ? 45.268  44.816  -0.207  1.00 43.52  ? 358 GLY A C   1 
ATOM   1525 O  O   . GLY A  1 358 ? 45.603  44.402  0.907   1.00 42.15  ? 358 GLY A O   1 
ATOM   1526 N  N   . GLU A  1 359 ? 46.128  45.250  -1.128  1.00 42.30  ? 359 GLU A N   1 
ATOM   1527 C  CA  . GLU A  1 359 ? 47.580  45.319  -0.913  1.00 40.92  ? 359 GLU A CA  1 
ATOM   1528 C  C   . GLU A  1 359 ? 48.103  46.701  -1.298  1.00 41.30  ? 359 GLU A C   1 
ATOM   1529 O  O   . GLU A  1 359 ? 47.629  47.293  -2.268  1.00 44.85  ? 359 GLU A O   1 
ATOM   1530 C  CB  . GLU A  1 359 ? 48.296  44.232  -1.722  1.00 40.59  ? 359 GLU A CB  1 
ATOM   1531 C  CG  . GLU A  1 359 ? 49.780  44.054  -1.404  1.00 39.14  ? 359 GLU A CG  1 
ATOM   1532 C  CD  . GLU A  1 359 ? 50.722  44.945  -2.205  1.00 38.28  ? 359 GLU A CD  1 
ATOM   1533 O  OE1 . GLU A  1 359 ? 50.303  45.542  -3.220  1.00 36.75  ? 359 GLU A OE1 1 
ATOM   1534 O  OE2 . GLU A  1 359 ? 51.905  45.036  -1.819  1.00 42.15  ? 359 GLU A OE2 1 
HETATM 1535 C  C   . SEB A  1 360 ? 48.634  49.641  -0.616  1.00 55.13  ? 360 SEB A C   1 
HETATM 1536 N  N   . SEB A  1 360 ? 49.077  47.197  -0.530  1.00 46.67  ? 360 SEB A N   1 
HETATM 1537 C  CI2 . SEB A  1 360 ? 52.124  46.923  -6.906  1.00 89.61  ? 360 SEB A CI2 1 
HETATM 1538 C  CH2 . SEB A  1 360 ? 52.196  47.527  -5.649  1.00 97.32  ? 360 SEB A CH2 1 
HETATM 1539 C  CJ  . SEB A  1 360 ? 52.659  47.574  -8.020  1.00 99.61  ? 360 SEB A CJ  1 
HETATM 1540 C  CI1 . SEB A  1 360 ? 53.265  48.825  -7.878  1.00 96.44  ? 360 SEB A CI1 1 
HETATM 1541 C  CH1 . SEB A  1 360 ? 53.336  49.427  -6.620  1.00 100.14 ? 360 SEB A CH1 1 
HETATM 1542 C  CZ  . SEB A  1 360 ? 52.787  48.787  -5.508  1.00 105.86 ? 360 SEB A CZ  1 
HETATM 1543 C  CE  . SEB A  1 360 ? 52.890  49.432  -4.143  1.00 103.08 ? 360 SEB A CE  1 
HETATM 1544 O  OD2 . SEB A  1 360 ? 50.470  50.205  -4.466  1.00 93.01  ? 360 SEB A OD2 1 
HETATM 1545 O  OD1 . SEB A  1 360 ? 51.996  51.671  -3.454  1.00 105.38 ? 360 SEB A OD1 1 
HETATM 1546 S  SD  . SEB A  1 360 ? 51.588  50.302  -3.576  1.00 102.48 ? 360 SEB A SD  1 
HETATM 1547 O  OG  . SEB A  1 360 ? 51.182  49.797  -2.177  1.00 76.78  ? 360 SEB A OG  1 
HETATM 1548 C  CB  . SEB A  1 360 ? 50.518  48.544  -1.997  1.00 68.14  ? 360 SEB A CB  1 
HETATM 1549 C  CA  . SEB A  1 360 ? 49.681  48.541  -0.711  1.00 57.30  ? 360 SEB A CA  1 
HETATM 1550 O  O   . SEB A  1 360 ? 47.935  49.727  0.392   1.00 51.86  ? 360 SEB A O   1 
ATOM   1551 N  N   . ALA A  1 361 ? 48.522  50.487  -1.645  1.00 53.22  ? 361 ALA A N   1 
ATOM   1552 C  CA  . ALA A  1 361 ? 47.447  51.493  -1.755  1.00 50.32  ? 361 ALA A CA  1 
ATOM   1553 C  C   . ALA A  1 361 ? 46.032  50.901  -1.663  1.00 47.29  ? 361 ALA A C   1 
ATOM   1554 O  O   . ALA A  1 361 ? 45.103  51.577  -1.213  1.00 46.53  ? 361 ALA A O   1 
ATOM   1555 C  CB  . ALA A  1 361 ? 47.599  52.280  -3.049  1.00 47.60  ? 361 ALA A CB  1 
ATOM   1556 N  N   . GLY A  1 362 ? 45.873  49.655  -2.104  1.00 44.49  ? 362 GLY A N   1 
ATOM   1557 C  CA  . GLY A  1 362 ? 44.628  48.906  -1.910  1.00 45.67  ? 362 GLY A CA  1 
ATOM   1558 C  C   . GLY A  1 362 ? 44.334  48.614  -0.446  1.00 47.92  ? 362 GLY A C   1 
ATOM   1559 O  O   . GLY A  1 362 ? 43.188  48.684  -0.013  1.00 50.64  ? 362 GLY A O   1 
ATOM   1560 N  N   . ALA A  1 363 ? 45.379  48.276  0.306   1.00 49.21  ? 363 ALA A N   1 
ATOM   1561 C  CA  . ALA A  1 363 ? 45.298  48.093  1.759   1.00 48.09  ? 363 ALA A CA  1 
ATOM   1562 C  C   . ALA A  1 363 ? 45.090  49.420  2.496   1.00 43.45  ? 363 ALA A C   1 
ATOM   1563 O  O   . ALA A  1 363 ? 44.368  49.466  3.495   1.00 40.93  ? 363 ALA A O   1 
ATOM   1564 C  CB  . ALA A  1 363 ? 46.542  47.387  2.281   1.00 48.96  ? 363 ALA A CB  1 
ATOM   1565 N  N   . VAL A  1 364 ? 45.735  50.483  2.013   1.00 40.29  ? 364 VAL A N   1 
ATOM   1566 C  CA  . VAL A  1 364 ? 45.482  51.841  2.511   1.00 40.60  ? 364 VAL A CA  1 
ATOM   1567 C  C   . VAL A  1 364 ? 44.006  52.173  2.301   1.00 45.34  ? 364 VAL A C   1 
ATOM   1568 O  O   . VAL A  1 364 ? 43.321  52.603  3.224   1.00 52.93  ? 364 VAL A O   1 
ATOM   1569 C  CB  . VAL A  1 364 ? 46.348  52.904  1.793   1.00 36.83  ? 364 VAL A CB  1 
ATOM   1570 C  CG1 . VAL A  1 364 ? 45.926  54.320  2.185   1.00 35.81  ? 364 VAL A CG1 1 
ATOM   1571 C  CG2 . VAL A  1 364 ? 47.822  52.703  2.109   1.00 37.00  ? 364 VAL A CG2 1 
ATOM   1572 N  N   . SER A  1 365 ? 43.540  51.963  1.073   1.00 44.10  ? 365 SER A N   1 
ATOM   1573 C  CA  . SER A  1 365 ? 42.132  52.150  0.698   1.00 39.19  ? 365 SER A CA  1 
ATOM   1574 C  C   . SER A  1 365 ? 41.159  51.417  1.628   1.00 37.20  ? 365 SER A C   1 
ATOM   1575 O  O   . SER A  1 365 ? 40.154  51.993  2.052   1.00 34.71  ? 365 SER A O   1 
ATOM   1576 C  CB  . SER A  1 365 ? 41.911  51.707  -0.752  1.00 40.78  ? 365 SER A CB  1 
ATOM   1577 O  OG  . SER A  1 365 ? 42.335  52.706  -1.663  1.00 41.83  ? 365 SER A OG  1 
ATOM   1578 N  N   . VAL A  1 366 ? 41.468  50.159  1.938   1.00 36.23  ? 366 VAL A N   1 
ATOM   1579 C  CA  . VAL A  1 366 ? 40.690  49.364  2.901   1.00 40.11  ? 366 VAL A CA  1 
ATOM   1580 C  C   . VAL A  1 366 ? 40.638  50.035  4.283   1.00 44.74  ? 366 VAL A C   1 
ATOM   1581 O  O   . VAL A  1 366 ? 39.590  50.040  4.933   1.00 49.76  ? 366 VAL A O   1 
ATOM   1582 C  CB  . VAL A  1 366 ? 41.242  47.917  3.007   1.00 37.06  ? 366 VAL A CB  1 
ATOM   1583 C  CG1 . VAL A  1 366 ? 40.703  47.185  4.229   1.00 35.90  ? 366 VAL A CG1 1 
ATOM   1584 C  CG2 . VAL A  1 366 ? 40.887  47.121  1.763   1.00 37.35  ? 366 VAL A CG2 1 
ATOM   1585 N  N   . SER A  1 367 ? 41.767  50.591  4.718   1.00 47.26  ? 367 SER A N   1 
ATOM   1586 C  CA  . SER A  1 367 ? 41.863  51.266  6.020   1.00 47.04  ? 367 SER A CA  1 
ATOM   1587 C  C   . SER A  1 367 ? 41.073  52.572  6.078   1.00 49.33  ? 367 SER A C   1 
ATOM   1588 O  O   . SER A  1 367 ? 40.504  52.914  7.114   1.00 53.43  ? 367 SER A O   1 
ATOM   1589 C  CB  . SER A  1 367 ? 43.320  51.534  6.388   1.00 44.74  ? 367 SER A CB  1 
ATOM   1590 O  OG  . SER A  1 367 ? 43.929  52.472  5.523   1.00 37.37  ? 367 SER A OG  1 
ATOM   1591 N  N   . LEU A  1 368 ? 41.059  53.293  4.964   1.00 47.76  ? 368 LEU A N   1 
ATOM   1592 C  CA  . LEU A  1 368 ? 40.269  54.515  4.833   1.00 43.99  ? 368 LEU A CA  1 
ATOM   1593 C  C   . LEU A  1 368 ? 38.772  54.220  4.834   1.00 45.83  ? 368 LEU A C   1 
ATOM   1594 O  O   . LEU A  1 368 ? 37.988  55.027  5.328   1.00 45.65  ? 368 LEU A O   1 
ATOM   1595 C  CB  . LEU A  1 368 ? 40.656  55.262  3.560   1.00 40.67  ? 368 LEU A CB  1 
ATOM   1596 C  CG  . LEU A  1 368 ? 42.123  55.700  3.507   1.00 43.37  ? 368 LEU A CG  1 
ATOM   1597 C  CD1 . LEU A  1 368 ? 42.508  56.086  2.090   1.00 47.16  ? 368 LEU A CD1 1 
ATOM   1598 C  CD2 . LEU A  1 368 ? 42.405  56.832  4.481   1.00 45.38  ? 368 LEU A CD2 1 
ATOM   1599 N  N   . HIS A  1 369 ? 38.386  53.066  4.290   1.00 49.23  ? 369 HIS A N   1 
ATOM   1600 C  CA  . HIS A  1 369 ? 36.988  52.612  4.329   1.00 49.60  ? 369 HIS A CA  1 
ATOM   1601 C  C   . HIS A  1 369 ? 36.517  52.272  5.750   1.00 48.09  ? 369 HIS A C   1 
ATOM   1602 O  O   . HIS A  1 369 ? 35.351  52.496  6.084   1.00 57.79  ? 369 HIS A O   1 
ATOM   1603 C  CB  . HIS A  1 369 ? 36.759  51.417  3.390   1.00 49.26  ? 369 HIS A CB  1 
ATOM   1604 C  CG  . HIS A  1 369 ? 36.706  51.787  1.940   1.00 46.75  ? 369 HIS A CG  1 
ATOM   1605 N  ND1 . HIS A  1 369 ? 35.841  52.739  1.444   1.00 42.88  ? 369 HIS A ND1 1 
ATOM   1606 C  CD2 . HIS A  1 369 ? 37.401  51.321  0.876   1.00 44.55  ? 369 HIS A CD2 1 
ATOM   1607 C  CE1 . HIS A  1 369 ? 36.016  52.854  0.140   1.00 41.39  ? 369 HIS A CE1 1 
ATOM   1608 N  NE2 . HIS A  1 369 ? 36.957  52.004  -0.230  1.00 41.89  ? 369 HIS A NE2 1 
ATOM   1609 N  N   . LEU A  1 370 ? 37.418  51.730  6.570   1.00 46.26  ? 370 LEU A N   1 
ATOM   1610 C  CA  . LEU A  1 370 ? 37.153  51.511  8.002   1.00 48.84  ? 370 LEU A CA  1 
ATOM   1611 C  C   . LEU A  1 370 ? 36.986  52.832  8.771   1.00 51.87  ? 370 LEU A C   1 
ATOM   1612 O  O   . LEU A  1 370 ? 36.100  52.952  9.621   1.00 54.75  ? 370 LEU A O   1 
ATOM   1613 C  CB  . LEU A  1 370 ? 38.269  50.673  8.634   1.00 46.63  ? 370 LEU A CB  1 
ATOM   1614 C  CG  . LEU A  1 370 ? 38.406  49.213  8.183   1.00 43.26  ? 370 LEU A CG  1 
ATOM   1615 C  CD1 . LEU A  1 370 ? 39.804  48.693  8.476   1.00 44.49  ? 370 LEU A CD1 1 
ATOM   1616 C  CD2 . LEU A  1 370 ? 37.376  48.322  8.859   1.00 40.22  ? 370 LEU A CD2 1 
ATOM   1617 N  N   . LEU A  1 371 ? 37.844  53.806  8.469   1.00 51.23  ? 371 LEU A N   1 
ATOM   1618 C  CA  . LEU A  1 371 ? 37.764  55.152  9.064   1.00 50.84  ? 371 LEU A CA  1 
ATOM   1619 C  C   . LEU A  1 371 ? 36.574  55.979  8.577   1.00 50.12  ? 371 LEU A C   1 
ATOM   1620 O  O   . LEU A  1 371 ? 35.896  56.623  9.381   1.00 52.90  ? 371 LEU A O   1 
ATOM   1621 C  CB  . LEU A  1 371 ? 39.054  55.942  8.802   1.00 51.34  ? 371 LEU A CB  1 
ATOM   1622 C  CG  . LEU A  1 371 ? 40.118  55.858  9.894   1.00 50.28  ? 371 LEU A CG  1 
ATOM   1623 C  CD1 . LEU A  1 371 ? 40.519  54.422  10.195  1.00 53.95  ? 371 LEU A CD1 1 
ATOM   1624 C  CD2 . LEU A  1 371 ? 41.322  56.672  9.464   1.00 46.67  ? 371 LEU A CD2 1 
ATOM   1625 N  N   . SER A  1 372 ? 36.342  55.967  7.264   1.00 50.18  ? 372 SER A N   1 
ATOM   1626 C  CA  . SER A  1 372 ? 35.353  56.842  6.624   1.00 50.36  ? 372 SER A CA  1 
ATOM   1627 C  C   . SER A  1 372 ? 33.925  56.542  7.066   1.00 52.15  ? 372 SER A C   1 
ATOM   1628 O  O   . SER A  1 372 ? 33.583  55.399  7.369   1.00 54.27  ? 372 SER A O   1 
ATOM   1629 C  CB  . SER A  1 372 ? 35.438  56.735  5.097   1.00 51.70  ? 372 SER A CB  1 
ATOM   1630 O  OG  . SER A  1 372 ? 34.454  57.534  4.460   1.00 48.89  ? 372 SER A OG  1 
ATOM   1631 N  N   . ALA A  1 373 ? 33.109  57.592  7.083   1.00 50.77  ? 373 ALA A N   1 
ATOM   1632 C  CA  . ALA A  1 373 ? 31.694  57.518  7.453   1.00 48.10  ? 373 ALA A CA  1 
ATOM   1633 C  C   . ALA A  1 373 ? 30.813  57.038  6.306   1.00 48.88  ? 373 ALA A C   1 
ATOM   1634 O  O   . ALA A  1 373 ? 29.860  56.286  6.527   1.00 49.38  ? 373 ALA A O   1 
ATOM   1635 C  CB  . ALA A  1 373 ? 31.218  58.881  7.912   1.00 47.73  ? 373 ALA A CB  1 
ATOM   1636 N  N   . LEU A  1 374 ? 31.128  57.484  5.091   1.00 47.33  ? 374 LEU A N   1 
ATOM   1637 C  CA  . LEU A  1 374 ? 30.334  57.148  3.904   1.00 50.02  ? 374 LEU A CA  1 
ATOM   1638 C  C   . LEU A  1 374 ? 30.370  55.663  3.525   1.00 52.29  ? 374 LEU A C   1 
ATOM   1639 O  O   . LEU A  1 374 ? 29.434  55.167  2.895   1.00 53.86  ? 374 LEU A O   1 
ATOM   1640 C  CB  . LEU A  1 374 ? 30.755  58.008  2.706   1.00 50.73  ? 374 LEU A CB  1 
ATOM   1641 C  CG  . LEU A  1 374 ? 30.192  59.434  2.723   1.00 50.02  ? 374 LEU A CG  1 
ATOM   1642 C  CD1 . LEU A  1 374 ? 31.031  60.354  1.854   1.00 49.48  ? 374 LEU A CD1 1 
ATOM   1643 C  CD2 . LEU A  1 374 ? 28.735  59.457  2.274   1.00 47.94  ? 374 LEU A CD2 1 
ATOM   1644 N  N   . SER A  1 375 ? 31.442  54.970  3.908   1.00 55.10  ? 375 SER A N   1 
ATOM   1645 C  CA  . SER A  1 375 ? 31.585  53.531  3.658   1.00 58.77  ? 375 SER A CA  1 
ATOM   1646 C  C   . SER A  1 375 ? 31.564  52.684  4.941   1.00 56.42  ? 375 SER A C   1 
ATOM   1647 O  O   . SER A  1 375 ? 31.902  51.500  4.904   1.00 60.17  ? 375 SER A O   1 
ATOM   1648 C  CB  . SER A  1 375 ? 32.867  53.266  2.857   1.00 58.39  ? 375 SER A CB  1 
ATOM   1649 O  OG  . SER A  1 375 ? 33.996  53.808  3.516   1.00 58.63  ? 375 SER A OG  1 
ATOM   1650 N  N   . ARG A  1 376 ? 31.139  53.277  6.057   1.00 55.86  ? 376 ARG A N   1 
ATOM   1651 C  CA  . ARG A  1 376 ? 31.117  52.586  7.356   1.00 57.39  ? 376 ARG A CA  1 
ATOM   1652 C  C   . ARG A  1 376 ? 30.052  51.486  7.445   1.00 52.60  ? 376 ARG A C   1 
ATOM   1653 O  O   . ARG A  1 376 ? 30.245  50.509  8.166   1.00 48.40  ? 376 ARG A O   1 
ATOM   1654 C  CB  . ARG A  1 376 ? 30.925  53.594  8.502   1.00 64.43  ? 376 ARG A CB  1 
ATOM   1655 C  CG  . ARG A  1 376 ? 31.158  53.050  9.913   1.00 67.97  ? 376 ARG A CG  1 
ATOM   1656 C  CD  . ARG A  1 376 ? 32.622  52.744  10.204  1.00 67.38  ? 376 ARG A CD  1 
ATOM   1657 N  NE  . ARG A  1 376 ? 33.372  53.932  10.618  1.00 65.40  ? 376 ARG A NE  1 
ATOM   1658 C  CZ  . ARG A  1 376 ? 33.411  54.434  11.856  1.00 64.31  ? 376 ARG A CZ  1 
ATOM   1659 N  NH1 . ARG A  1 376 ? 34.139  55.523  12.097  1.00 65.71  ? 376 ARG A NH1 1 
ATOM   1660 N  NH2 . ARG A  1 376 ? 32.734  53.872  12.859  1.00 65.25  ? 376 ARG A NH2 1 
ATOM   1661 N  N   . ASP A  1 377 ? 28.945  51.642  6.718   1.00 54.46  ? 377 ASP A N   1 
ATOM   1662 C  CA  . ASP A  1 377 ? 27.854  50.645  6.716   1.00 60.72  ? 377 ASP A CA  1 
ATOM   1663 C  C   . ASP A  1 377 ? 27.767  49.800  5.425   1.00 63.51  ? 377 ASP A C   1 
ATOM   1664 O  O   . ASP A  1 377 ? 26.731  49.182  5.161   1.00 67.86  ? 377 ASP A O   1 
ATOM   1665 C  CB  . ASP A  1 377 ? 26.504  51.324  7.020   1.00 67.33  ? 377 ASP A CB  1 
ATOM   1666 C  CG  . ASP A  1 377 ? 26.024  52.237  5.895   1.00 76.99  ? 377 ASP A CG  1 
ATOM   1667 O  OD1 . ASP A  1 377 ? 26.793  53.129  5.478   1.00 78.02  ? 377 ASP A OD1 1 
ATOM   1668 O  OD2 . ASP A  1 377 ? 24.872  52.067  5.440   1.00 80.08  ? 377 ASP A OD2 1 
ATOM   1669 N  N   . LEU A  1 378 ? 28.855  49.753  4.652   1.00 61.93  ? 378 LEU A N   1 
ATOM   1670 C  CA  . LEU A  1 378 ? 28.886  49.053  3.352   1.00 58.74  ? 378 LEU A CA  1 
ATOM   1671 C  C   . LEU A  1 378 ? 29.648  47.722  3.308   1.00 58.31  ? 378 LEU A C   1 
ATOM   1672 O  O   . LEU A  1 378 ? 29.549  46.999  2.313   1.00 64.97  ? 378 LEU A O   1 
ATOM   1673 C  CB  . LEU A  1 378 ? 29.448  49.986  2.275   1.00 56.89  ? 378 LEU A CB  1 
ATOM   1674 C  CG  . LEU A  1 378 ? 28.567  51.176  1.893   1.00 56.43  ? 378 LEU A CG  1 
ATOM   1675 C  CD1 . LEU A  1 378 ? 29.306  52.044  0.896   1.00 58.03  ? 378 LEU A CD1 1 
ATOM   1676 C  CD2 . LEU A  1 378 ? 27.235  50.747  1.296   1.00 56.20  ? 378 LEU A CD2 1 
ATOM   1677 N  N   . PHE A  1 379 ? 30.403  47.403  4.359   1.00 59.85  ? 379 PHE A N   1 
ATOM   1678 C  CA  . PHE A  1 379 ? 31.124  46.120  4.454   1.00 57.71  ? 379 PHE A CA  1 
ATOM   1679 C  C   . PHE A  1 379 ? 31.152  45.583  5.895   1.00 56.34  ? 379 PHE A C   1 
ATOM   1680 O  O   . PHE A  1 379 ? 30.566  46.191  6.793   1.00 48.35  ? 379 PHE A O   1 
ATOM   1681 C  CB  . PHE A  1 379 ? 32.538  46.270  3.872   1.00 54.74  ? 379 PHE A CB  1 
ATOM   1682 C  CG  . PHE A  1 379 ? 33.437  47.172  4.669   1.00 50.55  ? 379 PHE A CG  1 
ATOM   1683 C  CD1 . PHE A  1 379 ? 33.406  48.549  4.483   1.00 49.13  ? 379 PHE A CD1 1 
ATOM   1684 C  CD2 . PHE A  1 379 ? 34.323  46.644  5.602   1.00 50.46  ? 379 PHE A CD2 1 
ATOM   1685 C  CE1 . PHE A  1 379 ? 34.238  49.381  5.217   1.00 48.33  ? 379 PHE A CE1 1 
ATOM   1686 C  CE2 . PHE A  1 379 ? 35.156  47.471  6.338   1.00 49.18  ? 379 PHE A CE2 1 
ATOM   1687 C  CZ  . PHE A  1 379 ? 35.115  48.843  6.144   1.00 47.85  ? 379 PHE A CZ  1 
ATOM   1688 N  N   . GLN A  1 380 ? 31.802  44.433  6.095   1.00 52.65  ? 380 GLN A N   1 
ATOM   1689 C  CA  . GLN A  1 380 ? 31.951  43.821  7.429   1.00 55.98  ? 380 GLN A CA  1 
ATOM   1690 C  C   . GLN A  1 380 ? 33.404  43.870  7.916   1.00 57.95  ? 380 GLN A C   1 
ATOM   1691 O  O   . GLN A  1 380 ? 33.739  44.685  8.779   1.00 64.97  ? 380 GLN A O   1 
ATOM   1692 C  CB  . GLN A  1 380 ? 31.413  42.377  7.447   1.00 53.89  ? 380 GLN A CB  1 
ATOM   1693 C  CG  . GLN A  1 380 ? 31.392  41.732  8.836   1.00 51.11  ? 380 GLN A CG  1 
ATOM   1694 C  CD  . GLN A  1 380 ? 31.071  40.245  8.814   1.00 53.78  ? 380 GLN A CD  1 
ATOM   1695 O  OE1 . GLN A  1 380 ? 31.436  39.527  7.881   1.00 56.95  ? 380 GLN A OE1 1 
ATOM   1696 N  NE2 . GLN A  1 380 ? 30.399  39.773  9.859   1.00 56.52  ? 380 GLN A NE2 1 
ATOM   1697 N  N   . ARG A  1 381 ? 34.254  43.011  7.353   1.00 54.33  ? 381 ARG A N   1 
ATOM   1698 C  CA  . ARG A  1 381 ? 35.622  42.804  7.841   1.00 54.25  ? 381 ARG A CA  1 
ATOM   1699 C  C   . ARG A  1 381 ? 36.643  43.402  6.885   1.00 55.26  ? 381 ARG A C   1 
ATOM   1700 O  O   . ARG A  1 381 ? 36.296  43.842  5.785   1.00 56.66  ? 381 ARG A O   1 
ATOM   1701 C  CB  . ARG A  1 381 ? 35.893  41.311  8.023   1.00 56.34  ? 381 ARG A CB  1 
ATOM   1702 C  CG  . ARG A  1 381 ? 34.965  40.646  9.018   1.00 60.20  ? 381 ARG A CG  1 
ATOM   1703 C  CD  . ARG A  1 381 ? 35.507  39.304  9.468   1.00 65.07  ? 381 ARG A CD  1 
ATOM   1704 N  NE  . ARG A  1 381 ? 34.564  38.627  10.356  1.00 66.08  ? 381 ARG A NE  1 
ATOM   1705 C  CZ  . ARG A  1 381 ? 33.535  37.869  9.969   1.00 72.55  ? 381 ARG A CZ  1 
ATOM   1706 N  NH1 . ARG A  1 381 ? 33.270  37.653  8.679   1.00 72.95  ? 381 ARG A NH1 1 
ATOM   1707 N  NH2 . ARG A  1 381 ? 32.753  37.314  10.892  1.00 84.39  ? 381 ARG A NH2 1 
ATOM   1708 N  N   . ALA A  1 382 ? 37.902  43.417  7.319   1.00 51.11  ? 382 ALA A N   1 
ATOM   1709 C  CA  . ALA A  1 382 ? 38.989  43.987  6.524   1.00 48.99  ? 382 ALA A CA  1 
ATOM   1710 C  C   . ALA A  1 382 ? 40.284  43.183  6.610   1.00 46.73  ? 382 ALA A C   1 
ATOM   1711 O  O   . ALA A  1 382 ? 40.691  42.763  7.696   1.00 50.10  ? 382 ALA A O   1 
ATOM   1712 C  CB  . ALA A  1 382 ? 39.242  45.418  6.956   1.00 46.90  ? 382 ALA A CB  1 
ATOM   1713 N  N   . ILE A  1 383 ? 40.913  42.975  5.452   1.00 44.66  ? 383 ILE A N   1 
ATOM   1714 C  CA  . ILE A  1 383 ? 42.285  42.465  5.360   1.00 42.90  ? 383 ILE A CA  1 
ATOM   1715 C  C   . ILE A  1 383 ? 43.157  43.563  4.747   1.00 44.99  ? 383 ILE A C   1 
ATOM   1716 O  O   . ILE A  1 383 ? 42.738  44.243  3.809   1.00 49.43  ? 383 ILE A O   1 
ATOM   1717 C  CB  . ILE A  1 383 ? 42.382  41.180  4.508   1.00 42.73  ? 383 ILE A CB  1 
ATOM   1718 C  CG1 . ILE A  1 383 ? 41.480  40.080  5.082   1.00 43.67  ? 383 ILE A CG1 1 
ATOM   1719 C  CG2 . ILE A  1 383 ? 43.827  40.686  4.423   1.00 43.63  ? 383 ILE A CG2 1 
ATOM   1720 C  CD1 . ILE A  1 383 ? 41.255  38.904  4.153   1.00 43.33  ? 383 ILE A CD1 1 
ATOM   1721 N  N   . LEU A  1 384 ? 44.368  43.722  5.283   1.00 45.33  ? 384 LEU A N   1 
ATOM   1722 C  CA  . LEU A  1 384 ? 45.277  44.804  4.884   1.00 46.45  ? 384 LEU A CA  1 
ATOM   1723 C  C   . LEU A  1 384 ? 46.708  44.298  4.691   1.00 46.00  ? 384 LEU A C   1 
ATOM   1724 O  O   . LEU A  1 384 ? 47.493  44.236  5.638   1.00 41.28  ? 384 LEU A O   1 
ATOM   1725 C  CB  . LEU A  1 384 ? 45.263  45.925  5.926   1.00 50.99  ? 384 LEU A CB  1 
ATOM   1726 C  CG  . LEU A  1 384 ? 43.932  46.634  6.202   1.00 53.65  ? 384 LEU A CG  1 
ATOM   1727 C  CD1 . LEU A  1 384 ? 43.106  45.928  7.271   1.00 53.06  ? 384 LEU A CD1 1 
ATOM   1728 C  CD2 . LEU A  1 384 ? 44.205  48.059  6.644   1.00 55.92  ? 384 LEU A CD2 1 
ATOM   1729 N  N   . GLN A  1 385 ? 47.038  43.948  3.452   1.00 47.00  ? 385 GLN A N   1 
ATOM   1730 C  CA  . GLN A  1 385 ? 48.364  43.434  3.105   1.00 46.46  ? 385 GLN A CA  1 
ATOM   1731 C  C   . GLN A  1 385 ? 49.370  44.564  2.868   1.00 44.44  ? 385 GLN A C   1 
ATOM   1732 O  O   . GLN A  1 385 ? 49.310  45.248  1.849   1.00 44.15  ? 385 GLN A O   1 
ATOM   1733 C  CB  . GLN A  1 385 ? 48.276  42.550  1.859   1.00 51.39  ? 385 GLN A CB  1 
ATOM   1734 C  CG  . GLN A  1 385 ? 47.475  41.267  2.053   1.00 56.14  ? 385 GLN A CG  1 
ATOM   1735 C  CD  . GLN A  1 385 ? 47.111  40.581  0.744   1.00 61.71  ? 385 GLN A CD  1 
ATOM   1736 O  OE1 . GLN A  1 385 ? 46.086  39.905  0.655   1.00 58.88  ? 385 GLN A OE1 1 
ATOM   1737 N  NE2 . GLN A  1 385 ? 47.947  40.750  -0.276  1.00 66.03  ? 385 GLN A NE2 1 
ATOM   1738 N  N   . SER A  1 386 ? 50.287  44.751  3.817   1.00 45.41  ? 386 SER A N   1 
ATOM   1739 C  CA  . SER A  1 386 ? 51.379  45.732  3.705   1.00 46.70  ? 386 SER A CA  1 
ATOM   1740 C  C   . SER A  1 386 ? 50.894  47.155  3.390   1.00 49.74  ? 386 SER A C   1 
ATOM   1741 O  O   . SER A  1 386 ? 51.311  47.766  2.403   1.00 50.39  ? 386 SER A O   1 
ATOM   1742 C  CB  . SER A  1 386 ? 52.403  45.265  2.663   1.00 48.98  ? 386 SER A CB  1 
ATOM   1743 O  OG  . SER A  1 386 ? 52.887  43.968  2.971   1.00 54.38  ? 386 SER A OG  1 
ATOM   1744 N  N   . GLY A  1 387 ? 50.000  47.664  4.232   1.00 52.25  ? 387 GLY A N   1 
ATOM   1745 C  CA  . GLY A  1 387 ? 49.498  49.033  4.096   1.00 53.15  ? 387 GLY A CA  1 
ATOM   1746 C  C   . GLY A  1 387 ? 48.610  49.477  5.246   1.00 54.75  ? 387 GLY A C   1 
ATOM   1747 O  O   . GLY A  1 387 ? 48.007  48.650  5.934   1.00 58.71  ? 387 GLY A O   1 
ATOM   1748 N  N   . SER A  1 388 ? 48.536  50.793  5.446   1.00 52.99  ? 388 SER A N   1 
ATOM   1749 C  CA  . SER A  1 388 ? 47.715  51.398  6.504   1.00 53.95  ? 388 SER A CA  1 
ATOM   1750 C  C   . SER A  1 388 ? 47.519  52.906  6.242   1.00 54.22  ? 388 SER A C   1 
ATOM   1751 O  O   . SER A  1 388 ? 48.305  53.506  5.503   1.00 57.95  ? 388 SER A O   1 
ATOM   1752 C  CB  . SER A  1 388 ? 48.372  51.168  7.870   1.00 54.76  ? 388 SER A CB  1 
ATOM   1753 O  OG  . SER A  1 388 ? 49.329  52.172  8.144   1.00 61.14  ? 388 SER A OG  1 
ATOM   1754 N  N   . PRO A  1 389 ? 46.502  53.535  6.879   1.00 55.55  ? 389 PRO A N   1 
ATOM   1755 C  CA  . PRO A  1 389 ? 46.166  54.927  6.551   1.00 58.17  ? 389 PRO A CA  1 
ATOM   1756 C  C   . PRO A  1 389 ? 47.097  55.978  7.167   1.00 60.10  ? 389 PRO A C   1 
ATOM   1757 O  O   . PRO A  1 389 ? 46.992  57.160  6.827   1.00 61.72  ? 389 PRO A O   1 
ATOM   1758 C  CB  . PRO A  1 389 ? 44.765  55.082  7.141   1.00 59.30  ? 389 PRO A CB  1 
ATOM   1759 C  CG  . PRO A  1 389 ? 44.764  54.177  8.331   1.00 57.41  ? 389 PRO A CG  1 
ATOM   1760 C  CD  . PRO A  1 389 ? 45.808  53.108  8.111   1.00 57.08  ? 389 PRO A CD  1 
ATOM   1761 N  N   . THR A  1 390 ? 47.994  55.541  8.050   1.00 59.92  ? 390 THR A N   1 
ATOM   1762 C  CA  . THR A  1 390 ? 48.922  56.422  8.757   1.00 58.49  ? 390 THR A CA  1 
ATOM   1763 C  C   . THR A  1 390 ? 50.299  56.461  8.081   1.00 53.39  ? 390 THR A C   1 
ATOM   1764 O  O   . THR A  1 390 ? 51.245  57.024  8.639   1.00 53.18  ? 390 THR A O   1 
ATOM   1765 C  CB  . THR A  1 390 ? 49.052  56.019  10.252  1.00 63.26  ? 390 THR A CB  1 
ATOM   1766 O  OG1 . THR A  1 390 ? 49.876  56.969  10.941  1.00 80.64  ? 390 THR A OG1 1 
ATOM   1767 C  CG2 . THR A  1 390 ? 49.638  54.607  10.436  1.00 64.74  ? 390 THR A CG2 1 
ATOM   1768 N  N   . ALA A  1 391 ? 50.407  55.868  6.889   1.00 52.57  ? 391 ALA A N   1 
ATOM   1769 C  CA  . ALA A  1 391 ? 51.653  55.879  6.123   1.00 48.40  ? 391 ALA A CA  1 
ATOM   1770 C  C   . ALA A  1 391 ? 51.977  57.301  5.644   1.00 47.88  ? 391 ALA A C   1 
ATOM   1771 O  O   . ALA A  1 391 ? 51.056  58.071  5.359   1.00 46.61  ? 391 ALA A O   1 
ATOM   1772 C  CB  . ALA A  1 391 ? 51.557  54.926  4.942   1.00 44.23  ? 391 ALA A CB  1 
ATOM   1773 N  N   . PRO A  1 392 ? 53.280  57.659  5.566   1.00 48.43  ? 392 PRO A N   1 
ATOM   1774 C  CA  . PRO A  1 392 ? 53.680  59.005  5.110   1.00 45.79  ? 392 PRO A CA  1 
ATOM   1775 C  C   . PRO A  1 392 ? 53.146  59.396  3.726   1.00 44.66  ? 392 PRO A C   1 
ATOM   1776 O  O   . PRO A  1 392 ? 52.751  60.545  3.513   1.00 51.00  ? 392 PRO A O   1 
ATOM   1777 C  CB  . PRO A  1 392 ? 55.212  58.922  5.064   1.00 47.51  ? 392 PRO A CB  1 
ATOM   1778 C  CG  . PRO A  1 392 ? 55.574  57.819  5.989   1.00 47.65  ? 392 PRO A CG  1 
ATOM   1779 C  CD  . PRO A  1 392 ? 54.458  56.828  5.890   1.00 48.54  ? 392 PRO A CD  1 
ATOM   1780 N  N   . TRP A  1 393 ? 53.144  58.427  2.815   1.00 44.84  ? 393 TRP A N   1 
ATOM   1781 C  CA  . TRP A  1 393 ? 52.738  58.621  1.413   1.00 42.34  ? 393 TRP A CA  1 
ATOM   1782 C  C   . TRP A  1 393 ? 51.239  58.454  1.152   1.00 44.91  ? 393 TRP A C   1 
ATOM   1783 O  O   . TRP A  1 393 ? 50.741  58.915  0.123   1.00 46.04  ? 393 TRP A O   1 
ATOM   1784 C  CB  . TRP A  1 393 ? 53.503  57.655  0.499   1.00 42.10  ? 393 TRP A CB  1 
ATOM   1785 C  CG  . TRP A  1 393 ? 53.328  56.195  0.835   1.00 42.24  ? 393 TRP A CG  1 
ATOM   1786 C  CD1 . TRP A  1 393 ? 54.135  55.437  1.636   1.00 43.85  ? 393 TRP A CD1 1 
ATOM   1787 C  CD2 . TRP A  1 393 ? 52.285  55.325  0.381   1.00 40.91  ? 393 TRP A CD2 1 
ATOM   1788 N  NE1 . TRP A  1 393 ? 53.658  54.154  1.714   1.00 45.39  ? 393 TRP A NE1 1 
ATOM   1789 C  CE2 . TRP A  1 393 ? 52.525  54.055  0.952   1.00 41.35  ? 393 TRP A CE2 1 
ATOM   1790 C  CE3 . TRP A  1 393 ? 51.170  55.493  -0.452  1.00 42.39  ? 393 TRP A CE3 1 
ATOM   1791 C  CZ2 . TRP A  1 393 ? 51.691  52.957  0.716   1.00 41.97  ? 393 TRP A CZ2 1 
ATOM   1792 C  CZ3 . TRP A  1 393 ? 50.340  54.400  -0.687  1.00 43.40  ? 393 TRP A CZ3 1 
ATOM   1793 C  CH2 . TRP A  1 393 ? 50.607  53.148  -0.103  1.00 43.83  ? 393 TRP A CH2 1 
ATOM   1794 N  N   . ALA A  1 394 ? 50.545  57.772  2.066   1.00 48.84  ? 394 ALA A N   1 
ATOM   1795 C  CA  . ALA A  1 394 ? 49.115  57.441  1.922   1.00 45.06  ? 394 ALA A CA  1 
ATOM   1796 C  C   . ALA A  1 394 ? 48.232  58.657  1.682   1.00 41.81  ? 394 ALA A C   1 
ATOM   1797 O  O   . ALA A  1 394 ? 47.335  58.625  0.835   1.00 43.30  ? 394 ALA A O   1 
ATOM   1798 C  CB  . ALA A  1 394 ? 48.626  56.701  3.155   1.00 43.00  ? 394 ALA A CB  1 
ATOM   1799 N  N   . LEU A  1 395 ? 48.481  59.706  2.461   1.00 41.14  ? 395 LEU A N   1 
ATOM   1800 C  CA  . LEU A  1 395 ? 47.783  60.982  2.325   1.00 43.17  ? 395 LEU A CA  1 
ATOM   1801 C  C   . LEU A  1 395 ? 48.732  62.138  2.049   1.00 44.86  ? 395 LEU A C   1 
ATOM   1802 O  O   . LEU A  1 395 ? 49.951  62.027  2.211   1.00 44.31  ? 395 LEU A O   1 
ATOM   1803 C  CB  . LEU A  1 395 ? 46.972  61.289  3.585   1.00 44.01  ? 395 LEU A CB  1 
ATOM   1804 C  CG  . LEU A  1 395 ? 45.566  60.691  3.624   1.00 46.65  ? 395 LEU A CG  1 
ATOM   1805 C  CD1 . LEU A  1 395 ? 45.602  59.213  3.977   1.00 45.54  ? 395 LEU A CD1 1 
ATOM   1806 C  CD2 . LEU A  1 395 ? 44.716  61.458  4.622   1.00 50.54  ? 395 LEU A CD2 1 
ATOM   1807 N  N   . VAL A  1 396 ? 48.132  63.246  1.632   1.00 43.05  ? 396 VAL A N   1 
ATOM   1808 C  CA  . VAL A  1 396 ? 48.831  64.501  1.398   1.00 42.96  ? 396 VAL A CA  1 
ATOM   1809 C  C   . VAL A  1 396 ? 47.938  65.621  1.929   1.00 38.86  ? 396 VAL A C   1 
ATOM   1810 O  O   . VAL A  1 396 ? 46.716  65.483  1.947   1.00 40.98  ? 396 VAL A O   1 
ATOM   1811 C  CB  . VAL A  1 396 ? 49.159  64.678  -0.104  1.00 47.93  ? 396 VAL A CB  1 
ATOM   1812 C  CG1 . VAL A  1 396 ? 47.895  64.857  -0.941  1.00 50.64  ? 396 VAL A CG1 1 
ATOM   1813 C  CG2 . VAL A  1 396 ? 50.141  65.821  -0.316  1.00 51.28  ? 396 VAL A CG2 1 
ATOM   1814 N  N   . SER A  1 397 ? 48.550  66.714  2.373   1.00 40.54  ? 397 SER A N   1 
ATOM   1815 C  CA  . SER A  1 397 ? 47.806  67.852  2.916   1.00 46.85  ? 397 SER A CA  1 
ATOM   1816 C  C   . SER A  1 397 ? 47.058  68.612  1.821   1.00 51.84  ? 397 SER A C   1 
ATOM   1817 O  O   . SER A  1 397 ? 47.441  68.564  0.651   1.00 53.06  ? 397 SER A O   1 
ATOM   1818 C  CB  . SER A  1 397 ? 48.753  68.804  3.649   1.00 46.41  ? 397 SER A CB  1 
ATOM   1819 O  OG  . SER A  1 397 ? 49.702  69.373  2.761   1.00 46.28  ? 397 SER A OG  1 
ATOM   1820 N  N   . ARG A  1 398 ? 45.997  69.313  2.220   1.00 56.14  ? 398 ARG A N   1 
ATOM   1821 C  CA  . ARG A  1 398 ? 45.247  70.208  1.329   1.00 56.53  ? 398 ARG A CA  1 
ATOM   1822 C  C   . ARG A  1 398 ? 46.129  71.342  0.775   1.00 54.74  ? 398 ARG A C   1 
ATOM   1823 O  O   . ARG A  1 398 ? 45.938  71.781  -0.361  1.00 53.14  ? 398 ARG A O   1 
ATOM   1824 C  CB  . ARG A  1 398 ? 44.028  70.801  2.058   1.00 63.64  ? 398 ARG A CB  1 
ATOM   1825 C  CG  . ARG A  1 398 ? 42.990  69.776  2.508   1.00 66.16  ? 398 ARG A CG  1 
ATOM   1826 C  CD  . ARG A  1 398 ? 41.650  70.411  2.872   1.00 66.14  ? 398 ARG A CD  1 
ATOM   1827 N  NE  . ARG A  1 398 ? 41.723  71.222  4.093   1.00 74.39  ? 398 ARG A NE  1 
ATOM   1828 C  CZ  . ARG A  1 398 ? 41.859  72.552  4.149   1.00 89.17  ? 398 ARG A CZ  1 
ATOM   1829 N  NH1 . ARG A  1 398 ? 41.944  73.302  3.047   1.00 88.45  ? 398 ARG A NH1 1 
ATOM   1830 N  NH2 . ARG A  1 398 ? 41.910  73.149  5.338   1.00 96.06  ? 398 ARG A NH2 1 
ATOM   1831 N  N   . GLU A  1 399 ? 47.095  71.795  1.578   1.00 56.35  ? 399 GLU A N   1 
ATOM   1832 C  CA  . GLU A  1 399 ? 48.012  72.877  1.192   1.00 61.73  ? 399 GLU A CA  1 
ATOM   1833 C  C   . GLU A  1 399 ? 48.977  72.429  0.091   1.00 60.17  ? 399 GLU A C   1 
ATOM   1834 O  O   . GLU A  1 399 ? 49.213  73.164  -0.870  1.00 52.73  ? 399 GLU A O   1 
ATOM   1835 C  CB  . GLU A  1 399 ? 48.814  73.388  2.401   1.00 65.13  ? 399 GLU A CB  1 
ATOM   1836 C  CG  . GLU A  1 399 ? 47.978  74.027  3.506   1.00 68.94  ? 399 GLU A CG  1 
ATOM   1837 C  CD  . GLU A  1 399 ? 47.560  73.048  4.590   1.00 70.91  ? 399 GLU A CD  1 
ATOM   1838 O  OE1 . GLU A  1 399 ? 48.445  72.538  5.310   1.00 69.71  ? 399 GLU A OE1 1 
ATOM   1839 O  OE2 . GLU A  1 399 ? 46.341  72.794  4.725   1.00 66.70  ? 399 GLU A OE2 1 
ATOM   1840 N  N   . GLU A  1 400 ? 49.534  71.229  0.246   1.00 63.93  ? 400 GLU A N   1 
ATOM   1841 C  CA  . GLU A  1 400 ? 50.435  70.641  -0.752  1.00 61.73  ? 400 GLU A CA  1 
ATOM   1842 C  C   . GLU A  1 400 ? 49.679  70.113  -1.974  1.00 64.42  ? 400 GLU A C   1 
ATOM   1843 O  O   . GLU A  1 400 ? 50.167  70.237  -3.098  1.00 67.43  ? 400 GLU A O   1 
ATOM   1844 C  CB  . GLU A  1 400 ? 51.277  69.519  -0.125  1.00 58.81  ? 400 GLU A CB  1 
ATOM   1845 C  CG  . GLU A  1 400 ? 52.366  68.934  -1.029  1.00 61.30  ? 400 GLU A CG  1 
ATOM   1846 C  CD  . GLU A  1 400 ? 53.467  69.918  -1.408  1.00 61.61  ? 400 GLU A CD  1 
ATOM   1847 O  OE1 . GLU A  1 400 ? 53.669  70.923  -0.691  1.00 53.62  ? 400 GLU A OE1 1 
ATOM   1848 O  OE2 . GLU A  1 400 ? 54.143  69.677  -2.431  1.00 59.41  ? 400 GLU A OE2 1 
ATOM   1849 N  N   . ALA A  1 401 ? 48.508  69.516  -1.749  1.00 67.45  ? 401 ALA A N   1 
ATOM   1850 C  CA  . ALA A  1 401 ? 47.674  68.979  -2.835  1.00 70.81  ? 401 ALA A CA  1 
ATOM   1851 C  C   . ALA A  1 401 ? 47.194  70.053  -3.818  1.00 78.82  ? 401 ALA A C   1 
ATOM   1852 O  O   . ALA A  1 401 ? 47.144  69.808  -5.025  1.00 84.68  ? 401 ALA A O   1 
ATOM   1853 C  CB  . ALA A  1 401 ? 46.488  68.219  -2.266  1.00 68.61  ? 401 ALA A CB  1 
ATOM   1854 N  N   . THR A  1 402 ? 46.838  71.227  -3.293  1.00 73.91  ? 402 THR A N   1 
ATOM   1855 C  CA  . THR A  1 402 ? 46.505  72.401  -4.118  1.00 73.07  ? 402 THR A CA  1 
ATOM   1856 C  C   . THR A  1 402 ? 47.674  72.833  -5.009  1.00 70.53  ? 402 THR A C   1 
ATOM   1857 O  O   . THR A  1 402 ? 47.483  73.111  -6.192  1.00 80.02  ? 402 THR A O   1 
ATOM   1858 C  CB  . THR A  1 402 ? 46.090  73.620  -3.259  1.00 72.18  ? 402 THR A CB  1 
ATOM   1859 O  OG1 . THR A  1 402 ? 46.916  73.700  -2.091  1.00 86.91  ? 402 THR A OG1 1 
ATOM   1860 C  CG2 . THR A  1 402 ? 44.639  73.527  -2.834  1.00 71.56  ? 402 THR A CG2 1 
ATOM   1861 N  N   . LEU A  1 403 ? 48.874  72.883  -4.428  1.00 62.24  ? 403 LEU A N   1 
ATOM   1862 C  CA  . LEU A  1 403 ? 50.090  73.319  -5.143  1.00 63.52  ? 403 LEU A CA  1 
ATOM   1863 C  C   . LEU A  1 403 ? 50.531  72.360  -6.255  1.00 64.52  ? 403 LEU A C   1 
ATOM   1864 O  O   . LEU A  1 403 ? 51.017  72.804  -7.296  1.00 59.48  ? 403 LEU A O   1 
ATOM   1865 C  CB  . LEU A  1 403 ? 51.256  73.570  -4.167  1.00 65.78  ? 403 LEU A CB  1 
ATOM   1866 C  CG  . LEU A  1 403 ? 51.522  75.023  -3.748  1.00 65.11  ? 403 LEU A CG  1 
ATOM   1867 C  CD1 . LEU A  1 403 ? 50.290  75.724  -3.187  1.00 66.72  ? 403 LEU A CD1 1 
ATOM   1868 C  CD2 . LEU A  1 403 ? 52.661  75.056  -2.739  1.00 60.25  ? 403 LEU A CD2 1 
ATOM   1869 N  N   . ARG A  1 404 ? 50.369  71.057  -6.028  1.00 67.96  ? 404 ARG A N   1 
ATOM   1870 C  CA  . ARG A  1 404 ? 50.737  70.034  -7.021  1.00 63.81  ? 404 ARG A CA  1 
ATOM   1871 C  C   . ARG A  1 404 ? 49.813  70.015  -8.236  1.00 56.16  ? 404 ARG A C   1 
ATOM   1872 O  O   . ARG A  1 404 ? 50.260  69.737  -9.350  1.00 58.77  ? 404 ARG A O   1 
ATOM   1873 C  CB  . ARG A  1 404 ? 50.794  68.645  -6.380  1.00 62.96  ? 404 ARG A CB  1 
ATOM   1874 C  CG  . ARG A  1 404 ? 51.989  68.474  -5.463  1.00 64.07  ? 404 ARG A CG  1 
ATOM   1875 C  CD  . ARG A  1 404 ? 52.005  67.123  -4.774  1.00 65.56  ? 404 ARG A CD  1 
ATOM   1876 N  NE  . ARG A  1 404 ? 53.012  67.077  -3.714  1.00 66.64  ? 404 ARG A NE  1 
ATOM   1877 C  CZ  . ARG A  1 404 ? 53.241  66.033  -2.917  1.00 64.80  ? 404 ARG A CZ  1 
ATOM   1878 N  NH1 . ARG A  1 404 ? 52.537  64.908  -3.043  1.00 63.97  ? 404 ARG A NH1 1 
ATOM   1879 N  NH2 . ARG A  1 404 ? 54.188  66.116  -1.985  1.00 67.11  ? 404 ARG A NH2 1 
ATOM   1880 N  N   . ALA A  1 405 ? 48.531  70.294  -8.017  1.00 51.92  ? 405 ALA A N   1 
ATOM   1881 C  CA  . ALA A  1 405 ? 47.580  70.457  -9.115  1.00 55.41  ? 405 ALA A CA  1 
ATOM   1882 C  C   . ALA A  1 405 ? 47.944  71.663  -9.989  1.00 57.59  ? 405 ALA A C   1 
ATOM   1883 O  O   . ALA A  1 405 ? 47.817  71.606  -11.217 1.00 63.85  ? 405 ALA A O   1 
ATOM   1884 C  CB  . ALA A  1 405 ? 46.173  70.605  -8.572  1.00 55.32  ? 405 ALA A CB  1 
ATOM   1885 N  N   . LEU A  1 406 ? 48.387  72.744  -9.347  1.00 61.11  ? 406 LEU A N   1 
ATOM   1886 C  CA  . LEU A  1 406 ? 48.893  73.927  -10.047 1.00 60.51  ? 406 LEU A CA  1 
ATOM   1887 C  C   . LEU A  1 406 ? 50.202  73.638  -10.795 1.00 59.07  ? 406 LEU A C   1 
ATOM   1888 O  O   . LEU A  1 406 ? 50.401  74.137  -11.907 1.00 59.78  ? 406 LEU A O   1 
ATOM   1889 C  CB  . LEU A  1 406 ? 49.086  75.086  -9.062  1.00 62.60  ? 406 LEU A CB  1 
ATOM   1890 C  CG  . LEU A  1 406 ? 47.813  75.608  -8.382  1.00 62.32  ? 406 LEU A CG  1 
ATOM   1891 C  CD1 . LEU A  1 406 ? 48.142  76.418  -7.135  1.00 61.34  ? 406 LEU A CD1 1 
ATOM   1892 C  CD2 . LEU A  1 406 ? 46.980  76.440  -9.345  1.00 67.28  ? 406 LEU A CD2 1 
ATOM   1893 N  N   . ARG A  1 407 ? 51.085  72.844  -10.183 1.00 57.08  ? 407 ARG A N   1 
ATOM   1894 C  CA  . ARG A  1 407 ? 52.312  72.365  -10.844 1.00 59.64  ? 407 ARG A CA  1 
ATOM   1895 C  C   . ARG A  1 407 ? 51.991  71.539  -12.086 1.00 57.67  ? 407 ARG A C   1 
ATOM   1896 O  O   . ARG A  1 407 ? 52.648  71.687  -13.118 1.00 61.81  ? 407 ARG A O   1 
ATOM   1897 C  CB  . ARG A  1 407 ? 53.155  71.498  -9.902  1.00 66.16  ? 407 ARG A CB  1 
ATOM   1898 C  CG  . ARG A  1 407 ? 53.951  72.242  -8.842  1.00 73.95  ? 407 ARG A CG  1 
ATOM   1899 C  CD  . ARG A  1 407 ? 54.557  71.250  -7.855  1.00 78.66  ? 407 ARG A CD  1 
ATOM   1900 N  NE  . ARG A  1 407 ? 55.021  71.876  -6.615  1.00 79.49  ? 407 ARG A NE  1 
ATOM   1901 C  CZ  . ARG A  1 407 ? 55.378  71.218  -5.508  1.00 78.56  ? 407 ARG A CZ  1 
ATOM   1902 N  NH1 . ARG A  1 407 ? 55.331  69.886  -5.447  1.00 76.19  ? 407 ARG A NH1 1 
ATOM   1903 N  NH2 . ARG A  1 407 ? 55.784  71.901  -4.441  1.00 80.77  ? 407 ARG A NH2 1 
ATOM   1904 N  N   . LEU A  1 408 ? 51.000  70.654  -11.965 1.00 58.06  ? 408 LEU A N   1 
ATOM   1905 C  CA  . LEU A  1 408 ? 50.545  69.833  -13.090 1.00 55.84  ? 408 LEU A CA  1 
ATOM   1906 C  C   . LEU A  1 408 ? 50.054  70.707  -14.232 1.00 51.91  ? 408 LEU A C   1 
ATOM   1907 O  O   . LEU A  1 408 ? 50.476  70.539  -15.373 1.00 49.45  ? 408 LEU A O   1 
ATOM   1908 C  CB  . LEU A  1 408 ? 49.428  68.874  -12.661 1.00 56.67  ? 408 LEU A CB  1 
ATOM   1909 C  CG  . LEU A  1 408 ? 48.961  67.854  -13.708 1.00 57.99  ? 408 LEU A CG  1 
ATOM   1910 C  CD1 . LEU A  1 408 ? 50.081  66.900  -14.089 1.00 59.28  ? 408 LEU A CD1 1 
ATOM   1911 C  CD2 . LEU A  1 408 ? 47.761  67.068  -13.207 1.00 58.10  ? 408 LEU A CD2 1 
ATOM   1912 N  N   . ALA A  1 409 ? 49.166  71.641  -13.906 1.00 53.01  ? 409 ALA A N   1 
ATOM   1913 C  CA  . ALA A  1 409 ? 48.679  72.630  -14.867 1.00 57.21  ? 409 ALA A CA  1 
ATOM   1914 C  C   . ALA A  1 409 ? 49.831  73.415  -15.516 1.00 64.50  ? 409 ALA A C   1 
ATOM   1915 O  O   . ALA A  1 409 ? 49.852  73.600  -16.732 1.00 67.75  ? 409 ALA A O   1 
ATOM   1916 C  CB  . ALA A  1 409 ? 47.702  73.577  -14.189 1.00 57.83  ? 409 ALA A CB  1 
ATOM   1917 N  N   . GLU A  1 410 ? 50.791  73.848  -14.700 1.00 66.83  ? 410 GLU A N   1 
ATOM   1918 C  CA  . GLU A  1 410 ? 51.982  74.561  -15.186 1.00 66.20  ? 410 GLU A CA  1 
ATOM   1919 C  C   . GLU A  1 410 ? 52.817  73.721  -16.158 1.00 65.71  ? 410 GLU A C   1 
ATOM   1920 O  O   . GLU A  1 410 ? 53.207  74.200  -17.226 1.00 67.55  ? 410 GLU A O   1 
ATOM   1921 C  CB  . GLU A  1 410 ? 52.853  75.004  -14.005 1.00 64.32  ? 410 GLU A CB  1 
ATOM   1922 C  CG  . GLU A  1 410 ? 54.000  75.936  -14.384 1.00 62.61  ? 410 GLU A CG  1 
ATOM   1923 C  CD  . GLU A  1 410 ? 54.513  76.770  -13.220 1.00 63.96  ? 410 GLU A CD  1 
ATOM   1924 O  OE1 . GLU A  1 410 ? 54.512  76.274  -12.072 1.00 57.63  ? 410 GLU A OE1 1 
ATOM   1925 O  OE2 . GLU A  1 410 ? 54.926  77.926  -13.454 1.00 68.22  ? 410 GLU A OE2 1 
ATOM   1926 N  N   . ALA A  1 411 ? 53.082  72.476  -15.773 1.00 65.33  ? 411 ALA A N   1 
ATOM   1927 C  CA  . ALA A  1 411 ? 53.862  71.538  -16.591 1.00 68.54  ? 411 ALA A CA  1 
ATOM   1928 C  C   . ALA A  1 411 ? 53.170  71.114  -17.896 1.00 67.88  ? 411 ALA A C   1 
ATOM   1929 O  O   . ALA A  1 411 ? 53.838  70.923  -18.916 1.00 74.71  ? 411 ALA A O   1 
ATOM   1930 C  CB  . ALA A  1 411 ? 54.230  70.311  -15.769 1.00 68.42  ? 411 ALA A CB  1 
ATOM   1931 N  N   . VAL A  1 412 ? 51.845  70.969  -17.857 1.00 68.34  ? 412 VAL A N   1 
ATOM   1932 C  CA  . VAL A  1 412 ? 51.049  70.577  -19.036 1.00 69.16  ? 412 VAL A CA  1 
ATOM   1933 C  C   . VAL A  1 412 ? 50.827  71.761  -20.001 1.00 64.30  ? 412 VAL A C   1 
ATOM   1934 O  O   . VAL A  1 412 ? 50.594  71.555  -21.198 1.00 58.00  ? 412 VAL A O   1 
ATOM   1935 C  CB  . VAL A  1 412 ? 49.716  69.911  -18.599 1.00 69.15  ? 412 VAL A CB  1 
ATOM   1936 C  CG1 . VAL A  1 412 ? 48.824  69.558  -19.782 1.00 71.85  ? 412 VAL A CG1 1 
ATOM   1937 C  CG2 . VAL A  1 412 ? 50.011  68.633  -17.828 1.00 70.63  ? 412 VAL A CG2 1 
ATOM   1938 N  N   . GLY A  1 413 ? 50.925  72.985  -19.483 1.00 66.26  ? 413 GLY A N   1 
ATOM   1939 C  CA  . GLY A  1 413 ? 50.795  74.211  -20.287 1.00 69.94  ? 413 GLY A CA  1 
ATOM   1940 C  C   . GLY A  1 413 ? 49.432  74.852  -20.124 1.00 75.49  ? 413 GLY A C   1 
ATOM   1941 O  O   . GLY A  1 413 ? 48.754  75.157  -21.110 1.00 79.21  ? 413 GLY A O   1 
ATOM   1942 N  N   . CYS A  1 414 ? 49.055  75.066  -18.865 1.00 78.15  ? 414 CYS A N   1 
ATOM   1943 C  CA  . CYS A  1 414 ? 47.730  75.557  -18.478 1.00 74.64  ? 414 CYS A CA  1 
ATOM   1944 C  C   . CYS A  1 414 ? 47.866  76.766  -17.543 1.00 71.92  ? 414 CYS A C   1 
ATOM   1945 O  O   . CYS A  1 414 ? 48.950  76.996  -17.004 1.00 71.67  ? 414 CYS A O   1 
ATOM   1946 C  CB  . CYS A  1 414 ? 46.944  74.435  -17.789 1.00 74.87  ? 414 CYS A CB  1 
ATOM   1947 S  SG  . CYS A  1 414 ? 45.779  73.580  -18.867 1.00 87.42  ? 414 CYS A SG  1 
ATOM   1948 N  N   . PRO A  1 415 ? 46.781  77.553  -17.361 1.00 66.90  ? 415 PRO A N   1 
ATOM   1949 C  CA  . PRO A  1 415 ? 46.812  78.604  -16.337 1.00 72.92  ? 415 PRO A CA  1 
ATOM   1950 C  C   . PRO A  1 415 ? 46.944  78.027  -14.926 1.00 79.78  ? 415 PRO A C   1 
ATOM   1951 O  O   . PRO A  1 415 ? 46.156  77.162  -14.538 1.00 79.47  ? 415 PRO A O   1 
ATOM   1952 C  CB  . PRO A  1 415 ? 45.468  79.317  -16.524 1.00 69.12  ? 415 PRO A CB  1 
ATOM   1953 C  CG  . PRO A  1 415 ? 45.136  79.095  -17.955 1.00 65.25  ? 415 PRO A CG  1 
ATOM   1954 C  CD  . PRO A  1 415 ? 45.601  77.698  -18.234 1.00 62.72  ? 415 PRO A CD  1 
ATOM   1955 N  N   . HIS A  1 416 ? 47.934  78.516  -14.182 1.00 81.30  ? 416 HIS A N   1 
ATOM   1956 C  CA  . HIS A  1 416 ? 48.383  77.872  -12.941 1.00 79.90  ? 416 HIS A CA  1 
ATOM   1957 C  C   . HIS A  1 416 ? 48.568  78.869  -11.796 1.00 78.39  ? 416 HIS A C   1 
ATOM   1958 O  O   . HIS A  1 416 ? 49.632  78.945  -11.172 1.00 72.96  ? 416 HIS A O   1 
ATOM   1959 C  CB  . HIS A  1 416 ? 49.661  77.060  -13.197 1.00 83.34  ? 416 HIS A CB  1 
ATOM   1960 C  CG  . HIS A  1 416 ? 50.722  77.791  -13.964 1.00 88.15  ? 416 HIS A CG  1 
ATOM   1961 N  ND1 . HIS A  1 416 ? 50.767  77.811  -15.343 1.00 86.98  ? 416 HIS A ND1 1 
ATOM   1962 C  CD2 . HIS A  1 416 ? 51.789  78.503  -13.545 1.00 88.42  ? 416 HIS A CD2 1 
ATOM   1963 C  CE1 . HIS A  1 416 ? 51.838  78.479  -15.730 1.00 86.47  ? 416 HIS A CE1 1 
ATOM   1964 N  NE2 . HIS A  1 416 ? 52.376  79.033  -14.662 1.00 94.18  ? 416 HIS A NE2 1 
ATOM   1965 N  N   . GLU A  1 417 ? 47.504  79.625  -11.530 1.00 78.06  ? 417 GLU A N   1 
ATOM   1966 C  CA  . GLU A  1 417 ? 47.472  80.612  -10.446 1.00 79.78  ? 417 GLU A CA  1 
ATOM   1967 C  C   . GLU A  1 417 ? 46.406  80.227  -9.406  1.00 78.18  ? 417 GLU A C   1 
ATOM   1968 O  O   . GLU A  1 417 ? 45.279  79.888  -9.786  1.00 62.55  ? 417 GLU A O   1 
ATOM   1969 C  CB  . GLU A  1 417 ? 47.175  82.008  -11.011 1.00 86.42  ? 417 GLU A CB  1 
ATOM   1970 C  CG  . GLU A  1 417 ? 47.713  83.147  -10.153 1.00 93.10  ? 417 GLU A CG  1 
ATOM   1971 C  CD  . GLU A  1 417 ? 47.198  84.514  -10.568 1.00 94.54  ? 417 GLU A CD  1 
ATOM   1972 O  OE1 . GLU A  1 417 ? 46.961  84.732  -11.775 1.00 87.55  ? 417 GLU A OE1 1 
ATOM   1973 O  OE2 . GLU A  1 417 ? 47.039  85.379  -9.680  1.00 87.31  ? 417 GLU A OE2 1 
ATOM   1974 N  N   . PRO A  1 418 ? 46.749  80.282  -8.094  1.00 85.25  ? 418 PRO A N   1 
ATOM   1975 C  CA  . PRO A  1 418 ? 45.759  79.975  -7.043  1.00 88.67  ? 418 PRO A CA  1 
ATOM   1976 C  C   . PRO A  1 418 ? 44.647  81.020  -6.859  1.00 88.16  ? 418 PRO A C   1 
ATOM   1977 O  O   . PRO A  1 418 ? 43.655  80.744  -6.181  1.00 79.76  ? 418 PRO A O   1 
ATOM   1978 C  CB  . PRO A  1 418 ? 46.613  79.872  -5.772  1.00 83.12  ? 418 PRO A CB  1 
ATOM   1979 C  CG  . PRO A  1 418 ? 47.798  80.721  -6.044  1.00 79.10  ? 418 PRO A CG  1 
ATOM   1980 C  CD  . PRO A  1 418 ? 48.073  80.584  -7.514  1.00 81.27  ? 418 PRO A CD  1 
ATOM   1981 N  N   . SER A  1 419 ? 44.831  82.203  -7.441  1.00 90.03  ? 419 SER A N   1 
ATOM   1982 C  CA  . SER A  1 419 ? 43.818  83.256  -7.446  1.00 84.53  ? 419 SER A CA  1 
ATOM   1983 C  C   . SER A  1 419 ? 42.574  82.846  -8.234  1.00 81.31  ? 419 SER A C   1 
ATOM   1984 O  O   . SER A  1 419 ? 41.460  82.909  -7.706  1.00 74.40  ? 419 SER A O   1 
ATOM   1985 C  CB  . SER A  1 419 ? 44.406  84.542  -8.031  1.00 82.57  ? 419 SER A CB  1 
ATOM   1986 O  OG  . SER A  1 419 ? 45.637  84.876  -7.404  1.00 82.55  ? 419 SER A OG  1 
ATOM   1987 N  N   . LYS A  1 420 ? 42.773  82.427  -9.485  1.00 82.97  ? 420 LYS A N   1 
ATOM   1988 C  CA  . LYS A  1 420 ? 41.668  82.003  -10.364 1.00 98.46  ? 420 LYS A CA  1 
ATOM   1989 C  C   . LYS A  1 420 ? 41.776  80.521  -10.758 1.00 99.70  ? 420 LYS A C   1 
ATOM   1990 O  O   . LYS A  1 420 ? 42.433  80.169  -11.742 1.00 99.35  ? 420 LYS A O   1 
ATOM   1991 C  CB  . LYS A  1 420 ? 41.596  82.907  -11.596 1.00 95.78  ? 420 LYS A CB  1 
ATOM   1992 C  CG  . LYS A  1 420 ? 41.204  84.337  -11.255 1.00 95.39  ? 420 LYS A CG  1 
ATOM   1993 C  CD  . LYS A  1 420 ? 40.779  85.117  -12.487 1.00 103.20 ? 420 LYS A CD  1 
ATOM   1994 C  CE  . LYS A  1 420 ? 40.667  86.606  -12.199 1.00 106.46 ? 420 LYS A CE  1 
ATOM   1995 N  NZ  . LYS A  1 420 ? 41.996  87.278  -12.151 1.00 106.82 ? 420 LYS A NZ  1 
ATOM   1996 N  N   . LEU A  1 421 ? 41.105  79.672  -9.977  1.00 90.62  ? 421 LEU A N   1 
ATOM   1997 C  CA  . LEU A  1 421 ? 41.224  78.204  -10.068 1.00 80.37  ? 421 LEU A CA  1 
ATOM   1998 C  C   . LEU A  1 421 ? 40.263  77.515  -11.044 1.00 82.21  ? 421 LEU A C   1 
ATOM   1999 O  O   . LEU A  1 421 ? 40.418  76.323  -11.321 1.00 75.29  ? 421 LEU A O   1 
ATOM   2000 C  CB  . LEU A  1 421 ? 41.046  77.586  -8.676  1.00 80.35  ? 421 LEU A CB  1 
ATOM   2001 C  CG  . LEU A  1 421 ? 42.143  77.904  -7.658  1.00 81.60  ? 421 LEU A CG  1 
ATOM   2002 C  CD1 . LEU A  1 421 ? 41.693  77.562  -6.244  1.00 80.04  ? 421 LEU A CD1 1 
ATOM   2003 C  CD2 . LEU A  1 421 ? 43.415  77.151  -8.012  1.00 77.88  ? 421 LEU A CD2 1 
ATOM   2004 N  N   . SER A  1 422 ? 39.269  78.249  -11.544 1.00 87.09  ? 422 SER A N   1 
ATOM   2005 C  CA  . SER A  1 422 ? 38.373  77.741  -12.590 1.00 88.12  ? 422 SER A CA  1 
ATOM   2006 C  C   . SER A  1 422 ? 39.114  77.494  -13.908 1.00 88.80  ? 422 SER A C   1 
ATOM   2007 O  O   . SER A  1 422 ? 38.892  76.477  -14.565 1.00 79.71  ? 422 SER A O   1 
ATOM   2008 C  CB  . SER A  1 422 ? 37.223  78.721  -12.833 1.00 85.42  ? 422 SER A CB  1 
ATOM   2009 O  OG  . SER A  1 422 ? 36.419  78.864  -11.676 1.00 91.61  ? 422 SER A OG  1 
ATOM   2010 N  N   . ASP A  1 423 ? 39.992  78.427  -14.274 1.00 89.18  ? 423 ASP A N   1 
ATOM   2011 C  CA  . ASP A  1 423 ? 40.746  78.372  -15.537 1.00 91.90  ? 423 ASP A CA  1 
ATOM   2012 C  C   . ASP A  1 423 ? 41.669  77.150  -15.642 1.00 85.99  ? 423 ASP A C   1 
ATOM   2013 O  O   . ASP A  1 423 ? 41.868  76.611  -16.733 1.00 88.16  ? 423 ASP A O   1 
ATOM   2014 C  CB  . ASP A  1 423 ? 41.579  79.649  -15.715 1.00 95.82  ? 423 ASP A CB  1 
ATOM   2015 C  CG  . ASP A  1 423 ? 40.723  80.896  -15.879 1.00 88.36  ? 423 ASP A CG  1 
ATOM   2016 O  OD1 . ASP A  1 423 ? 39.844  80.908  -16.767 1.00 85.10  ? 423 ASP A OD1 1 
ATOM   2017 O  OD2 . ASP A  1 423 ? 40.941  81.871  -15.128 1.00 84.33  ? 423 ASP A OD2 1 
ATOM   2018 N  N   . ALA A  1 424 ? 42.227  76.733  -14.506 1.00 77.73  ? 424 ALA A N   1 
ATOM   2019 C  CA  . ALA A  1 424 ? 43.135  75.582  -14.430 1.00 71.90  ? 424 ALA A CA  1 
ATOM   2020 C  C   . ALA A  1 424 ? 42.432  74.257  -14.706 1.00 68.73  ? 424 ALA A C   1 
ATOM   2021 O  O   . ALA A  1 424 ? 42.887  73.468  -15.528 1.00 64.94  ? 424 ALA A O   1 
ATOM   2022 C  CB  . ALA A  1 424 ? 43.794  75.530  -13.061 1.00 69.61  ? 424 ALA A CB  1 
ATOM   2023 N  N   . VAL A  1 425 ? 41.326  74.022  -14.004 1.00 71.00  ? 425 VAL A N   1 
ATOM   2024 C  CA  . VAL A  1 425 ? 40.565  72.767  -14.128 1.00 69.53  ? 425 VAL A CA  1 
ATOM   2025 C  C   . VAL A  1 425 ? 39.948  72.624  -15.522 1.00 73.22  ? 425 VAL A C   1 
ATOM   2026 O  O   . VAL A  1 425 ? 39.976  71.538  -16.105 1.00 74.20  ? 425 VAL A O   1 
ATOM   2027 C  CB  . VAL A  1 425 ? 39.451  72.650  -13.058 1.00 69.37  ? 425 VAL A CB  1 
ATOM   2028 C  CG1 . VAL A  1 425 ? 38.661  71.357  -13.223 1.00 72.03  ? 425 VAL A CG1 1 
ATOM   2029 C  CG2 . VAL A  1 425 ? 40.041  72.683  -11.660 1.00 69.61  ? 425 VAL A CG2 1 
ATOM   2030 N  N   . GLU A  1 426 ? 39.389  73.721  -16.031 1.00 75.98  ? 426 GLU A N   1 
ATOM   2031 C  CA  . GLU A  1 426 ? 38.757  73.761  -17.358 1.00 72.97  ? 426 GLU A CA  1 
ATOM   2032 C  C   . GLU A  1 426 ? 39.641  73.200  -18.474 1.00 69.56  ? 426 GLU A C   1 
ATOM   2033 O  O   . GLU A  1 426 ? 39.218  72.309  -19.215 1.00 63.02  ? 426 GLU A O   1 
ATOM   2034 C  CB  . GLU A  1 426 ? 38.321  75.191  -17.700 1.00 73.93  ? 426 GLU A CB  1 
ATOM   2035 C  CG  . GLU A  1 426 ? 36.990  75.579  -17.069 1.00 74.24  ? 426 GLU A CG  1 
ATOM   2036 C  CD  . GLU A  1 426 ? 36.518  76.976  -17.446 1.00 75.60  ? 426 GLU A CD  1 
ATOM   2037 O  OE1 . GLU A  1 426 ? 37.230  77.688  -18.186 1.00 64.72  ? 426 GLU A OE1 1 
ATOM   2038 O  OE2 . GLU A  1 426 ? 35.419  77.364  -16.995 1.00 76.37  ? 426 GLU A OE2 1 
ATOM   2039 N  N   . CYS A  1 427 ? 40.862  73.720  -18.577 1.00 67.12  ? 427 CYS A N   1 
ATOM   2040 C  CA  . CYS A  1 427 ? 41.825  73.243  -19.577 1.00 73.84  ? 427 CYS A CA  1 
ATOM   2041 C  C   . CYS A  1 427 ? 42.379  71.856  -19.228 1.00 68.67  ? 427 CYS A C   1 
ATOM   2042 O  O   . CYS A  1 427 ? 42.550  71.026  -20.123 1.00 67.36  ? 427 CYS A O   1 
ATOM   2043 C  CB  . CYS A  1 427 ? 42.966  74.241  -19.768 1.00 84.41  ? 427 CYS A CB  1 
ATOM   2044 S  SG  . CYS A  1 427 ? 44.020  74.425  -18.320 1.00 110.30 ? 427 CYS A SG  1 
ATOM   2045 N  N   . LEU A  1 428 ? 42.649  71.612  -17.941 1.00 64.30  ? 428 LEU A N   1 
ATOM   2046 C  CA  . LEU A  1 428 ? 43.034  70.270  -17.444 1.00 60.36  ? 428 LEU A CA  1 
ATOM   2047 C  C   . LEU A  1 428 ? 42.050  69.172  -17.873 1.00 62.64  ? 428 LEU A C   1 
ATOM   2048 O  O   . LEU A  1 428 ? 42.471  68.077  -18.255 1.00 69.19  ? 428 LEU A O   1 
ATOM   2049 C  CB  . LEU A  1 428 ? 43.177  70.260  -15.913 1.00 59.65  ? 428 LEU A CB  1 
ATOM   2050 C  CG  . LEU A  1 428 ? 44.473  70.803  -15.295 1.00 65.42  ? 428 LEU A CG  1 
ATOM   2051 C  CD1 . LEU A  1 428 ? 44.299  71.016  -13.798 1.00 68.31  ? 428 LEU A CD1 1 
ATOM   2052 C  CD2 . LEU A  1 428 ? 45.660  69.890  -15.548 1.00 67.85  ? 428 LEU A CD2 1 
ATOM   2053 N  N   . ARG A  1 429 ? 40.754  69.469  -17.799 1.00 61.64  ? 429 ARG A N   1 
ATOM   2054 C  CA  . ARG A  1 429 ? 39.712  68.586  -18.341 1.00 59.32  ? 429 ARG A CA  1 
ATOM   2055 C  C   . ARG A  1 429 ? 39.769  68.486  -19.870 1.00 57.31  ? 429 ARG A C   1 
ATOM   2056 O  O   . ARG A  1 429 ? 39.450  67.444  -20.448 1.00 52.11  ? 429 ARG A O   1 
ATOM   2057 C  CB  . ARG A  1 429 ? 38.329  69.061  -17.899 1.00 59.07  ? 429 ARG A CB  1 
ATOM   2058 C  CG  . ARG A  1 429 ? 38.036  68.818  -16.426 1.00 63.28  ? 429 ARG A CG  1 
ATOM   2059 C  CD  . ARG A  1 429 ? 36.558  68.994  -16.126 1.00 70.75  ? 429 ARG A CD  1 
ATOM   2060 N  NE  . ARG A  1 429 ? 36.082  70.331  -16.507 1.00 74.47  ? 429 ARG A NE  1 
ATOM   2061 C  CZ  . ARG A  1 429 ? 35.723  71.313  -15.674 1.00 71.69  ? 429 ARG A CZ  1 
ATOM   2062 N  NH1 . ARG A  1 429 ? 35.739  71.155  -14.352 1.00 76.04  ? 429 ARG A NH1 1 
ATOM   2063 N  NH2 . ARG A  1 429 ? 35.319  72.477  -16.179 1.00 66.62  ? 429 ARG A NH2 1 
ATOM   2064 N  N   . GLY A  1 430 ? 40.164  69.584  -20.506 1.00 59.16  ? 430 GLY A N   1 
ATOM   2065 C  CA  . GLY A  1 430 ? 40.376  69.640  -21.954 1.00 60.61  ? 430 GLY A CA  1 
ATOM   2066 C  C   . GLY A  1 430 ? 41.608  68.922  -22.487 1.00 57.35  ? 430 GLY A C   1 
ATOM   2067 O  O   . GLY A  1 430 ? 41.636  68.553  -23.664 1.00 57.72  ? 430 GLY A O   1 
ATOM   2068 N  N   . LYS A  1 431 ? 42.624  68.726  -21.643 1.00 55.17  ? 431 LYS A N   1 
ATOM   2069 C  CA  . LYS A  1 431 ? 43.866  68.055  -22.067 1.00 58.29  ? 431 LYS A CA  1 
ATOM   2070 C  C   . LYS A  1 431 ? 43.683  66.550  -22.259 1.00 57.41  ? 431 LYS A C   1 
ATOM   2071 O  O   . LYS A  1 431 ? 42.710  65.956  -21.782 1.00 53.29  ? 431 LYS A O   1 
ATOM   2072 C  CB  . LYS A  1 431 ? 45.018  68.315  -21.080 1.00 53.57  ? 431 LYS A CB  1 
ATOM   2073 C  CG  . LYS A  1 431 ? 45.544  69.746  -21.075 1.00 55.34  ? 431 LYS A CG  1 
ATOM   2074 C  CD  . LYS A  1 431 ? 46.399  70.080  -22.296 1.00 60.86  ? 431 LYS A CD  1 
ATOM   2075 C  CE  . LYS A  1 431 ? 46.599  71.584  -22.442 1.00 62.42  ? 431 LYS A CE  1 
ATOM   2076 N  NZ  . LYS A  1 431 ? 47.116  71.975  -23.783 1.00 57.33  ? 431 LYS A NZ  1 
ATOM   2077 N  N   . ASP A  1 432 ? 44.637  65.954  -22.971 1.00 54.69  ? 432 ASP A N   1 
ATOM   2078 C  CA  . ASP A  1 432 ? 44.672  64.511  -23.195 1.00 54.44  ? 432 ASP A CA  1 
ATOM   2079 C  C   . ASP A  1 432 ? 45.055  63.842  -21.872 1.00 53.13  ? 432 ASP A C   1 
ATOM   2080 O  O   . ASP A  1 432 ? 45.967  64.315  -21.192 1.00 55.48  ? 432 ASP A O   1 
ATOM   2081 C  CB  . ASP A  1 432 ? 45.693  64.172  -24.285 1.00 56.76  ? 432 ASP A CB  1 
ATOM   2082 C  CG  . ASP A  1 432 ? 45.587  62.737  -24.767 1.00 56.24  ? 432 ASP A CG  1 
ATOM   2083 O  OD1 . ASP A  1 432 ? 44.598  62.411  -25.457 1.00 57.72  ? 432 ASP A OD1 1 
ATOM   2084 O  OD2 . ASP A  1 432 ? 46.498  61.938  -24.472 1.00 53.91  ? 432 ASP A OD2 1 
ATOM   2085 N  N   . PRO A  1 433 ? 44.351  62.760  -21.484 1.00 55.97  ? 433 PRO A N   1 
ATOM   2086 C  CA  . PRO A  1 433 ? 44.640  62.151  -20.180 1.00 55.72  ? 433 PRO A CA  1 
ATOM   2087 C  C   . PRO A  1 433 ? 46.038  61.518  -20.060 1.00 54.68  ? 433 PRO A C   1 
ATOM   2088 O  O   . PRO A  1 433 ? 46.593  61.476  -18.960 1.00 46.84  ? 433 PRO A O   1 
ATOM   2089 C  CB  . PRO A  1 433 ? 43.541  61.091  -20.046 1.00 57.78  ? 433 PRO A CB  1 
ATOM   2090 C  CG  . PRO A  1 433 ? 43.210  60.724  -21.447 1.00 55.91  ? 433 PRO A CG  1 
ATOM   2091 C  CD  . PRO A  1 433 ? 43.296  62.017  -22.201 1.00 59.10  ? 433 PRO A CD  1 
ATOM   2092 N  N   . HIS A  1 434 ? 46.587  61.039  -21.176 1.00 56.75  ? 434 HIS A N   1 
ATOM   2093 C  CA  . HIS A  1 434 ? 47.929  60.441  -21.194 1.00 55.38  ? 434 HIS A CA  1 
ATOM   2094 C  C   . HIS A  1 434 ? 49.061  61.452  -20.956 1.00 53.77  ? 434 HIS A C   1 
ATOM   2095 O  O   . HIS A  1 434 ? 50.018  61.133  -20.247 1.00 49.40  ? 434 HIS A O   1 
ATOM   2096 C  CB  . HIS A  1 434 ? 48.177  59.678  -22.501 1.00 56.76  ? 434 HIS A CB  1 
ATOM   2097 C  CG  . HIS A  1 434 ? 47.434  58.381  -22.597 1.00 53.01  ? 434 HIS A CG  1 
ATOM   2098 N  ND1 . HIS A  1 434 ? 46.289  58.234  -23.350 1.00 53.26  ? 434 HIS A ND1 1 
ATOM   2099 C  CD2 . HIS A  1 434 ? 47.675  57.170  -22.041 1.00 55.13  ? 434 HIS A CD2 1 
ATOM   2100 C  CE1 . HIS A  1 434 ? 45.856  56.990  -23.252 1.00 54.01  ? 434 HIS A CE1 1 
ATOM   2101 N  NE2 . HIS A  1 434 ? 46.679  56.324  -22.463 1.00 56.22  ? 434 HIS A NE2 1 
ATOM   2102 N  N   . VAL A  1 435 ? 48.963  62.650  -21.542 1.00 56.37  ? 435 VAL A N   1 
ATOM   2103 C  CA  . VAL A  1 435 ? 49.975  63.706  -21.302 1.00 61.26  ? 435 VAL A CA  1 
ATOM   2104 C  C   . VAL A  1 435 ? 49.861  64.262  -19.877 1.00 60.73  ? 435 VAL A C   1 
ATOM   2105 O  O   . VAL A  1 435 ? 50.848  64.719  -19.300 1.00 67.06  ? 435 VAL A O   1 
ATOM   2106 C  CB  . VAL A  1 435 ? 49.944  64.867  -22.344 1.00 58.28  ? 435 VAL A CB  1 
ATOM   2107 C  CG1 . VAL A  1 435 ? 50.068  64.330  -23.764 1.00 61.11  ? 435 VAL A CG1 1 
ATOM   2108 C  CG2 . VAL A  1 435 ? 48.706  65.748  -22.210 1.00 56.95  ? 435 VAL A CG2 1 
ATOM   2109 N  N   . LEU A  1 436 ? 48.647  64.215  -19.333 1.00 55.72  ? 436 LEU A N   1 
ATOM   2110 C  CA  . LEU A  1 436 ? 48.371  64.624  -17.954 1.00 58.31  ? 436 LEU A CA  1 
ATOM   2111 C  C   . LEU A  1 436 ? 49.141  63.744  -16.955 1.00 58.14  ? 436 LEU A C   1 
ATOM   2112 O  O   . LEU A  1 436 ? 49.894  64.259  -16.130 1.00 57.54  ? 436 LEU A O   1 
ATOM   2113 C  CB  . LEU A  1 436 ? 46.852  64.583  -17.679 1.00 61.11  ? 436 LEU A CB  1 
ATOM   2114 C  CG  . LEU A  1 436 ? 46.162  65.803  -17.056 1.00 58.35  ? 436 LEU A CG  1 
ATOM   2115 C  CD1 . LEU A  1 436 ? 46.396  67.071  -17.859 1.00 57.13  ? 436 LEU A CD1 1 
ATOM   2116 C  CD2 . LEU A  1 436 ? 44.668  65.543  -16.961 1.00 54.84  ? 436 LEU A CD2 1 
ATOM   2117 N  N   . VAL A  1 437 ? 48.964  62.427  -17.050 1.00 54.79  ? 437 VAL A N   1 
ATOM   2118 C  CA  . VAL A  1 437 ? 49.673  61.477  -16.164 1.00 53.28  ? 437 VAL A CA  1 
ATOM   2119 C  C   . VAL A  1 437 ? 51.202  61.436  -16.348 1.00 57.63  ? 437 VAL A C   1 
ATOM   2120 O  O   . VAL A  1 437 ? 51.934  61.230  -15.376 1.00 61.80  ? 437 VAL A O   1 
ATOM   2121 C  CB  . VAL A  1 437 ? 49.104  60.032  -16.238 1.00 54.83  ? 437 VAL A CB  1 
ATOM   2122 C  CG1 . VAL A  1 437 ? 47.660  59.999  -15.756 1.00 56.68  ? 437 VAL A CG1 1 
ATOM   2123 C  CG2 . VAL A  1 437 ? 49.224  59.426  -17.635 1.00 53.76  ? 437 VAL A CG2 1 
ATOM   2124 N  N   . ASN A  1 438 ? 51.670  61.626  -17.583 1.00 62.63  ? 438 ASN A N   1 
ATOM   2125 C  CA  . ASN A  1 438 ? 53.113  61.617  -17.899 1.00 59.26  ? 438 ASN A CA  1 
ATOM   2126 C  C   . ASN A  1 438 ? 53.897  62.787  -17.287 1.00 62.32  ? 438 ASN A C   1 
ATOM   2127 O  O   . ASN A  1 438 ? 55.099  62.657  -17.041 1.00 59.35  ? 438 ASN A O   1 
ATOM   2128 C  CB  . ASN A  1 438 ? 53.346  61.607  -19.421 1.00 61.99  ? 438 ASN A CB  1 
ATOM   2129 C  CG  . ASN A  1 438 ? 53.045  60.261  -20.069 1.00 69.28  ? 438 ASN A CG  1 
ATOM   2130 O  OD1 . ASN A  1 438 ? 52.752  59.270  -19.399 1.00 66.13  ? 438 ASN A OD1 1 
ATOM   2131 N  ND2 . ASN A  1 438 ? 53.120  60.226  -21.395 1.00 71.58  ? 438 ASN A ND2 1 
ATOM   2132 N  N   . ASN A  1 439 ? 53.222  63.914  -17.050 1.00 63.45  ? 439 ASN A N   1 
ATOM   2133 C  CA  . ASN A  1 439 ? 53.854  65.120  -16.485 1.00 59.71  ? 439 ASN A CA  1 
ATOM   2134 C  C   . ASN A  1 439 ? 53.531  65.354  -14.992 1.00 57.53  ? 439 ASN A C   1 
ATOM   2135 O  O   . ASN A  1 439 ? 53.514  66.497  -14.525 1.00 60.14  ? 439 ASN A O   1 
ATOM   2136 C  CB  . ASN A  1 439 ? 53.460  66.348  -17.322 1.00 57.47  ? 439 ASN A CB  1 
ATOM   2137 C  CG  . ASN A  1 439 ? 53.851  66.215  -18.788 1.00 54.99  ? 439 ASN A CG  1 
ATOM   2138 O  OD1 . ASN A  1 439 ? 53.072  66.553  -19.682 1.00 54.32  ? 439 ASN A OD1 1 
ATOM   2139 N  ND2 . ASN A  1 439 ? 55.064  65.734  -19.039 1.00 57.25  ? 439 ASN A ND2 1 
ATOM   2140 N  N   . GLU A  1 440 ? 53.296  64.270  -14.253 1.00 57.51  ? 440 GLU A N   1 
ATOM   2141 C  CA  . GLU A  1 440 ? 53.038  64.321  -12.805 1.00 57.69  ? 440 GLU A CA  1 
ATOM   2142 C  C   . GLU A  1 440 ? 54.319  64.304  -11.970 1.00 55.92  ? 440 GLU A C   1 
ATOM   2143 O  O   . GLU A  1 440 ? 54.406  64.971  -10.936 1.00 54.21  ? 440 GLU A O   1 
ATOM   2144 C  CB  . GLU A  1 440 ? 52.181  63.127  -12.379 1.00 61.97  ? 440 GLU A CB  1 
ATOM   2145 C  CG  . GLU A  1 440 ? 50.724  63.205  -12.800 1.00 62.73  ? 440 GLU A CG  1 
ATOM   2146 C  CD  . GLU A  1 440 ? 49.908  62.010  -12.342 1.00 63.54  ? 440 GLU A CD  1 
ATOM   2147 O  OE1 . GLU A  1 440 ? 48.747  61.903  -12.781 1.00 58.26  ? 440 GLU A OE1 1 
ATOM   2148 O  OE2 . GLU A  1 440 ? 50.408  61.179  -11.552 1.00 61.30  ? 440 GLU A OE2 1 
ATOM   2149 N  N   . TRP A  1 441 ? 55.298  63.529  -12.430 1.00 55.69  ? 441 TRP A N   1 
ATOM   2150 C  CA  . TRP A  1 441 ? 56.501  63.215  -11.664 1.00 55.66  ? 441 TRP A CA  1 
ATOM   2151 C  C   . TRP A  1 441 ? 57.594  64.268  -11.869 1.00 59.95  ? 441 TRP A C   1 
ATOM   2152 O  O   . TRP A  1 441 ? 58.226  64.322  -12.928 1.00 61.34  ? 441 TRP A O   1 
ATOM   2153 C  CB  . TRP A  1 441 ? 57.023  61.834  -12.070 1.00 55.97  ? 441 TRP A CB  1 
ATOM   2154 C  CG  . TRP A  1 441 ? 56.005  60.743  -11.947 1.00 55.17  ? 441 TRP A CG  1 
ATOM   2155 C  CD1 . TRP A  1 441 ? 55.079  60.378  -12.880 1.00 59.34  ? 441 TRP A CD1 1 
ATOM   2156 C  CD2 . TRP A  1 441 ? 55.816  59.870  -10.830 1.00 54.89  ? 441 TRP A CD2 1 
ATOM   2157 N  NE1 . TRP A  1 441 ? 54.320  59.335  -12.413 1.00 60.30  ? 441 TRP A NE1 1 
ATOM   2158 C  CE2 . TRP A  1 441 ? 54.752  59.001  -11.157 1.00 56.06  ? 441 TRP A CE2 1 
ATOM   2159 C  CE3 . TRP A  1 441 ? 56.441  59.736  -9.583  1.00 58.30  ? 441 TRP A CE3 1 
ATOM   2160 C  CZ2 . TRP A  1 441 ? 54.296  58.010  -10.283 1.00 56.52  ? 441 TRP A CZ2 1 
ATOM   2161 C  CZ3 . TRP A  1 441 ? 55.988  58.747  -8.711  1.00 60.31  ? 441 TRP A CZ3 1 
ATOM   2162 C  CH2 . TRP A  1 441 ? 54.924  57.898  -9.068  1.00 58.73  ? 441 TRP A CH2 1 
ATOM   2163 N  N   . GLY A  1 442 ? 57.798  65.101  -10.848 1.00 61.04  ? 442 GLY A N   1 
ATOM   2164 C  CA  . GLY A  1 442 ? 58.826  66.151  -10.852 1.00 62.16  ? 442 GLY A CA  1 
ATOM   2165 C  C   . GLY A  1 442 ? 59.989  65.808  -9.937  1.00 62.51  ? 442 GLY A C   1 
ATOM   2166 O  O   . GLY A  1 442 ? 60.673  64.808  -10.157 1.00 62.19  ? 442 GLY A O   1 
ATOM   2167 N  N   . THR A  1 443 ? 60.219  66.648  -8.925  1.00 64.20  ? 443 THR A N   1 
ATOM   2168 C  CA  . THR A  1 443 ? 61.223  66.389  -7.885  1.00 69.18  ? 443 THR A CA  1 
ATOM   2169 C  C   . THR A  1 443 ? 60.518  65.893  -6.623  1.00 66.12  ? 443 THR A C   1 
ATOM   2170 O  O   . THR A  1 443 ? 59.980  66.687  -5.844  1.00 57.78  ? 443 THR A O   1 
ATOM   2171 C  CB  . THR A  1 443 ? 62.073  67.635  -7.553  1.00 74.62  ? 443 THR A CB  1 
ATOM   2172 O  OG1 . THR A  1 443 ? 61.220  68.773  -7.373  1.00 76.93  ? 443 THR A OG1 1 
ATOM   2173 C  CG2 . THR A  1 443 ? 63.079  67.920  -8.666  1.00 74.54  ? 443 THR A CG2 1 
ATOM   2174 N  N   . LEU A  1 444 ? 60.511  64.572  -6.458  1.00 66.27  ? 444 LEU A N   1 
ATOM   2175 C  CA  . LEU A  1 444 ? 59.955  63.902  -5.280  1.00 62.59  ? 444 LEU A CA  1 
ATOM   2176 C  C   . LEU A  1 444 ? 60.955  62.892  -4.722  1.00 64.72  ? 444 LEU A C   1 
ATOM   2177 O  O   . LEU A  1 444 ? 61.681  62.239  -5.474  1.00 62.21  ? 444 LEU A O   1 
ATOM   2178 C  CB  . LEU A  1 444 ? 58.659  63.172  -5.640  1.00 62.12  ? 444 LEU A CB  1 
ATOM   2179 C  CG  . LEU A  1 444 ? 57.456  64.031  -6.033  1.00 64.09  ? 444 LEU A CG  1 
ATOM   2180 C  CD1 . LEU A  1 444 ? 56.411  63.195  -6.760  1.00 61.19  ? 444 LEU A CD1 1 
ATOM   2181 C  CD2 . LEU A  1 444 ? 56.856  64.712  -4.810  1.00 61.24  ? 444 LEU A CD2 1 
ATOM   2182 N  N   . GLY A  1 445 ? 60.977  62.772  -3.397  1.00 65.95  ? 445 GLY A N   1 
ATOM   2183 C  CA  . GLY A  1 445 ? 61.799  61.780  -2.701  1.00 65.38  ? 445 GLY A CA  1 
ATOM   2184 C  C   . GLY A  1 445 ? 61.286  60.356  -2.832  1.00 65.68  ? 445 GLY A C   1 
ATOM   2185 O  O   . GLY A  1 445 ? 60.353  60.085  -3.596  1.00 61.28  ? 445 GLY A O   1 
ATOM   2186 N  N   . ILE A  1 446 ? 61.902  59.447  -2.078  1.00 66.30  ? 446 ILE A N   1 
ATOM   2187 C  CA  . ILE A  1 446 ? 61.521  58.024  -2.109  1.00 62.14  ? 446 ILE A CA  1 
ATOM   2188 C  C   . ILE A  1 446 ? 60.174  57.801  -1.423  1.00 63.38  ? 446 ILE A C   1 
ATOM   2189 O  O   . ILE A  1 446 ? 59.904  58.368  -0.361  1.00 62.91  ? 446 ILE A O   1 
ATOM   2190 C  CB  . ILE A  1 446 ? 62.594  57.058  -1.522  1.00 61.45  ? 446 ILE A CB  1 
ATOM   2191 C  CG1 . ILE A  1 446 ? 62.131  55.599  -1.674  1.00 59.58  ? 446 ILE A CG1 1 
ATOM   2192 C  CG2 . ILE A  1 446 ? 62.903  57.343  -0.052  1.00 61.93  ? 446 ILE A CG2 1 
ATOM   2193 C  CD1 . ILE A  1 446 ? 63.251  54.586  -1.699  1.00 65.98  ? 446 ILE A CD1 1 
ATOM   2194 N  N   . CYS A  1 447 ? 59.349  56.963  -2.050  1.00 63.89  ? 447 CYS A N   1 
ATOM   2195 C  CA  . CYS A  1 447 ? 58.017  56.614  -1.557  1.00 62.05  ? 447 CYS A CA  1 
ATOM   2196 C  C   . CYS A  1 447 ? 57.188  57.845  -1.186  1.00 59.86  ? 447 CYS A C   1 
ATOM   2197 O  O   . CYS A  1 447 ? 56.738  57.987  -0.050  1.00 63.01  ? 447 CYS A O   1 
ATOM   2198 C  CB  . CYS A  1 447 ? 58.125  55.644  -0.378  1.00 58.58  ? 447 CYS A CB  1 
ATOM   2199 S  SG  . CYS A  1 447 ? 58.836  54.039  -0.811  1.00 59.81  ? 447 CYS A SG  1 
ATOM   2200 N  N   . GLU A  1 448 ? 57.051  58.759  -2.142  1.00 61.25  ? 448 GLU A N   1 
ATOM   2201 C  CA  . GLU A  1 448 ? 56.034  59.808  -2.077  1.00 68.08  ? 448 GLU A CA  1 
ATOM   2202 C  C   . GLU A  1 448 ? 55.487  60.057  -3.478  1.00 63.51  ? 448 GLU A C   1 
ATOM   2203 O  O   . GLU A  1 448 ? 56.250  60.250  -4.431  1.00 54.37  ? 448 GLU A O   1 
ATOM   2204 C  CB  . GLU A  1 448 ? 56.551  61.096  -1.419  1.00 71.41  ? 448 GLU A CB  1 
ATOM   2205 C  CG  . GLU A  1 448 ? 57.797  61.719  -2.024  1.00 72.17  ? 448 GLU A CG  1 
ATOM   2206 C  CD  . GLU A  1 448 ? 58.152  63.043  -1.368  1.00 72.34  ? 448 GLU A CD  1 
ATOM   2207 O  OE1 . GLU A  1 448 ? 58.188  63.105  -0.120  1.00 71.50  ? 448 GLU A OE1 1 
ATOM   2208 O  OE2 . GLU A  1 448 ? 58.405  64.024  -2.101  1.00 74.71  ? 448 GLU A OE2 1 
ATOM   2209 N  N   . PHE A  1 449 ? 54.160  60.041  -3.583  1.00 63.59  ? 449 PHE A N   1 
ATOM   2210 C  CA  . PHE A  1 449 ? 53.459  60.026  -4.866  1.00 57.56  ? 449 PHE A CA  1 
ATOM   2211 C  C   . PHE A  1 449 ? 52.658  61.313  -5.050  1.00 57.22  ? 449 PHE A C   1 
ATOM   2212 O  O   . PHE A  1 449 ? 52.012  61.775  -4.105  1.00 58.99  ? 449 PHE A O   1 
ATOM   2213 C  CB  . PHE A  1 449 ? 52.539  58.811  -4.937  1.00 56.12  ? 449 PHE A CB  1 
ATOM   2214 C  CG  . PHE A  1 449 ? 53.223  57.519  -4.591  1.00 51.40  ? 449 PHE A CG  1 
ATOM   2215 C  CD1 . PHE A  1 449 ? 54.317  57.081  -5.331  1.00 50.89  ? 449 PHE A CD1 1 
ATOM   2216 C  CD2 . PHE A  1 449 ? 52.786  56.742  -3.524  1.00 51.28  ? 449 PHE A CD2 1 
ATOM   2217 C  CE1 . PHE A  1 449 ? 54.960  55.893  -5.016  1.00 52.58  ? 449 PHE A CE1 1 
ATOM   2218 C  CE2 . PHE A  1 449 ? 53.421  55.550  -3.207  1.00 55.93  ? 449 PHE A CE2 1 
ATOM   2219 C  CZ  . PHE A  1 449 ? 54.509  55.123  -3.954  1.00 54.62  ? 449 PHE A CZ  1 
ATOM   2220 N  N   . PRO A  1 450 ? 52.687  61.886  -6.269  1.00 57.31  ? 450 PRO A N   1 
ATOM   2221 C  CA  . PRO A  1 450 ? 52.224  63.260  -6.510  1.00 58.58  ? 450 PRO A CA  1 
ATOM   2222 C  C   . PRO A  1 450 ? 50.736  63.513  -6.241  1.00 53.28  ? 450 PRO A C   1 
ATOM   2223 O  O   . PRO A  1 450 ? 50.377  64.599  -5.783  1.00 52.34  ? 450 PRO A O   1 
ATOM   2224 C  CB  . PRO A  1 450 ? 52.545  63.477  -7.995  1.00 63.57  ? 450 PRO A CB  1 
ATOM   2225 C  CG  . PRO A  1 450 ? 52.499  62.116  -8.593  1.00 64.33  ? 450 PRO A CG  1 
ATOM   2226 C  CD  . PRO A  1 450 ? 53.014  61.192  -7.532  1.00 59.68  ? 450 PRO A CD  1 
ATOM   2227 N  N   . PHE A  1 451 ? 49.896  62.521  -6.529  1.00 54.99  ? 451 PHE A N   1 
ATOM   2228 C  CA  . PHE A  1 451 ? 48.441  62.631  -6.355  1.00 55.60  ? 451 PHE A CA  1 
ATOM   2229 C  C   . PHE A  1 451 ? 47.862  61.388  -5.669  1.00 54.60  ? 451 PHE A C   1 
ATOM   2230 O  O   . PHE A  1 451 ? 47.732  60.323  -6.277  1.00 52.71  ? 451 PHE A O   1 
ATOM   2231 C  CB  . PHE A  1 451 ? 47.764  62.898  -7.700  1.00 58.00  ? 451 PHE A CB  1 
ATOM   2232 C  CG  . PHE A  1 451 ? 48.178  64.202  -8.327  1.00 61.01  ? 451 PHE A CG  1 
ATOM   2233 C  CD1 . PHE A  1 451 ? 47.616  65.404  -7.904  1.00 62.42  ? 451 PHE A CD1 1 
ATOM   2234 C  CD2 . PHE A  1 451 ? 49.152  64.234  -9.322  1.00 60.98  ? 451 PHE A CD2 1 
ATOM   2235 C  CE1 . PHE A  1 451 ? 48.005  66.609  -8.472  1.00 58.54  ? 451 PHE A CE1 1 
ATOM   2236 C  CE2 . PHE A  1 451 ? 49.542  65.436  -9.895  1.00 57.54  ? 451 PHE A CE2 1 
ATOM   2237 C  CZ  . PHE A  1 451 ? 48.968  66.624  -9.470  1.00 57.13  ? 451 PHE A CZ  1 
ATOM   2238 N  N   . VAL A  1 452 ? 47.521  61.567  -4.394  1.00 53.00  ? 452 VAL A N   1 
ATOM   2239 C  CA  . VAL A  1 452 ? 47.049  60.512  -3.491  1.00 51.46  ? 452 VAL A CA  1 
ATOM   2240 C  C   . VAL A  1 452 ? 45.834  61.067  -2.737  1.00 52.14  ? 452 VAL A C   1 
ATOM   2241 O  O   . VAL A  1 452 ? 45.490  62.241  -2.915  1.00 62.53  ? 452 VAL A O   1 
ATOM   2242 C  CB  . VAL A  1 452 ? 48.158  60.083  -2.491  1.00 51.50  ? 452 VAL A CB  1 
ATOM   2243 C  CG1 . VAL A  1 452 ? 49.176  59.185  -3.174  1.00 50.93  ? 452 VAL A CG1 1 
ATOM   2244 C  CG2 . VAL A  1 452 ? 48.847  61.286  -1.853  1.00 49.77  ? 452 VAL A CG2 1 
ATOM   2245 N  N   . PRO A  1 453 ? 45.163  60.232  -1.911  1.00 45.07  ? 453 PRO A N   1 
ATOM   2246 C  CA  . PRO A  1 453 ? 44.064  60.724  -1.077  1.00 44.79  ? 453 PRO A CA  1 
ATOM   2247 C  C   . PRO A  1 453 ? 44.366  61.949  -0.208  1.00 45.11  ? 453 PRO A C   1 
ATOM   2248 O  O   . PRO A  1 453 ? 45.524  62.239  0.098   1.00 49.75  ? 453 PRO A O   1 
ATOM   2249 C  CB  . PRO A  1 453 ? 43.750  59.521  -0.194  1.00 45.40  ? 453 PRO A CB  1 
ATOM   2250 C  CG  . PRO A  1 453 ? 44.000  58.358  -1.086  1.00 45.18  ? 453 PRO A CG  1 
ATOM   2251 C  CD  . PRO A  1 453 ? 45.152  58.754  -1.975  1.00 46.17  ? 453 PRO A CD  1 
ATOM   2252 N  N   . VAL A  1 454 ? 43.301  62.647  0.172   1.00 49.48  ? 454 VAL A N   1 
ATOM   2253 C  CA  . VAL A  1 454 ? 43.380  63.877  0.960   1.00 52.49  ? 454 VAL A CA  1 
ATOM   2254 C  C   . VAL A  1 454 ? 42.164  63.991  1.888   1.00 50.25  ? 454 VAL A C   1 
ATOM   2255 O  O   . VAL A  1 454 ? 41.076  63.513  1.567   1.00 48.09  ? 454 VAL A O   1 
ATOM   2256 C  CB  . VAL A  1 454 ? 43.509  65.126  0.041   1.00 57.39  ? 454 VAL A CB  1 
ATOM   2257 C  CG1 . VAL A  1 454 ? 42.318  65.263  -0.902  1.00 59.68  ? 454 VAL A CG1 1 
ATOM   2258 C  CG2 . VAL A  1 454 ? 43.702  66.405  0.850   1.00 65.98  ? 454 VAL A CG2 1 
ATOM   2259 N  N   . VAL A  1 455 ? 42.371  64.621  3.042   1.00 47.84  ? 455 VAL A N   1 
ATOM   2260 C  CA  . VAL A  1 455 ? 41.272  64.943  3.966   1.00 47.85  ? 455 VAL A CA  1 
ATOM   2261 C  C   . VAL A  1 455 ? 40.370  66.031  3.344   1.00 47.69  ? 455 VAL A C   1 
ATOM   2262 O  O   . VAL A  1 455 ? 40.678  67.220  3.392   1.00 44.07  ? 455 VAL A O   1 
ATOM   2263 C  CB  . VAL A  1 455 ? 41.771  65.290  5.404   1.00 47.73  ? 455 VAL A CB  1 
ATOM   2264 C  CG1 . VAL A  1 455 ? 42.835  66.387  5.428   1.00 54.83  ? 455 VAL A CG1 1 
ATOM   2265 C  CG2 . VAL A  1 455 ? 40.600  65.653  6.312   1.00 44.98  ? 455 VAL A CG2 1 
ATOM   2266 N  N   . ASP A  1 456 ? 39.255  65.589  2.763   1.00 47.39  ? 456 ASP A N   1 
ATOM   2267 C  CA  . ASP A  1 456 ? 38.372  66.446  1.943   1.00 45.46  ? 456 ASP A CA  1 
ATOM   2268 C  C   . ASP A  1 456 ? 37.208  67.098  2.697   1.00 44.78  ? 456 ASP A C   1 
ATOM   2269 O  O   . ASP A  1 456 ? 36.868  68.252  2.426   1.00 46.23  ? 456 ASP A O   1 
ATOM   2270 C  CB  . ASP A  1 456 ? 37.827  65.665  0.734   1.00 50.06  ? 456 ASP A CB  1 
ATOM   2271 C  CG  . ASP A  1 456 ? 37.025  64.432  1.128   1.00 49.60  ? 456 ASP A CG  1 
ATOM   2272 O  OD1 . ASP A  1 456 ? 37.446  63.710  2.058   1.00 49.03  ? 456 ASP A OD1 1 
ATOM   2273 O  OD2 . ASP A  1 456 ? 35.972  64.181  0.504   1.00 52.81  ? 456 ASP A OD2 1 
ATOM   2274 N  N   . GLY A  1 457 ? 36.603  66.357  3.626   1.00 47.03  ? 457 GLY A N   1 
ATOM   2275 C  CA  . GLY A  1 457 ? 35.413  66.810  4.361   1.00 47.79  ? 457 GLY A CA  1 
ATOM   2276 C  C   . GLY A  1 457 ? 34.244  65.838  4.323   1.00 48.85  ? 457 GLY A C   1 
ATOM   2277 O  O   . GLY A  1 457 ? 33.511  65.714  5.305   1.00 59.44  ? 457 GLY A O   1 
ATOM   2278 N  N   . ALA A  1 458 ? 34.063  65.160  3.190   1.00 44.62  ? 458 ALA A N   1 
ATOM   2279 C  CA  . ALA A  1 458 ? 32.950  64.226  2.992   1.00 45.09  ? 458 ALA A CA  1 
ATOM   2280 C  C   . ALA A  1 458 ? 33.360  62.781  3.273   1.00 46.67  ? 458 ALA A C   1 
ATOM   2281 O  O   . ALA A  1 458 ? 32.767  62.122  4.131   1.00 49.31  ? 458 ALA A O   1 
ATOM   2282 C  CB  . ALA A  1 458 ? 32.405  64.359  1.580   1.00 46.88  ? 458 ALA A CB  1 
ATOM   2283 N  N   . PHE A  1 459 ? 34.366  62.299  2.542   1.00 45.75  ? 459 PHE A N   1 
ATOM   2284 C  CA  . PHE A  1 459 ? 34.888  60.937  2.726   1.00 45.00  ? 459 PHE A CA  1 
ATOM   2285 C  C   . PHE A  1 459 ? 35.635  60.836  4.057   1.00 45.36  ? 459 PHE A C   1 
ATOM   2286 O  O   . PHE A  1 459 ? 35.317  59.983  4.888   1.00 44.47  ? 459 PHE A O   1 
ATOM   2287 C  CB  . PHE A  1 459 ? 35.788  60.508  1.555   1.00 41.34  ? 459 PHE A CB  1 
ATOM   2288 C  CG  . PHE A  1 459 ? 36.023  59.023  1.493   1.00 37.61  ? 459 PHE A CG  1 
ATOM   2289 C  CD1 . PHE A  1 459 ? 35.036  58.169  1.005   1.00 36.62  ? 459 PHE A CD1 1 
ATOM   2290 C  CD2 . PHE A  1 459 ? 37.217  58.468  1.942   1.00 35.27  ? 459 PHE A CD2 1 
ATOM   2291 C  CE1 . PHE A  1 459 ? 35.238  56.797  0.958   1.00 35.51  ? 459 PHE A CE1 1 
ATOM   2292 C  CE2 . PHE A  1 459 ? 37.426  57.097  1.897   1.00 35.50  ? 459 PHE A CE2 1 
ATOM   2293 C  CZ  . PHE A  1 459 ? 36.436  56.261  1.405   1.00 36.06  ? 459 PHE A CZ  1 
ATOM   2294 N  N   . LEU A  1 460 ? 36.616  61.717  4.243   1.00 42.12  ? 460 LEU A N   1 
ATOM   2295 C  CA  . LEU A  1 460 ? 37.297  61.910  5.531   1.00 41.59  ? 460 LEU A CA  1 
ATOM   2296 C  C   . LEU A  1 460 ? 37.129  63.370  5.950   1.00 42.25  ? 460 LEU A C   1 
ATOM   2297 O  O   . LEU A  1 460 ? 37.294  64.266  5.122   1.00 41.91  ? 460 LEU A O   1 
ATOM   2298 C  CB  . LEU A  1 460 ? 38.793  61.599  5.419   1.00 41.61  ? 460 LEU A CB  1 
ATOM   2299 C  CG  . LEU A  1 460 ? 39.209  60.321  4.691   1.00 45.11  ? 460 LEU A CG  1 
ATOM   2300 C  CD1 . LEU A  1 460 ? 40.720  60.274  4.530   1.00 46.39  ? 460 LEU A CD1 1 
ATOM   2301 C  CD2 . LEU A  1 460 ? 38.702  59.078  5.409   1.00 44.49  ? 460 LEU A CD2 1 
ATOM   2302 N  N   . ASP A  1 461 ? 36.809  63.603  7.225   1.00 42.41  ? 461 ASP A N   1 
ATOM   2303 C  CA  . ASP A  1 461 ? 36.753  64.978  7.787   1.00 44.77  ? 461 ASP A CA  1 
ATOM   2304 C  C   . ASP A  1 461 ? 37.814  65.250  8.871   1.00 43.60  ? 461 ASP A C   1 
ATOM   2305 O  O   . ASP A  1 461 ? 37.707  66.211  9.638   1.00 49.87  ? 461 ASP A O   1 
ATOM   2306 C  CB  . ASP A  1 461 ? 35.340  65.329  8.289   1.00 44.64  ? 461 ASP A CB  1 
ATOM   2307 C  CG  . ASP A  1 461 ? 34.809  64.356  9.318   1.00 46.33  ? 461 ASP A CG  1 
ATOM   2308 O  OD1 . ASP A  1 461 ? 35.559  63.944  10.230  1.00 48.91  ? 461 ASP A OD1 1 
ATOM   2309 O  OD2 . ASP A  1 461 ? 33.615  64.006  9.224   1.00 54.68  ? 461 ASP A OD2 1 
ATOM   2310 N  N   . GLU A  1 462 ? 38.835  64.399  8.914   1.00 41.68  ? 462 GLU A N   1 
ATOM   2311 C  CA  . GLU A  1 462 ? 39.974  64.560  9.820   1.00 41.82  ? 462 GLU A CA  1 
ATOM   2312 C  C   . GLU A  1 462 ? 41.112  63.668  9.333   1.00 40.60  ? 462 GLU A C   1 
ATOM   2313 O  O   . GLU A  1 462 ? 40.876  62.716  8.582   1.00 36.06  ? 462 GLU A O   1 
ATOM   2314 C  CB  . GLU A  1 462 ? 39.590  64.196  11.261  1.00 42.04  ? 462 GLU A CB  1 
ATOM   2315 C  CG  . GLU A  1 462 ? 39.084  62.768  11.428  1.00 45.93  ? 462 GLU A CG  1 
ATOM   2316 C  CD  . GLU A  1 462 ? 38.683  62.421  12.851  1.00 45.46  ? 462 GLU A CD  1 
ATOM   2317 O  OE1 . GLU A  1 462 ? 39.049  63.158  13.793  1.00 44.87  ? 462 GLU A OE1 1 
ATOM   2318 O  OE2 . GLU A  1 462 ? 37.997  61.391  13.032  1.00 46.17  ? 462 GLU A OE2 1 
ATOM   2319 N  N   . THR A  1 463 ? 42.337  63.973  9.757   1.00 42.41  ? 463 THR A N   1 
ATOM   2320 C  CA  . THR A  1 463 ? 43.489  63.149  9.395   1.00 41.67  ? 463 THR A CA  1 
ATOM   2321 C  C   . THR A  1 463 ? 43.374  61.785  10.086  1.00 42.36  ? 463 THR A C   1 
ATOM   2322 O  O   . THR A  1 463 ? 42.885  61.716  11.219  1.00 41.47  ? 463 THR A O   1 
ATOM   2323 C  CB  . THR A  1 463 ? 44.836  63.798  9.768   1.00 40.49  ? 463 THR A CB  1 
ATOM   2324 O  OG1 . THR A  1 463 ? 44.868  64.091  11.167  1.00 39.61  ? 463 THR A OG1 1 
ATOM   2325 C  CG2 . THR A  1 463 ? 45.054  65.080  8.987   1.00 42.75  ? 463 THR A CG2 1 
ATOM   2326 N  N   . PRO A  1 464 ? 43.820  60.701  9.415   1.00 39.66  ? 464 PRO A N   1 
ATOM   2327 C  CA  . PRO A  1 464 ? 43.640  59.342  9.947   1.00 39.98  ? 464 PRO A CA  1 
ATOM   2328 C  C   . PRO A  1 464 ? 44.274  59.088  11.316  1.00 45.00  ? 464 PRO A C   1 
ATOM   2329 O  O   . PRO A  1 464 ? 43.848  58.176  12.025  1.00 47.38  ? 464 PRO A O   1 
ATOM   2330 C  CB  . PRO A  1 464 ? 44.303  58.456  8.884   1.00 38.29  ? 464 PRO A CB  1 
ATOM   2331 C  CG  . PRO A  1 464 ? 44.308  59.280  7.650   1.00 39.55  ? 464 PRO A CG  1 
ATOM   2332 C  CD  . PRO A  1 464 ? 44.556  60.669  8.139   1.00 40.18  ? 464 PRO A CD  1 
ATOM   2333 N  N   . GLN A  1 465 ? 45.284  59.880  11.668  1.00 52.82  ? 465 GLN A N   1 
ATOM   2334 C  CA  . GLN A  1 465 ? 45.877  59.854  13.003  1.00 58.93  ? 465 GLN A CA  1 
ATOM   2335 C  C   . GLN A  1 465 ? 44.891  60.259  14.099  1.00 61.01  ? 465 GLN A C   1 
ATOM   2336 O  O   . GLN A  1 465 ? 44.832  59.611  15.146  1.00 60.78  ? 465 GLN A O   1 
ATOM   2337 C  CB  . GLN A  1 465 ? 47.105  60.760  13.039  1.00 58.08  ? 465 GLN A CB  1 
ATOM   2338 C  CG  . GLN A  1 465 ? 48.258  60.228  12.201  1.00 62.72  ? 465 GLN A CG  1 
ATOM   2339 C  CD  . GLN A  1 465 ? 48.919  61.299  11.355  1.00 71.20  ? 465 GLN A CD  1 
ATOM   2340 O  OE1 . GLN A  1 465 ? 49.012  61.172  10.133  1.00 74.19  ? 465 GLN A OE1 1 
ATOM   2341 N  NE2 . GLN A  1 465 ? 49.376  62.366  12.000  1.00 71.58  ? 465 GLN A NE2 1 
ATOM   2342 N  N   . ARG A  1 466 ? 44.123  61.321  13.853  1.00 59.87  ? 466 ARG A N   1 
ATOM   2343 C  CA  . ARG A  1 466 ? 43.145  61.819  14.831  1.00 59.00  ? 466 ARG A CA  1 
ATOM   2344 C  C   . ARG A  1 466 ? 41.988  60.837  15.003  1.00 57.69  ? 466 ARG A C   1 
ATOM   2345 O  O   . ARG A  1 466 ? 41.494  60.648  16.119  1.00 59.30  ? 466 ARG A O   1 
ATOM   2346 C  CB  . ARG A  1 466 ? 42.610  63.205  14.445  1.00 61.40  ? 466 ARG A CB  1 
ATOM   2347 C  CG  . ARG A  1 466 ? 43.706  64.226  14.180  1.00 65.32  ? 466 ARG A CG  1 
ATOM   2348 C  CD  . ARG A  1 466 ? 43.270  65.671  14.360  1.00 67.74  ? 466 ARG A CD  1 
ATOM   2349 N  NE  . ARG A  1 466 ? 44.384  66.585  14.077  1.00 70.81  ? 466 ARG A NE  1 
ATOM   2350 C  CZ  . ARG A  1 466 ? 44.667  67.142  12.894  1.00 70.11  ? 466 ARG A CZ  1 
ATOM   2351 N  NH1 . ARG A  1 466 ? 45.724  67.946  12.789  1.00 68.42  ? 466 ARG A NH1 1 
ATOM   2352 N  NH2 . ARG A  1 466 ? 43.917  66.919  11.813  1.00 68.92  ? 466 ARG A NH2 1 
ATOM   2353 N  N   . SER A  1 467 ? 41.559  60.227  13.897  1.00 56.40  ? 467 SER A N   1 
ATOM   2354 C  CA  . SER A  1 467 ? 40.586  59.131  13.928  1.00 54.96  ? 467 SER A CA  1 
ATOM   2355 C  C   . SER A  1 467 ? 41.119  57.968  14.757  1.00 53.78  ? 467 SER A C   1 
ATOM   2356 O  O   . SER A  1 467 ? 40.410  57.424  15.605  1.00 51.81  ? 467 SER A O   1 
ATOM   2357 C  CB  . SER A  1 467 ? 40.272  58.626  12.516  1.00 53.68  ? 467 SER A CB  1 
ATOM   2358 O  OG  . SER A  1 467 ? 39.544  59.582  11.769  1.00 53.65  ? 467 SER A OG  1 
ATOM   2359 N  N   . LEU A  1 468 ? 42.373  57.602  14.501  1.00 53.11  ? 468 LEU A N   1 
ATOM   2360 C  CA  . LEU A  1 468 ? 43.016  56.493  15.206  1.00 52.71  ? 468 LEU A CA  1 
ATOM   2361 C  C   . LEU A  1 468 ? 43.281  56.802  16.683  1.00 54.73  ? 468 LEU A C   1 
ATOM   2362 O  O   . LEU A  1 468 ? 43.081  55.938  17.531  1.00 56.68  ? 468 LEU A O   1 
ATOM   2363 C  CB  . LEU A  1 468 ? 44.314  56.065  14.502  1.00 50.24  ? 468 LEU A CB  1 
ATOM   2364 C  CG  . LEU A  1 468 ? 44.218  55.177  13.251  1.00 49.93  ? 468 LEU A CG  1 
ATOM   2365 C  CD1 . LEU A  1 468 ? 45.622  54.877  12.756  1.00 51.86  ? 468 LEU A CD1 1 
ATOM   2366 C  CD2 . LEU A  1 468 ? 43.467  53.870  13.467  1.00 48.81  ? 468 LEU A CD2 1 
ATOM   2367 N  N   . ALA A  1 469 ? 43.722  58.023  16.979  1.00 51.69  ? 469 ALA A N   1 
ATOM   2368 C  CA  . ALA A  1 469 ? 43.987  58.461  18.360  1.00 46.88  ? 469 ALA A CA  1 
ATOM   2369 C  C   . ALA A  1 469 ? 42.719  58.495  19.218  1.00 47.86  ? 469 ALA A C   1 
ATOM   2370 O  O   . ALA A  1 469 ? 42.688  57.934  20.315  1.00 53.10  ? 469 ALA A O   1 
ATOM   2371 C  CB  . ALA A  1 469 ? 44.649  59.830  18.357  1.00 45.94  ? 469 ALA A CB  1 
ATOM   2372 N  N   . SER A  1 470 ? 41.689  59.166  18.708  1.00 47.29  ? 470 SER A N   1 
ATOM   2373 C  CA  . SER A  1 470 ? 40.379  59.234  19.369  1.00 46.18  ? 470 SER A CA  1 
ATOM   2374 C  C   . SER A  1 470 ? 39.614  57.899  19.407  1.00 49.44  ? 470 SER A C   1 
ATOM   2375 O  O   . SER A  1 470 ? 38.774  57.696  20.287  1.00 56.47  ? 470 SER A O   1 
ATOM   2376 C  CB  . SER A  1 470 ? 39.508  60.284  18.680  1.00 46.09  ? 470 SER A CB  1 
ATOM   2377 O  OG  . SER A  1 470 ? 39.241  59.914  17.337  1.00 47.48  ? 470 SER A OG  1 
ATOM   2378 N  N   . GLY A  1 471 ? 39.896  57.014  18.450  1.00 50.55  ? 471 GLY A N   1 
ATOM   2379 C  CA  . GLY A  1 471 ? 39.244  55.696  18.351  1.00 49.73  ? 471 GLY A CA  1 
ATOM   2380 C  C   . GLY A  1 471 ? 38.039  55.630  17.420  1.00 48.29  ? 471 GLY A C   1 
ATOM   2381 O  O   . GLY A  1 471 ? 37.195  54.742  17.565  1.00 52.05  ? 471 GLY A O   1 
ATOM   2382 N  N   . ARG A  1 472 ? 37.974  56.550  16.456  1.00 48.28  ? 472 ARG A N   1 
ATOM   2383 C  CA  . ARG A  1 472 ? 36.824  56.679  15.557  1.00 48.34  ? 472 ARG A CA  1 
ATOM   2384 C  C   . ARG A  1 472 ? 37.053  55.852  14.298  1.00 50.11  ? 472 ARG A C   1 
ATOM   2385 O  O   . ARG A  1 472 ? 37.478  56.369  13.261  1.00 56.29  ? 472 ARG A O   1 
ATOM   2386 C  CB  . ARG A  1 472 ? 36.567  58.149  15.199  1.00 48.46  ? 472 ARG A CB  1 
ATOM   2387 C  CG  . ARG A  1 472 ? 35.983  58.969  16.342  1.00 47.64  ? 472 ARG A CG  1 
ATOM   2388 C  CD  . ARG A  1 472 ? 35.486  60.337  15.891  1.00 44.75  ? 472 ARG A CD  1 
ATOM   2389 N  NE  . ARG A  1 472 ? 36.571  61.309  15.740  1.00 40.97  ? 472 ARG A NE  1 
ATOM   2390 C  CZ  . ARG A  1 472 ? 37.064  62.092  16.705  1.00 38.25  ? 472 ARG A CZ  1 
ATOM   2391 N  NH1 . ARG A  1 472 ? 36.597  62.045  17.954  1.00 38.55  ? 472 ARG A NH1 1 
ATOM   2392 N  NH2 . ARG A  1 472 ? 38.055  62.934  16.418  1.00 37.60  ? 472 ARG A NH2 1 
ATOM   2393 N  N   . PHE A  1 473 ? 36.783  54.556  14.416  1.00 48.84  ? 473 PHE A N   1 
ATOM   2394 C  CA  . PHE A  1 473 ? 36.870  53.625  13.286  1.00 50.30  ? 473 PHE A CA  1 
ATOM   2395 C  C   . PHE A  1 473 ? 35.960  52.414  13.482  1.00 50.53  ? 473 PHE A C   1 
ATOM   2396 O  O   . PHE A  1 473 ? 35.440  52.190  14.580  1.00 58.03  ? 473 PHE A O   1 
ATOM   2397 C  CB  . PHE A  1 473 ? 38.323  53.200  13.025  1.00 50.78  ? 473 PHE A CB  1 
ATOM   2398 C  CG  . PHE A  1 473 ? 39.105  52.847  14.266  1.00 47.10  ? 473 PHE A CG  1 
ATOM   2399 C  CD1 . PHE A  1 473 ? 38.880  51.649  14.940  1.00 45.59  ? 473 PHE A CD1 1 
ATOM   2400 C  CD2 . PHE A  1 473 ? 40.095  53.703  14.746  1.00 44.79  ? 473 PHE A CD2 1 
ATOM   2401 C  CE1 . PHE A  1 473 ? 39.615  51.321  16.072  1.00 44.70  ? 473 PHE A CE1 1 
ATOM   2402 C  CE2 . PHE A  1 473 ? 40.833  53.377  15.875  1.00 43.53  ? 473 PHE A CE2 1 
ATOM   2403 C  CZ  . PHE A  1 473 ? 40.593  52.187  16.537  1.00 44.56  ? 473 PHE A CZ  1 
ATOM   2404 N  N   . LYS A  1 474 ? 35.769  51.645  12.411  1.00 45.72  ? 474 LYS A N   1 
ATOM   2405 C  CA  . LYS A  1 474 ? 34.819  50.532  12.423  1.00 47.82  ? 474 LYS A CA  1 
ATOM   2406 C  C   . LYS A  1 474 ? 35.236  49.439  13.404  1.00 50.55  ? 474 LYS A C   1 
ATOM   2407 O  O   . LYS A  1 474 ? 36.368  48.952  13.363  1.00 50.06  ? 474 LYS A O   1 
ATOM   2408 C  CB  . LYS A  1 474 ? 34.641  49.929  11.029  1.00 46.44  ? 474 LYS A CB  1 
ATOM   2409 C  CG  . LYS A  1 474 ? 33.343  49.144  10.893  1.00 46.15  ? 474 LYS A CG  1 
ATOM   2410 C  CD  . LYS A  1 474 ? 33.308  48.306  9.630   1.00 46.40  ? 474 LYS A CD  1 
ATOM   2411 C  CE  . LYS A  1 474 ? 31.902  47.810  9.325   1.00 49.30  ? 474 LYS A CE  1 
ATOM   2412 N  NZ  . LYS A  1 474 ? 31.351  46.823  10.297  1.00 48.82  ? 474 LYS A NZ  1 
ATOM   2413 N  N   . LYS A  1 475 ? 34.306  49.064  14.277  1.00 59.44  ? 475 LYS A N   1 
ATOM   2414 C  CA  . LYS A  1 475 ? 34.550  48.048  15.294  1.00 68.34  ? 475 LYS A CA  1 
ATOM   2415 C  C   . LYS A  1 475 ? 34.353  46.666  14.682  1.00 64.62  ? 475 LYS A C   1 
ATOM   2416 O  O   . LYS A  1 475 ? 33.255  46.102  14.707  1.00 67.89  ? 475 LYS A O   1 
ATOM   2417 C  CB  . LYS A  1 475 ? 33.643  48.277  16.509  1.00 73.48  ? 475 LYS A CB  1 
ATOM   2418 C  CG  . LYS A  1 475 ? 33.710  49.691  17.085  1.00 82.42  ? 475 LYS A CG  1 
ATOM   2419 C  CD  . LYS A  1 475 ? 35.130  50.132  17.429  1.00 88.98  ? 475 LYS A CD  1 
ATOM   2420 C  CE  . LYS A  1 475 ? 35.161  51.526  18.033  1.00 91.03  ? 475 LYS A CE  1 
ATOM   2421 N  NZ  . LYS A  1 475 ? 36.552  52.046  18.162  1.00 88.74  ? 475 LYS A NZ  1 
ATOM   2422 N  N   . THR A  1 476 ? 35.439  46.147  14.116  1.00 62.15  ? 476 THR A N   1 
ATOM   2423 C  CA  . THR A  1 476 ? 35.433  44.864  13.421  1.00 58.14  ? 476 THR A CA  1 
ATOM   2424 C  C   . THR A  1 476 ? 36.812  44.202  13.484  1.00 53.17  ? 476 THR A C   1 
ATOM   2425 O  O   . THR A  1 476 ? 37.788  44.817  13.920  1.00 48.80  ? 476 THR A O   1 
ATOM   2426 C  CB  . THR A  1 476 ? 34.968  45.047  11.958  1.00 58.66  ? 476 THR A CB  1 
ATOM   2427 O  OG1 . THR A  1 476 ? 34.634  43.771  11.394  1.00 64.10  ? 476 THR A OG1 1 
ATOM   2428 C  CG2 . THR A  1 476 ? 36.043  45.728  11.098  1.00 63.24  ? 476 THR A CG2 1 
ATOM   2429 N  N   . GLU A  1 477 ? 36.879  42.951  13.036  1.00 51.25  ? 477 GLU A N   1 
ATOM   2430 C  CA  . GLU A  1 477 ? 38.130  42.185  13.060  1.00 50.33  ? 477 GLU A CA  1 
ATOM   2431 C  C   . GLU A  1 477 ? 39.072  42.666  11.959  1.00 49.01  ? 477 GLU A C   1 
ATOM   2432 O  O   . GLU A  1 477 ? 38.631  43.217  10.948  1.00 50.11  ? 477 GLU A O   1 
ATOM   2433 C  CB  . GLU A  1 477 ? 37.882  40.681  12.895  1.00 50.72  ? 477 GLU A CB  1 
ATOM   2434 C  CG  . GLU A  1 477 ? 37.087  40.025  14.019  1.00 50.87  ? 477 GLU A CG  1 
ATOM   2435 C  CD  . GLU A  1 477 ? 35.578  40.079  13.825  1.00 53.70  ? 477 GLU A CD  1 
ATOM   2436 O  OE1 . GLU A  1 477 ? 35.099  39.943  12.678  1.00 49.79  ? 477 GLU A OE1 1 
ATOM   2437 O  OE2 . GLU A  1 477 ? 34.862  40.251  14.834  1.00 60.66  ? 477 GLU A OE2 1 
ATOM   2438 N  N   . ILE A  1 478 ? 40.366  42.440  12.171  1.00 45.35  ? 478 ILE A N   1 
ATOM   2439 C  CA  . ILE A  1 478 ? 41.416  42.836  11.232  1.00 43.81  ? 478 ILE A CA  1 
ATOM   2440 C  C   . ILE A  1 478 ? 42.394  41.676  11.057  1.00 46.15  ? 478 ILE A C   1 
ATOM   2441 O  O   . ILE A  1 478 ? 42.736  40.989  12.019  1.00 50.77  ? 478 ILE A O   1 
ATOM   2442 C  CB  . ILE A  1 478 ? 42.168  44.094  11.745  1.00 46.39  ? 478 ILE A CB  1 
ATOM   2443 C  CG1 . ILE A  1 478 ? 41.258  45.329  11.732  1.00 50.25  ? 478 ILE A CG1 1 
ATOM   2444 C  CG2 . ILE A  1 478 ? 43.433  44.391  10.943  1.00 50.15  ? 478 ILE A CG2 1 
ATOM   2445 C  CD1 . ILE A  1 478 ? 40.780  45.784  10.367  1.00 53.18  ? 478 ILE A CD1 1 
ATOM   2446 N  N   . LEU A  1 479 ? 42.817  41.461  9.814   1.00 46.51  ? 479 LEU A N   1 
ATOM   2447 C  CA  . LEU A  1 479 ? 43.941  40.586  9.489   1.00 44.48  ? 479 LEU A CA  1 
ATOM   2448 C  C   . LEU A  1 479 ? 44.889  41.417  8.641   1.00 44.72  ? 479 LEU A C   1 
ATOM   2449 O  O   . LEU A  1 479 ? 44.510  41.890  7.575   1.00 47.99  ? 479 LEU A O   1 
ATOM   2450 C  CB  . LEU A  1 479 ? 43.475  39.344  8.724   1.00 46.35  ? 479 LEU A CB  1 
ATOM   2451 C  CG  . LEU A  1 479 ? 44.524  38.247  8.459   1.00 49.30  ? 479 LEU A CG  1 
ATOM   2452 C  CD1 . LEU A  1 479 ? 43.889  36.862  8.527   1.00 50.21  ? 479 LEU A CD1 1 
ATOM   2453 C  CD2 . LEU A  1 479 ? 45.247  38.435  7.126   1.00 47.79  ? 479 LEU A CD2 1 
ATOM   2454 N  N   . THR A  1 480 ? 46.116  41.600  9.116   1.00 46.17  ? 480 THR A N   1 
ATOM   2455 C  CA  . THR A  1 480 ? 47.080  42.467  8.439   1.00 45.24  ? 480 THR A CA  1 
ATOM   2456 C  C   . THR A  1 480 ? 48.496  41.914  8.565   1.00 43.86  ? 480 THR A C   1 
ATOM   2457 O  O   . THR A  1 480 ? 48.736  40.951  9.293   1.00 40.58  ? 480 THR A O   1 
ATOM   2458 C  CB  . THR A  1 480 ? 46.988  43.919  8.975   1.00 44.51  ? 480 THR A CB  1 
ATOM   2459 O  OG1 . THR A  1 480 ? 47.754  44.799  8.141   1.00 48.25  ? 480 THR A OG1 1 
ATOM   2460 C  CG2 . THR A  1 480 ? 47.471  44.032  10.425  1.00 42.50  ? 480 THR A CG2 1 
ATOM   2461 N  N   . GLY A  1 481 ? 49.423  42.523  7.835   1.00 43.82  ? 481 GLY A N   1 
ATOM   2462 C  CA  . GLY A  1 481 ? 50.829  42.152  7.935   1.00 47.25  ? 481 GLY A CA  1 
ATOM   2463 C  C   . GLY A  1 481 ? 51.751  42.817  6.941   1.00 49.12  ? 481 GLY A C   1 
ATOM   2464 O  O   . GLY A  1 481 ? 51.324  43.593  6.083   1.00 49.36  ? 481 GLY A O   1 
ATOM   2465 N  N   . SER A  1 482 ? 53.031  42.486  7.088   1.00 52.81  ? 482 SER A N   1 
ATOM   2466 C  CA  . SER A  1 482 ? 54.115  43.015  6.262   1.00 49.66  ? 482 SER A CA  1 
ATOM   2467 C  C   . SER A  1 482 ? 54.947  41.872  5.694   1.00 45.07  ? 482 SER A C   1 
ATOM   2468 O  O   . SER A  1 482 ? 54.745  40.704  6.037   1.00 45.11  ? 482 SER A O   1 
ATOM   2469 C  CB  . SER A  1 482 ? 55.022  43.930  7.091   1.00 51.87  ? 482 SER A CB  1 
ATOM   2470 O  OG  . SER A  1 482 ? 54.255  44.810  7.896   1.00 59.83  ? 482 SER A OG  1 
ATOM   2471 N  N   . ASN A  1 483 ? 55.869  42.233  4.809   1.00 43.65  ? 483 ASN A N   1 
ATOM   2472 C  CA  . ASN A  1 483 ? 56.898  41.324  4.306   1.00 42.37  ? 483 ASN A CA  1 
ATOM   2473 C  C   . ASN A  1 483 ? 58.246  41.753  4.878   1.00 42.02  ? 483 ASN A C   1 
ATOM   2474 O  O   . ASN A  1 483 ? 58.385  42.863  5.407   1.00 42.54  ? 483 ASN A O   1 
ATOM   2475 C  CB  . ASN A  1 483 ? 56.947  41.342  2.778   1.00 44.49  ? 483 ASN A CB  1 
ATOM   2476 C  CG  . ASN A  1 483 ? 55.613  40.983  2.135   1.00 44.45  ? 483 ASN A CG  1 
ATOM   2477 O  OD1 . ASN A  1 483 ? 54.589  40.849  2.806   1.00 41.09  ? 483 ASN A OD1 1 
ATOM   2478 N  ND2 . ASN A  1 483 ? 55.624  40.831  0.814   1.00 45.12  ? 483 ASN A ND2 1 
ATOM   2479 N  N   . THR A  1 484 ? 59.233  40.868  4.775   1.00 42.43  ? 484 THR A N   1 
ATOM   2480 C  CA  . THR A  1 484 ? 60.566  41.123  5.344   1.00 45.42  ? 484 THR A CA  1 
ATOM   2481 C  C   . THR A  1 484 ? 61.348  42.221  4.619   1.00 46.55  ? 484 THR A C   1 
ATOM   2482 O  O   . THR A  1 484 ? 62.001  43.043  5.266   1.00 50.28  ? 484 THR A O   1 
ATOM   2483 C  CB  . THR A  1 484 ? 61.435  39.848  5.383   1.00 46.17  ? 484 THR A CB  1 
ATOM   2484 O  OG1 . THR A  1 484 ? 61.236  39.079  4.191   1.00 42.09  ? 484 THR A OG1 1 
ATOM   2485 C  CG2 . THR A  1 484 ? 61.079  39.008  6.584   1.00 47.95  ? 484 THR A CG2 1 
ATOM   2486 N  N   . GLU A  1 485 ? 61.283  42.217  3.288   1.00 51.44  ? 485 GLU A N   1 
ATOM   2487 C  CA  . GLU A  1 485 ? 61.985  43.201  2.453   1.00 50.41  ? 485 GLU A CA  1 
ATOM   2488 C  C   . GLU A  1 485 ? 61.000  44.099  1.697   1.00 48.44  ? 485 GLU A C   1 
ATOM   2489 O  O   . GLU A  1 485 ? 60.772  43.916  0.504   1.00 47.75  ? 485 GLU A O   1 
ATOM   2490 C  CB  . GLU A  1 485 ? 62.932  42.494  1.470   1.00 50.68  ? 485 GLU A CB  1 
ATOM   2491 C  CG  . GLU A  1 485 ? 64.224  41.961  2.080   1.00 51.01  ? 485 GLU A CG  1 
ATOM   2492 C  CD  . GLU A  1 485 ? 64.016  40.787  3.021   1.00 53.02  ? 485 GLU A CD  1 
ATOM   2493 O  OE1 . GLU A  1 485 ? 63.293  39.839  2.649   1.00 55.89  ? 485 GLU A OE1 1 
ATOM   2494 O  OE2 . GLU A  1 485 ? 64.586  40.804  4.133   1.00 50.78  ? 485 GLU A OE2 1 
ATOM   2495 N  N   . GLU A  1 486 ? 60.426  45.074  2.395   1.00 51.37  ? 486 GLU A N   1 
ATOM   2496 C  CA  . GLU A  1 486 ? 59.447  45.988  1.787   1.00 50.26  ? 486 GLU A CA  1 
ATOM   2497 C  C   . GLU A  1 486 ? 60.116  47.037  0.900   1.00 48.74  ? 486 GLU A C   1 
ATOM   2498 O  O   . GLU A  1 486 ? 59.650  47.309  -0.210  1.00 53.70  ? 486 GLU A O   1 
ATOM   2499 C  CB  . GLU A  1 486 ? 58.603  46.686  2.863   1.00 47.37  ? 486 GLU A CB  1 
ATOM   2500 C  CG  . GLU A  1 486 ? 57.680  45.759  3.645   1.00 46.76  ? 486 GLU A CG  1 
ATOM   2501 C  CD  . GLU A  1 486 ? 56.408  45.373  2.903   1.00 49.28  ? 486 GLU A CD  1 
ATOM   2502 O  OE1 . GLU A  1 486 ? 55.466  44.900  3.574   1.00 47.25  ? 486 GLU A OE1 1 
ATOM   2503 O  OE2 . GLU A  1 486 ? 56.335  45.524  1.668   1.00 46.89  ? 486 GLU A OE2 1 
ATOM   2504 N  N   . GLY A  1 487 ? 61.208  47.612  1.396   1.00 50.71  ? 487 GLY A N   1 
ATOM   2505 C  CA  . GLY A  1 487 ? 61.870  48.752  0.758   1.00 52.43  ? 487 GLY A CA  1 
ATOM   2506 C  C   . GLY A  1 487 ? 62.503  48.527  -0.606  1.00 50.86  ? 487 GLY A C   1 
ATOM   2507 O  O   . GLY A  1 487 ? 62.369  49.377  -1.488  1.00 50.17  ? 487 GLY A O   1 
ATOM   2508 N  N   . TYR A  1 488 ? 63.192  47.396  -0.771  1.00 51.11  ? 488 TYR A N   1 
ATOM   2509 C  CA  . TYR A  1 488 ? 64.003  47.111  -1.975  1.00 56.82  ? 488 TYR A CA  1 
ATOM   2510 C  C   . TYR A  1 488 ? 63.354  47.491  -3.312  1.00 58.11  ? 488 TYR A C   1 
ATOM   2511 O  O   . TYR A  1 488 ? 64.012  48.088  -4.165  1.00 58.31  ? 488 TYR A O   1 
ATOM   2512 C  CB  . TYR A  1 488 ? 64.407  45.629  -2.027  1.00 53.28  ? 488 TYR A CB  1 
ATOM   2513 C  CG  . TYR A  1 488 ? 65.643  45.242  -1.229  1.00 52.85  ? 488 TYR A CG  1 
ATOM   2514 C  CD1 . TYR A  1 488 ? 66.828  45.982  -1.299  1.00 50.03  ? 488 TYR A CD1 1 
ATOM   2515 C  CD2 . TYR A  1 488 ? 65.638  44.098  -0.439  1.00 56.70  ? 488 TYR A CD2 1 
ATOM   2516 C  CE1 . TYR A  1 488 ? 67.957  45.598  -0.581  1.00 52.92  ? 488 TYR A CE1 1 
ATOM   2517 C  CE2 . TYR A  1 488 ? 66.754  43.704  0.280   1.00 59.66  ? 488 TYR A CE2 1 
ATOM   2518 C  CZ  . TYR A  1 488 ? 67.910  44.453  0.209   1.00 57.93  ? 488 TYR A CZ  1 
ATOM   2519 O  OH  . TYR A  1 488 ? 69.005  44.047  0.934   1.00 59.27  ? 488 TYR A OH  1 
ATOM   2520 N  N   . TYR A  1 489 ? 62.080  47.139  -3.484  1.00 59.06  ? 489 TYR A N   1 
ATOM   2521 C  CA  . TYR A  1 489 ? 61.340  47.443  -4.720  1.00 58.48  ? 489 TYR A CA  1 
ATOM   2522 C  C   . TYR A  1 489 ? 61.385  48.933  -5.061  1.00 52.50  ? 489 TYR A C   1 
ATOM   2523 O  O   . TYR A  1 489 ? 61.566  49.304  -6.216  1.00 50.23  ? 489 TYR A O   1 
ATOM   2524 C  CB  . TYR A  1 489 ? 59.877  46.995  -4.609  1.00 64.35  ? 489 TYR A CB  1 
ATOM   2525 C  CG  . TYR A  1 489 ? 59.070  47.176  -5.885  1.00 62.61  ? 489 TYR A CG  1 
ATOM   2526 C  CD1 . TYR A  1 489 ? 59.083  46.205  -6.889  1.00 63.26  ? 489 TYR A CD1 1 
ATOM   2527 C  CD2 . TYR A  1 489 ? 58.289  48.319  -6.087  1.00 58.16  ? 489 TYR A CD2 1 
ATOM   2528 C  CE1 . TYR A  1 489 ? 58.345  46.369  -8.057  1.00 65.47  ? 489 TYR A CE1 1 
ATOM   2529 C  CE2 . TYR A  1 489 ? 57.550  48.492  -7.249  1.00 56.90  ? 489 TYR A CE2 1 
ATOM   2530 C  CZ  . TYR A  1 489 ? 57.580  47.515  -8.231  1.00 63.50  ? 489 TYR A CZ  1 
ATOM   2531 O  OH  . TYR A  1 489 ? 56.846  47.684  -9.383  1.00 66.91  ? 489 TYR A OH  1 
ATOM   2532 N  N   . PHE A  1 490 ? 61.235  49.772  -4.041  1.00 49.17  ? 490 PHE A N   1 
ATOM   2533 C  CA  . PHE A  1 490 ? 61.185  51.228  -4.211  1.00 48.17  ? 490 PHE A CA  1 
ATOM   2534 C  C   . PHE A  1 490 ? 62.576  51.856  -4.305  1.00 55.50  ? 490 PHE A C   1 
ATOM   2535 O  O   . PHE A  1 490 ? 62.743  52.891  -4.945  1.00 54.32  ? 490 PHE A O   1 
ATOM   2536 C  CB  . PHE A  1 490 ? 60.382  51.851  -3.075  1.00 45.80  ? 490 PHE A CB  1 
ATOM   2537 C  CG  . PHE A  1 490 ? 58.993  51.294  -2.957  1.00 49.40  ? 490 PHE A CG  1 
ATOM   2538 C  CD1 . PHE A  1 490 ? 57.960  51.793  -3.745  1.00 50.12  ? 490 PHE A CD1 1 
ATOM   2539 C  CD2 . PHE A  1 490 ? 58.721  50.249  -2.080  1.00 53.93  ? 490 PHE A CD2 1 
ATOM   2540 C  CE1 . PHE A  1 490 ? 56.678  51.271  -3.648  1.00 50.79  ? 490 PHE A CE1 1 
ATOM   2541 C  CE2 . PHE A  1 490 ? 57.443  49.721  -1.980  1.00 56.14  ? 490 PHE A CE2 1 
ATOM   2542 C  CZ  . PHE A  1 490 ? 56.420  50.233  -2.764  1.00 54.49  ? 490 PHE A CZ  1 
ATOM   2543 N  N   . ILE A  1 491 ? 63.561  51.214  -3.677  1.00 64.47  ? 491 ILE A N   1 
ATOM   2544 C  CA  . ILE A  1 491 ? 64.979  51.612  -3.778  1.00 59.89  ? 491 ILE A CA  1 
ATOM   2545 C  C   . ILE A  1 491 ? 65.638  51.022  -5.044  1.00 58.71  ? 491 ILE A C   1 
ATOM   2546 O  O   . ILE A  1 491 ? 66.785  51.338  -5.351  1.00 68.13  ? 491 ILE A O   1 
ATOM   2547 C  CB  . ILE A  1 491 ? 65.809  51.188  -2.534  1.00 56.47  ? 491 ILE A CB  1 
ATOM   2548 C  CG1 . ILE A  1 491 ? 65.081  51.503  -1.221  1.00 54.63  ? 491 ILE A CG1 1 
ATOM   2549 C  CG2 . ILE A  1 491 ? 67.151  51.922  -2.481  1.00 60.00  ? 491 ILE A CG2 1 
ATOM   2550 C  CD1 . ILE A  1 491 ? 65.545  50.646  -0.068  1.00 55.65  ? 491 ILE A CD1 1 
ATOM   2551 N  N   . ILE A  1 492 ? 64.937  50.144  -5.758  1.00 55.47  ? 492 ILE A N   1 
ATOM   2552 C  CA  . ILE A  1 492 ? 65.374  49.695  -7.088  1.00 49.22  ? 492 ILE A CA  1 
ATOM   2553 C  C   . ILE A  1 492 ? 65.048  50.753  -8.141  1.00 49.78  ? 492 ILE A C   1 
ATOM   2554 O  O   . ILE A  1 492 ? 65.904  51.130  -8.945  1.00 53.01  ? 492 ILE A O   1 
ATOM   2555 C  CB  . ILE A  1 492 ? 64.742  48.331  -7.460  1.00 46.50  ? 492 ILE A CB  1 
ATOM   2556 C  CG1 . ILE A  1 492 ? 65.561  47.200  -6.826  1.00 48.42  ? 492 ILE A CG1 1 
ATOM   2557 C  CG2 . ILE A  1 492 ? 64.686  48.125  -8.971  1.00 47.56  ? 492 ILE A CG2 1 
ATOM   2558 C  CD1 . ILE A  1 492 ? 64.828  45.880  -6.725  1.00 51.11  ? 492 ILE A CD1 1 
ATOM   2559 N  N   . TYR A  1 493 ? 63.796  51.199  -8.135  1.00 54.13  ? 493 TYR A N   1 
ATOM   2560 C  CA  . TYR A  1 493 ? 63.310  52.218  -9.075  1.00 55.85  ? 493 TYR A CA  1 
ATOM   2561 C  C   . TYR A  1 493 ? 63.872  53.609  -8.767  1.00 57.23  ? 493 TYR A C   1 
ATOM   2562 O  O   . TYR A  1 493 ? 64.156  54.391  -9.678  1.00 53.04  ? 493 TYR A O   1 
ATOM   2563 C  CB  . TYR A  1 493 ? 61.778  52.233  -9.089  1.00 56.28  ? 493 TYR A CB  1 
ATOM   2564 C  CG  . TYR A  1 493 ? 61.187  51.105  -9.909  1.00 54.61  ? 493 TYR A CG  1 
ATOM   2565 C  CD1 . TYR A  1 493 ? 61.199  49.787  -9.443  1.00 54.47  ? 493 TYR A CD1 1 
ATOM   2566 C  CD2 . TYR A  1 493 ? 60.629  51.350  -11.159 1.00 52.98  ? 493 TYR A CD2 1 
ATOM   2567 C  CE1 . TYR A  1 493 ? 60.664  48.751  -10.196 1.00 55.87  ? 493 TYR A CE1 1 
ATOM   2568 C  CE2 . TYR A  1 493 ? 60.091  50.322  -11.916 1.00 54.50  ? 493 TYR A CE2 1 
ATOM   2569 C  CZ  . TYR A  1 493 ? 60.114  49.024  -11.435 1.00 56.49  ? 493 TYR A CZ  1 
ATOM   2570 O  OH  . TYR A  1 493 ? 59.586  47.996  -12.180 1.00 50.69  ? 493 TYR A OH  1 
ATOM   2571 N  N   . TYR A  1 494 ? 64.012  53.899  -7.478  1.00 62.73  ? 494 TYR A N   1 
ATOM   2572 C  CA  . TYR A  1 494 ? 64.763  55.051  -6.985  1.00 58.34  ? 494 TYR A CA  1 
ATOM   2573 C  C   . TYR A  1 494 ? 66.163  54.528  -6.749  1.00 60.44  ? 494 TYR A C   1 
ATOM   2574 O  O   . TYR A  1 494 ? 66.324  53.327  -6.614  1.00 55.88  ? 494 TYR A O   1 
ATOM   2575 C  CB  . TYR A  1 494 ? 64.154  55.504  -5.669  1.00 57.12  ? 494 TYR A CB  1 
ATOM   2576 C  CG  . TYR A  1 494 ? 64.352  56.950  -5.325  1.00 56.15  ? 494 TYR A CG  1 
ATOM   2577 C  CD1 . TYR A  1 494 ? 65.497  57.381  -4.655  1.00 56.20  ? 494 TYR A CD1 1 
ATOM   2578 C  CD2 . TYR A  1 494 ? 63.371  57.890  -5.630  1.00 54.35  ? 494 TYR A CD2 1 
ATOM   2579 C  CE1 . TYR A  1 494 ? 65.669  58.717  -4.321  1.00 54.00  ? 494 TYR A CE1 1 
ATOM   2580 C  CE2 . TYR A  1 494 ? 63.530  59.226  -5.300  1.00 51.19  ? 494 TYR A CE2 1 
ATOM   2581 C  CZ  . TYR A  1 494 ? 64.680  59.637  -4.646  1.00 51.59  ? 494 TYR A CZ  1 
ATOM   2582 O  OH  . TYR A  1 494 ? 64.851  60.962  -4.317  1.00 51.38  ? 494 TYR A OH  1 
ATOM   2583 N  N   . LEU A  1 495 ? 67.165  55.405  -6.696  1.00 59.75  ? 495 LEU A N   1 
ATOM   2584 C  CA  . LEU A  1 495 ? 68.573  54.984  -6.571  1.00 60.14  ? 495 LEU A CA  1 
ATOM   2585 C  C   . LEU A  1 495 ? 68.854  53.917  -7.617  1.00 61.12  ? 495 LEU A C   1 
ATOM   2586 O  O   . LEU A  1 495 ? 68.842  52.716  -7.339  1.00 60.66  ? 495 LEU A O   1 
ATOM   2587 C  CB  . LEU A  1 495 ? 68.910  54.468  -5.166  1.00 62.14  ? 495 LEU A CB  1 
ATOM   2588 C  CG  . LEU A  1 495 ? 69.014  55.464  -4.006  1.00 66.17  ? 495 LEU A CG  1 
ATOM   2589 C  CD1 . LEU A  1 495 ? 69.789  54.804  -2.874  1.00 69.97  ? 495 LEU A CD1 1 
ATOM   2590 C  CD2 . LEU A  1 495 ? 69.660  56.792  -4.390  1.00 67.04  ? 495 LEU A CD2 1 
ATOM   2591 N  N   . THR A  1 496 ? 69.061  54.395  -8.833  1.00 63.67  ? 496 THR A N   1 
ATOM   2592 C  CA  . THR A  1 496 ? 69.187  53.562  -10.023 1.00 57.04  ? 496 THR A CA  1 
ATOM   2593 C  C   . THR A  1 496 ? 70.659  53.207  -10.280 1.00 59.05  ? 496 THR A C   1 
ATOM   2594 O  O   . THR A  1 496 ? 70.974  52.081  -10.671 1.00 52.37  ? 496 THR A O   1 
ATOM   2595 C  CB  . THR A  1 496 ? 68.492  54.279  -11.220 1.00 54.60  ? 496 THR A CB  1 
ATOM   2596 O  OG1 . THR A  1 496 ? 67.196  53.697  -11.440 1.00 53.38  ? 496 THR A OG1 1 
ATOM   2597 C  CG2 . THR A  1 496 ? 69.296  54.222  -12.528 1.00 55.09  ? 496 THR A CG2 1 
ATOM   2598 N  N   . GLU A  1 497 ? 71.541  54.181  -10.058 1.00 65.34  ? 497 GLU A N   1 
ATOM   2599 C  CA  . GLU A  1 497 ? 72.987  54.018  -10.218 1.00 65.49  ? 497 GLU A CA  1 
ATOM   2600 C  C   . GLU A  1 497 ? 73.569  53.085  -9.155  1.00 65.12  ? 497 GLU A C   1 
ATOM   2601 O  O   . GLU A  1 497 ? 74.279  52.131  -9.481  1.00 61.01  ? 497 GLU A O   1 
ATOM   2602 C  CB  . GLU A  1 497 ? 73.669  55.384  -10.166 1.00 66.91  ? 497 GLU A CB  1 
ATOM   2603 C  CG  . GLU A  1 497 ? 73.229  56.324  -11.280 1.00 68.70  ? 497 GLU A CG  1 
ATOM   2604 C  CD  . GLU A  1 497 ? 74.192  57.478  -11.498 1.00 74.11  ? 497 GLU A CD  1 
ATOM   2605 O  OE1 . GLU A  1 497 ? 74.368  57.891  -12.663 1.00 70.63  ? 497 GLU A OE1 1 
ATOM   2606 O  OE2 . GLU A  1 497 ? 74.776  57.970  -10.508 1.00 74.19  ? 497 GLU A OE2 1 
ATOM   2607 N  N   . LEU A  1 498 ? 73.274  53.381  -7.891  1.00 72.42  ? 498 LEU A N   1 
ATOM   2608 C  CA  . LEU A  1 498 ? 73.431  52.412  -6.799  1.00 71.30  ? 498 LEU A CA  1 
ATOM   2609 C  C   . LEU A  1 498 ? 72.210  51.498  -6.846  1.00 70.71  ? 498 LEU A C   1 
ATOM   2610 O  O   . LEU A  1 498 ? 71.147  51.941  -7.257  1.00 86.22  ? 498 LEU A O   1 
ATOM   2611 C  CB  . LEU A  1 498 ? 73.510  53.125  -5.447  1.00 68.99  ? 498 LEU A CB  1 
ATOM   2612 C  CG  . LEU A  1 498 ? 73.686  52.252  -4.199  1.00 71.42  ? 498 LEU A CG  1 
ATOM   2613 C  CD1 . LEU A  1 498 ? 75.014  51.509  -4.225  1.00 75.56  ? 498 LEU A CD1 1 
ATOM   2614 C  CD2 . LEU A  1 498 ? 73.577  53.110  -2.949  1.00 70.73  ? 498 LEU A CD2 1 
ATOM   2615 N  N   . LEU A  1 499 ? 72.357  50.237  -6.438  1.00 62.36  ? 499 LEU A N   1 
ATOM   2616 C  CA  . LEU A  1 499 ? 71.278  49.223  -6.542  1.00 68.86  ? 499 LEU A CA  1 
ATOM   2617 C  C   . LEU A  1 499 ? 70.760  49.051  -7.982  1.00 72.85  ? 499 LEU A C   1 
ATOM   2618 O  O   . LEU A  1 499 ? 69.633  49.444  -8.307  1.00 80.70  ? 499 LEU A O   1 
ATOM   2619 C  CB  . LEU A  1 499 ? 70.092  49.513  -5.589  1.00 64.47  ? 499 LEU A CB  1 
ATOM   2620 C  CG  . LEU A  1 499 ? 70.197  49.341  -4.065  1.00 64.14  ? 499 LEU A CG  1 
ATOM   2621 C  CD1 . LEU A  1 499 ? 68.838  48.933  -3.510  1.00 66.09  ? 499 LEU A CD1 1 
ATOM   2622 C  CD2 . LEU A  1 499 ? 71.236  48.321  -3.630  1.00 64.72  ? 499 LEU A CD2 1 
ATOM   2623 N  N   . ARG A  1 500 ? 71.600  48.472  -8.835  1.00 71.46  ? 500 ARG A N   1 
ATOM   2624 C  CA  . ARG A  1 500 ? 71.198  48.107  -10.193 1.00 70.06  ? 500 ARG A CA  1 
ATOM   2625 C  C   . ARG A  1 500 ? 70.445  46.780  -10.154 1.00 67.18  ? 500 ARG A C   1 
ATOM   2626 O  O   . ARG A  1 500 ? 70.671  45.959  -9.258  1.00 63.55  ? 500 ARG A O   1 
ATOM   2627 C  CB  . ARG A  1 500 ? 72.416  48.000  -11.112 1.00 69.93  ? 500 ARG A CB  1 
ATOM   2628 C  CG  . ARG A  1 500 ? 73.093  49.335  -11.388 1.00 71.36  ? 500 ARG A CG  1 
ATOM   2629 C  CD  . ARG A  1 500 ? 73.969  49.292  -12.631 1.00 84.14  ? 500 ARG A CD  1 
ATOM   2630 N  NE  . ARG A  1 500 ? 74.235  50.634  -13.154 1.00 92.82  ? 500 ARG A NE  1 
ATOM   2631 C  CZ  . ARG A  1 500 ? 75.185  51.470  -12.723 1.00 94.04  ? 500 ARG A CZ  1 
ATOM   2632 N  NH1 . ARG A  1 500 ? 76.015  51.140  -11.732 1.00 96.38  ? 500 ARG A NH1 1 
ATOM   2633 N  NH2 . ARG A  1 500 ? 75.307  52.666  -13.297 1.00 95.03  ? 500 ARG A NH2 1 
ATOM   2634 N  N   . LYS A  1 501 ? 69.551  46.579  -11.121 1.00 60.60  ? 501 LYS A N   1 
ATOM   2635 C  CA  . LYS A  1 501 ? 68.800  45.326  -11.235 1.00 56.35  ? 501 LYS A CA  1 
ATOM   2636 C  C   . LYS A  1 501 ? 69.709  44.245  -11.821 1.00 54.43  ? 501 LYS A C   1 
ATOM   2637 O  O   . LYS A  1 501 ? 69.667  43.946  -13.019 1.00 58.80  ? 501 LYS A O   1 
ATOM   2638 C  CB  . LYS A  1 501 ? 67.534  45.512  -12.080 1.00 56.08  ? 501 LYS A CB  1 
ATOM   2639 C  CG  . LYS A  1 501 ? 66.620  44.285  -12.106 1.00 56.75  ? 501 LYS A CG  1 
ATOM   2640 C  CD  . LYS A  1 501 ? 65.674  44.252  -13.302 1.00 56.30  ? 501 LYS A CD  1 
ATOM   2641 C  CE  . LYS A  1 501 ? 66.373  44.202  -14.659 1.00 55.81  ? 501 LYS A CE  1 
ATOM   2642 N  NZ  . LYS A  1 501 ? 67.415  43.143  -14.790 1.00 54.28  ? 501 LYS A NZ  1 
ATOM   2643 N  N   . GLU A  1 502 ? 70.535  43.672  -10.953 1.00 58.51  ? 502 GLU A N   1 
ATOM   2644 C  CA  . GLU A  1 502 ? 71.504  42.650  -11.338 1.00 62.63  ? 502 GLU A CA  1 
ATOM   2645 C  C   . GLU A  1 502 ? 71.926  41.827  -10.124 1.00 62.59  ? 502 GLU A C   1 
ATOM   2646 O  O   . GLU A  1 502 ? 71.656  42.201  -8.979  1.00 65.74  ? 502 GLU A O   1 
ATOM   2647 C  CB  . GLU A  1 502 ? 72.723  43.293  -12.012 1.00 64.60  ? 502 GLU A CB  1 
ATOM   2648 C  CG  . GLU A  1 502 ? 73.452  44.321  -11.154 1.00 66.22  ? 502 GLU A CG  1 
ATOM   2649 C  CD  . GLU A  1 502 ? 74.615  44.992  -11.865 1.00 71.64  ? 502 GLU A CD  1 
ATOM   2650 O  OE1 . GLU A  1 502 ? 74.795  44.785  -13.086 1.00 81.92  ? 502 GLU A OE1 1 
ATOM   2651 O  OE2 . GLU A  1 502 ? 75.359  45.737  -11.195 1.00 75.54  ? 502 GLU A OE2 1 
ATOM   2652 N  N   . GLU A  1 503 ? 72.602  40.717  -10.393 1.00 63.77  ? 503 GLU A N   1 
ATOM   2653 C  CA  . GLU A  1 503 ? 72.958  39.744  -9.361  1.00 58.85  ? 503 GLU A CA  1 
ATOM   2654 C  C   . GLU A  1 503 ? 74.205  40.187  -8.584  1.00 56.39  ? 503 GLU A C   1 
ATOM   2655 O  O   . GLU A  1 503 ? 75.186  40.645  -9.174  1.00 46.42  ? 503 GLU A O   1 
ATOM   2656 C  CB  . GLU A  1 503 ? 73.181  38.356  -9.985  1.00 56.74  ? 503 GLU A CB  1 
ATOM   2657 C  CG  . GLU A  1 503 ? 72.554  37.210  -9.198  1.00 60.05  ? 503 GLU A CG  1 
ATOM   2658 C  CD  . GLU A  1 503 ? 71.044  37.101  -9.371  1.00 66.13  ? 503 GLU A CD  1 
ATOM   2659 O  OE1 . GLU A  1 503 ? 70.506  37.524  -10.419 1.00 65.01  ? 503 GLU A OE1 1 
ATOM   2660 O  OE2 . GLU A  1 503 ? 70.385  36.577  -8.449  1.00 74.08  ? 503 GLU A OE2 1 
ATOM   2661 N  N   . GLY A  1 504 ? 74.148  40.041  -7.261  1.00 57.19  ? 504 GLY A N   1 
ATOM   2662 C  CA  . GLY A  1 504 ? 75.282  40.308  -6.373  1.00 57.21  ? 504 GLY A CA  1 
ATOM   2663 C  C   . GLY A  1 504 ? 75.734  41.750  -6.221  1.00 55.87  ? 504 GLY A C   1 
ATOM   2664 O  O   . GLY A  1 504 ? 76.940  42.011  -6.182  1.00 55.58  ? 504 GLY A O   1 
ATOM   2665 N  N   . VAL A  1 505 ? 74.791  42.688  -6.126  1.00 55.99  ? 505 VAL A N   1 
ATOM   2666 C  CA  . VAL A  1 505 ? 75.143  44.083  -5.823  1.00 61.10  ? 505 VAL A CA  1 
ATOM   2667 C  C   . VAL A  1 505 ? 75.331  44.251  -4.316  1.00 60.13  ? 505 VAL A C   1 
ATOM   2668 O  O   . VAL A  1 505 ? 74.694  43.557  -3.518  1.00 54.97  ? 505 VAL A O   1 
ATOM   2669 C  CB  . VAL A  1 505 ? 74.120  45.122  -6.355  1.00 62.62  ? 505 VAL A CB  1 
ATOM   2670 C  CG1 . VAL A  1 505 ? 73.879  44.930  -7.845  1.00 64.51  ? 505 VAL A CG1 1 
ATOM   2671 C  CG2 . VAL A  1 505 ? 72.803  45.077  -5.595  1.00 63.73  ? 505 VAL A CG2 1 
ATOM   2672 N  N   . THR A  1 506 ? 76.211  45.177  -3.947  1.00 58.94  ? 506 THR A N   1 
ATOM   2673 C  CA  . THR A  1 506 ? 76.472  45.516  -2.548  1.00 57.85  ? 506 THR A CA  1 
ATOM   2674 C  C   . THR A  1 506 ? 76.666  47.022  -2.382  1.00 60.03  ? 506 THR A C   1 
ATOM   2675 O  O   . THR A  1 506 ? 76.867  47.748  -3.360  1.00 64.73  ? 506 THR A O   1 
ATOM   2676 C  CB  . THR A  1 506 ? 77.728  44.807  -2.011  1.00 59.89  ? 506 THR A CB  1 
ATOM   2677 O  OG1 . THR A  1 506 ? 78.856  45.121  -2.840  1.00 67.33  ? 506 THR A OG1 1 
ATOM   2678 C  CG2 . THR A  1 506 ? 77.540  43.296  -1.954  1.00 57.73  ? 506 THR A CG2 1 
ATOM   2679 N  N   . VAL A  1 507 ? 76.615  47.467  -1.129  1.00 58.67  ? 507 VAL A N   1 
ATOM   2680 C  CA  . VAL A  1 507 ? 76.720  48.885  -0.770  1.00 58.96  ? 507 VAL A CA  1 
ATOM   2681 C  C   . VAL A  1 507 ? 77.883  49.074  0.199   1.00 58.12  ? 507 VAL A C   1 
ATOM   2682 O  O   . VAL A  1 507 ? 77.860  48.526  1.297   1.00 58.74  ? 507 VAL A O   1 
ATOM   2683 C  CB  . VAL A  1 507 ? 75.417  49.383  -0.096  1.00 63.26  ? 507 VAL A CB  1 
ATOM   2684 C  CG1 . VAL A  1 507 ? 75.519  50.852  0.304   1.00 63.84  ? 507 VAL A CG1 1 
ATOM   2685 C  CG2 . VAL A  1 507 ? 74.222  49.180  -1.017  1.00 65.11  ? 507 VAL A CG2 1 
ATOM   2686 N  N   . THR A  1 508 ? 78.884  49.860  -0.197  1.00 60.85  ? 508 THR A N   1 
ATOM   2687 C  CA  . THR A  1 508 ? 79.988  50.218  0.703   1.00 57.33  ? 508 THR A CA  1 
ATOM   2688 C  C   . THR A  1 508 ? 79.512  51.251  1.713   1.00 56.58  ? 508 THR A C   1 
ATOM   2689 O  O   . THR A  1 508 ? 78.516  51.940  1.486   1.00 56.18  ? 508 THR A O   1 
ATOM   2690 C  CB  . THR A  1 508 ? 81.203  50.801  -0.043  1.00 59.92  ? 508 THR A CB  1 
ATOM   2691 O  OG1 . THR A  1 508 ? 80.814  51.975  -0.769  1.00 64.58  ? 508 THR A OG1 1 
ATOM   2692 C  CG2 . THR A  1 508 ? 81.792  49.780  -1.005  1.00 60.11  ? 508 THR A CG2 1 
ATOM   2693 N  N   . ARG A  1 509 ? 80.244  51.363  2.817   1.00 61.02  ? 509 ARG A N   1 
ATOM   2694 C  CA  . ARG A  1 509 ? 79.848  52.239  3.926   1.00 60.17  ? 509 ARG A CA  1 
ATOM   2695 C  C   . ARG A  1 509 ? 79.688  53.697  3.492   1.00 58.68  ? 509 ARG A C   1 
ATOM   2696 O  O   . ARG A  1 509 ? 78.777  54.384  3.952   1.00 55.16  ? 509 ARG A O   1 
ATOM   2697 C  CB  . ARG A  1 509 ? 80.839  52.138  5.096   1.00 60.01  ? 509 ARG A CB  1 
ATOM   2698 C  CG  . ARG A  1 509 ? 80.362  52.778  6.400   1.00 60.42  ? 509 ARG A CG  1 
ATOM   2699 C  CD  . ARG A  1 509 ? 79.219  51.993  7.027   1.00 59.44  ? 509 ARG A CD  1 
ATOM   2700 N  NE  . ARG A  1 509 ? 78.559  52.695  8.127   1.00 57.47  ? 509 ARG A NE  1 
ATOM   2701 C  CZ  . ARG A  1 509 ? 77.448  52.276  8.739   1.00 57.69  ? 509 ARG A CZ  1 
ATOM   2702 N  NH1 . ARG A  1 509 ? 76.841  51.145  8.374   1.00 61.28  ? 509 ARG A NH1 1 
ATOM   2703 N  NH2 . ARG A  1 509 ? 76.933  52.997  9.731   1.00 58.90  ? 509 ARG A NH2 1 
ATOM   2704 N  N   . GLU A  1 510 ? 80.561  54.150  2.594   1.00 63.12  ? 510 GLU A N   1 
ATOM   2705 C  CA  . GLU A  1 510 ? 80.471  55.498  2.020   1.00 67.79  ? 510 GLU A CA  1 
ATOM   2706 C  C   . GLU A  1 510 ? 79.184  55.672  1.201   1.00 62.57  ? 510 GLU A C   1 
ATOM   2707 O  O   . GLU A  1 510 ? 78.518  56.704  1.303   1.00 59.09  ? 510 GLU A O   1 
ATOM   2708 C  CB  . GLU A  1 510 ? 81.697  55.791  1.145   1.00 75.02  ? 510 GLU A CB  1 
ATOM   2709 C  CG  . GLU A  1 510 ? 81.830  57.246  0.695   1.00 78.65  ? 510 GLU A CG  1 
ATOM   2710 C  CD  . GLU A  1 510 ? 82.462  57.383  -0.680  1.00 82.74  ? 510 GLU A CD  1 
ATOM   2711 O  OE1 . GLU A  1 510 ? 81.824  57.980  -1.575  1.00 81.20  ? 510 GLU A OE1 1 
ATOM   2712 O  OE2 . GLU A  1 510 ? 83.593  56.887  -0.868  1.00 84.46  ? 510 GLU A OE2 1 
ATOM   2713 N  N   . GLU A  1 511 ? 78.851  54.665  0.393   1.00 56.16  ? 511 GLU A N   1 
ATOM   2714 C  CA  . GLU A  1 511 ? 77.611  54.662  -0.397  1.00 56.78  ? 511 GLU A CA  1 
ATOM   2715 C  C   . GLU A  1 511 ? 76.344  54.582  0.466   1.00 60.70  ? 511 GLU A C   1 
ATOM   2716 O  O   . GLU A  1 511 ? 75.315  55.163  0.115   1.00 61.12  ? 511 GLU A O   1 
ATOM   2717 C  CB  . GLU A  1 511 ? 77.631  53.518  -1.413  1.00 54.08  ? 511 GLU A CB  1 
ATOM   2718 C  CG  . GLU A  1 511 ? 78.611  53.740  -2.556  1.00 54.27  ? 511 GLU A CG  1 
ATOM   2719 C  CD  . GLU A  1 511 ? 78.600  52.620  -3.584  1.00 54.75  ? 511 GLU A CD  1 
ATOM   2720 O  OE1 . GLU A  1 511 ? 78.303  51.461  -3.222  1.00 57.81  ? 511 GLU A OE1 1 
ATOM   2721 O  OE2 . GLU A  1 511 ? 78.899  52.901  -4.763  1.00 51.59  ? 511 GLU A OE2 1 
ATOM   2722 N  N   . PHE A  1 512 ? 76.427  53.856  1.581   1.00 62.83  ? 512 PHE A N   1 
ATOM   2723 C  CA  . PHE A  1 512 ? 75.344  53.793  2.569   1.00 61.99  ? 512 PHE A CA  1 
ATOM   2724 C  C   . PHE A  1 512 ? 75.142  55.141  3.282   1.00 65.23  ? 512 PHE A C   1 
ATOM   2725 O  O   . PHE A  1 512 ? 74.011  55.609  3.423   1.00 68.35  ? 512 PHE A O   1 
ATOM   2726 C  CB  . PHE A  1 512 ? 75.623  52.679  3.588   1.00 58.77  ? 512 PHE A CB  1 
ATOM   2727 C  CG  . PHE A  1 512 ? 74.792  52.777  4.838   1.00 61.22  ? 512 PHE A CG  1 
ATOM   2728 C  CD1 . PHE A  1 512 ? 73.463  52.364  4.841   1.00 63.08  ? 512 PHE A CD1 1 
ATOM   2729 C  CD2 . PHE A  1 512 ? 75.332  53.301  6.009   1.00 64.04  ? 512 PHE A CD2 1 
ATOM   2730 C  CE1 . PHE A  1 512 ? 72.693  52.465  5.992   1.00 64.06  ? 512 PHE A CE1 1 
ATOM   2731 C  CE2 . PHE A  1 512 ? 74.568  53.406  7.161   1.00 61.24  ? 512 PHE A CE2 1 
ATOM   2732 C  CZ  . PHE A  1 512 ? 73.247  52.988  7.152   1.00 62.04  ? 512 PHE A CZ  1 
ATOM   2733 N  N   . LEU A  1 513 ? 76.244  55.733  3.746   1.00 66.89  ? 513 LEU A N   1 
ATOM   2734 C  CA  . LEU A  1 513 ? 76.251  57.081  4.370   1.00 65.59  ? 513 LEU A CA  1 
ATOM   2735 C  C   . LEU A  1 513 ? 75.623  58.195  3.504   1.00 65.55  ? 513 LEU A C   1 
ATOM   2736 O  O   . LEU A  1 513 ? 75.006  59.120  4.039   1.00 57.00  ? 513 LEU A O   1 
ATOM   2737 C  CB  . LEU A  1 513 ? 77.680  57.487  4.795   1.00 63.91  ? 513 LEU A CB  1 
ATOM   2738 C  CG  . LEU A  1 513 ? 78.127  57.246  6.250   1.00 62.34  ? 513 LEU A CG  1 
ATOM   2739 C  CD1 . LEU A  1 513 ? 77.501  58.266  7.190   1.00 65.68  ? 513 LEU A CD1 1 
ATOM   2740 C  CD2 . LEU A  1 513 ? 77.831  55.842  6.751   1.00 61.63  ? 513 LEU A CD2 1 
ATOM   2741 N  N   . GLN A  1 514 ? 75.800  58.113  2.185   1.00 67.70  ? 514 GLN A N   1 
ATOM   2742 C  CA  . GLN A  1 514 ? 75.186  59.064  1.237   1.00 68.50  ? 514 GLN A CA  1 
ATOM   2743 C  C   . GLN A  1 514 ? 73.695  58.777  1.016   1.00 67.91  ? 514 GLN A C   1 
ATOM   2744 O  O   . GLN A  1 514 ? 72.915  59.700  0.777   1.00 65.18  ? 514 GLN A O   1 
ATOM   2745 C  CB  . GLN A  1 514 ? 75.930  59.038  -0.111  1.00 70.77  ? 514 GLN A CB  1 
ATOM   2746 C  CG  . GLN A  1 514 ? 75.402  59.991  -1.191  1.00 73.54  ? 514 GLN A CG  1 
ATOM   2747 C  CD  . GLN A  1 514 ? 75.440  61.458  -0.787  1.00 76.05  ? 514 GLN A CD  1 
ATOM   2748 O  OE1 . GLN A  1 514 ? 76.333  61.895  -0.059  1.00 82.60  ? 514 GLN A OE1 1 
ATOM   2749 N  NE2 . GLN A  1 514 ? 74.470  62.228  -1.269  1.00 67.98  ? 514 GLN A NE2 1 
ATOM   2750 N  N   . ALA A  1 515 ? 73.317  57.501  1.073   1.00 64.73  ? 515 ALA A N   1 
ATOM   2751 C  CA  . ALA A  1 515 ? 71.933  57.072  0.842   1.00 59.14  ? 515 ALA A CA  1 
ATOM   2752 C  C   . ALA A  1 515 ? 70.941  57.589  1.886   1.00 58.92  ? 515 ALA A C   1 
ATOM   2753 O  O   . ALA A  1 515 ? 69.821  57.950  1.534   1.00 62.53  ? 515 ALA A O   1 
ATOM   2754 C  CB  . ALA A  1 515 ? 71.860  55.558  0.752   1.00 56.57  ? 515 ALA A CB  1 
ATOM   2755 N  N   . VAL A  1 516 ? 71.345  57.625  3.155   1.00 61.55  ? 516 VAL A N   1 
ATOM   2756 C  CA  . VAL A  1 516 ? 70.487  58.183  4.225   1.00 66.84  ? 516 VAL A CA  1 
ATOM   2757 C  C   . VAL A  1 516 ? 70.151  59.675  4.043   1.00 62.75  ? 516 VAL A C   1 
ATOM   2758 O  O   . VAL A  1 516 ? 69.105  60.132  4.497   1.00 59.83  ? 516 VAL A O   1 
ATOM   2759 C  CB  . VAL A  1 516 ? 71.050  57.940  5.650   1.00 69.49  ? 516 VAL A CB  1 
ATOM   2760 C  CG1 . VAL A  1 516 ? 71.104  56.449  5.950   1.00 71.91  ? 516 VAL A CG1 1 
ATOM   2761 C  CG2 . VAL A  1 516 ? 72.420  58.578  5.849   1.00 70.23  ? 516 VAL A CG2 1 
ATOM   2762 N  N   . ARG A  1 517 ? 71.044  60.416  3.389   1.00 64.29  ? 517 ARG A N   1 
ATOM   2763 C  CA  . ARG A  1 517 ? 70.795  61.810  3.003   1.00 67.46  ? 517 ARG A CA  1 
ATOM   2764 C  C   . ARG A  1 517 ? 69.716  61.856  1.920   1.00 61.15  ? 517 ARG A C   1 
ATOM   2765 O  O   . ARG A  1 517 ? 68.739  62.597  2.036   1.00 61.85  ? 517 ARG A O   1 
ATOM   2766 C  CB  . ARG A  1 517 ? 72.090  62.454  2.479   1.00 78.80  ? 517 ARG A CB  1 
ATOM   2767 C  CG  . ARG A  1 517 ? 72.024  63.951  2.173   1.00 85.57  ? 517 ARG A CG  1 
ATOM   2768 C  CD  . ARG A  1 517 ? 72.426  64.797  3.371   1.00 87.95  ? 517 ARG A CD  1 
ATOM   2769 N  NE  . ARG A  1 517 ? 72.212  66.233  3.164   1.00 90.58  ? 517 ARG A NE  1 
ATOM   2770 C  CZ  . ARG A  1 517 ? 71.030  66.857  3.181   1.00 86.38  ? 517 ARG A CZ  1 
ATOM   2771 N  NH1 . ARG A  1 517 ? 69.890  66.191  3.374   1.00 84.89  ? 517 ARG A NH1 1 
ATOM   2772 N  NH2 . ARG A  1 517 ? 70.982  68.174  2.985   1.00 81.02  ? 517 ARG A NH2 1 
ATOM   2773 N  N   . GLU A  1 518 ? 69.917  61.059  0.871   1.00 59.64  ? 518 GLU A N   1 
ATOM   2774 C  CA  . GLU A  1 518 ? 68.996  60.989  -0.270  1.00 62.05  ? 518 GLU A CA  1 
ATOM   2775 C  C   . GLU A  1 518 ? 67.639  60.357  0.067   1.00 61.82  ? 518 GLU A C   1 
ATOM   2776 O  O   . GLU A  1 518 ? 66.597  60.859  -0.360  1.00 60.01  ? 518 GLU A O   1 
ATOM   2777 C  CB  . GLU A  1 518 ? 69.661  60.244  -1.437  1.00 62.51  ? 518 GLU A CB  1 
ATOM   2778 C  CG  . GLU A  1 518 ? 70.836  61.003  -2.047  1.00 67.75  ? 518 GLU A CG  1 
ATOM   2779 C  CD  . GLU A  1 518 ? 71.452  60.312  -3.255  1.00 66.95  ? 518 GLU A CD  1 
ATOM   2780 O  OE1 . GLU A  1 518 ? 70.701  59.798  -4.111  1.00 67.45  ? 518 GLU A OE1 1 
ATOM   2781 O  OE2 . GLU A  1 518 ? 72.698  60.297  -3.358  1.00 64.71  ? 518 GLU A OE2 1 
ATOM   2782 N  N   . LEU A  1 519 ? 67.662  59.263  0.824   1.00 59.75  ? 519 LEU A N   1 
ATOM   2783 C  CA  . LEU A  1 519 ? 66.439  58.548  1.218   1.00 57.57  ? 519 LEU A CA  1 
ATOM   2784 C  C   . LEU A  1 519 ? 65.651  59.256  2.329   1.00 57.69  ? 519 LEU A C   1 
ATOM   2785 O  O   . LEU A  1 519 ? 64.446  59.035  2.461   1.00 61.11  ? 519 LEU A O   1 
ATOM   2786 C  CB  . LEU A  1 519 ? 66.762  57.105  1.634   1.00 61.43  ? 519 LEU A CB  1 
ATOM   2787 C  CG  . LEU A  1 519 ? 67.285  56.137  0.561   1.00 61.27  ? 519 LEU A CG  1 
ATOM   2788 C  CD1 . LEU A  1 519 ? 67.587  54.786  1.190   1.00 60.84  ? 519 LEU A CD1 1 
ATOM   2789 C  CD2 . LEU A  1 519 ? 66.308  55.958  -0.589  1.00 60.13  ? 519 LEU A CD2 1 
ATOM   2790 N  N   . ASN A  1 520 ? 66.331  60.085  3.123   1.00 60.33  ? 520 ASN A N   1 
ATOM   2791 C  CA  . ASN A  1 520 ? 65.683  60.971  4.101   1.00 62.42  ? 520 ASN A CA  1 
ATOM   2792 C  C   . ASN A  1 520 ? 66.166  62.408  3.870   1.00 68.45  ? 520 ASN A C   1 
ATOM   2793 O  O   . ASN A  1 520 ? 67.035  62.896  4.598   1.00 72.95  ? 520 ASN A O   1 
ATOM   2794 C  CB  . ASN A  1 520 ? 65.985  60.534  5.540   1.00 60.15  ? 520 ASN A CB  1 
ATOM   2795 C  CG  . ASN A  1 520 ? 65.299  59.237  5.915   1.00 60.97  ? 520 ASN A CG  1 
ATOM   2796 O  OD1 . ASN A  1 520 ? 64.075  59.117  5.822   1.00 70.70  ? 520 ASN A OD1 1 
ATOM   2797 N  ND2 . ASN A  1 520 ? 66.081  58.263  6.356   1.00 53.95  ? 520 ASN A ND2 1 
ATOM   2798 N  N   . PRO A  1 521 ? 65.616  63.086  2.840   1.00 77.28  ? 521 PRO A N   1 
ATOM   2799 C  CA  . PRO A  1 521 ? 66.013  64.462  2.526   1.00 76.88  ? 521 PRO A CA  1 
ATOM   2800 C  C   . PRO A  1 521 ? 65.356  65.552  3.395   1.00 70.41  ? 521 PRO A C   1 
ATOM   2801 O  O   . PRO A  1 521 ? 65.849  66.682  3.411   1.00 67.40  ? 521 PRO A O   1 
ATOM   2802 C  CB  . PRO A  1 521 ? 65.589  64.612  1.062   1.00 83.43  ? 521 PRO A CB  1 
ATOM   2803 C  CG  . PRO A  1 521 ? 64.407  63.717  0.924   1.00 84.71  ? 521 PRO A CG  1 
ATOM   2804 C  CD  . PRO A  1 521 ? 64.565  62.603  1.923   1.00 79.82  ? 521 PRO A CD  1 
ATOM   2805 N  N   . TYR A  1 522 ? 64.275  65.218  4.105   1.00 75.26  ? 522 TYR A N   1 
ATOM   2806 C  CA  . TYR A  1 522 ? 63.533  66.186  4.935   1.00 79.14  ? 522 TYR A CA  1 
ATOM   2807 C  C   . TYR A  1 522 ? 63.998  66.309  6.401   1.00 80.11  ? 522 TYR A C   1 
ATOM   2808 O  O   . TYR A  1 522 ? 63.445  67.123  7.147   1.00 88.44  ? 522 TYR A O   1 
ATOM   2809 C  CB  . TYR A  1 522 ? 62.034  65.857  4.906   1.00 81.77  ? 522 TYR A CB  1 
ATOM   2810 C  CG  . TYR A  1 522 ? 61.403  65.966  3.533   1.00 86.33  ? 522 TYR A CG  1 
ATOM   2811 C  CD1 . TYR A  1 522 ? 61.054  67.210  2.999   1.00 88.38  ? 522 TYR A CD1 1 
ATOM   2812 C  CD2 . TYR A  1 522 ? 61.143  64.826  2.769   1.00 88.22  ? 522 TYR A CD2 1 
ATOM   2813 C  CE1 . TYR A  1 522 ? 60.472  67.313  1.741   1.00 94.58  ? 522 TYR A CE1 1 
ATOM   2814 C  CE2 . TYR A  1 522 ? 60.561  64.919  1.511   1.00 88.50  ? 522 TYR A CE2 1 
ATOM   2815 C  CZ  . TYR A  1 522 ? 60.227  66.163  1.000   1.00 93.96  ? 522 TYR A CZ  1 
ATOM   2816 O  OH  . TYR A  1 522 ? 59.650  66.259  -0.246  1.00 84.69  ? 522 TYR A OH  1 
ATOM   2817 N  N   . VAL A  1 523 ? 65.004  65.528  6.808   1.00 83.86  ? 523 VAL A N   1 
ATOM   2818 C  CA  . VAL A  1 523 ? 65.504  65.546  8.204   1.00 88.47  ? 523 VAL A CA  1 
ATOM   2819 C  C   . VAL A  1 523 ? 66.816  66.330  8.344   1.00 94.04  ? 523 VAL A C   1 
ATOM   2820 O  O   . VAL A  1 523 ? 67.630  66.366  7.418   1.00 93.21  ? 523 VAL A O   1 
ATOM   2821 C  CB  . VAL A  1 523 ? 65.657  64.126  8.809   1.00 91.30  ? 523 VAL A CB  1 
ATOM   2822 C  CG1 . VAL A  1 523 ? 64.306  63.425  8.861   1.00 86.26  ? 523 VAL A CG1 1 
ATOM   2823 C  CG2 . VAL A  1 523 ? 66.683  63.283  8.056   1.00 94.80  ? 523 VAL A CG2 1 
ATOM   2824 N  N   . ASN A  1 524 ? 67.000  66.938  9.517   1.00 101.46 ? 524 ASN A N   1 
ATOM   2825 C  CA  . ASN A  1 524 ? 68.093  67.906  9.767   1.00 101.64 ? 524 ASN A CA  1 
ATOM   2826 C  C   . ASN A  1 524 ? 69.517  67.369  9.554   1.00 95.89  ? 524 ASN A C   1 
ATOM   2827 O  O   . ASN A  1 524 ? 70.203  67.782  8.616   1.00 95.24  ? 524 ASN A O   1 
ATOM   2828 C  CB  . ASN A  1 524 ? 67.970  68.592  11.156  1.00 103.77 ? 524 ASN A CB  1 
ATOM   2829 C  CG  . ASN A  1 524 ? 67.634  67.628  12.290  1.00 100.27 ? 524 ASN A CG  1 
ATOM   2830 O  OD1 . ASN A  1 524 ? 66.637  66.906  12.231  1.00 101.25 ? 524 ASN A OD1 1 
ATOM   2831 N  ND2 . ASN A  1 524 ? 68.457  67.631  13.335  1.00 93.10  ? 524 ASN A ND2 1 
ATOM   2832 N  N   . GLY A  1 525 ? 69.943  66.442  10.405  1.00 86.56  ? 525 GLY A N   1 
ATOM   2833 C  CA  . GLY A  1 525 ? 71.345  66.020  10.456  1.00 85.61  ? 525 GLY A CA  1 
ATOM   2834 C  C   . GLY A  1 525 ? 71.672  65.241  11.712  1.00 84.35  ? 525 GLY A C   1 
ATOM   2835 O  O   . GLY A  1 525 ? 72.281  64.175  11.643  1.00 83.08  ? 525 GLY A O   1 
ATOM   2836 N  N   . ALA A  1 526 ? 71.272  65.784  12.860  1.00 85.49  ? 526 ALA A N   1 
ATOM   2837 C  CA  . ALA A  1 526 ? 71.300  65.056  14.135  1.00 81.65  ? 526 ALA A CA  1 
ATOM   2838 C  C   . ALA A  1 526 ? 70.328  63.868  14.118  1.00 78.65  ? 526 ALA A C   1 
ATOM   2839 O  O   . ALA A  1 526 ? 70.595  62.827  14.722  1.00 78.61  ? 526 ALA A O   1 
ATOM   2840 C  CB  . ALA A  1 526 ? 70.973  65.993  15.288  1.00 75.42  ? 526 ALA A CB  1 
ATOM   2841 N  N   . ALA A  1 527 ? 69.197  64.047  13.435  1.00 70.65  ? 527 ALA A N   1 
ATOM   2842 C  CA  . ALA A  1 527 ? 68.259  62.962  13.139  1.00 65.96  ? 527 ALA A CA  1 
ATOM   2843 C  C   . ALA A  1 527 ? 68.871  61.936  12.190  1.00 64.23  ? 527 ALA A C   1 
ATOM   2844 O  O   . ALA A  1 527 ? 68.660  60.735  12.350  1.00 67.47  ? 527 ALA A O   1 
ATOM   2845 C  CB  . ALA A  1 527 ? 66.985  63.529  12.535  1.00 69.71  ? 527 ALA A CB  1 
ATOM   2846 N  N   . ARG A  1 528 ? 69.615  62.421  11.198  1.00 66.79  ? 528 ARG A N   1 
ATOM   2847 C  CA  . ARG A  1 528 ? 70.354  61.557  10.271  1.00 63.34  ? 528 ARG A CA  1 
ATOM   2848 C  C   . ARG A  1 528 ? 71.434  60.715  10.962  1.00 66.50  ? 528 ARG A C   1 
ATOM   2849 O  O   . ARG A  1 528 ? 71.753  59.620  10.496  1.00 69.48  ? 528 ARG A O   1 
ATOM   2850 C  CB  . ARG A  1 528 ? 70.968  62.381  9.134   1.00 66.82  ? 528 ARG A CB  1 
ATOM   2851 C  CG  . ARG A  1 528 ? 71.220  61.568  7.872   1.00 74.60  ? 528 ARG A CG  1 
ATOM   2852 C  CD  . ARG A  1 528 ? 71.724  62.412  6.709   1.00 72.65  ? 528 ARG A CD  1 
ATOM   2853 N  NE  . ARG A  1 528 ? 70.824  63.526  6.387   1.00 69.44  ? 528 ARG A NE  1 
ATOM   2854 C  CZ  . ARG A  1 528 ? 71.050  64.823  6.627   1.00 69.96  ? 528 ARG A CZ  1 
ATOM   2855 N  NH1 . ARG A  1 528 ? 72.183  65.254  7.188   1.00 67.37  ? 528 ARG A NH1 1 
ATOM   2856 N  NH2 . ARG A  1 528 ? 70.130  65.717  6.275   1.00 70.71  ? 528 ARG A NH2 1 
ATOM   2857 N  N   . GLN A  1 529 ? 71.991  61.228  12.061  1.00 67.49  ? 529 GLN A N   1 
ATOM   2858 C  CA  . GLN A  1 529 ? 72.903  60.456  12.914  1.00 63.20  ? 529 GLN A CA  1 
ATOM   2859 C  C   . GLN A  1 529 ? 72.179  59.336  13.669  1.00 62.33  ? 529 GLN A C   1 
ATOM   2860 O  O   . GLN A  1 529 ? 72.741  58.257  13.870  1.00 73.81  ? 529 GLN A O   1 
ATOM   2861 C  CB  . GLN A  1 529 ? 73.639  61.358  13.917  1.00 66.48  ? 529 GLN A CB  1 
ATOM   2862 C  CG  . GLN A  1 529 ? 74.597  62.378  13.309  1.00 69.50  ? 529 GLN A CG  1 
ATOM   2863 C  CD  . GLN A  1 529 ? 75.601  61.772  12.342  1.00 78.35  ? 529 GLN A CD  1 
ATOM   2864 O  OE1 . GLN A  1 529 ? 76.142  60.691  12.583  1.00 80.55  ? 529 GLN A OE1 1 
ATOM   2865 N  NE2 . GLN A  1 529 ? 75.855  62.469  11.240  1.00 85.19  ? 529 GLN A NE2 1 
ATOM   2866 N  N   . ALA A  1 530 ? 70.954  59.606  14.113  1.00 58.37  ? 530 ALA A N   1 
ATOM   2867 C  CA  . ALA A  1 530 ? 70.109  58.577  14.733  1.00 57.70  ? 530 ALA A CA  1 
ATOM   2868 C  C   . ALA A  1 530 ? 69.731  57.459  13.755  1.00 59.47  ? 530 ALA A C   1 
ATOM   2869 O  O   . ALA A  1 530 ? 69.601  56.298  14.155  1.00 65.42  ? 530 ALA A O   1 
ATOM   2870 C  CB  . ALA A  1 530 ? 68.858  59.205  15.326  1.00 55.41  ? 530 ALA A CB  1 
ATOM   2871 N  N   . ILE A  1 531 ? 69.554  57.817  12.483  1.00 53.57  ? 531 ILE A N   1 
ATOM   2872 C  CA  . ILE A  1 531 ? 69.216  56.849  11.432  1.00 50.68  ? 531 ILE A CA  1 
ATOM   2873 C  C   . ILE A  1 531 ? 70.388  55.910  11.119  1.00 45.49  ? 531 ILE A C   1 
ATOM   2874 O  O   . ILE A  1 531 ? 70.180  54.704  10.967  1.00 44.47  ? 531 ILE A O   1 
ATOM   2875 C  CB  . ILE A  1 531 ? 68.706  57.555  10.150  1.00 51.83  ? 531 ILE A CB  1 
ATOM   2876 C  CG1 . ILE A  1 531 ? 67.398  58.297  10.451  1.00 53.80  ? 531 ILE A CG1 1 
ATOM   2877 C  CG2 . ILE A  1 531 ? 68.450  56.552  9.023   1.00 52.19  ? 531 ILE A CG2 1 
ATOM   2878 C  CD1 . ILE A  1 531 ? 67.090  59.433  9.502   1.00 56.12  ? 531 ILE A CD1 1 
ATOM   2879 N  N   . VAL A  1 532 ? 71.598  56.459  11.008  1.00 48.25  ? 532 VAL A N   1 
ATOM   2880 C  CA  . VAL A  1 532 ? 72.797  55.629  10.764  1.00 56.18  ? 532 VAL A CA  1 
ATOM   2881 C  C   . VAL A  1 532 ? 73.145  54.690  11.931  1.00 54.65  ? 532 VAL A C   1 
ATOM   2882 O  O   . VAL A  1 532 ? 73.717  53.631  11.702  1.00 53.30  ? 532 VAL A O   1 
ATOM   2883 C  CB  . VAL A  1 532 ? 74.056  56.441  10.342  1.00 63.38  ? 532 VAL A CB  1 
ATOM   2884 C  CG1 . VAL A  1 532 ? 73.811  57.174  9.032   1.00 66.24  ? 532 VAL A CG1 1 
ATOM   2885 C  CG2 . VAL A  1 532 ? 74.508  57.417  11.415  1.00 73.27  ? 532 VAL A CG2 1 
ATOM   2886 N  N   . PHE A  1 533 ? 72.803  55.069  13.164  1.00 54.82  ? 533 PHE A N   1 
ATOM   2887 C  CA  . PHE A  1 533 ? 73.011  54.189  14.330  1.00 55.10  ? 533 PHE A CA  1 
ATOM   2888 C  C   . PHE A  1 533 ? 71.972  53.069  14.398  1.00 52.28  ? 533 PHE A C   1 
ATOM   2889 O  O   . PHE A  1 533 ? 72.328  51.909  14.642  1.00 52.91  ? 533 PHE A O   1 
ATOM   2890 C  CB  . PHE A  1 533 ? 73.011  54.977  15.650  1.00 62.35  ? 533 PHE A CB  1 
ATOM   2891 C  CG  . PHE A  1 533 ? 72.890  54.104  16.880  1.00 62.52  ? 533 PHE A CG  1 
ATOM   2892 C  CD1 . PHE A  1 533 ? 73.944  53.281  17.273  1.00 58.09  ? 533 PHE A CD1 1 
ATOM   2893 C  CD2 . PHE A  1 533 ? 71.715  54.084  17.633  1.00 63.69  ? 533 PHE A CD2 1 
ATOM   2894 C  CE1 . PHE A  1 533 ? 73.835  52.467  18.394  1.00 56.84  ? 533 PHE A CE1 1 
ATOM   2895 C  CE2 . PHE A  1 533 ? 71.602  53.272  18.755  1.00 59.03  ? 533 PHE A CE2 1 
ATOM   2896 C  CZ  . PHE A  1 533 ? 72.663  52.463  19.136  1.00 57.81  ? 533 PHE A CZ  1 
ATOM   2897 N  N   . GLU A  1 534 ? 70.699  53.416  14.203  1.00 53.35  ? 534 GLU A N   1 
ATOM   2898 C  CA  . GLU A  1 534 ? 69.613  52.429  14.270  1.00 60.96  ? 534 GLU A CA  1 
ATOM   2899 C  C   . GLU A  1 534 ? 69.702  51.374  13.166  1.00 58.89  ? 534 GLU A C   1 
ATOM   2900 O  O   . GLU A  1 534 ? 69.347  50.214  13.390  1.00 57.27  ? 534 GLU A O   1 
ATOM   2901 C  CB  . GLU A  1 534 ? 68.238  53.113  14.221  1.00 65.16  ? 534 GLU A CB  1 
ATOM   2902 C  CG  . GLU A  1 534 ? 67.042  52.178  14.425  1.00 63.94  ? 534 GLU A CG  1 
ATOM   2903 C  CD  . GLU A  1 534 ? 67.060  51.445  15.759  1.00 61.41  ? 534 GLU A CD  1 
ATOM   2904 O  OE1 . GLU A  1 534 ? 67.398  52.072  16.787  1.00 57.79  ? 534 GLU A OE1 1 
ATOM   2905 O  OE2 . GLU A  1 534 ? 66.731  50.240  15.780  1.00 60.47  ? 534 GLU A OE2 1 
ATOM   2906 N  N   . TYR A  1 535 ? 70.176  51.783  11.992  1.00 53.57  ? 535 TYR A N   1 
ATOM   2907 C  CA  . TYR A  1 535 ? 70.264  50.899  10.834  1.00 54.91  ? 535 TYR A CA  1 
ATOM   2908 C  C   . TYR A  1 535 ? 71.720  50.647  10.453  1.00 57.88  ? 535 TYR A C   1 
ATOM   2909 O  O   . TYR A  1 535 ? 72.186  51.043  9.386   1.00 68.23  ? 535 TYR A O   1 
ATOM   2910 C  CB  . TYR A  1 535 ? 69.427  51.465  9.683   1.00 55.71  ? 535 TYR A CB  1 
ATOM   2911 C  CG  . TYR A  1 535 ? 67.947  51.435  10.000  1.00 52.72  ? 535 TYR A CG  1 
ATOM   2912 C  CD1 . TYR A  1 535 ? 67.330  52.497  10.666  1.00 51.23  ? 535 TYR A CD1 1 
ATOM   2913 C  CD2 . TYR A  1 535 ? 67.167  50.326  9.672   1.00 51.62  ? 535 TYR A CD2 1 
ATOM   2914 C  CE1 . TYR A  1 535 ? 65.977  52.463  10.974  1.00 51.02  ? 535 TYR A CE1 1 
ATOM   2915 C  CE2 . TYR A  1 535 ? 65.815  50.285  9.976   1.00 51.45  ? 535 TYR A CE2 1 
ATOM   2916 C  CZ  . TYR A  1 535 ? 65.226  51.351  10.626  1.00 51.47  ? 535 TYR A CZ  1 
ATOM   2917 O  OH  . TYR A  1 535 ? 63.885  51.304  10.923  1.00 51.88  ? 535 TYR A OH  1 
ATOM   2918 N  N   . THR A  1 536 ? 72.422  49.975  11.364  1.00 60.18  ? 536 THR A N   1 
ATOM   2919 C  CA  . THR A  1 536 ? 73.805  49.528  11.155  1.00 59.72  ? 536 THR A CA  1 
ATOM   2920 C  C   . THR A  1 536 ? 74.011  48.176  11.829  1.00 58.01  ? 536 THR A C   1 
ATOM   2921 O  O   . THR A  1 536 ? 73.640  47.986  12.990  1.00 58.80  ? 536 THR A O   1 
ATOM   2922 C  CB  . THR A  1 536 ? 74.834  50.546  11.698  1.00 55.53  ? 536 THR A CB  1 
ATOM   2923 O  OG1 . THR A  1 536 ? 74.785  51.731  10.900  1.00 57.07  ? 536 THR A OG1 1 
ATOM   2924 C  CG2 . THR A  1 536 ? 76.273  50.000  11.645  1.00 53.42  ? 536 THR A CG2 1 
ATOM   2925 N  N   . ASP A  1 537 ? 74.616  47.251  11.088  1.00 56.40  ? 537 ASP A N   1 
ATOM   2926 C  CA  . ASP A  1 537 ? 74.984  45.940  11.605  1.00 55.37  ? 537 ASP A CA  1 
ATOM   2927 C  C   . ASP A  1 537 ? 76.292  46.066  12.384  1.00 54.19  ? 537 ASP A C   1 
ATOM   2928 O  O   . ASP A  1 537 ? 77.372  45.962  11.814  1.00 55.38  ? 537 ASP A O   1 
ATOM   2929 C  CB  . ASP A  1 537 ? 75.130  44.949  10.443  1.00 54.80  ? 537 ASP A CB  1 
ATOM   2930 C  CG  . ASP A  1 537 ? 75.451  43.535  10.901  1.00 52.08  ? 537 ASP A CG  1 
ATOM   2931 O  OD1 . ASP A  1 537 ? 75.034  43.139  12.013  1.00 55.58  ? 537 ASP A OD1 1 
ATOM   2932 O  OD2 . ASP A  1 537 ? 76.119  42.808  10.135  1.00 51.97  ? 537 ASP A OD2 1 
ATOM   2933 N  N   . TRP A  1 538 ? 76.184  46.284  13.692  1.00 55.58  ? 538 TRP A N   1 
ATOM   2934 C  CA  . TRP A  1 538 ? 77.362  46.510  14.544  1.00 52.81  ? 538 TRP A CA  1 
ATOM   2935 C  C   . TRP A  1 538 ? 78.239  45.275  14.782  1.00 57.00  ? 538 TRP A C   1 
ATOM   2936 O  O   . TRP A  1 538 ? 79.341  45.401  15.320  1.00 62.62  ? 538 TRP A O   1 
ATOM   2937 C  CB  . TRP A  1 538 ? 76.941  47.134  15.877  1.00 50.46  ? 538 TRP A CB  1 
ATOM   2938 C  CG  . TRP A  1 538 ? 76.363  48.499  15.695  1.00 50.71  ? 538 TRP A CG  1 
ATOM   2939 C  CD1 . TRP A  1 538 ? 75.052  48.854  15.808  1.00 50.41  ? 538 TRP A CD1 1 
ATOM   2940 C  CD2 . TRP A  1 538 ? 77.072  49.690  15.325  1.00 52.93  ? 538 TRP A CD2 1 
ATOM   2941 N  NE1 . TRP A  1 538 ? 74.899  50.195  15.550  1.00 50.16  ? 538 TRP A NE1 1 
ATOM   2942 C  CE2 . TRP A  1 538 ? 76.122  50.734  15.250  1.00 51.36  ? 538 TRP A CE2 1 
ATOM   2943 C  CE3 . TRP A  1 538 ? 78.419  49.979  15.059  1.00 55.54  ? 538 TRP A CE3 1 
ATOM   2944 C  CZ2 . TRP A  1 538 ? 76.476  52.051  14.917  1.00 51.24  ? 538 TRP A CZ2 1 
ATOM   2945 C  CZ3 . TRP A  1 538 ? 78.772  51.293  14.728  1.00 57.54  ? 538 TRP A CZ3 1 
ATOM   2946 C  CH2 . TRP A  1 538 ? 77.799  52.310  14.662  1.00 53.11  ? 538 TRP A CH2 1 
ATOM   2947 N  N   . THR A  1 539 ? 77.754  44.096  14.390  1.00 59.99  ? 539 THR A N   1 
ATOM   2948 C  CA  . THR A  1 539 ? 78.590  42.891  14.344  1.00 60.22  ? 539 THR A CA  1 
ATOM   2949 C  C   . THR A  1 539 ? 79.683  43.030  13.280  1.00 63.33  ? 539 THR A C   1 
ATOM   2950 O  O   . THR A  1 539 ? 80.798  42.540  13.465  1.00 78.38  ? 539 THR A O   1 
ATOM   2951 C  CB  . THR A  1 539 ? 77.782  41.612  14.029  1.00 61.69  ? 539 THR A CB  1 
ATOM   2952 O  OG1 . THR A  1 539 ? 77.209  41.702  12.719  1.00 60.15  ? 539 THR A OG1 1 
ATOM   2953 C  CG2 . THR A  1 539 ? 76.675  41.377  15.056  1.00 65.13  ? 539 THR A CG2 1 
ATOM   2954 N  N   . GLU A  1 540 ? 79.344  43.689  12.170  1.00 64.76  ? 540 GLU A N   1 
ATOM   2955 C  CA  . GLU A  1 540 ? 80.281  43.927  11.070  1.00 64.13  ? 540 GLU A CA  1 
ATOM   2956 C  C   . GLU A  1 540 ? 79.885  45.243  10.359  1.00 57.80  ? 540 GLU A C   1 
ATOM   2957 O  O   . GLU A  1 540 ? 79.297  45.213  9.277   1.00 55.60  ? 540 GLU A O   1 
ATOM   2958 C  CB  . GLU A  1 540 ? 80.283  42.709  10.124  1.00 73.17  ? 540 GLU A CB  1 
ATOM   2959 C  CG  . GLU A  1 540 ? 81.630  42.396  9.482   1.00 85.09  ? 540 GLU A CG  1 
ATOM   2960 C  CD  . GLU A  1 540 ? 81.705  40.981  8.928   1.00 89.23  ? 540 GLU A CD  1 
ATOM   2961 O  OE1 . GLU A  1 540 ? 81.192  40.748  7.814   1.00 79.93  ? 540 GLU A OE1 1 
ATOM   2962 O  OE2 . GLU A  1 540 ? 82.286  40.105  9.604   1.00 85.83  ? 540 GLU A OE2 1 
ATOM   2963 N  N   . PRO A  1 541 ? 80.180  46.408  10.992  1.00 58.30  ? 541 PRO A N   1 
ATOM   2964 C  CA  . PRO A  1 541 ? 79.723  47.747  10.558  1.00 60.23  ? 541 PRO A CA  1 
ATOM   2965 C  C   . PRO A  1 541 ? 79.883  48.089  9.079   1.00 65.37  ? 541 PRO A C   1 
ATOM   2966 O  O   . PRO A  1 541 ? 78.993  48.711  8.495   1.00 67.84  ? 541 PRO A O   1 
ATOM   2967 C  CB  . PRO A  1 541 ? 80.591  48.690  11.390  1.00 58.57  ? 541 PRO A CB  1 
ATOM   2968 C  CG  . PRO A  1 541 ? 80.817  47.944  12.649  1.00 62.72  ? 541 PRO A CG  1 
ATOM   2969 C  CD  . PRO A  1 541 ? 80.946  46.500  12.252  1.00 64.72  ? 541 PRO A CD  1 
ATOM   2970 N  N   . ASP A  1 542 ? 81.007  47.682  8.496   1.00 66.36  ? 542 ASP A N   1 
ATOM   2971 C  CA  . ASP A  1 542 ? 81.325  47.975  7.093   1.00 62.98  ? 542 ASP A CA  1 
ATOM   2972 C  C   . ASP A  1 542 ? 81.026  46.805  6.138   1.00 58.48  ? 542 ASP A C   1 
ATOM   2973 O  O   . ASP A  1 542 ? 81.674  46.679  5.094   1.00 53.71  ? 542 ASP A O   1 
ATOM   2974 C  CB  . ASP A  1 542 ? 82.803  48.377  6.980   1.00 65.42  ? 542 ASP A CB  1 
ATOM   2975 C  CG  . ASP A  1 542 ? 83.162  49.568  7.859   1.00 66.98  ? 542 ASP A CG  1 
ATOM   2976 O  OD1 . ASP A  1 542 ? 82.337  50.497  7.993   1.00 65.23  ? 542 ASP A OD1 1 
ATOM   2977 O  OD2 . ASP A  1 542 ? 84.283  49.578  8.410   1.00 74.16  ? 542 ASP A OD2 1 
ATOM   2978 N  N   . ASN A  1 543 ? 80.045  45.964  6.477   1.00 55.07  ? 543 ASN A N   1 
ATOM   2979 C  CA  . ASN A  1 543 ? 79.690  44.807  5.644   1.00 55.41  ? 543 ASN A CA  1 
ATOM   2980 C  C   . ASN A  1 543 ? 78.901  45.288  4.422   1.00 54.58  ? 543 ASN A C   1 
ATOM   2981 O  O   . ASN A  1 543 ? 77.874  45.950  4.582   1.00 48.66  ? 543 ASN A O   1 
ATOM   2982 C  CB  . ASN A  1 543 ? 78.873  43.781  6.437   1.00 54.80  ? 543 ASN A CB  1 
ATOM   2983 C  CG  . ASN A  1 543 ? 78.737  42.441  5.720   1.00 51.02  ? 543 ASN A CG  1 
ATOM   2984 O  OD1 . ASN A  1 543 ? 78.471  42.376  4.519   1.00 49.79  ? 543 ASN A OD1 1 
ATOM   2985 N  ND2 . ASN A  1 543 ? 78.904  41.357  6.470   1.00 53.51  ? 543 ASN A ND2 1 
ATOM   2986 N  N   . PRO A  1 544 ? 79.376  44.962  3.202   1.00 57.04  ? 544 PRO A N   1 
ATOM   2987 C  CA  . PRO A  1 544 ? 78.663  45.398  1.998   1.00 55.85  ? 544 PRO A CA  1 
ATOM   2988 C  C   . PRO A  1 544 ? 77.227  44.869  1.846   1.00 49.90  ? 544 PRO A C   1 
ATOM   2989 O  O   . PRO A  1 544 ? 76.378  45.569  1.291   1.00 46.86  ? 544 PRO A O   1 
ATOM   2990 C  CB  . PRO A  1 544 ? 79.561  44.898  0.859   1.00 57.91  ? 544 PRO A CB  1 
ATOM   2991 C  CG  . PRO A  1 544 ? 80.906  44.753  1.462   1.00 59.33  ? 544 PRO A CG  1 
ATOM   2992 C  CD  . PRO A  1 544 ? 80.645  44.292  2.858   1.00 58.44  ? 544 PRO A CD  1 
ATOM   2993 N  N   . ASN A  1 545 ? 76.968  43.658  2.341   1.00 47.45  ? 545 ASN A N   1 
ATOM   2994 C  CA  . ASN A  1 545 ? 75.628  43.051  2.283   1.00 47.56  ? 545 ASN A CA  1 
ATOM   2995 C  C   . ASN A  1 545 ? 74.675  43.615  3.339   1.00 41.70  ? 545 ASN A C   1 
ATOM   2996 O  O   . ASN A  1 545 ? 73.487  43.802  3.066   1.00 38.89  ? 545 ASN A O   1 
ATOM   2997 C  CB  . ASN A  1 545 ? 75.710  41.527  2.428   1.00 49.65  ? 545 ASN A CB  1 
ATOM   2998 C  CG  . ASN A  1 545 ? 76.427  40.869  1.265   1.00 51.97  ? 545 ASN A CG  1 
ATOM   2999 O  OD1 . ASN A  1 545 ? 77.510  41.298  0.868   1.00 65.66  ? 545 ASN A OD1 1 
ATOM   3000 N  ND2 . ASN A  1 545 ? 75.828  39.817  0.716   1.00 53.79  ? 545 ASN A ND2 1 
ATOM   3001 N  N   . SER A  1 546 ? 75.196  43.868  4.539   1.00 40.08  ? 546 SER A N   1 
ATOM   3002 C  CA  . SER A  1 546 ? 74.406  44.445  5.637   1.00 42.51  ? 546 SER A CA  1 
ATOM   3003 C  C   . SER A  1 546 ? 74.025  45.906  5.393   1.00 38.22  ? 546 SER A C   1 
ATOM   3004 O  O   . SER A  1 546 ? 72.937  46.340  5.776   1.00 34.39  ? 546 SER A O   1 
ATOM   3005 C  CB  . SER A  1 546 ? 75.165  44.340  6.958   1.00 43.10  ? 546 SER A CB  1 
ATOM   3006 O  OG  . SER A  1 546 ? 75.649  43.024  7.172   1.00 49.70  ? 546 SER A OG  1 
ATOM   3007 N  N   . ASN A  1 547 ? 74.935  46.655  4.778   1.00 38.50  ? 547 ASN A N   1 
ATOM   3008 C  CA  . ASN A  1 547 ? 74.681  48.046  4.395   1.00 44.19  ? 547 ASN A CA  1 
ATOM   3009 C  C   . ASN A  1 547 ? 73.603  48.182  3.317   1.00 52.07  ? 547 ASN A C   1 
ATOM   3010 O  O   . ASN A  1 547 ? 72.824  49.134  3.342   1.00 62.60  ? 547 ASN A O   1 
ATOM   3011 C  CB  . ASN A  1 547 ? 75.976  48.712  3.932   1.00 44.34  ? 547 ASN A CB  1 
ATOM   3012 C  CG  . ASN A  1 547 ? 76.830  49.179  5.090   1.00 44.56  ? 547 ASN A CG  1 
ATOM   3013 O  OD1 . ASN A  1 547 ? 76.882  50.367  5.386   1.00 46.85  ? 547 ASN A OD1 1 
ATOM   3014 N  ND2 . ASN A  1 547 ? 77.484  48.243  5.766   1.00 46.35  ? 547 ASN A ND2 1 
ATOM   3015 N  N   . ARG A  1 548 ? 73.579  47.247  2.370   1.00 56.49  ? 548 ARG A N   1 
ATOM   3016 C  CA  . ARG A  1 548 ? 72.478  47.132  1.406   1.00 56.19  ? 548 ARG A CA  1 
ATOM   3017 C  C   . ARG A  1 548 ? 71.159  46.819  2.121   1.00 51.66  ? 548 ARG A C   1 
ATOM   3018 O  O   . ARG A  1 548 ? 70.123  47.413  1.812   1.00 49.74  ? 548 ARG A O   1 
ATOM   3019 C  CB  . ARG A  1 548 ? 72.793  46.044  0.370   1.00 57.78  ? 548 ARG A CB  1 
ATOM   3020 C  CG  . ARG A  1 548 ? 71.662  45.730  -0.608  1.00 59.19  ? 548 ARG A CG  1 
ATOM   3021 C  CD  . ARG A  1 548 ? 72.048  44.705  -1.670  1.00 59.20  ? 548 ARG A CD  1 
ATOM   3022 N  NE  . ARG A  1 548 ? 72.822  43.582  -1.137  1.00 55.60  ? 548 ARG A NE  1 
ATOM   3023 C  CZ  . ARG A  1 548 ? 72.337  42.585  -0.393  1.00 52.97  ? 548 ARG A CZ  1 
ATOM   3024 N  NH1 . ARG A  1 548 ? 71.048  42.527  -0.059  1.00 53.28  ? 548 ARG A NH1 1 
ATOM   3025 N  NH2 . ARG A  1 548 ? 73.160  41.627  0.029   1.00 57.40  ? 548 ARG A NH2 1 
ATOM   3026 N  N   . ASP A  1 549 ? 71.213  45.879  3.063   1.00 51.75  ? 549 ASP A N   1 
ATOM   3027 C  CA  . ASP A  1 549 ? 70.049  45.488  3.865   1.00 53.80  ? 549 ASP A CA  1 
ATOM   3028 C  C   . ASP A  1 549 ? 69.522  46.630  4.734   1.00 56.12  ? 549 ASP A C   1 
ATOM   3029 O  O   . ASP A  1 549 ? 68.312  46.749  4.940   1.00 61.91  ? 549 ASP A O   1 
ATOM   3030 C  CB  . ASP A  1 549 ? 70.401  44.287  4.751   1.00 52.87  ? 549 ASP A CB  1 
ATOM   3031 C  CG  . ASP A  1 549 ? 69.187  43.693  5.456   1.00 53.88  ? 549 ASP A CG  1 
ATOM   3032 O  OD1 . ASP A  1 549 ? 68.112  43.576  4.826   1.00 53.79  ? 549 ASP A OD1 1 
ATOM   3033 O  OD2 . ASP A  1 549 ? 69.313  43.330  6.644   1.00 51.45  ? 549 ASP A OD2 1 
ATOM   3034 N  N   . ALA A  1 550 ? 70.436  47.453  5.245   1.00 58.10  ? 550 ALA A N   1 
ATOM   3035 C  CA  . ALA A  1 550 ? 70.083  48.618  6.058   1.00 56.96  ? 550 ALA A CA  1 
ATOM   3036 C  C   . ALA A  1 550 ? 69.194  49.593  5.295   1.00 54.49  ? 550 ALA A C   1 
ATOM   3037 O  O   . ALA A  1 550 ? 68.294  50.197  5.880   1.00 54.12  ? 550 ALA A O   1 
ATOM   3038 C  CB  . ALA A  1 550 ? 71.337  49.330  6.539   1.00 56.89  ? 550 ALA A CB  1 
ATOM   3039 N  N   . LEU A  1 551 ? 69.453  49.737  3.995   1.00 51.67  ? 551 LEU A N   1 
ATOM   3040 C  CA  . LEU A  1 551 ? 68.657  50.610  3.133   1.00 52.61  ? 551 LEU A CA  1 
ATOM   3041 C  C   . LEU A  1 551 ? 67.247  50.067  2.930   1.00 53.06  ? 551 LEU A C   1 
ATOM   3042 O  O   . LEU A  1 551 ? 66.283  50.830  2.958   1.00 62.76  ? 551 LEU A O   1 
ATOM   3043 C  CB  . LEU A  1 551 ? 69.337  50.811  1.776   1.00 53.03  ? 551 LEU A CB  1 
ATOM   3044 C  CG  . LEU A  1 551 ? 70.716  51.478  1.782   1.00 53.04  ? 551 LEU A CG  1 
ATOM   3045 C  CD1 . LEU A  1 551 ? 71.255  51.565  0.362   1.00 53.11  ? 551 LEU A CD1 1 
ATOM   3046 C  CD2 . LEU A  1 551 ? 70.693  52.858  2.423   1.00 51.67  ? 551 LEU A CD2 1 
ATOM   3047 N  N   . ASP A  1 552 ? 67.136  48.758  2.717   1.00 50.34  ? 552 ASP A N   1 
ATOM   3048 C  CA  . ASP A  1 552 ? 65.830  48.100  2.592   1.00 50.39  ? 552 ASP A CA  1 
ATOM   3049 C  C   . ASP A  1 552 ? 64.957  48.304  3.828   1.00 46.50  ? 552 ASP A C   1 
ATOM   3050 O  O   . ASP A  1 552 ? 63.764  48.605  3.714   1.00 52.66  ? 552 ASP A O   1 
ATOM   3051 C  CB  . ASP A  1 552 ? 66.006  46.601  2.340   1.00 51.39  ? 552 ASP A CB  1 
ATOM   3052 C  CG  . ASP A  1 552 ? 64.702  45.829  2.445   1.00 51.18  ? 552 ASP A CG  1 
ATOM   3053 O  OD1 . ASP A  1 552 ? 63.875  45.916  1.513   1.00 52.69  ? 552 ASP A OD1 1 
ATOM   3054 O  OD2 . ASP A  1 552 ? 64.510  45.141  3.468   1.00 52.63  ? 552 ASP A OD2 1 
ATOM   3055 N  N   . LYS A  1 553 ? 65.567  48.144  4.998   1.00 44.46  ? 553 LYS A N   1 
ATOM   3056 C  CA  . LYS A  1 553 ? 64.842  48.187  6.267   1.00 42.56  ? 553 LYS A CA  1 
ATOM   3057 C  C   . LYS A  1 553 ? 64.375  49.597  6.636   1.00 45.83  ? 553 LYS A C   1 
ATOM   3058 O  O   . LYS A  1 553 ? 63.227  49.769  7.029   1.00 48.30  ? 553 LYS A O   1 
ATOM   3059 C  CB  . LYS A  1 553 ? 65.675  47.564  7.402   1.00 43.01  ? 553 LYS A CB  1 
ATOM   3060 C  CG  . LYS A  1 553 ? 65.366  46.099  7.676   1.00 41.35  ? 553 LYS A CG  1 
ATOM   3061 C  CD  . LYS A  1 553 ? 65.855  45.185  6.564   1.00 38.98  ? 553 LYS A CD  1 
ATOM   3062 C  CE  . LYS A  1 553 ? 65.192  43.818  6.627   1.00 38.63  ? 553 LYS A CE  1 
ATOM   3063 N  NZ  . LYS A  1 553 ? 65.242  43.134  5.309   1.00 37.20  ? 553 LYS A NZ  1 
ATOM   3064 N  N   . MET A  1 554 ? 65.249  50.594  6.501   1.00 49.87  ? 554 MET A N   1 
ATOM   3065 C  CA  . MET A  1 554 ? 64.894  51.998  6.809   1.00 50.57  ? 554 MET A CA  1 
ATOM   3066 C  C   . MET A  1 554 ? 63.728  52.527  5.965   1.00 49.12  ? 554 MET A C   1 
ATOM   3067 O  O   . MET A  1 554 ? 62.888  53.276  6.463   1.00 49.11  ? 554 MET A O   1 
ATOM   3068 C  CB  . MET A  1 554 ? 66.105  52.934  6.659   1.00 53.56  ? 554 MET A CB  1 
ATOM   3069 C  CG  . MET A  1 554 ? 66.676  53.035  5.252   1.00 58.34  ? 554 MET A CG  1 
ATOM   3070 S  SD  . MET A  1 554 ? 68.119  54.102  5.137   1.00 67.06  ? 554 MET A SD  1 
ATOM   3071 C  CE  . MET A  1 554 ? 67.314  55.697  5.148   1.00 64.63  ? 554 MET A CE  1 
ATOM   3072 N  N   . VAL A  1 555 ? 63.696  52.133  4.693   1.00 47.56  ? 555 VAL A N   1 
ATOM   3073 C  CA  . VAL A  1 555 ? 62.605  52.486  3.779   1.00 47.83  ? 555 VAL A CA  1 
ATOM   3074 C  C   . VAL A  1 555 ? 61.378  51.624  4.086   1.00 49.40  ? 555 VAL A C   1 
ATOM   3075 O  O   . VAL A  1 555 ? 60.262  52.136  4.165   1.00 56.42  ? 555 VAL A O   1 
ATOM   3076 C  CB  . VAL A  1 555 ? 63.036  52.327  2.300   1.00 44.32  ? 555 VAL A CB  1 
ATOM   3077 C  CG1 . VAL A  1 555 ? 61.882  52.582  1.335   1.00 41.49  ? 555 VAL A CG1 1 
ATOM   3078 C  CG2 . VAL A  1 555 ? 64.177  53.282  1.980   1.00 44.26  ? 555 VAL A CG2 1 
ATOM   3079 N  N   . GLY A  1 556 ? 61.600  50.323  4.258   1.00 45.96  ? 556 GLY A N   1 
ATOM   3080 C  CA  . GLY A  1 556 ? 60.526  49.367  4.543   1.00 44.27  ? 556 GLY A CA  1 
ATOM   3081 C  C   . GLY A  1 556 ? 59.807  49.584  5.865   1.00 42.05  ? 556 GLY A C   1 
ATOM   3082 O  O   . GLY A  1 556 ? 58.582  49.463  5.936   1.00 40.43  ? 556 GLY A O   1 
ATOM   3083 N  N   . ASP A  1 557 ? 60.573  49.895  6.909   1.00 40.43  ? 557 ASP A N   1 
ATOM   3084 C  CA  . ASP A  1 557 ? 60.026  50.183  8.240   1.00 42.21  ? 557 ASP A CA  1 
ATOM   3085 C  C   . ASP A  1 557 ? 59.243  51.488  8.234   1.00 44.51  ? 557 ASP A C   1 
ATOM   3086 O  O   . ASP A  1 557 ? 58.085  51.525  8.652   1.00 42.84  ? 557 ASP A O   1 
ATOM   3087 C  CB  . ASP A  1 557 ? 61.145  50.271  9.289   1.00 39.38  ? 557 ASP A CB  1 
ATOM   3088 C  CG  . ASP A  1 557 ? 61.786  48.921  9.592   1.00 37.36  ? 557 ASP A CG  1 
ATOM   3089 O  OD1 . ASP A  1 557 ? 61.254  47.869  9.172   1.00 36.18  ? 557 ASP A OD1 1 
ATOM   3090 O  OD2 . ASP A  1 557 ? 62.839  48.908  10.266  1.00 30.83  ? 557 ASP A OD2 1 
ATOM   3091 N  N   . TYR A  1 558 ? 59.890  52.546  7.753   1.00 45.32  ? 558 TYR A N   1 
ATOM   3092 C  CA  . TYR A  1 558 ? 59.295  53.883  7.727   1.00 46.28  ? 558 TYR A CA  1 
ATOM   3093 C  C   . TYR A  1 558 ? 58.010  53.953  6.896   1.00 47.20  ? 558 TYR A C   1 
ATOM   3094 O  O   . TYR A  1 558 ? 57.015  54.526  7.348   1.00 53.97  ? 558 TYR A O   1 
ATOM   3095 C  CB  . TYR A  1 558 ? 60.304  54.924  7.222   1.00 43.78  ? 558 TYR A CB  1 
ATOM   3096 C  CG  . TYR A  1 558 ? 59.803  56.350  7.344   1.00 44.80  ? 558 TYR A CG  1 
ATOM   3097 C  CD1 . TYR A  1 558 ? 59.582  56.925  8.595   1.00 47.18  ? 558 TYR A CD1 1 
ATOM   3098 C  CD2 . TYR A  1 558 ? 59.537  57.120  6.211   1.00 47.29  ? 558 TYR A CD2 1 
ATOM   3099 C  CE1 . TYR A  1 558 ? 59.116  58.226  8.718   1.00 47.32  ? 558 TYR A CE1 1 
ATOM   3100 C  CE2 . TYR A  1 558 ? 59.072  58.424  6.324   1.00 51.82  ? 558 TYR A CE2 1 
ATOM   3101 C  CZ  . TYR A  1 558 ? 58.863  58.972  7.580   1.00 49.96  ? 558 TYR A CZ  1 
ATOM   3102 O  OH  . TYR A  1 558 ? 58.401  60.264  7.699   1.00 49.72  ? 558 TYR A OH  1 
ATOM   3103 N  N   . HIS A  1 559 ? 58.031  53.357  5.705   1.00 46.35  ? 559 HIS A N   1 
ATOM   3104 C  CA  . HIS A  1 559 ? 56.918  53.484  4.751   1.00 50.96  ? 559 HIS A CA  1 
ATOM   3105 C  C   . HIS A  1 559 ? 55.837  52.397  4.809   1.00 50.28  ? 559 HIS A C   1 
ATOM   3106 O  O   . HIS A  1 559 ? 54.743  52.614  4.283   1.00 46.83  ? 559 HIS A O   1 
ATOM   3107 C  CB  . HIS A  1 559 ? 57.457  53.602  3.321   1.00 55.09  ? 559 HIS A CB  1 
ATOM   3108 C  CG  . HIS A  1 559 ? 58.204  54.874  3.069   1.00 56.90  ? 559 HIS A CG  1 
ATOM   3109 N  ND1 . HIS A  1 559 ? 57.578  56.099  2.985   1.00 61.34  ? 559 HIS A ND1 1 
ATOM   3110 C  CD2 . HIS A  1 559 ? 59.524  55.114  2.888   1.00 54.55  ? 559 HIS A CD2 1 
ATOM   3111 C  CE1 . HIS A  1 559 ? 58.479  57.039  2.766   1.00 58.51  ? 559 HIS A CE1 1 
ATOM   3112 N  NE2 . HIS A  1 559 ? 59.668  56.467  2.699   1.00 58.12  ? 559 HIS A NE2 1 
ATOM   3113 N  N   . PHE A  1 560 ? 56.121  51.249  5.432   1.00 50.70  ? 560 PHE A N   1 
ATOM   3114 C  CA  . PHE A  1 560 ? 55.162  50.124  5.455   1.00 51.61  ? 560 PHE A CA  1 
ATOM   3115 C  C   . PHE A  1 560 ? 55.009  49.427  6.812   1.00 51.97  ? 560 PHE A C   1 
ATOM   3116 O  O   . PHE A  1 560 ? 53.982  49.594  7.473   1.00 52.25  ? 560 PHE A O   1 
ATOM   3117 C  CB  . PHE A  1 560 ? 55.507  49.107  4.360   1.00 53.03  ? 560 PHE A CB  1 
ATOM   3118 C  CG  . PHE A  1 560 ? 55.358  49.653  2.970   1.00 53.28  ? 560 PHE A CG  1 
ATOM   3119 C  CD1 . PHE A  1 560 ? 54.117  49.664  2.345   1.00 56.53  ? 560 PHE A CD1 1 
ATOM   3120 C  CD2 . PHE A  1 560 ? 56.453  50.182  2.293   1.00 55.03  ? 560 PHE A CD2 1 
ATOM   3121 C  CE1 . PHE A  1 560 ? 53.971  50.180  1.065   1.00 60.98  ? 560 PHE A CE1 1 
ATOM   3122 C  CE2 . PHE A  1 560 ? 56.314  50.700  1.013   1.00 56.97  ? 560 PHE A CE2 1 
ATOM   3123 C  CZ  . PHE A  1 560 ? 55.071  50.698  0.397   1.00 60.20  ? 560 PHE A CZ  1 
ATOM   3124 N  N   . THR A  1 561 ? 56.022  48.658  7.215   1.00 53.37  ? 561 THR A N   1 
ATOM   3125 C  CA  . THR A  1 561 ? 55.933  47.746  8.375   1.00 53.73  ? 561 THR A CA  1 
ATOM   3126 C  C   . THR A  1 561 ? 55.409  48.395  9.663   1.00 51.62  ? 561 THR A C   1 
ATOM   3127 O  O   . THR A  1 561 ? 54.508  47.859  10.310  1.00 52.61  ? 561 THR A O   1 
ATOM   3128 C  CB  . THR A  1 561 ? 57.297  47.067  8.662   1.00 54.50  ? 561 THR A CB  1 
ATOM   3129 O  OG1 . THR A  1 561 ? 57.770  46.417  7.474   1.00 50.53  ? 561 THR A OG1 1 
ATOM   3130 C  CG2 . THR A  1 561 ? 57.196  46.027  9.788   1.00 56.91  ? 561 THR A CG2 1 
ATOM   3131 N  N   . CYS A  1 562 ? 55.981  49.538  10.021  1.00 50.73  ? 562 CYS A N   1 
ATOM   3132 C  CA  . CYS A  1 562 ? 55.647  50.229  11.273  1.00 52.11  ? 562 CYS A CA  1 
ATOM   3133 C  C   . CYS A  1 562 ? 54.285  50.909  11.262  1.00 47.88  ? 562 CYS A C   1 
ATOM   3134 O  O   . CYS A  1 562 ? 53.655  51.069  12.310  1.00 49.90  ? 562 CYS A O   1 
ATOM   3135 C  CB  . CYS A  1 562 ? 56.736  51.243  11.603  1.00 58.50  ? 562 CYS A CB  1 
ATOM   3136 S  SG  . CYS A  1 562 ? 58.340  50.442  11.802  1.00 76.11  ? 562 CYS A SG  1 
ATOM   3137 N  N   . ASN A  1 563 ? 53.842  51.304  10.077  1.00 49.55  ? 563 ASN A N   1 
ATOM   3138 C  CA  . ASN A  1 563 ? 52.527  51.917  9.894   1.00 50.10  ? 563 ASN A CA  1 
ATOM   3139 C  C   . ASN A  1 563 ? 51.404  50.872  9.977   1.00 51.17  ? 563 ASN A C   1 
ATOM   3140 O  O   . ASN A  1 563 ? 50.304  51.175  10.446  1.00 48.23  ? 563 ASN A O   1 
ATOM   3141 C  CB  . ASN A  1 563 ? 52.495  52.670  8.566   1.00 50.83  ? 563 ASN A CB  1 
ATOM   3142 C  CG  . ASN A  1 563 ? 53.619  53.687  8.450   1.00 55.38  ? 563 ASN A CG  1 
ATOM   3143 O  OD1 . ASN A  1 563 ? 53.900  54.431  9.390   1.00 61.83  ? 563 ASN A OD1 1 
ATOM   3144 N  ND2 . ASN A  1 563 ? 54.271  53.718  7.295   1.00 58.07  ? 563 ASN A ND2 1 
ATOM   3145 N  N   . VAL A  1 564 ? 51.689  49.656  9.509   1.00 51.23  ? 564 VAL A N   1 
ATOM   3146 C  CA  . VAL A  1 564 ? 50.822  48.487  9.725   1.00 46.22  ? 564 VAL A CA  1 
ATOM   3147 C  C   . VAL A  1 564 ? 50.722  48.167  11.220  1.00 40.17  ? 564 VAL A C   1 
ATOM   3148 O  O   . VAL A  1 564 ? 49.639  47.862  11.724  1.00 33.74  ? 564 VAL A O   1 
ATOM   3149 C  CB  . VAL A  1 564 ? 51.350  47.248  8.953   1.00 46.58  ? 564 VAL A CB  1 
ATOM   3150 C  CG1 . VAL A  1 564 ? 50.622  45.967  9.353   1.00 48.40  ? 564 VAL A CG1 1 
ATOM   3151 C  CG2 . VAL A  1 564 ? 51.218  47.461  7.452   1.00 46.86  ? 564 VAL A CG2 1 
ATOM   3152 N  N   . ASN A  1 565 ? 51.861  48.227  11.907  1.00 40.01  ? 565 ASN A N   1 
ATOM   3153 C  CA  . ASN A  1 565 ? 51.924  47.978  13.345  1.00 45.65  ? 565 ASN A CA  1 
ATOM   3154 C  C   . ASN A  1 565 ? 51.122  48.997  14.154  1.00 46.42  ? 565 ASN A C   1 
ATOM   3155 O  O   . ASN A  1 565 ? 50.385  48.610  15.055  1.00 45.21  ? 565 ASN A O   1 
ATOM   3156 C  CB  . ASN A  1 565 ? 53.382  47.930  13.819  1.00 47.44  ? 565 ASN A CB  1 
ATOM   3157 C  CG  . ASN A  1 565 ? 54.119  46.690  13.333  1.00 52.42  ? 565 ASN A CG  1 
ATOM   3158 O  OD1 . ASN A  1 565 ? 53.634  45.952  12.473  1.00 51.48  ? 565 ASN A OD1 1 
ATOM   3159 N  ND2 . ASN A  1 565 ? 55.305  46.460  13.885  1.00 56.38  ? 565 ASN A ND2 1 
ATOM   3160 N  N   . GLU A  1 566 ? 51.254  50.281  13.821  1.00 44.48  ? 566 GLU A N   1 
ATOM   3161 C  CA  . GLU A  1 566 ? 50.471  51.341  14.472  1.00 43.95  ? 566 GLU A CA  1 
ATOM   3162 C  C   . GLU A  1 566 ? 48.975  51.065  14.355  1.00 44.98  ? 566 GLU A C   1 
ATOM   3163 O  O   . GLU A  1 566 ? 48.253  51.068  15.353  1.00 44.29  ? 566 GLU A O   1 
ATOM   3164 C  CB  . GLU A  1 566 ? 50.787  52.711  13.859  1.00 46.42  ? 566 GLU A CB  1 
ATOM   3165 C  CG  . GLU A  1 566 ? 50.058  53.877  14.529  1.00 51.18  ? 566 GLU A CG  1 
ATOM   3166 C  CD  . GLU A  1 566 ? 50.521  55.248  14.058  1.00 54.33  ? 566 GLU A CD  1 
ATOM   3167 O  OE1 . GLU A  1 566 ? 50.128  56.250  14.693  1.00 53.40  ? 566 GLU A OE1 1 
ATOM   3168 O  OE2 . GLU A  1 566 ? 51.267  55.339  13.061  1.00 59.17  ? 566 GLU A OE2 1 
ATOM   3169 N  N   . PHE A  1 567 ? 48.534  50.824  13.122  1.00 50.61  ? 567 PHE A N   1 
ATOM   3170 C  CA  . PHE A  1 567 ? 47.126  50.550  12.805  1.00 51.61  ? 567 PHE A CA  1 
ATOM   3171 C  C   . PHE A  1 567 ? 46.615  49.302  13.523  1.00 52.27  ? 567 PHE A C   1 
ATOM   3172 O  O   . PHE A  1 567 ? 45.546  49.322  14.136  1.00 45.94  ? 567 PHE A O   1 
ATOM   3173 C  CB  . PHE A  1 567 ? 46.954  50.387  11.289  1.00 48.09  ? 567 PHE A CB  1 
ATOM   3174 C  CG  . PHE A  1 567 ? 45.517  50.306  10.836  1.00 46.15  ? 567 PHE A CG  1 
ATOM   3175 C  CD1 . PHE A  1 567 ? 44.667  51.397  10.981  1.00 48.75  ? 567 PHE A CD1 1 
ATOM   3176 C  CD2 . PHE A  1 567 ? 45.015  49.146  10.249  1.00 46.99  ? 567 PHE A CD2 1 
ATOM   3177 C  CE1 . PHE A  1 567 ? 43.344  51.333  10.564  1.00 49.41  ? 567 PHE A CE1 1 
ATOM   3178 C  CE2 . PHE A  1 567 ? 43.692  49.076  9.829   1.00 47.76  ? 567 PHE A CE2 1 
ATOM   3179 C  CZ  . PHE A  1 567 ? 42.856  50.171  9.985   1.00 50.51  ? 567 PHE A CZ  1 
ATOM   3180 N  N   . ALA A  1 568 ? 47.392  48.227  13.430  1.00 54.24  ? 568 ALA A N   1 
ATOM   3181 C  CA  . ALA A  1 568 ? 47.090  46.956  14.099  1.00 60.38  ? 568 ALA A CA  1 
ATOM   3182 C  C   . ALA A  1 568 ? 47.068  47.059  15.626  1.00 61.22  ? 568 ALA A C   1 
ATOM   3183 O  O   . ALA A  1 568 ? 46.209  46.458  16.274  1.00 57.76  ? 568 ALA A O   1 
ATOM   3184 C  CB  . ALA A  1 568 ? 48.089  45.894  13.671  1.00 62.68  ? 568 ALA A CB  1 
ATOM   3185 N  N   . GLN A  1 569 ? 48.012  47.815  16.189  1.00 61.30  ? 569 GLN A N   1 
ATOM   3186 C  CA  . GLN A  1 569 ? 48.113  47.982  17.647  1.00 63.06  ? 569 GLN A CA  1 
ATOM   3187 C  C   . GLN A  1 569 ? 46.986  48.870  18.171  1.00 60.69  ? 569 GLN A C   1 
ATOM   3188 O  O   . GLN A  1 569 ? 46.438  48.606  19.241  1.00 70.04  ? 569 GLN A O   1 
ATOM   3189 C  CB  . GLN A  1 569 ? 49.483  48.552  18.052  1.00 65.94  ? 569 GLN A CB  1 
ATOM   3190 C  CG  . GLN A  1 569 ? 49.977  48.125  19.435  1.00 65.64  ? 569 GLN A CG  1 
ATOM   3191 C  CD  . GLN A  1 569 ? 49.366  48.911  20.582  1.00 67.83  ? 569 GLN A CD  1 
ATOM   3192 O  OE1 . GLN A  1 569 ? 49.165  50.122  20.486  1.00 71.22  ? 569 GLN A OE1 1 
ATOM   3193 N  NE2 . GLN A  1 569 ? 49.084  48.223  21.685  1.00 69.45  ? 569 GLN A NE2 1 
ATOM   3194 N  N   . ARG A  1 570 ? 46.643  49.910  17.413  1.00 59.13  ? 570 ARG A N   1 
ATOM   3195 C  CA  . ARG A  1 570 ? 45.516  50.789  17.749  1.00 59.82  ? 570 ARG A CA  1 
ATOM   3196 C  C   . ARG A  1 570 ? 44.142  50.115  17.622  1.00 61.39  ? 570 ARG A C   1 
ATOM   3197 O  O   . ARG A  1 570 ? 43.184  50.539  18.275  1.00 68.32  ? 570 ARG A O   1 
ATOM   3198 C  CB  . ARG A  1 570 ? 45.562  52.063  16.901  1.00 57.49  ? 570 ARG A CB  1 
ATOM   3199 C  CG  . ARG A  1 570 ? 46.661  53.044  17.305  1.00 60.27  ? 570 ARG A CG  1 
ATOM   3200 C  CD  . ARG A  1 570 ? 46.454  53.680  18.678  1.00 57.35  ? 570 ARG A CD  1 
ATOM   3201 N  NE  . ARG A  1 570 ? 45.123  54.290  18.819  1.00 57.74  ? 570 ARG A NE  1 
ATOM   3202 C  CZ  . ARG A  1 570 ? 44.176  53.944  19.702  1.00 57.43  ? 570 ARG A CZ  1 
ATOM   3203 N  NH1 . ARG A  1 570 ? 44.365  52.980  20.600  1.00 56.86  ? 570 ARG A NH1 1 
ATOM   3204 N  NH2 . ARG A  1 570 ? 43.012  54.590  19.698  1.00 57.66  ? 570 ARG A NH2 1 
ATOM   3205 N  N   . TYR A  1 571 ? 44.052  49.083  16.784  1.00 59.70  ? 571 TYR A N   1 
ATOM   3206 C  CA  . TYR A  1 571 ? 42.841  48.251  16.694  1.00 56.41  ? 571 TYR A CA  1 
ATOM   3207 C  C   . TYR A  1 571 ? 42.735  47.265  17.856  1.00 54.29  ? 571 TYR A C   1 
ATOM   3208 O  O   . TYR A  1 571 ? 41.634  46.895  18.267  1.00 59.09  ? 571 TYR A O   1 
ATOM   3209 C  CB  . TYR A  1 571 ? 42.774  47.494  15.356  1.00 56.79  ? 571 TYR A CB  1 
ATOM   3210 C  CG  . TYR A  1 571 ? 41.658  47.990  14.471  1.00 53.59  ? 571 TYR A CG  1 
ATOM   3211 C  CD1 . TYR A  1 571 ? 41.745  49.231  13.846  1.00 56.25  ? 571 TYR A CD1 1 
ATOM   3212 C  CD2 . TYR A  1 571 ? 40.495  47.239  14.287  1.00 47.68  ? 571 TYR A CD2 1 
ATOM   3213 C  CE1 . TYR A  1 571 ? 40.721  49.704  13.042  1.00 54.12  ? 571 TYR A CE1 1 
ATOM   3214 C  CE2 . TYR A  1 571 ? 39.465  47.705  13.480  1.00 48.07  ? 571 TYR A CE2 1 
ATOM   3215 C  CZ  . TYR A  1 571 ? 39.584  48.940  12.864  1.00 50.65  ? 571 TYR A CZ  1 
ATOM   3216 O  OH  . TYR A  1 571 ? 38.579  49.426  12.061  1.00 58.01  ? 571 TYR A OH  1 
ATOM   3217 N  N   . ALA A  1 572 ? 43.888  46.855  18.376  1.00 49.41  ? 572 ALA A N   1 
ATOM   3218 C  CA  . ALA A  1 572 ? 43.978  45.826  19.408  1.00 48.88  ? 572 ALA A CA  1 
ATOM   3219 C  C   . ALA A  1 572 ? 43.530  46.363  20.756  1.00 48.14  ? 572 ALA A C   1 
ATOM   3220 O  O   . ALA A  1 572 ? 42.691  45.760  21.430  1.00 47.83  ? 572 ALA A O   1 
ATOM   3221 C  CB  . ALA A  1 572 ? 45.406  45.322  19.502  1.00 50.06  ? 572 ALA A CB  1 
ATOM   3222 N  N   . GLU A  1 573 ? 44.089  47.513  21.127  1.00 47.29  ? 573 GLU A N   1 
ATOM   3223 C  CA  . GLU A  1 573 ? 43.764  48.185  22.393  1.00 47.13  ? 573 GLU A CA  1 
ATOM   3224 C  C   . GLU A  1 573 ? 42.464  49.027  22.360  1.00 44.62  ? 573 GLU A C   1 
ATOM   3225 O  O   . GLU A  1 573 ? 42.277  49.913  23.197  1.00 44.23  ? 573 GLU A O   1 
ATOM   3226 C  CB  . GLU A  1 573 ? 44.978  48.997  22.890  1.00 47.77  ? 573 GLU A CB  1 
ATOM   3227 C  CG  . GLU A  1 573 ? 45.357  50.228  22.075  1.00 46.41  ? 573 GLU A CG  1 
ATOM   3228 C  CD  . GLU A  1 573 ? 46.749  50.773  22.393  1.00 46.43  ? 573 GLU A CD  1 
ATOM   3229 O  OE1 . GLU A  1 573 ? 47.565  50.071  23.033  1.00 41.13  ? 573 GLU A OE1 1 
ATOM   3230 O  OE2 . GLU A  1 573 ? 47.033  51.922  21.990  1.00 46.69  ? 573 GLU A OE2 1 
ATOM   3231 N  N   . GLU A  1 574 ? 41.588  48.744  21.389  1.00 47.01  ? 574 GLU A N   1 
ATOM   3232 C  CA  . GLU A  1 574 ? 40.181  49.178  21.398  1.00 45.54  ? 574 GLU A CA  1 
ATOM   3233 C  C   . GLU A  1 574 ? 39.179  48.002  21.442  1.00 44.80  ? 574 GLU A C   1 
ATOM   3234 O  O   . GLU A  1 574 ? 37.975  48.214  21.272  1.00 48.48  ? 574 GLU A O   1 
ATOM   3235 C  CB  . GLU A  1 574 ? 39.896  50.062  20.177  1.00 45.78  ? 574 GLU A CB  1 
ATOM   3236 C  CG  . GLU A  1 574 ? 40.592  51.417  20.208  1.00 53.40  ? 574 GLU A CG  1 
ATOM   3237 C  CD  . GLU A  1 574 ? 39.990  52.394  21.206  1.00 60.66  ? 574 GLU A CD  1 
ATOM   3238 O  OE1 . GLU A  1 574 ? 38.747  52.469  21.316  1.00 66.01  ? 574 GLU A OE1 1 
ATOM   3239 O  OE2 . GLU A  1 574 ? 40.768  53.106  21.877  1.00 63.93  ? 574 GLU A OE2 1 
ATOM   3240 N  N   . GLY A  1 575 ? 39.668  46.779  21.670  1.00 45.31  ? 575 GLY A N   1 
ATOM   3241 C  CA  . GLY A  1 575 ? 38.803  45.601  21.864  1.00 48.06  ? 575 GLY A CA  1 
ATOM   3242 C  C   . GLY A  1 575 ? 38.737  44.600  20.719  1.00 51.75  ? 575 GLY A C   1 
ATOM   3243 O  O   . GLY A  1 575 ? 38.430  43.427  20.943  1.00 53.54  ? 575 GLY A O   1 
ATOM   3244 N  N   . ASN A  1 576 ? 39.017  45.057  19.500  1.00 55.97  ? 576 ASN A N   1 
ATOM   3245 C  CA  . ASN A  1 576 ? 38.901  44.223  18.302  1.00 51.24  ? 576 ASN A CA  1 
ATOM   3246 C  C   . ASN A  1 576 ? 40.014  43.186  18.211  1.00 49.79  ? 576 ASN A C   1 
ATOM   3247 O  O   . ASN A  1 576 ? 41.162  43.458  18.576  1.00 51.38  ? 576 ASN A O   1 
ATOM   3248 C  CB  . ASN A  1 576 ? 38.930  45.094  17.045  1.00 51.55  ? 576 ASN A CB  1 
ATOM   3249 C  CG  . ASN A  1 576 ? 37.720  46.000  16.932  1.00 51.06  ? 576 ASN A CG  1 
ATOM   3250 O  OD1 . ASN A  1 576 ? 36.579  45.546  17.026  1.00 50.09  ? 576 ASN A OD1 1 
ATOM   3251 N  ND2 . ASN A  1 576 ? 37.963  47.290  16.720  1.00 47.59  ? 576 ASN A ND2 1 
ATOM   3252 N  N   . ASN A  1 577 ? 39.661  42.001  17.712  1.00 48.08  ? 577 ASN A N   1 
ATOM   3253 C  CA  . ASN A  1 577 ? 40.629  40.929  17.479  1.00 48.95  ? 577 ASN A CA  1 
ATOM   3254 C  C   . ASN A  1 577 ? 41.438  41.205  16.210  1.00 44.62  ? 577 ASN A C   1 
ATOM   3255 O  O   . ASN A  1 577 ? 40.868  41.470  15.148  1.00 42.42  ? 577 ASN A O   1 
ATOM   3256 C  CB  . ASN A  1 577 ? 39.920  39.578  17.354  1.00 52.44  ? 577 ASN A CB  1 
ATOM   3257 C  CG  . ASN A  1 577 ? 39.186  39.175  18.622  1.00 52.20  ? 577 ASN A CG  1 
ATOM   3258 O  OD1 . ASN A  1 577 ? 39.647  39.431  19.735  1.00 52.49  ? 577 ASN A OD1 1 
ATOM   3259 N  ND2 . ASN A  1 577 ? 38.035  38.531  18.457  1.00 53.07  ? 577 ASN A ND2 1 
ATOM   3260 N  N   . VAL A  1 578 ? 42.761  41.134  16.340  1.00 45.79  ? 578 VAL A N   1 
ATOM   3261 C  CA  . VAL A  1 578 ? 43.702  41.404  15.249  1.00 43.28  ? 578 VAL A CA  1 
ATOM   3262 C  C   . VAL A  1 578 ? 44.542  40.152  15.018  1.00 41.67  ? 578 VAL A C   1 
ATOM   3263 O  O   . VAL A  1 578 ? 44.831  39.417  15.962  1.00 39.47  ? 578 VAL A O   1 
ATOM   3264 C  CB  . VAL A  1 578 ? 44.607  42.611  15.594  1.00 42.01  ? 578 VAL A CB  1 
ATOM   3265 C  CG1 . VAL A  1 578 ? 45.620  42.903  14.490  1.00 43.02  ? 578 VAL A CG1 1 
ATOM   3266 C  CG2 . VAL A  1 578 ? 43.760  43.848  15.852  1.00 42.11  ? 578 VAL A CG2 1 
ATOM   3267 N  N   . TYR A  1 579 ? 44.929  39.917  13.766  1.00 43.67  ? 579 TYR A N   1 
ATOM   3268 C  CA  . TYR A  1 579 ? 45.763  38.769  13.388  1.00 44.61  ? 579 TYR A CA  1 
ATOM   3269 C  C   . TYR A  1 579 ? 46.892  39.229  12.462  1.00 43.62  ? 579 TYR A C   1 
ATOM   3270 O  O   . TYR A  1 579 ? 46.692  39.401  11.258  1.00 49.30  ? 579 TYR A O   1 
ATOM   3271 C  CB  . TYR A  1 579 ? 44.916  37.682  12.717  1.00 48.08  ? 579 TYR A CB  1 
ATOM   3272 C  CG  . TYR A  1 579 ? 43.900  37.043  13.643  1.00 51.30  ? 579 TYR A CG  1 
ATOM   3273 C  CD1 . TYR A  1 579 ? 42.643  37.618  13.834  1.00 52.09  ? 579 TYR A CD1 1 
ATOM   3274 C  CD2 . TYR A  1 579 ? 44.194  35.861  14.331  1.00 54.81  ? 579 TYR A CD2 1 
ATOM   3275 C  CE1 . TYR A  1 579 ? 41.709  37.039  14.683  1.00 57.12  ? 579 TYR A CE1 1 
ATOM   3276 C  CE2 . TYR A  1 579 ? 43.265  35.273  15.183  1.00 53.02  ? 579 TYR A CE2 1 
ATOM   3277 C  CZ  . TYR A  1 579 ? 42.024  35.865  15.355  1.00 54.72  ? 579 TYR A CZ  1 
ATOM   3278 O  OH  . TYR A  1 579 ? 41.098  35.290  16.196  1.00 53.01  ? 579 TYR A OH  1 
ATOM   3279 N  N   . MET A  1 580 ? 48.075  39.424  13.043  1.00 44.77  ? 580 MET A N   1 
ATOM   3280 C  CA  . MET A  1 580 ? 49.247  39.935  12.329  1.00 45.30  ? 580 MET A CA  1 
ATOM   3281 C  C   . MET A  1 580 ? 50.019  38.792  11.667  1.00 51.43  ? 580 MET A C   1 
ATOM   3282 O  O   . MET A  1 580 ? 50.155  37.715  12.253  1.00 55.50  ? 580 MET A O   1 
ATOM   3283 C  CB  . MET A  1 580 ? 50.160  40.683  13.308  1.00 43.00  ? 580 MET A CB  1 
ATOM   3284 C  CG  . MET A  1 580 ? 51.366  41.367  12.677  1.00 42.68  ? 580 MET A CG  1 
ATOM   3285 S  SD  . MET A  1 580 ? 50.942  42.864  11.766  1.00 49.51  ? 580 MET A SD  1 
ATOM   3286 C  CE  . MET A  1 580 ? 50.991  44.084  13.076  1.00 46.09  ? 580 MET A CE  1 
ATOM   3287 N  N   . TYR A  1 581 ? 50.515  39.034  10.450  1.00 53.82  ? 581 TYR A N   1 
ATOM   3288 C  CA  . TYR A  1 581 ? 51.439  38.107  9.769   1.00 50.67  ? 581 TYR A CA  1 
ATOM   3289 C  C   . TYR A  1 581 ? 52.766  38.778  9.407   1.00 51.50  ? 581 TYR A C   1 
ATOM   3290 O  O   . TYR A  1 581 ? 52.841  40.003  9.279   1.00 48.52  ? 581 TYR A O   1 
ATOM   3291 C  CB  . TYR A  1 581 ? 50.805  37.481  8.511   1.00 50.11  ? 581 TYR A CB  1 
ATOM   3292 C  CG  . TYR A  1 581 ? 50.673  38.389  7.303   1.00 51.72  ? 581 TYR A CG  1 
ATOM   3293 C  CD1 . TYR A  1 581 ? 51.746  38.584  6.429   1.00 49.72  ? 581 TYR A CD1 1 
ATOM   3294 C  CD2 . TYR A  1 581 ? 49.465  39.024  7.007   1.00 51.92  ? 581 TYR A CD2 1 
ATOM   3295 C  CE1 . TYR A  1 581 ? 51.630  39.406  5.320   1.00 52.20  ? 581 TYR A CE1 1 
ATOM   3296 C  CE2 . TYR A  1 581 ? 49.340  39.851  5.898   1.00 50.23  ? 581 TYR A CE2 1 
ATOM   3297 C  CZ  . TYR A  1 581 ? 50.425  40.036  5.057   1.00 52.08  ? 581 TYR A CZ  1 
ATOM   3298 O  OH  . TYR A  1 581 ? 50.317  40.846  3.952   1.00 55.62  ? 581 TYR A OH  1 
ATOM   3299 N  N   . LEU A  1 582 ? 53.804  37.955  9.255   1.00 52.90  ? 582 LEU A N   1 
ATOM   3300 C  CA  . LEU A  1 582 ? 55.064  38.355  8.618   1.00 54.95  ? 582 LEU A CA  1 
ATOM   3301 C  C   . LEU A  1 582 ? 55.340  37.364  7.490   1.00 54.18  ? 582 LEU A C   1 
ATOM   3302 O  O   . LEU A  1 582 ? 55.607  36.188  7.748   1.00 62.37  ? 582 LEU A O   1 
ATOM   3303 C  CB  . LEU A  1 582 ? 56.225  38.361  9.620   1.00 52.85  ? 582 LEU A CB  1 
ATOM   3304 C  CG  . LEU A  1 582 ? 57.614  38.740  9.079   1.00 48.30  ? 582 LEU A CG  1 
ATOM   3305 C  CD1 . LEU A  1 582 ? 57.667  40.176  8.574   1.00 46.02  ? 582 LEU A CD1 1 
ATOM   3306 C  CD2 . LEU A  1 582 ? 58.666  38.517  10.153  1.00 48.49  ? 582 LEU A CD2 1 
ATOM   3307 N  N   . TYR A  1 583 ? 55.261  37.839  6.247   1.00 50.15  ? 583 TYR A N   1 
ATOM   3308 C  CA  . TYR A  1 583 ? 55.427  36.980  5.072   1.00 51.20  ? 583 TYR A CA  1 
ATOM   3309 C  C   . TYR A  1 583 ? 56.913  36.877  4.705   1.00 49.84  ? 583 TYR A C   1 
ATOM   3310 O  O   . TYR A  1 583 ? 57.531  37.873  4.327   1.00 51.88  ? 583 TYR A O   1 
ATOM   3311 C  CB  . TYR A  1 583 ? 54.599  37.518  3.902   1.00 48.37  ? 583 TYR A CB  1 
ATOM   3312 C  CG  . TYR A  1 583 ? 54.633  36.635  2.678   1.00 46.08  ? 583 TYR A CG  1 
ATOM   3313 C  CD1 . TYR A  1 583 ? 53.877  35.464  2.611   1.00 44.93  ? 583 TYR A CD1 1 
ATOM   3314 C  CD2 . TYR A  1 583 ? 55.430  36.966  1.585   1.00 46.74  ? 583 TYR A CD2 1 
ATOM   3315 C  CE1 . TYR A  1 583 ? 53.914  34.652  1.486   1.00 44.83  ? 583 TYR A CE1 1 
ATOM   3316 C  CE2 . TYR A  1 583 ? 55.475  36.162  0.456   1.00 46.34  ? 583 TYR A CE2 1 
ATOM   3317 C  CZ  . TYR A  1 583 ? 54.717  35.007  0.410   1.00 45.24  ? 583 TYR A CZ  1 
ATOM   3318 O  OH  . TYR A  1 583 ? 54.765  34.212  -0.711  1.00 45.73  ? 583 TYR A OH  1 
ATOM   3319 N  N   . THR A  1 584 ? 57.464  35.664  4.814   1.00 51.52  ? 584 THR A N   1 
ATOM   3320 C  CA  . THR A  1 584 ? 58.922  35.424  4.744   1.00 54.77  ? 584 THR A CA  1 
ATOM   3321 C  C   . THR A  1 584 ? 59.338  34.372  3.694   1.00 51.37  ? 584 THR A C   1 
ATOM   3322 O  O   . THR A  1 584 ? 60.249  33.573  3.945   1.00 53.33  ? 584 THR A O   1 
ATOM   3323 C  CB  . THR A  1 584 ? 59.487  34.974  6.123   1.00 55.88  ? 584 THR A CB  1 
ATOM   3324 O  OG1 . THR A  1 584 ? 59.003  33.662  6.447   1.00 55.57  ? 584 THR A OG1 1 
ATOM   3325 C  CG2 . THR A  1 584 ? 59.097  35.933  7.232   1.00 52.90  ? 584 THR A CG2 1 
ATOM   3326 N  N   . HIS A  1 585 ? 58.703  34.391  2.519   1.00 49.73  ? 585 HIS A N   1 
ATOM   3327 C  CA  . HIS A  1 585 ? 58.947  33.366  1.483   1.00 55.05  ? 585 HIS A CA  1 
ATOM   3328 C  C   . HIS A  1 585 ? 59.337  33.914  0.103   1.00 56.20  ? 585 HIS A C   1 
ATOM   3329 O  O   . HIS A  1 585 ? 58.647  34.767  -0.462  1.00 54.40  ? 585 HIS A O   1 
ATOM   3330 C  CB  . HIS A  1 585 ? 57.732  32.450  1.332   1.00 57.66  ? 585 HIS A CB  1 
ATOM   3331 C  CG  . HIS A  1 585 ? 57.877  31.437  0.237   1.00 62.27  ? 585 HIS A CG  1 
ATOM   3332 N  ND1 . HIS A  1 585 ? 58.869  30.480  0.234   1.00 63.91  ? 585 HIS A ND1 1 
ATOM   3333 C  CD2 . HIS A  1 585 ? 57.162  31.242  -0.896  1.00 69.57  ? 585 HIS A CD2 1 
ATOM   3334 C  CE1 . HIS A  1 585 ? 58.750  29.731  -0.848  1.00 70.65  ? 585 HIS A CE1 1 
ATOM   3335 N  NE2 . HIS A  1 585 ? 57.726  30.175  -1.552  1.00 67.43  ? 585 HIS A NE2 1 
ATOM   3336 N  N   . ARG A  1 586 ? 60.445  33.388  -0.419  1.00 58.16  ? 586 ARG A N   1 
ATOM   3337 C  CA  . ARG A  1 586 ? 60.903  33.633  -1.790  1.00 58.21  ? 586 ARG A CA  1 
ATOM   3338 C  C   . ARG A  1 586 ? 60.375  32.530  -2.693  1.00 61.43  ? 586 ARG A C   1 
ATOM   3339 O  O   . ARG A  1 586 ? 60.606  31.352  -2.421  1.00 61.73  ? 586 ARG A O   1 
ATOM   3340 C  CB  . ARG A  1 586 ? 62.434  33.590  -1.869  1.00 59.43  ? 586 ARG A CB  1 
ATOM   3341 C  CG  . ARG A  1 586 ? 63.140  34.910  -1.624  1.00 60.60  ? 586 ARG A CG  1 
ATOM   3342 C  CD  . ARG A  1 586 ? 63.225  35.786  -2.867  1.00 58.09  ? 586 ARG A CD  1 
ATOM   3343 N  NE  . ARG A  1 586 ? 63.990  35.199  -3.975  1.00 53.37  ? 586 ARG A NE  1 
ATOM   3344 C  CZ  . ARG A  1 586 ? 64.472  35.879  -5.019  1.00 56.57  ? 586 ARG A CZ  1 
ATOM   3345 N  NH1 . ARG A  1 586 ? 64.299  37.199  -5.131  1.00 55.48  ? 586 ARG A NH1 1 
ATOM   3346 N  NH2 . ARG A  1 586 ? 65.147  35.235  -5.969  1.00 57.61  ? 586 ARG A NH2 1 
ATOM   3347 N  N   . SER A  1 587 ? 59.697  32.909  -3.774  1.00 61.74  ? 587 SER A N   1 
ATOM   3348 C  CA  . SER A  1 587 ? 59.330  31.955  -4.819  1.00 60.92  ? 587 SER A CA  1 
ATOM   3349 C  C   . SER A  1 587 ? 60.605  31.422  -5.469  1.00 68.19  ? 587 SER A C   1 
ATOM   3350 O  O   . SER A  1 587 ? 61.568  32.172  -5.653  1.00 72.32  ? 587 SER A O   1 
ATOM   3351 C  CB  . SER A  1 587 ? 58.441  32.618  -5.871  1.00 64.89  ? 587 SER A CB  1 
ATOM   3352 O  OG  . SER A  1 587 ? 57.156  32.906  -5.348  1.00 67.66  ? 587 SER A OG  1 
ATOM   3353 N  N   . LYS A  1 588 ? 60.610  30.133  -5.803  1.00 69.33  ? 588 LYS A N   1 
ATOM   3354 C  CA  . LYS A  1 588 ? 61.825  29.470  -6.298  1.00 66.76  ? 588 LYS A CA  1 
ATOM   3355 C  C   . LYS A  1 588 ? 62.303  30.040  -7.636  1.00 60.22  ? 588 LYS A C   1 
ATOM   3356 O  O   . LYS A  1 588 ? 63.507  30.201  -7.846  1.00 60.14  ? 588 LYS A O   1 
ATOM   3357 C  CB  . LYS A  1 588 ? 61.632  27.953  -6.416  1.00 72.75  ? 588 LYS A CB  1 
ATOM   3358 C  CG  . LYS A  1 588 ? 62.952  27.189  -6.396  1.00 79.38  ? 588 LYS A CG  1 
ATOM   3359 C  CD  . LYS A  1 588 ? 62.795  25.697  -6.659  1.00 87.42  ? 588 LYS A CD  1 
ATOM   3360 C  CE  . LYS A  1 588 ? 62.793  25.360  -8.145  1.00 91.90  ? 588 LYS A CE  1 
ATOM   3361 N  NZ  . LYS A  1 588 ? 63.004  23.903  -8.384  1.00 90.96  ? 588 LYS A NZ  1 
ATOM   3362 N  N   . GLY A  1 589 ? 61.357  30.346  -8.523  1.00 56.35  ? 589 GLY A N   1 
ATOM   3363 C  CA  . GLY A  1 589 ? 61.653  30.952  -9.825  1.00 57.26  ? 589 GLY A CA  1 
ATOM   3364 C  C   . GLY A  1 589 ? 61.331  32.434  -9.857  1.00 57.17  ? 589 GLY A C   1 
ATOM   3365 O  O   . GLY A  1 589 ? 60.663  32.909  -10.779 1.00 65.90  ? 589 GLY A O   1 
ATOM   3366 N  N   . ASN A  1 590 ? 61.817  33.162  -8.852  1.00 54.96  ? 590 ASN A N   1 
ATOM   3367 C  CA  . ASN A  1 590 ? 61.557  34.595  -8.724  1.00 54.02  ? 590 ASN A CA  1 
ATOM   3368 C  C   . ASN A  1 590 ? 62.462  35.348  -9.706  1.00 53.88  ? 590 ASN A C   1 
ATOM   3369 O  O   . ASN A  1 590 ? 63.683  35.175  -9.665  1.00 55.47  ? 590 ASN A O   1 
ATOM   3370 C  CB  . ASN A  1 590 ? 61.804  35.057  -7.282  1.00 51.20  ? 590 ASN A CB  1 
ATOM   3371 C  CG  . ASN A  1 590 ? 61.637  36.558  -7.100  1.00 49.61  ? 590 ASN A CG  1 
ATOM   3372 O  OD1 . ASN A  1 590 ? 62.572  37.327  -7.319  1.00 48.53  ? 590 ASN A OD1 1 
ATOM   3373 N  ND2 . ASN A  1 590 ? 60.449  36.978  -6.678  1.00 48.10  ? 590 ASN A ND2 1 
ATOM   3374 N  N   . PRO A  1 591 ? 61.871  36.181  -10.589 1.00 53.93  ? 591 PRO A N   1 
ATOM   3375 C  CA  . PRO A  1 591 ? 62.646  36.842  -11.649 1.00 55.87  ? 591 PRO A CA  1 
ATOM   3376 C  C   . PRO A  1 591 ? 63.639  37.898  -11.156 1.00 53.72  ? 591 PRO A C   1 
ATOM   3377 O  O   . PRO A  1 591 ? 64.651  38.135  -11.820 1.00 51.55  ? 591 PRO A O   1 
ATOM   3378 C  CB  . PRO A  1 591 ? 61.564  37.490  -12.518 1.00 60.51  ? 591 PRO A CB  1 
ATOM   3379 C  CG  . PRO A  1 591 ? 60.444  37.751  -11.578 1.00 61.73  ? 591 PRO A CG  1 
ATOM   3380 C  CD  . PRO A  1 591 ? 60.463  36.620  -10.593 1.00 57.65  ? 591 PRO A CD  1 
ATOM   3381 N  N   . TRP A  1 592 ? 63.345  38.525  -10.017 1.00 52.62  ? 592 TRP A N   1 
ATOM   3382 C  CA  . TRP A  1 592 ? 64.238  39.530  -9.425  1.00 49.64  ? 592 TRP A CA  1 
ATOM   3383 C  C   . TRP A  1 592 ? 65.478  38.868  -8.814  1.00 50.60  ? 592 TRP A C   1 
ATOM   3384 O  O   . TRP A  1 592 ? 65.456  37.663  -8.545  1.00 55.12  ? 592 TRP A O   1 
ATOM   3385 C  CB  . TRP A  1 592 ? 63.509  40.342  -8.354  1.00 43.97  ? 592 TRP A CB  1 
ATOM   3386 C  CG  . TRP A  1 592 ? 62.316  41.082  -8.856  1.00 43.68  ? 592 TRP A CG  1 
ATOM   3387 C  CD1 . TRP A  1 592 ? 61.032  40.625  -8.911  1.00 46.38  ? 592 TRP A CD1 1 
ATOM   3388 C  CD2 . TRP A  1 592 ? 62.285  42.430  -9.339  1.00 42.05  ? 592 TRP A CD2 1 
ATOM   3389 N  NE1 . TRP A  1 592 ? 60.202  41.599  -9.412  1.00 46.19  ? 592 TRP A NE1 1 
ATOM   3390 C  CE2 . TRP A  1 592 ? 60.944  42.720  -9.680  1.00 43.65  ? 592 TRP A CE2 1 
ATOM   3391 C  CE3 . TRP A  1 592 ? 63.259  43.422  -9.517  1.00 42.11  ? 592 TRP A CE3 1 
ATOM   3392 C  CZ2 . TRP A  1 592 ? 60.552  43.959  -10.201 1.00 44.56  ? 592 TRP A CZ2 1 
ATOM   3393 C  CZ3 . TRP A  1 592 ? 62.870  44.657  -10.034 1.00 46.83  ? 592 TRP A CZ3 1 
ATOM   3394 C  CH2 . TRP A  1 592 ? 61.525  44.913  -10.369 1.00 47.14  ? 592 TRP A CH2 1 
ATOM   3395 N  N   . PRO A  1 593 ? 66.566  39.646  -8.594  1.00 52.40  ? 593 PRO A N   1 
ATOM   3396 C  CA  . PRO A  1 593 ? 67.782  39.070  -7.995  1.00 49.78  ? 593 PRO A CA  1 
ATOM   3397 C  C   . PRO A  1 593 ? 67.555  38.408  -6.630  1.00 51.40  ? 593 PRO A C   1 
ATOM   3398 O  O   . PRO A  1 593 ? 66.646  38.800  -5.896  1.00 52.73  ? 593 PRO A O   1 
ATOM   3399 C  CB  . PRO A  1 593 ? 68.710  40.281  -7.853  1.00 48.57  ? 593 PRO A CB  1 
ATOM   3400 C  CG  . PRO A  1 593 ? 68.266  41.225  -8.911  1.00 48.26  ? 593 PRO A CG  1 
ATOM   3401 C  CD  . PRO A  1 593 ? 66.777  41.056  -8.987  1.00 53.18  ? 593 PRO A CD  1 
ATOM   3402 N  N   . ARG A  1 594 ? 68.379  37.413  -6.306  1.00 54.71  ? 594 ARG A N   1 
ATOM   3403 C  CA  . ARG A  1 594 ? 68.227  36.657  -5.053  1.00 54.40  ? 594 ARG A CA  1 
ATOM   3404 C  C   . ARG A  1 594 ? 68.510  37.463  -3.771  1.00 54.83  ? 594 ARG A C   1 
ATOM   3405 O  O   . ARG A  1 594 ? 68.041  37.091  -2.693  1.00 60.58  ? 594 ARG A O   1 
ATOM   3406 C  CB  . ARG A  1 594 ? 69.041  35.346  -5.091  1.00 55.92  ? 594 ARG A CB  1 
ATOM   3407 C  CG  . ARG A  1 594 ? 70.550  35.488  -4.935  1.00 66.34  ? 594 ARG A CG  1 
ATOM   3408 C  CD  . ARG A  1 594 ? 71.252  34.133  -4.930  1.00 66.33  ? 594 ARG A CD  1 
ATOM   3409 N  NE  . ARG A  1 594 ? 71.498  33.627  -6.283  1.00 70.40  ? 594 ARG A NE  1 
ATOM   3410 C  CZ  . ARG A  1 594 ? 72.477  34.033  -7.098  1.00 66.90  ? 594 ARG A CZ  1 
ATOM   3411 N  NH1 . ARG A  1 594 ? 73.343  34.979  -6.728  1.00 68.55  ? 594 ARG A NH1 1 
ATOM   3412 N  NH2 . ARG A  1 594 ? 72.589  33.488  -8.309  1.00 61.90  ? 594 ARG A NH2 1 
ATOM   3413 N  N   . TRP A  1 595 ? 69.267  38.555  -3.893  1.00 52.73  ? 595 TRP A N   1 
ATOM   3414 C  CA  . TRP A  1 595 ? 69.474  39.501  -2.775  1.00 54.90  ? 595 TRP A CA  1 
ATOM   3415 C  C   . TRP A  1 595 ? 68.236  40.322  -2.382  1.00 61.40  ? 595 TRP A C   1 
ATOM   3416 O  O   . TRP A  1 595 ? 68.127  40.752  -1.230  1.00 66.48  ? 595 TRP A O   1 
ATOM   3417 C  CB  . TRP A  1 595 ? 70.654  40.451  -3.043  1.00 53.25  ? 595 TRP A CB  1 
ATOM   3418 C  CG  . TRP A  1 595 ? 70.551  41.328  -4.272  1.00 53.28  ? 595 TRP A CG  1 
ATOM   3419 C  CD1 . TRP A  1 595 ? 71.096  41.074  -5.493  1.00 57.35  ? 595 TRP A CD1 1 
ATOM   3420 C  CD2 . TRP A  1 595 ? 69.904  42.607  -4.383  1.00 50.96  ? 595 TRP A CD2 1 
ATOM   3421 N  NE1 . TRP A  1 595 ? 70.822  42.097  -6.365  1.00 54.51  ? 595 TRP A NE1 1 
ATOM   3422 C  CE2 . TRP A  1 595 ? 70.084  43.049  -5.714  1.00 50.05  ? 595 TRP A CE2 1 
ATOM   3423 C  CE3 . TRP A  1 595 ? 69.177  43.413  -3.497  1.00 50.65  ? 595 TRP A CE3 1 
ATOM   3424 C  CZ2 . TRP A  1 595 ? 69.577  44.269  -6.178  1.00 51.37  ? 595 TRP A CZ2 1 
ATOM   3425 C  CZ3 . TRP A  1 595 ? 68.670  44.630  -3.962  1.00 49.86  ? 595 TRP A CZ3 1 
ATOM   3426 C  CH2 . TRP A  1 595 ? 68.873  45.041  -5.291  1.00 52.20  ? 595 TRP A CH2 1 
ATOM   3427 N  N   . THR A  1 596 ? 67.319  40.535  -3.328  1.00 59.29  ? 596 THR A N   1 
ATOM   3428 C  CA  . THR A  1 596 ? 66.120  41.357  -3.088  1.00 57.98  ? 596 THR A CA  1 
ATOM   3429 C  C   . THR A  1 596 ? 65.176  40.773  -2.028  1.00 59.16  ? 596 THR A C   1 
ATOM   3430 O  O   . THR A  1 596 ? 64.374  41.499  -1.447  1.00 53.36  ? 596 THR A O   1 
ATOM   3431 C  CB  . THR A  1 596 ? 65.292  41.585  -4.373  1.00 54.12  ? 596 THR A CB  1 
ATOM   3432 O  OG1 . THR A  1 596 ? 64.805  40.331  -4.870  1.00 52.79  ? 596 THR A OG1 1 
ATOM   3433 C  CG2 . THR A  1 596 ? 66.109  42.285  -5.458  1.00 52.33  ? 596 THR A CG2 1 
ATOM   3434 N  N   . GLY A  1 597 ? 65.250  39.462  -1.810  1.00 57.80  ? 597 GLY A N   1 
ATOM   3435 C  CA  . GLY A  1 597 ? 64.477  38.806  -0.758  1.00 56.84  ? 597 GLY A CA  1 
ATOM   3436 C  C   . GLY A  1 597 ? 62.981  38.839  -1.012  1.00 53.68  ? 597 GLY A C   1 
ATOM   3437 O  O   . GLY A  1 597 ? 62.536  38.912  -2.161  1.00 55.10  ? 597 GLY A O   1 
ATOM   3438 N  N   . VAL A  1 598 ? 62.211  38.808  0.070   1.00 53.97  ? 598 VAL A N   1 
ATOM   3439 C  CA  . VAL A  1 598 ? 60.753  38.766  -0.019  1.00 55.73  ? 598 VAL A CA  1 
ATOM   3440 C  C   . VAL A  1 598 ? 60.253  40.189  -0.218  1.00 52.77  ? 598 VAL A C   1 
ATOM   3441 O  O   . VAL A  1 598 ? 60.030  40.928  0.748   1.00 50.41  ? 598 VAL A O   1 
ATOM   3442 C  CB  . VAL A  1 598 ? 60.102  38.150  1.233   1.00 58.08  ? 598 VAL A CB  1 
ATOM   3443 C  CG1 . VAL A  1 598 ? 58.612  37.940  1.005   1.00 53.90  ? 598 VAL A CG1 1 
ATOM   3444 C  CG2 . VAL A  1 598 ? 60.768  36.833  1.597   1.00 61.44  ? 598 VAL A CG2 1 
ATOM   3445 N  N   . MET A  1 599 ? 60.073  40.565  -1.478  1.00 52.01  ? 599 MET A N   1 
ATOM   3446 C  CA  . MET A  1 599 ? 59.728  41.946  -1.811  1.00 52.34  ? 599 MET A CA  1 
ATOM   3447 C  C   . MET A  1 599 ? 58.263  42.299  -1.564  1.00 50.21  ? 599 MET A C   1 
ATOM   3448 O  O   . MET A  1 599 ? 57.413  41.432  -1.342  1.00 43.89  ? 599 MET A O   1 
ATOM   3449 C  CB  . MET A  1 599 ? 60.154  42.317  -3.241  1.00 54.84  ? 599 MET A CB  1 
ATOM   3450 C  CG  . MET A  1 599 ? 61.432  43.147  -3.278  1.00 56.77  ? 599 MET A CG  1 
ATOM   3451 S  SD  . MET A  1 599 ? 61.780  43.856  -4.890  1.00 58.72  ? 599 MET A SD  1 
ATOM   3452 C  CE  . MET A  1 599 ? 62.037  42.358  -5.822  1.00 59.39  ? 599 MET A CE  1 
ATOM   3453 N  N   . HIS A  1 600 ? 58.014  43.603  -1.576  1.00 50.36  ? 600 HIS A N   1 
ATOM   3454 C  CA  . HIS A  1 600 ? 56.679  44.174  -1.448  1.00 53.97  ? 600 HIS A CA  1 
ATOM   3455 C  C   . HIS A  1 600 ? 55.755  43.681  -2.567  1.00 52.89  ? 600 HIS A C   1 
ATOM   3456 O  O   . HIS A  1 600 ? 55.965  44.010  -3.737  1.00 59.83  ? 600 HIS A O   1 
ATOM   3457 C  CB  . HIS A  1 600 ? 56.795  45.697  -1.492  1.00 57.15  ? 600 HIS A CB  1 
ATOM   3458 C  CG  . HIS A  1 600 ? 55.494  46.415  -1.349  1.00 54.31  ? 600 HIS A CG  1 
ATOM   3459 N  ND1 . HIS A  1 600 ? 54.774  46.430  -0.175  1.00 52.80  ? 600 HIS A ND1 1 
ATOM   3460 C  CD2 . HIS A  1 600 ? 54.794  47.162  -2.230  1.00 49.35  ? 600 HIS A CD2 1 
ATOM   3461 C  CE1 . HIS A  1 600 ? 53.681  47.151  -0.341  1.00 53.27  ? 600 HIS A CE1 1 
ATOM   3462 N  NE2 . HIS A  1 600 ? 53.671  47.608  -1.578  1.00 53.97  ? 600 HIS A NE2 1 
ATOM   3463 N  N   . GLY A  1 601 ? 54.751  42.886  -2.197  1.00 49.40  ? 601 GLY A N   1 
ATOM   3464 C  CA  . GLY A  1 601 ? 53.759  42.360  -3.145  1.00 46.57  ? 601 GLY A CA  1 
ATOM   3465 C  C   . GLY A  1 601 ? 53.890  40.885  -3.504  1.00 45.45  ? 601 GLY A C   1 
ATOM   3466 O  O   . GLY A  1 601 ? 53.124  40.382  -4.329  1.00 50.89  ? 601 GLY A O   1 
ATOM   3467 N  N   . ASP A  1 602 ? 54.848  40.190  -2.889  1.00 46.92  ? 602 ASP A N   1 
ATOM   3468 C  CA  . ASP A  1 602 ? 55.080  38.764  -3.157  1.00 46.87  ? 602 ASP A CA  1 
ATOM   3469 C  C   . ASP A  1 602 ? 53.949  37.869  -2.638  1.00 50.30  ? 602 ASP A C   1 
ATOM   3470 O  O   . ASP A  1 602 ? 53.629  36.849  -3.252  1.00 55.14  ? 602 ASP A O   1 
ATOM   3471 C  CB  . ASP A  1 602 ? 56.412  38.316  -2.543  1.00 44.64  ? 602 ASP A CB  1 
ATOM   3472 C  CG  . ASP A  1 602 ? 57.623  38.927  -3.237  1.00 45.01  ? 602 ASP A CG  1 
ATOM   3473 O  OD1 . ASP A  1 602 ? 57.459  39.770  -4.148  1.00 47.15  ? 602 ASP A OD1 1 
ATOM   3474 O  OD2 . ASP A  1 602 ? 58.756  38.560  -2.860  1.00 48.21  ? 602 ASP A OD2 1 
ATOM   3475 N  N   . GLU A  1 603 ? 53.364  38.260  -1.504  1.00 48.29  ? 603 GLU A N   1 
ATOM   3476 C  CA  . GLU A  1 603 ? 52.198  37.583  -0.907  1.00 47.18  ? 603 GLU A CA  1 
ATOM   3477 C  C   . GLU A  1 603 ? 50.995  37.418  -1.845  1.00 47.25  ? 603 GLU A C   1 
ATOM   3478 O  O   . GLU A  1 603 ? 50.260  36.434  -1.742  1.00 46.68  ? 603 GLU A O   1 
ATOM   3479 C  CB  . GLU A  1 603 ? 51.755  38.308  0.382   1.00 49.72  ? 603 GLU A CB  1 
ATOM   3480 C  CG  . GLU A  1 603 ? 51.022  39.651  0.221   1.00 52.56  ? 603 GLU A CG  1 
ATOM   3481 C  CD  . GLU A  1 603 ? 51.937  40.848  0.001   1.00 58.85  ? 603 GLU A CD  1 
ATOM   3482 O  OE1 . GLU A  1 603 ? 53.079  40.670  -0.469  1.00 64.01  ? 603 GLU A OE1 1 
ATOM   3483 O  OE2 . GLU A  1 603 ? 51.509  41.982  0.305   1.00 59.47  ? 603 GLU A OE2 1 
ATOM   3484 N  N   . ILE A  1 604 ? 50.816  38.383  -2.748  1.00 49.48  ? 604 ILE A N   1 
ATOM   3485 C  CA  . ILE A  1 604 ? 49.654  38.453  -3.648  1.00 46.12  ? 604 ILE A CA  1 
ATOM   3486 C  C   . ILE A  1 604 ? 49.540  37.190  -4.505  1.00 48.76  ? 604 ILE A C   1 
ATOM   3487 O  O   . ILE A  1 604 ? 48.444  36.665  -4.714  1.00 52.37  ? 604 ILE A O   1 
ATOM   3488 C  CB  . ILE A  1 604 ? 49.729  39.685  -4.584  1.00 45.24  ? 604 ILE A CB  1 
ATOM   3489 C  CG1 . ILE A  1 604 ? 49.691  40.996  -3.785  1.00 41.97  ? 604 ILE A CG1 1 
ATOM   3490 C  CG2 . ILE A  1 604 ? 48.576  39.685  -5.587  1.00 48.67  ? 604 ILE A CG2 1 
ATOM   3491 C  CD1 . ILE A  1 604 ? 50.198  42.192  -4.563  1.00 41.03  ? 604 ILE A CD1 1 
ATOM   3492 N  N   . ASN A  1 605 ? 50.687  36.723  -4.995  1.00 47.58  ? 605 ASN A N   1 
ATOM   3493 C  CA  . ASN A  1 605 ? 50.766  35.530  -5.847  1.00 45.16  ? 605 ASN A CA  1 
ATOM   3494 C  C   . ASN A  1 605 ? 50.186  34.286  -5.161  1.00 44.68  ? 605 ASN A C   1 
ATOM   3495 O  O   . ASN A  1 605 ? 49.595  33.429  -5.819  1.00 43.71  ? 605 ASN A O   1 
ATOM   3496 C  CB  . ASN A  1 605 ? 52.217  35.257  -6.273  1.00 44.64  ? 605 ASN A CB  1 
ATOM   3497 C  CG  . ASN A  1 605 ? 52.824  36.401  -7.073  1.00 45.46  ? 605 ASN A CG  1 
ATOM   3498 O  OD1 . ASN A  1 605 ? 52.826  37.549  -6.626  1.00 44.43  ? 605 ASN A OD1 1 
ATOM   3499 N  ND2 . ASN A  1 605 ? 53.349  36.091  -8.254  1.00 45.04  ? 605 ASN A ND2 1 
ATOM   3500 N  N   . TYR A  1 606 ? 50.346  34.211  -3.839  1.00 45.78  ? 606 TYR A N   1 
ATOM   3501 C  CA  . TYR A  1 606 ? 49.881  33.072  -3.040  1.00 45.29  ? 606 TYR A CA  1 
ATOM   3502 C  C   . TYR A  1 606 ? 48.455  33.215  -2.487  1.00 43.82  ? 606 TYR A C   1 
ATOM   3503 O  O   . TYR A  1 606 ? 47.754  32.208  -2.363  1.00 39.10  ? 606 TYR A O   1 
ATOM   3504 C  CB  . TYR A  1 606 ? 50.876  32.787  -1.911  1.00 43.88  ? 606 TYR A CB  1 
ATOM   3505 C  CG  . TYR A  1 606 ? 52.182  32.216  -2.414  1.00 44.50  ? 606 TYR A CG  1 
ATOM   3506 C  CD1 . TYR A  1 606 ? 53.121  33.032  -3.043  1.00 43.42  ? 606 TYR A CD1 1 
ATOM   3507 C  CD2 . TYR A  1 606 ? 52.477  30.859  -2.282  1.00 47.62  ? 606 TYR A CD2 1 
ATOM   3508 C  CE1 . TYR A  1 606 ? 54.318  32.521  -3.515  1.00 42.35  ? 606 TYR A CE1 1 
ATOM   3509 C  CE2 . TYR A  1 606 ? 53.674  30.337  -2.754  1.00 46.85  ? 606 TYR A CE2 1 
ATOM   3510 C  CZ  . TYR A  1 606 ? 54.591  31.172  -3.369  1.00 43.63  ? 606 TYR A CZ  1 
ATOM   3511 O  OH  . TYR A  1 606 ? 55.782  30.667  -3.839  1.00 47.47  ? 606 TYR A OH  1 
ATOM   3512 N  N   . VAL A  1 607 ? 48.030  34.437  -2.149  1.00 46.33  ? 607 VAL A N   1 
ATOM   3513 C  CA  . VAL A  1 607 ? 46.635  34.668  -1.694  1.00 52.56  ? 607 VAL A CA  1 
ATOM   3514 C  C   . VAL A  1 607 ? 45.608  34.476  -2.821  1.00 52.52  ? 607 VAL A C   1 
ATOM   3515 O  O   . VAL A  1 607 ? 44.460  34.123  -2.554  1.00 52.81  ? 607 VAL A O   1 
ATOM   3516 C  CB  . VAL A  1 607 ? 46.400  36.053  -1.022  1.00 54.55  ? 607 VAL A CB  1 
ATOM   3517 C  CG1 . VAL A  1 607 ? 47.315  36.248  0.177   1.00 57.69  ? 607 VAL A CG1 1 
ATOM   3518 C  CG2 . VAL A  1 607 ? 46.567  37.201  -2.003  1.00 59.36  ? 607 VAL A CG2 1 
ATOM   3519 N  N   . PHE A  1 608 ? 46.028  34.725  -4.065  1.00 48.82  ? 608 PHE A N   1 
ATOM   3520 C  CA  . PHE A  1 608 ? 45.174  34.545  -5.257  1.00 48.21  ? 608 PHE A CA  1 
ATOM   3521 C  C   . PHE A  1 608 ? 45.317  33.188  -5.971  1.00 48.09  ? 608 PHE A C   1 
ATOM   3522 O  O   . PHE A  1 608 ? 44.669  32.958  -6.994  1.00 44.80  ? 608 PHE A O   1 
ATOM   3523 C  CB  . PHE A  1 608 ? 45.400  35.698  -6.246  1.00 48.78  ? 608 PHE A CB  1 
ATOM   3524 C  CG  . PHE A  1 608 ? 44.606  36.929  -5.921  1.00 50.00  ? 608 PHE A CG  1 
ATOM   3525 C  CD1 . PHE A  1 608 ? 43.230  36.951  -6.135  1.00 50.05  ? 608 PHE A CD1 1 
ATOM   3526 C  CD2 . PHE A  1 608 ? 45.223  38.062  -5.399  1.00 45.99  ? 608 PHE A CD2 1 
ATOM   3527 C  CE1 . PHE A  1 608 ? 42.484  38.076  -5.836  1.00 46.67  ? 608 PHE A CE1 1 
ATOM   3528 C  CE2 . PHE A  1 608 ? 44.480  39.195  -5.099  1.00 46.16  ? 608 PHE A CE2 1 
ATOM   3529 C  CZ  . PHE A  1 608 ? 43.108  39.198  -5.320  1.00 50.25  ? 608 PHE A CZ  1 
ATOM   3530 N  N   . GLY A  1 609 ? 46.155  32.304  -5.435  1.00 48.45  ? 609 GLY A N   1 
ATOM   3531 C  CA  . GLY A  1 609 ? 46.254  30.922  -5.911  1.00 49.72  ? 609 GLY A CA  1 
ATOM   3532 C  C   . GLY A  1 609 ? 46.918  30.764  -7.263  1.00 55.28  ? 609 GLY A C   1 
ATOM   3533 O  O   . GLY A  1 609 ? 46.471  29.960  -8.086  1.00 64.11  ? 609 GLY A O   1 
ATOM   3534 N  N   . GLU A  1 610 ? 47.981  31.529  -7.492  1.00 54.06  ? 610 GLU A N   1 
ATOM   3535 C  CA  . GLU A  1 610 ? 48.726  31.457  -8.753  1.00 54.89  ? 610 GLU A CA  1 
ATOM   3536 C  C   . GLU A  1 610 ? 49.518  30.138  -8.915  1.00 52.62  ? 610 GLU A C   1 
ATOM   3537 O  O   . GLU A  1 610 ? 49.666  29.659  -10.040 1.00 52.65  ? 610 GLU A O   1 
ATOM   3538 C  CB  . GLU A  1 610 ? 49.640  32.682  -8.930  1.00 57.63  ? 610 GLU A CB  1 
ATOM   3539 C  CG  . GLU A  1 610 ? 49.787  33.121  -10.382 1.00 61.12  ? 610 GLU A CG  1 
ATOM   3540 C  CD  . GLU A  1 610 ? 50.611  34.386  -10.567 1.00 67.23  ? 610 GLU A CD  1 
ATOM   3541 O  OE1 . GLU A  1 610 ? 50.416  35.068  -11.595 1.00 71.36  ? 610 GLU A OE1 1 
ATOM   3542 O  OE2 . GLU A  1 610 ? 51.451  34.703  -9.697  1.00 73.35  ? 610 GLU A OE2 1 
ATOM   3543 N  N   . PRO A  1 611 ? 50.032  29.553  -7.806  1.00 51.07  ? 611 PRO A N   1 
ATOM   3544 C  CA  . PRO A  1 611 ? 50.662  28.221  -7.880  1.00 49.64  ? 611 PRO A CA  1 
ATOM   3545 C  C   . PRO A  1 611 ? 49.750  27.065  -8.298  1.00 50.73  ? 611 PRO A C   1 
ATOM   3546 O  O   . PRO A  1 611 ? 50.242  26.069  -8.832  1.00 54.13  ? 611 PRO A O   1 
ATOM   3547 C  CB  . PRO A  1 611 ? 51.176  27.997  -6.452  1.00 48.65  ? 611 PRO A CB  1 
ATOM   3548 C  CG  . PRO A  1 611 ? 51.405  29.364  -5.927  1.00 50.90  ? 611 PRO A CG  1 
ATOM   3549 C  CD  . PRO A  1 611 ? 50.289  30.183  -6.496  1.00 53.84  ? 611 PRO A CD  1 
ATOM   3550 N  N   . LEU A  1 612 ? 48.446  27.199  -8.061  1.00 52.26  ? 612 LEU A N   1 
ATOM   3551 C  CA  . LEU A  1 612 ? 47.468  26.188  -8.490  1.00 51.01  ? 612 LEU A CA  1 
ATOM   3552 C  C   . LEU A  1 612 ? 47.321  26.106  -10.020 1.00 51.87  ? 612 LEU A C   1 
ATOM   3553 O  O   . LEU A  1 612 ? 46.812  25.109  -10.533 1.00 53.98  ? 612 LEU A O   1 
ATOM   3554 C  CB  . LEU A  1 612 ? 46.105  26.413  -7.817  1.00 50.04  ? 612 LEU A CB  1 
ATOM   3555 C  CG  . LEU A  1 612 ? 45.939  25.828  -6.407  1.00 46.47  ? 612 LEU A CG  1 
ATOM   3556 C  CD1 . LEU A  1 612 ? 46.977  26.340  -5.415  1.00 43.80  ? 612 LEU A CD1 1 
ATOM   3557 C  CD2 . LEU A  1 612 ? 44.535  26.123  -5.901  1.00 48.11  ? 612 LEU A CD2 1 
ATOM   3558 N  N   . ASN A  1 613 ? 47.748  27.156  -10.725 1.00 52.28  ? 613 ASN A N   1 
ATOM   3559 C  CA  . ASN A  1 613 ? 47.959  27.109  -12.178 1.00 52.19  ? 613 ASN A CA  1 
ATOM   3560 C  C   . ASN A  1 613 ? 49.286  26.396  -12.483 1.00 52.06  ? 613 ASN A C   1 
ATOM   3561 O  O   . ASN A  1 613 ? 50.355  26.994  -12.317 1.00 50.52  ? 613 ASN A O   1 
ATOM   3562 C  CB  . ASN A  1 613 ? 47.942  28.527  -12.771 1.00 53.06  ? 613 ASN A CB  1 
ATOM   3563 C  CG  . ASN A  1 613 ? 48.072  28.543  -14.290 1.00 55.32  ? 613 ASN A CG  1 
ATOM   3564 O  OD1 . ASN A  1 613 ? 47.653  27.611  -14.982 1.00 56.21  ? 613 ASN A OD1 1 
ATOM   3565 N  ND2 . ASN A  1 613 ? 48.651  29.617  -14.815 1.00 59.66  ? 613 ASN A ND2 1 
ATOM   3566 N  N   . PRO A  1 614 ? 49.226  25.115  -12.930 1.00 53.37  ? 614 PRO A N   1 
ATOM   3567 C  CA  . PRO A  1 614 ? 50.465  24.346  -13.099 1.00 53.92  ? 614 PRO A CA  1 
ATOM   3568 C  C   . PRO A  1 614 ? 51.296  24.705  -14.333 1.00 52.86  ? 614 PRO A C   1 
ATOM   3569 O  O   . PRO A  1 614 ? 52.441  24.271  -14.429 1.00 56.81  ? 614 PRO A O   1 
ATOM   3570 C  CB  . PRO A  1 614 ? 49.975  22.889  -13.199 1.00 54.32  ? 614 PRO A CB  1 
ATOM   3571 C  CG  . PRO A  1 614 ? 48.481  22.935  -13.186 1.00 52.64  ? 614 PRO A CG  1 
ATOM   3572 C  CD  . PRO A  1 614 ? 48.075  24.349  -13.439 1.00 54.42  ? 614 PRO A CD  1 
ATOM   3573 N  N   . THR A  1 615 ? 50.729  25.474  -15.263 1.00 48.12  ? 615 THR A N   1 
ATOM   3574 C  CA  . THR A  1 615 ? 51.471  25.984  -16.418 1.00 51.31  ? 615 THR A CA  1 
ATOM   3575 C  C   . THR A  1 615 ? 52.572  26.985  -16.038 1.00 58.68  ? 615 THR A C   1 
ATOM   3576 O  O   . THR A  1 615 ? 53.473  27.249  -16.839 1.00 69.89  ? 615 THR A O   1 
ATOM   3577 C  CB  . THR A  1 615 ? 50.520  26.609  -17.452 1.00 50.11  ? 615 THR A CB  1 
ATOM   3578 O  OG1 . THR A  1 615 ? 49.695  27.594  -16.820 1.00 52.12  ? 615 THR A OG1 1 
ATOM   3579 C  CG2 . THR A  1 615 ? 49.641  25.534  -18.066 1.00 50.46  ? 615 THR A CG2 1 
ATOM   3580 N  N   . LEU A  1 616 ? 52.478  27.547  -14.833 1.00 62.47  ? 616 LEU A N   1 
ATOM   3581 C  CA  . LEU A  1 616 ? 53.605  28.214  -14.177 1.00 66.89  ? 616 LEU A CA  1 
ATOM   3582 C  C   . LEU A  1 616 ? 54.336  27.156  -13.348 1.00 69.96  ? 616 LEU A C   1 
ATOM   3583 O  O   . LEU A  1 616 ? 53.696  26.277  -12.765 1.00 86.81  ? 616 LEU A O   1 
ATOM   3584 C  CB  . LEU A  1 616 ? 53.106  29.342  -13.273 1.00 67.04  ? 616 LEU A CB  1 
ATOM   3585 C  CG  . LEU A  1 616 ? 52.115  30.331  -13.904 1.00 70.13  ? 616 LEU A CG  1 
ATOM   3586 C  CD1 . LEU A  1 616 ? 51.364  31.088  -12.826 1.00 73.08  ? 616 LEU A CD1 1 
ATOM   3587 C  CD2 . LEU A  1 616 ? 52.810  31.295  -14.853 1.00 69.41  ? 616 LEU A CD2 1 
ATOM   3588 N  N   . GLY A  1 617 ? 55.661  27.254  -13.261 1.00 65.51  ? 617 GLY A N   1 
ATOM   3589 C  CA  . GLY A  1 617 ? 56.487  26.202  -12.641 1.00 59.87  ? 617 GLY A CA  1 
ATOM   3590 C  C   . GLY A  1 617 ? 56.674  26.297  -11.132 1.00 55.00  ? 617 GLY A C   1 
ATOM   3591 O  O   . GLY A  1 617 ? 57.801  26.212  -10.639 1.00 60.12  ? 617 GLY A O   1 
ATOM   3592 N  N   . TYR A  1 618 ? 55.570  26.459  -10.403 1.00 57.05  ? 618 TYR A N   1 
ATOM   3593 C  CA  . TYR A  1 618 ? 55.590  26.506  -8.934  1.00 58.11  ? 618 TYR A CA  1 
ATOM   3594 C  C   . TYR A  1 618 ? 55.786  25.090  -8.374  1.00 57.84  ? 618 TYR A C   1 
ATOM   3595 O  O   . TYR A  1 618 ? 55.279  24.118  -8.940  1.00 60.89  ? 618 TYR A O   1 
ATOM   3596 C  CB  . TYR A  1 618 ? 54.288  27.108  -8.378  1.00 58.10  ? 618 TYR A CB  1 
ATOM   3597 C  CG  . TYR A  1 618 ? 54.228  28.628  -8.342  1.00 55.34  ? 618 TYR A CG  1 
ATOM   3598 C  CD1 . TYR A  1 618 ? 54.797  29.345  -7.287  1.00 55.21  ? 618 TYR A CD1 1 
ATOM   3599 C  CD2 . TYR A  1 618 ? 53.573  29.349  -9.344  1.00 52.97  ? 618 TYR A CD2 1 
ATOM   3600 C  CE1 . TYR A  1 618 ? 54.727  30.732  -7.238  1.00 55.44  ? 618 TYR A CE1 1 
ATOM   3601 C  CE2 . TYR A  1 618 ? 53.494  30.735  -9.302  1.00 49.88  ? 618 TYR A CE2 1 
ATOM   3602 C  CZ  . TYR A  1 618 ? 54.075  31.422  -8.251  1.00 52.67  ? 618 TYR A CZ  1 
ATOM   3603 O  OH  . TYR A  1 618 ? 54.006  32.795  -8.209  1.00 52.72  ? 618 TYR A OH  1 
ATOM   3604 N  N   . THR A  1 619 ? 56.501  24.988  -7.253  1.00 56.99  ? 619 THR A N   1 
ATOM   3605 C  CA  . THR A  1 619 ? 56.817  23.684  -6.636  1.00 58.10  ? 619 THR A CA  1 
ATOM   3606 C  C   . THR A  1 619 ? 55.581  23.084  -5.946  1.00 64.77  ? 619 THR A C   1 
ATOM   3607 O  O   . THR A  1 619 ? 54.507  23.693  -5.935  1.00 69.24  ? 619 THR A O   1 
ATOM   3608 C  CB  . THR A  1 619 ? 57.992  23.768  -5.621  1.00 53.34  ? 619 THR A CB  1 
ATOM   3609 O  OG1 . THR A  1 619 ? 57.587  24.493  -4.450  1.00 48.68  ? 619 THR A OG1 1 
ATOM   3610 C  CG2 . THR A  1 619 ? 59.229  24.425  -6.235  1.00 53.08  ? 619 THR A CG2 1 
ATOM   3611 N  N   . GLU A  1 620 ? 55.741  21.890  -5.379  1.00 67.78  ? 620 GLU A N   1 
ATOM   3612 C  CA  . GLU A  1 620 ? 54.667  21.221  -4.638  1.00 66.18  ? 620 GLU A CA  1 
ATOM   3613 C  C   . GLU A  1 620 ? 54.428  21.869  -3.272  1.00 63.04  ? 620 GLU A C   1 
ATOM   3614 O  O   . GLU A  1 620 ? 53.282  22.003  -2.841  1.00 61.64  ? 620 GLU A O   1 
ATOM   3615 C  CB  . GLU A  1 620 ? 54.984  19.729  -4.469  1.00 68.33  ? 620 GLU A CB  1 
ATOM   3616 C  CG  . GLU A  1 620 ? 53.815  18.866  -3.994  1.00 70.94  ? 620 GLU A CG  1 
ATOM   3617 C  CD  . GLU A  1 620 ? 52.657  18.791  -4.980  1.00 75.68  ? 620 GLU A CD  1 
ATOM   3618 O  OE1 . GLU A  1 620 ? 51.531  18.473  -4.540  1.00 81.40  ? 620 GLU A OE1 1 
ATOM   3619 O  OE2 . GLU A  1 620 ? 52.858  19.043  -6.188  1.00 75.42  ? 620 GLU A OE2 1 
ATOM   3620 N  N   . ASP A  1 621 ? 55.508  22.250  -2.591  1.00 62.58  ? 621 ASP A N   1 
ATOM   3621 C  CA  . ASP A  1 621 ? 55.411  22.932  -1.292  1.00 65.06  ? 621 ASP A CA  1 
ATOM   3622 C  C   . ASP A  1 621 ? 54.845  24.349  -1.411  1.00 62.68  ? 621 ASP A C   1 
ATOM   3623 O  O   . ASP A  1 621 ? 54.165  24.823  -0.500  1.00 63.88  ? 621 ASP A O   1 
ATOM   3624 C  CB  . ASP A  1 621 ? 56.769  22.957  -0.578  1.00 67.89  ? 621 ASP A CB  1 
ATOM   3625 C  CG  . ASP A  1 621 ? 57.089  21.645  0.122   1.00 70.65  ? 621 ASP A CG  1 
ATOM   3626 O  OD1 . ASP A  1 621 ? 56.702  20.573  -0.393  1.00 69.36  ? 621 ASP A OD1 1 
ATOM   3627 O  OD2 . ASP A  1 621 ? 57.734  21.685  1.190   1.00 79.80  ? 621 ASP A OD2 1 
ATOM   3628 N  N   . GLU A  1 622 ? 55.135  25.014  -2.527  1.00 57.04  ? 622 GLU A N   1 
ATOM   3629 C  CA  . GLU A  1 622 ? 54.548  26.321  -2.843  1.00 54.16  ? 622 GLU A CA  1 
ATOM   3630 C  C   . GLU A  1 622 ? 53.042  26.227  -3.120  1.00 53.77  ? 622 GLU A C   1 
ATOM   3631 O  O   . GLU A  1 622 ? 52.285  27.135  -2.768  1.00 50.59  ? 622 GLU A O   1 
ATOM   3632 C  CB  . GLU A  1 622 ? 55.275  26.946  -4.035  1.00 55.09  ? 622 GLU A CB  1 
ATOM   3633 C  CG  . GLU A  1 622 ? 56.672  27.446  -3.685  1.00 59.10  ? 622 GLU A CG  1 
ATOM   3634 C  CD  . GLU A  1 622 ? 57.509  27.844  -4.892  1.00 62.72  ? 622 GLU A CD  1 
ATOM   3635 O  OE1 . GLU A  1 622 ? 57.256  27.353  -6.014  1.00 61.98  ? 622 GLU A OE1 1 
ATOM   3636 O  OE2 . GLU A  1 622 ? 58.449  28.645  -4.713  1.00 65.64  ? 622 GLU A OE2 1 
ATOM   3637 N  N   . LYS A  1 623 ? 52.622  25.129  -3.752  1.00 60.53  ? 623 LYS A N   1 
ATOM   3638 C  CA  . LYS A  1 623 ? 51.199  24.830  -3.964  1.00 63.67  ? 623 LYS A CA  1 
ATOM   3639 C  C   . LYS A  1 623 ? 50.464  24.566  -2.645  1.00 64.22  ? 623 LYS A C   1 
ATOM   3640 O  O   . LYS A  1 623 ? 49.343  25.041  -2.453  1.00 64.83  ? 623 LYS A O   1 
ATOM   3641 C  CB  . LYS A  1 623 ? 51.030  23.632  -4.908  1.00 63.89  ? 623 LYS A CB  1 
ATOM   3642 C  CG  . LYS A  1 623 ? 51.327  23.939  -6.368  1.00 64.72  ? 623 LYS A CG  1 
ATOM   3643 C  CD  . LYS A  1 623 ? 51.463  22.669  -7.196  1.00 71.15  ? 623 LYS A CD  1 
ATOM   3644 C  CE  . LYS A  1 623 ? 51.851  22.984  -8.634  1.00 75.84  ? 623 LYS A CE  1 
ATOM   3645 N  NZ  . LYS A  1 623 ? 51.913  21.774  -9.499  1.00 71.60  ? 623 LYS A NZ  1 
ATOM   3646 N  N   . ASP A  1 624 ? 51.097  23.802  -1.754  1.00 65.15  ? 624 ASP A N   1 
ATOM   3647 C  CA  . ASP A  1 624 ? 50.584  23.577  -0.394  1.00 68.27  ? 624 ASP A CA  1 
ATOM   3648 C  C   . ASP A  1 624 ? 50.569  24.856  0.450   1.00 68.09  ? 624 ASP A C   1 
ATOM   3649 O  O   . ASP A  1 624 ? 49.685  25.037  1.289   1.00 66.34  ? 624 ASP A O   1 
ATOM   3650 C  CB  . ASP A  1 624 ? 51.412  22.501  0.325   1.00 67.09  ? 624 ASP A CB  1 
ATOM   3651 C  CG  . ASP A  1 624 ? 51.087  21.088  -0.142  1.00 66.99  ? 624 ASP A CG  1 
ATOM   3652 O  OD1 . ASP A  1 624 ? 49.890  20.756  -0.291  1.00 61.35  ? 624 ASP A OD1 1 
ATOM   3653 O  OD2 . ASP A  1 624 ? 52.035  20.297  -0.345  1.00 75.91  ? 624 ASP A OD2 1 
ATOM   3654 N  N   . PHE A  1 625 ? 51.553  25.726  0.223   1.00 64.08  ? 625 PHE A N   1 
ATOM   3655 C  CA  . PHE A  1 625 ? 51.672  27.002  0.935   1.00 60.66  ? 625 PHE A CA  1 
ATOM   3656 C  C   . PHE A  1 625 ? 50.618  28.016  0.484   1.00 58.90  ? 625 PHE A C   1 
ATOM   3657 O  O   . PHE A  1 625 ? 50.147  28.816  1.291   1.00 72.67  ? 625 PHE A O   1 
ATOM   3658 C  CB  . PHE A  1 625 ? 53.085  27.576  0.754   1.00 60.18  ? 625 PHE A CB  1 
ATOM   3659 C  CG  . PHE A  1 625 ? 53.351  28.828  1.552   1.00 58.54  ? 625 PHE A CG  1 
ATOM   3660 C  CD1 . PHE A  1 625 ? 53.108  28.872  2.926   1.00 58.67  ? 625 PHE A CD1 1 
ATOM   3661 C  CD2 . PHE A  1 625 ? 53.874  29.960  0.935   1.00 58.18  ? 625 PHE A CD2 1 
ATOM   3662 C  CE1 . PHE A  1 625 ? 53.360  30.025  3.658   1.00 59.03  ? 625 PHE A CE1 1 
ATOM   3663 C  CE2 . PHE A  1 625 ? 54.131  31.112  1.662   1.00 60.91  ? 625 PHE A CE2 1 
ATOM   3664 C  CZ  . PHE A  1 625 ? 53.874  31.146  3.025   1.00 60.60  ? 625 PHE A CZ  1 
ATOM   3665 N  N   . SER A  1 626 ? 50.261  27.989  -0.798  1.00 53.31  ? 626 SER A N   1 
ATOM   3666 C  CA  . SER A  1 626 ? 49.176  28.826  -1.322  1.00 52.79  ? 626 SER A CA  1 
ATOM   3667 C  C   . SER A  1 626 ? 47.824  28.398  -0.761  1.00 51.81  ? 626 SER A C   1 
ATOM   3668 O  O   . SER A  1 626 ? 47.053  29.232  -0.284  1.00 49.62  ? 626 SER A O   1 
ATOM   3669 C  CB  . SER A  1 626 ? 49.133  28.757  -2.844  1.00 56.29  ? 626 SER A CB  1 
ATOM   3670 O  OG  . SER A  1 626 ? 48.196  29.683  -3.361  1.00 56.18  ? 626 SER A OG  1 
ATOM   3671 N  N   . ARG A  1 627 ? 47.552  27.095  -0.838  1.00 59.88  ? 627 ARG A N   1 
ATOM   3672 C  CA  . ARG A  1 627 ? 46.365  26.480  -0.224  1.00 61.41  ? 627 ARG A CA  1 
ATOM   3673 C  C   . ARG A  1 627 ? 46.241  26.789  1.274   1.00 61.63  ? 627 ARG A C   1 
ATOM   3674 O  O   . ARG A  1 627 ? 45.134  26.952  1.793   1.00 60.37  ? 627 ARG A O   1 
ATOM   3675 C  CB  . ARG A  1 627 ? 46.387  24.958  -0.432  1.00 62.85  ? 627 ARG A CB  1 
ATOM   3676 C  CG  . ARG A  1 627 ? 45.993  24.511  -1.836  1.00 71.82  ? 627 ARG A CG  1 
ATOM   3677 C  CD  . ARG A  1 627 ? 45.462  23.084  -1.866  1.00 75.74  ? 627 ARG A CD  1 
ATOM   3678 N  NE  . ARG A  1 627 ? 46.518  22.084  -1.678  1.00 78.20  ? 627 ARG A NE  1 
ATOM   3679 C  CZ  . ARG A  1 627 ? 47.123  21.385  -2.646  1.00 81.07  ? 627 ARG A CZ  1 
ATOM   3680 N  NH1 . ARG A  1 627 ? 46.807  21.539  -3.935  1.00 75.56  ? 627 ARG A NH1 1 
ATOM   3681 N  NH2 . ARG A  1 627 ? 48.068  20.507  -2.316  1.00 85.95  ? 627 ARG A NH2 1 
ATOM   3682 N  N   . LYS A  1 628 ? 47.388  26.855  1.949   1.00 61.81  ? 628 LYS A N   1 
ATOM   3683 C  CA  . LYS A  1 628 ? 47.471  27.185  3.372   1.00 56.14  ? 628 LYS A CA  1 
ATOM   3684 C  C   . LYS A  1 628 ? 47.017  28.613  3.667   1.00 58.35  ? 628 LYS A C   1 
ATOM   3685 O  O   . LYS A  1 628 ? 46.126  28.818  4.495   1.00 69.15  ? 628 LYS A O   1 
ATOM   3686 C  CB  . LYS A  1 628 ? 48.904  26.976  3.872   1.00 56.25  ? 628 LYS A CB  1 
ATOM   3687 C  CG  . LYS A  1 628 ? 49.095  27.082  5.379   1.00 57.51  ? 628 LYS A CG  1 
ATOM   3688 C  CD  . LYS A  1 628 ? 50.479  26.586  5.780   1.00 55.98  ? 628 LYS A CD  1 
ATOM   3689 C  CE  . LYS A  1 628 ? 50.994  27.264  7.037   1.00 52.78  ? 628 LYS A CE  1 
ATOM   3690 N  NZ  . LYS A  1 628 ? 52.379  26.821  7.360   1.00 51.64  ? 628 LYS A NZ  1 
ATOM   3691 N  N   . ILE A  1 629 ? 47.623  29.590  2.990   1.00 56.50  ? 629 ILE A N   1 
ATOM   3692 C  CA  . ILE A  1 629 ? 47.299  31.006  3.248   1.00 53.92  ? 629 ILE A CA  1 
ATOM   3693 C  C   . ILE A  1 629 ? 45.949  31.422  2.647   1.00 54.64  ? 629 ILE A C   1 
ATOM   3694 O  O   . ILE A  1 629 ? 45.305  32.335  3.157   1.00 53.38  ? 629 ILE A O   1 
ATOM   3695 C  CB  . ILE A  1 629 ? 48.427  32.000  2.850   1.00 52.57  ? 629 ILE A CB  1 
ATOM   3696 C  CG1 . ILE A  1 629 ? 48.511  32.241  1.342   1.00 59.35  ? 629 ILE A CG1 1 
ATOM   3697 C  CG2 . ILE A  1 629 ? 49.781  31.543  3.385   1.00 52.84  ? 629 ILE A CG2 1 
ATOM   3698 C  CD1 . ILE A  1 629 ? 49.252  33.520  1.022   1.00 70.40  ? 629 ILE A CD1 1 
ATOM   3699 N  N   . MET A  1 630 ? 45.530  30.761  1.568   1.00 53.21  ? 630 MET A N   1 
ATOM   3700 C  CA  . MET A  1 630 ? 44.189  30.971  1.002   1.00 53.60  ? 630 MET A CA  1 
ATOM   3701 C  C   . MET A  1 630 ? 43.070  30.588  1.971   1.00 51.85  ? 630 MET A C   1 
ATOM   3702 O  O   . MET A  1 630 ? 42.001  31.203  1.951   1.00 53.82  ? 630 MET A O   1 
ATOM   3703 C  CB  . MET A  1 630 ? 44.014  30.190  -0.303  1.00 58.50  ? 630 MET A CB  1 
ATOM   3704 C  CG  . MET A  1 630 ? 44.632  30.862  -1.516  1.00 63.01  ? 630 MET A CG  1 
ATOM   3705 S  SD  . MET A  1 630 ? 44.732  29.751  -2.931  1.00 67.48  ? 630 MET A SD  1 
ATOM   3706 C  CE  . MET A  1 630 ? 43.001  29.600  -3.359  1.00 65.14  ? 630 MET A CE  1 
ATOM   3707 N  N   . ARG A  1 631 ? 43.315  29.576  2.805   1.00 52.30  ? 631 ARG A N   1 
ATOM   3708 C  CA  . ARG A  1 631 ? 42.340  29.153  3.808   1.00 52.68  ? 631 ARG A CA  1 
ATOM   3709 C  C   . ARG A  1 631 ? 42.266  30.170  4.936   1.00 53.14  ? 631 ARG A C   1 
ATOM   3710 O  O   . ARG A  1 631 ? 41.178  30.623  5.271   1.00 56.30  ? 631 ARG A O   1 
ATOM   3711 C  CB  . ARG A  1 631 ? 42.674  27.769  4.369   1.00 53.81  ? 631 ARG A CB  1 
ATOM   3712 C  CG  . ARG A  1 631 ? 41.537  27.113  5.149   1.00 54.32  ? 631 ARG A CG  1 
ATOM   3713 C  CD  . ARG A  1 631 ? 40.410  26.617  4.250   1.00 50.92  ? 631 ARG A CD  1 
ATOM   3714 N  NE  . ARG A  1 631 ? 40.791  25.426  3.485   1.00 54.16  ? 631 ARG A NE  1 
ATOM   3715 C  CZ  . ARG A  1 631 ? 40.150  24.947  2.414   1.00 59.96  ? 631 ARG A CZ  1 
ATOM   3716 N  NH1 . ARG A  1 631 ? 39.069  25.550  1.917   1.00 60.05  ? 631 ARG A NH1 1 
ATOM   3717 N  NH2 . ARG A  1 631 ? 40.607  23.846  1.820   1.00 65.88  ? 631 ARG A NH2 1 
ATOM   3718 N  N   . TYR A  1 632 ? 43.419  30.519  5.509   1.00 52.35  ? 632 TYR A N   1 
ATOM   3719 C  CA  . TYR A  1 632 ? 43.506  31.570  6.538   1.00 53.17  ? 632 TYR A CA  1 
ATOM   3720 C  C   . TYR A  1 632 ? 42.770  32.847  6.121   1.00 51.13  ? 632 TYR A C   1 
ATOM   3721 O  O   . TYR A  1 632 ? 42.045  33.442  6.917   1.00 49.90  ? 632 TYR A O   1 
ATOM   3722 C  CB  . TYR A  1 632 ? 44.966  31.951  6.835   1.00 54.10  ? 632 TYR A CB  1 
ATOM   3723 C  CG  . TYR A  1 632 ? 45.811  30.981  7.651   1.00 53.47  ? 632 TYR A CG  1 
ATOM   3724 C  CD1 . TYR A  1 632 ? 45.250  30.103  8.587   1.00 50.61  ? 632 TYR A CD1 1 
ATOM   3725 C  CD2 . TYR A  1 632 ? 47.202  30.991  7.521   1.00 57.69  ? 632 TYR A CD2 1 
ATOM   3726 C  CE1 . TYR A  1 632 ? 46.047  29.244  9.331   1.00 51.25  ? 632 TYR A CE1 1 
ATOM   3727 C  CE2 . TYR A  1 632 ? 48.005  30.139  8.264   1.00 55.25  ? 632 TYR A CE2 1 
ATOM   3728 C  CZ  . TYR A  1 632 ? 47.425  29.267  9.167   1.00 52.77  ? 632 TYR A CZ  1 
ATOM   3729 O  OH  . TYR A  1 632 ? 48.223  28.421  9.903   1.00 56.25  ? 632 TYR A OH  1 
ATOM   3730 N  N   . TRP A  1 633 ? 42.973  33.256  4.872   1.00 54.31  ? 633 TRP A N   1 
ATOM   3731 C  CA  . TRP A  1 633 ? 42.321  34.447  4.320   1.00 55.05  ? 633 TRP A CA  1 
ATOM   3732 C  C   . TRP A  1 633 ? 40.795  34.273  4.246   1.00 56.68  ? 633 TRP A C   1 
ATOM   3733 O  O   . TRP A  1 633 ? 40.045  35.135  4.709   1.00 53.19  ? 633 TRP A O   1 
ATOM   3734 C  CB  . TRP A  1 633 ? 42.894  34.793  2.933   1.00 50.59  ? 633 TRP A CB  1 
ATOM   3735 C  CG  . TRP A  1 633 ? 43.961  35.869  2.934   1.00 49.19  ? 633 TRP A CG  1 
ATOM   3736 C  CD1 . TRP A  1 633 ? 43.946  37.027  2.210   1.00 48.53  ? 633 TRP A CD1 1 
ATOM   3737 C  CD2 . TRP A  1 633 ? 45.187  35.886  3.686   1.00 50.58  ? 633 TRP A CD2 1 
ATOM   3738 N  NE1 . TRP A  1 633 ? 45.079  37.761  2.459   1.00 48.12  ? 633 TRP A NE1 1 
ATOM   3739 C  CE2 . TRP A  1 633 ? 45.858  37.086  3.361   1.00 48.06  ? 633 TRP A CE2 1 
ATOM   3740 C  CE3 . TRP A  1 633 ? 45.783  35.008  4.604   1.00 52.24  ? 633 TRP A CE3 1 
ATOM   3741 C  CZ2 . TRP A  1 633 ? 47.095  37.430  3.919   1.00 50.99  ? 633 TRP A CZ2 1 
ATOM   3742 C  CZ3 . TRP A  1 633 ? 47.015  35.350  5.158   1.00 49.78  ? 633 TRP A CZ3 1 
ATOM   3743 C  CH2 . TRP A  1 633 ? 47.656  36.552  4.812   1.00 51.99  ? 633 TRP A CH2 1 
ATOM   3744 N  N   . SER A  1 634 ? 40.355  33.154  3.674   1.00 57.93  ? 634 SER A N   1 
ATOM   3745 C  CA  . SER A  1 634 ? 38.923  32.868  3.500   1.00 59.50  ? 634 SER A CA  1 
ATOM   3746 C  C   . SER A  1 634 ? 38.210  32.533  4.816   1.00 62.87  ? 634 SER A C   1 
ATOM   3747 O  O   . SER A  1 634 ? 37.093  32.999  5.046   1.00 62.07  ? 634 SER A O   1 
ATOM   3748 C  CB  . SER A  1 634 ? 38.717  31.740  2.488   1.00 60.57  ? 634 SER A CB  1 
ATOM   3749 O  OG  . SER A  1 634 ? 39.352  30.547  2.910   1.00 63.95  ? 634 SER A OG  1 
ATOM   3750 N  N   . ASN A  1 635 ? 38.852  31.718  5.656   1.00 62.91  ? 635 ASN A N   1 
ATOM   3751 C  CA  . ASN A  1 635 ? 38.378  31.430  7.026   1.00 63.27  ? 635 ASN A CA  1 
ATOM   3752 C  C   . ASN A  1 635 ? 38.117  32.707  7.828   1.00 65.65  ? 635 ASN A C   1 
ATOM   3753 O  O   . ASN A  1 635 ? 37.124  32.799  8.554   1.00 70.51  ? 635 ASN A O   1 
ATOM   3754 C  CB  . ASN A  1 635 ? 39.387  30.559  7.799   1.00 60.79  ? 635 ASN A CB  1 
ATOM   3755 C  CG  . ASN A  1 635 ? 39.290  29.080  7.453   1.00 58.24  ? 635 ASN A CG  1 
ATOM   3756 O  OD1 . ASN A  1 635 ? 38.705  28.692  6.439   1.00 61.76  ? 635 ASN A OD1 1 
ATOM   3757 N  ND2 . ASN A  1 635 ? 39.875  28.244  8.303   1.00 55.74  ? 635 ASN A ND2 1 
ATOM   3758 N  N   . PHE A  1 636 ? 39.020  33.675  7.692   1.00 58.68  ? 636 PHE A N   1 
ATOM   3759 C  CA  . PHE A  1 636 ? 38.888  34.974  8.346   1.00 54.02  ? 636 PHE A CA  1 
ATOM   3760 C  C   . PHE A  1 636 ? 37.736  35.794  7.766   1.00 53.01  ? 636 PHE A C   1 
ATOM   3761 O  O   . PHE A  1 636 ? 36.973  36.410  8.512   1.00 50.89  ? 636 PHE A O   1 
ATOM   3762 C  CB  . PHE A  1 636 ? 40.192  35.764  8.233   1.00 49.98  ? 636 PHE A CB  1 
ATOM   3763 C  CG  . PHE A  1 636 ? 40.093  37.154  8.783   1.00 45.95  ? 636 PHE A CG  1 
ATOM   3764 C  CD1 . PHE A  1 636 ? 40.034  37.363  10.154  1.00 52.32  ? 636 PHE A CD1 1 
ATOM   3765 C  CD2 . PHE A  1 636 ? 40.022  38.251  7.935   1.00 47.14  ? 636 PHE A CD2 1 
ATOM   3766 C  CE1 . PHE A  1 636 ? 39.925  38.643  10.672  1.00 53.20  ? 636 PHE A CE1 1 
ATOM   3767 C  CE2 . PHE A  1 636 ? 39.913  39.534  8.446   1.00 51.35  ? 636 PHE A CE2 1 
ATOM   3768 C  CZ  . PHE A  1 636 ? 39.865  39.732  9.818   1.00 49.54  ? 636 PHE A CZ  1 
ATOM   3769 N  N   . ALA A  1 637 ? 37.623  35.804  6.439   1.00 55.41  ? 637 ALA A N   1 
ATOM   3770 C  CA  . ALA A  1 637 ? 36.542  36.517  5.748   1.00 58.24  ? 637 ALA A CA  1 
ATOM   3771 C  C   . ALA A  1 637 ? 35.161  35.964  6.102   1.00 57.29  ? 637 ALA A C   1 
ATOM   3772 O  O   . ALA A  1 637 ? 34.178  36.708  6.118   1.00 57.00  ? 637 ALA A O   1 
ATOM   3773 C  CB  . ALA A  1 637 ? 36.756  36.472  4.243   1.00 57.82  ? 637 ALA A CB  1 
ATOM   3774 N  N   . LYS A  1 638 ? 35.099  34.664  6.389   1.00 54.61  ? 638 LYS A N   1 
ATOM   3775 C  CA  . LYS A  1 638 ? 33.853  34.008  6.779   1.00 57.94  ? 638 LYS A CA  1 
ATOM   3776 C  C   . LYS A  1 638 ? 33.476  34.297  8.237   1.00 60.02  ? 638 LYS A C   1 
ATOM   3777 O  O   . LYS A  1 638 ? 32.460  34.946  8.500   1.00 60.07  ? 638 LYS A O   1 
ATOM   3778 C  CB  . LYS A  1 638 ? 33.959  32.498  6.544   1.00 58.17  ? 638 LYS A CB  1 
ATOM   3779 C  CG  . LYS A  1 638 ? 33.901  32.100  5.077   1.00 57.61  ? 638 LYS A CG  1 
ATOM   3780 C  CD  . LYS A  1 638 ? 34.286  30.643  4.870   1.00 56.75  ? 638 LYS A CD  1 
ATOM   3781 C  CE  . LYS A  1 638 ? 34.282  30.265  3.397   1.00 59.38  ? 638 LYS A CE  1 
ATOM   3782 N  NZ  . LYS A  1 638 ? 35.004  28.986  3.146   1.00 60.31  ? 638 LYS A NZ  1 
ATOM   3783 N  N   . THR A  1 639 ? 34.309  33.828  9.168   1.00 59.65  ? 639 THR A N   1 
ATOM   3784 C  CA  . THR A  1 639 ? 33.996  33.828  10.615  1.00 60.75  ? 639 THR A CA  1 
ATOM   3785 C  C   . THR A  1 639 ? 34.744  34.860  11.481  1.00 57.18  ? 639 THR A C   1 
ATOM   3786 O  O   . THR A  1 639 ? 34.476  34.960  12.681  1.00 63.01  ? 639 THR A O   1 
ATOM   3787 C  CB  . THR A  1 639 ? 34.248  32.431  11.231  1.00 64.28  ? 639 THR A CB  1 
ATOM   3788 O  OG1 . THR A  1 639 ? 35.604  32.031  10.985  1.00 62.71  ? 639 THR A OG1 1 
ATOM   3789 C  CG2 . THR A  1 639 ? 33.295  31.396  10.642  1.00 66.13  ? 639 THR A CG2 1 
ATOM   3790 N  N   . GLY A  1 640 ? 35.659  35.626  10.887  1.00 53.70  ? 640 GLY A N   1 
ATOM   3791 C  CA  . GLY A  1 640 ? 36.478  36.595  11.636  1.00 54.06  ? 640 GLY A CA  1 
ATOM   3792 C  C   . GLY A  1 640 ? 37.670  36.015  12.383  1.00 57.34  ? 640 GLY A C   1 
ATOM   3793 O  O   . GLY A  1 640 ? 38.223  36.667  13.272  1.00 55.65  ? 640 GLY A O   1 
ATOM   3794 N  N   . ASN A  1 641 ? 38.060  34.792  12.023  1.00 58.95  ? 641 ASN A N   1 
ATOM   3795 C  CA  . ASN A  1 641 ? 39.232  34.121  12.584  1.00 58.25  ? 641 ASN A CA  1 
ATOM   3796 C  C   . ASN A  1 641 ? 39.876  33.315  11.454  1.00 57.97  ? 641 ASN A C   1 
ATOM   3797 O  O   . ASN A  1 641 ? 39.198  32.481  10.847  1.00 63.74  ? 641 ASN A O   1 
ATOM   3798 C  CB  . ASN A  1 641 ? 38.810  33.192  13.734  1.00 57.19  ? 641 ASN A CB  1 
ATOM   3799 C  CG  . ASN A  1 641 ? 39.984  32.706  14.579  1.00 56.79  ? 641 ASN A CG  1 
ATOM   3800 O  OD1 . ASN A  1 641 ? 41.150  32.912  14.247  1.00 62.26  ? 641 ASN A OD1 1 
ATOM   3801 N  ND2 . ASN A  1 641 ? 39.667  32.050  15.689  1.00 58.87  ? 641 ASN A ND2 1 
ATOM   3802 N  N   . PRO A  1 642 ? 41.172  33.563  11.150  1.00 54.61  ? 642 PRO A N   1 
ATOM   3803 C  CA  . PRO A  1 642 ? 41.814  32.739  10.118  1.00 54.56  ? 642 PRO A CA  1 
ATOM   3804 C  C   . PRO A  1 642 ? 41.986  31.283  10.537  1.00 55.11  ? 642 PRO A C   1 
ATOM   3805 O  O   . PRO A  1 642 ? 41.972  30.392  9.685   1.00 56.64  ? 642 PRO A O   1 
ATOM   3806 C  CB  . PRO A  1 642 ? 43.186  33.401  9.940   1.00 58.37  ? 642 PRO A CB  1 
ATOM   3807 C  CG  . PRO A  1 642 ? 43.448  34.081  11.233  1.00 59.70  ? 642 PRO A CG  1 
ATOM   3808 C  CD  . PRO A  1 642 ? 42.106  34.575  11.682  1.00 60.21  ? 642 PRO A CD  1 
ATOM   3809 N  N   . ASN A  1 643 ? 42.138  31.063  11.840  1.00 58.60  ? 643 ASN A N   1 
ATOM   3810 C  CA  . ASN A  1 643 ? 42.316  29.728  12.412  1.00 56.88  ? 643 ASN A CA  1 
ATOM   3811 C  C   . ASN A  1 643 ? 41.188  28.765  12.034  1.00 61.61  ? 643 ASN A C   1 
ATOM   3812 O  O   . ASN A  1 643 ? 40.042  29.197  11.872  1.00 63.83  ? 643 ASN A O   1 
ATOM   3813 C  CB  . ASN A  1 643 ? 42.390  29.818  13.936  1.00 54.20  ? 643 ASN A CB  1 
ATOM   3814 C  CG  . ASN A  1 643 ? 43.604  30.583  14.413  1.00 53.62  ? 643 ASN A CG  1 
ATOM   3815 O  OD1 . ASN A  1 643 ? 44.735  30.236  14.079  1.00 56.10  ? 643 ASN A OD1 1 
ATOM   3816 N  ND2 . ASN A  1 643 ? 43.377  31.631  15.198  1.00 54.35  ? 643 ASN A ND2 1 
ATOM   3817 N  N   . PRO A  1 644 ? 41.501  27.458  11.899  1.00 67.78  ? 644 PRO A N   1 
ATOM   3818 C  CA  . PRO A  1 644 ? 40.425  26.489  11.670  1.00 69.90  ? 644 PRO A CA  1 
ATOM   3819 C  C   . PRO A  1 644 ? 39.599  26.227  12.930  1.00 74.01  ? 644 PRO A C   1 
ATOM   3820 O  O   . PRO A  1 644 ? 39.999  26.612  14.034  1.00 75.73  ? 644 PRO A O   1 
ATOM   3821 C  CB  . PRO A  1 644 ? 41.169  25.214  11.230  1.00 73.59  ? 644 PRO A CB  1 
ATOM   3822 C  CG  . PRO A  1 644 ? 42.602  25.597  11.067  1.00 76.50  ? 644 PRO A CG  1 
ATOM   3823 C  CD  . PRO A  1 644 ? 42.816  26.795  11.931  1.00 72.60  ? 644 PRO A CD  1 
ATOM   3824 N  N   . ASN A  1 645 ? 38.455  25.573  12.747  1.00 78.60  ? 645 ASN A N   1 
ATOM   3825 C  CA  . ASN A  1 645 ? 37.543  25.262  13.852  1.00 84.24  ? 645 ASN A CA  1 
ATOM   3826 C  C   . ASN A  1 645 ? 38.206  24.265  14.810  1.00 85.80  ? 645 ASN A C   1 
ATOM   3827 O  O   . ASN A  1 645 ? 38.253  24.495  16.022  1.00 78.30  ? 645 ASN A O   1 
ATOM   3828 C  CB  . ASN A  1 645 ? 36.212  24.705  13.318  1.00 85.18  ? 645 ASN A CB  1 
ATOM   3829 C  CG  . ASN A  1 645 ? 35.032  25.025  14.225  1.00 88.46  ? 645 ASN A CG  1 
ATOM   3830 O  OD1 . ASN A  1 645 ? 34.754  26.191  14.515  1.00 88.88  ? 645 ASN A OD1 1 
ATOM   3831 N  ND2 . ASN A  1 645 ? 34.322  23.991  14.661  1.00 91.16  ? 645 ASN A ND2 1 
ATOM   3832 N  N   . THR A  1 646 ? 38.716  23.172  14.242  1.00 94.26  ? 646 THR A N   1 
ATOM   3833 C  CA  . THR A  1 646 ? 39.524  22.182  14.962  1.00 97.57  ? 646 THR A CA  1 
ATOM   3834 C  C   . THR A  1 646 ? 40.956  22.229  14.426  1.00 99.44  ? 646 THR A C   1 
ATOM   3835 O  O   . THR A  1 646 ? 41.187  21.937  13.247  1.00 97.99  ? 646 THR A O   1 
ATOM   3836 C  CB  . THR A  1 646 ? 38.958  20.758  14.792  1.00 96.17  ? 646 THR A CB  1 
ATOM   3837 O  OG1 . THR A  1 646 ? 38.873  20.432  13.399  1.00 90.24  ? 646 THR A OG1 1 
ATOM   3838 C  CG2 . THR A  1 646 ? 37.572  20.650  15.425  1.00 91.54  ? 646 THR A CG2 1 
ATOM   3839 N  N   . ALA A  1 647 ? 41.900  22.599  15.294  1.00 101.00 ? 647 ALA A N   1 
ATOM   3840 C  CA  . ALA A  1 647 ? 43.302  22.834  14.917  1.00 105.16 ? 647 ALA A CA  1 
ATOM   3841 C  C   . ALA A  1 647 ? 43.955  21.660  14.180  1.00 111.54 ? 647 ALA A C   1 
ATOM   3842 O  O   . ALA A  1 647 ? 43.578  20.500  14.377  1.00 112.29 ? 647 ALA A O   1 
ATOM   3843 C  CB  . ALA A  1 647 ? 44.122  23.190  16.149  1.00 102.41 ? 647 ALA A CB  1 
ATOM   3844 N  N   . SER A  1 648 ? 44.936  21.986  13.340  1.00 109.82 ? 648 SER A N   1 
ATOM   3845 C  CA  . SER A  1 648 ? 45.664  21.004  12.527  1.00 104.98 ? 648 SER A CA  1 
ATOM   3846 C  C   . SER A  1 648 ? 47.171  21.284  12.527  1.00 89.81  ? 648 SER A C   1 
ATOM   3847 O  O   . SER A  1 648 ? 47.612  22.376  12.891  1.00 78.09  ? 648 SER A O   1 
ATOM   3848 C  CB  . SER A  1 648 ? 45.131  21.012  11.089  1.00 104.94 ? 648 SER A CB  1 
ATOM   3849 O  OG  . SER A  1 648 ? 43.776  20.590  11.044  1.00 106.76 ? 648 SER A OG  1 
ATOM   3850 N  N   . SER A  1 649 ? 47.946  20.279  12.129  1.00 86.92  ? 649 SER A N   1 
ATOM   3851 C  CA  . SER A  1 649 ? 49.396  20.417  11.930  1.00 85.47  ? 649 SER A CA  1 
ATOM   3852 C  C   . SER A  1 649 ? 49.683  21.118  10.600  1.00 88.47  ? 649 SER A C   1 
ATOM   3853 O  O   . SER A  1 649 ? 50.633  21.897  10.487  1.00 78.40  ? 649 SER A O   1 
ATOM   3854 C  CB  . SER A  1 649 ? 50.077  19.046  11.960  1.00 85.01  ? 649 SER A CB  1 
ATOM   3855 O  OG  . SER A  1 649 ? 49.520  18.174  10.991  1.00 87.38  ? 649 SER A OG  1 
ATOM   3856 N  N   . GLU A  1 650 ? 48.856  20.815  9.600   1.00 94.95  ? 650 GLU A N   1 
ATOM   3857 C  CA  . GLU A  1 650 ? 48.869  21.490  8.296   1.00 98.82  ? 650 GLU A CA  1 
ATOM   3858 C  C   . GLU A  1 650 ? 48.507  22.977  8.391   1.00 93.90  ? 650 GLU A C   1 
ATOM   3859 O  O   . GLU A  1 650 ? 49.015  23.793  7.618   1.00 106.42 ? 650 GLU A O   1 
ATOM   3860 C  CB  . GLU A  1 650 ? 47.881  20.808  7.347   1.00 109.37 ? 650 GLU A CB  1 
ATOM   3861 C  CG  . GLU A  1 650 ? 48.234  19.372  6.981   1.00 121.09 ? 650 GLU A CG  1 
ATOM   3862 C  CD  . GLU A  1 650 ? 47.120  18.657  6.236   1.00 123.35 ? 650 GLU A CD  1 
ATOM   3863 O  OE1 . GLU A  1 650 ? 47.105  17.408  6.256   1.00 125.47 ? 650 GLU A OE1 1 
ATOM   3864 O  OE2 . GLU A  1 650 ? 46.258  19.332  5.631   1.00 126.21 ? 650 GLU A OE2 1 
ATOM   3865 N  N   . PHE A  1 651 ? 47.623  23.304  9.334   1.00 86.48  ? 651 PHE A N   1 
ATOM   3866 C  CA  . PHE A  1 651 ? 47.177  24.678  9.602   1.00 79.76  ? 651 PHE A CA  1 
ATOM   3867 C  C   . PHE A  1 651 ? 47.496  25.067  11.054  1.00 71.18  ? 651 PHE A C   1 
ATOM   3868 O  O   . PHE A  1 651 ? 46.629  24.948  11.927  1.00 72.50  ? 651 PHE A O   1 
ATOM   3869 C  CB  . PHE A  1 651 ? 45.667  24.807  9.358   1.00 83.10  ? 651 PHE A CB  1 
ATOM   3870 C  CG  . PHE A  1 651 ? 45.263  24.635  7.921   1.00 84.34  ? 651 PHE A CG  1 
ATOM   3871 C  CD1 . PHE A  1 651 ? 45.325  25.708  7.036   1.00 86.97  ? 651 PHE A CD1 1 
ATOM   3872 C  CD2 . PHE A  1 651 ? 44.806  23.406  7.451   1.00 83.23  ? 651 PHE A CD2 1 
ATOM   3873 C  CE1 . PHE A  1 651 ? 44.949  25.554  5.708   1.00 87.37  ? 651 PHE A CE1 1 
ATOM   3874 C  CE2 . PHE A  1 651 ? 44.427  23.248  6.122   1.00 82.78  ? 651 PHE A CE2 1 
ATOM   3875 C  CZ  . PHE A  1 651 ? 44.499  24.323  5.249   1.00 80.99  ? 651 PHE A CZ  1 
ATOM   3876 N  N   . PRO A  1 652 ? 48.739  25.527  11.323  1.00 64.57  ? 652 PRO A N   1 
ATOM   3877 C  CA  . PRO A  1 652 ? 49.141  25.976  12.668  1.00 66.27  ? 652 PRO A CA  1 
ATOM   3878 C  C   . PRO A  1 652 ? 48.286  27.097  13.274  1.00 63.94  ? 652 PRO A C   1 
ATOM   3879 O  O   . PRO A  1 652 ? 47.518  27.758  12.565  1.00 57.84  ? 652 PRO A O   1 
ATOM   3880 C  CB  . PRO A  1 652 ? 50.576  26.470  12.458  1.00 64.12  ? 652 PRO A CB  1 
ATOM   3881 C  CG  . PRO A  1 652 ? 51.072  25.712  11.283  1.00 61.16  ? 652 PRO A CG  1 
ATOM   3882 C  CD  . PRO A  1 652 ? 49.888  25.493  10.398  1.00 62.99  ? 652 PRO A CD  1 
ATOM   3883 N  N   . GLU A  1 653 ? 48.438  27.298  14.582  1.00 68.81  ? 653 GLU A N   1 
ATOM   3884 C  CA  . GLU A  1 653 ? 47.688  28.324  15.306  1.00 70.92  ? 653 GLU A CA  1 
ATOM   3885 C  C   . GLU A  1 653 ? 48.207  29.718  14.967  1.00 70.74  ? 653 GLU A C   1 
ATOM   3886 O  O   . GLU A  1 653 ? 49.399  30.000  15.100  1.00 76.19  ? 653 GLU A O   1 
ATOM   3887 C  CB  . GLU A  1 653 ? 47.766  28.119  16.822  1.00 74.72  ? 653 GLU A CB  1 
ATOM   3888 C  CG  . GLU A  1 653 ? 46.675  28.870  17.589  1.00 84.76  ? 653 GLU A CG  1 
ATOM   3889 C  CD  . GLU A  1 653 ? 47.096  29.316  18.981  1.00 97.25  ? 653 GLU A CD  1 
ATOM   3890 O  OE1 . GLU A  1 653 ? 47.890  28.608  19.636  1.00 109.38 ? 653 GLU A OE1 1 
ATOM   3891 O  OE2 . GLU A  1 653 ? 46.619  30.382  19.427  1.00 98.73  ? 653 GLU A OE2 1 
ATOM   3892 N  N   . TRP A  1 654 ? 47.293  30.561  14.503  1.00 63.37  ? 654 TRP A N   1 
ATOM   3893 C  CA  . TRP A  1 654 ? 47.509  31.991  14.366  1.00 59.43  ? 654 TRP A CA  1 
ATOM   3894 C  C   . TRP A  1 654 ? 46.892  32.662  15.608  1.00 62.51  ? 654 TRP A C   1 
ATOM   3895 O  O   . TRP A  1 654 ? 45.672  32.839  15.670  1.00 58.64  ? 654 TRP A O   1 
ATOM   3896 C  CB  . TRP A  1 654 ? 46.847  32.478  13.070  1.00 54.82  ? 654 TRP A CB  1 
ATOM   3897 C  CG  . TRP A  1 654 ? 47.295  33.828  12.578  1.00 58.29  ? 654 TRP A CG  1 
ATOM   3898 C  CD1 . TRP A  1 654 ? 47.800  34.859  13.322  1.00 60.15  ? 654 TRP A CD1 1 
ATOM   3899 C  CD2 . TRP A  1 654 ? 47.236  34.302  11.229  1.00 59.15  ? 654 TRP A CD2 1 
ATOM   3900 N  NE1 . TRP A  1 654 ? 48.075  35.935  12.518  1.00 57.40  ? 654 TRP A NE1 1 
ATOM   3901 C  CE2 . TRP A  1 654 ? 47.739  35.621  11.228  1.00 55.84  ? 654 TRP A CE2 1 
ATOM   3902 C  CE3 . TRP A  1 654 ? 46.817  33.737  10.017  1.00 54.12  ? 654 TRP A CE3 1 
ATOM   3903 C  CZ2 . TRP A  1 654 ? 47.826  36.387  10.068  1.00 54.62  ? 654 TRP A CZ2 1 
ATOM   3904 C  CZ3 . TRP A  1 654 ? 46.909  34.500  8.859   1.00 52.88  ? 654 TRP A CZ3 1 
ATOM   3905 C  CH2 . TRP A  1 654 ? 47.412  35.811  8.895   1.00 55.34  ? 654 TRP A CH2 1 
ATOM   3906 N  N   . PRO A  1 655 ? 47.727  33.020  16.613  1.00 61.49  ? 655 PRO A N   1 
ATOM   3907 C  CA  . PRO A  1 655 ? 47.173  33.697  17.788  1.00 60.05  ? 655 PRO A CA  1 
ATOM   3908 C  C   . PRO A  1 655 ? 46.810  35.149  17.507  1.00 63.29  ? 655 PRO A C   1 
ATOM   3909 O  O   . PRO A  1 655 ? 47.313  35.748  16.554  1.00 66.87  ? 655 PRO A O   1 
ATOM   3910 C  CB  . PRO A  1 655 ? 48.311  33.620  18.809  1.00 58.12  ? 655 PRO A CB  1 
ATOM   3911 C  CG  . PRO A  1 655 ? 49.543  33.580  17.985  1.00 58.47  ? 655 PRO A CG  1 
ATOM   3912 C  CD  . PRO A  1 655 ? 49.182  32.815  16.745  1.00 61.57  ? 655 PRO A CD  1 
ATOM   3913 N  N   . LYS A  1 656 ? 45.941  35.698  18.348  1.00 64.93  ? 656 LYS A N   1 
ATOM   3914 C  CA  . LYS A  1 656 ? 45.499  37.080  18.216  1.00 61.19  ? 656 LYS A CA  1 
ATOM   3915 C  C   . LYS A  1 656 ? 46.669  38.028  18.483  1.00 60.22  ? 656 LYS A C   1 
ATOM   3916 O  O   . LYS A  1 656 ? 47.447  37.814  19.419  1.00 63.65  ? 656 LYS A O   1 
ATOM   3917 C  CB  . LYS A  1 656 ? 44.362  37.387  19.199  1.00 61.41  ? 656 LYS A CB  1 
ATOM   3918 C  CG  . LYS A  1 656 ? 43.088  36.570  19.000  1.00 61.98  ? 656 LYS A CG  1 
ATOM   3919 C  CD  . LYS A  1 656 ? 42.159  36.684  20.206  1.00 64.30  ? 656 LYS A CD  1 
ATOM   3920 C  CE  . LYS A  1 656 ? 41.121  35.571  20.247  1.00 68.28  ? 656 LYS A CE  1 
ATOM   3921 N  NZ  . LYS A  1 656 ? 40.486  35.447  21.589  1.00 67.02  ? 656 LYS A NZ  1 
ATOM   3922 N  N   . HIS A  1 657 ? 46.803  39.053  17.643  1.00 60.25  ? 657 HIS A N   1 
ATOM   3923 C  CA  . HIS A  1 657 ? 47.711  40.168  17.908  1.00 61.80  ? 657 HIS A CA  1 
ATOM   3924 C  C   . HIS A  1 657 ? 47.058  41.056  18.964  1.00 57.57  ? 657 HIS A C   1 
ATOM   3925 O  O   . HIS A  1 657 ? 46.372  42.033  18.650  1.00 54.87  ? 657 HIS A O   1 
ATOM   3926 C  CB  . HIS A  1 657 ? 48.021  40.958  16.633  1.00 63.06  ? 657 HIS A CB  1 
ATOM   3927 C  CG  . HIS A  1 657 ? 48.994  42.079  16.838  1.00 59.97  ? 657 HIS A CG  1 
ATOM   3928 N  ND1 . HIS A  1 657 ? 50.353  41.925  16.670  1.00 59.90  ? 657 HIS A ND1 1 
ATOM   3929 C  CD2 . HIS A  1 657 ? 48.804  43.371  17.201  1.00 63.24  ? 657 HIS A CD2 1 
ATOM   3930 C  CE1 . HIS A  1 657 ? 50.958  43.074  16.915  1.00 66.15  ? 657 HIS A CE1 1 
ATOM   3931 N  NE2 . HIS A  1 657 ? 50.041  43.966  17.244  1.00 67.85  ? 657 HIS A NE2 1 
ATOM   3932 N  N   . THR A  1 658 ? 47.264  40.679  20.219  1.00 56.10  ? 658 THR A N   1 
ATOM   3933 C  CA  . THR A  1 658 ? 46.690  41.408  21.351  1.00 54.11  ? 658 THR A CA  1 
ATOM   3934 C  C   . THR A  1 658 ? 47.570  42.615  21.700  1.00 50.36  ? 658 THR A C   1 
ATOM   3935 O  O   . THR A  1 658 ? 48.753  42.654  21.353  1.00 46.96  ? 658 THR A O   1 
ATOM   3936 C  CB  . THR A  1 658 ? 46.416  40.484  22.570  1.00 53.84  ? 658 THR A CB  1 
ATOM   3937 O  OG1 . THR A  1 658 ? 45.783  41.237  23.614  1.00 71.91  ? 658 THR A OG1 1 
ATOM   3938 C  CG2 . THR A  1 658 ? 47.677  39.825  23.119  1.00 55.68  ? 658 THR A CG2 1 
ATOM   3939 N  N   . ALA A  1 659 ? 46.969  43.600  22.364  1.00 50.75  ? 659 ALA A N   1 
ATOM   3940 C  CA  . ALA A  1 659 ? 47.639  44.863  22.700  1.00 54.21  ? 659 ALA A CA  1 
ATOM   3941 C  C   . ALA A  1 659 ? 48.857  44.684  23.612  1.00 54.85  ? 659 ALA A C   1 
ATOM   3942 O  O   . ALA A  1 659 ? 49.905  45.292  23.382  1.00 48.12  ? 659 ALA A O   1 
ATOM   3943 C  CB  . ALA A  1 659 ? 46.645  45.813  23.346  1.00 55.07  ? 659 ALA A CB  1 
ATOM   3944 N  N   . HIS A  1 660 ? 48.700  43.855  24.643  1.00 66.08  ? 660 HIS A N   1 
ATOM   3945 C  CA  . HIS A  1 660 ? 49.774  43.574  25.617  1.00 74.13  ? 660 HIS A CA  1 
ATOM   3946 C  C   . HIS A  1 660 ? 50.877  42.635  25.089  1.00 63.39  ? 660 HIS A C   1 
ATOM   3947 O  O   . HIS A  1 660 ? 52.027  42.703  25.538  1.00 63.02  ? 660 HIS A O   1 
ATOM   3948 C  CB  . HIS A  1 660 ? 49.187  43.045  26.947  1.00 83.30  ? 660 HIS A CB  1 
ATOM   3949 C  CG  . HIS A  1 660 ? 48.499  41.712  26.845  1.00 89.37  ? 660 HIS A CG  1 
ATOM   3950 N  ND1 . HIS A  1 660 ? 47.155  41.585  26.566  1.00 86.91  ? 660 HIS A ND1 1 
ATOM   3951 C  CD2 . HIS A  1 660 ? 48.967  40.452  27.015  1.00 89.85  ? 660 HIS A CD2 1 
ATOM   3952 C  CE1 . HIS A  1 660 ? 46.827  40.305  26.554  1.00 80.53  ? 660 HIS A CE1 1 
ATOM   3953 N  NE2 . HIS A  1 660 ? 47.909  39.596  26.822  1.00 81.80  ? 660 HIS A NE2 1 
ATOM   3954 N  N   . GLY A  1 661 ? 50.518  41.789  24.124  1.00 60.10  ? 661 GLY A N   1 
ATOM   3955 C  CA  . GLY A  1 661 ? 51.381  40.713  23.606  1.00 67.17  ? 661 GLY A CA  1 
ATOM   3956 C  C   . GLY A  1 661 ? 52.030  40.995  22.260  1.00 70.74  ? 661 GLY A C   1 
ATOM   3957 O  O   . GLY A  1 661 ? 53.177  40.607  22.033  1.00 76.05  ? 661 GLY A O   1 
ATOM   3958 N  N   . ARG A  1 662 ? 51.286  41.650  21.368  1.00 67.74  ? 662 ARG A N   1 
ATOM   3959 C  CA  . ARG A  1 662 ? 51.766  42.057  20.041  1.00 63.06  ? 662 ARG A CA  1 
ATOM   3960 C  C   . ARG A  1 662 ? 52.281  40.877  19.187  1.00 65.39  ? 662 ARG A C   1 
ATOM   3961 O  O   . ARG A  1 662 ? 53.223  41.032  18.406  1.00 71.70  ? 662 ARG A O   1 
ATOM   3962 C  CB  . ARG A  1 662 ? 52.840  43.155  20.168  1.00 61.95  ? 662 ARG A CB  1 
ATOM   3963 C  CG  . ARG A  1 662 ? 52.411  44.396  20.946  1.00 60.95  ? 662 ARG A CG  1 
ATOM   3964 C  CD  . ARG A  1 662 ? 53.572  45.374  21.079  1.00 61.66  ? 662 ARG A CD  1 
ATOM   3965 N  NE  . ARG A  1 662 ? 53.315  46.485  22.004  1.00 69.20  ? 662 ARG A NE  1 
ATOM   3966 C  CZ  . ARG A  1 662 ? 53.415  46.439  23.338  1.00 73.67  ? 662 ARG A CZ  1 
ATOM   3967 N  NH1 . ARG A  1 662 ? 53.750  45.318  23.980  1.00 75.07  ? 662 ARG A NH1 1 
ATOM   3968 N  NH2 . ARG A  1 662 ? 53.163  47.537  24.049  1.00 69.82  ? 662 ARG A NH2 1 
ATOM   3969 N  N   . HIS A  1 663 ? 51.648  39.712  19.336  1.00 65.38  ? 663 HIS A N   1 
ATOM   3970 C  CA  . HIS A  1 663 ? 52.066  38.489  18.636  1.00 66.24  ? 663 HIS A CA  1 
ATOM   3971 C  C   . HIS A  1 663 ? 51.837  38.563  17.123  1.00 61.78  ? 663 HIS A C   1 
ATOM   3972 O  O   . HIS A  1 663 ? 50.983  39.315  16.652  1.00 63.10  ? 663 HIS A O   1 
ATOM   3973 C  CB  . HIS A  1 663 ? 51.315  37.262  19.182  1.00 68.93  ? 663 HIS A CB  1 
ATOM   3974 C  CG  . HIS A  1 663 ? 51.856  36.738  20.477  1.00 64.22  ? 663 HIS A CG  1 
ATOM   3975 N  ND1 . HIS A  1 663 ? 53.095  36.144  20.582  1.00 61.11  ? 663 HIS A ND1 1 
ATOM   3976 C  CD2 . HIS A  1 663 ? 51.312  36.693  21.717  1.00 65.51  ? 663 HIS A CD2 1 
ATOM   3977 C  CE1 . HIS A  1 663 ? 53.299  35.772  21.834  1.00 65.17  ? 663 HIS A CE1 1 
ATOM   3978 N  NE2 . HIS A  1 663 ? 52.232  36.093  22.543  1.00 66.14  ? 663 HIS A NE2 1 
ATOM   3979 N  N   . TYR A  1 664 ? 52.612  37.774  16.378  1.00 59.84  ? 664 TYR A N   1 
ATOM   3980 C  CA  . TYR A  1 664 ? 52.364  37.540  14.947  1.00 59.30  ? 664 TYR A CA  1 
ATOM   3981 C  C   . TYR A  1 664 ? 52.800  36.137  14.527  1.00 57.32  ? 664 TYR A C   1 
ATOM   3982 O  O   . TYR A  1 664 ? 53.750  35.584  15.081  1.00 57.98  ? 664 TYR A O   1 
ATOM   3983 C  CB  . TYR A  1 664 ? 53.061  38.588  14.066  1.00 56.31  ? 664 TYR A CB  1 
ATOM   3984 C  CG  . TYR A  1 664 ? 54.569  38.463  14.004  1.00 54.35  ? 664 TYR A CG  1 
ATOM   3985 C  CD1 . TYR A  1 664 ? 55.188  37.641  13.058  1.00 52.93  ? 664 TYR A CD1 1 
ATOM   3986 C  CD2 . TYR A  1 664 ? 55.376  39.170  14.887  1.00 56.59  ? 664 TYR A CD2 1 
ATOM   3987 C  CE1 . TYR A  1 664 ? 56.571  37.524  13.005  1.00 54.67  ? 664 TYR A CE1 1 
ATOM   3988 C  CE2 . TYR A  1 664 ? 56.759  39.065  14.841  1.00 55.89  ? 664 TYR A CE2 1 
ATOM   3989 C  CZ  . TYR A  1 664 ? 57.353  38.241  13.900  1.00 52.13  ? 664 TYR A CZ  1 
ATOM   3990 O  OH  . TYR A  1 664 ? 58.725  38.137  13.854  1.00 47.70  ? 664 TYR A OH  1 
ATOM   3991 N  N   . LEU A  1 665 ? 52.105  35.590  13.532  1.00 56.98  ? 665 LEU A N   1 
ATOM   3992 C  CA  . LEU A  1 665 ? 52.443  34.303  12.922  1.00 58.59  ? 665 LEU A CA  1 
ATOM   3993 C  C   . LEU A  1 665 ? 53.334  34.529  11.705  1.00 66.41  ? 665 LEU A C   1 
ATOM   3994 O  O   . LEU A  1 665 ? 52.966  35.282  10.804  1.00 76.98  ? 665 LEU A O   1 
ATOM   3995 C  CB  . LEU A  1 665 ? 51.163  33.585  12.482  1.00 54.50  ? 665 LEU A CB  1 
ATOM   3996 C  CG  . LEU A  1 665 ? 51.292  32.365  11.557  1.00 53.19  ? 665 LEU A CG  1 
ATOM   3997 C  CD1 . LEU A  1 665 ? 51.986  31.210  12.259  1.00 55.78  ? 665 LEU A CD1 1 
ATOM   3998 C  CD2 . LEU A  1 665 ? 49.921  31.941  11.062  1.00 57.55  ? 665 LEU A CD2 1 
ATOM   3999 N  N   . GLU A  1 666 ? 54.489  33.868  11.668  1.00 61.03  ? 666 GLU A N   1 
ATOM   4000 C  CA  . GLU A  1 666 ? 55.327  33.871  10.467  1.00 61.37  ? 666 GLU A CA  1 
ATOM   4001 C  C   . GLU A  1 666 ? 54.668  32.996  9.398   1.00 61.27  ? 666 GLU A C   1 
ATOM   4002 O  O   . GLU A  1 666 ? 54.253  31.871  9.685   1.00 63.64  ? 666 GLU A O   1 
ATOM   4003 C  CB  . GLU A  1 666 ? 56.739  33.356  10.770  1.00 65.31  ? 666 GLU A CB  1 
ATOM   4004 C  CG  . GLU A  1 666 ? 57.728  33.561  9.623   1.00 66.35  ? 666 GLU A CG  1 
ATOM   4005 C  CD  . GLU A  1 666 ? 59.095  32.946  9.875   1.00 62.74  ? 666 GLU A CD  1 
ATOM   4006 O  OE1 . GLU A  1 666 ? 59.485  32.779  11.050  1.00 62.10  ? 666 GLU A OE1 1 
ATOM   4007 O  OE2 . GLU A  1 666 ? 59.790  32.635  8.883   1.00 60.88  ? 666 GLU A OE2 1 
ATOM   4008 N  N   . LEU A  1 667 ? 54.568  33.530  8.179   1.00 58.25  ? 667 LEU A N   1 
ATOM   4009 C  CA  . LEU A  1 667 ? 54.044  32.791  7.025   1.00 56.56  ? 667 LEU A CA  1 
ATOM   4010 C  C   . LEU A  1 667 ? 55.184  32.409  6.088   1.00 56.08  ? 667 LEU A C   1 
ATOM   4011 O  O   . LEU A  1 667 ? 55.695  33.244  5.336   1.00 53.78  ? 667 LEU A O   1 
ATOM   4012 C  CB  . LEU A  1 667 ? 52.994  33.612  6.269   1.00 54.63  ? 667 LEU A CB  1 
ATOM   4013 C  CG  . LEU A  1 667 ? 51.698  33.954  7.010   1.00 51.36  ? 667 LEU A CG  1 
ATOM   4014 C  CD1 . LEU A  1 667 ? 50.816  34.835  6.139   1.00 49.54  ? 667 LEU A CD1 1 
ATOM   4015 C  CD2 . LEU A  1 667 ? 50.934  32.706  7.429   1.00 54.00  ? 667 LEU A CD2 1 
ATOM   4016 N  N   . GLY A  1 668 ? 55.580  31.140  6.159   1.00 62.78  ? 668 GLY A N   1 
ATOM   4017 C  CA  . GLY A  1 668 ? 56.599  30.564  5.278   1.00 62.73  ? 668 GLY A CA  1 
ATOM   4018 C  C   . GLY A  1 668 ? 56.360  29.081  5.062   1.00 66.05  ? 668 GLY A C   1 
ATOM   4019 O  O   . GLY A  1 668 ? 55.382  28.518  5.563   1.00 71.46  ? 668 GLY A O   1 
ATOM   4020 N  N   . LEU A  1 669 ? 57.268  28.453  4.319   1.00 67.85  ? 669 LEU A N   1 
ATOM   4021 C  CA  . LEU A  1 669 ? 57.131  27.051  3.898   1.00 66.38  ? 669 LEU A CA  1 
ATOM   4022 C  C   . LEU A  1 669 ? 57.053  26.066  5.056   1.00 70.21  ? 669 LEU A C   1 
ATOM   4023 O  O   . LEU A  1 669 ? 56.075  25.327  5.197   1.00 76.89  ? 669 LEU A O   1 
ATOM   4024 C  CB  . LEU A  1 669 ? 58.319  26.644  3.020   1.00 65.91  ? 669 LEU A CB  1 
ATOM   4025 C  CG  . LEU A  1 669 ? 58.457  27.287  1.642   1.00 71.33  ? 669 LEU A CG  1 
ATOM   4026 C  CD1 . LEU A  1 669 ? 59.813  26.913  1.060   1.00 77.29  ? 669 LEU A CD1 1 
ATOM   4027 C  CD2 . LEU A  1 669 ? 57.327  26.859  0.715   1.00 67.01  ? 669 LEU A CD2 1 
ATOM   4028 N  N   . ASN A  1 670 ? 58.099  26.081  5.875   1.00 69.13  ? 670 ASN A N   1 
ATOM   4029 C  CA  . ASN A  1 670 ? 58.360  25.043  6.867   1.00 70.84  ? 670 ASN A CA  1 
ATOM   4030 C  C   . ASN A  1 670 ? 58.510  25.729  8.215   1.00 65.64  ? 670 ASN A C   1 
ATOM   4031 O  O   . ASN A  1 670 ? 59.564  25.666  8.858   1.00 66.34  ? 670 ASN A O   1 
ATOM   4032 C  CB  . ASN A  1 670 ? 59.634  24.279  6.480   1.00 79.30  ? 670 ASN A CB  1 
ATOM   4033 C  CG  . ASN A  1 670 ? 59.947  23.106  7.406   1.00 88.73  ? 670 ASN A CG  1 
ATOM   4034 O  OD1 . ASN A  1 670 ? 59.126  22.692  8.231   1.00 92.12  ? 670 ASN A OD1 1 
ATOM   4035 N  ND2 . ASN A  1 670 ? 61.158  22.566  7.263   1.00 98.36  ? 670 ASN A ND2 1 
ATOM   4036 N  N   . THR A  1 671 ? 57.443  26.397  8.631   1.00 62.06  ? 671 THR A N   1 
ATOM   4037 C  CA  . THR A  1 671 ? 57.439  27.088  9.907   1.00 55.44  ? 671 THR A CA  1 
ATOM   4038 C  C   . THR A  1 671 ? 56.036  27.419  10.391  1.00 51.77  ? 671 THR A C   1 
ATOM   4039 O  O   . THR A  1 671 ? 55.067  27.435  9.628   1.00 49.48  ? 671 THR A O   1 
ATOM   4040 C  CB  . THR A  1 671 ? 58.285  28.388  9.860   1.00 55.15  ? 671 THR A CB  1 
ATOM   4041 O  OG1 . THR A  1 671 ? 58.331  28.988  11.161  1.00 60.18  ? 671 THR A OG1 1 
ATOM   4042 C  CG2 . THR A  1 671 ? 57.724  29.398  8.855   1.00 56.14  ? 671 THR A CG2 1 
ATOM   4043 N  N   . SER A  1 672 ? 55.974  27.673  11.689  1.00 56.64  ? 672 SER A N   1 
ATOM   4044 C  CA  . SER A  1 672 ? 54.795  28.210  12.355  1.00 56.44  ? 672 SER A CA  1 
ATOM   4045 C  C   . SER A  1 672 ? 55.254  29.054  13.551  1.00 55.52  ? 672 SER A C   1 
ATOM   4046 O  O   . SER A  1 672 ? 54.627  29.055  14.617  1.00 57.86  ? 672 SER A O   1 
ATOM   4047 C  CB  . SER A  1 672 ? 53.882  27.068  12.793  1.00 54.34  ? 672 SER A CB  1 
ATOM   4048 O  OG  . SER A  1 672 ? 54.551  26.183  13.676  1.00 57.46  ? 672 SER A OG  1 
ATOM   4049 N  N   . PHE A  1 673 ? 56.351  29.784  13.338  1.00 54.42  ? 673 PHE A N   1 
ATOM   4050 C  CA  . PHE A  1 673 ? 57.032  30.551  14.377  1.00 56.20  ? 673 PHE A CA  1 
ATOM   4051 C  C   . PHE A  1 673 ? 56.173  31.750  14.763  1.00 59.81  ? 673 PHE A C   1 
ATOM   4052 O  O   . PHE A  1 673 ? 55.856  32.587  13.911  1.00 74.47  ? 673 PHE A O   1 
ATOM   4053 C  CB  . PHE A  1 673 ? 58.413  31.004  13.863  1.00 54.32  ? 673 PHE A CB  1 
ATOM   4054 C  CG  . PHE A  1 673 ? 59.067  32.083  14.691  1.00 54.60  ? 673 PHE A CG  1 
ATOM   4055 C  CD1 . PHE A  1 673 ? 59.714  31.774  15.884  1.00 55.56  ? 673 PHE A CD1 1 
ATOM   4056 C  CD2 . PHE A  1 673 ? 59.056  33.411  14.263  1.00 53.32  ? 673 PHE A CD2 1 
ATOM   4057 C  CE1 . PHE A  1 673 ? 60.324  32.769  16.641  1.00 54.27  ? 673 PHE A CE1 1 
ATOM   4058 C  CE2 . PHE A  1 673 ? 59.663  34.408  15.016  1.00 52.43  ? 673 PHE A CE2 1 
ATOM   4059 C  CZ  . PHE A  1 673 ? 60.298  34.087  16.206  1.00 49.71  ? 673 PHE A CZ  1 
ATOM   4060 N  N   . VAL A  1 674 ? 55.788  31.812  16.037  1.00 56.03  ? 674 VAL A N   1 
ATOM   4061 C  CA  . VAL A  1 674 ? 55.045  32.950  16.573  1.00 56.59  ? 674 VAL A CA  1 
ATOM   4062 C  C   . VAL A  1 674 ? 56.033  33.913  17.222  1.00 51.79  ? 674 VAL A C   1 
ATOM   4063 O  O   . VAL A  1 674 ? 56.657  33.578  18.232  1.00 55.01  ? 674 VAL A O   1 
ATOM   4064 C  CB  . VAL A  1 674 ? 53.977  32.518  17.599  1.00 58.76  ? 674 VAL A CB  1 
ATOM   4065 C  CG1 . VAL A  1 674 ? 53.235  33.728  18.163  1.00 54.96  ? 674 VAL A CG1 1 
ATOM   4066 C  CG2 . VAL A  1 674 ? 52.993  31.546  16.959  1.00 59.08  ? 674 VAL A CG2 1 
ATOM   4067 N  N   . GLY A  1 675 ? 56.165  35.100  16.636  1.00 47.95  ? 675 GLY A N   1 
ATOM   4068 C  CA  . GLY A  1 675 ? 57.038  36.145  17.167  1.00 47.02  ? 675 GLY A CA  1 
ATOM   4069 C  C   . GLY A  1 675 ? 56.232  37.196  17.897  1.00 46.32  ? 675 GLY A C   1 
ATOM   4070 O  O   . GLY A  1 675 ? 55.055  36.989  18.202  1.00 50.06  ? 675 GLY A O   1 
ATOM   4071 N  N   . ARG A  1 676 ? 56.885  38.317  18.186  1.00 48.72  ? 676 ARG A N   1 
ATOM   4072 C  CA  . ARG A  1 676 ? 56.242  39.484  18.785  1.00 51.92  ? 676 ARG A CA  1 
ATOM   4073 C  C   . ARG A  1 676 ? 56.692  40.738  18.039  1.00 50.17  ? 676 ARG A C   1 
ATOM   4074 O  O   . ARG A  1 676 ? 57.877  41.082  18.054  1.00 52.55  ? 676 ARG A O   1 
ATOM   4075 C  CB  . ARG A  1 676 ? 56.580  39.588  20.276  1.00 60.23  ? 676 ARG A CB  1 
ATOM   4076 C  CG  . ARG A  1 676 ? 55.813  38.590  21.135  1.00 69.62  ? 676 ARG A CG  1 
ATOM   4077 C  CD  . ARG A  1 676 ? 56.082  38.732  22.629  1.00 74.67  ? 676 ARG A CD  1 
ATOM   4078 N  NE  . ARG A  1 676 ? 55.473  39.936  23.207  1.00 82.05  ? 676 ARG A NE  1 
ATOM   4079 C  CZ  . ARG A  1 676 ? 55.198  40.128  24.502  1.00 90.54  ? 676 ARG A CZ  1 
ATOM   4080 N  NH1 . ARG A  1 676 ? 55.464  39.196  25.419  1.00 98.69  ? 676 ARG A NH1 1 
ATOM   4081 N  NH2 . ARG A  1 676 ? 54.646  41.277  24.889  1.00 89.62  ? 676 ARG A NH2 1 
ATOM   4082 N  N   . GLY A  1 677 ? 55.738  41.402  17.385  1.00 51.23  ? 677 GLY A N   1 
ATOM   4083 C  CA  . GLY A  1 677 ? 55.980  42.650  16.650  1.00 55.40  ? 677 GLY A CA  1 
ATOM   4084 C  C   . GLY A  1 677 ? 55.209  42.724  15.336  1.00 53.61  ? 677 GLY A C   1 
ATOM   4085 O  O   . GLY A  1 677 ? 53.983  42.836  15.368  1.00 60.43  ? 677 GLY A O   1 
ATOM   4086 N  N   . PRO A  1 678 ? 55.878  42.668  14.178  1.00 47.84  ? 678 PRO A N   1 
ATOM   4087 C  CA  . PRO A  1 678 ? 57.329  42.498  14.040  1.00 49.83  ? 678 PRO A CA  1 
ATOM   4088 C  C   . PRO A  1 678 ? 58.119  43.811  14.124  1.00 50.04  ? 678 PRO A C   1 
ATOM   4089 O  O   . PRO A  1 678 ? 57.589  44.879  13.801  1.00 58.99  ? 678 PRO A O   1 
ATOM   4090 C  CB  . PRO A  1 678 ? 57.463  41.894  12.640  1.00 49.69  ? 678 PRO A CB  1 
ATOM   4091 C  CG  . PRO A  1 678 ? 56.310  42.457  11.881  1.00 49.68  ? 678 PRO A CG  1 
ATOM   4092 C  CD  . PRO A  1 678 ? 55.200  42.693  12.869  1.00 47.71  ? 678 PRO A CD  1 
ATOM   4093 N  N   . ARG A  1 679 ? 59.378  43.703  14.555  1.00 45.90  ? 679 ARG A N   1 
ATOM   4094 C  CA  . ARG A  1 679 ? 60.347  44.817  14.565  1.00 45.79  ? 679 ARG A CA  1 
ATOM   4095 C  C   . ARG A  1 679 ? 59.898  46.037  15.390  1.00 47.00  ? 679 ARG A C   1 
ATOM   4096 O  O   . ARG A  1 679 ? 59.875  47.166  14.898  1.00 42.15  ? 679 ARG A O   1 
ATOM   4097 C  CB  . ARG A  1 679 ? 60.705  45.222  13.126  1.00 44.08  ? 679 ARG A CB  1 
ATOM   4098 C  CG  . ARG A  1 679 ? 61.292  44.085  12.304  1.00 42.93  ? 679 ARG A CG  1 
ATOM   4099 C  CD  . ARG A  1 679 ? 61.519  44.483  10.855  1.00 40.42  ? 679 ARG A CD  1 
ATOM   4100 N  NE  . ARG A  1 679 ? 62.426  45.620  10.723  1.00 36.98  ? 679 ARG A NE  1 
ATOM   4101 C  CZ  . ARG A  1 679 ? 63.754  45.578  10.853  1.00 33.75  ? 679 ARG A CZ  1 
ATOM   4102 N  NH1 . ARG A  1 679 ? 64.390  44.441  11.134  1.00 32.46  ? 679 ARG A NH1 1 
ATOM   4103 N  NH2 . ARG A  1 679 ? 64.458  46.696  10.703  1.00 35.36  ? 679 ARG A NH2 1 
ATOM   4104 N  N   . LEU A  1 680 ? 59.565  45.787  16.653  1.00 49.55  ? 680 LEU A N   1 
ATOM   4105 C  CA  . LEU A  1 680 ? 59.037  46.818  17.561  1.00 50.47  ? 680 LEU A CA  1 
ATOM   4106 C  C   . LEU A  1 680 ? 60.035  47.916  17.950  1.00 50.29  ? 680 LEU A C   1 
ATOM   4107 O  O   . LEU A  1 680 ? 59.634  49.063  18.155  1.00 51.07  ? 680 LEU A O   1 
ATOM   4108 C  CB  . LEU A  1 680 ? 58.477  46.164  18.830  1.00 50.77  ? 680 LEU A CB  1 
ATOM   4109 C  CG  . LEU A  1 680 ? 57.195  45.351  18.627  1.00 47.62  ? 680 LEU A CG  1 
ATOM   4110 C  CD1 . LEU A  1 680 ? 56.977  44.350  19.753  1.00 44.79  ? 680 LEU A CD1 1 
ATOM   4111 C  CD2 . LEU A  1 680 ? 55.987  46.268  18.484  1.00 48.10  ? 680 LEU A CD2 1 
ATOM   4112 N  N   . ARG A  1 681 ? 61.316  47.566  18.057  1.00 52.74  ? 681 ARG A N   1 
ATOM   4113 C  CA  . ARG A  1 681 ? 62.369  48.530  18.406  1.00 55.24  ? 681 ARG A CA  1 
ATOM   4114 C  C   . ARG A  1 681 ? 62.624  49.545  17.287  1.00 55.46  ? 681 ARG A C   1 
ATOM   4115 O  O   . ARG A  1 681 ? 62.800  50.738  17.546  1.00 56.57  ? 681 ARG A O   1 
ATOM   4116 C  CB  . ARG A  1 681 ? 63.671  47.793  18.713  1.00 55.50  ? 681 ARG A CB  1 
ATOM   4117 C  CG  . ARG A  1 681 ? 64.666  48.582  19.561  1.00 55.60  ? 681 ARG A CG  1 
ATOM   4118 C  CD  . ARG A  1 681 ? 66.076  48.576  18.978  1.00 61.69  ? 681 ARG A CD  1 
ATOM   4119 N  NE  . ARG A  1 681 ? 66.492  47.265  18.469  1.00 61.34  ? 681 ARG A NE  1 
ATOM   4120 C  CZ  . ARG A  1 681 ? 67.550  47.042  17.687  1.00 62.29  ? 681 ARG A CZ  1 
ATOM   4121 N  NH1 . ARG A  1 681 ? 68.348  48.039  17.299  1.00 63.45  ? 681 ARG A NH1 1 
ATOM   4122 N  NH2 . ARG A  1 681 ? 67.817  45.801  17.284  1.00 58.65  ? 681 ARG A NH2 1 
ATOM   4123 N  N   . GLN A  1 682 ? 62.656  49.049  16.053  1.00 53.28  ? 682 GLN A N   1 
ATOM   4124 C  CA  . GLN A  1 682 ? 62.840  49.890  14.870  1.00 53.49  ? 682 GLN A CA  1 
ATOM   4125 C  C   . GLN A  1 682 ? 61.632  50.793  14.616  1.00 56.21  ? 682 GLN A C   1 
ATOM   4126 O  O   . GLN A  1 682 ? 61.782  51.916  14.141  1.00 58.15  ? 682 GLN A O   1 
ATOM   4127 C  CB  . GLN A  1 682 ? 63.111  49.027  13.636  1.00 52.65  ? 682 GLN A CB  1 
ATOM   4128 C  CG  . GLN A  1 682 ? 64.445  48.289  13.676  1.00 52.48  ? 682 GLN A CG  1 
ATOM   4129 C  CD  . GLN A  1 682 ? 64.351  46.857  14.181  1.00 52.50  ? 682 GLN A CD  1 
ATOM   4130 O  OE1 . GLN A  1 682 ? 63.374  46.464  14.826  1.00 58.32  ? 682 GLN A OE1 1 
ATOM   4131 N  NE2 . GLN A  1 682 ? 65.383  46.070  13.898  1.00 51.94  ? 682 GLN A NE2 1 
ATOM   4132 N  N   . CYS A  1 683 ? 60.440  50.288  14.922  1.00 58.53  ? 683 CYS A N   1 
ATOM   4133 C  CA  . CYS A  1 683 ? 59.214  51.085  14.847  1.00 62.20  ? 683 CYS A CA  1 
ATOM   4134 C  C   . CYS A  1 683 ? 59.093  52.085  15.994  1.00 61.36  ? 683 CYS A C   1 
ATOM   4135 O  O   . CYS A  1 683 ? 58.606  53.198  15.797  1.00 61.71  ? 683 CYS A O   1 
ATOM   4136 C  CB  . CYS A  1 683 ? 58.000  50.163  14.791  1.00 64.19  ? 683 CYS A CB  1 
ATOM   4137 S  SG  . CYS A  1 683 ? 58.006  49.123  13.312  1.00 75.99  ? 683 CYS A SG  1 
ATOM   4138 N  N   . ALA A  1 684 ? 59.534  51.685  17.184  1.00 61.14  ? 684 ALA A N   1 
ATOM   4139 C  CA  . ALA A  1 684 ? 59.665  52.607  18.315  1.00 62.28  ? 684 ALA A CA  1 
ATOM   4140 C  C   . ALA A  1 684 ? 60.619  53.763  18.002  1.00 61.93  ? 684 ALA A C   1 
ATOM   4141 O  O   . ALA A  1 684 ? 60.401  54.891  18.447  1.00 71.39  ? 684 ALA A O   1 
ATOM   4142 C  CB  . ALA A  1 684 ? 60.136  51.861  19.549  1.00 58.84  ? 684 ALA A CB  1 
ATOM   4143 N  N   . PHE A  1 685 ? 61.671  53.468  17.241  1.00 53.34  ? 685 PHE A N   1 
ATOM   4144 C  CA  . PHE A  1 685 ? 62.591  54.494  16.746  1.00 51.49  ? 685 PHE A CA  1 
ATOM   4145 C  C   . PHE A  1 685 ? 61.858  55.541  15.901  1.00 54.59  ? 685 PHE A C   1 
ATOM   4146 O  O   . PHE A  1 685 ? 61.940  56.740  16.174  1.00 59.22  ? 685 PHE A O   1 
ATOM   4147 C  CB  . PHE A  1 685 ? 63.718  53.847  15.931  1.00 51.31  ? 685 PHE A CB  1 
ATOM   4148 C  CG  . PHE A  1 685 ? 64.507  54.818  15.105  1.00 51.29  ? 685 PHE A CG  1 
ATOM   4149 C  CD1 . PHE A  1 685 ? 65.405  55.687  15.708  1.00 50.70  ? 685 PHE A CD1 1 
ATOM   4150 C  CD2 . PHE A  1 685 ? 64.357  54.862  13.721  1.00 48.12  ? 685 PHE A CD2 1 
ATOM   4151 C  CE1 . PHE A  1 685 ? 66.137  56.587  14.950  1.00 48.79  ? 685 PHE A CE1 1 
ATOM   4152 C  CE2 . PHE A  1 685 ? 65.087  55.760  12.959  1.00 49.18  ? 685 PHE A CE2 1 
ATOM   4153 C  CZ  . PHE A  1 685 ? 65.979  56.625  13.574  1.00 47.84  ? 685 PHE A CZ  1 
ATOM   4154 N  N   . TRP A  1 686 ? 61.146  55.064  14.883  1.00 55.10  ? 686 TRP A N   1 
ATOM   4155 C  CA  . TRP A  1 686 ? 60.457  55.929  13.917  1.00 52.83  ? 686 TRP A CA  1 
ATOM   4156 C  C   . TRP A  1 686 ? 59.260  56.691  14.486  1.00 54.82  ? 686 TRP A C   1 
ATOM   4157 O  O   . TRP A  1 686 ? 59.046  57.854  14.141  1.00 54.50  ? 686 TRP A O   1 
ATOM   4158 C  CB  . TRP A  1 686 ? 59.976  55.106  12.716  1.00 53.28  ? 686 TRP A CB  1 
ATOM   4159 C  CG  . TRP A  1 686 ? 61.058  54.698  11.762  1.00 53.14  ? 686 TRP A CG  1 
ATOM   4160 C  CD1 . TRP A  1 686 ? 61.416  53.425  11.422  1.00 53.42  ? 686 TRP A CD1 1 
ATOM   4161 C  CD2 . TRP A  1 686 ? 61.911  55.568  11.011  1.00 49.15  ? 686 TRP A CD2 1 
ATOM   4162 N  NE1 . TRP A  1 686 ? 62.439  53.448  10.508  1.00 49.22  ? 686 TRP A NE1 1 
ATOM   4163 C  CE2 . TRP A  1 686 ? 62.765  54.749  10.238  1.00 47.21  ? 686 TRP A CE2 1 
ATOM   4164 C  CE3 . TRP A  1 686 ? 62.038  56.961  10.915  1.00 48.81  ? 686 TRP A CE3 1 
ATOM   4165 C  CZ2 . TRP A  1 686 ? 63.736  55.276  9.380   1.00 49.27  ? 686 TRP A CZ2 1 
ATOM   4166 C  CZ3 . TRP A  1 686 ? 63.004  57.486  10.060  1.00 51.56  ? 686 TRP A CZ3 1 
ATOM   4167 C  CH2 . TRP A  1 686 ? 63.840  56.643  9.304   1.00 51.35  ? 686 TRP A CH2 1 
ATOM   4168 N  N   . LYS A  1 687 ? 58.480  56.025  15.333  1.00 61.72  ? 687 LYS A N   1 
ATOM   4169 C  CA  . LYS A  1 687 ? 57.209  56.567  15.828  1.00 66.92  ? 687 LYS A CA  1 
ATOM   4170 C  C   . LYS A  1 687 ? 57.307  57.310  17.172  1.00 67.47  ? 687 LYS A C   1 
ATOM   4171 O  O   . LYS A  1 687 ? 56.442  58.138  17.469  1.00 65.68  ? 687 LYS A O   1 
ATOM   4172 C  CB  . LYS A  1 687 ? 56.167  55.445  15.924  1.00 73.51  ? 687 LYS A CB  1 
ATOM   4173 C  CG  . LYS A  1 687 ? 55.964  54.626  14.645  1.00 74.48  ? 687 LYS A CG  1 
ATOM   4174 C  CD  . LYS A  1 687 ? 55.566  55.446  13.423  1.00 75.32  ? 687 LYS A CD  1 
ATOM   4175 C  CE  . LYS A  1 687 ? 54.251  56.174  13.624  1.00 77.10  ? 687 LYS A CE  1 
ATOM   4176 N  NZ  . LYS A  1 687 ? 53.681  56.655  12.334  1.00 79.33  ? 687 LYS A NZ  1 
ATOM   4177 N  N   . LYS A  1 688 ? 58.339  57.017  17.971  1.00 71.51  ? 688 LYS A N   1 
ATOM   4178 C  CA  . LYS A  1 688 ? 58.535  57.652  19.295  1.00 68.24  ? 688 LYS A CA  1 
ATOM   4179 C  C   . LYS A  1 688 ? 59.835  58.459  19.424  1.00 64.67  ? 688 LYS A C   1 
ATOM   4180 O  O   . LYS A  1 688 ? 59.792  59.634  19.804  1.00 62.72  ? 688 LYS A O   1 
ATOM   4181 C  CB  . LYS A  1 688 ? 58.474  56.613  20.427  1.00 67.94  ? 688 LYS A CB  1 
ATOM   4182 C  CG  . LYS A  1 688 ? 57.234  55.729  20.432  1.00 70.60  ? 688 LYS A CG  1 
ATOM   4183 C  CD  . LYS A  1 688 ? 55.979  56.498  20.816  1.00 72.67  ? 688 LYS A CD  1 
ATOM   4184 C  CE  . LYS A  1 688 ? 54.731  55.671  20.560  1.00 73.85  ? 688 LYS A CE  1 
ATOM   4185 N  NZ  . LYS A  1 688 ? 53.495  56.466  20.789  1.00 76.94  ? 688 LYS A NZ  1 
ATOM   4186 N  N   . TYR A  1 689 ? 60.977  57.842  19.114  1.00 58.92  ? 689 TYR A N   1 
ATOM   4187 C  CA  . TYR A  1 689 ? 62.286  58.471  19.362  1.00 58.26  ? 689 TYR A CA  1 
ATOM   4188 C  C   . TYR A  1 689 ? 62.608  59.628  18.418  1.00 61.27  ? 689 TYR A C   1 
ATOM   4189 O  O   . TYR A  1 689 ? 62.857  60.748  18.864  1.00 67.89  ? 689 TYR A O   1 
ATOM   4190 C  CB  . TYR A  1 689 ? 63.437  57.458  19.295  1.00 55.93  ? 689 TYR A CB  1 
ATOM   4191 C  CG  . TYR A  1 689 ? 64.789  58.125  19.489  1.00 54.68  ? 689 TYR A CG  1 
ATOM   4192 C  CD1 . TYR A  1 689 ? 65.137  58.685  20.718  1.00 49.70  ? 689 TYR A CD1 1 
ATOM   4193 C  CD2 . TYR A  1 689 ? 65.701  58.239  18.436  1.00 56.02  ? 689 TYR A CD2 1 
ATOM   4194 C  CE1 . TYR A  1 689 ? 66.359  59.318  20.902  1.00 47.94  ? 689 TYR A CE1 1 
ATOM   4195 C  CE2 . TYR A  1 689 ? 66.927  58.869  18.614  1.00 53.37  ? 689 TYR A CE2 1 
ATOM   4196 C  CZ  . TYR A  1 689 ? 67.251  59.407  19.848  1.00 49.07  ? 689 TYR A CZ  1 
ATOM   4197 O  OH  . TYR A  1 689 ? 68.462  60.031  20.031  1.00 49.96  ? 689 TYR A OH  1 
ATOM   4198 N  N   . LEU A  1 690 ? 62.642  59.336  17.122  1.00 60.80  ? 690 LEU A N   1 
ATOM   4199 C  CA  . LEU A  1 690 ? 63.061  60.321  16.120  1.00 56.37  ? 690 LEU A CA  1 
ATOM   4200 C  C   . LEU A  1 690 ? 62.156  61.565  16.035  1.00 57.72  ? 690 LEU A C   1 
ATOM   4201 O  O   . LEU A  1 690 ? 62.664  62.657  15.785  1.00 59.54  ? 690 LEU A O   1 
ATOM   4202 C  CB  . LEU A  1 690 ? 63.211  59.672  14.737  1.00 58.35  ? 690 LEU A CB  1 
ATOM   4203 C  CG  . LEU A  1 690 ? 64.051  60.444  13.709  1.00 58.66  ? 690 LEU A CG  1 
ATOM   4204 C  CD1 . LEU A  1 690 ? 65.527  60.396  14.069  1.00 59.20  ? 690 LEU A CD1 1 
ATOM   4205 C  CD2 . LEU A  1 690 ? 63.849  59.888  12.310  1.00 59.64  ? 690 LEU A CD2 1 
ATOM   4206 N  N   . PRO A  1 691 ? 60.826  61.409  16.237  1.00 55.49  ? 691 PRO A N   1 
ATOM   4207 C  CA  . PRO A  1 691 ? 59.929  62.573  16.289  1.00 58.97  ? 691 PRO A CA  1 
ATOM   4208 C  C   . PRO A  1 691 ? 60.300  63.626  17.334  1.00 64.80  ? 691 PRO A C   1 
ATOM   4209 O  O   . PRO A  1 691 ? 60.353  64.814  17.007  1.00 71.71  ? 691 PRO A O   1 
ATOM   4210 C  CB  . PRO A  1 691 ? 58.574  61.945  16.617  1.00 56.32  ? 691 PRO A CB  1 
ATOM   4211 C  CG  . PRO A  1 691 ? 58.640  60.619  15.957  1.00 56.71  ? 691 PRO A CG  1 
ATOM   4212 C  CD  . PRO A  1 691 ? 60.052  60.155  16.170  1.00 54.21  ? 691 PRO A CD  1 
ATOM   4213 N  N   . GLN A  1 692 ? 60.548  63.190  18.567  1.00 68.70  ? 692 GLN A N   1 
ATOM   4214 C  CA  . GLN A  1 692 ? 60.983  64.102  19.633  1.00 70.90  ? 692 GLN A CA  1 
ATOM   4215 C  C   . GLN A  1 692 ? 62.423  64.603  19.441  1.00 74.54  ? 692 GLN A C   1 
ATOM   4216 O  O   . GLN A  1 692 ? 62.758  65.697  19.905  1.00 90.81  ? 692 GLN A O   1 
ATOM   4217 C  CB  . GLN A  1 692 ? 60.793  63.487  21.030  1.00 70.59  ? 692 GLN A CB  1 
ATOM   4218 C  CG  . GLN A  1 692 ? 61.657  62.278  21.363  1.00 72.66  ? 692 GLN A CG  1 
ATOM   4219 C  CD  . GLN A  1 692 ? 61.384  61.719  22.751  1.00 76.70  ? 692 GLN A CD  1 
ATOM   4220 O  OE1 . GLN A  1 692 ? 60.632  62.297  23.538  1.00 75.41  ? 692 GLN A OE1 1 
ATOM   4221 N  NE2 . GLN A  1 692 ? 61.998  60.581  23.056  1.00 71.91  ? 692 GLN A NE2 1 
ATOM   4222 N  N   . LEU A  1 693 ? 63.262  63.811  18.768  1.00 69.71  ? 693 LEU A N   1 
ATOM   4223 C  CA  . LEU A  1 693 ? 64.630  64.236  18.436  1.00 66.88  ? 693 LEU A CA  1 
ATOM   4224 C  C   . LEU A  1 693 ? 64.640  65.379  17.416  1.00 66.17  ? 693 LEU A C   1 
ATOM   4225 O  O   . LEU A  1 693 ? 65.477  66.279  17.505  1.00 69.84  ? 693 LEU A O   1 
ATOM   4226 C  CB  . LEU A  1 693 ? 65.482  63.065  17.923  1.00 63.72  ? 693 LEU A CB  1 
ATOM   4227 C  CG  . LEU A  1 693 ? 66.953  63.389  17.601  1.00 62.94  ? 693 LEU A CG  1 
ATOM   4228 C  CD1 . LEU A  1 693 ? 67.718  63.860  18.831  1.00 64.34  ? 693 LEU A CD1 1 
ATOM   4229 C  CD2 . LEU A  1 693 ? 67.656  62.191  16.986  1.00 64.53  ? 693 LEU A CD2 1 
ATOM   4230 N  N   . VAL A  1 694 ? 63.729  65.325  16.446  1.00 66.97  ? 694 VAL A N   1 
ATOM   4231 C  CA  . VAL A  1 694 ? 63.508  66.441  15.517  1.00 71.59  ? 694 VAL A CA  1 
ATOM   4232 C  C   . VAL A  1 694 ? 62.902  67.649  16.248  1.00 73.47  ? 694 VAL A C   1 
ATOM   4233 O  O   . VAL A  1 694 ? 63.288  68.787  15.979  1.00 73.33  ? 694 VAL A O   1 
ATOM   4234 C  CB  . VAL A  1 694 ? 62.634  66.015  14.313  1.00 73.36  ? 694 VAL A CB  1 
ATOM   4235 C  CG1 . VAL A  1 694 ? 62.260  67.204  13.432  1.00 74.19  ? 694 VAL A CG1 1 
ATOM   4236 C  CG2 . VAL A  1 694 ? 63.375  64.984  13.475  1.00 73.13  ? 694 VAL A CG2 1 
ATOM   4237 N  N   . ALA A  1 695 ? 61.959  67.396  17.157  1.00 76.47  ? 695 ALA A N   1 
ATOM   4238 C  CA  . ALA A  1 695 ? 61.357  68.450  17.990  1.00 79.91  ? 695 ALA A CA  1 
ATOM   4239 C  C   . ALA A  1 695 ? 62.379  69.156  18.890  1.00 86.09  ? 695 ALA A C   1 
ATOM   4240 O  O   . ALA A  1 695 ? 62.291  70.367  19.101  1.00 104.39 ? 695 ALA A O   1 
ATOM   4241 C  CB  . ALA A  1 695 ? 60.226  67.879  18.832  1.00 79.39  ? 695 ALA A CB  1 
ATOM   4242 N  N   . ALA A  1 696 ? 63.336  68.391  19.413  1.00 79.83  ? 696 ALA A N   1 
ATOM   4243 C  CA  . ALA A  1 696 ? 64.417  68.930  20.243  1.00 79.38  ? 696 ALA A CA  1 
ATOM   4244 C  C   . ALA A  1 696 ? 65.439  69.750  19.439  1.00 83.86  ? 696 ALA A C   1 
ATOM   4245 O  O   . ALA A  1 696 ? 65.810  70.851  19.850  1.00 89.50  ? 696 ALA A O   1 
ATOM   4246 C  CB  . ALA A  1 696 ? 65.115  67.800  20.986  1.00 77.97  ? 696 ALA A CB  1 
ATOM   4247 N  N   . THR A  1 697 ? 65.878  69.211  18.298  1.00 84.20  ? 697 THR A N   1 
ATOM   4248 C  CA  . THR A  1 697 ? 66.956  69.814  17.481  1.00 77.96  ? 697 THR A CA  1 
ATOM   4249 C  C   . THR A  1 697 ? 66.521  70.869  16.447  1.00 81.75  ? 697 THR A C   1 
ATOM   4250 O  O   . THR A  1 697 ? 67.377  71.511  15.833  1.00 74.40  ? 697 THR A O   1 
ATOM   4251 C  CB  . THR A  1 697 ? 67.760  68.731  16.725  1.00 69.01  ? 697 THR A CB  1 
ATOM   4252 O  OG1 . THR A  1 697 ? 66.886  67.984  15.869  1.00 69.69  ? 697 THR A OG1 1 
ATOM   4253 C  CG2 . THR A  1 697 ? 68.447  67.790  17.700  1.00 68.50  ? 697 THR A CG2 1 
ATOM   4254 N  N   . SER A  1 698 ? 65.213  71.038  16.247  1.00 98.51  ? 698 SER A N   1 
ATOM   4255 C  CA  . SER A  1 698 ? 64.682  72.036  15.299  1.00 104.80 ? 698 SER A CA  1 
ATOM   4256 C  C   . SER A  1 698 ? 65.024  73.480  15.697  1.00 113.96 ? 698 SER A C   1 
ATOM   4257 O  O   . SER A  1 698 ? 65.320  74.312  14.835  1.00 103.46 ? 698 SER A O   1 
ATOM   4258 C  CB  . SER A  1 698 ? 63.163  71.886  15.147  1.00 104.96 ? 698 SER A CB  1 
ATOM   4259 O  OG  . SER A  1 698 ? 62.513  71.952  16.404  1.00 103.11 ? 698 SER A OG  1 
ATOM   4260 N  N   . ASN A  1 699 ? 64.976  73.755  17.002  1.00 115.09 ? 699 ASN A N   1 
ATOM   4261 C  CA  . ASN A  1 699 ? 65.344  75.068  17.566  1.00 108.02 ? 699 ASN A CA  1 
ATOM   4262 C  C   . ASN A  1 699 ? 66.816  75.105  17.983  1.00 102.94 ? 699 ASN A C   1 
ATOM   4263 O  O   . ASN A  1 699 ? 67.686  74.591  17.279  1.00 93.33  ? 699 ASN A O   1 
ATOM   4264 C  CB  . ASN A  1 699 ? 64.432  75.444  18.753  1.00 104.47 ? 699 ASN A CB  1 
ATOM   4265 C  CG  . ASN A  1 699 ? 64.588  74.514  19.950  1.00 98.66  ? 699 ASN A CG  1 
ATOM   4266 O  OD1 . ASN A  1 699 ? 63.875  73.516  20.067  1.00 83.87  ? 699 ASN A OD1 1 
ATOM   4267 N  ND2 . ASN A  1 699 ? 65.517  74.839  20.842  1.00 87.09  ? 699 ASN A ND2 1 
ATOM   4268 N  N   . ASP B  1 162 ? 11.498  36.109  15.483  1.00 96.27  ? 162 ASP B N   1 
ATOM   4269 C  CA  . ASP B  1 162 ? 10.089  36.293  15.960  1.00 93.54  ? 162 ASP B CA  1 
ATOM   4270 C  C   . ASP B  1 162 ? 9.080   36.269  14.813  1.00 94.33  ? 162 ASP B C   1 
ATOM   4271 O  O   . ASP B  1 162 ? 9.301   36.890  13.770  1.00 93.23  ? 162 ASP B O   1 
ATOM   4272 C  CB  . ASP B  1 162 ? 9.934   37.611  16.736  1.00 90.35  ? 162 ASP B CB  1 
ATOM   4273 C  CG  . ASP B  1 162 ? 10.429  37.512  18.169  1.00 91.90  ? 162 ASP B CG  1 
ATOM   4274 O  OD1 . ASP B  1 162 ? 9.943   36.634  18.913  1.00 89.66  ? 162 ASP B OD1 1 
ATOM   4275 O  OD2 . ASP B  1 162 ? 11.293  38.326  18.558  1.00 88.48  ? 162 ASP B OD2 1 
ATOM   4276 N  N   . ASN B  1 163 ? 7.977   35.550  15.026  1.00 100.99 ? 163 ASN B N   1 
ATOM   4277 C  CA  . ASN B  1 163 ? 6.818   35.576  14.119  1.00 96.15  ? 163 ASN B CA  1 
ATOM   4278 C  C   . ASN B  1 163 ? 5.836   36.716  14.469  1.00 91.07  ? 163 ASN B C   1 
ATOM   4279 O  O   . ASN B  1 163 ? 4.842   36.920  13.769  1.00 86.58  ? 163 ASN B O   1 
ATOM   4280 C  CB  . ASN B  1 163 ? 6.116   34.202  14.070  1.00 91.96  ? 163 ASN B CB  1 
ATOM   4281 C  CG  . ASN B  1 163 ? 5.092   34.005  15.180  1.00 90.71  ? 163 ASN B CG  1 
ATOM   4282 O  OD1 . ASN B  1 163 ? 3.927   33.711  14.911  1.00 83.67  ? 163 ASN B OD1 1 
ATOM   4283 N  ND2 . ASN B  1 163 ? 5.520   34.161  16.427  1.00 85.09  ? 163 ASN B ND2 1 
ATOM   4284 N  N   . ASP B  1 164 ? 6.120   37.433  15.561  1.00 82.34  ? 164 ASP B N   1 
ATOM   4285 C  CA  . ASP B  1 164 ? 5.450   38.691  15.902  1.00 84.21  ? 164 ASP B CA  1 
ATOM   4286 C  C   . ASP B  1 164 ? 5.740   39.748  14.823  1.00 84.45  ? 164 ASP B C   1 
ATOM   4287 O  O   . ASP B  1 164 ? 6.909   40.027  14.546  1.00 75.88  ? 164 ASP B O   1 
ATOM   4288 C  CB  . ASP B  1 164 ? 5.947   39.182  17.268  1.00 86.33  ? 164 ASP B CB  1 
ATOM   4289 C  CG  . ASP B  1 164 ? 5.172   40.385  17.785  1.00 86.66  ? 164 ASP B CG  1 
ATOM   4290 O  OD1 . ASP B  1 164 ? 3.934   40.289  17.914  1.00 95.44  ? 164 ASP B OD1 1 
ATOM   4291 O  OD2 . ASP B  1 164 ? 5.807   41.421  18.079  1.00 78.67  ? 164 ASP B OD2 1 
ATOM   4292 N  N   . PRO B  1 165 ? 4.687   40.327  14.208  1.00 80.13  ? 165 PRO B N   1 
ATOM   4293 C  CA  . PRO B  1 165 ? 4.912   41.225  13.069  1.00 74.92  ? 165 PRO B CA  1 
ATOM   4294 C  C   . PRO B  1 165 ? 5.420   42.632  13.420  1.00 73.62  ? 165 PRO B C   1 
ATOM   4295 O  O   . PRO B  1 165 ? 6.037   43.276  12.567  1.00 76.45  ? 165 PRO B O   1 
ATOM   4296 C  CB  . PRO B  1 165 ? 3.531   41.296  12.410  1.00 80.64  ? 165 PRO B CB  1 
ATOM   4297 C  CG  . PRO B  1 165 ? 2.571   41.089  13.526  1.00 80.69  ? 165 PRO B CG  1 
ATOM   4298 C  CD  . PRO B  1 165 ? 3.251   40.201  14.528  1.00 77.19  ? 165 PRO B CD  1 
ATOM   4299 N  N   . LEU B  1 166 ? 5.164   43.102  14.640  1.00 72.30  ? 166 LEU B N   1 
ATOM   4300 C  CA  . LEU B  1 166 ? 5.573   44.454  15.063  1.00 65.75  ? 166 LEU B CA  1 
ATOM   4301 C  C   . LEU B  1 166 ? 7.095   44.614  15.204  1.00 63.85  ? 166 LEU B C   1 
ATOM   4302 O  O   . LEU B  1 166 ? 7.616   45.725  15.047  1.00 56.88  ? 166 LEU B O   1 
ATOM   4303 C  CB  . LEU B  1 166 ? 4.872   44.862  16.366  1.00 68.74  ? 166 LEU B CB  1 
ATOM   4304 C  CG  . LEU B  1 166 ? 3.460   45.442  16.227  1.00 70.01  ? 166 LEU B CG  1 
ATOM   4305 C  CD1 . LEU B  1 166 ? 2.459   44.384  15.789  1.00 70.14  ? 166 LEU B CD1 1 
ATOM   4306 C  CD2 . LEU B  1 166 ? 3.019   46.063  17.542  1.00 71.30  ? 166 LEU B CD2 1 
ATOM   4307 N  N   . VAL B  1 167 ? 7.791   43.514  15.504  1.00 62.55  ? 167 VAL B N   1 
ATOM   4308 C  CA  . VAL B  1 167 ? 9.269   43.507  15.502  1.00 63.04  ? 167 VAL B CA  1 
ATOM   4309 C  C   . VAL B  1 167 ? 9.832   43.314  14.095  1.00 62.22  ? 167 VAL B C   1 
ATOM   4310 O  O   . VAL B  1 167 ? 9.270   42.575  13.282  1.00 60.11  ? 167 VAL B O   1 
ATOM   4311 C  CB  . VAL B  1 167 ? 9.925   42.470  16.458  1.00 69.18  ? 167 VAL B CB  1 
ATOM   4312 C  CG1 . VAL B  1 167 ? 9.796   42.917  17.905  1.00 78.56  ? 167 VAL B CG1 1 
ATOM   4313 C  CG2 . VAL B  1 167 ? 9.376   41.062  16.266  1.00 73.63  ? 167 VAL B CG2 1 
ATOM   4314 N  N   . VAL B  1 168 ? 10.946  43.996  13.831  1.00 66.39  ? 168 VAL B N   1 
ATOM   4315 C  CA  . VAL B  1 168 ? 11.650  43.944  12.547  1.00 64.69  ? 168 VAL B CA  1 
ATOM   4316 C  C   . VAL B  1 168 ? 13.151  43.992  12.839  1.00 65.17  ? 168 VAL B C   1 
ATOM   4317 O  O   . VAL B  1 168 ? 13.622  44.920  13.500  1.00 63.38  ? 168 VAL B O   1 
ATOM   4318 C  CB  . VAL B  1 168 ? 11.272  45.145  11.641  1.00 68.20  ? 168 VAL B CB  1 
ATOM   4319 C  CG1 . VAL B  1 168 ? 12.053  45.125  10.332  1.00 69.68  ? 168 VAL B CG1 1 
ATOM   4320 C  CG2 . VAL B  1 168 ? 9.780   45.159  11.339  1.00 69.50  ? 168 VAL B CG2 1 
ATOM   4321 N  N   . ASN B  1 169 ? 13.889  42.997  12.344  1.00 59.05  ? 169 ASN B N   1 
ATOM   4322 C  CA  . ASN B  1 169 ? 15.354  42.960  12.477  1.00 58.48  ? 169 ASN B CA  1 
ATOM   4323 C  C   . ASN B  1 169 ? 16.023  43.792  11.371  1.00 59.81  ? 169 ASN B C   1 
ATOM   4324 O  O   . ASN B  1 169 ? 16.194  43.323  10.243  1.00 51.94  ? 169 ASN B O   1 
ATOM   4325 C  CB  . ASN B  1 169 ? 15.869  41.508  12.468  1.00 59.15  ? 169 ASN B CB  1 
ATOM   4326 C  CG  . ASN B  1 169 ? 17.373  41.406  12.717  1.00 62.94  ? 169 ASN B CG  1 
ATOM   4327 O  OD1 . ASN B  1 169 ? 17.957  42.213  13.443  1.00 58.55  ? 169 ASN B OD1 1 
ATOM   4328 N  ND2 . ASN B  1 169 ? 18.000  40.402  12.115  1.00 63.04  ? 169 ASN B ND2 1 
ATOM   4329 N  N   . THR B  1 170 ? 16.397  45.023  11.716  1.00 65.99  ? 170 THR B N   1 
ATOM   4330 C  CA  . THR B  1 170 ? 17.097  45.942  10.807  1.00 69.93  ? 170 THR B CA  1 
ATOM   4331 C  C   . THR B  1 170 ? 18.567  45.540  10.623  1.00 67.14  ? 170 THR B C   1 
ATOM   4332 O  O   . THR B  1 170 ? 19.043  44.592  11.256  1.00 70.00  ? 170 THR B O   1 
ATOM   4333 C  CB  . THR B  1 170 ? 17.026  47.401  11.322  1.00 73.81  ? 170 THR B CB  1 
ATOM   4334 O  OG1 . THR B  1 170 ? 17.639  47.498  12.614  1.00 79.69  ? 170 THR B OG1 1 
ATOM   4335 C  CG2 . THR B  1 170 ? 15.580  47.880  11.408  1.00 72.42  ? 170 THR B CG2 1 
ATOM   4336 N  N   . ASP B  1 171 ? 19.278  46.266  9.759   1.00 63.10  ? 171 ASP B N   1 
ATOM   4337 C  CA  . ASP B  1 171 ? 20.718  46.018  9.535   1.00 65.02  ? 171 ASP B CA  1 
ATOM   4338 C  C   . ASP B  1 171 ? 21.641  46.363  10.726  1.00 59.50  ? 171 ASP B C   1 
ATOM   4339 O  O   . ASP B  1 171 ? 22.784  45.903  10.758  1.00 63.72  ? 171 ASP B O   1 
ATOM   4340 C  CB  . ASP B  1 171 ? 21.233  46.655  8.219   1.00 66.89  ? 171 ASP B CB  1 
ATOM   4341 C  CG  . ASP B  1 171 ? 20.895  48.139  8.077   1.00 68.85  ? 171 ASP B CG  1 
ATOM   4342 O  OD1 . ASP B  1 171 ? 20.817  48.858  9.096   1.00 68.86  ? 171 ASP B OD1 1 
ATOM   4343 O  OD2 . ASP B  1 171 ? 20.714  48.587  6.923   1.00 72.50  ? 171 ASP B OD2 1 
ATOM   4344 N  N   . LYS B  1 172 ? 21.151  47.155  11.684  1.00 52.62  ? 172 LYS B N   1 
ATOM   4345 C  CA  . LYS B  1 172 ? 21.902  47.480  12.913  1.00 51.44  ? 172 LYS B CA  1 
ATOM   4346 C  C   . LYS B  1 172 ? 21.245  46.978  14.213  1.00 54.12  ? 172 LYS B C   1 
ATOM   4347 O  O   . LYS B  1 172 ? 21.695  47.323  15.306  1.00 58.98  ? 172 LYS B O   1 
ATOM   4348 C  CB  . LYS B  1 172 ? 22.133  48.994  12.997  1.00 49.49  ? 172 LYS B CB  1 
ATOM   4349 C  CG  . LYS B  1 172 ? 23.054  49.549  11.922  1.00 46.74  ? 172 LYS B CG  1 
ATOM   4350 C  CD  . LYS B  1 172 ? 24.515  49.242  12.208  1.00 45.87  ? 172 LYS B CD  1 
ATOM   4351 C  CE  . LYS B  1 172 ? 25.431  49.992  11.256  1.00 43.26  ? 172 LYS B CE  1 
ATOM   4352 N  NZ  . LYS B  1 172 ? 26.838  49.992  11.738  1.00 39.13  ? 172 LYS B NZ  1 
ATOM   4353 N  N   . GLY B  1 173 ? 20.199  46.162  14.102  1.00 53.41  ? 173 GLY B N   1 
ATOM   4354 C  CA  . GLY B  1 173 ? 19.555  45.567  15.278  1.00 54.88  ? 173 GLY B CA  1 
ATOM   4355 C  C   . GLY B  1 173 ? 18.087  45.275  15.058  1.00 56.53  ? 173 GLY B C   1 
ATOM   4356 O  O   . GLY B  1 173 ? 17.613  45.268  13.926  1.00 56.64  ? 173 GLY B O   1 
ATOM   4357 N  N   . ARG B  1 174 ? 17.379  45.014  16.154  1.00 59.05  ? 174 ARG B N   1 
ATOM   4358 C  CA  . ARG B  1 174 ? 15.926  44.793  16.135  1.00 64.65  ? 174 ARG B CA  1 
ATOM   4359 C  C   . ARG B  1 174 ? 15.162  45.980  16.729  1.00 65.89  ? 174 ARG B C   1 
ATOM   4360 O  O   . ARG B  1 174 ? 15.666  46.662  17.624  1.00 71.33  ? 174 ARG B O   1 
ATOM   4361 C  CB  . ARG B  1 174 ? 15.569  43.509  16.893  1.00 65.14  ? 174 ARG B CB  1 
ATOM   4362 C  CG  . ARG B  1 174 ? 15.439  42.271  16.017  1.00 67.61  ? 174 ARG B CG  1 
ATOM   4363 C  CD  . ARG B  1 174 ? 15.214  41.028  16.864  1.00 67.74  ? 174 ARG B CD  1 
ATOM   4364 N  NE  . ARG B  1 174 ? 16.432  40.632  17.578  1.00 68.50  ? 174 ARG B NE  1 
ATOM   4365 C  CZ  . ARG B  1 174 ? 16.482  39.862  18.668  1.00 71.39  ? 174 ARG B CZ  1 
ATOM   4366 N  NH1 . ARG B  1 174 ? 15.376  39.371  19.231  1.00 72.96  ? 174 ARG B NH1 1 
ATOM   4367 N  NH2 . ARG B  1 174 ? 17.664  39.583  19.212  1.00 73.65  ? 174 ARG B NH2 1 
ATOM   4368 N  N   . ILE B  1 175 ? 13.950  46.212  16.223  1.00 62.99  ? 175 ILE B N   1 
ATOM   4369 C  CA  . ILE B  1 175 ? 13.059  47.264  16.740  1.00 58.96  ? 175 ILE B CA  1 
ATOM   4370 C  C   . ILE B  1 175 ? 11.612  46.784  16.837  1.00 54.42  ? 175 ILE B C   1 
ATOM   4371 O  O   . ILE B  1 175 ? 11.154  46.037  15.977  1.00 50.73  ? 175 ILE B O   1 
ATOM   4372 C  CB  . ILE B  1 175 ? 13.093  48.543  15.874  1.00 55.20  ? 175 ILE B CB  1 
ATOM   4373 C  CG1 . ILE B  1 175 ? 12.988  48.208  14.385  1.00 56.52  ? 175 ILE B CG1 1 
ATOM   4374 C  CG2 . ILE B  1 175 ? 14.355  49.342  16.156  1.00 56.93  ? 175 ILE B CG2 1 
ATOM   4375 C  CD1 . ILE B  1 175 ? 12.610  49.387  13.520  1.00 58.03  ? 175 ILE B CD1 1 
ATOM   4376 N  N   . ARG B  1 176 ? 10.907  47.229  17.879  1.00 55.38  ? 176 ARG B N   1 
ATOM   4377 C  CA  . ARG B  1 176 ? 9.486   46.906  18.072  1.00 58.07  ? 176 ARG B CA  1 
ATOM   4378 C  C   . ARG B  1 176 ? 8.624   48.157  17.900  1.00 57.24  ? 176 ARG B C   1 
ATOM   4379 O  O   . ARG B  1 176 ? 8.853   49.174  18.559  1.00 50.83  ? 176 ARG B O   1 
ATOM   4380 C  CB  . ARG B  1 176 ? 9.232   46.287  19.452  1.00 58.32  ? 176 ARG B CB  1 
ATOM   4381 C  CG  . ARG B  1 176 ? 7.862   45.621  19.566  1.00 58.36  ? 176 ARG B CG  1 
ATOM   4382 C  CD  . ARG B  1 176 ? 7.454   45.305  20.997  1.00 61.67  ? 176 ARG B CD  1 
ATOM   4383 N  NE  . ARG B  1 176 ? 8.078   44.089  21.529  1.00 58.83  ? 176 ARG B NE  1 
ATOM   4384 C  CZ  . ARG B  1 176 ? 9.219   44.034  22.224  1.00 58.94  ? 176 ARG B CZ  1 
ATOM   4385 N  NH1 . ARG B  1 176 ? 9.930   45.130  22.490  1.00 67.01  ? 176 ARG B NH1 1 
ATOM   4386 N  NH2 . ARG B  1 176 ? 9.664   42.856  22.656  1.00 58.25  ? 176 ARG B NH2 1 
ATOM   4387 N  N   . GLY B  1 177 ? 7.625   48.054  17.024  1.00 59.30  ? 177 GLY B N   1 
ATOM   4388 C  CA  . GLY B  1 177 ? 6.687   49.144  16.746  1.00 57.26  ? 177 GLY B CA  1 
ATOM   4389 C  C   . GLY B  1 177 ? 5.453   49.079  17.627  1.00 54.34  ? 177 GLY B C   1 
ATOM   4390 O  O   . GLY B  1 177 ? 5.478   48.474  18.702  1.00 55.45  ? 177 GLY B O   1 
ATOM   4391 N  N   . ILE B  1 178 ? 4.375   49.712  17.166  1.00 47.48  ? 178 ILE B N   1 
ATOM   4392 C  CA  . ILE B  1 178 ? 3.111   49.753  17.908  1.00 46.53  ? 178 ILE B CA  1 
ATOM   4393 C  C   . ILE B  1 178 ? 1.917   50.019  16.985  1.00 51.30  ? 178 ILE B C   1 
ATOM   4394 O  O   . ILE B  1 178 ? 2.013   50.800  16.035  1.00 46.19  ? 178 ILE B O   1 
ATOM   4395 C  CB  . ILE B  1 178 ? 3.156   50.790  19.062  1.00 44.27  ? 178 ILE B CB  1 
ATOM   4396 C  CG1 . ILE B  1 178 ? 1.857   50.747  19.880  1.00 45.64  ? 178 ILE B CG1 1 
ATOM   4397 C  CG2 . ILE B  1 178 ? 3.435   52.197  18.541  1.00 43.75  ? 178 ILE B CG2 1 
ATOM   4398 C  CD1 . ILE B  1 178 ? 1.994   51.303  21.279  1.00 47.38  ? 178 ILE B CD1 1 
ATOM   4399 N  N   . THR B  1 179 ? 0.803   49.348  17.278  1.00 57.23  ? 179 THR B N   1 
ATOM   4400 C  CA  . THR B  1 179 ? -0.457  49.541  16.564  1.00 54.87  ? 179 THR B CA  1 
ATOM   4401 C  C   . THR B  1 179 ? -1.249  50.666  17.219  1.00 56.95  ? 179 THR B C   1 
ATOM   4402 O  O   . THR B  1 179 ? -1.478  50.651  18.430  1.00 58.50  ? 179 THR B O   1 
ATOM   4403 C  CB  . THR B  1 179 ? -1.315  48.265  16.562  1.00 54.20  ? 179 THR B CB  1 
ATOM   4404 O  OG1 . THR B  1 179 ? -0.522  47.154  16.125  1.00 53.48  ? 179 THR B OG1 1 
ATOM   4405 C  CG2 . THR B  1 179 ? -2.524  48.424  15.632  1.00 52.56  ? 179 THR B CG2 1 
ATOM   4406 N  N   . VAL B  1 180 ? -1.660  51.629  16.398  1.00 57.62  ? 180 VAL B N   1 
ATOM   4407 C  CA  . VAL B  1 180 ? -2.396  52.809  16.845  1.00 54.60  ? 180 VAL B CA  1 
ATOM   4408 C  C   . VAL B  1 180 ? -3.482  53.161  15.839  1.00 52.87  ? 180 VAL B C   1 
ATOM   4409 O  O   . VAL B  1 180 ? -3.456  52.707  14.691  1.00 54.56  ? 180 VAL B O   1 
ATOM   4410 C  CB  . VAL B  1 180 ? -1.466  54.029  17.035  1.00 54.22  ? 180 VAL B CB  1 
ATOM   4411 C  CG1 . VAL B  1 180 ? -0.475  53.767  18.158  1.00 56.53  ? 180 VAL B CG1 1 
ATOM   4412 C  CG2 . VAL B  1 180 ? -0.724  54.380  15.748  1.00 56.64  ? 180 VAL B CG2 1 
ATOM   4413 N  N   . ASP B  1 181 ? -4.420  53.988  16.282  1.00 49.60  ? 181 ASP B N   1 
ATOM   4414 C  CA  . ASP B  1 181 ? -5.538  54.415  15.448  1.00 49.09  ? 181 ASP B CA  1 
ATOM   4415 C  C   . ASP B  1 181 ? -5.179  55.686  14.694  1.00 47.97  ? 181 ASP B C   1 
ATOM   4416 O  O   . ASP B  1 181 ? -4.681  56.646  15.287  1.00 47.05  ? 181 ASP B O   1 
ATOM   4417 C  CB  . ASP B  1 181 ? -6.790  54.660  16.300  1.00 52.87  ? 181 ASP B CB  1 
ATOM   4418 C  CG  . ASP B  1 181 ? -7.479  53.370  16.722  1.00 58.31  ? 181 ASP B CG  1 
ATOM   4419 O  OD1 . ASP B  1 181 ? -6.812  52.314  16.801  1.00 62.27  ? 181 ASP B OD1 1 
ATOM   4420 O  OD2 . ASP B  1 181 ? -8.699  53.417  16.985  1.00 60.78  ? 181 ASP B OD2 1 
ATOM   4421 N  N   . ALA B  1 182 ? -5.423  55.677  13.387  1.00 53.86  ? 182 ALA B N   1 
ATOM   4422 C  CA  . ALA B  1 182 ? -5.404  56.899  12.589  1.00 58.23  ? 182 ALA B CA  1 
ATOM   4423 C  C   . ALA B  1 182 ? -6.636  57.725  12.973  1.00 56.53  ? 182 ALA B C   1 
ATOM   4424 O  O   . ALA B  1 182 ? -7.694  57.144  13.233  1.00 59.32  ? 182 ALA B O   1 
ATOM   4425 C  CB  . ALA B  1 182 ? -5.419  56.568  11.106  1.00 63.94  ? 182 ALA B CB  1 
ATOM   4426 N  N   . PRO B  1 183 ? -6.512  59.070  13.026  1.00 53.52  ? 183 PRO B N   1 
ATOM   4427 C  CA  . PRO B  1 183 ? -7.618  59.967  13.395  1.00 52.60  ? 183 PRO B CA  1 
ATOM   4428 C  C   . PRO B  1 183 ? -9.003  59.577  12.866  1.00 55.73  ? 183 PRO B C   1 
ATOM   4429 O  O   . PRO B  1 183 ? -9.995  59.701  13.587  1.00 50.17  ? 183 PRO B O   1 
ATOM   4430 C  CB  . PRO B  1 183 ? -7.187  61.291  12.779  1.00 54.11  ? 183 PRO B CB  1 
ATOM   4431 C  CG  . PRO B  1 183 ? -5.704  61.273  12.894  1.00 55.87  ? 183 PRO B CG  1 
ATOM   4432 C  CD  . PRO B  1 183 ? -5.272  59.835  12.788  1.00 55.52  ? 183 PRO B CD  1 
ATOM   4433 N  N   . SER B  1 184 ? -9.046  59.120  11.615  1.00 62.47  ? 184 SER B N   1 
ATOM   4434 C  CA  . SER B  1 184 ? -10.269 58.612  10.975  1.00 64.13  ? 184 SER B CA  1 
ATOM   4435 C  C   . SER B  1 184 ? -10.983 57.503  11.757  1.00 66.56  ? 184 SER B C   1 
ATOM   4436 O  O   . SER B  1 184 ? -12.212 57.503  11.861  1.00 71.09  ? 184 SER B O   1 
ATOM   4437 C  CB  . SER B  1 184 ? -9.937  58.084  9.576   1.00 63.68  ? 184 SER B CB  1 
ATOM   4438 O  OG  . SER B  1 184 ? -9.029  56.995  9.636   1.00 58.78  ? 184 SER B OG  1 
ATOM   4439 N  N   . GLY B  1 185 ? -10.198 56.576  12.301  1.00 68.63  ? 185 GLY B N   1 
ATOM   4440 C  CA  . GLY B  1 185 ? -10.701 55.352  12.937  1.00 65.18  ? 185 GLY B CA  1 
ATOM   4441 C  C   . GLY B  1 185 ? -9.927  54.120  12.490  1.00 63.51  ? 185 GLY B C   1 
ATOM   4442 O  O   . GLY B  1 185 ? -9.793  53.157  13.251  1.00 52.47  ? 185 GLY B O   1 
ATOM   4443 N  N   . LYS B  1 186 ? -9.424  54.157  11.253  1.00 62.29  ? 186 LYS B N   1 
ATOM   4444 C  CA  . LYS B  1 186 ? -8.627  53.070  10.669  1.00 57.70  ? 186 LYS B CA  1 
ATOM   4445 C  C   . LYS B  1 186 ? -7.310  52.877  11.409  1.00 58.71  ? 186 LYS B C   1 
ATOM   4446 O  O   . LYS B  1 186 ? -6.789  53.804  12.033  1.00 60.14  ? 186 LYS B O   1 
ATOM   4447 C  CB  . LYS B  1 186 ? -8.338  53.340  9.189   1.00 56.98  ? 186 LYS B CB  1 
ATOM   4448 C  CG  . LYS B  1 186 ? -9.577  53.378  8.309   1.00 56.89  ? 186 LYS B CG  1 
ATOM   4449 C  CD  . LYS B  1 186 ? -9.245  53.724  6.867   1.00 54.76  ? 186 LYS B CD  1 
ATOM   4450 C  CE  . LYS B  1 186 ? -10.503 53.748  6.016   1.00 53.86  ? 186 LYS B CE  1 
ATOM   4451 N  NZ  . LYS B  1 186 ? -10.259 54.294  4.653   1.00 52.70  ? 186 LYS B NZ  1 
ATOM   4452 N  N   . LYS B  1 187 ? -6.769  51.668  11.298  1.00 57.51  ? 187 LYS B N   1 
ATOM   4453 C  CA  . LYS B  1 187 ? -5.651  51.218  12.139  1.00 59.29  ? 187 LYS B CA  1 
ATOM   4454 C  C   . LYS B  1 187 ? -4.356  51.063  11.335  1.00 55.45  ? 187 LYS B C   1 
ATOM   4455 O  O   . LYS B  1 187 ? -4.376  50.604  10.191  1.00 48.81  ? 187 LYS B O   1 
ATOM   4456 C  CB  . LYS B  1 187 ? -6.008  49.916  12.882  1.00 66.98  ? 187 LYS B CB  1 
ATOM   4457 C  CG  . LYS B  1 187 ? -6.346  48.714  12.002  1.00 79.25  ? 187 LYS B CG  1 
ATOM   4458 C  CD  . LYS B  1 187 ? -7.229  47.696  12.719  1.00 79.24  ? 187 LYS B CD  1 
ATOM   4459 C  CE  . LYS B  1 187 ? -7.733  46.609  11.776  1.00 73.53  ? 187 LYS B CE  1 
ATOM   4460 N  NZ  . LYS B  1 187 ? -6.668  45.681  11.301  1.00 67.91  ? 187 LYS B NZ  1 
ATOM   4461 N  N   . VAL B  1 188 ? -3.242  51.462  11.955  1.00 59.51  ? 188 VAL B N   1 
ATOM   4462 C  CA  . VAL B  1 188 ? -1.905  51.441  11.339  1.00 61.07  ? 188 VAL B CA  1 
ATOM   4463 C  C   . VAL B  1 188 ? -0.844  50.908  12.303  1.00 59.32  ? 188 VAL B C   1 
ATOM   4464 O  O   . VAL B  1 188 ? -0.997  51.022  13.519  1.00 67.78  ? 188 VAL B O   1 
ATOM   4465 C  CB  . VAL B  1 188 ? -1.457  52.857  10.892  1.00 62.98  ? 188 VAL B CB  1 
ATOM   4466 C  CG1 . VAL B  1 188 ? -2.272  53.325  9.701   1.00 64.99  ? 188 VAL B CG1 1 
ATOM   4467 C  CG2 . VAL B  1 188 ? -1.558  53.871  12.031  1.00 62.29  ? 188 VAL B CG2 1 
ATOM   4468 N  N   . ASP B  1 189 ? 0.225   50.334  11.749  1.00 52.61  ? 189 ASP B N   1 
ATOM   4469 C  CA  . ASP B  1 189 ? 1.448   50.040  12.507  1.00 51.46  ? 189 ASP B CA  1 
ATOM   4470 C  C   . ASP B  1 189 ? 2.408   51.213  12.356  1.00 49.07  ? 189 ASP B C   1 
ATOM   4471 O  O   . ASP B  1 189 ? 2.624   51.690  11.239  1.00 48.12  ? 189 ASP B O   1 
ATOM   4472 C  CB  . ASP B  1 189 ? 2.134   48.774  11.991  1.00 52.93  ? 189 ASP B CB  1 
ATOM   4473 C  CG  . ASP B  1 189 ? 1.251   47.547  12.076  1.00 56.28  ? 189 ASP B CG  1 
ATOM   4474 O  OD1 . ASP B  1 189 ? 0.434   47.449  13.017  1.00 61.38  ? 189 ASP B OD1 1 
ATOM   4475 O  OD2 . ASP B  1 189 ? 1.386   46.667  11.200  1.00 57.96  ? 189 ASP B OD2 1 
ATOM   4476 N  N   . VAL B  1 190 ? 2.980   51.667  13.472  1.00 43.48  ? 190 VAL B N   1 
ATOM   4477 C  CA  . VAL B  1 190 ? 3.962   52.761  13.462  1.00 44.15  ? 190 VAL B CA  1 
ATOM   4478 C  C   . VAL B  1 190 ? 5.269   52.343  14.145  1.00 42.34  ? 190 VAL B C   1 
ATOM   4479 O  O   . VAL B  1 190 ? 5.266   51.543  15.084  1.00 40.69  ? 190 VAL B O   1 
ATOM   4480 C  CB  . VAL B  1 190 ? 3.409   54.080  14.080  1.00 46.79  ? 190 VAL B CB  1 
ATOM   4481 C  CG1 . VAL B  1 190 ? 2.067   54.449  13.467  1.00 48.48  ? 190 VAL B CG1 1 
ATOM   4482 C  CG2 . VAL B  1 190 ? 3.280   54.015  15.597  1.00 50.68  ? 190 VAL B CG2 1 
ATOM   4483 N  N   . TRP B  1 191 ? 6.373   52.894  13.644  1.00 44.13  ? 191 TRP B N   1 
ATOM   4484 C  CA  . TRP B  1 191 ? 7.702   52.732  14.227  1.00 45.35  ? 191 TRP B CA  1 
ATOM   4485 C  C   . TRP B  1 191 ? 8.314   54.128  14.352  1.00 46.64  ? 191 TRP B C   1 
ATOM   4486 O  O   . TRP B  1 191 ? 8.745   54.716  13.357  1.00 48.47  ? 191 TRP B O   1 
ATOM   4487 C  CB  . TRP B  1 191 ? 8.585   51.842  13.353  1.00 43.01  ? 191 TRP B CB  1 
ATOM   4488 C  CG  . TRP B  1 191 ? 8.135   50.415  13.256  1.00 43.05  ? 191 TRP B CG  1 
ATOM   4489 C  CD1 . TRP B  1 191 ? 8.591   49.362  13.993  1.00 43.24  ? 191 TRP B CD1 1 
ATOM   4490 C  CD2 . TRP B  1 191 ? 7.161   49.877  12.351  1.00 41.48  ? 191 TRP B CD2 1 
ATOM   4491 N  NE1 . TRP B  1 191 ? 7.955   48.206  13.616  1.00 41.50  ? 191 TRP B NE1 1 
ATOM   4492 C  CE2 . TRP B  1 191 ? 7.073   48.492  12.609  1.00 39.46  ? 191 TRP B CE2 1 
ATOM   4493 C  CE3 . TRP B  1 191 ? 6.350   50.432  11.351  1.00 45.71  ? 191 TRP B CE3 1 
ATOM   4494 C  CZ2 . TRP B  1 191 ? 6.204   47.651  11.904  1.00 40.25  ? 191 TRP B CZ2 1 
ATOM   4495 C  CZ3 . TRP B  1 191 ? 5.485   49.594  10.649  1.00 43.51  ? 191 TRP B CZ3 1 
ATOM   4496 C  CH2 . TRP B  1 191 ? 5.421   48.218  10.931  1.00 41.11  ? 191 TRP B CH2 1 
ATOM   4497 N  N   . LEU B  1 192 ? 8.338   54.642  15.581  1.00 45.07  ? 192 LEU B N   1 
ATOM   4498 C  CA  . LEU B  1 192 ? 8.707   56.035  15.869  1.00 47.24  ? 192 LEU B CA  1 
ATOM   4499 C  C   . LEU B  1 192 ? 10.047  56.145  16.600  1.00 46.64  ? 192 LEU B C   1 
ATOM   4500 O  O   . LEU B  1 192 ? 10.250  55.519  17.638  1.00 46.59  ? 192 LEU B O   1 
ATOM   4501 C  CB  . LEU B  1 192 ? 7.600   56.700  16.701  1.00 48.56  ? 192 LEU B CB  1 
ATOM   4502 C  CG  . LEU B  1 192 ? 6.411   57.357  15.977  1.00 48.37  ? 192 LEU B CG  1 
ATOM   4503 C  CD1 . LEU B  1 192 ? 5.987   56.625  14.713  1.00 49.39  ? 192 LEU B CD1 1 
ATOM   4504 C  CD2 . LEU B  1 192 ? 5.227   57.492  16.925  1.00 46.54  ? 192 LEU B CD2 1 
ATOM   4505 N  N   . GLY B  1 193 ? 10.947  56.961  16.056  1.00 50.10  ? 193 GLY B N   1 
ATOM   4506 C  CA  . GLY B  1 193 ? 12.271  57.176  16.639  1.00 48.96  ? 193 GLY B CA  1 
ATOM   4507 C  C   . GLY B  1 193 ? 13.252  56.047  16.380  1.00 52.66  ? 193 GLY B C   1 
ATOM   4508 O  O   . GLY B  1 193 ? 13.916  55.577  17.305  1.00 54.01  ? 193 GLY B O   1 
ATOM   4509 N  N   . ILE B  1 194 ? 13.347  55.616  15.123  1.00 53.32  ? 194 ILE B N   1 
ATOM   4510 C  CA  . ILE B  1 194 ? 14.345  54.625  14.714  1.00 53.56  ? 194 ILE B CA  1 
ATOM   4511 C  C   . ILE B  1 194 ? 15.652  55.384  14.474  1.00 58.99  ? 194 ILE B C   1 
ATOM   4512 O  O   . ILE B  1 194 ? 15.692  56.235  13.583  1.00 61.94  ? 194 ILE B O   1 
ATOM   4513 C  CB  . ILE B  1 194 ? 13.963  53.900  13.399  1.00 54.68  ? 194 ILE B CB  1 
ATOM   4514 C  CG1 . ILE B  1 194 ? 12.570  53.261  13.484  1.00 51.16  ? 194 ILE B CG1 1 
ATOM   4515 C  CG2 . ILE B  1 194 ? 15.001  52.828  13.070  1.00 59.29  ? 194 ILE B CG2 1 
ATOM   4516 C  CD1 . ILE B  1 194 ? 12.007  52.843  12.139  1.00 49.35  ? 194 ILE B CD1 1 
ATOM   4517 N  N   . PRO B  1 195 ? 16.721  55.096  15.253  1.00 61.07  ? 195 PRO B N   1 
ATOM   4518 C  CA  . PRO B  1 195 ? 17.988  55.789  14.970  1.00 54.68  ? 195 PRO B CA  1 
ATOM   4519 C  C   . PRO B  1 195 ? 18.640  55.302  13.672  1.00 51.03  ? 195 PRO B C   1 
ATOM   4520 O  O   . PRO B  1 195 ? 18.688  54.091  13.424  1.00 51.45  ? 195 PRO B O   1 
ATOM   4521 C  CB  . PRO B  1 195 ? 18.868  55.436  16.176  1.00 54.22  ? 195 PRO B CB  1 
ATOM   4522 C  CG  . PRO B  1 195 ? 18.314  54.157  16.691  1.00 56.60  ? 195 PRO B CG  1 
ATOM   4523 C  CD  . PRO B  1 195 ? 16.838  54.200  16.419  1.00 60.38  ? 195 PRO B CD  1 
ATOM   4524 N  N   . TYR B  1 196 ? 19.109  56.246  12.856  1.00 45.30  ? 196 TYR B N   1 
ATOM   4525 C  CA  . TYR B  1 196 ? 19.875  55.939  11.637  1.00 41.86  ? 196 TYR B CA  1 
ATOM   4526 C  C   . TYR B  1 196 ? 21.315  56.473  11.654  1.00 42.30  ? 196 TYR B C   1 
ATOM   4527 O  O   . TYR B  1 196 ? 22.039  56.316  10.667  1.00 46.00  ? 196 TYR B O   1 
ATOM   4528 C  CB  . TYR B  1 196 ? 19.129  56.441  10.389  1.00 38.72  ? 196 TYR B CB  1 
ATOM   4529 C  CG  . TYR B  1 196 ? 19.058  57.946  10.219  1.00 36.09  ? 196 TYR B CG  1 
ATOM   4530 C  CD1 . TYR B  1 196 ? 20.063  58.645  9.547   1.00 36.29  ? 196 TYR B CD1 1 
ATOM   4531 C  CD2 . TYR B  1 196 ? 17.969  58.668  10.700  1.00 38.23  ? 196 TYR B CD2 1 
ATOM   4532 C  CE1 . TYR B  1 196 ? 19.994  60.023  9.380   1.00 37.73  ? 196 TYR B CE1 1 
ATOM   4533 C  CE2 . TYR B  1 196 ? 17.886  60.046  10.534  1.00 38.77  ? 196 TYR B CE2 1 
ATOM   4534 C  CZ  . TYR B  1 196 ? 18.901  60.719  9.876   1.00 38.38  ? 196 TYR B CZ  1 
ATOM   4535 O  OH  . TYR B  1 196 ? 18.825  62.082  9.712   1.00 36.98  ? 196 TYR B OH  1 
ATOM   4536 N  N   . ALA B  1 197 ? 21.726  57.086  12.765  1.00 39.96  ? 197 ALA B N   1 
ATOM   4537 C  CA  . ALA B  1 197 ? 23.051  57.703  12.867  1.00 43.03  ? 197 ALA B CA  1 
ATOM   4538 C  C   . ALA B  1 197 ? 23.585  57.754  14.297  1.00 43.17  ? 197 ALA B C   1 
ATOM   4539 O  O   . ALA B  1 197 ? 22.823  57.653  15.263  1.00 48.41  ? 197 ALA B O   1 
ATOM   4540 C  CB  . ALA B  1 197 ? 23.009  59.109  12.283  1.00 39.94  ? 197 ALA B CB  1 
ATOM   4541 N  N   . GLN B  1 198 ? 24.907  57.895  14.415  1.00 48.28  ? 198 GLN B N   1 
ATOM   4542 C  CA  . GLN B  1 198 ? 25.536  58.285  15.680  1.00 55.35  ? 198 GLN B CA  1 
ATOM   4543 C  C   . GLN B  1 198 ? 25.071  59.714  15.991  1.00 52.96  ? 198 GLN B C   1 
ATOM   4544 O  O   . GLN B  1 198 ? 25.075  60.559  15.091  1.00 60.86  ? 198 GLN B O   1 
ATOM   4545 C  CB  . GLN B  1 198 ? 27.073  58.251  15.596  1.00 60.17  ? 198 GLN B CB  1 
ATOM   4546 C  CG  . GLN B  1 198 ? 27.710  56.900  15.903  1.00 61.45  ? 198 GLN B CG  1 
ATOM   4547 C  CD  . GLN B  1 198 ? 29.231  56.904  15.780  1.00 60.29  ? 198 GLN B CD  1 
ATOM   4548 O  OE1 . GLN B  1 198 ? 29.857  57.951  15.609  1.00 52.28  ? 198 GLN B OE1 1 
ATOM   4549 N  NE2 . GLN B  1 198 ? 29.829  55.721  15.872  1.00 60.18  ? 198 GLN B NE2 1 
ATOM   4550 N  N   . PRO B  1 199 ? 24.639  59.981  17.244  1.00 45.79  ? 199 PRO B N   1 
ATOM   4551 C  CA  . PRO B  1 199 ? 24.312  61.356  17.627  1.00 45.58  ? 199 PRO B CA  1 
ATOM   4552 C  C   . PRO B  1 199 ? 25.473  62.317  17.328  1.00 39.57  ? 199 PRO B C   1 
ATOM   4553 O  O   . PRO B  1 199 ? 26.568  62.125  17.863  1.00 39.78  ? 199 PRO B O   1 
ATOM   4554 C  CB  . PRO B  1 199 ? 24.063  61.252  19.136  1.00 45.78  ? 199 PRO B CB  1 
ATOM   4555 C  CG  . PRO B  1 199 ? 23.595  59.858  19.344  1.00 46.62  ? 199 PRO B CG  1 
ATOM   4556 C  CD  . PRO B  1 199 ? 24.260  59.015  18.293  1.00 46.24  ? 199 PRO B CD  1 
ATOM   4557 N  N   . PRO B  1 200 ? 25.248  63.327  16.458  1.00 36.80  ? 200 PRO B N   1 
ATOM   4558 C  CA  . PRO B  1 200 ? 26.307  64.261  16.069  1.00 40.86  ? 200 PRO B CA  1 
ATOM   4559 C  C   . PRO B  1 200 ? 26.626  65.223  17.215  1.00 45.54  ? 200 PRO B C   1 
ATOM   4560 O  O   . PRO B  1 200 ? 26.251  66.402  17.196  1.00 45.38  ? 200 PRO B O   1 
ATOM   4561 C  CB  . PRO B  1 200 ? 25.710  64.972  14.853  1.00 41.54  ? 200 PRO B CB  1 
ATOM   4562 C  CG  . PRO B  1 200 ? 24.250  64.977  15.124  1.00 40.97  ? 200 PRO B CG  1 
ATOM   4563 C  CD  . PRO B  1 200 ? 23.956  63.698  15.854  1.00 39.41  ? 200 PRO B CD  1 
ATOM   4564 N  N   . VAL B  1 201 ? 27.338  64.679  18.197  1.00 49.50  ? 201 VAL B N   1 
ATOM   4565 C  CA  . VAL B  1 201 ? 27.541  65.294  19.502  1.00 47.09  ? 201 VAL B CA  1 
ATOM   4566 C  C   . VAL B  1 201 ? 29.039  65.419  19.741  1.00 44.03  ? 201 VAL B C   1 
ATOM   4567 O  O   . VAL B  1 201 ? 29.802  64.495  19.448  1.00 44.39  ? 201 VAL B O   1 
ATOM   4568 C  CB  . VAL B  1 201 ? 26.881  64.438  20.609  1.00 47.33  ? 201 VAL B CB  1 
ATOM   4569 C  CG1 . VAL B  1 201 ? 27.267  64.907  22.011  1.00 54.79  ? 201 VAL B CG1 1 
ATOM   4570 C  CG2 . VAL B  1 201 ? 25.368  64.465  20.447  1.00 45.45  ? 201 VAL B CG2 1 
ATOM   4571 N  N   . GLY B  1 202 ? 29.445  66.562  20.284  1.00 45.86  ? 202 GLY B N   1 
ATOM   4572 C  CA  . GLY B  1 202 ? 30.847  66.826  20.594  1.00 51.43  ? 202 GLY B CA  1 
ATOM   4573 C  C   . GLY B  1 202 ? 31.716  66.929  19.348  1.00 53.66  ? 202 GLY B C   1 
ATOM   4574 O  O   . GLY B  1 202 ? 31.500  67.832  18.541  1.00 58.57  ? 202 GLY B O   1 
ATOM   4575 N  N   . PRO B  1 203 ? 32.691  66.004  19.175  1.00 54.71  ? 203 PRO B N   1 
ATOM   4576 C  CA  . PRO B  1 203 ? 33.573  66.037  17.994  1.00 58.04  ? 203 PRO B CA  1 
ATOM   4577 C  C   . PRO B  1 203 ? 32.838  66.003  16.656  1.00 62.16  ? 203 PRO B C   1 
ATOM   4578 O  O   . PRO B  1 203 ? 33.275  66.638  15.694  1.00 68.91  ? 203 PRO B O   1 
ATOM   4579 C  CB  . PRO B  1 203 ? 34.414  64.764  18.141  1.00 56.36  ? 203 PRO B CB  1 
ATOM   4580 C  CG  . PRO B  1 203 ? 34.373  64.436  19.585  1.00 57.30  ? 203 PRO B CG  1 
ATOM   4581 C  CD  . PRO B  1 203 ? 33.028  64.876  20.066  1.00 53.55  ? 203 PRO B CD  1 
ATOM   4582 N  N   . LEU B  1 204 ? 31.725  65.274  16.618  1.00 64.01  ? 204 LEU B N   1 
ATOM   4583 C  CA  . LEU B  1 204 ? 30.942  65.085  15.397  1.00 60.23  ? 204 LEU B CA  1 
ATOM   4584 C  C   . LEU B  1 204 ? 29.987  66.239  15.042  1.00 58.98  ? 204 LEU B C   1 
ATOM   4585 O  O   . LEU B  1 204 ? 29.225  66.122  14.077  1.00 62.89  ? 204 LEU B O   1 
ATOM   4586 C  CB  . LEU B  1 204 ? 30.174  63.758  15.490  1.00 53.86  ? 204 LEU B CB  1 
ATOM   4587 C  CG  . LEU B  1 204 ? 31.024  62.508  15.769  1.00 48.21  ? 204 LEU B CG  1 
ATOM   4588 C  CD1 . LEU B  1 204 ? 30.154  61.264  15.825  1.00 48.80  ? 204 LEU B CD1 1 
ATOM   4589 C  CD2 . LEU B  1 204 ? 32.113  62.321  14.724  1.00 46.01  ? 204 LEU B CD2 1 
ATOM   4590 N  N   . ARG B  1 205 ? 30.031  67.344  15.791  1.00 54.48  ? 205 ARG B N   1 
ATOM   4591 C  CA  . ARG B  1 205 ? 29.190  68.504  15.494  1.00 55.06  ? 205 ARG B CA  1 
ATOM   4592 C  C   . ARG B  1 205 ? 29.698  69.257  14.268  1.00 54.83  ? 205 ARG B C   1 
ATOM   4593 O  O   . ARG B  1 205 ? 30.907  69.382  14.061  1.00 52.92  ? 205 ARG B O   1 
ATOM   4594 C  CB  . ARG B  1 205 ? 29.097  69.451  16.688  1.00 53.16  ? 205 ARG B CB  1 
ATOM   4595 C  CG  . ARG B  1 205 ? 28.007  70.504  16.511  1.00 53.88  ? 205 ARG B CG  1 
ATOM   4596 C  CD  . ARG B  1 205 ? 27.439  70.991  17.834  1.00 54.66  ? 205 ARG B CD  1 
ATOM   4597 N  NE  . ARG B  1 205 ? 28.048  72.223  18.320  1.00 52.07  ? 205 ARG B NE  1 
ATOM   4598 C  CZ  . ARG B  1 205 ? 27.826  72.759  19.521  1.00 53.89  ? 205 ARG B CZ  1 
ATOM   4599 N  NH1 . ARG B  1 205 ? 27.012  72.179  20.406  1.00 48.69  ? 205 ARG B NH1 1 
ATOM   4600 N  NH2 . ARG B  1 205 ? 28.433  73.890  19.847  1.00 56.74  ? 205 ARG B NH2 1 
ATOM   4601 N  N   . PHE B  1 206 ? 28.748  69.725  13.456  1.00 50.50  ? 206 PHE B N   1 
ATOM   4602 C  CA  . PHE B  1 206 ? 28.992  70.351  12.139  1.00 51.83  ? 206 PHE B CA  1 
ATOM   4603 C  C   . PHE B  1 206 ? 29.485  69.401  11.033  1.00 52.92  ? 206 PHE B C   1 
ATOM   4604 O  O   . PHE B  1 206 ? 29.337  69.715  9.850   1.00 62.95  ? 206 PHE B O   1 
ATOM   4605 C  CB  . PHE B  1 206 ? 29.926  71.564  12.245  1.00 51.48  ? 206 PHE B CB  1 
ATOM   4606 C  CG  . PHE B  1 206 ? 29.549  72.525  13.337  1.00 53.27  ? 206 PHE B CG  1 
ATOM   4607 C  CD1 . PHE B  1 206 ? 28.339  73.211  13.290  1.00 54.40  ? 206 PHE B CD1 1 
ATOM   4608 C  CD2 . PHE B  1 206 ? 30.402  72.745  14.414  1.00 57.13  ? 206 PHE B CD2 1 
ATOM   4609 C  CE1 . PHE B  1 206 ? 27.986  74.097  14.297  1.00 53.18  ? 206 PHE B CE1 1 
ATOM   4610 C  CE2 . PHE B  1 206 ? 30.057  73.631  15.421  1.00 56.33  ? 206 PHE B CE2 1 
ATOM   4611 C  CZ  . PHE B  1 206 ? 28.848  74.308  15.362  1.00 55.34  ? 206 PHE B CZ  1 
ATOM   4612 N  N   . ARG B  1 207 ? 30.058  68.256  11.409  1.00 53.85  ? 207 ARG B N   1 
ATOM   4613 C  CA  . ARG B  1 207 ? 30.523  67.254  10.458  1.00 55.58  ? 207 ARG B CA  1 
ATOM   4614 C  C   . ARG B  1 207 ? 29.354  66.424  9.957   1.00 53.25  ? 207 ARG B C   1 
ATOM   4615 O  O   . ARG B  1 207 ? 28.259  66.465  10.522  1.00 50.17  ? 207 ARG B O   1 
ATOM   4616 C  CB  . ARG B  1 207 ? 31.545  66.325  11.116  1.00 58.67  ? 207 ARG B CB  1 
ATOM   4617 C  CG  . ARG B  1 207 ? 32.758  67.037  11.693  1.00 62.04  ? 207 ARG B CG  1 
ATOM   4618 C  CD  . ARG B  1 207 ? 33.661  66.081  12.455  1.00 61.71  ? 207 ARG B CD  1 
ATOM   4619 N  NE  . ARG B  1 207 ? 34.801  66.770  13.060  1.00 62.15  ? 207 ARG B NE  1 
ATOM   4620 C  CZ  . ARG B  1 207 ? 35.829  66.173  13.668  1.00 62.13  ? 207 ARG B CZ  1 
ATOM   4621 N  NH1 . ARG B  1 207 ? 35.894  64.845  13.770  1.00 64.64  ? 207 ARG B NH1 1 
ATOM   4622 N  NH2 . ARG B  1 207 ? 36.808  66.914  14.181  1.00 64.05  ? 207 ARG B NH2 1 
ATOM   4623 N  N   . HIS B  1 208 ? 29.605  65.659  8.899   1.00 52.61  ? 208 HIS B N   1 
ATOM   4624 C  CA  . HIS B  1 208 ? 28.590  64.778  8.314   1.00 51.60  ? 208 HIS B CA  1 
ATOM   4625 C  C   . HIS B  1 208 ? 28.344  63.591  9.257   1.00 50.61  ? 208 HIS B C   1 
ATOM   4626 O  O   . HIS B  1 208 ? 29.224  63.251  10.056  1.00 52.90  ? 208 HIS B O   1 
ATOM   4627 C  CB  . HIS B  1 208 ? 29.030  64.286  6.927   1.00 51.26  ? 208 HIS B CB  1 
ATOM   4628 C  CG  . HIS B  1 208 ? 29.266  65.384  5.936   1.00 49.90  ? 208 HIS B CG  1 
ATOM   4629 N  ND1 . HIS B  1 208 ? 29.965  65.188  4.765   1.00 49.24  ? 208 HIS B ND1 1 
ATOM   4630 C  CD2 . HIS B  1 208 ? 28.916  66.692  5.951   1.00 49.16  ? 208 HIS B CD2 1 
ATOM   4631 C  CE1 . HIS B  1 208 ? 30.029  66.326  4.097   1.00 51.40  ? 208 HIS B CE1 1 
ATOM   4632 N  NE2 . HIS B  1 208 ? 29.397  67.254  4.793   1.00 48.69  ? 208 HIS B NE2 1 
ATOM   4633 N  N   . PRO B  1 209 ? 27.157  62.957  9.173   1.00 49.72  ? 209 PRO B N   1 
ATOM   4634 C  CA  . PRO B  1 209 ? 26.834  61.900  10.130  1.00 49.08  ? 209 PRO B CA  1 
ATOM   4635 C  C   . PRO B  1 209 ? 27.576  60.593  9.875   1.00 49.49  ? 209 PRO B C   1 
ATOM   4636 O  O   . PRO B  1 209 ? 27.944  60.292  8.735   1.00 50.71  ? 209 PRO B O   1 
ATOM   4637 C  CB  . PRO B  1 209 ? 25.341  61.683  9.903   1.00 48.02  ? 209 PRO B CB  1 
ATOM   4638 C  CG  . PRO B  1 209 ? 25.184  61.939  8.450   1.00 51.02  ? 209 PRO B CG  1 
ATOM   4639 C  CD  . PRO B  1 209 ? 26.079  63.117  8.179   1.00 51.02  ? 209 PRO B CD  1 
ATOM   4640 N  N   . ARG B  1 210 ? 27.779  59.839  10.949  1.00 49.33  ? 210 ARG B N   1 
ATOM   4641 C  CA  . ARG B  1 210 ? 28.263  58.461  10.887  1.00 45.82  ? 210 ARG B CA  1 
ATOM   4642 C  C   . ARG B  1 210 ? 27.030  57.578  11.090  1.00 47.99  ? 210 ARG B C   1 
ATOM   4643 O  O   . ARG B  1 210 ? 26.101  57.994  11.787  1.00 52.51  ? 210 ARG B O   1 
ATOM   4644 C  CB  . ARG B  1 210 ? 29.301  58.180  11.989  1.00 44.54  ? 210 ARG B CB  1 
ATOM   4645 C  CG  . ARG B  1 210 ? 30.232  59.339  12.347  1.00 43.05  ? 210 ARG B CG  1 
ATOM   4646 C  CD  . ARG B  1 210 ? 30.995  59.838  11.135  1.00 43.86  ? 210 ARG B CD  1 
ATOM   4647 N  NE  . ARG B  1 210 ? 31.557  61.178  11.314  1.00 45.45  ? 210 ARG B NE  1 
ATOM   4648 C  CZ  . ARG B  1 210 ? 32.857  61.483  11.417  1.00 48.23  ? 210 ARG B CZ  1 
ATOM   4649 N  NH1 . ARG B  1 210 ? 33.814  60.551  11.382  1.00 52.15  ? 210 ARG B NH1 1 
ATOM   4650 N  NH2 . ARG B  1 210 ? 33.204  62.757  11.570  1.00 48.68  ? 210 ARG B NH2 1 
ATOM   4651 N  N   . PRO B  1 211 ? 27.003  56.364  10.495  1.00 49.07  ? 211 PRO B N   1 
ATOM   4652 C  CA  . PRO B  1 211 ? 25.870  55.457  10.752  1.00 46.93  ? 211 PRO B CA  1 
ATOM   4653 C  C   . PRO B  1 211 ? 25.777  55.018  12.210  1.00 51.05  ? 211 PRO B C   1 
ATOM   4654 O  O   . PRO B  1 211 ? 26.750  55.138  12.959  1.00 59.29  ? 211 PRO B O   1 
ATOM   4655 C  CB  . PRO B  1 211 ? 26.169  54.242  9.865   1.00 48.95  ? 211 PRO B CB  1 
ATOM   4656 C  CG  . PRO B  1 211 ? 27.176  54.706  8.878   1.00 52.34  ? 211 PRO B CG  1 
ATOM   4657 C  CD  . PRO B  1 211 ? 27.979  55.758  9.573   1.00 50.13  ? 211 PRO B CD  1 
ATOM   4658 N  N   . ALA B  1 212 ? 24.617  54.494  12.594  1.00 54.71  ? 212 ALA B N   1 
ATOM   4659 C  CA  . ALA B  1 212 ? 24.357  54.141  13.992  1.00 56.90  ? 212 ALA B CA  1 
ATOM   4660 C  C   . ALA B  1 212 ? 25.164  52.917  14.421  1.00 57.26  ? 212 ALA B C   1 
ATOM   4661 O  O   . ALA B  1 212 ? 25.383  52.004  13.626  1.00 55.13  ? 212 ALA B O   1 
ATOM   4662 C  CB  . ALA B  1 212 ? 22.871  53.896  14.214  1.00 53.48  ? 212 ALA B CB  1 
ATOM   4663 N  N   . GLU B  1 213 ? 25.623  52.925  15.672  1.00 59.98  ? 213 GLU B N   1 
ATOM   4664 C  CA  . GLU B  1 213 ? 26.239  51.746  16.284  1.00 66.65  ? 213 GLU B CA  1 
ATOM   4665 C  C   . GLU B  1 213 ? 25.163  50.691  16.510  1.00 66.97  ? 213 GLU B C   1 
ATOM   4666 O  O   . GLU B  1 213 ? 24.043  51.023  16.910  1.00 69.34  ? 213 GLU B O   1 
ATOM   4667 C  CB  . GLU B  1 213 ? 26.900  52.102  17.619  1.00 74.00  ? 213 GLU B CB  1 
ATOM   4668 C  CG  . GLU B  1 213 ? 28.190  52.901  17.490  1.00 80.75  ? 213 GLU B CG  1 
ATOM   4669 C  CD  . GLU B  1 213 ? 28.675  53.468  18.815  1.00 88.35  ? 213 GLU B CD  1 
ATOM   4670 O  OE1 . GLU B  1 213 ? 28.363  52.886  19.877  1.00 83.72  ? 213 GLU B OE1 1 
ATOM   4671 O  OE2 . GLU B  1 213 ? 29.379  54.499  18.794  1.00 92.97  ? 213 GLU B OE2 1 
ATOM   4672 N  N   . LYS B  1 214 ? 25.500  49.429  16.248  1.00 64.16  ? 214 LYS B N   1 
ATOM   4673 C  CA  . LYS B  1 214 ? 24.528  48.346  16.381  1.00 61.47  ? 214 LYS B CA  1 
ATOM   4674 C  C   . LYS B  1 214 ? 24.179  48.099  17.850  1.00 61.21  ? 214 LYS B C   1 
ATOM   4675 O  O   . LYS B  1 214 ? 25.052  48.128  18.722  1.00 52.08  ? 214 LYS B O   1 
ATOM   4676 C  CB  . LYS B  1 214 ? 24.992  47.056  15.676  1.00 60.65  ? 214 LYS B CB  1 
ATOM   4677 C  CG  . LYS B  1 214 ? 26.059  46.222  16.377  1.00 60.66  ? 214 LYS B CG  1 
ATOM   4678 C  CD  . LYS B  1 214 ? 26.260  44.905  15.641  1.00 63.77  ? 214 LYS B CD  1 
ATOM   4679 C  CE  . LYS B  1 214 ? 27.409  44.092  16.213  1.00 64.37  ? 214 LYS B CE  1 
ATOM   4680 N  NZ  . LYS B  1 214 ? 27.714  42.905  15.367  1.00 59.71  ? 214 LYS B NZ  1 
ATOM   4681 N  N   . TRP B  1 215 ? 22.894  47.866  18.095  1.00 62.58  ? 215 TRP B N   1 
ATOM   4682 C  CA  . TRP B  1 215 ? 22.359  47.702  19.448  1.00 62.31  ? 215 TRP B CA  1 
ATOM   4683 C  C   . TRP B  1 215 ? 21.952  46.255  19.674  1.00 67.46  ? 215 TRP B C   1 
ATOM   4684 O  O   . TRP B  1 215 ? 21.706  45.503  18.725  1.00 54.53  ? 215 TRP B O   1 
ATOM   4685 C  CB  . TRP B  1 215 ? 21.167  48.638  19.708  1.00 60.38  ? 215 TRP B CB  1 
ATOM   4686 C  CG  . TRP B  1 215 ? 20.016  48.452  18.762  1.00 55.50  ? 215 TRP B CG  1 
ATOM   4687 C  CD1 . TRP B  1 215 ? 18.996  47.552  18.874  1.00 52.60  ? 215 TRP B CD1 1 
ATOM   4688 C  CD2 . TRP B  1 215 ? 19.778  49.179  17.553  1.00 49.06  ? 215 TRP B CD2 1 
ATOM   4689 N  NE1 . TRP B  1 215 ? 18.139  47.673  17.810  1.00 51.35  ? 215 TRP B NE1 1 
ATOM   4690 C  CE2 . TRP B  1 215 ? 18.593  48.665  16.983  1.00 49.36  ? 215 TRP B CE2 1 
ATOM   4691 C  CE3 . TRP B  1 215 ? 20.452  50.215  16.894  1.00 46.32  ? 215 TRP B CE3 1 
ATOM   4692 C  CZ2 . TRP B  1 215 ? 18.064  49.153  15.784  1.00 49.63  ? 215 TRP B CZ2 1 
ATOM   4693 C  CZ3 . TRP B  1 215 ? 19.926  50.703  15.701  1.00 49.00  ? 215 TRP B CZ3 1 
ATOM   4694 C  CH2 . TRP B  1 215 ? 18.742  50.169  15.160  1.00 50.57  ? 215 TRP B CH2 1 
ATOM   4695 N  N   . THR B  1 216 ? 21.868  45.897  20.950  1.00 78.55  ? 216 THR B N   1 
ATOM   4696 C  CA  . THR B  1 216 ? 21.559  44.532  21.383  1.00 78.26  ? 216 THR B CA  1 
ATOM   4697 C  C   . THR B  1 216 ? 20.124  44.458  21.904  1.00 73.14  ? 216 THR B C   1 
ATOM   4698 O  O   . THR B  1 216 ? 19.585  45.442  22.422  1.00 67.10  ? 216 THR B O   1 
ATOM   4699 C  CB  . THR B  1 216 ? 22.567  44.010  22.445  1.00 82.51  ? 216 THR B CB  1 
ATOM   4700 O  OG1 . THR B  1 216 ? 22.307  42.627  22.718  1.00 94.73  ? 216 THR B OG1 1 
ATOM   4701 C  CG2 . THR B  1 216 ? 22.515  44.811  23.764  1.00 77.05  ? 216 THR B CG2 1 
ATOM   4702 N  N   . GLY B  1 217 ? 19.516  43.286  21.751  1.00 66.24  ? 217 GLY B N   1 
ATOM   4703 C  CA  . GLY B  1 217 ? 18.140  43.057  22.185  1.00 65.74  ? 217 GLY B CA  1 
ATOM   4704 C  C   . GLY B  1 217 ? 17.147  43.639  21.196  1.00 59.51  ? 217 GLY B C   1 
ATOM   4705 O  O   . GLY B  1 217 ? 17.310  43.480  19.985  1.00 64.83  ? 217 GLY B O   1 
ATOM   4706 N  N   . VAL B  1 218 ? 16.120  44.309  21.720  1.00 52.72  ? 218 VAL B N   1 
ATOM   4707 C  CA  . VAL B  1 218 ? 15.063  44.922  20.908  1.00 49.94  ? 218 VAL B CA  1 
ATOM   4708 C  C   . VAL B  1 218 ? 14.807  46.341  21.408  1.00 50.50  ? 218 VAL B C   1 
ATOM   4709 O  O   . VAL B  1 218 ? 14.382  46.541  22.549  1.00 48.36  ? 218 VAL B O   1 
ATOM   4710 C  CB  . VAL B  1 218 ? 13.752  44.101  20.958  1.00 48.76  ? 218 VAL B CB  1 
ATOM   4711 C  CG1 . VAL B  1 218 ? 12.611  44.819  20.238  1.00 49.04  ? 218 VAL B CG1 1 
ATOM   4712 C  CG2 . VAL B  1 218 ? 13.962  42.725  20.344  1.00 46.70  ? 218 VAL B CG2 1 
ATOM   4713 N  N   . LEU B  1 219 ? 15.065  47.313  20.538  1.00 55.21  ? 219 LEU B N   1 
ATOM   4714 C  CA  . LEU B  1 219 ? 14.828  48.725  20.821  1.00 58.33  ? 219 LEU B CA  1 
ATOM   4715 C  C   . LEU B  1 219 ? 13.347  49.063  20.641  1.00 60.45  ? 219 LEU B C   1 
ATOM   4716 O  O   . LEU B  1 219 ? 12.778  48.815  19.580  1.00 51.74  ? 219 LEU B O   1 
ATOM   4717 C  CB  . LEU B  1 219 ? 15.682  49.578  19.880  1.00 59.35  ? 219 LEU B CB  1 
ATOM   4718 C  CG  . LEU B  1 219 ? 15.627  51.103  20.003  1.00 61.16  ? 219 LEU B CG  1 
ATOM   4719 C  CD1 . LEU B  1 219 ? 16.230  51.567  21.319  1.00 63.00  ? 219 LEU B CD1 1 
ATOM   4720 C  CD2 . LEU B  1 219 ? 16.362  51.742  18.836  1.00 64.18  ? 219 LEU B CD2 1 
ATOM   4721 N  N   . ASN B  1 220 ? 12.733  49.637  21.675  1.00 66.21  ? 220 ASN B N   1 
ATOM   4722 C  CA  . ASN B  1 220 ? 11.325  50.052  21.617  1.00 68.63  ? 220 ASN B CA  1 
ATOM   4723 C  C   . ASN B  1 220 ? 11.212  51.341  20.808  1.00 62.45  ? 220 ASN B C   1 
ATOM   4724 O  O   . ASN B  1 220 ? 11.382  52.438  21.351  1.00 64.86  ? 220 ASN B O   1 
ATOM   4725 C  CB  . ASN B  1 220 ? 10.740  50.269  23.024  1.00 73.21  ? 220 ASN B CB  1 
ATOM   4726 C  CG  . ASN B  1 220 ? 10.556  48.974  23.805  1.00 76.74  ? 220 ASN B CG  1 
ATOM   4727 O  OD1 . ASN B  1 220 ? 10.841  47.879  23.307  1.00 73.54  ? 220 ASN B OD1 1 
ATOM   4728 N  ND2 . ASN B  1 220 ? 10.073  49.106  25.053  1.00 86.20  ? 220 ASN B ND2 1 
ATOM   4729 N  N   . THR B  1 221 ? 10.933  51.199  19.514  1.00 58.87  ? 221 THR B N   1 
ATOM   4730 C  CA  . THR B  1 221 ? 10.790  52.354  18.615  1.00 58.34  ? 221 THR B CA  1 
ATOM   4731 C  C   . THR B  1 221 ? 9.323   52.814  18.571  1.00 56.28  ? 221 THR B C   1 
ATOM   4732 O  O   . THR B  1 221 ? 8.625   52.679  17.566  1.00 57.61  ? 221 THR B O   1 
ATOM   4733 C  CB  . THR B  1 221 ? 11.402  52.088  17.213  1.00 59.80  ? 221 THR B CB  1 
ATOM   4734 O  OG1 . THR B  1 221 ? 11.468  53.316  16.480  1.00 72.76  ? 221 THR B OG1 1 
ATOM   4735 C  CG2 . THR B  1 221 ? 10.618  51.057  16.400  1.00 61.88  ? 221 THR B CG2 1 
ATOM   4736 N  N   . THR B  1 222 ? 8.884   53.402  19.677  1.00 52.07  ? 222 THR B N   1 
ATOM   4737 C  CA  . THR B  1 222 ? 7.459   53.711  19.893  1.00 53.78  ? 222 THR B CA  1 
ATOM   4738 C  C   . THR B  1 222 ? 7.121   55.180  20.215  1.00 49.69  ? 222 THR B C   1 
ATOM   4739 O  O   . THR B  1 222 ? 5.982   55.605  20.004  1.00 49.57  ? 222 THR B O   1 
ATOM   4740 C  CB  . THR B  1 222 ? 6.865   52.774  20.971  1.00 61.84  ? 222 THR B CB  1 
ATOM   4741 O  OG1 . THR B  1 222 ? 5.472   53.058  21.142  1.00 76.20  ? 222 THR B OG1 1 
ATOM   4742 C  CG2 . THR B  1 222 ? 7.603   52.903  22.315  1.00 65.69  ? 222 THR B CG2 1 
ATOM   4743 N  N   . THR B  1 223 ? 8.095   55.936  20.720  1.00 46.64  ? 223 THR B N   1 
ATOM   4744 C  CA  . THR B  1 223 ? 7.927   57.355  21.058  1.00 46.26  ? 223 THR B CA  1 
ATOM   4745 C  C   . THR B  1 223 ? 8.442   58.248  19.920  1.00 46.33  ? 223 THR B C   1 
ATOM   4746 O  O   . THR B  1 223 ? 9.491   57.943  19.343  1.00 46.42  ? 223 THR B O   1 
ATOM   4747 C  CB  . THR B  1 223 ? 8.698   57.690  22.354  1.00 46.41  ? 223 THR B CB  1 
ATOM   4748 O  OG1 . THR B  1 223 ? 8.426   56.695  23.350  1.00 50.22  ? 223 THR B OG1 1 
ATOM   4749 C  CG2 . THR B  1 223 ? 8.311   59.061  22.900  1.00 45.62  ? 223 THR B CG2 1 
ATOM   4750 N  N   . PRO B  1 224 ? 7.718   59.350  19.592  1.00 51.59  ? 224 PRO B N   1 
ATOM   4751 C  CA  . PRO B  1 224 ? 8.229   60.256  18.549  1.00 51.27  ? 224 PRO B CA  1 
ATOM   4752 C  C   . PRO B  1 224 ? 9.569   60.904  18.928  1.00 46.68  ? 224 PRO B C   1 
ATOM   4753 O  O   . PRO B  1 224 ? 9.750   61.286  20.087  1.00 42.84  ? 224 PRO B O   1 
ATOM   4754 C  CB  . PRO B  1 224 ? 7.126   61.319  18.414  1.00 50.73  ? 224 PRO B CB  1 
ATOM   4755 C  CG  . PRO B  1 224 ? 6.303   61.204  19.646  1.00 52.69  ? 224 PRO B CG  1 
ATOM   4756 C  CD  . PRO B  1 224 ? 6.382   59.768  20.060  1.00 53.03  ? 224 PRO B CD  1 
ATOM   4757 N  N   . PRO B  1 225 ? 10.499  61.024  17.958  1.00 47.59  ? 225 PRO B N   1 
ATOM   4758 C  CA  . PRO B  1 225 ? 11.860  61.473  18.248  1.00 46.81  ? 225 PRO B CA  1 
ATOM   4759 C  C   . PRO B  1 225 ? 11.980  62.937  18.647  1.00 45.31  ? 225 PRO B C   1 
ATOM   4760 O  O   . PRO B  1 225 ? 11.054  63.729  18.454  1.00 43.95  ? 225 PRO B O   1 
ATOM   4761 C  CB  . PRO B  1 225 ? 12.586  61.246  16.919  1.00 49.52  ? 225 PRO B CB  1 
ATOM   4762 C  CG  . PRO B  1 225 ? 11.522  61.398  15.893  1.00 48.37  ? 225 PRO B CG  1 
ATOM   4763 C  CD  . PRO B  1 225 ? 10.320  60.758  16.518  1.00 49.01  ? 225 PRO B CD  1 
ATOM   4764 N  N   . ASN B  1 226 ? 13.140  63.271  19.198  1.00 42.24  ? 226 ASN B N   1 
ATOM   4765 C  CA  . ASN B  1 226 ? 13.479  64.646  19.539  1.00 41.55  ? 226 ASN B CA  1 
ATOM   4766 C  C   . ASN B  1 226 ? 13.645  65.461  18.265  1.00 41.69  ? 226 ASN B C   1 
ATOM   4767 O  O   . ASN B  1 226 ? 14.299  65.014  17.318  1.00 38.70  ? 226 ASN B O   1 
ATOM   4768 C  CB  . ASN B  1 226 ? 14.791  64.702  20.330  1.00 43.61  ? 226 ASN B CB  1 
ATOM   4769 C  CG  . ASN B  1 226 ? 14.713  63.977  21.663  1.00 44.91  ? 226 ASN B CG  1 
ATOM   4770 O  OD1 . ASN B  1 226 ? 13.647  63.528  22.088  1.00 53.67  ? 226 ASN B OD1 1 
ATOM   4771 N  ND2 . ASN B  1 226 ? 15.854  63.858  22.332  1.00 44.28  ? 226 ASN B ND2 1 
ATOM   4772 N  N   . SER B  1 227 ? 13.043  66.647  18.242  1.00 43.06  ? 227 SER B N   1 
ATOM   4773 C  CA  . SER B  1 227 ? 13.284  67.606  17.173  1.00 42.80  ? 227 SER B CA  1 
ATOM   4774 C  C   . SER B  1 227 ? 14.695  68.162  17.324  1.00 46.33  ? 227 SER B C   1 
ATOM   4775 O  O   . SER B  1 227 ? 15.200  68.287  18.442  1.00 49.07  ? 227 SER B O   1 
ATOM   4776 C  CB  . SER B  1 227 ? 12.271  68.748  17.234  1.00 41.20  ? 227 SER B CB  1 
ATOM   4777 O  OG  . SER B  1 227 ? 10.942  68.261  17.158  1.00 40.90  ? 227 SER B OG  1 
ATOM   4778 N  N   . CYS B  1 228 ? 15.331  68.476  16.200  1.00 48.95  ? 228 CYS B N   1 
ATOM   4779 C  CA  . CYS B  1 228 ? 16.673  69.056  16.212  1.00 48.61  ? 228 CYS B CA  1 
ATOM   4780 C  C   . CYS B  1 228 ? 16.634  70.484  16.743  1.00 50.82  ? 228 CYS B C   1 
ATOM   4781 O  O   . CYS B  1 228 ? 15.602  71.156  16.667  1.00 52.19  ? 228 CYS B O   1 
ATOM   4782 C  CB  . CYS B  1 228 ? 17.294  69.030  14.814  1.00 49.80  ? 228 CYS B CB  1 
ATOM   4783 S  SG  . CYS B  1 228 ? 17.527  67.373  14.126  1.00 52.48  ? 228 CYS B SG  1 
ATOM   4784 N  N   . VAL B  1 229 ? 17.769  70.930  17.275  1.00 49.58  ? 229 VAL B N   1 
ATOM   4785 C  CA  . VAL B  1 229 ? 17.880  72.236  17.928  1.00 47.14  ? 229 VAL B CA  1 
ATOM   4786 C  C   . VAL B  1 229 ? 17.568  73.361  16.940  1.00 48.35  ? 229 VAL B C   1 
ATOM   4787 O  O   . VAL B  1 229 ? 18.149  73.427  15.855  1.00 49.21  ? 229 VAL B O   1 
ATOM   4788 C  CB  . VAL B  1 229 ? 19.284  72.448  18.540  1.00 44.83  ? 229 VAL B CB  1 
ATOM   4789 C  CG1 . VAL B  1 229 ? 19.455  73.870  19.068  1.00 46.44  ? 229 VAL B CG1 1 
ATOM   4790 C  CG2 . VAL B  1 229 ? 19.533  71.446  19.658  1.00 44.75  ? 229 VAL B CG2 1 
ATOM   4791 N  N   . GLN B  1 230 ? 16.646  74.234  17.336  1.00 53.84  ? 230 GLN B N   1 
ATOM   4792 C  CA  . GLN B  1 230 ? 16.213  75.364  16.517  1.00 59.12  ? 230 GLN B CA  1 
ATOM   4793 C  C   . GLN B  1 230 ? 15.557  76.432  17.393  1.00 63.47  ? 230 GLN B C   1 
ATOM   4794 O  O   . GLN B  1 230 ? 15.400  76.243  18.604  1.00 61.27  ? 230 GLN B O   1 
ATOM   4795 C  CB  . GLN B  1 230 ? 15.240  74.890  15.430  1.00 57.14  ? 230 GLN B CB  1 
ATOM   4796 C  CG  . GLN B  1 230 ? 13.904  74.372  15.946  1.00 57.91  ? 230 GLN B CG  1 
ATOM   4797 C  CD  . GLN B  1 230 ? 13.126  73.627  14.883  1.00 63.00  ? 230 GLN B CD  1 
ATOM   4798 O  OE1 . GLN B  1 230 ? 12.098  74.105  14.402  1.00 62.27  ? 230 GLN B OE1 1 
ATOM   4799 N  NE2 . GLN B  1 230 ? 13.622  72.458  14.496  1.00 64.25  ? 230 GLN B NE2 1 
ATOM   4800 N  N   . ILE B  1 231 ? 15.176  77.548  16.773  1.00 69.46  ? 231 ILE B N   1 
ATOM   4801 C  CA  . ILE B  1 231 ? 14.452  78.619  17.473  1.00 71.65  ? 231 ILE B CA  1 
ATOM   4802 C  C   . ILE B  1 231 ? 12.950  78.341  17.551  1.00 71.12  ? 231 ILE B C   1 
ATOM   4803 O  O   . ILE B  1 231 ? 12.398  77.610  16.722  1.00 65.95  ? 231 ILE B O   1 
ATOM   4804 C  CB  . ILE B  1 231 ? 14.699  80.020  16.858  1.00 73.10  ? 231 ILE B CB  1 
ATOM   4805 C  CG1 . ILE B  1 231 ? 14.202  80.120  15.408  1.00 79.94  ? 231 ILE B CG1 1 
ATOM   4806 C  CG2 . ILE B  1 231 ? 16.177  80.369  16.942  1.00 71.85  ? 231 ILE B CG2 1 
ATOM   4807 C  CD1 . ILE B  1 231 ? 13.968  81.546  14.957  1.00 85.97  ? 231 ILE B CD1 1 
ATOM   4808 N  N   . VAL B  1 232 ? 12.311  78.941  18.554  1.00 73.61  ? 232 VAL B N   1 
ATOM   4809 C  CA  . VAL B  1 232 ? 10.852  78.856  18.744  1.00 66.95  ? 232 VAL B CA  1 
ATOM   4810 C  C   . VAL B  1 232 ? 10.211  80.193  18.353  1.00 64.34  ? 232 VAL B C   1 
ATOM   4811 O  O   . VAL B  1 232 ? 10.597  81.251  18.856  1.00 61.32  ? 232 VAL B O   1 
ATOM   4812 C  CB  . VAL B  1 232 ? 10.420  78.425  20.179  1.00 58.92  ? 232 VAL B CB  1 
ATOM   4813 C  CG1 . VAL B  1 232 ? 10.580  76.920  20.357  1.00 51.82  ? 232 VAL B CG1 1 
ATOM   4814 C  CG2 . VAL B  1 232 ? 11.170  79.175  21.277  1.00 60.38  ? 232 VAL B CG2 1 
ATOM   4815 N  N   . ASP B  1 233 ? 9.255   80.126  17.427  1.00 62.92  ? 233 ASP B N   1 
ATOM   4816 C  CA  . ASP B  1 233 ? 8.535   81.298  16.929  1.00 62.71  ? 233 ASP B CA  1 
ATOM   4817 C  C   . ASP B  1 233 ? 7.622   81.884  18.012  1.00 65.61  ? 233 ASP B C   1 
ATOM   4818 O  O   . ASP B  1 233 ? 6.520   81.379  18.253  1.00 63.15  ? 233 ASP B O   1 
ATOM   4819 C  CB  . ASP B  1 233 ? 7.729   80.910  15.679  1.00 62.23  ? 233 ASP B CB  1 
ATOM   4820 C  CG  . ASP B  1 233 ? 7.299   82.109  14.854  1.00 59.89  ? 233 ASP B CG  1 
ATOM   4821 O  OD1 . ASP B  1 233 ? 6.814   83.106  15.430  1.00 61.33  ? 233 ASP B OD1 1 
ATOM   4822 O  OD2 . ASP B  1 233 ? 7.435   82.040  13.614  1.00 59.09  ? 233 ASP B OD2 1 
ATOM   4823 N  N   . THR B  1 234 ? 8.104   82.939  18.668  1.00 68.19  ? 234 THR B N   1 
ATOM   4824 C  CA  . THR B  1 234 ? 7.343   83.655  19.699  1.00 67.29  ? 234 THR B CA  1 
ATOM   4825 C  C   . THR B  1 234 ? 7.428   85.174  19.490  1.00 66.91  ? 234 THR B C   1 
ATOM   4826 O  O   . THR B  1 234 ? 7.707   85.933  20.423  1.00 72.20  ? 234 THR B O   1 
ATOM   4827 C  CB  . THR B  1 234 ? 7.816   83.275  21.122  1.00 64.63  ? 234 THR B CB  1 
ATOM   4828 O  OG1 . THR B  1 234 ? 9.222   83.520  21.247  1.00 61.26  ? 234 THR B OG1 1 
ATOM   4829 C  CG2 . THR B  1 234 ? 7.526   81.807  21.417  1.00 61.81  ? 234 THR B CG2 1 
ATOM   4830 N  N   . VAL B  1 235 ? 7.189   85.599  18.249  1.00 68.77  ? 235 VAL B N   1 
ATOM   4831 C  CA  . VAL B  1 235 ? 6.986   87.018  17.917  1.00 67.86  ? 235 VAL B CA  1 
ATOM   4832 C  C   . VAL B  1 235 ? 5.488   87.363  18.025  1.00 69.54  ? 235 VAL B C   1 
ATOM   4833 O  O   . VAL B  1 235 ? 5.130   88.453  18.475  1.00 76.26  ? 235 VAL B O   1 
ATOM   4834 C  CB  . VAL B  1 235 ? 7.592   87.390  16.530  1.00 62.60  ? 235 VAL B CB  1 
ATOM   4835 C  CG1 . VAL B  1 235 ? 6.697   86.975  15.365  1.00 57.17  ? 235 VAL B CG1 1 
ATOM   4836 C  CG2 . VAL B  1 235 ? 7.899   88.881  16.457  1.00 63.03  ? 235 VAL B CG2 1 
ATOM   4837 N  N   . PHE B  1 236 ? 4.635   86.421  17.609  1.00 68.86  ? 236 PHE B N   1 
ATOM   4838 C  CA  . PHE B  1 236 ? 3.175   86.496  17.788  1.00 69.58  ? 236 PHE B CA  1 
ATOM   4839 C  C   . PHE B  1 236 ? 2.678   85.797  19.061  1.00 72.91  ? 236 PHE B C   1 
ATOM   4840 O  O   . PHE B  1 236 ? 1.477   85.812  19.347  1.00 84.89  ? 236 PHE B O   1 
ATOM   4841 C  CB  . PHE B  1 236 ? 2.464   85.893  16.569  1.00 71.66  ? 236 PHE B CB  1 
ATOM   4842 C  CG  . PHE B  1 236 ? 2.672   86.671  15.302  1.00 69.62  ? 236 PHE B CG  1 
ATOM   4843 C  CD1 . PHE B  1 236 ? 2.230   87.986  15.206  1.00 69.81  ? 236 PHE B CD1 1 
ATOM   4844 C  CD2 . PHE B  1 236 ? 3.300   86.094  14.199  1.00 70.76  ? 236 PHE B CD2 1 
ATOM   4845 C  CE1 . PHE B  1 236 ? 2.415   88.716  14.043  1.00 70.78  ? 236 PHE B CE1 1 
ATOM   4846 C  CE2 . PHE B  1 236 ? 3.486   86.822  13.031  1.00 73.50  ? 236 PHE B CE2 1 
ATOM   4847 C  CZ  . PHE B  1 236 ? 3.043   88.134  12.955  1.00 74.70  ? 236 PHE B CZ  1 
ATOM   4848 N  N   . GLY B  1 237 ? 3.591   85.183  19.811  1.00 75.05  ? 237 GLY B N   1 
ATOM   4849 C  CA  . GLY B  1 237 ? 3.262   84.550  21.085  1.00 72.42  ? 237 GLY B CA  1 
ATOM   4850 C  C   . GLY B  1 237 ? 2.696   83.163  20.859  1.00 71.69  ? 237 GLY B C   1 
ATOM   4851 O  O   . GLY B  1 237 ? 3.415   82.264  20.418  1.00 76.47  ? 237 GLY B O   1 
ATOM   4852 N  N   . ASP B  1 238 ? 1.408   82.997  21.156  1.00 74.33  ? 238 ASP B N   1 
ATOM   4853 C  CA  . ASP B  1 238 ? 0.722   81.708  21.006  1.00 80.44  ? 238 ASP B CA  1 
ATOM   4854 C  C   . ASP B  1 238 ? -0.423  81.812  19.992  1.00 82.09  ? 238 ASP B C   1 
ATOM   4855 O  O   . ASP B  1 238 ? -1.594  81.583  20.313  1.00 96.00  ? 238 ASP B O   1 
ATOM   4856 C  CB  . ASP B  1 238 ? 0.238   81.202  22.371  1.00 84.51  ? 238 ASP B CB  1 
ATOM   4857 C  CG  . ASP B  1 238 ? 1.388   80.835  23.298  1.00 85.86  ? 238 ASP B CG  1 
ATOM   4858 O  OD1 . ASP B  1 238 ? 2.238   80.009  22.902  1.00 83.27  ? 238 ASP B OD1 1 
ATOM   4859 O  OD2 . ASP B  1 238 ? 1.436   81.365  24.429  1.00 90.74  ? 238 ASP B OD2 1 
ATOM   4860 N  N   . PHE B  1 239 ? -0.051  82.172  18.766  1.00 78.06  ? 239 PHE B N   1 
ATOM   4861 C  CA  . PHE B  1 239 ? -0.952  82.173  17.614  1.00 75.73  ? 239 PHE B CA  1 
ATOM   4862 C  C   . PHE B  1 239 ? -0.932  80.763  17.002  1.00 78.78  ? 239 PHE B C   1 
ATOM   4863 O  O   . PHE B  1 239 ? 0.139   80.300  16.603  1.00 81.00  ? 239 PHE B O   1 
ATOM   4864 C  CB  . PHE B  1 239 ? -0.476  83.215  16.593  1.00 79.63  ? 239 PHE B CB  1 
ATOM   4865 C  CG  . PHE B  1 239 ? -1.536  83.639  15.614  1.00 85.71  ? 239 PHE B CG  1 
ATOM   4866 C  CD1 . PHE B  1 239 ? -2.553  84.506  16.006  1.00 88.46  ? 239 PHE B CD1 1 
ATOM   4867 C  CD2 . PHE B  1 239 ? -1.518  83.184  14.297  1.00 86.45  ? 239 PHE B CD2 1 
ATOM   4868 C  CE1 . PHE B  1 239 ? -3.536  84.900  15.110  1.00 89.19  ? 239 PHE B CE1 1 
ATOM   4869 C  CE2 . PHE B  1 239 ? -2.497  83.579  13.395  1.00 86.76  ? 239 PHE B CE2 1 
ATOM   4870 C  CZ  . PHE B  1 239 ? -3.507  84.439  13.802  1.00 86.15  ? 239 PHE B CZ  1 
ATOM   4871 N  N   . PRO B  1 240 ? -2.093  80.061  16.948  1.00 93.10  ? 240 PRO B N   1 
ATOM   4872 C  CA  . PRO B  1 240 ? -2.135  78.675  16.427  1.00 95.96  ? 240 PRO B CA  1 
ATOM   4873 C  C   . PRO B  1 240 ? -1.520  78.443  15.037  1.00 93.40  ? 240 PRO B C   1 
ATOM   4874 O  O   . PRO B  1 240 ? -0.925  77.389  14.799  1.00 95.18  ? 240 PRO B O   1 
ATOM   4875 C  CB  . PRO B  1 240 ? -3.634  78.361  16.395  1.00 101.03 ? 240 PRO B CB  1 
ATOM   4876 C  CG  . PRO B  1 240 ? -4.209  79.200  17.477  1.00 106.85 ? 240 PRO B CG  1 
ATOM   4877 C  CD  . PRO B  1 240 ? -3.411  80.472  17.473  1.00 103.79 ? 240 PRO B CD  1 
ATOM   4878 N  N   . GLY B  1 241 ? -1.674  79.416  14.142  1.00 88.11  ? 241 GLY B N   1 
ATOM   4879 C  CA  . GLY B  1 241 ? -1.098  79.357  12.792  1.00 83.86  ? 241 GLY B CA  1 
ATOM   4880 C  C   . GLY B  1 241 ? 0.425   79.391  12.724  1.00 84.58  ? 241 GLY B C   1 
ATOM   4881 O  O   . GLY B  1 241 ? 1.016   78.877  11.769  1.00 92.66  ? 241 GLY B O   1 
ATOM   4882 N  N   . ALA B  1 242 ? 1.050   80.005  13.729  1.00 79.52  ? 242 ALA B N   1 
ATOM   4883 C  CA  . ALA B  1 242 ? 2.516   80.079  13.853  1.00 73.12  ? 242 ALA B CA  1 
ATOM   4884 C  C   . ALA B  1 242 ? 3.109   78.949  14.708  1.00 74.08  ? 242 ALA B C   1 
ATOM   4885 O  O   . ALA B  1 242 ? 4.159   78.397  14.368  1.00 70.19  ? 242 ALA B O   1 
ATOM   4886 C  CB  . ALA B  1 242 ? 2.914   81.429  14.428  1.00 72.00  ? 242 ALA B CB  1 
ATOM   4887 N  N   . THR B  1 243 ? 2.441   78.624  15.816  1.00 75.68  ? 243 THR B N   1 
ATOM   4888 C  CA  . THR B  1 243 ? 2.895   77.575  16.747  1.00 70.82  ? 243 THR B CA  1 
ATOM   4889 C  C   . THR B  1 243 ? 2.771   76.136  16.227  1.00 74.00  ? 243 THR B C   1 
ATOM   4890 O  O   . THR B  1 243 ? 3.382   75.225  16.793  1.00 72.40  ? 243 THR B O   1 
ATOM   4891 C  CB  . THR B  1 243 ? 2.164   77.662  18.103  1.00 62.89  ? 243 THR B CB  1 
ATOM   4892 O  OG1 . THR B  1 243 ? 0.749   77.583  17.897  1.00 57.94  ? 243 THR B OG1 1 
ATOM   4893 C  CG2 . THR B  1 243 ? 2.501   78.962  18.816  1.00 61.86  ? 243 THR B CG2 1 
ATOM   4894 N  N   . MET B  1 244 ? 1.983   75.925  15.171  1.00 73.81  ? 244 MET B N   1 
ATOM   4895 C  CA  . MET B  1 244 ? 1.900   74.607  14.512  1.00 74.31  ? 244 MET B CA  1 
ATOM   4896 C  C   . MET B  1 244 ? 3.204   74.184  13.818  1.00 67.95  ? 244 MET B C   1 
ATOM   4897 O  O   . MET B  1 244 ? 3.439   72.990  13.619  1.00 69.39  ? 244 MET B O   1 
ATOM   4898 C  CB  . MET B  1 244 ? 0.733   74.564  13.512  1.00 77.24  ? 244 MET B CB  1 
ATOM   4899 C  CG  . MET B  1 244 ? 0.809   75.567  12.367  1.00 78.77  ? 244 MET B CG  1 
ATOM   4900 S  SD  . MET B  1 244 ? -0.333  75.180  11.024  1.00 76.31  ? 244 MET B SD  1 
ATOM   4901 C  CE  . MET B  1 244 ? -1.915  75.379  11.841  1.00 79.28  ? 244 MET B CE  1 
ATOM   4902 N  N   . TRP B  1 245 ? 4.030   75.165  13.449  1.00 61.63  ? 245 TRP B N   1 
ATOM   4903 C  CA  . TRP B  1 245 ? 5.346   74.930  12.835  1.00 61.96  ? 245 TRP B CA  1 
ATOM   4904 C  C   . TRP B  1 245 ? 6.488   74.855  13.862  1.00 60.34  ? 245 TRP B C   1 
ATOM   4905 O  O   . TRP B  1 245 ? 7.579   74.382  13.534  1.00 60.13  ? 245 TRP B O   1 
ATOM   4906 C  CB  . TRP B  1 245 ? 5.645   76.010  11.787  1.00 62.82  ? 245 TRP B CB  1 
ATOM   4907 C  CG  . TRP B  1 245 ? 4.492   76.263  10.860  1.00 63.14  ? 245 TRP B CG  1 
ATOM   4908 C  CD1 . TRP B  1 245 ? 3.740   77.399  10.780  1.00 66.82  ? 245 TRP B CD1 1 
ATOM   4909 C  CD2 . TRP B  1 245 ? 3.935   75.344  9.912   1.00 64.65  ? 245 TRP B CD2 1 
ATOM   4910 N  NE1 . TRP B  1 245 ? 2.759   77.254  9.829   1.00 69.37  ? 245 TRP B NE1 1 
ATOM   4911 C  CE2 . TRP B  1 245 ? 2.854   76.003  9.281   1.00 65.96  ? 245 TRP B CE2 1 
ATOM   4912 C  CE3 . TRP B  1 245 ? 4.248   74.034  9.527   1.00 61.20  ? 245 TRP B CE3 1 
ATOM   4913 C  CZ2 . TRP B  1 245 ? 2.083   75.393  8.284   1.00 63.41  ? 245 TRP B CZ2 1 
ATOM   4914 C  CZ3 . TRP B  1 245 ? 3.482   73.429  8.533   1.00 60.89  ? 245 TRP B CZ3 1 
ATOM   4915 C  CH2 . TRP B  1 245 ? 2.411   74.110  7.926   1.00 63.72  ? 245 TRP B CH2 1 
ATOM   4916 N  N   . ASN B  1 246 ? 6.243   75.332  15.085  1.00 59.79  ? 246 ASN B N   1 
ATOM   4917 C  CA  . ASN B  1 246 ? 7.174   75.139  16.203  1.00 56.04  ? 246 ASN B CA  1 
ATOM   4918 C  C   . ASN B  1 246 ? 7.242   73.665  16.615  1.00 54.97  ? 246 ASN B C   1 
ATOM   4919 O  O   . ASN B  1 246 ? 6.245   72.950  16.495  1.00 52.54  ? 246 ASN B O   1 
ATOM   4920 C  CB  . ASN B  1 246 ? 6.752   75.970  17.420  1.00 54.36  ? 246 ASN B CB  1 
ATOM   4921 C  CG  . ASN B  1 246 ? 6.923   77.459  17.207  1.00 54.18  ? 246 ASN B CG  1 
ATOM   4922 O  OD1 . ASN B  1 246 ? 7.828   77.899  16.494  1.00 54.78  ? 246 ASN B OD1 1 
ATOM   4923 N  ND2 . ASN B  1 246 ? 6.073   78.249  17.855  1.00 61.08  ? 246 ASN B ND2 1 
ATOM   4924 N  N   . PRO B  1 247 ? 8.412   73.211  17.114  1.00 52.40  ? 247 PRO B N   1 
ATOM   4925 C  CA  . PRO B  1 247 ? 8.585   71.799  17.494  1.00 52.34  ? 247 PRO B CA  1 
ATOM   4926 C  C   . PRO B  1 247 ? 7.700   71.338  18.667  1.00 48.37  ? 247 PRO B C   1 
ATOM   4927 O  O   . PRO B  1 247 ? 7.583   72.048  19.668  1.00 48.09  ? 247 PRO B O   1 
ATOM   4928 C  CB  . PRO B  1 247 ? 10.078  71.693  17.853  1.00 48.58  ? 247 PRO B CB  1 
ATOM   4929 C  CG  . PRO B  1 247 ? 10.584  73.086  17.964  1.00 48.03  ? 247 PRO B CG  1 
ATOM   4930 C  CD  . PRO B  1 247 ? 9.675   73.969  17.181  1.00 49.29  ? 247 PRO B CD  1 
ATOM   4931 N  N   . ASN B  1 248 ? 7.090   70.160  18.512  1.00 45.23  ? 248 ASN B N   1 
ATOM   4932 C  CA  . ASN B  1 248 ? 6.206   69.552  19.534  1.00 45.53  ? 248 ASN B CA  1 
ATOM   4933 C  C   . ASN B  1 248 ? 6.851   68.418  20.358  1.00 49.78  ? 248 ASN B C   1 
ATOM   4934 O  O   . ASN B  1 248 ? 6.205   67.854  21.245  1.00 53.48  ? 248 ASN B O   1 
ATOM   4935 C  CB  . ASN B  1 248 ? 4.887   69.072  18.896  1.00 44.24  ? 248 ASN B CB  1 
ATOM   4936 C  CG  . ASN B  1 248 ? 5.088   68.025  17.807  1.00 45.57  ? 248 ASN B CG  1 
ATOM   4937 O  OD1 . ASN B  1 248 ? 6.215   67.680  17.445  1.00 47.08  ? 248 ASN B OD1 1 
ATOM   4938 N  ND2 . ASN B  1 248 ? 3.982   67.523  17.270  1.00 47.39  ? 248 ASN B ND2 1 
ATOM   4939 N  N   . THR B  1 249 ? 8.108   68.091  20.051  1.00 50.63  ? 249 THR B N   1 
ATOM   4940 C  CA  . THR B  1 249 ? 8.927   67.175  20.860  1.00 49.58  ? 249 THR B CA  1 
ATOM   4941 C  C   . THR B  1 249 ? 10.120  67.956  21.421  1.00 47.75  ? 249 THR B C   1 
ATOM   4942 O  O   . THR B  1 249 ? 10.448  69.026  20.896  1.00 50.42  ? 249 THR B O   1 
ATOM   4943 C  CB  . THR B  1 249 ? 9.415   65.970  20.033  1.00 48.46  ? 249 THR B CB  1 
ATOM   4944 O  OG1 . THR B  1 249 ? 9.986   66.424  18.800  1.00 48.32  ? 249 THR B OG1 1 
ATOM   4945 C  CG2 . THR B  1 249 ? 8.258   65.037  19.738  1.00 50.20  ? 249 THR B CG2 1 
ATOM   4946 N  N   . PRO B  1 250 ? 10.765  67.442  22.493  1.00 41.87  ? 250 PRO B N   1 
ATOM   4947 C  CA  . PRO B  1 250 ? 11.854  68.215  23.102  1.00 43.01  ? 250 PRO B CA  1 
ATOM   4948 C  C   . PRO B  1 250 ? 13.059  68.399  22.181  1.00 46.05  ? 250 PRO B C   1 
ATOM   4949 O  O   . PRO B  1 250 ? 13.396  67.497  21.411  1.00 44.17  ? 250 PRO B O   1 
ATOM   4950 C  CB  . PRO B  1 250 ? 12.235  67.382  24.335  1.00 43.26  ? 250 PRO B CB  1 
ATOM   4951 C  CG  . PRO B  1 250 ? 11.746  66.010  24.039  1.00 42.66  ? 250 PRO B CG  1 
ATOM   4952 C  CD  . PRO B  1 250 ? 10.483  66.218  23.265  1.00 41.36  ? 250 PRO B CD  1 
ATOM   4953 N  N   . LEU B  1 251 ? 13.684  69.572  22.266  1.00 50.36  ? 251 LEU B N   1 
ATOM   4954 C  CA  . LEU B  1 251 ? 14.848  69.903  21.445  1.00 49.66  ? 251 LEU B CA  1 
ATOM   4955 C  C   . LEU B  1 251 ? 16.093  69.183  21.952  1.00 49.88  ? 251 LEU B C   1 
ATOM   4956 O  O   . LEU B  1 251 ? 16.333  69.109  23.160  1.00 44.47  ? 251 LEU B O   1 
ATOM   4957 C  CB  . LEU B  1 251 ? 15.105  71.413  21.429  1.00 50.60  ? 251 LEU B CB  1 
ATOM   4958 C  CG  . LEU B  1 251 ? 14.041  72.334  20.834  1.00 44.19  ? 251 LEU B CG  1 
ATOM   4959 C  CD1 . LEU B  1 251 ? 14.501  73.778  20.954  1.00 42.09  ? 251 LEU B CD1 1 
ATOM   4960 C  CD2 . LEU B  1 251 ? 13.766  71.996  19.380  1.00 44.68  ? 251 LEU B CD2 1 
ATOM   4961 N  N   . SER B  1 252 ? 16.879  68.662  21.012  1.00 48.48  ? 252 SER B N   1 
ATOM   4962 C  CA  . SER B  1 252 ? 18.078  67.886  21.320  1.00 46.57  ? 252 SER B CA  1 
ATOM   4963 C  C   . SER B  1 252 ? 18.988  67.811  20.098  1.00 43.84  ? 252 SER B C   1 
ATOM   4964 O  O   . SER B  1 252 ? 18.509  67.755  18.965  1.00 39.09  ? 252 SER B O   1 
ATOM   4965 C  CB  . SER B  1 252 ? 17.689  66.470  21.755  1.00 46.08  ? 252 SER B CB  1 
ATOM   4966 O  OG  . SER B  1 252 ? 18.818  65.740  22.207  1.00 44.89  ? 252 SER B OG  1 
ATOM   4967 N  N   . GLU B  1 253 ? 20.299  67.822  20.335  1.00 44.51  ? 253 GLU B N   1 
ATOM   4968 C  CA  . GLU B  1 253 ? 21.284  67.557  19.281  1.00 44.79  ? 253 GLU B CA  1 
ATOM   4969 C  C   . GLU B  1 253 ? 21.196  66.107  18.808  1.00 45.18  ? 253 GLU B C   1 
ATOM   4970 O  O   . GLU B  1 253 ? 21.369  65.820  17.622  1.00 44.71  ? 253 GLU B O   1 
ATOM   4971 C  CB  . GLU B  1 253 ? 22.696  67.860  19.775  1.00 44.58  ? 253 GLU B CB  1 
ATOM   4972 C  CG  . GLU B  1 253 ? 22.931  69.333  20.081  1.00 46.07  ? 253 GLU B CG  1 
ATOM   4973 C  CD  . GLU B  1 253 ? 24.326  69.792  19.709  1.00 46.10  ? 253 GLU B CD  1 
ATOM   4974 O  OE1 . GLU B  1 253 ? 25.055  70.282  20.598  1.00 48.20  ? 253 GLU B OE1 1 
ATOM   4975 O  OE2 . GLU B  1 253 ? 24.690  69.654  18.523  1.00 40.40  ? 253 GLU B OE2 1 
ATOM   4976 N  N   . ASP B  1 254 ? 20.934  65.206  19.753  1.00 48.42  ? 254 ASP B N   1 
ATOM   4977 C  CA  . ASP B  1 254 ? 20.572  63.826  19.449  1.00 49.66  ? 254 ASP B CA  1 
ATOM   4978 C  C   . ASP B  1 254 ? 19.155  63.811  18.866  1.00 51.67  ? 254 ASP B C   1 
ATOM   4979 O  O   . ASP B  1 254 ? 18.168  63.633  19.587  1.00 46.82  ? 254 ASP B O   1 
ATOM   4980 C  CB  . ASP B  1 254 ? 20.672  62.958  20.713  1.00 47.06  ? 254 ASP B CB  1 
ATOM   4981 C  CG  . ASP B  1 254 ? 20.356  61.485  20.457  1.00 48.30  ? 254 ASP B CG  1 
ATOM   4982 O  OD1 . ASP B  1 254 ? 20.368  61.033  19.279  1.00 54.43  ? 254 ASP B OD1 1 
ATOM   4983 O  OD2 . ASP B  1 254 ? 20.101  60.765  21.452  1.00 51.36  ? 254 ASP B OD2 1 
ATOM   4984 N  N   . CYS B  1 255 ? 19.081  64.023  17.553  1.00 53.87  ? 255 CYS B N   1 
ATOM   4985 C  CA  . CYS B  1 255 ? 17.806  64.094  16.828  1.00 48.32  ? 255 CYS B CA  1 
ATOM   4986 C  C   . CYS B  1 255 ? 17.749  63.310  15.514  1.00 43.03  ? 255 CYS B C   1 
ATOM   4987 O  O   . CYS B  1 255 ? 16.741  63.379  14.819  1.00 46.95  ? 255 CYS B O   1 
ATOM   4988 C  CB  . CYS B  1 255 ? 17.465  65.560  16.543  1.00 50.11  ? 255 CYS B CB  1 
ATOM   4989 S  SG  . CYS B  1 255 ? 18.673  66.421  15.507  1.00 48.94  ? 255 CYS B SG  1 
ATOM   4990 N  N   . LEU B  1 256 ? 18.782  62.533  15.193  1.00 43.75  ? 256 LEU B N   1 
ATOM   4991 C  CA  . LEU B  1 256 ? 18.873  61.881  13.877  1.00 41.33  ? 256 LEU B CA  1 
ATOM   4992 C  C   . LEU B  1 256 ? 18.121  60.553  13.909  1.00 40.06  ? 256 LEU B C   1 
ATOM   4993 O  O   . LEU B  1 256 ? 18.716  59.487  14.101  1.00 41.33  ? 256 LEU B O   1 
ATOM   4994 C  CB  . LEU B  1 256 ? 20.335  61.688  13.451  1.00 40.58  ? 256 LEU B CB  1 
ATOM   4995 C  CG  . LEU B  1 256 ? 21.036  62.900  12.829  1.00 40.24  ? 256 LEU B CG  1 
ATOM   4996 C  CD1 . LEU B  1 256 ? 21.016  64.104  13.752  1.00 44.47  ? 256 LEU B CD1 1 
ATOM   4997 C  CD2 . LEU B  1 256 ? 22.471  62.549  12.482  1.00 41.18  ? 256 LEU B CD2 1 
ATOM   4998 N  N   . TYR B  1 257 ? 16.803  60.643  13.741  1.00 39.74  ? 257 TYR B N   1 
ATOM   4999 C  CA  . TYR B  1 257 ? 15.904  59.483  13.776  1.00 40.75  ? 257 TYR B CA  1 
ATOM   5000 C  C   . TYR B  1 257 ? 14.915  59.474  12.607  1.00 42.17  ? 257 TYR B C   1 
ATOM   5001 O  O   . TYR B  1 257 ? 14.634  60.513  12.003  1.00 41.05  ? 257 TYR B O   1 
ATOM   5002 C  CB  . TYR B  1 257 ? 15.133  59.443  15.101  1.00 40.58  ? 257 TYR B CB  1 
ATOM   5003 C  CG  . TYR B  1 257 ? 16.017  59.314  16.324  1.00 34.97  ? 257 TYR B CG  1 
ATOM   5004 C  CD1 . TYR B  1 257 ? 16.627  60.433  16.886  1.00 33.12  ? 257 TYR B CD1 1 
ATOM   5005 C  CD2 . TYR B  1 257 ? 16.244  58.074  16.922  1.00 31.77  ? 257 TYR B CD2 1 
ATOM   5006 C  CE1 . TYR B  1 257 ? 17.446  60.327  18.000  1.00 33.36  ? 257 TYR B CE1 1 
ATOM   5007 C  CE2 . TYR B  1 257 ? 17.057  57.954  18.040  1.00 32.14  ? 257 TYR B CE2 1 
ATOM   5008 C  CZ  . TYR B  1 257 ? 17.657  59.083  18.575  1.00 32.16  ? 257 TYR B CZ  1 
ATOM   5009 O  OH  . TYR B  1 257 ? 18.462  58.967  19.684  1.00 30.58  ? 257 TYR B OH  1 
ATOM   5010 N  N   . ILE B  1 258 ? 14.391  58.281  12.318  1.00 45.16  ? 258 ILE B N   1 
ATOM   5011 C  CA  . ILE B  1 258 ? 13.442  58.036  11.220  1.00 47.61  ? 258 ILE B CA  1 
ATOM   5012 C  C   . ILE B  1 258 ? 12.125  57.495  11.774  1.00 46.15  ? 258 ILE B C   1 
ATOM   5013 O  O   . ILE B  1 258 ? 12.115  56.677  12.699  1.00 43.37  ? 258 ILE B O   1 
ATOM   5014 C  CB  . ILE B  1 258 ? 14.021  57.048  10.168  1.00 50.76  ? 258 ILE B CB  1 
ATOM   5015 C  CG1 . ILE B  1 258 ? 14.925  57.798  9.186   1.00 54.96  ? 258 ILE B CG1 1 
ATOM   5016 C  CG2 . ILE B  1 258 ? 12.922  56.344  9.365   1.00 52.72  ? 258 ILE B CG2 1 
ATOM   5017 C  CD1 . ILE B  1 258 ? 15.837  56.906  8.367   1.00 57.08  ? 258 ILE B CD1 1 
ATOM   5018 N  N   . ASN B  1 259 ? 11.025  57.952  11.177  1.00 45.07  ? 259 ASN B N   1 
ATOM   5019 C  CA  . ASN B  1 259 ? 9.681   57.474  11.488  1.00 46.93  ? 259 ASN B CA  1 
ATOM   5020 C  C   . ASN B  1 259 ? 9.173   56.641  10.323  1.00 49.60  ? 259 ASN B C   1 
ATOM   5021 O  O   . ASN B  1 259 ? 9.311   57.044  9.168   1.00 50.24  ? 259 ASN B O   1 
ATOM   5022 C  CB  . ASN B  1 259 ? 8.727   58.645  11.719  1.00 44.07  ? 259 ASN B CB  1 
ATOM   5023 C  CG  . ASN B  1 259 ? 9.246   59.628  12.748  1.00 44.44  ? 259 ASN B CG  1 
ATOM   5024 O  OD1 . ASN B  1 259 ? 9.725   59.234  13.811  1.00 43.63  ? 259 ASN B OD1 1 
ATOM   5025 N  ND2 . ASN B  1 259 ? 9.153   60.917  12.439  1.00 45.56  ? 259 ASN B ND2 1 
ATOM   5026 N  N   . VAL B  1 260 ? 8.591   55.487  10.635  1.00 51.09  ? 260 VAL B N   1 
ATOM   5027 C  CA  . VAL B  1 260 ? 7.969   54.620  9.637   1.00 52.37  ? 260 VAL B CA  1 
ATOM   5028 C  C   . VAL B  1 260 ? 6.551   54.311  10.106  1.00 49.40  ? 260 VAL B C   1 
ATOM   5029 O  O   . VAL B  1 260 ? 6.330   53.996  11.275  1.00 41.76  ? 260 VAL B O   1 
ATOM   5030 C  CB  . VAL B  1 260 ? 8.785   53.325  9.422   1.00 56.34  ? 260 VAL B CB  1 
ATOM   5031 C  CG1 . VAL B  1 260 ? 8.076   52.360  8.471   1.00 55.48  ? 260 VAL B CG1 1 
ATOM   5032 C  CG2 . VAL B  1 260 ? 10.171  53.670  8.891   1.00 54.76  ? 260 VAL B CG2 1 
ATOM   5033 N  N   . VAL B  1 261 ? 5.603   54.427  9.181   1.00 46.76  ? 261 VAL B N   1 
ATOM   5034 C  CA  . VAL B  1 261 ? 4.185   54.196  9.439   1.00 45.26  ? 261 VAL B CA  1 
ATOM   5035 C  C   . VAL B  1 261 ? 3.650   53.369  8.274   1.00 44.30  ? 261 VAL B C   1 
ATOM   5036 O  O   . VAL B  1 261 ? 3.671   53.829  7.129   1.00 39.97  ? 261 VAL B O   1 
ATOM   5037 C  CB  . VAL B  1 261 ? 3.416   55.533  9.554   1.00 47.38  ? 261 VAL B CB  1 
ATOM   5038 C  CG1 . VAL B  1 261 ? 1.913   55.311  9.703   1.00 50.56  ? 261 VAL B CG1 1 
ATOM   5039 C  CG2 . VAL B  1 261 ? 3.945   56.343  10.731  1.00 47.56  ? 261 VAL B CG2 1 
ATOM   5040 N  N   . ALA B  1 262 ? 3.179   52.157  8.570   1.00 47.74  ? 262 ALA B N   1 
ATOM   5041 C  CA  . ALA B  1 262 ? 2.646   51.242  7.553   1.00 54.09  ? 262 ALA B CA  1 
ATOM   5042 C  C   . ALA B  1 262 ? 1.139   51.036  7.750   1.00 56.22  ? 262 ALA B C   1 
ATOM   5043 O  O   . ALA B  1 262 ? 0.673   50.989  8.892   1.00 61.44  ? 262 ALA B O   1 
ATOM   5044 C  CB  . ALA B  1 262 ? 3.366   49.906  7.620   1.00 57.04  ? 262 ALA B CB  1 
ATOM   5045 N  N   . PRO B  1 263 ? 0.372   50.902  6.642   1.00 54.03  ? 263 PRO B N   1 
ATOM   5046 C  CA  . PRO B  1 263 ? -1.069  50.658  6.742   1.00 57.26  ? 263 PRO B CA  1 
ATOM   5047 C  C   . PRO B  1 263 ? -1.399  49.187  6.977   1.00 57.63  ? 263 PRO B C   1 
ATOM   5048 O  O   . PRO B  1 263 ? -0.581  48.319  6.673   1.00 59.86  ? 263 PRO B O   1 
ATOM   5049 C  CB  . PRO B  1 263 ? -1.589  51.113  5.380   1.00 55.23  ? 263 PRO B CB  1 
ATOM   5050 C  CG  . PRO B  1 263 ? -0.466  50.834  4.447   1.00 53.14  ? 263 PRO B CG  1 
ATOM   5051 C  CD  . PRO B  1 263 ? 0.810   50.952  5.234   1.00 54.44  ? 263 PRO B CD  1 
ATOM   5052 N  N   . ARG B  1 264 ? -2.590  48.926  7.517   1.00 57.55  ? 264 ARG B N   1 
ATOM   5053 C  CA  . ARG B  1 264 ? -3.071  47.559  7.768   1.00 60.07  ? 264 ARG B CA  1 
ATOM   5054 C  C   . ARG B  1 264 ? -4.349  47.263  6.964   1.00 59.10  ? 264 ARG B C   1 
ATOM   5055 O  O   . ARG B  1 264 ? -5.249  48.106  6.942   1.00 62.94  ? 264 ARG B O   1 
ATOM   5056 C  CB  . ARG B  1 264 ? -3.301  47.330  9.261   1.00 62.04  ? 264 ARG B CB  1 
ATOM   5057 C  CG  . ARG B  1 264 ? -2.003  47.254  10.062  1.00 67.30  ? 264 ARG B CG  1 
ATOM   5058 C  CD  . ARG B  1 264 ? -2.032  46.131  11.083  1.00 67.18  ? 264 ARG B CD  1 
ATOM   5059 N  NE  . ARG B  1 264 ? -2.991  46.395  12.152  1.00 68.67  ? 264 ARG B NE  1 
ATOM   5060 C  CZ  . ARG B  1 264 ? -3.436  45.492  13.027  1.00 73.31  ? 264 ARG B CZ  1 
ATOM   5061 N  NH1 . ARG B  1 264 ? -3.025  44.223  12.986  1.00 69.42  ? 264 ARG B NH1 1 
ATOM   5062 N  NH2 . ARG B  1 264 ? -4.312  45.863  13.956  1.00 82.92  ? 264 ARG B NH2 1 
ATOM   5063 N  N   . PRO B  1 265 ? -4.456  46.095  6.311   1.00 61.08  ? 265 PRO B N   1 
ATOM   5064 C  CA  . PRO B  1 265 ? -3.458  45.008  6.330   1.00 62.22  ? 265 PRO B CA  1 
ATOM   5065 C  C   . PRO B  1 265 ? -2.099  45.388  5.742   1.00 65.22  ? 265 PRO B C   1 
ATOM   5066 O  O   . PRO B  1 265 ? -2.031  46.184  4.801   1.00 60.48  ? 265 PRO B O   1 
ATOM   5067 C  CB  . PRO B  1 265 ? -4.109  43.923  5.463   1.00 61.98  ? 265 PRO B CB  1 
ATOM   5068 C  CG  . PRO B  1 265 ? -5.046  44.662  4.574   1.00 65.90  ? 265 PRO B CG  1 
ATOM   5069 C  CD  . PRO B  1 265 ? -5.584  45.780  5.417   1.00 63.62  ? 265 PRO B CD  1 
ATOM   5070 N  N   . ARG B  1 266 ? -1.038  44.824  6.318   1.00 63.93  ? 266 ARG B N   1 
ATOM   5071 C  CA  . ARG B  1 266 ? 0.327   45.186  5.954   1.00 59.17  ? 266 ARG B CA  1 
ATOM   5072 C  C   . ARG B  1 266 ? 0.645   44.754  4.528   1.00 57.26  ? 266 ARG B C   1 
ATOM   5073 O  O   . ARG B  1 266 ? 0.484   43.577  4.192   1.00 50.35  ? 266 ARG B O   1 
ATOM   5074 C  CB  . ARG B  1 266 ? 1.351   44.575  6.912   1.00 59.50  ? 266 ARG B CB  1 
ATOM   5075 C  CG  . ARG B  1 266 ? 2.765   45.094  6.676   1.00 62.77  ? 266 ARG B CG  1 
ATOM   5076 C  CD  . ARG B  1 266 ? 3.756   44.514  7.661   1.00 62.70  ? 266 ARG B CD  1 
ATOM   5077 N  NE  . ARG B  1 266 ? 3.599   45.080  8.998   1.00 61.31  ? 266 ARG B NE  1 
ATOM   5078 C  CZ  . ARG B  1 266 ? 4.164   44.594  10.102  1.00 62.90  ? 266 ARG B CZ  1 
ATOM   5079 N  NH1 . ARG B  1 266 ? 3.950   45.194  11.269  1.00 68.95  ? 266 ARG B NH1 1 
ATOM   5080 N  NH2 . ARG B  1 266 ? 4.938   43.509  10.055  1.00 65.65  ? 266 ARG B NH2 1 
ATOM   5081 N  N   . PRO B  1 267 ? 1.102   45.704  3.688   1.00 62.52  ? 267 PRO B N   1 
ATOM   5082 C  CA  . PRO B  1 267 ? 1.502   45.346  2.337   1.00 66.31  ? 267 PRO B CA  1 
ATOM   5083 C  C   . PRO B  1 267 ? 2.866   44.636  2.292   1.00 67.40  ? 267 PRO B C   1 
ATOM   5084 O  O   . PRO B  1 267 ? 3.475   44.351  3.325   1.00 66.92  ? 267 PRO B O   1 
ATOM   5085 C  CB  . PRO B  1 267 ? 1.522   46.699  1.613   1.00 65.42  ? 267 PRO B CB  1 
ATOM   5086 C  CG  . PRO B  1 267 ? 1.866   47.673  2.669   1.00 64.02  ? 267 PRO B CG  1 
ATOM   5087 C  CD  . PRO B  1 267 ? 1.227   47.157  3.924   1.00 63.54  ? 267 PRO B CD  1 
ATOM   5088 N  N   . LYS B  1 268 ? 3.317   44.380  1.074   1.00 70.69  ? 268 LYS B N   1 
ATOM   5089 C  CA  . LYS B  1 268 ? 4.438   43.486  0.775   1.00 71.17  ? 268 LYS B CA  1 
ATOM   5090 C  C   . LYS B  1 268 ? 5.550   44.187  -0.012  1.00 66.44  ? 268 LYS B C   1 
ATOM   5091 O  O   . LYS B  1 268 ? 6.737   43.971  0.247   1.00 62.78  ? 268 LYS B O   1 
ATOM   5092 C  CB  . LYS B  1 268 ? 3.927   42.257  -0.003  1.00 77.67  ? 268 LYS B CB  1 
ATOM   5093 C  CG  . LYS B  1 268 ? 3.118   42.548  -1.272  1.00 80.26  ? 268 LYS B CG  1 
ATOM   5094 C  CD  . LYS B  1 268 ? 1.636   42.848  -1.031  1.00 78.78  ? 268 LYS B CD  1 
ATOM   5095 C  CE  . LYS B  1 268 ? 1.128   43.965  -1.937  1.00 77.68  ? 268 LYS B CE  1 
ATOM   5096 N  NZ  . LYS B  1 268 ? 1.335   43.664  -3.385  1.00 81.35  ? 268 LYS B NZ  1 
ATOM   5097 N  N   . ASN B  1 269 ? 5.145   45.027  -0.964  1.00 62.53  ? 269 ASN B N   1 
ATOM   5098 C  CA  . ASN B  1 269 ? 6.042   45.686  -1.900  1.00 62.03  ? 269 ASN B CA  1 
ATOM   5099 C  C   . ASN B  1 269 ? 5.359   46.987  -2.368  1.00 58.19  ? 269 ASN B C   1 
ATOM   5100 O  O   . ASN B  1 269 ? 5.315   47.296  -3.563  1.00 55.38  ? 269 ASN B O   1 
ATOM   5101 C  CB  . ASN B  1 269 ? 6.326   44.724  -3.078  1.00 63.03  ? 269 ASN B CB  1 
ATOM   5102 C  CG  . ASN B  1 269 ? 7.810   44.492  -3.325  1.00 66.06  ? 269 ASN B CG  1 
ATOM   5103 O  OD1 . ASN B  1 269 ? 8.662   45.306  -2.970  1.00 68.13  ? 269 ASN B OD1 1 
ATOM   5104 N  ND2 . ASN B  1 269 ? 8.124   43.364  -3.952  1.00 67.88  ? 269 ASN B ND2 1 
ATOM   5105 N  N   . ALA B  1 270 ? 4.824   47.743  -1.408  1.00 57.53  ? 270 ALA B N   1 
ATOM   5106 C  CA  . ALA B  1 270 ? 4.049   48.954  -1.699  1.00 56.48  ? 270 ALA B CA  1 
ATOM   5107 C  C   . ALA B  1 270 ? 4.954   50.149  -1.916  1.00 50.69  ? 270 ALA B C   1 
ATOM   5108 O  O   . ALA B  1 270 ? 6.128   50.128  -1.542  1.00 50.94  ? 270 ALA B O   1 
ATOM   5109 C  CB  . ALA B  1 270 ? 3.073   49.250  -0.574  1.00 59.74  ? 270 ALA B CB  1 
ATOM   5110 N  N   . ALA B  1 271 ? 4.393   51.196  -2.513  1.00 56.01  ? 271 ALA B N   1 
ATOM   5111 C  CA  . ALA B  1 271 ? 5.139   52.420  -2.796  1.00 58.06  ? 271 ALA B CA  1 
ATOM   5112 C  C   . ALA B  1 271 ? 5.447   53.164  -1.501  1.00 54.70  ? 271 ALA B C   1 
ATOM   5113 O  O   . ALA B  1 271 ? 4.592   53.263  -0.620  1.00 58.32  ? 271 ALA B O   1 
ATOM   5114 C  CB  . ALA B  1 271 ? 4.359   53.313  -3.746  1.00 59.43  ? 271 ALA B CB  1 
ATOM   5115 N  N   . VAL B  1 272 ? 6.672   53.670  -1.397  1.00 50.66  ? 272 VAL B N   1 
ATOM   5116 C  CA  . VAL B  1 272 ? 7.129   54.389  -0.211  1.00 50.79  ? 272 VAL B CA  1 
ATOM   5117 C  C   . VAL B  1 272 ? 7.093   55.889  -0.508  1.00 53.00  ? 272 VAL B C   1 
ATOM   5118 O  O   . VAL B  1 272 ? 7.716   56.350  -1.464  1.00 55.14  ? 272 VAL B O   1 
ATOM   5119 C  CB  . VAL B  1 272 ? 8.551   53.954  0.211   1.00 52.51  ? 272 VAL B CB  1 
ATOM   5120 C  CG1 . VAL B  1 272 ? 8.984   54.654  1.495   1.00 57.17  ? 272 VAL B CG1 1 
ATOM   5121 C  CG2 . VAL B  1 272 ? 8.615   52.444  0.404   1.00 51.46  ? 272 VAL B CG2 1 
ATOM   5122 N  N   . MET B  1 273 ? 6.349   56.632  0.310   1.00 49.82  ? 273 MET B N   1 
ATOM   5123 C  CA  . MET B  1 273 ? 6.259   58.091  0.205   1.00 47.52  ? 273 MET B CA  1 
ATOM   5124 C  C   . MET B  1 273 ? 7.068   58.733  1.331   1.00 47.38  ? 273 MET B C   1 
ATOM   5125 O  O   . MET B  1 273 ? 6.625   58.773  2.480   1.00 46.31  ? 273 MET B O   1 
ATOM   5126 C  CB  . MET B  1 273 ? 4.795   58.534  0.257   1.00 48.44  ? 273 MET B CB  1 
ATOM   5127 C  CG  . MET B  1 273 ? 4.086   58.418  -1.085  1.00 49.13  ? 273 MET B CG  1 
ATOM   5128 S  SD  . MET B  1 273 ? 2.371   58.975  -1.066  1.00 48.27  ? 273 MET B SD  1 
ATOM   5129 C  CE  . MET B  1 273 ? 2.565   60.735  -1.324  1.00 43.97  ? 273 MET B CE  1 
ATOM   5130 N  N   . LEU B  1 274 ? 8.247   59.245  0.981   1.00 45.87  ? 274 LEU B N   1 
ATOM   5131 C  CA  . LEU B  1 274 ? 9.241   59.688  1.961   1.00 48.06  ? 274 LEU B CA  1 
ATOM   5132 C  C   . LEU B  1 274 ? 9.210   61.207  2.160   1.00 49.33  ? 274 LEU B C   1 
ATOM   5133 O  O   . LEU B  1 274 ? 9.575   61.966  1.258   1.00 49.28  ? 274 LEU B O   1 
ATOM   5134 C  CB  . LEU B  1 274 ? 10.634  59.254  1.499   1.00 54.12  ? 274 LEU B CB  1 
ATOM   5135 C  CG  . LEU B  1 274 ? 11.826  59.201  2.476   1.00 56.23  ? 274 LEU B CG  1 
ATOM   5136 C  CD1 . LEU B  1 274 ? 11.554  59.702  3.894   1.00 58.97  ? 274 LEU B CD1 1 
ATOM   5137 C  CD2 . LEU B  1 274 ? 12.392  57.794  2.523   1.00 57.14  ? 274 LEU B CD2 1 
ATOM   5138 N  N   . TRP B  1 275 ? 8.806   61.634  3.356   1.00 50.33  ? 275 TRP B N   1 
ATOM   5139 C  CA  . TRP B  1 275 ? 8.645   63.057  3.676   1.00 47.78  ? 275 TRP B CA  1 
ATOM   5140 C  C   . TRP B  1 275 ? 9.918   63.723  4.211   1.00 45.77  ? 275 TRP B C   1 
ATOM   5141 O  O   . TRP B  1 275 ? 10.477  63.282  5.218   1.00 52.41  ? 275 TRP B O   1 
ATOM   5142 C  CB  . TRP B  1 275 ? 7.522   63.249  4.696   1.00 47.87  ? 275 TRP B CB  1 
ATOM   5143 C  CG  . TRP B  1 275 ? 7.262   64.695  5.021   1.00 50.95  ? 275 TRP B CG  1 
ATOM   5144 C  CD1 . TRP B  1 275 ? 7.540   65.335  6.192   1.00 53.18  ? 275 TRP B CD1 1 
ATOM   5145 C  CD2 . TRP B  1 275 ? 6.692   65.680  4.152   1.00 49.58  ? 275 TRP B CD2 1 
ATOM   5146 N  NE1 . TRP B  1 275 ? 7.167   66.655  6.112   1.00 47.90  ? 275 TRP B NE1 1 
ATOM   5147 C  CE2 . TRP B  1 275 ? 6.643   66.894  4.869   1.00 50.07  ? 275 TRP B CE2 1 
ATOM   5148 C  CE3 . TRP B  1 275 ? 6.206   65.651  2.841   1.00 50.75  ? 275 TRP B CE3 1 
ATOM   5149 C  CZ2 . TRP B  1 275 ? 6.130   68.075  4.315   1.00 53.22  ? 275 TRP B CZ2 1 
ATOM   5150 C  CZ3 . TRP B  1 275 ? 5.696   66.823  2.285   1.00 55.47  ? 275 TRP B CZ3 1 
ATOM   5151 C  CH2 . TRP B  1 275 ? 5.664   68.019  3.024   1.00 54.85  ? 275 TRP B CH2 1 
ATOM   5152 N  N   . ILE B  1 276 ? 10.351  64.785  3.532   1.00 44.81  ? 276 ILE B N   1 
ATOM   5153 C  CA  . ILE B  1 276 ? 11.382  65.695  4.041   1.00 47.63  ? 276 ILE B CA  1 
ATOM   5154 C  C   . ILE B  1 276 ? 10.689  67.031  4.327   1.00 48.01  ? 276 ILE B C   1 
ATOM   5155 O  O   . ILE B  1 276 ? 10.137  67.653  3.418   1.00 49.02  ? 276 ILE B O   1 
ATOM   5156 C  CB  . ILE B  1 276 ? 12.551  65.888  3.042   1.00 49.95  ? 276 ILE B CB  1 
ATOM   5157 C  CG1 . ILE B  1 276 ? 13.293  64.562  2.819   1.00 49.85  ? 276 ILE B CG1 1 
ATOM   5158 C  CG2 . ILE B  1 276 ? 13.538  66.934  3.560   1.00 54.03  ? 276 ILE B CG2 1 
ATOM   5159 C  CD1 . ILE B  1 276 ? 14.296  64.577  1.680   1.00 47.62  ? 276 ILE B CD1 1 
ATOM   5160 N  N   . PHE B  1 277 ? 10.720  67.454  5.590   1.00 53.39  ? 277 PHE B N   1 
ATOM   5161 C  CA  . PHE B  1 277 ? 10.090  68.716  6.020   1.00 50.88  ? 277 PHE B CA  1 
ATOM   5162 C  C   . PHE B  1 277 ? 10.849  69.950  5.538   1.00 48.37  ? 277 PHE B C   1 
ATOM   5163 O  O   . PHE B  1 277 ? 11.982  69.855  5.062   1.00 43.66  ? 277 PHE B O   1 
ATOM   5164 C  CB  . PHE B  1 277 ? 9.929   68.774  7.555   1.00 48.97  ? 277 PHE B CB  1 
ATOM   5165 C  CG  . PHE B  1 277 ? 11.233  68.822  8.315   1.00 48.29  ? 277 PHE B CG  1 
ATOM   5166 C  CD1 . PHE B  1 277 ? 11.956  70.011  8.439   1.00 50.23  ? 277 PHE B CD1 1 
ATOM   5167 C  CD2 . PHE B  1 277 ? 11.734  67.676  8.926   1.00 47.01  ? 277 PHE B CD2 1 
ATOM   5168 C  CE1 . PHE B  1 277 ? 13.153  70.047  9.138   1.00 50.18  ? 277 PHE B CE1 1 
ATOM   5169 C  CE2 . PHE B  1 277 ? 12.930  67.709  9.626   1.00 48.38  ? 277 PHE B CE2 1 
ATOM   5170 C  CZ  . PHE B  1 277 ? 13.640  68.895  9.736   1.00 49.07  ? 277 PHE B CZ  1 
ATOM   5171 N  N   . GLY B  1 278 ? 10.211  71.106  5.709   1.00 51.70  ? 278 GLY B N   1 
ATOM   5172 C  CA  . GLY B  1 278 ? 10.805  72.401  5.389   1.00 53.55  ? 278 GLY B CA  1 
ATOM   5173 C  C   . GLY B  1 278 ? 10.702  73.387  6.536   1.00 54.36  ? 278 GLY B C   1 
ATOM   5174 O  O   . GLY B  1 278 ? 9.746   73.358  7.315   1.00 62.13  ? 278 GLY B O   1 
ATOM   5175 N  N   . GLY B  1 279 ? 11.702  74.258  6.637   1.00 54.72  ? 279 GLY B N   1 
ATOM   5176 C  CA  . GLY B  1 279 ? 11.682  75.385  7.575   1.00 57.49  ? 279 GLY B CA  1 
ATOM   5177 C  C   . GLY B  1 279 ? 12.784  76.398  7.298   1.00 56.50  ? 279 GLY B C   1 
ATOM   5178 O  O   . GLY B  1 279 ? 13.456  76.856  8.221   1.00 58.83  ? 279 GLY B O   1 
ATOM   5179 N  N   . GLY B  1 280 ? 12.958  76.745  6.020   1.00 51.67  ? 280 GLY B N   1 
ATOM   5180 C  CA  . GLY B  1 280 ? 14.053  77.613  5.555   1.00 50.29  ? 280 GLY B CA  1 
ATOM   5181 C  C   . GLY B  1 280 ? 15.455  77.108  5.860   1.00 51.66  ? 280 GLY B C   1 
ATOM   5182 O  O   . GLY B  1 280 ? 16.400  77.898  5.936   1.00 55.30  ? 280 GLY B O   1 
ATOM   5183 N  N   . PHE B  1 281 ? 15.579  75.790  6.035   1.00 52.36  ? 281 PHE B N   1 
ATOM   5184 C  CA  . PHE B  1 281 ? 16.792  75.132  6.554   1.00 52.20  ? 281 PHE B CA  1 
ATOM   5185 C  C   . PHE B  1 281 ? 17.258  75.597  7.951   1.00 53.99  ? 281 PHE B C   1 
ATOM   5186 O  O   . PHE B  1 281 ? 18.359  75.242  8.377   1.00 62.16  ? 281 PHE B O   1 
ATOM   5187 C  CB  . PHE B  1 281 ? 17.945  75.229  5.541   1.00 50.43  ? 281 PHE B CB  1 
ATOM   5188 C  CG  . PHE B  1 281 ? 17.677  74.510  4.249   1.00 50.68  ? 281 PHE B CG  1 
ATOM   5189 C  CD1 . PHE B  1 281 ? 17.818  73.128  4.172   1.00 46.04  ? 281 PHE B CD1 1 
ATOM   5190 C  CD2 . PHE B  1 281 ? 17.287  75.207  3.107   1.00 51.49  ? 281 PHE B CD2 1 
ATOM   5191 C  CE1 . PHE B  1 281 ? 17.576  72.452  2.986   1.00 45.75  ? 281 PHE B CE1 1 
ATOM   5192 C  CE2 . PHE B  1 281 ? 17.047  74.535  1.914   1.00 52.18  ? 281 PHE B CE2 1 
ATOM   5193 C  CZ  . PHE B  1 281 ? 17.189  73.155  1.855   1.00 50.34  ? 281 PHE B CZ  1 
ATOM   5194 N  N   . TYR B  1 282 ? 16.426  76.366  8.662   1.00 55.96  ? 282 TYR B N   1 
ATOM   5195 C  CA  . TYR B  1 282 ? 16.717  76.823  10.032  1.00 51.39  ? 282 TYR B CA  1 
ATOM   5196 C  C   . TYR B  1 282 ? 15.774  76.230  11.088  1.00 43.65  ? 282 TYR B C   1 
ATOM   5197 O  O   . TYR B  1 282 ? 15.979  76.444  12.285  1.00 39.62  ? 282 TYR B O   1 
ATOM   5198 C  CB  . TYR B  1 282 ? 16.677  78.360  10.109  1.00 53.65  ? 282 TYR B CB  1 
ATOM   5199 C  CG  . TYR B  1 282 ? 15.326  78.997  9.814   1.00 59.05  ? 282 TYR B CG  1 
ATOM   5200 C  CD1 . TYR B  1 282 ? 14.338  79.097  10.803  1.00 63.16  ? 282 TYR B CD1 1 
ATOM   5201 C  CD2 . TYR B  1 282 ? 15.046  79.532  8.557   1.00 55.50  ? 282 TYR B CD2 1 
ATOM   5202 C  CE1 . TYR B  1 282 ? 13.107  79.686  10.537  1.00 57.04  ? 282 TYR B CE1 1 
ATOM   5203 C  CE2 . TYR B  1 282 ? 13.818  80.123  8.284   1.00 57.75  ? 282 TYR B CE2 1 
ATOM   5204 C  CZ  . TYR B  1 282 ? 12.852  80.198  9.275   1.00 57.12  ? 282 TYR B CZ  1 
ATOM   5205 O  OH  . TYR B  1 282 ? 11.639  80.787  9.002   1.00 58.75  ? 282 TYR B OH  1 
ATOM   5206 N  N   . SER B  1 283 ? 14.757  75.488  10.647  1.00 41.23  ? 283 SER B N   1 
ATOM   5207 C  CA  . SER B  1 283 ? 13.667  75.048  11.519  1.00 45.84  ? 283 SER B CA  1 
ATOM   5208 C  C   . SER B  1 283 ? 12.942  73.836  10.940  1.00 46.62  ? 283 SER B C   1 
ATOM   5209 O  O   . SER B  1 283 ? 13.224  73.404  9.820   1.00 47.76  ? 283 SER B O   1 
ATOM   5210 C  CB  . SER B  1 283 ? 12.674  76.198  11.743  1.00 47.61  ? 283 SER B CB  1 
ATOM   5211 O  OG  . SER B  1 283 ? 12.144  76.673  10.519  1.00 43.51  ? 283 SER B OG  1 
ATOM   5212 N  N   . GLY B  1 284 ? 12.013  73.296  11.728  1.00 47.96  ? 284 GLY B N   1 
ATOM   5213 C  CA  . GLY B  1 284 ? 11.164  72.178  11.321  1.00 52.28  ? 284 GLY B CA  1 
ATOM   5214 C  C   . GLY B  1 284 ? 11.440  70.873  12.042  1.00 50.13  ? 284 GLY B C   1 
ATOM   5215 O  O   . GLY B  1 284 ? 12.477  70.703  12.687  1.00 50.43  ? 284 GLY B O   1 
ATOM   5216 N  N   . THR B  1 285 ? 10.486  69.953  11.915  1.00 50.73  ? 285 THR B N   1 
ATOM   5217 C  CA  . THR B  1 285 ? 10.589  68.604  12.473  1.00 51.25  ? 285 THR B CA  1 
ATOM   5218 C  C   . THR B  1 285 ? 9.512   67.693  11.868  1.00 50.77  ? 285 THR B C   1 
ATOM   5219 O  O   . THR B  1 285 ? 8.408   68.142  11.567  1.00 53.80  ? 285 THR B O   1 
ATOM   5220 C  CB  . THR B  1 285 ? 10.482  68.606  14.020  1.00 51.51  ? 285 THR B CB  1 
ATOM   5221 O  OG1 . THR B  1 285 ? 10.556  67.264  14.516  1.00 45.08  ? 285 THR B OG1 1 
ATOM   5222 C  CG2 . THR B  1 285 ? 9.177   69.251  14.502  1.00 53.82  ? 285 THR B CG2 1 
ATOM   5223 N  N   . ALA B  1 286 ? 9.848   66.418  11.695  1.00 50.82  ? 286 ALA B N   1 
ATOM   5224 C  CA  . ALA B  1 286 ? 8.904   65.409  11.189  1.00 50.79  ? 286 ALA B CA  1 
ATOM   5225 C  C   . ALA B  1 286 ? 7.730   65.115  12.137  1.00 49.16  ? 286 ALA B C   1 
ATOM   5226 O  O   . ALA B  1 286 ? 6.656   64.704  11.690  1.00 50.96  ? 286 ALA B O   1 
ATOM   5227 C  CB  . ALA B  1 286 ? 9.649   64.120  10.873  1.00 52.09  ? 286 ALA B CB  1 
ATOM   5228 N  N   . THR B  1 287 ? 7.940   65.333  13.435  1.00 49.36  ? 287 THR B N   1 
ATOM   5229 C  CA  . THR B  1 287 ? 6.950   65.005  14.469  1.00 48.61  ? 287 THR B CA  1 
ATOM   5230 C  C   . THR B  1 287 ? 5.726   65.925  14.566  1.00 47.72  ? 287 THR B C   1 
ATOM   5231 O  O   . THR B  1 287 ? 4.804   65.627  15.332  1.00 49.64  ? 287 THR B O   1 
ATOM   5232 C  CB  . THR B  1 287 ? 7.615   64.975  15.859  1.00 50.75  ? 287 THR B CB  1 
ATOM   5233 O  OG1 . THR B  1 287 ? 8.225   66.243  16.132  1.00 49.57  ? 287 THR B OG1 1 
ATOM   5234 C  CG2 . THR B  1 287 ? 8.664   63.883  15.917  1.00 54.96  ? 287 THR B CG2 1 
ATOM   5235 N  N   . LEU B  1 288 ? 5.716   67.034  13.822  1.00 44.24  ? 288 LEU B N   1 
ATOM   5236 C  CA  . LEU B  1 288 ? 4.570   67.955  13.803  1.00 43.69  ? 288 LEU B CA  1 
ATOM   5237 C  C   . LEU B  1 288 ? 3.255   67.244  13.467  1.00 49.68  ? 288 LEU B C   1 
ATOM   5238 O  O   . LEU B  1 288 ? 3.215   66.376  12.591  1.00 46.34  ? 288 LEU B O   1 
ATOM   5239 C  CB  . LEU B  1 288 ? 4.791   69.089  12.793  1.00 40.29  ? 288 LEU B CB  1 
ATOM   5240 C  CG  . LEU B  1 288 ? 5.961   70.059  12.988  1.00 39.58  ? 288 LEU B CG  1 
ATOM   5241 C  CD1 . LEU B  1 288 ? 5.919   71.138  11.917  1.00 37.31  ? 288 LEU B CD1 1 
ATOM   5242 C  CD2 . LEU B  1 288 ? 5.974   70.694  14.368  1.00 42.62  ? 288 LEU B CD2 1 
ATOM   5243 N  N   . ASP B  1 289 ? 2.192   67.626  14.173  1.00 50.20  ? 289 ASP B N   1 
ATOM   5244 C  CA  . ASP B  1 289 ? 0.847   67.069  13.969  1.00 50.92  ? 289 ASP B CA  1 
ATOM   5245 C  C   . ASP B  1 289 ? 0.233   67.367  12.591  1.00 53.05  ? 289 ASP B C   1 
ATOM   5246 O  O   . ASP B  1 289 ? -0.687  66.669  12.166  1.00 54.84  ? 289 ASP B O   1 
ATOM   5247 C  CB  . ASP B  1 289 ? -0.101  67.569  15.068  1.00 54.90  ? 289 ASP B CB  1 
ATOM   5248 C  CG  . ASP B  1 289 ? 0.219   66.983  16.436  1.00 58.91  ? 289 ASP B CG  1 
ATOM   5249 O  OD1 . ASP B  1 289 ? 0.426   65.754  16.538  1.00 60.28  ? 289 ASP B OD1 1 
ATOM   5250 O  OD2 . ASP B  1 289 ? 0.250   67.753  17.420  1.00 60.02  ? 289 ASP B OD2 1 
ATOM   5251 N  N   . VAL B  1 290 ? 0.714   68.415  11.923  1.00 58.77  ? 290 VAL B N   1 
ATOM   5252 C  CA  . VAL B  1 290 ? 0.343   68.688  10.517  1.00 62.84  ? 290 VAL B CA  1 
ATOM   5253 C  C   . VAL B  1 290 ? 0.885   67.647  9.522   1.00 62.95  ? 290 VAL B C   1 
ATOM   5254 O  O   . VAL B  1 290 ? 0.223   67.356  8.524   1.00 64.76  ? 290 VAL B O   1 
ATOM   5255 C  CB  . VAL B  1 290 ? 0.730   70.115  10.043  1.00 69.72  ? 290 VAL B CB  1 
ATOM   5256 C  CG1 . VAL B  1 290 ? -0.054  71.164  10.819  1.00 79.78  ? 290 VAL B CG1 1 
ATOM   5257 C  CG2 . VAL B  1 290 ? 2.231   70.372  10.140  1.00 70.22  ? 290 VAL B CG2 1 
ATOM   5258 N  N   . TYR B  1 291 ? 2.070   67.091  9.795   1.00 55.63  ? 291 TYR B N   1 
ATOM   5259 C  CA  . TYR B  1 291 ? 2.638   66.002  8.975   1.00 52.95  ? 291 TYR B CA  1 
ATOM   5260 C  C   . TYR B  1 291 ? 2.196   64.606  9.448   1.00 62.52  ? 291 TYR B C   1 
ATOM   5261 O  O   . TYR B  1 291 ? 2.984   63.657  9.389   1.00 68.41  ? 291 TYR B O   1 
ATOM   5262 C  CB  . TYR B  1 291 ? 4.178   66.033  8.988   1.00 46.83  ? 291 TYR B CB  1 
ATOM   5263 C  CG  . TYR B  1 291 ? 4.840   67.350  8.661   1.00 42.73  ? 291 TYR B CG  1 
ATOM   5264 C  CD1 . TYR B  1 291 ? 4.297   68.231  7.725   1.00 40.22  ? 291 TYR B CD1 1 
ATOM   5265 C  CD2 . TYR B  1 291 ? 6.052   67.695  9.263   1.00 36.45  ? 291 TYR B CD2 1 
ATOM   5266 C  CE1 . TYR B  1 291 ? 4.929   69.430  7.428   1.00 38.43  ? 291 TYR B CE1 1 
ATOM   5267 C  CE2 . TYR B  1 291 ? 6.686   68.890  8.965   1.00 35.84  ? 291 TYR B CE2 1 
ATOM   5268 C  CZ  . TYR B  1 291 ? 6.122   69.753  8.048   1.00 37.96  ? 291 TYR B CZ  1 
ATOM   5269 O  OH  . TYR B  1 291 ? 6.749   70.940  7.751   1.00 42.59  ? 291 TYR B OH  1 
ATOM   5270 N  N   . ASP B  1 292 ? 0.952   64.464  9.909   1.00 65.22  ? 292 ASP B N   1 
ATOM   5271 C  CA  . ASP B  1 292 ? 0.509   63.198  10.506  1.00 67.04  ? 292 ASP B CA  1 
ATOM   5272 C  C   . ASP B  1 292 ? 0.434   62.105  9.431   1.00 67.55  ? 292 ASP B C   1 
ATOM   5273 O  O   . ASP B  1 292 ? -0.401  62.155  8.524   1.00 67.71  ? 292 ASP B O   1 
ATOM   5274 C  CB  . ASP B  1 292 ? -0.825  63.349  11.256  1.00 69.48  ? 292 ASP B CB  1 
ATOM   5275 C  CG  . ASP B  1 292 ? -0.938  62.405  12.455  1.00 68.21  ? 292 ASP B CG  1 
ATOM   5276 O  OD1 . ASP B  1 292 ? -0.695  61.191  12.282  1.00 58.13  ? 292 ASP B OD1 1 
ATOM   5277 O  OD2 . ASP B  1 292 ? -1.270  62.880  13.564  1.00 62.86  ? 292 ASP B OD2 1 
ATOM   5278 N  N   . HIS B  1 293 ? 1.330   61.128  9.557   1.00 63.40  ? 293 HIS B N   1 
ATOM   5279 C  CA  . HIS B  1 293 ? 1.526   60.075  8.553   1.00 61.56  ? 293 HIS B CA  1 
ATOM   5280 C  C   . HIS B  1 293 ? 0.407   59.032  8.547   1.00 59.30  ? 293 HIS B C   1 
ATOM   5281 O  O   . HIS B  1 293 ? 0.184   58.372  7.528   1.00 56.75  ? 293 HIS B O   1 
ATOM   5282 C  CB  . HIS B  1 293 ? 2.848   59.333  8.791   1.00 67.74  ? 293 HIS B CB  1 
ATOM   5283 C  CG  . HIS B  1 293 ? 4.024   60.226  9.041   1.00 67.22  ? 293 HIS B CG  1 
ATOM   5284 N  ND1 . HIS B  1 293 ? 4.349   61.283  8.219   1.00 73.26  ? 293 HIS B ND1 1 
ATOM   5285 C  CD2 . HIS B  1 293 ? 4.957   60.210  10.022  1.00 68.35  ? 293 HIS B CD2 1 
ATOM   5286 C  CE1 . HIS B  1 293 ? 5.429   61.884  8.686   1.00 71.70  ? 293 HIS B CE1 1 
ATOM   5287 N  NE2 . HIS B  1 293 ? 5.817   61.253  9.780   1.00 68.33  ? 293 HIS B NE2 1 
ATOM   5288 N  N   . ARG B  1 294 ? -0.267  58.874  9.689   1.00 61.02  ? 294 ARG B N   1 
ATOM   5289 C  CA  . ARG B  1 294 ? -1.286  57.836  9.895   1.00 63.48  ? 294 ARG B CA  1 
ATOM   5290 C  C   . ARG B  1 294 ? -2.382  57.884  8.841   1.00 60.31  ? 294 ARG B C   1 
ATOM   5291 O  O   . ARG B  1 294 ? -2.702  56.873  8.211   1.00 52.84  ? 294 ARG B O   1 
ATOM   5292 C  CB  . ARG B  1 294 ? -1.946  58.002  11.268  1.00 67.47  ? 294 ARG B CB  1 
ATOM   5293 C  CG  . ARG B  1 294 ? -1.045  57.785  12.472  1.00 71.78  ? 294 ARG B CG  1 
ATOM   5294 C  CD  . ARG B  1 294 ? -1.860  57.945  13.745  1.00 74.64  ? 294 ARG B CD  1 
ATOM   5295 N  NE  . ARG B  1 294 ? -1.068  57.860  14.971  1.00 75.38  ? 294 ARG B NE  1 
ATOM   5296 C  CZ  . ARG B  1 294 ? -1.547  58.060  16.201  1.00 84.24  ? 294 ARG B CZ  1 
ATOM   5297 N  NH1 . ARG B  1 294 ? -2.831  58.366  16.397  1.00 88.61  ? 294 ARG B NH1 1 
ATOM   5298 N  NH2 . ARG B  1 294 ? -0.736  57.955  17.250  1.00 86.88  ? 294 ARG B NH2 1 
ATOM   5299 N  N   . ALA B  1 295 ? -2.947  59.078  8.674   1.00 57.22  ? 295 ALA B N   1 
ATOM   5300 C  CA  . ALA B  1 295 ? -4.055  59.317  7.754   1.00 57.43  ? 295 ALA B CA  1 
ATOM   5301 C  C   . ALA B  1 295 ? -3.673  58.996  6.313   1.00 57.89  ? 295 ALA B C   1 
ATOM   5302 O  O   . ALA B  1 295 ? -4.368  58.235  5.647   1.00 59.58  ? 295 ALA B O   1 
ATOM   5303 C  CB  . ALA B  1 295 ? -4.521  60.759  7.863   1.00 61.27  ? 295 ALA B CB  1 
ATOM   5304 N  N   . LEU B  1 296 ? -2.560  59.566  5.855   1.00 59.53  ? 296 LEU B N   1 
ATOM   5305 C  CA  . LEU B  1 296 ? -2.065  59.353  4.485   1.00 57.25  ? 296 LEU B CA  1 
ATOM   5306 C  C   . LEU B  1 296 ? -1.809  57.879  4.162   1.00 53.89  ? 296 LEU B C   1 
ATOM   5307 O  O   . LEU B  1 296 ? -2.323  57.358  3.170   1.00 52.55  ? 296 LEU B O   1 
ATOM   5308 C  CB  . LEU B  1 296 ? -0.786  60.163  4.235   1.00 59.98  ? 296 LEU B CB  1 
ATOM   5309 C  CG  . LEU B  1 296 ? -0.135  60.040  2.847   1.00 61.88  ? 296 LEU B CG  1 
ATOM   5310 C  CD1 . LEU B  1 296 ? -1.073  60.506  1.739   1.00 60.93  ? 296 LEU B CD1 1 
ATOM   5311 C  CD2 . LEU B  1 296 ? 1.172   60.817  2.808   1.00 64.81  ? 296 LEU B CD2 1 
ATOM   5312 N  N   . ALA B  1 297 ? -0.997  57.236  4.998   1.00 50.34  ? 297 ALA B N   1 
ATOM   5313 C  CA  . ALA B  1 297 ? -0.667  55.812  4.864   1.00 49.35  ? 297 ALA B CA  1 
ATOM   5314 C  C   . ALA B  1 297 ? -1.911  54.926  4.785   1.00 52.42  ? 297 ALA B C   1 
ATOM   5315 O  O   . ALA B  1 297 ? -2.061  54.135  3.852   1.00 55.25  ? 297 ALA B O   1 
ATOM   5316 C  CB  . ALA B  1 297 ? 0.204   55.368  6.029   1.00 49.60  ? 297 ALA B CB  1 
ATOM   5317 N  N   . SER B  1 298 ? -2.794  55.083  5.769   1.00 51.54  ? 298 SER B N   1 
ATOM   5318 C  CA  . SER B  1 298 ? -4.016  54.274  5.882   1.00 48.31  ? 298 SER B CA  1 
ATOM   5319 C  C   . SER B  1 298 ? -5.034  54.490  4.754   1.00 48.87  ? 298 SER B C   1 
ATOM   5320 O  O   . SER B  1 298 ? -5.771  53.565  4.406   1.00 56.59  ? 298 SER B O   1 
ATOM   5321 C  CB  . SER B  1 298 ? -4.697  54.531  7.231   1.00 51.25  ? 298 SER B CB  1 
ATOM   5322 O  OG  . SER B  1 298 ? -5.080  55.891  7.363   1.00 52.73  ? 298 SER B OG  1 
ATOM   5323 N  N   . GLU B  1 299 ? -5.067  55.696  4.187   1.00 49.09  ? 299 GLU B N   1 
ATOM   5324 C  CA  . GLU B  1 299 ? -6.064  56.068  3.169   1.00 50.04  ? 299 GLU B CA  1 
ATOM   5325 C  C   . GLU B  1 299 ? -5.677  55.645  1.748   1.00 52.83  ? 299 GLU B C   1 
ATOM   5326 O  O   . GLU B  1 299 ? -6.549  55.328  0.933   1.00 52.13  ? 299 GLU B O   1 
ATOM   5327 C  CB  . GLU B  1 299 ? -6.306  57.581  3.199   1.00 51.55  ? 299 GLU B CB  1 
ATOM   5328 C  CG  . GLU B  1 299 ? -7.718  58.009  2.820   1.00 57.87  ? 299 GLU B CG  1 
ATOM   5329 C  CD  . GLU B  1 299 ? -8.762  57.669  3.874   1.00 62.62  ? 299 GLU B CD  1 
ATOM   5330 O  OE1 . GLU B  1 299 ? -8.434  57.626  5.081   1.00 64.38  ? 299 GLU B OE1 1 
ATOM   5331 O  OE2 . GLU B  1 299 ? -9.929  57.446  3.491   1.00 67.40  ? 299 GLU B OE2 1 
ATOM   5332 N  N   . GLU B  1 300 ? -4.374  55.651  1.468   1.00 57.21  ? 300 GLU B N   1 
ATOM   5333 C  CA  . GLU B  1 300 ? -3.831  55.355  0.131   1.00 58.26  ? 300 GLU B CA  1 
ATOM   5334 C  C   . GLU B  1 300 ? -3.097  54.018  0.001   1.00 56.97  ? 300 GLU B C   1 
ATOM   5335 O  O   . GLU B  1 300 ? -2.691  53.652  -1.105  1.00 55.74  ? 300 GLU B O   1 
ATOM   5336 C  CB  . GLU B  1 300 ? -2.871  56.474  -0.288  1.00 58.82  ? 300 GLU B CB  1 
ATOM   5337 C  CG  . GLU B  1 300 ? -3.432  57.880  -0.130  1.00 63.50  ? 300 GLU B CG  1 
ATOM   5338 C  CD  . GLU B  1 300 ? -4.781  58.053  -0.805  1.00 64.56  ? 300 GLU B CD  1 
ATOM   5339 O  OE1 . GLU B  1 300 ? -4.912  57.657  -1.982  1.00 71.09  ? 300 GLU B OE1 1 
ATOM   5340 O  OE2 . GLU B  1 300 ? -5.712  58.580  -0.159  1.00 67.56  ? 300 GLU B OE2 1 
ATOM   5341 N  N   . ASN B  1 301 ? -2.940  53.296  1.111   1.00 57.80  ? 301 ASN B N   1 
ATOM   5342 C  CA  . ASN B  1 301 ? -2.126  52.073  1.166   1.00 64.09  ? 301 ASN B CA  1 
ATOM   5343 C  C   . ASN B  1 301 ? -0.705  52.307  0.617   1.00 59.83  ? 301 ASN B C   1 
ATOM   5344 O  O   . ASN B  1 301 ? -0.329  51.784  -0.438  1.00 64.54  ? 301 ASN B O   1 
ATOM   5345 C  CB  . ASN B  1 301 ? -2.837  50.894  0.470   1.00 64.30  ? 301 ASN B CB  1 
ATOM   5346 C  CG  . ASN B  1 301 ? -3.932  50.282  1.330   1.00 69.01  ? 301 ASN B CG  1 
ATOM   5347 O  OD1 . ASN B  1 301 ? -3.658  49.703  2.381   1.00 70.79  ? 301 ASN B OD1 1 
ATOM   5348 N  ND2 . ASN B  1 301 ? -5.177  50.401  0.881   1.00 73.86  ? 301 ASN B ND2 1 
ATOM   5349 N  N   . VAL B  1 302 ? 0.049   53.139  1.336   1.00 50.37  ? 302 VAL B N   1 
ATOM   5350 C  CA  . VAL B  1 302 ? 1.475   53.384  1.064   1.00 49.34  ? 302 VAL B CA  1 
ATOM   5351 C  C   . VAL B  1 302 ? 2.254   53.407  2.377   1.00 48.38  ? 302 VAL B C   1 
ATOM   5352 O  O   . VAL B  1 302 ? 1.697   53.733  3.431   1.00 50.49  ? 302 VAL B O   1 
ATOM   5353 C  CB  . VAL B  1 302 ? 1.725   54.723  0.314   1.00 53.48  ? 302 VAL B CB  1 
ATOM   5354 C  CG1 . VAL B  1 302 ? 1.013   54.735  -1.030  1.00 58.72  ? 302 VAL B CG1 1 
ATOM   5355 C  CG2 . VAL B  1 302 ? 1.302   55.932  1.143   1.00 56.51  ? 302 VAL B CG2 1 
ATOM   5356 N  N   . ILE B  1 303 ? 3.544   53.088  2.299   1.00 45.17  ? 303 ILE B N   1 
ATOM   5357 C  CA  . ILE B  1 303 ? 4.445   53.212  3.444   1.00 45.72  ? 303 ILE B CA  1 
ATOM   5358 C  C   . ILE B  1 303 ? 4.910   54.671  3.515   1.00 49.93  ? 303 ILE B C   1 
ATOM   5359 O  O   . ILE B  1 303 ? 5.776   55.092  2.745   1.00 59.81  ? 303 ILE B O   1 
ATOM   5360 C  CB  . ILE B  1 303 ? 5.664   52.258  3.340   1.00 48.08  ? 303 ILE B CB  1 
ATOM   5361 C  CG1 . ILE B  1 303 ? 5.231   50.812  3.045   1.00 47.79  ? 303 ILE B CG1 1 
ATOM   5362 C  CG2 . ILE B  1 303 ? 6.504   52.299  4.613   1.00 48.14  ? 303 ILE B CG2 1 
ATOM   5363 C  CD1 . ILE B  1 303 ? 4.222   50.224  4.012   1.00 49.55  ? 303 ILE B CD1 1 
ATOM   5364 N  N   . VAL B  1 304 ? 4.317   55.439  4.428   1.00 49.98  ? 304 VAL B N   1 
ATOM   5365 C  CA  . VAL B  1 304 ? 4.742   56.819  4.674   1.00 43.89  ? 304 VAL B CA  1 
ATOM   5366 C  C   . VAL B  1 304 ? 5.911   56.799  5.651   1.00 47.17  ? 304 VAL B C   1 
ATOM   5367 O  O   . VAL B  1 304 ? 5.774   56.343  6.788   1.00 52.58  ? 304 VAL B O   1 
ATOM   5368 C  CB  . VAL B  1 304 ? 3.613   57.703  5.240   1.00 42.61  ? 304 VAL B CB  1 
ATOM   5369 C  CG1 . VAL B  1 304 ? 4.094   59.141  5.418   1.00 42.74  ? 304 VAL B CG1 1 
ATOM   5370 C  CG2 . VAL B  1 304 ? 2.408   57.686  4.313   1.00 45.90  ? 304 VAL B CG2 1 
ATOM   5371 N  N   . VAL B  1 305 ? 7.051   57.304  5.186   1.00 51.45  ? 305 VAL B N   1 
ATOM   5372 C  CA  . VAL B  1 305 ? 8.277   57.404  5.971   1.00 51.63  ? 305 VAL B CA  1 
ATOM   5373 C  C   . VAL B  1 305 ? 8.618   58.889  6.093   1.00 49.98  ? 305 VAL B C   1 
ATOM   5374 O  O   . VAL B  1 305 ? 8.292   59.686  5.209   1.00 50.98  ? 305 VAL B O   1 
ATOM   5375 C  CB  . VAL B  1 305 ? 9.434   56.625  5.293   1.00 59.09  ? 305 VAL B CB  1 
ATOM   5376 C  CG1 . VAL B  1 305 ? 10.744  56.737  6.070   1.00 60.52  ? 305 VAL B CG1 1 
ATOM   5377 C  CG2 . VAL B  1 305 ? 9.061   55.157  5.132   1.00 61.89  ? 305 VAL B CG2 1 
ATOM   5378 N  N   . SER B  1 306 ? 9.256   59.255  7.200   1.00 47.31  ? 306 SER B N   1 
ATOM   5379 C  CA  . SER B  1 306 ? 9.792   60.602  7.391   1.00 47.88  ? 306 SER B CA  1 
ATOM   5380 C  C   . SER B  1 306 ? 11.069  60.536  8.213   1.00 50.16  ? 306 SER B C   1 
ATOM   5381 O  O   . SER B  1 306 ? 11.383  59.507  8.819   1.00 50.47  ? 306 SER B O   1 
ATOM   5382 C  CB  . SER B  1 306 ? 8.766   61.524  8.053   1.00 48.64  ? 306 SER B CB  1 
ATOM   5383 O  OG  . SER B  1 306 ? 8.451   61.097  9.364   1.00 49.38  ? 306 SER B OG  1 
ATOM   5384 N  N   . LEU B  1 307 ? 11.793  61.649  8.224   1.00 50.28  ? 307 LEU B N   1 
ATOM   5385 C  CA  . LEU B  1 307 ? 13.116  61.713  8.836   1.00 46.00  ? 307 LEU B CA  1 
ATOM   5386 C  C   . LEU B  1 307 ? 13.376  63.068  9.473   1.00 44.74  ? 307 LEU B C   1 
ATOM   5387 O  O   . LEU B  1 307 ? 12.756  64.073  9.113   1.00 51.26  ? 307 LEU B O   1 
ATOM   5388 C  CB  . LEU B  1 307 ? 14.188  61.410  7.785   1.00 44.46  ? 307 LEU B CB  1 
ATOM   5389 C  CG  . LEU B  1 307 ? 14.367  62.445  6.662   1.00 41.14  ? 307 LEU B CG  1 
ATOM   5390 C  CD1 . LEU B  1 307 ? 15.496  63.419  6.972   1.00 43.89  ? 307 LEU B CD1 1 
ATOM   5391 C  CD2 . LEU B  1 307 ? 14.639  61.761  5.331   1.00 39.60  ? 307 LEU B CD2 1 
ATOM   5392 N  N   . GLN B  1 308 ? 14.318  63.073  10.410  1.00 44.50  ? 308 GLN B N   1 
ATOM   5393 C  CA  . GLN B  1 308 ? 14.760  64.281  11.090  1.00 47.95  ? 308 GLN B CA  1 
ATOM   5394 C  C   . GLN B  1 308 ? 16.156  64.607  10.591  1.00 47.63  ? 308 GLN B C   1 
ATOM   5395 O  O   . GLN B  1 308 ? 17.087  63.830  10.816  1.00 55.60  ? 308 GLN B O   1 
ATOM   5396 C  CB  . GLN B  1 308 ? 14.813  64.051  12.597  1.00 48.53  ? 308 GLN B CB  1 
ATOM   5397 C  CG  . GLN B  1 308 ? 13.482  63.749  13.267  1.00 49.29  ? 308 GLN B CG  1 
ATOM   5398 C  CD  . GLN B  1 308 ? 12.691  64.995  13.611  1.00 52.83  ? 308 GLN B CD  1 
ATOM   5399 O  OE1 . GLN B  1 308 ? 12.816  66.032  12.957  1.00 56.87  ? 308 GLN B OE1 1 
ATOM   5400 N  NE2 . GLN B  1 308 ? 11.861  64.897  14.641  1.00 63.29  ? 308 GLN B NE2 1 
ATOM   5401 N  N   . TYR B  1 309 ? 16.299  65.738  9.905   1.00 46.09  ? 309 TYR B N   1 
ATOM   5402 C  CA  . TYR B  1 309 ? 17.616  66.217  9.468   1.00 48.54  ? 309 TYR B CA  1 
ATOM   5403 C  C   . TYR B  1 309 ? 17.989  67.482  10.247  1.00 46.95  ? 309 TYR B C   1 
ATOM   5404 O  O   . TYR B  1 309 ? 17.114  68.278  10.599  1.00 47.90  ? 309 TYR B O   1 
ATOM   5405 C  CB  . TYR B  1 309 ? 17.660  66.437  7.945   1.00 51.00  ? 309 TYR B CB  1 
ATOM   5406 C  CG  . TYR B  1 309 ? 16.824  67.587  7.422   1.00 53.24  ? 309 TYR B CG  1 
ATOM   5407 C  CD1 . TYR B  1 309 ? 15.477  67.408  7.101   1.00 53.60  ? 309 TYR B CD1 1 
ATOM   5408 C  CD2 . TYR B  1 309 ? 17.386  68.851  7.220   1.00 52.74  ? 309 TYR B CD2 1 
ATOM   5409 C  CE1 . TYR B  1 309 ? 14.707  68.458  6.616   1.00 56.97  ? 309 TYR B CE1 1 
ATOM   5410 C  CE2 . TYR B  1 309 ? 16.624  69.909  6.736   1.00 55.21  ? 309 TYR B CE2 1 
ATOM   5411 C  CZ  . TYR B  1 309 ? 15.286  69.708  6.436   1.00 58.79  ? 309 TYR B CZ  1 
ATOM   5412 O  OH  . TYR B  1 309 ? 14.527  70.750  5.953   1.00 58.42  ? 309 TYR B OH  1 
ATOM   5413 N  N   . ARG B  1 310 ? 19.283  67.643  10.528  1.00 45.92  ? 310 ARG B N   1 
ATOM   5414 C  CA  . ARG B  1 310 ? 19.790  68.804  11.269  1.00 45.46  ? 310 ARG B CA  1 
ATOM   5415 C  C   . ARG B  1 310 ? 19.536  70.098  10.500  1.00 44.38  ? 310 ARG B C   1 
ATOM   5416 O  O   . ARG B  1 310 ? 19.768  70.157  9.290   1.00 46.07  ? 310 ARG B O   1 
ATOM   5417 C  CB  . ARG B  1 310 ? 21.293  68.681  11.528  1.00 47.11  ? 310 ARG B CB  1 
ATOM   5418 C  CG  . ARG B  1 310 ? 21.695  67.606  12.520  1.00 44.38  ? 310 ARG B CG  1 
ATOM   5419 C  CD  . ARG B  1 310 ? 23.210  67.573  12.707  1.00 46.83  ? 310 ARG B CD  1 
ATOM   5420 N  NE  . ARG B  1 310 ? 23.889  66.664  11.780  1.00 49.34  ? 310 ARG B NE  1 
ATOM   5421 C  CZ  . ARG B  1 310 ? 25.211  66.572  11.616  1.00 51.19  ? 310 ARG B CZ  1 
ATOM   5422 N  NH1 . ARG B  1 310 ? 26.051  67.347  12.305  1.00 53.82  ? 310 ARG B NH1 1 
ATOM   5423 N  NH2 . ARG B  1 310 ? 25.704  65.696  10.742  1.00 49.72  ? 310 ARG B NH2 1 
ATOM   5424 N  N   . VAL B  1 311 ? 19.073  71.123  11.212  1.00 49.49  ? 311 VAL B N   1 
ATOM   5425 C  CA  . VAL B  1 311 ? 18.785  72.440  10.621  1.00 49.97  ? 311 VAL B CA  1 
ATOM   5426 C  C   . VAL B  1 311 ? 19.617  73.524  11.296  1.00 48.15  ? 311 VAL B C   1 
ATOM   5427 O  O   . VAL B  1 311 ? 20.283  73.273  12.304  1.00 48.91  ? 311 VAL B O   1 
ATOM   5428 C  CB  . VAL B  1 311 ? 17.276  72.804  10.666  1.00 49.36  ? 311 VAL B CB  1 
ATOM   5429 C  CG1 . VAL B  1 311 ? 16.504  71.949  9.675   1.00 48.94  ? 311 VAL B CG1 1 
ATOM   5430 C  CG2 . VAL B  1 311 ? 16.691  72.672  12.069  1.00 51.58  ? 311 VAL B CG2 1 
ATOM   5431 N  N   . ALA B  1 312 ? 19.589  74.713  10.695  1.00 46.59  ? 312 ALA B N   1 
ATOM   5432 C  CA  . ALA B  1 312 ? 20.304  75.905  11.171  1.00 47.84  ? 312 ALA B CA  1 
ATOM   5433 C  C   . ALA B  1 312 ? 21.823  75.729  10.980  1.00 49.34  ? 312 ALA B C   1 
ATOM   5434 O  O   . ALA B  1 312 ? 22.245  74.906  10.161  1.00 50.27  ? 312 ALA B O   1 
ATOM   5435 C  CB  . ALA B  1 312 ? 19.918  76.228  12.617  1.00 49.24  ? 312 ALA B CB  1 
ATOM   5436 N  N   . SER B  1 313 ? 22.637  76.506  11.699  1.00 51.98  ? 313 SER B N   1 
ATOM   5437 C  CA  . SER B  1 313 ? 24.102  76.410  11.608  1.00 49.44  ? 313 SER B CA  1 
ATOM   5438 C  C   . SER B  1 313 ? 24.625  75.028  12.008  1.00 52.20  ? 313 SER B C   1 
ATOM   5439 O  O   . SER B  1 313 ? 25.627  74.570  11.473  1.00 54.01  ? 313 SER B O   1 
ATOM   5440 C  CB  . SER B  1 313 ? 24.784  77.492  12.453  1.00 47.43  ? 313 SER B CB  1 
ATOM   5441 O  OG  . SER B  1 313 ? 24.484  77.338  13.832  1.00 54.64  ? 313 SER B OG  1 
ATOM   5442 N  N   . LEU B  1 314 ? 23.936  74.359  12.929  1.00 56.53  ? 314 LEU B N   1 
ATOM   5443 C  CA  . LEU B  1 314 ? 24.268  72.973  13.284  1.00 60.97  ? 314 LEU B CA  1 
ATOM   5444 C  C   . LEU B  1 314 ? 24.147  72.007  12.098  1.00 63.57  ? 314 LEU B C   1 
ATOM   5445 O  O   . LEU B  1 314 ? 24.901  71.034  12.009  1.00 66.69  ? 314 LEU B O   1 
ATOM   5446 C  CB  . LEU B  1 314 ? 23.390  72.489  14.440  1.00 61.23  ? 314 LEU B CB  1 
ATOM   5447 C  CG  . LEU B  1 314 ? 23.487  73.265  15.757  1.00 63.68  ? 314 LEU B CG  1 
ATOM   5448 C  CD1 . LEU B  1 314 ? 22.540  72.651  16.772  1.00 62.62  ? 314 LEU B CD1 1 
ATOM   5449 C  CD2 . LEU B  1 314 ? 24.905  73.288  16.306  1.00 65.03  ? 314 LEU B CD2 1 
ATOM   5450 N  N   . GLY B  1 315 ? 23.205  72.289  11.200  1.00 60.40  ? 315 GLY B N   1 
ATOM   5451 C  CA  . GLY B  1 315 ? 22.993  71.497  9.989   1.00 55.94  ? 315 GLY B CA  1 
ATOM   5452 C  C   . GLY B  1 315 ? 23.734  71.945  8.738   1.00 52.35  ? 315 GLY B C   1 
ATOM   5453 O  O   . GLY B  1 315 ? 23.969  71.125  7.849   1.00 48.51  ? 315 GLY B O   1 
ATOM   5454 N  N   . PHE B  1 316 ? 24.092  73.229  8.649   1.00 47.04  ? 316 PHE B N   1 
ATOM   5455 C  CA  . PHE B  1 316 ? 24.607  73.808  7.389   1.00 51.11  ? 316 PHE B CA  1 
ATOM   5456 C  C   . PHE B  1 316 ? 25.732  74.846  7.549   1.00 53.32  ? 316 PHE B C   1 
ATOM   5457 O  O   . PHE B  1 316 ? 25.871  75.749  6.714   1.00 59.60  ? 316 PHE B O   1 
ATOM   5458 C  CB  . PHE B  1 316 ? 23.438  74.404  6.581   1.00 51.21  ? 316 PHE B CB  1 
ATOM   5459 C  CG  . PHE B  1 316 ? 22.498  73.372  6.025   1.00 47.06  ? 316 PHE B CG  1 
ATOM   5460 C  CD1 . PHE B  1 316 ? 22.785  72.723  4.829   1.00 46.15  ? 316 PHE B CD1 1 
ATOM   5461 C  CD2 . PHE B  1 316 ? 21.328  73.040  6.700   1.00 46.36  ? 316 PHE B CD2 1 
ATOM   5462 C  CE1 . PHE B  1 316 ? 21.924  71.764  4.316   1.00 46.48  ? 316 PHE B CE1 1 
ATOM   5463 C  CE2 . PHE B  1 316 ? 20.465  72.079  6.195   1.00 46.25  ? 316 PHE B CE2 1 
ATOM   5464 C  CZ  . PHE B  1 316 ? 20.761  71.441  4.999   1.00 46.67  ? 316 PHE B CZ  1 
ATOM   5465 N  N   . LEU B  1 317 ? 26.550  74.706  8.594   1.00 56.14  ? 317 LEU B N   1 
ATOM   5466 C  CA  . LEU B  1 317 ? 27.686  75.614  8.811   1.00 55.53  ? 317 LEU B CA  1 
ATOM   5467 C  C   . LEU B  1 317 ? 28.791  75.293  7.812   1.00 54.32  ? 317 LEU B C   1 
ATOM   5468 O  O   . LEU B  1 317 ? 29.092  74.122  7.573   1.00 55.61  ? 317 LEU B O   1 
ATOM   5469 C  CB  . LEU B  1 317 ? 28.245  75.487  10.232  1.00 54.39  ? 317 LEU B CB  1 
ATOM   5470 C  CG  . LEU B  1 317 ? 29.332  76.475  10.671  1.00 54.49  ? 317 LEU B CG  1 
ATOM   5471 C  CD1 . LEU B  1 317 ? 28.748  77.865  10.848  1.00 53.71  ? 317 LEU B CD1 1 
ATOM   5472 C  CD2 . LEU B  1 317 ? 29.977  76.016  11.968  1.00 58.26  ? 317 LEU B CD2 1 
ATOM   5473 N  N   . PHE B  1 318 ? 29.394  76.340  7.251   1.00 54.76  ? 318 PHE B N   1 
ATOM   5474 C  CA  . PHE B  1 318 ? 30.477  76.213  6.274   1.00 54.68  ? 318 PHE B CA  1 
ATOM   5475 C  C   . PHE B  1 318 ? 31.613  77.169  6.623   1.00 55.39  ? 318 PHE B C   1 
ATOM   5476 O  O   . PHE B  1 318 ? 31.385  78.362  6.821   1.00 58.46  ? 318 PHE B O   1 
ATOM   5477 C  CB  . PHE B  1 318 ? 29.956  76.527  4.867   1.00 54.99  ? 318 PHE B CB  1 
ATOM   5478 C  CG  . PHE B  1 318 ? 30.975  76.329  3.773   1.00 54.98  ? 318 PHE B CG  1 
ATOM   5479 C  CD1 . PHE B  1 318 ? 31.818  77.370  3.381   1.00 49.91  ? 318 PHE B CD1 1 
ATOM   5480 C  CD2 . PHE B  1 318 ? 31.082  75.104  3.118   1.00 53.55  ? 318 PHE B CD2 1 
ATOM   5481 C  CE1 . PHE B  1 318 ? 32.753  77.184  2.371   1.00 45.49  ? 318 PHE B CE1 1 
ATOM   5482 C  CE2 . PHE B  1 318 ? 32.010  74.916  2.103   1.00 48.80  ? 318 PHE B CE2 1 
ATOM   5483 C  CZ  . PHE B  1 318 ? 32.846  75.957  1.729   1.00 46.92  ? 318 PHE B CZ  1 
ATOM   5484 N  N   . LEU B  1 319 ? 32.823  76.624  6.720   1.00 56.77  ? 319 LEU B N   1 
ATOM   5485 C  CA  . LEU B  1 319 ? 34.064  77.409  6.770   1.00 52.63  ? 319 LEU B CA  1 
ATOM   5486 C  C   . LEU B  1 319 ? 35.074  77.003  5.678   1.00 53.24  ? 319 LEU B C   1 
ATOM   5487 O  O   . LEU B  1 319 ? 36.191  77.522  5.645   1.00 59.22  ? 319 LEU B O   1 
ATOM   5488 C  CB  . LEU B  1 319 ? 34.705  77.273  8.156   1.00 55.69  ? 319 LEU B CB  1 
ATOM   5489 C  CG  . LEU B  1 319 ? 33.931  77.931  9.305   1.00 58.20  ? 319 LEU B CG  1 
ATOM   5490 C  CD1 . LEU B  1 319 ? 34.240  77.268  10.641  1.00 59.06  ? 319 LEU B CD1 1 
ATOM   5491 C  CD2 . LEU B  1 319 ? 34.230  79.422  9.365   1.00 60.42  ? 319 LEU B CD2 1 
ATOM   5492 N  N   . GLY B  1 320 ? 34.676  76.105  4.776   1.00 51.99  ? 320 GLY B N   1 
ATOM   5493 C  CA  . GLY B  1 320 ? 35.575  75.573  3.744   1.00 53.44  ? 320 GLY B CA  1 
ATOM   5494 C  C   . GLY B  1 320 ? 36.690  74.681  4.267   1.00 55.56  ? 320 GLY B C   1 
ATOM   5495 O  O   . GLY B  1 320 ? 37.729  74.542  3.618   1.00 55.88  ? 320 GLY B O   1 
ATOM   5496 N  N   . THR B  1 321 ? 36.465  74.076  5.434   1.00 56.49  ? 321 THR B N   1 
ATOM   5497 C  CA  . THR B  1 321 ? 37.426  73.183  6.089   1.00 56.20  ? 321 THR B CA  1 
ATOM   5498 C  C   . THR B  1 321 ? 36.795  71.797  6.227   1.00 53.51  ? 321 THR B C   1 
ATOM   5499 O  O   . THR B  1 321 ? 35.584  71.657  6.054   1.00 47.82  ? 321 THR B O   1 
ATOM   5500 C  CB  . THR B  1 321 ? 37.816  73.696  7.494   1.00 57.99  ? 321 THR B CB  1 
ATOM   5501 O  OG1 . THR B  1 321 ? 36.634  73.959  8.262   1.00 60.61  ? 321 THR B OG1 1 
ATOM   5502 C  CG2 . THR B  1 321 ? 38.642  74.966  7.393   1.00 59.80  ? 321 THR B CG2 1 
ATOM   5503 N  N   . PRO B  1 322 ? 37.608  70.763  6.520   1.00 54.05  ? 322 PRO B N   1 
ATOM   5504 C  CA  . PRO B  1 322 ? 37.038  69.432  6.786   1.00 55.41  ? 322 PRO B CA  1 
ATOM   5505 C  C   . PRO B  1 322 ? 36.151  69.352  8.039   1.00 52.09  ? 322 PRO B C   1 
ATOM   5506 O  O   . PRO B  1 322 ? 35.182  68.594  8.050   1.00 49.42  ? 322 PRO B O   1 
ATOM   5507 C  CB  . PRO B  1 322 ? 38.278  68.537  6.940   1.00 56.68  ? 322 PRO B CB  1 
ATOM   5508 C  CG  . PRO B  1 322 ? 39.420  69.464  7.170   1.00 55.78  ? 322 PRO B CG  1 
ATOM   5509 C  CD  . PRO B  1 322 ? 39.078  70.710  6.420   1.00 53.14  ? 322 PRO B CD  1 
ATOM   5510 N  N   . GLU B  1 323 ? 36.480  70.135  9.064   1.00 55.13  ? 323 GLU B N   1 
ATOM   5511 C  CA  . GLU B  1 323 ? 35.710  70.167  10.314  1.00 60.74  ? 323 GLU B CA  1 
ATOM   5512 C  C   . GLU B  1 323 ? 34.411  70.985  10.226  1.00 59.57  ? 323 GLU B C   1 
ATOM   5513 O  O   . GLU B  1 323 ? 33.553  70.878  11.106  1.00 57.82  ? 323 GLU B O   1 
ATOM   5514 C  CB  . GLU B  1 323 ? 36.591  70.680  11.452  1.00 67.13  ? 323 GLU B CB  1 
ATOM   5515 C  CG  . GLU B  1 323 ? 37.795  69.786  11.720  1.00 67.47  ? 323 GLU B CG  1 
ATOM   5516 C  CD  . GLU B  1 323 ? 38.501  70.101  13.026  1.00 68.81  ? 323 GLU B CD  1 
ATOM   5517 O  OE1 . GLU B  1 323 ? 38.640  71.295  13.366  1.00 69.91  ? 323 GLU B OE1 1 
ATOM   5518 O  OE2 . GLU B  1 323 ? 38.927  69.148  13.714  1.00 62.03  ? 323 GLU B OE2 1 
ATOM   5519 N  N   . ALA B  1 324 ? 34.287  71.806  9.182   1.00 61.32  ? 324 ALA B N   1 
ATOM   5520 C  CA  . ALA B  1 324 ? 33.029  72.475  8.828   1.00 54.69  ? 324 ALA B CA  1 
ATOM   5521 C  C   . ALA B  1 324 ? 32.856  72.461  7.301   1.00 46.73  ? 324 ALA B C   1 
ATOM   5522 O  O   . ALA B  1 324 ? 33.006  73.495  6.642   1.00 43.98  ? 324 ALA B O   1 
ATOM   5523 C  CB  . ALA B  1 324 ? 33.011  73.898  9.365   1.00 56.09  ? 324 ALA B CB  1 
ATOM   5524 N  N   . PRO B  1 325 ? 32.542  71.282  6.728   1.00 45.46  ? 325 PRO B N   1 
ATOM   5525 C  CA  . PRO B  1 325 ? 32.486  71.112  5.275   1.00 49.01  ? 325 PRO B CA  1 
ATOM   5526 C  C   . PRO B  1 325 ? 31.216  71.647  4.596   1.00 51.54  ? 325 PRO B C   1 
ATOM   5527 O  O   . PRO B  1 325 ? 31.218  71.832  3.376   1.00 53.95  ? 325 PRO B O   1 
ATOM   5528 C  CB  . PRO B  1 325 ? 32.569  69.593  5.113   1.00 47.74  ? 325 PRO B CB  1 
ATOM   5529 C  CG  . PRO B  1 325 ? 31.878  69.065  6.321   1.00 47.32  ? 325 PRO B CG  1 
ATOM   5530 C  CD  . PRO B  1 325 ? 32.116  70.055  7.431   1.00 48.02  ? 325 PRO B CD  1 
ATOM   5531 N  N   . GLY B  1 326 ? 30.155  71.879  5.370   1.00 50.54  ? 326 GLY B N   1 
ATOM   5532 C  CA  . GLY B  1 326 ? 28.851  72.285  4.831   1.00 52.03  ? 326 GLY B CA  1 
ATOM   5533 C  C   . GLY B  1 326 ? 27.953  71.106  4.501   1.00 50.64  ? 326 GLY B C   1 
ATOM   5534 O  O   . GLY B  1 326 ? 28.414  69.963  4.421   1.00 51.91  ? 326 GLY B O   1 
ATOM   5535 N  N   . ASN B  1 327 ? 26.663  71.397  4.323   1.00 45.62  ? 327 ASN B N   1 
ATOM   5536 C  CA  . ASN B  1 327 ? 25.649  70.418  3.885   1.00 45.10  ? 327 ASN B CA  1 
ATOM   5537 C  C   . ASN B  1 327 ? 25.463  69.184  4.782   1.00 43.31  ? 327 ASN B C   1 
ATOM   5538 O  O   . ASN B  1 327 ? 24.978  68.151  4.313   1.00 39.89  ? 327 ASN B O   1 
ATOM   5539 C  CB  . ASN B  1 327 ? 25.929  69.965  2.436   1.00 48.10  ? 327 ASN B CB  1 
ATOM   5540 C  CG  . ASN B  1 327 ? 25.701  71.063  1.418   1.00 47.99  ? 327 ASN B CG  1 
ATOM   5541 O  OD1 . ASN B  1 327 ? 25.431  72.213  1.761   1.00 44.65  ? 327 ASN B OD1 1 
ATOM   5542 N  ND2 . ASN B  1 327 ? 25.798  70.702  0.144   1.00 51.89  ? 327 ASN B ND2 1 
ATOM   5543 N  N   . ALA B  1 328 ? 25.805  69.290  6.064   1.00 47.02  ? 328 ALA B N   1 
ATOM   5544 C  CA  . ALA B  1 328 ? 25.627  68.167  6.995   1.00 49.68  ? 328 ALA B CA  1 
ATOM   5545 C  C   . ALA B  1 328 ? 24.176  67.664  7.021   1.00 50.73  ? 328 ALA B C   1 
ATOM   5546 O  O   . ALA B  1 328 ? 23.935  66.454  7.052   1.00 54.15  ? 328 ALA B O   1 
ATOM   5547 C  CB  . ALA B  1 328 ? 26.078  68.553  8.396   1.00 49.71  ? 328 ALA B CB  1 
ATOM   5548 N  N   . GLY B  1 329 ? 23.231  68.604  6.985   1.00 51.28  ? 329 GLY B N   1 
ATOM   5549 C  CA  . GLY B  1 329 ? 21.797  68.301  6.941   1.00 50.82  ? 329 GLY B CA  1 
ATOM   5550 C  C   . GLY B  1 329 ? 21.382  67.477  5.736   1.00 50.16  ? 329 GLY B C   1 
ATOM   5551 O  O   . GLY B  1 329 ? 20.556  66.575  5.851   1.00 50.27  ? 329 GLY B O   1 
ATOM   5552 N  N   . LEU B  1 330 ? 21.954  67.796  4.579   1.00 46.74  ? 330 LEU B N   1 
ATOM   5553 C  CA  . LEU B  1 330 ? 21.713  67.030  3.355   1.00 45.98  ? 330 LEU B CA  1 
ATOM   5554 C  C   . LEU B  1 330 ? 22.382  65.651  3.371   1.00 45.90  ? 330 LEU B C   1 
ATOM   5555 O  O   . LEU B  1 330 ? 21.856  64.704  2.782   1.00 48.20  ? 330 LEU B O   1 
ATOM   5556 C  CB  . LEU B  1 330 ? 22.166  67.829  2.134   1.00 43.40  ? 330 LEU B CB  1 
ATOM   5557 C  CG  . LEU B  1 330 ? 21.272  69.026  1.804   1.00 43.34  ? 330 LEU B CG  1 
ATOM   5558 C  CD1 . LEU B  1 330 ? 22.004  70.008  0.903   1.00 43.60  ? 330 LEU B CD1 1 
ATOM   5559 C  CD2 . LEU B  1 330 ? 19.971  68.574  1.155   1.00 44.47  ? 330 LEU B CD2 1 
ATOM   5560 N  N   . PHE B  1 331 ? 23.536  65.545  4.030   1.00 42.81  ? 331 PHE B N   1 
ATOM   5561 C  CA  . PHE B  1 331 ? 24.193  64.243  4.232   1.00 40.84  ? 331 PHE B CA  1 
ATOM   5562 C  C   . PHE B  1 331 ? 23.444  63.385  5.256   1.00 40.69  ? 331 PHE B C   1 
ATOM   5563 O  O   . PHE B  1 331 ? 23.502  62.155  5.187   1.00 41.61  ? 331 PHE B O   1 
ATOM   5564 C  CB  . PHE B  1 331 ? 25.669  64.401  4.631   1.00 42.28  ? 331 PHE B CB  1 
ATOM   5565 C  CG  . PHE B  1 331 ? 26.599  64.581  3.461   1.00 40.41  ? 331 PHE B CG  1 
ATOM   5566 C  CD1 . PHE B  1 331 ? 27.170  63.479  2.834   1.00 41.73  ? 331 PHE B CD1 1 
ATOM   5567 C  CD2 . PHE B  1 331 ? 26.904  65.850  2.982   1.00 40.00  ? 331 PHE B CD2 1 
ATOM   5568 C  CE1 . PHE B  1 331 ? 28.028  63.641  1.755   1.00 42.51  ? 331 PHE B CE1 1 
ATOM   5569 C  CE2 . PHE B  1 331 ? 27.759  66.020  1.903   1.00 40.27  ? 331 PHE B CE2 1 
ATOM   5570 C  CZ  . PHE B  1 331 ? 28.323  64.913  1.289   1.00 42.88  ? 331 PHE B CZ  1 
ATOM   5571 N  N   . ASP B  1 332 ? 22.761  64.029  6.206   1.00 43.74  ? 332 ASP B N   1 
ATOM   5572 C  CA  . ASP B  1 332 ? 21.829  63.337  7.113   1.00 44.66  ? 332 ASP B CA  1 
ATOM   5573 C  C   . ASP B  1 332 ? 20.694  62.699  6.318   1.00 46.66  ? 332 ASP B C   1 
ATOM   5574 O  O   . ASP B  1 332 ? 20.385  61.518  6.496   1.00 43.25  ? 332 ASP B O   1 
ATOM   5575 C  CB  . ASP B  1 332 ? 21.228  64.296  8.152   1.00 43.46  ? 332 ASP B CB  1 
ATOM   5576 C  CG  . ASP B  1 332 ? 22.261  64.878  9.106   1.00 42.83  ? 332 ASP B CG  1 
ATOM   5577 O  OD1 . ASP B  1 332 ? 23.237  64.189  9.456   1.00 44.60  ? 332 ASP B OD1 1 
ATOM   5578 O  OD2 . ASP B  1 332 ? 22.081  66.038  9.531   1.00 38.15  ? 332 ASP B OD2 1 
ATOM   5579 N  N   . GLN B  1 333 ? 20.079  63.502  5.451   1.00 47.22  ? 333 GLN B N   1 
ATOM   5580 C  CA  . GLN B  1 333 ? 19.030  63.041  4.537   1.00 50.19  ? 333 GLN B CA  1 
ATOM   5581 C  C   . GLN B  1 333 ? 19.519  61.929  3.605   1.00 50.10  ? 333 GLN B C   1 
ATOM   5582 O  O   . GLN B  1 333 ? 18.800  60.961  3.364   1.00 46.36  ? 333 GLN B O   1 
ATOM   5583 C  CB  . GLN B  1 333 ? 18.514  64.204  3.688   1.00 49.57  ? 333 GLN B CB  1 
ATOM   5584 C  CG  . GLN B  1 333 ? 17.728  65.267  4.440   1.00 44.83  ? 333 GLN B CG  1 
ATOM   5585 C  CD  . GLN B  1 333 ? 17.309  66.414  3.539   1.00 46.83  ? 333 GLN B CD  1 
ATOM   5586 O  OE1 . GLN B  1 333 ? 17.429  66.333  2.316   1.00 46.35  ? 333 GLN B OE1 1 
ATOM   5587 N  NE2 . GLN B  1 333 ? 16.815  67.490  4.140   1.00 49.54  ? 333 GLN B NE2 1 
ATOM   5588 N  N   . ASN B  1 334 ? 20.736  62.088  3.085   1.00 48.41  ? 334 ASN B N   1 
ATOM   5589 C  CA  . ASN B  1 334 ? 21.374  61.087  2.226   1.00 48.16  ? 334 ASN B CA  1 
ATOM   5590 C  C   . ASN B  1 334 ? 21.527  59.740  2.933   1.00 48.78  ? 334 ASN B C   1 
ATOM   5591 O  O   . ASN B  1 334 ? 21.196  58.698  2.366   1.00 44.44  ? 334 ASN B O   1 
ATOM   5592 C  CB  . ASN B  1 334 ? 22.752  61.578  1.783   1.00 50.19  ? 334 ASN B CB  1 
ATOM   5593 C  CG  . ASN B  1 334 ? 23.394  60.668  0.750   1.00 48.93  ? 334 ASN B CG  1 
ATOM   5594 O  OD1 . ASN B  1 334 ? 23.096  60.753  -0.439  1.00 44.91  ? 334 ASN B OD1 1 
ATOM   5595 N  ND2 . ASN B  1 334 ? 24.293  59.800  1.201   1.00 50.55  ? 334 ASN B ND2 1 
ATOM   5596 N  N   . LEU B  1 335 ? 22.046  59.776  4.160   1.00 53.95  ? 335 LEU B N   1 
ATOM   5597 C  CA  . LEU B  1 335 ? 22.179  58.570  4.997   1.00 48.90  ? 335 LEU B CA  1 
ATOM   5598 C  C   . LEU B  1 335 ? 20.820  57.971  5.350   1.00 46.62  ? 335 LEU B C   1 
ATOM   5599 O  O   . LEU B  1 335 ? 20.663  56.747  5.381   1.00 51.93  ? 335 LEU B O   1 
ATOM   5600 C  CB  . LEU B  1 335 ? 22.963  58.868  6.285   1.00 47.04  ? 335 LEU B CB  1 
ATOM   5601 C  CG  . LEU B  1 335 ? 23.210  57.708  7.270   1.00 48.52  ? 335 LEU B CG  1 
ATOM   5602 C  CD1 . LEU B  1 335 ? 23.932  56.530  6.624   1.00 46.01  ? 335 LEU B CD1 1 
ATOM   5603 C  CD2 . LEU B  1 335 ? 23.987  58.201  8.481   1.00 49.04  ? 335 LEU B CD2 1 
ATOM   5604 N  N   . ALA B  1 336 ? 19.855  58.840  5.634   1.00 43.86  ? 336 ALA B N   1 
ATOM   5605 C  CA  . ALA B  1 336 ? 18.476  58.424  5.889   1.00 41.75  ? 336 ALA B CA  1 
ATOM   5606 C  C   . ALA B  1 336 ? 17.850  57.713  4.680   1.00 41.98  ? 336 ALA B C   1 
ATOM   5607 O  O   . ALA B  1 336 ? 17.122  56.730  4.848   1.00 41.74  ? 336 ALA B O   1 
ATOM   5608 C  CB  . ALA B  1 336 ? 17.633  59.622  6.303   1.00 41.30  ? 336 ALA B CB  1 
ATOM   5609 N  N   . LEU B  1 337 ? 18.135  58.211  3.474   1.00 44.13  ? 337 LEU B N   1 
ATOM   5610 C  CA  . LEU B  1 337 ? 17.695  57.557  2.230   1.00 47.54  ? 337 LEU B CA  1 
ATOM   5611 C  C   . LEU B  1 337 ? 18.343  56.181  2.039   1.00 51.81  ? 337 LEU B C   1 
ATOM   5612 O  O   . LEU B  1 337 ? 17.694  55.254  1.548   1.00 56.19  ? 337 LEU B O   1 
ATOM   5613 C  CB  . LEU B  1 337 ? 17.988  58.430  0.997   1.00 48.19  ? 337 LEU B CB  1 
ATOM   5614 C  CG  . LEU B  1 337 ? 17.215  59.735  0.737   1.00 49.03  ? 337 LEU B CG  1 
ATOM   5615 C  CD1 . LEU B  1 337 ? 17.536  60.247  -0.661  1.00 45.71  ? 337 LEU B CD1 1 
ATOM   5616 C  CD2 . LEU B  1 337 ? 15.710  59.589  0.899   1.00 51.19  ? 337 LEU B CD2 1 
ATOM   5617 N  N   . ARG B  1 338 ? 19.619  56.063  2.409   1.00 55.73  ? 338 ARG B N   1 
ATOM   5618 C  CA  . ARG B  1 338 ? 20.331  54.776  2.378   1.00 55.71  ? 338 ARG B CA  1 
ATOM   5619 C  C   . ARG B  1 338 ? 19.768  53.766  3.375   1.00 57.38  ? 338 ARG B C   1 
ATOM   5620 O  O   . ARG B  1 338 ? 19.817  52.560  3.124   1.00 61.05  ? 338 ARG B O   1 
ATOM   5621 C  CB  . ARG B  1 338 ? 21.832  54.963  2.627   1.00 57.23  ? 338 ARG B CB  1 
ATOM   5622 C  CG  . ARG B  1 338 ? 22.570  55.578  1.450   1.00 64.39  ? 338 ARG B CG  1 
ATOM   5623 C  CD  . ARG B  1 338 ? 24.069  55.335  1.512   1.00 73.72  ? 338 ARG B CD  1 
ATOM   5624 N  NE  . ARG B  1 338 ? 24.713  56.049  2.615   1.00 80.16  ? 338 ARG B NE  1 
ATOM   5625 C  CZ  . ARG B  1 338 ? 26.029  56.107  2.826   1.00 83.07  ? 338 ARG B CZ  1 
ATOM   5626 N  NH1 . ARG B  1 338 ? 26.887  55.493  2.010   1.00 81.38  ? 338 ARG B NH1 1 
ATOM   5627 N  NH2 . ARG B  1 338 ? 26.495  56.790  3.866   1.00 82.21  ? 338 ARG B NH2 1 
ATOM   5628 N  N   . TRP B  1 339 ? 19.248  54.255  4.500   1.00 52.95  ? 339 TRP B N   1 
ATOM   5629 C  CA  . TRP B  1 339 ? 18.575  53.397  5.474   1.00 49.27  ? 339 TRP B CA  1 
ATOM   5630 C  C   . TRP B  1 339 ? 17.291  52.816  4.885   1.00 46.31  ? 339 TRP B C   1 
ATOM   5631 O  O   . TRP B  1 339 ? 17.065  51.607  4.948   1.00 47.37  ? 339 TRP B O   1 
ATOM   5632 C  CB  . TRP B  1 339 ? 18.254  54.164  6.757   1.00 46.48  ? 339 TRP B CB  1 
ATOM   5633 C  CG  . TRP B  1 339 ? 17.706  53.284  7.843   1.00 44.66  ? 339 TRP B CG  1 
ATOM   5634 C  CD1 . TRP B  1 339 ? 18.414  52.645  8.818   1.00 44.36  ? 339 TRP B CD1 1 
ATOM   5635 C  CD2 . TRP B  1 339 ? 16.333  52.934  8.050   1.00 43.46  ? 339 TRP B CD2 1 
ATOM   5636 N  NE1 . TRP B  1 339 ? 17.567  51.923  9.624   1.00 48.68  ? 339 TRP B NE1 1 
ATOM   5637 C  CE2 . TRP B  1 339 ? 16.283  52.083  9.173   1.00 45.35  ? 339 TRP B CE2 1 
ATOM   5638 C  CE3 . TRP B  1 339 ? 15.137  53.260  7.394   1.00 42.78  ? 339 TRP B CE3 1 
ATOM   5639 C  CZ2 . TRP B  1 339 ? 15.084  51.551  9.656   1.00 46.79  ? 339 TRP B CZ2 1 
ATOM   5640 C  CZ3 . TRP B  1 339 ? 13.946  52.733  7.873   1.00 42.52  ? 339 TRP B CZ3 1 
ATOM   5641 C  CH2 . TRP B  1 339 ? 13.929  51.888  8.996   1.00 47.06  ? 339 TRP B CH2 1 
ATOM   5642 N  N   . VAL B  1 340 ? 16.459  53.693  4.329   1.00 42.84  ? 340 VAL B N   1 
ATOM   5643 C  CA  . VAL B  1 340 ? 15.176  53.301  3.732   1.00 45.44  ? 340 VAL B CA  1 
ATOM   5644 C  C   . VAL B  1 340 ? 15.371  52.313  2.575   1.00 49.67  ? 340 VAL B C   1 
ATOM   5645 O  O   . VAL B  1 340 ? 14.573  51.399  2.406   1.00 50.86  ? 340 VAL B O   1 
ATOM   5646 C  CB  . VAL B  1 340 ? 14.358  54.546  3.305   1.00 43.82  ? 340 VAL B CB  1 
ATOM   5647 C  CG1 . VAL B  1 340 ? 13.125  54.176  2.482   1.00 43.28  ? 340 VAL B CG1 1 
ATOM   5648 C  CG2 . VAL B  1 340 ? 13.930  55.314  4.546   1.00 45.93  ? 340 VAL B CG2 1 
ATOM   5649 N  N   . ARG B  1 341 ? 16.439  52.488  1.803   1.00 53.36  ? 341 ARG B N   1 
ATOM   5650 C  CA  . ARG B  1 341 ? 16.786  51.540  0.744   1.00 52.48  ? 341 ARG B CA  1 
ATOM   5651 C  C   . ARG B  1 341 ? 17.138  50.150  1.306   1.00 50.63  ? 341 ARG B C   1 
ATOM   5652 O  O   . ARG B  1 341 ? 16.660  49.138  0.791   1.00 50.81  ? 341 ARG B O   1 
ATOM   5653 C  CB  . ARG B  1 341 ? 17.938  52.087  -0.104  1.00 57.21  ? 341 ARG B CB  1 
ATOM   5654 C  CG  . ARG B  1 341 ? 18.293  51.218  -1.302  1.00 62.16  ? 341 ARG B CG  1 
ATOM   5655 C  CD  . ARG B  1 341 ? 19.160  51.955  -2.311  1.00 61.29  ? 341 ARG B CD  1 
ATOM   5656 N  NE  . ARG B  1 341 ? 19.524  51.095  -3.439  1.00 58.25  ? 341 ARG B NE  1 
ATOM   5657 C  CZ  . ARG B  1 341 ? 18.711  50.739  -4.438  1.00 59.82  ? 341 ARG B CZ  1 
ATOM   5658 N  NH1 . ARG B  1 341 ? 17.446  51.160  -4.486  1.00 63.01  ? 341 ARG B NH1 1 
ATOM   5659 N  NH2 . ARG B  1 341 ? 19.166  49.946  -5.406  1.00 57.65  ? 341 ARG B NH2 1 
ATOM   5660 N  N   . ASP B  1 342 ? 17.957  50.112  2.359   1.00 52.06  ? 342 ASP B N   1 
ATOM   5661 C  CA  . ASP B  1 342 ? 18.415  48.842  2.962   1.00 53.70  ? 342 ASP B CA  1 
ATOM   5662 C  C   . ASP B  1 342 ? 17.367  48.095  3.801   1.00 57.46  ? 342 ASP B C   1 
ATOM   5663 O  O   . ASP B  1 342 ? 17.465  46.873  3.948   1.00 63.39  ? 342 ASP B O   1 
ATOM   5664 C  CB  . ASP B  1 342 ? 19.655  49.070  3.848   1.00 54.00  ? 342 ASP B CB  1 
ATOM   5665 C  CG  . ASP B  1 342 ? 20.879  49.540  3.067   1.00 57.11  ? 342 ASP B CG  1 
ATOM   5666 O  OD1 . ASP B  1 342 ? 20.939  49.349  1.832   1.00 56.18  ? 342 ASP B OD1 1 
ATOM   5667 O  OD2 . ASP B  1 342 ? 21.796  50.100  3.704   1.00 58.27  ? 342 ASP B OD2 1 
ATOM   5668 N  N   . ASN B  1 343 ? 16.382  48.817  4.343   1.00 62.23  ? 343 ASN B N   1 
ATOM   5669 C  CA  . ASN B  1 343 ? 15.469  48.278  5.376   1.00 60.47  ? 343 ASN B CA  1 
ATOM   5670 C  C   . ASN B  1 343 ? 13.963  48.216  5.050   1.00 60.16  ? 343 ASN B C   1 
ATOM   5671 O  O   . ASN B  1 343 ? 13.268  47.350  5.588   1.00 57.37  ? 343 ASN B O   1 
ATOM   5672 C  CB  . ASN B  1 343 ? 15.649  49.068  6.679   1.00 58.64  ? 343 ASN B CB  1 
ATOM   5673 C  CG  . ASN B  1 343 ? 17.059  48.976  7.233   1.00 55.21  ? 343 ASN B CG  1 
ATOM   5674 O  OD1 . ASN B  1 343 ? 17.359  48.108  8.051   1.00 59.27  ? 343 ASN B OD1 1 
ATOM   5675 N  ND2 . ASN B  1 343 ? 17.932  49.869  6.783   1.00 54.94  ? 343 ASN B ND2 1 
ATOM   5676 N  N   . ILE B  1 344 ? 13.458  49.110  4.195   1.00 53.02  ? 344 ILE B N   1 
ATOM   5677 C  CA  . ILE B  1 344 ? 11.994  49.303  4.032   1.00 51.17  ? 344 ILE B CA  1 
ATOM   5678 C  C   . ILE B  1 344 ? 11.221  48.090  3.465   1.00 50.25  ? 344 ILE B C   1 
ATOM   5679 O  O   . ILE B  1 344 ? 10.000  48.015  3.627   1.00 50.23  ? 344 ILE B O   1 
ATOM   5680 C  CB  . ILE B  1 344 ? 11.655  50.619  3.261   1.00 52.00  ? 344 ILE B CB  1 
ATOM   5681 C  CG1 . ILE B  1 344 ? 10.287  51.193  3.679   1.00 51.87  ? 344 ILE B CG1 1 
ATOM   5682 C  CG2 . ILE B  1 344 ? 11.723  50.430  1.747   1.00 56.26  ? 344 ILE B CG2 1 
ATOM   5683 C  CD1 . ILE B  1 344 ? 10.266  51.857  5.044   1.00 51.25  ? 344 ILE B CD1 1 
ATOM   5684 N  N   . HIS B  1 345 ? 11.915  47.151  2.819   1.00 54.33  ? 345 HIS B N   1 
ATOM   5685 C  CA  . HIS B  1 345 ? 11.305  45.863  2.431   1.00 57.65  ? 345 HIS B CA  1 
ATOM   5686 C  C   . HIS B  1 345 ? 10.831  45.039  3.633   1.00 54.12  ? 345 HIS B C   1 
ATOM   5687 O  O   . HIS B  1 345 ? 9.861   44.286  3.521   1.00 51.26  ? 345 HIS B O   1 
ATOM   5688 C  CB  . HIS B  1 345 ? 12.261  45.017  1.580   1.00 63.08  ? 345 HIS B CB  1 
ATOM   5689 C  CG  . HIS B  1 345 ? 11.563  44.043  0.676   1.00 68.63  ? 345 HIS B CG  1 
ATOM   5690 N  ND1 . HIS B  1 345 ? 10.431  43.351  1.052   1.00 67.04  ? 345 HIS B ND1 1 
ATOM   5691 C  CD2 . HIS B  1 345 ? 11.842  43.644  -0.588  1.00 72.81  ? 345 HIS B CD2 1 
ATOM   5692 C  CE1 . HIS B  1 345 ? 10.040  42.572  0.059   1.00 65.89  ? 345 HIS B CE1 1 
ATOM   5693 N  NE2 . HIS B  1 345 ? 10.880  42.730  -0.948  1.00 72.43  ? 345 HIS B NE2 1 
ATOM   5694 N  N   . ARG B  1 346 ? 11.504  45.189  4.771   1.00 57.69  ? 346 ARG B N   1 
ATOM   5695 C  CA  . ARG B  1 346 ? 11.126  44.479  6.000   1.00 65.72  ? 346 ARG B CA  1 
ATOM   5696 C  C   . ARG B  1 346 ? 9.837   45.033  6.647   1.00 66.77  ? 346 ARG B C   1 
ATOM   5697 O  O   . ARG B  1 346 ? 9.173   44.324  7.407   1.00 63.35  ? 346 ARG B O   1 
ATOM   5698 C  CB  . ARG B  1 346 ? 12.275  44.500  7.015   1.00 70.06  ? 346 ARG B CB  1 
ATOM   5699 C  CG  . ARG B  1 346 ? 13.637  44.053  6.488   1.00 72.38  ? 346 ARG B CG  1 
ATOM   5700 C  CD  . ARG B  1 346 ? 14.652  43.961  7.619   1.00 79.71  ? 346 ARG B CD  1 
ATOM   5701 N  NE  . ARG B  1 346 ? 15.940  44.577  7.275   1.00 87.08  ? 346 ARG B NE  1 
ATOM   5702 C  CZ  . ARG B  1 346 ? 17.038  43.942  6.850   1.00 89.87  ? 346 ARG B CZ  1 
ATOM   5703 N  NH1 . ARG B  1 346 ? 17.070  42.617  6.689   1.00 89.52  ? 346 ARG B NH1 1 
ATOM   5704 N  NH2 . ARG B  1 346 ? 18.133  44.652  6.580   1.00 90.56  ? 346 ARG B NH2 1 
ATOM   5705 N  N   . PHE B  1 347 ? 9.503   46.291  6.346   1.00 68.00  ? 347 PHE B N   1 
ATOM   5706 C  CA  . PHE B  1 347 ? 8.250   46.938  6.787   1.00 64.80  ? 347 PHE B CA  1 
ATOM   5707 C  C   . PHE B  1 347 ? 7.076   46.778  5.801   1.00 65.84  ? 347 PHE B C   1 
ATOM   5708 O  O   . PHE B  1 347 ? 5.943   47.142  6.127   1.00 63.73  ? 347 PHE B O   1 
ATOM   5709 C  CB  . PHE B  1 347 ? 8.489   48.433  7.027   1.00 62.99  ? 347 PHE B CB  1 
ATOM   5710 C  CG  . PHE B  1 347 ? 9.516   48.727  8.087   1.00 65.92  ? 347 PHE B CG  1 
ATOM   5711 C  CD1 . PHE B  1 347 ? 10.868  48.791  7.761   1.00 67.20  ? 347 PHE B CD1 1 
ATOM   5712 C  CD2 . PHE B  1 347 ? 9.137   48.959  9.406   1.00 62.41  ? 347 PHE B CD2 1 
ATOM   5713 C  CE1 . PHE B  1 347 ? 11.822  49.068  8.725   1.00 63.24  ? 347 PHE B CE1 1 
ATOM   5714 C  CE2 . PHE B  1 347 ? 10.090  49.239  10.377  1.00 60.06  ? 347 PHE B CE2 1 
ATOM   5715 C  CZ  . PHE B  1 347 ? 11.432  49.294  10.033  1.00 61.54  ? 347 PHE B CZ  1 
ATOM   5716 N  N   . GLY B  1 348 ? 7.356   46.248  4.610   1.00 60.01  ? 348 GLY B N   1 
ATOM   5717 C  CA  . GLY B  1 348 ? 6.344   46.017  3.567   1.00 57.90  ? 348 GLY B CA  1 
ATOM   5718 C  C   . GLY B  1 348 ? 6.407   46.959  2.372   1.00 61.64  ? 348 GLY B C   1 
ATOM   5719 O  O   . GLY B  1 348 ? 5.520   46.926  1.517   1.00 61.38  ? 348 GLY B O   1 
ATOM   5720 N  N   . GLY B  1 349 ? 7.443   47.798  2.313   1.00 59.11  ? 349 GLY B N   1 
ATOM   5721 C  CA  . GLY B  1 349 ? 7.617   48.771  1.230   1.00 58.32  ? 349 GLY B CA  1 
ATOM   5722 C  C   . GLY B  1 349 ? 8.595   48.323  0.157   1.00 58.61  ? 349 GLY B C   1 
ATOM   5723 O  O   . GLY B  1 349 ? 9.542   47.596  0.435   1.00 54.60  ? 349 GLY B O   1 
ATOM   5724 N  N   . ASP B  1 350 ? 8.360   48.772  -1.074  1.00 58.55  ? 350 ASP B N   1 
ATOM   5725 C  CA  . ASP B  1 350 ? 9.250   48.502  -2.204  1.00 56.45  ? 350 ASP B CA  1 
ATOM   5726 C  C   . ASP B  1 350 ? 10.406  49.500  -2.147  1.00 60.99  ? 350 ASP B C   1 
ATOM   5727 O  O   . ASP B  1 350 ? 10.162  50.710  -2.113  1.00 70.35  ? 350 ASP B O   1 
ATOM   5728 C  CB  . ASP B  1 350 ? 8.497   48.659  -3.531  1.00 52.00  ? 350 ASP B CB  1 
ATOM   5729 C  CG  . ASP B  1 350 ? 9.187   47.961  -4.702  1.00 48.98  ? 350 ASP B CG  1 
ATOM   5730 O  OD1 . ASP B  1 350 ? 10.413  47.723  -4.657  1.00 45.04  ? 350 ASP B OD1 1 
ATOM   5731 O  OD2 . ASP B  1 350 ? 8.488   47.653  -5.689  1.00 48.86  ? 350 ASP B OD2 1 
ATOM   5732 N  N   . PRO B  1 351 ? 11.663  49.008  -2.122  1.00 54.85  ? 351 PRO B N   1 
ATOM   5733 C  CA  . PRO B  1 351 ? 12.800  49.940  -2.182  1.00 55.72  ? 351 PRO B CA  1 
ATOM   5734 C  C   . PRO B  1 351 ? 12.953  50.676  -3.521  1.00 54.40  ? 351 PRO B C   1 
ATOM   5735 O  O   . PRO B  1 351 ? 13.541  51.759  -3.559  1.00 54.61  ? 351 PRO B O   1 
ATOM   5736 C  CB  . PRO B  1 351 ? 14.018  49.035  -1.937  1.00 57.87  ? 351 PRO B CB  1 
ATOM   5737 C  CG  . PRO B  1 351 ? 13.475  47.787  -1.339  1.00 57.02  ? 351 PRO B CG  1 
ATOM   5738 C  CD  . PRO B  1 351 ? 12.118  47.618  -1.936  1.00 53.12  ? 351 PRO B CD  1 
ATOM   5739 N  N   . SER B  1 352 ? 12.446  50.080  -4.599  1.00 55.47  ? 352 SER B N   1 
ATOM   5740 C  CA  . SER B  1 352 ? 12.499  50.676  -5.936  1.00 55.75  ? 352 SER B CA  1 
ATOM   5741 C  C   . SER B  1 352 ? 11.411  51.725  -6.209  1.00 54.76  ? 352 SER B C   1 
ATOM   5742 O  O   . SER B  1 352 ? 11.503  52.450  -7.200  1.00 57.34  ? 352 SER B O   1 
ATOM   5743 C  CB  . SER B  1 352 ? 12.431  49.577  -7.001  1.00 55.09  ? 352 SER B CB  1 
ATOM   5744 O  OG  . SER B  1 352 ? 11.179  48.914  -6.988  1.00 54.43  ? 352 SER B OG  1 
ATOM   5745 N  N   . ARG B  1 353 ? 10.388  51.792  -5.353  1.00 57.23  ? 353 ARG B N   1 
ATOM   5746 C  CA  . ARG B  1 353 ? 9.296   52.773  -5.490  1.00 59.96  ? 353 ARG B CA  1 
ATOM   5747 C  C   . ARG B  1 353 ? 9.272   53.783  -4.332  1.00 59.42  ? 353 ARG B C   1 
ATOM   5748 O  O   . ARG B  1 353 ? 8.220   54.059  -3.746  1.00 61.47  ? 353 ARG B O   1 
ATOM   5749 C  CB  . ARG B  1 353 ? 7.951   52.051  -5.619  1.00 59.72  ? 353 ARG B CB  1 
ATOM   5750 C  CG  . ARG B  1 353 ? 7.885   51.086  -6.796  1.00 61.98  ? 353 ARG B CG  1 
ATOM   5751 C  CD  . ARG B  1 353 ? 6.702   50.142  -6.682  1.00 60.32  ? 353 ARG B CD  1 
ATOM   5752 N  NE  . ARG B  1 353 ? 5.427   50.800  -6.982  1.00 62.54  ? 353 ARG B NE  1 
ATOM   5753 C  CZ  . ARG B  1 353 ? 4.225   50.380  -6.577  1.00 67.38  ? 353 ARG B CZ  1 
ATOM   5754 N  NH1 . ARG B  1 353 ? 4.083   49.290  -5.820  1.00 66.18  ? 353 ARG B NH1 1 
ATOM   5755 N  NH2 . ARG B  1 353 ? 3.141   51.068  -6.924  1.00 69.42  ? 353 ARG B NH2 1 
ATOM   5756 N  N   . VAL B  1 354 ? 10.446  54.332  -4.025  1.00 56.23  ? 354 VAL B N   1 
ATOM   5757 C  CA  . VAL B  1 354 ? 10.597  55.394  -3.031  1.00 52.98  ? 354 VAL B CA  1 
ATOM   5758 C  C   . VAL B  1 354 ? 10.384  56.736  -3.730  1.00 52.53  ? 354 VAL B C   1 
ATOM   5759 O  O   . VAL B  1 354 ? 11.195  57.144  -4.562  1.00 54.21  ? 354 VAL B O   1 
ATOM   5760 C  CB  . VAL B  1 354 ? 11.988  55.351  -2.355  1.00 55.55  ? 354 VAL B CB  1 
ATOM   5761 C  CG1 . VAL B  1 354 ? 12.183  56.512  -1.385  1.00 61.70  ? 354 VAL B CG1 1 
ATOM   5762 C  CG2 . VAL B  1 354 ? 12.169  54.039  -1.609  1.00 53.93  ? 354 VAL B CG2 1 
ATOM   5763 N  N   . THR B  1 355 ? 9.282   57.400  -3.387  1.00 54.68  ? 355 THR B N   1 
ATOM   5764 C  CA  . THR B  1 355 ? 8.939   58.716  -3.921  1.00 54.01  ? 355 THR B CA  1 
ATOM   5765 C  C   . THR B  1 355 ? 9.214   59.770  -2.855  1.00 48.79  ? 355 THR B C   1 
ATOM   5766 O  O   . THR B  1 355 ? 8.570   59.774  -1.803  1.00 55.63  ? 355 THR B O   1 
ATOM   5767 C  CB  . THR B  1 355 ? 7.454   58.782  -4.325  1.00 57.62  ? 355 THR B CB  1 
ATOM   5768 O  OG1 . THR B  1 355 ? 7.147   57.678  -5.186  1.00 64.05  ? 355 THR B OG1 1 
ATOM   5769 C  CG2 . THR B  1 355 ? 7.126   60.101  -5.041  1.00 56.15  ? 355 THR B CG2 1 
ATOM   5770 N  N   . LEU B  1 356 ? 10.169  60.656  -3.127  1.00 44.39  ? 356 LEU B N   1 
ATOM   5771 C  CA  . LEU B  1 356 ? 10.469  61.758  -2.217  1.00 45.14  ? 356 LEU B CA  1 
ATOM   5772 C  C   . LEU B  1 356 ? 9.394   62.837  -2.342  1.00 46.84  ? 356 LEU B C   1 
ATOM   5773 O  O   . LEU B  1 356 ? 8.909   63.108  -3.441  1.00 46.86  ? 356 LEU B O   1 
ATOM   5774 C  CB  . LEU B  1 356 ? 11.846  62.352  -2.520  1.00 43.39  ? 356 LEU B CB  1 
ATOM   5775 C  CG  . LEU B  1 356 ? 13.045  61.402  -2.557  1.00 43.63  ? 356 LEU B CG  1 
ATOM   5776 C  CD1 . LEU B  1 356 ? 14.305  62.183  -2.890  1.00 44.61  ? 356 LEU B CD1 1 
ATOM   5777 C  CD2 . LEU B  1 356 ? 13.218  60.665  -1.239  1.00 45.38  ? 356 LEU B CD2 1 
ATOM   5778 N  N   . PHE B  1 357 ? 9.006   63.429  -1.215  1.00 45.36  ? 357 PHE B N   1 
ATOM   5779 C  CA  . PHE B  1 357 ? 8.085   64.571  -1.230  1.00 45.21  ? 357 PHE B CA  1 
ATOM   5780 C  C   . PHE B  1 357 ? 8.323   65.514  -0.057  1.00 44.66  ? 357 PHE B C   1 
ATOM   5781 O  O   . PHE B  1 357 ? 8.612   65.079  1.053   1.00 48.95  ? 357 PHE B O   1 
ATOM   5782 C  CB  . PHE B  1 357 ? 6.608   64.141  -1.400  1.00 49.63  ? 357 PHE B CB  1 
ATOM   5783 C  CG  . PHE B  1 357 ? 5.919   63.637  -0.155  1.00 46.58  ? 357 PHE B CG  1 
ATOM   5784 C  CD1 . PHE B  1 357 ? 6.457   62.611  0.610   1.00 44.37  ? 357 PHE B CD1 1 
ATOM   5785 C  CD2 . PHE B  1 357 ? 4.663   64.144  0.201   1.00 45.28  ? 357 PHE B CD2 1 
ATOM   5786 C  CE1 . PHE B  1 357 ? 5.790   62.133  1.733   1.00 46.26  ? 357 PHE B CE1 1 
ATOM   5787 C  CE2 . PHE B  1 357 ? 3.990   63.671  1.320   1.00 45.80  ? 357 PHE B CE2 1 
ATOM   5788 C  CZ  . PHE B  1 357 ? 4.555   62.664  2.089   1.00 46.43  ? 357 PHE B CZ  1 
ATOM   5789 N  N   . GLY B  1 358 ? 8.241   66.811  -0.339  1.00 45.27  ? 358 GLY B N   1 
ATOM   5790 C  CA  . GLY B  1 358 ? 8.571   67.851  0.629   1.00 46.79  ? 358 GLY B CA  1 
ATOM   5791 C  C   . GLY B  1 358 ? 7.978   69.185  0.228   1.00 48.70  ? 358 GLY B C   1 
ATOM   5792 O  O   . GLY B  1 358 ? 7.475   69.344  -0.891  1.00 56.21  ? 358 GLY B O   1 
ATOM   5793 N  N   . GLU B  1 359 ? 8.034   70.136  1.158   1.00 45.29  ? 359 GLU B N   1 
ATOM   5794 C  CA  . GLU B  1 359 ? 7.504   71.487  0.956   1.00 47.81  ? 359 GLU B CA  1 
ATOM   5795 C  C   . GLU B  1 359 ? 8.520   72.541  1.392   1.00 51.18  ? 359 GLU B C   1 
ATOM   5796 O  O   . GLU B  1 359 ? 9.306   72.296  2.308   1.00 51.51  ? 359 GLU B O   1 
ATOM   5797 C  CB  . GLU B  1 359 ? 6.196   71.653  1.731   1.00 50.75  ? 359 GLU B CB  1 
ATOM   5798 C  CG  . GLU B  1 359 ? 5.423   72.933  1.423   1.00 51.51  ? 359 GLU B CG  1 
ATOM   5799 C  CD  . GLU B  1 359 ? 5.809   74.139  2.268   1.00 50.06  ? 359 GLU B CD  1 
ATOM   5800 O  OE1 . GLU B  1 359 ? 6.408   73.975  3.353   1.00 46.05  ? 359 GLU B OE1 1 
ATOM   5801 O  OE2 . GLU B  1 359 ? 5.491   75.269  1.842   1.00 57.54  ? 359 GLU B OE2 1 
HETATM 5802 C  C   . SEB B  1 360 ? 10.861  74.321  0.880   1.00 55.94  ? 360 SEB B C   1 
HETATM 5803 N  N   . SEB B  1 360 ? 8.491   73.704  0.735   1.00 54.14  ? 360 SEB B N   1 
HETATM 5804 C  CI2 . SEB B  1 360 ? 7.190   76.883  8.188   1.00 87.55  ? 360 SEB B CI2 1 
HETATM 5805 C  CH2 . SEB B  1 360 ? 7.342   76.857  6.800   1.00 83.79  ? 360 SEB B CH2 1 
HETATM 5806 C  CJ  . SEB B  1 360 ? 8.034   77.673  8.970   1.00 80.39  ? 360 SEB B CJ  1 
HETATM 5807 C  CI1 . SEB B  1 360 ? 9.030   78.437  8.363   1.00 81.46  ? 360 SEB B CI1 1 
HETATM 5808 C  CH1 . SEB B  1 360 ? 9.185   78.413  6.972   1.00 85.65  ? 360 SEB B CH1 1 
HETATM 5809 C  CZ  . SEB B  1 360 ? 8.349   77.614  6.187   1.00 98.41  ? 360 SEB B CZ  1 
HETATM 5810 C  CE  . SEB B  1 360 ? 8.488   77.584  4.677   1.00 107.71 ? 360 SEB B CE  1 
HETATM 5811 O  OD2 . SEB B  1 360 ? 10.545  76.094  4.892   1.00 109.91 ? 360 SEB B OD2 1 
HETATM 5812 O  OD1 . SEB B  1 360 ? 10.859  78.268  4.099   1.00 110.86 ? 360 SEB B OD1 1 
HETATM 5813 S  SD  . SEB B  1 360 ? 9.983   77.131  4.084   1.00 115.29 ? 360 SEB B SD  1 
HETATM 5814 O  OG  . SEB B  1 360 ? 9.870   76.601  2.639   1.00 90.10  ? 360 SEB B OG  1 
HETATM 5815 C  CB  . SEB B  1 360 ? 9.054   75.465  2.335   1.00 73.32  ? 360 SEB B CB  1 
HETATM 5816 C  CA  . SEB B  1 360 ? 9.431   74.814  1.000   1.00 60.64  ? 360 SEB B CA  1 
HETATM 5817 O  O   . SEB B  1 360 ? 11.249  73.841  -0.186  1.00 57.76  ? 360 SEB B O   1 
ATOM   5818 N  N   . ALA B  1 361 ? 11.652  74.423  1.951   1.00 51.91  ? 361 ALA B N   1 
ATOM   5819 C  CA  . ALA B  1 361 ? 13.031  73.901  1.973   1.00 51.03  ? 361 ALA B CA  1 
ATOM   5820 C  C   . ALA B  1 361 ? 13.110  72.375  1.861   1.00 50.16  ? 361 ALA B C   1 
ATOM   5821 O  O   . ALA B  1 361 ? 14.146  71.832  1.476   1.00 51.56  ? 361 ALA B O   1 
ATOM   5822 C  CB  . ALA B  1 361 ? 13.749  74.360  3.231   1.00 47.94  ? 361 ALA B CB  1 
ATOM   5823 N  N   . GLY B  1 362 ? 12.025  71.694  2.220   1.00 48.84  ? 362 GLY B N   1 
ATOM   5824 C  CA  . GLY B  1 362 ? 11.903  70.248  2.040   1.00 49.14  ? 362 GLY B CA  1 
ATOM   5825 C  C   . GLY B  1 362 ? 11.809  69.845  0.580   1.00 49.05  ? 362 GLY B C   1 
ATOM   5826 O  O   . GLY B  1 362 ? 12.324  68.805  0.187   1.00 43.65  ? 362 GLY B O   1 
ATOM   5827 N  N   . ALA B  1 363 ? 11.139  70.673  -0.216  1.00 50.10  ? 363 ALA B N   1 
ATOM   5828 C  CA  . ALA B  1 363 ? 11.082  70.505  -1.666  1.00 46.36  ? 363 ALA B CA  1 
ATOM   5829 C  C   . ALA B  1 363 ? 12.426  70.854  -2.311  1.00 43.69  ? 363 ALA B C   1 
ATOM   5830 O  O   . ALA B  1 363 ? 12.839  70.201  -3.270  1.00 44.76  ? 363 ALA B O   1 
ATOM   5831 C  CB  . ALA B  1 363 ? 9.969   71.356  -2.253  1.00 44.07  ? 363 ALA B CB  1 
ATOM   5832 N  N   . VAL B  1 364 ? 13.100  71.877  -1.781  1.00 40.28  ? 364 VAL B N   1 
ATOM   5833 C  CA  . VAL B  1 364 ? 14.472  72.213  -2.194  1.00 42.29  ? 364 VAL B CA  1 
ATOM   5834 C  C   . VAL B  1 364 ? 15.391  71.015  -1.961  1.00 43.86  ? 364 VAL B C   1 
ATOM   5835 O  O   . VAL B  1 364 ? 16.087  70.577  -2.874  1.00 47.60  ? 364 VAL B O   1 
ATOM   5836 C  CB  . VAL B  1 364 ? 15.023  73.444  -1.437  1.00 42.00  ? 364 VAL B CB  1 
ATOM   5837 C  CG1 . VAL B  1 364 ? 16.513  73.649  -1.697  1.00 41.30  ? 364 VAL B CG1 1 
ATOM   5838 C  CG2 . VAL B  1 364 ? 14.269  74.694  -1.845  1.00 42.41  ? 364 VAL B CG2 1 
ATOM   5839 N  N   . SER B  1 365 ? 15.384  70.506  -0.731  1.00 44.93  ? 365 SER B N   1 
ATOM   5840 C  CA  . SER B  1 365 ? 16.093  69.272  -0.371  1.00 43.59  ? 365 SER B CA  1 
ATOM   5841 C  C   . SER B  1 365 ? 15.838  68.143  -1.373  1.00 44.45  ? 365 SER B C   1 
ATOM   5842 O  O   . SER B  1 365 ? 16.778  67.578  -1.936  1.00 43.62  ? 365 SER B O   1 
ATOM   5843 C  CB  . SER B  1 365 ? 15.658  68.814  1.023   1.00 43.55  ? 365 SER B CB  1 
ATOM   5844 O  OG  . SER B  1 365 ? 16.206  69.636  2.036   1.00 43.73  ? 365 SER B OG  1 
ATOM   5845 N  N   . VAL B  1 366 ? 14.556  67.847  -1.590  1.00 44.08  ? 366 VAL B N   1 
ATOM   5846 C  CA  . VAL B  1 366 ? 14.108  66.814  -2.537  1.00 44.78  ? 366 VAL B CA  1 
ATOM   5847 C  C   . VAL B  1 366 ? 14.627  67.073  -3.959  1.00 46.86  ? 366 VAL B C   1 
ATOM   5848 O  O   . VAL B  1 366 ? 14.974  66.131  -4.676  1.00 46.20  ? 366 VAL B O   1 
ATOM   5849 C  CB  . VAL B  1 366 ? 12.555  66.704  -2.536  1.00 44.96  ? 366 VAL B CB  1 
ATOM   5850 C  CG1 . VAL B  1 366 ? 12.023  65.943  -3.748  1.00 47.63  ? 366 VAL B CG1 1 
ATOM   5851 C  CG2 . VAL B  1 366 ? 12.076  66.017  -1.266  1.00 44.22  ? 366 VAL B CG2 1 
ATOM   5852 N  N   . SER B  1 367 ? 14.664  68.344  -4.354  1.00 50.62  ? 367 SER B N   1 
ATOM   5853 C  CA  . SER B  1 367 ? 15.149  68.741  -5.682  1.00 48.78  ? 367 SER B CA  1 
ATOM   5854 C  C   . SER B  1 367 ? 16.654  68.533  -5.831  1.00 48.76  ? 367 SER B C   1 
ATOM   5855 O  O   . SER B  1 367 ? 17.123  68.094  -6.880  1.00 47.60  ? 367 SER B O   1 
ATOM   5856 C  CB  . SER B  1 367 ? 14.792  70.197  -5.994  1.00 47.27  ? 367 SER B CB  1 
ATOM   5857 O  OG  . SER B  1 367 ? 15.616  71.120  -5.303  1.00 45.69  ? 367 SER B OG  1 
ATOM   5858 N  N   . LEU B  1 368 ? 17.398  68.866  -4.779  1.00 49.91  ? 368 LEU B N   1 
ATOM   5859 C  CA  . LEU B  1 368 ? 18.849  68.658  -4.750  1.00 47.96  ? 368 LEU B CA  1 
ATOM   5860 C  C   . LEU B  1 368 ? 19.240  67.175  -4.757  1.00 47.11  ? 368 LEU B C   1 
ATOM   5861 O  O   . LEU B  1 368 ? 20.315  66.826  -5.245  1.00 48.17  ? 368 LEU B O   1 
ATOM   5862 C  CB  . LEU B  1 368 ? 19.475  69.377  -3.547  1.00 45.60  ? 368 LEU B CB  1 
ATOM   5863 C  CG  . LEU B  1 368 ? 19.363  70.910  -3.521  1.00 46.29  ? 368 LEU B CG  1 
ATOM   5864 C  CD1 . LEU B  1 368 ? 19.907  71.454  -2.209  1.00 50.67  ? 368 LEU B CD1 1 
ATOM   5865 C  CD2 . LEU B  1 368 ? 20.069  71.574  -4.695  1.00 45.87  ? 368 LEU B CD2 1 
ATOM   5866 N  N   . HIS B  1 369 ? 18.371  66.316  -4.225  1.00 46.25  ? 369 HIS B N   1 
ATOM   5867 C  CA  . HIS B  1 369 ? 18.566  64.861  -4.297  1.00 49.99  ? 369 HIS B CA  1 
ATOM   5868 C  C   . HIS B  1 369 ? 18.505  64.311  -5.731  1.00 48.80  ? 369 HIS B C   1 
ATOM   5869 O  O   . HIS B  1 369 ? 19.193  63.338  -6.049  1.00 52.02  ? 369 HIS B O   1 
ATOM   5870 C  CB  . HIS B  1 369 ? 17.565  64.129  -3.394  1.00 51.17  ? 369 HIS B CB  1 
ATOM   5871 C  CG  . HIS B  1 369 ? 17.911  64.190  -1.938  1.00 50.17  ? 369 HIS B CG  1 
ATOM   5872 N  ND1 . HIS B  1 369 ? 19.078  63.662  -1.428  1.00 52.48  ? 369 HIS B ND1 1 
ATOM   5873 C  CD2 . HIS B  1 369 ? 17.241  64.707  -0.882  1.00 50.31  ? 369 HIS B CD2 1 
ATOM   5874 C  CE1 . HIS B  1 369 ? 19.114  63.858  -0.122  1.00 51.38  ? 369 HIS B CE1 1 
ATOM   5875 N  NE2 . HIS B  1 369 ? 18.012  64.491  0.234   1.00 52.92  ? 369 HIS B NE2 1 
ATOM   5876 N  N   . LEU B  1 370 ? 17.685  64.928  -6.582  1.00 48.75  ? 370 LEU B N   1 
ATOM   5877 C  CA  . LEU B  1 370 ? 17.681  64.631  -8.022  1.00 51.33  ? 370 LEU B CA  1 
ATOM   5878 C  C   . LEU B  1 370 ? 18.981  65.093  -8.700  1.00 52.59  ? 370 LEU B C   1 
ATOM   5879 O  O   . LEU B  1 370 ? 19.522  64.390  -9.556  1.00 55.83  ? 370 LEU B O   1 
ATOM   5880 C  CB  . LEU B  1 370 ? 16.477  65.283  -8.711  1.00 47.92  ? 370 LEU B CB  1 
ATOM   5881 C  CG  . LEU B  1 370 ? 15.069  64.834  -8.291  1.00 43.96  ? 370 LEU B CG  1 
ATOM   5882 C  CD1 . LEU B  1 370 ? 14.060  65.952  -8.508  1.00 42.16  ? 370 LEU B CD1 1 
ATOM   5883 C  CD2 . LEU B  1 370 ? 14.635  63.582  -9.043  1.00 43.88  ? 370 LEU B CD2 1 
ATOM   5884 N  N   . LEU B  1 371 ? 19.464  66.276  -8.318  1.00 47.85  ? 371 LEU B N   1 
ATOM   5885 C  CA  . LEU B  1 371 ? 20.747  66.807  -8.813  1.00 47.69  ? 371 LEU B CA  1 
ATOM   5886 C  C   . LEU B  1 371 ? 21.965  66.018  -8.327  1.00 51.08  ? 371 LEU B C   1 
ATOM   5887 O  O   . LEU B  1 371 ? 22.910  65.807  -9.091  1.00 47.15  ? 371 LEU B O   1 
ATOM   5888 C  CB  . LEU B  1 371 ? 20.923  68.284  -8.420  1.00 44.84  ? 371 LEU B CB  1 
ATOM   5889 C  CG  . LEU B  1 371 ? 20.352  69.337  -9.374  1.00 47.71  ? 371 LEU B CG  1 
ATOM   5890 C  CD1 . LEU B  1 371 ? 18.911  69.059  -9.775  1.00 51.17  ? 371 LEU B CD1 1 
ATOM   5891 C  CD2 . LEU B  1 371 ? 20.464  70.712  -8.735  1.00 48.02  ? 371 LEU B CD2 1 
ATOM   5892 N  N   . SER B  1 372 ? 21.935  65.592  -7.063  1.00 56.51  ? 372 SER B N   1 
ATOM   5893 C  CA  . SER B  1 372 ? 23.118  65.033  -6.401  1.00 59.69  ? 372 SER B CA  1 
ATOM   5894 C  C   . SER B  1 372 ? 23.549  63.685  -6.973  1.00 62.20  ? 372 SER B C   1 
ATOM   5895 O  O   . SER B  1 372 ? 22.718  62.829  -7.279  1.00 67.44  ? 372 SER B O   1 
ATOM   5896 C  CB  . SER B  1 372 ? 22.885  64.887  -4.894  1.00 61.28  ? 372 SER B CB  1 
ATOM   5897 O  OG  . SER B  1 372 ? 24.068  64.477  -4.227  1.00 53.51  ? 372 SER B OG  1 
ATOM   5898 N  N   . ALA B  1 373 ? 24.863  63.530  -7.115  1.00 59.31  ? 373 ALA B N   1 
ATOM   5899 C  CA  . ALA B  1 373 ? 25.494  62.257  -7.466  1.00 52.60  ? 373 ALA B CA  1 
ATOM   5900 C  C   . ALA B  1 373 ? 25.301  61.184  -6.389  1.00 49.29  ? 373 ALA B C   1 
ATOM   5901 O  O   . ALA B  1 373 ? 25.071  60.016  -6.709  1.00 47.13  ? 373 ALA B O   1 
ATOM   5902 C  CB  . ALA B  1 373 ? 26.979  62.477  -7.707  1.00 51.19  ? 373 ALA B CB  1 
ATOM   5903 N  N   . LEU B  1 374 ? 25.401  61.588  -5.123  1.00 48.12  ? 374 LEU B N   1 
ATOM   5904 C  CA  . LEU B  1 374 ? 25.351  60.656  -3.990  1.00 48.13  ? 374 LEU B CA  1 
ATOM   5905 C  C   . LEU B  1 374 ? 23.987  60.005  -3.743  1.00 48.66  ? 374 LEU B C   1 
ATOM   5906 O  O   . LEU B  1 374 ? 23.937  58.845  -3.326  1.00 59.10  ? 374 LEU B O   1 
ATOM   5907 C  CB  . LEU B  1 374 ? 25.821  61.350  -2.706  1.00 49.44  ? 374 LEU B CB  1 
ATOM   5908 C  CG  . LEU B  1 374 ? 27.328  61.568  -2.531  1.00 50.08  ? 374 LEU B CG  1 
ATOM   5909 C  CD1 . LEU B  1 374 ? 27.575  62.496  -1.354  1.00 52.90  ? 374 LEU B CD1 1 
ATOM   5910 C  CD2 . LEU B  1 374 ? 28.083  60.260  -2.329  1.00 45.32  ? 374 LEU B CD2 1 
ATOM   5911 N  N   . SER B  1 375 ? 22.899  60.735  -3.987  1.00 50.50  ? 375 SER B N   1 
ATOM   5912 C  CA  . SER B  1 375 ? 21.541  60.207  -3.755  1.00 56.02  ? 375 SER B CA  1 
ATOM   5913 C  C   . SER B  1 375 ? 20.752  59.880  -5.039  1.00 55.53  ? 375 SER B C   1 
ATOM   5914 O  O   . SER B  1 375 ? 19.541  59.657  -4.981  1.00 52.81  ? 375 SER B O   1 
ATOM   5915 C  CB  . SER B  1 375 ? 20.747  61.163  -2.849  1.00 55.63  ? 375 SER B CB  1 
ATOM   5916 O  OG  . SER B  1 375 ? 20.789  62.491  -3.336  1.00 53.22  ? 375 SER B OG  1 
ATOM   5917 N  N   . ARG B  1 376 ? 21.444  59.812  -6.177  1.00 57.87  ? 376 ARG B N   1 
ATOM   5918 C  CA  . ARG B  1 376 ? 20.814  59.577  -7.485  1.00 57.42  ? 376 ARG B CA  1 
ATOM   5919 C  C   . ARG B  1 376 ? 20.117  58.217  -7.583  1.00 55.11  ? 376 ARG B C   1 
ATOM   5920 O  O   . ARG B  1 376 ? 19.050  58.115  -8.181  1.00 54.60  ? 376 ARG B O   1 
ATOM   5921 C  CB  . ARG B  1 376 ? 21.859  59.704  -8.607  1.00 62.85  ? 376 ARG B CB  1 
ATOM   5922 C  CG  . ARG B  1 376 ? 21.327  59.586  -10.035 1.00 66.05  ? 376 ARG B CG  1 
ATOM   5923 C  CD  . ARG B  1 376 ? 20.436  60.758  -10.420 1.00 71.97  ? 376 ARG B CD  1 
ATOM   5924 N  NE  . ARG B  1 376 ? 21.188  62.009  -10.551 1.00 70.00  ? 376 ARG B NE  1 
ATOM   5925 C  CZ  . ARG B  1 376 ? 21.726  62.487  -11.678 1.00 66.51  ? 376 ARG B CZ  1 
ATOM   5926 N  NH1 . ARG B  1 376 ? 22.385  63.643  -11.644 1.00 72.63  ? 376 ARG B NH1 1 
ATOM   5927 N  NH2 . ARG B  1 376 ? 21.620  61.838  -12.840 1.00 63.18  ? 376 ARG B NH2 1 
ATOM   5928 N  N   . ASP B  1 377 ? 20.723  57.191  -6.987  1.00 53.63  ? 377 ASP B N   1 
ATOM   5929 C  CA  . ASP B  1 377 ? 20.220  55.807  -7.076  1.00 57.10  ? 377 ASP B CA  1 
ATOM   5930 C  C   . ASP B  1 377 ? 19.524  55.304  -5.792  1.00 56.92  ? 377 ASP B C   1 
ATOM   5931 O  O   . ASP B  1 377 ? 19.349  54.095  -5.614  1.00 54.87  ? 377 ASP B O   1 
ATOM   5932 C  CB  . ASP B  1 377 ? 21.358  54.853  -7.500  1.00 67.39  ? 377 ASP B CB  1 
ATOM   5933 C  CG  . ASP B  1 377 ? 22.489  54.766  -6.472  1.00 76.23  ? 377 ASP B CG  1 
ATOM   5934 O  OD1 . ASP B  1 377 ? 22.688  55.727  -5.698  1.00 70.90  ? 377 ASP B OD1 1 
ATOM   5935 O  OD2 . ASP B  1 377 ? 23.189  53.731  -6.452  1.00 80.94  ? 377 ASP B OD2 1 
ATOM   5936 N  N   . LEU B  1 378 ? 19.112  56.232  -4.924  1.00 57.42  ? 378 LEU B N   1 
ATOM   5937 C  CA  . LEU B  1 378 ? 18.465  55.911  -3.638  1.00 50.20  ? 378 LEU B CA  1 
ATOM   5938 C  C   . LEU B  1 378 ? 16.941  56.086  -3.620  1.00 49.08  ? 378 LEU B C   1 
ATOM   5939 O  O   . LEU B  1 378 ? 16.289  55.696  -2.648  1.00 51.41  ? 378 LEU B O   1 
ATOM   5940 C  CB  . LEU B  1 378 ? 19.072  56.768  -2.524  1.00 48.94  ? 378 LEU B CB  1 
ATOM   5941 C  CG  . LEU B  1 378 ? 20.583  56.672  -2.302  1.00 49.29  ? 378 LEU B CG  1 
ATOM   5942 C  CD1 . LEU B  1 378 ? 20.985  57.618  -1.182  1.00 48.86  ? 378 LEU B CD1 1 
ATOM   5943 C  CD2 . LEU B  1 378 ? 21.023  55.253  -1.970  1.00 49.54  ? 378 LEU B CD2 1 
ATOM   5944 N  N   . PHE B  1 379 ? 16.385  56.675  -4.678  1.00 49.93  ? 379 PHE B N   1 
ATOM   5945 C  CA  . PHE B  1 379 ? 14.936  56.863  -4.803  1.00 53.67  ? 379 PHE B CA  1 
ATOM   5946 C  C   . PHE B  1 379 ? 14.503  56.769  -6.269  1.00 53.33  ? 379 PHE B C   1 
ATOM   5947 O  O   . PHE B  1 379 ? 15.337  56.565  -7.152  1.00 55.59  ? 379 PHE B O   1 
ATOM   5948 C  CB  . PHE B  1 379 ? 14.522  58.200  -4.171  1.00 52.73  ? 379 PHE B CB  1 
ATOM   5949 C  CG  . PHE B  1 379 ? 14.996  59.409  -4.930  1.00 48.86  ? 379 PHE B CG  1 
ATOM   5950 C  CD1 . PHE B  1 379 ? 16.296  59.879  -4.778  1.00 48.84  ? 379 PHE B CD1 1 
ATOM   5951 C  CD2 . PHE B  1 379 ? 14.139  60.082  -5.794  1.00 49.14  ? 379 PHE B CD2 1 
ATOM   5952 C  CE1 . PHE B  1 379 ? 16.731  60.996  -5.477  1.00 52.25  ? 379 PHE B CE1 1 
ATOM   5953 C  CE2 . PHE B  1 379 ? 14.569  61.197  -6.496  1.00 50.03  ? 379 PHE B CE2 1 
ATOM   5954 C  CZ  . PHE B  1 379 ? 15.868  61.655  -6.337  1.00 53.68  ? 379 PHE B CZ  1 
ATOM   5955 N  N   . GLN B  1 380 ? 13.198  56.898  -6.512  1.00 50.64  ? 380 GLN B N   1 
ATOM   5956 C  CA  . GLN B  1 380 ? 12.635  56.851  -7.871  1.00 55.61  ? 380 GLN B CA  1 
ATOM   5957 C  C   . GLN B  1 380 ? 12.137  58.231  -8.322  1.00 61.92  ? 380 GLN B C   1 
ATOM   5958 O  O   . GLN B  1 380 ? 12.798  58.887  -9.128  1.00 64.01  ? 380 GLN B O   1 
ATOM   5959 C  CB  . GLN B  1 380 ? 11.524  55.794  -7.957  1.00 57.83  ? 380 GLN B CB  1 
ATOM   5960 C  CG  . GLN B  1 380 ? 11.071  55.469  -9.376  1.00 59.29  ? 380 GLN B CG  1 
ATOM   5961 C  CD  . GLN B  1 380 ? 9.891   54.510  -9.424  1.00 63.58  ? 380 GLN B CD  1 
ATOM   5962 O  OE1 . GLN B  1 380 ? 9.001   54.552  -8.574  1.00 64.63  ? 380 GLN B OE1 1 
ATOM   5963 N  NE2 . GLN B  1 380 ? 9.876   53.646  -10.432 1.00 64.96  ? 380 GLN B NE2 1 
ATOM   5964 N  N   . ARG B  1 381 ? 11.005  58.677  -7.772  1.00 67.45  ? 381 ARG B N   1 
ATOM   5965 C  CA  . ARG B  1 381 ? 10.317  59.903  -8.216  1.00 65.39  ? 381 ARG B CA  1 
ATOM   5966 C  C   . ARG B  1 381 ? 10.365  60.989  -7.144  1.00 61.14  ? 381 ARG B C   1 
ATOM   5967 O  O   . ARG B  1 381 ? 10.785  60.738  -6.011  1.00 60.36  ? 381 ARG B O   1 
ATOM   5968 C  CB  . ARG B  1 381 ? 8.860   59.595  -8.571  1.00 70.72  ? 381 ARG B CB  1 
ATOM   5969 C  CG  . ARG B  1 381 ? 8.691   58.478  -9.584  1.00 77.72  ? 381 ARG B CG  1 
ATOM   5970 C  CD  . ARG B  1 381 ? 7.249   58.357  -10.043 1.00 81.35  ? 381 ARG B CD  1 
ATOM   5971 N  NE  . ARG B  1 381 ? 7.039   57.148  -10.843 1.00 77.78  ? 381 ARG B NE  1 
ATOM   5972 C  CZ  . ARG B  1 381 ? 6.731   55.939  -10.366 1.00 85.31  ? 381 ARG B CZ  1 
ATOM   5973 N  NH1 . ARG B  1 381 ? 6.579   55.722  -9.059  1.00 86.06  ? 381 ARG B NH1 1 
ATOM   5974 N  NH2 . ARG B  1 381 ? 6.573   54.924  -11.213 1.00 95.44  ? 381 ARG B NH2 1 
ATOM   5975 N  N   . ALA B  1 382 ? 9.932   62.193  -7.518  1.00 58.95  ? 382 ALA B N   1 
ATOM   5976 C  CA  . ALA B  1 382 ? 9.976   63.361  -6.630  1.00 57.86  ? 382 ALA B CA  1 
ATOM   5977 C  C   . ALA B  1 382 ? 8.727   64.231  -6.747  1.00 56.19  ? 382 ALA B C   1 
ATOM   5978 O  O   . ALA B  1 382 ? 8.226   64.468  -7.850  1.00 69.64  ? 382 ALA B O   1 
ATOM   5979 C  CB  . ALA B  1 382 ? 11.211  64.191  -6.924  1.00 59.66  ? 382 ALA B CB  1 
ATOM   5980 N  N   . ILE B  1 383 ? 8.243   64.702  -5.597  1.00 52.63  ? 383 ILE B N   1 
ATOM   5981 C  CA  . ILE B  1 383 ? 7.126   65.649  -5.506  1.00 51.58  ? 383 ILE B CA  1 
ATOM   5982 C  C   . ILE B  1 383 ? 7.657   66.897  -4.796  1.00 48.46  ? 383 ILE B C   1 
ATOM   5983 O  O   . ILE B  1 383 ? 8.350   66.790  -3.783  1.00 45.79  ? 383 ILE B O   1 
ATOM   5984 C  CB  . ILE B  1 383 ? 5.915   65.049  -4.746  1.00 50.59  ? 383 ILE B CB  1 
ATOM   5985 C  CG1 . ILE B  1 383 ? 5.429   63.761  -5.430  1.00 51.13  ? 383 ILE B CG1 1 
ATOM   5986 C  CG2 . ILE B  1 383 ? 4.772   66.060  -4.622  1.00 49.95  ? 383 ILE B CG2 1 
ATOM   5987 C  CD1 . ILE B  1 383 ? 4.408   62.972  -4.636  1.00 52.26  ? 383 ILE B CD1 1 
ATOM   5988 N  N   . LEU B  1 384 ? 7.331   68.073  -5.331  1.00 45.47  ? 384 LEU B N   1 
ATOM   5989 C  CA  . LEU B  1 384 ? 7.956   69.328  -4.895  1.00 46.73  ? 384 LEU B CA  1 
ATOM   5990 C  C   . LEU B  1 384 ? 6.949   70.461  -4.706  1.00 48.48  ? 384 LEU B C   1 
ATOM   5991 O  O   . LEU B  1 384 ? 6.520   71.096  -5.669  1.00 48.63  ? 384 LEU B O   1 
ATOM   5992 C  CB  . LEU B  1 384 ? 9.027   69.753  -5.899  1.00 49.87  ? 384 LEU B CB  1 
ATOM   5993 C  CG  . LEU B  1 384 ? 10.165  68.750  -6.118  1.00 49.69  ? 384 LEU B CG  1 
ATOM   5994 C  CD1 . LEU B  1 384 ? 9.912   67.861  -7.329  1.00 50.34  ? 384 LEU B CD1 1 
ATOM   5995 C  CD2 . LEU B  1 384 ? 11.481  69.481  -6.290  1.00 47.90  ? 384 LEU B CD2 1 
ATOM   5996 N  N   . GLN B  1 385 ? 6.603   70.724  -3.450  1.00 45.67  ? 385 GLN B N   1 
ATOM   5997 C  CA  . GLN B  1 385 ? 5.619   71.748  -3.100  1.00 43.46  ? 385 GLN B CA  1 
ATOM   5998 C  C   . GLN B  1 385 ? 6.307   73.066  -2.732  1.00 41.48  ? 385 GLN B C   1 
ATOM   5999 O  O   . GLN B  1 385 ? 7.022   73.137  -1.737  1.00 42.96  ? 385 GLN B O   1 
ATOM   6000 C  CB  . GLN B  1 385 ? 4.754   71.261  -1.935  1.00 44.67  ? 385 GLN B CB  1 
ATOM   6001 C  CG  . GLN B  1 385 ? 4.015   69.952  -2.205  1.00 44.10  ? 385 GLN B CG  1 
ATOM   6002 C  CD  . GLN B  1 385 ? 3.286   69.400  -0.987  1.00 45.55  ? 385 GLN B CD  1 
ATOM   6003 O  OE1 . GLN B  1 385 ? 2.963   68.213  -0.937  1.00 45.84  ? 385 GLN B OE1 1 
ATOM   6004 N  NE2 . GLN B  1 385 ? 3.025   70.255  -0.001  1.00 45.04  ? 385 GLN B NE2 1 
ATOM   6005 N  N   . SER B  1 386 ? 6.092   74.098  -3.547  1.00 43.31  ? 386 SER B N   1 
ATOM   6006 C  CA  . SER B  1 386 ? 6.612   75.454  -3.289  1.00 46.97  ? 386 SER B CA  1 
ATOM   6007 C  C   . SER B  1 386 ? 8.135   75.492  -3.080  1.00 49.01  ? 386 SER B C   1 
ATOM   6008 O  O   . SER B  1 386 ? 8.629   76.165  -2.169  1.00 51.04  ? 386 SER B O   1 
ATOM   6009 C  CB  . SER B  1 386 ? 5.891   76.088  -2.087  1.00 45.61  ? 386 SER B CB  1 
ATOM   6010 O  OG  . SER B  1 386 ? 4.483   75.969  -2.210  1.00 50.56  ? 386 SER B OG  1 
ATOM   6011 N  N   . GLY B  1 387 ? 8.867   74.776  -3.931  1.00 47.68  ? 387 GLY B N   1 
ATOM   6012 C  CA  . GLY B  1 387 ? 10.326  74.690  -3.815  1.00 44.10  ? 387 GLY B CA  1 
ATOM   6013 C  C   . GLY B  1 387 ? 11.051  74.274  -5.080  1.00 44.90  ? 387 GLY B C   1 
ATOM   6014 O  O   . GLY B  1 387 ? 10.492  73.593  -5.942  1.00 45.12  ? 387 GLY B O   1 
ATOM   6015 N  N   . SER B  1 388 ? 12.314  74.688  -5.164  1.00 44.51  ? 388 SER B N   1 
ATOM   6016 C  CA  . SER B  1 388 ? 13.140  74.503  -6.358  1.00 43.49  ? 388 SER B CA  1 
ATOM   6017 C  C   . SER B  1 388 ? 14.613  74.801  -6.031  1.00 44.26  ? 388 SER B C   1 
ATOM   6018 O  O   . SER B  1 388 ? 14.888  75.712  -5.244  1.00 46.07  ? 388 SER B O   1 
ATOM   6019 C  CB  . SER B  1 388 ? 12.631  75.440  -7.460  1.00 44.55  ? 388 SER B CB  1 
ATOM   6020 O  OG  . SER B  1 388 ? 13.503  75.511  -8.571  1.00 47.16  ? 388 SER B OG  1 
ATOM   6021 N  N   . PRO B  1 389 ? 15.564  74.052  -6.640  1.00 45.51  ? 389 PRO B N   1 
ATOM   6022 C  CA  . PRO B  1 389 ? 16.976  74.227  -6.266  1.00 45.35  ? 389 PRO B CA  1 
ATOM   6023 C  C   . PRO B  1 389 ? 17.606  75.544  -6.730  1.00 43.08  ? 389 PRO B C   1 
ATOM   6024 O  O   . PRO B  1 389 ? 18.621  75.965  -6.170  1.00 46.51  ? 389 PRO B O   1 
ATOM   6025 C  CB  . PRO B  1 389 ? 17.668  73.038  -6.936  1.00 44.29  ? 389 PRO B CB  1 
ATOM   6026 C  CG  . PRO B  1 389 ? 16.821  72.708  -8.111  1.00 45.59  ? 389 PRO B CG  1 
ATOM   6027 C  CD  . PRO B  1 389 ? 15.421  73.172  -7.819  1.00 46.92  ? 389 PRO B CD  1 
ATOM   6028 N  N   . THR B  1 390 ? 17.004  76.181  -7.734  1.00 46.35  ? 390 THR B N   1 
ATOM   6029 C  CA  . THR B  1 390 ? 17.454  77.488  -8.225  1.00 48.24  ? 390 THR B CA  1 
ATOM   6030 C  C   . THR B  1 390 ? 16.815  78.690  -7.505  1.00 47.28  ? 390 THR B C   1 
ATOM   6031 O  O   . THR B  1 390 ? 16.959  79.827  -7.965  1.00 40.48  ? 390 THR B O   1 
ATOM   6032 C  CB  . THR B  1 390 ? 17.243  77.611  -9.754  1.00 50.03  ? 390 THR B CB  1 
ATOM   6033 O  OG1 . THR B  1 390 ? 17.935  78.766  -10.244 1.00 58.58  ? 390 THR B OG1 1 
ATOM   6034 C  CG2 . THR B  1 390 ? 15.752  77.703  -10.132 1.00 48.09  ? 390 THR B CG2 1 
ATOM   6035 N  N   . ALA B  1 391 ? 16.110  78.444  -6.398  1.00 51.16  ? 391 ALA B N   1 
ATOM   6036 C  CA  . ALA B  1 391 ? 15.562  79.517  -5.567  1.00 49.34  ? 391 ALA B CA  1 
ATOM   6037 C  C   . ALA B  1 391 ? 16.706  80.343  -4.955  1.00 50.70  ? 391 ALA B C   1 
ATOM   6038 O  O   . ALA B  1 391 ? 17.730  79.767  -4.579  1.00 53.33  ? 391 ALA B O   1 
ATOM   6039 C  CB  . ALA B  1 391 ? 14.675  78.931  -4.479  1.00 45.96  ? 391 ALA B CB  1 
ATOM   6040 N  N   . PRO B  1 392 ? 16.548  81.687  -4.856  1.00 54.74  ? 392 PRO B N   1 
ATOM   6041 C  CA  . PRO B  1 392 ? 17.660  82.523  -4.343  1.00 57.54  ? 392 PRO B CA  1 
ATOM   6042 C  C   . PRO B  1 392 ? 18.107  82.213  -2.901  1.00 59.12  ? 392 PRO B C   1 
ATOM   6043 O  O   . PRO B  1 392 ? 19.272  82.424  -2.556  1.00 57.44  ? 392 PRO B O   1 
ATOM   6044 C  CB  . PRO B  1 392 ? 17.108  83.959  -4.431  1.00 58.29  ? 392 PRO B CB  1 
ATOM   6045 C  CG  . PRO B  1 392 ? 15.889  83.883  -5.283  1.00 58.81  ? 392 PRO B CG  1 
ATOM   6046 C  CD  . PRO B  1 392 ? 15.346  82.497  -5.132  1.00 57.58  ? 392 PRO B CD  1 
ATOM   6047 N  N   . TRP B  1 393 ? 17.174  81.718  -2.092  1.00 56.57  ? 393 TRP B N   1 
ATOM   6048 C  CA  . TRP B  1 393 ? 17.425  81.357  -0.685  1.00 53.68  ? 393 TRP B CA  1 
ATOM   6049 C  C   . TRP B  1 393 ? 17.926  79.919  -0.477  1.00 50.77  ? 393 TRP B C   1 
ATOM   6050 O  O   . TRP B  1 393 ? 18.485  79.611  0.578   1.00 49.12  ? 393 TRP B O   1 
ATOM   6051 C  CB  . TRP B  1 393 ? 16.168  81.601  0.168   1.00 50.98  ? 393 TRP B CB  1 
ATOM   6052 C  CG  . TRP B  1 393 ? 14.928  80.896  -0.298  1.00 44.38  ? 393 TRP B CG  1 
ATOM   6053 C  CD1 . TRP B  1 393 ? 13.942  81.413  -1.091  1.00 43.77  ? 393 TRP B CD1 1 
ATOM   6054 C  CD2 . TRP B  1 393 ? 14.539  79.552  0.002   1.00 43.93  ? 393 TRP B CD2 1 
ATOM   6055 N  NE1 . TRP B  1 393 ? 12.967  80.473  -1.309  1.00 44.92  ? 393 TRP B NE1 1 
ATOM   6056 C  CE2 . TRP B  1 393 ? 13.307  79.321  -0.650  1.00 45.66  ? 393 TRP B CE2 1 
ATOM   6057 C  CE3 . TRP B  1 393 ? 15.112  78.518  0.756   1.00 41.39  ? 393 TRP B CE3 1 
ATOM   6058 C  CZ2 . TRP B  1 393 ? 12.634  78.097  -0.569  1.00 46.11  ? 393 TRP B CZ2 1 
ATOM   6059 C  CZ3 . TRP B  1 393 ? 14.443  77.301  0.837   1.00 43.31  ? 393 TRP B CZ3 1 
ATOM   6060 C  CH2 . TRP B  1 393 ? 13.213  77.105  0.180   1.00 45.08  ? 393 TRP B CH2 1 
ATOM   6061 N  N   . ALA B  1 394 ? 17.710  79.055  -1.471  1.00 52.14  ? 394 ALA B N   1 
ATOM   6062 C  CA  . ALA B  1 394 ? 18.091  77.629  -1.418  1.00 52.99  ? 394 ALA B CA  1 
ATOM   6063 C  C   . ALA B  1 394 ? 19.568  77.412  -1.105  1.00 52.67  ? 394 ALA B C   1 
ATOM   6064 O  O   . ALA B  1 394 ? 19.914  76.626  -0.219  1.00 51.99  ? 394 ALA B O   1 
ATOM   6065 C  CB  . ALA B  1 394 ? 17.745  76.948  -2.733  1.00 52.82  ? 394 ALA B CB  1 
ATOM   6066 N  N   . LEU B  1 395 ? 20.420  78.101  -1.861  1.00 52.90  ? 395 LEU B N   1 
ATOM   6067 C  CA  . LEU B  1 395 ? 21.867  78.106  -1.630  1.00 54.17  ? 395 LEU B CA  1 
ATOM   6068 C  C   . LEU B  1 395 ? 22.413  79.513  -1.414  1.00 56.37  ? 395 LEU B C   1 
ATOM   6069 O  O   . LEU B  1 395 ? 21.825  80.502  -1.859  1.00 58.60  ? 395 LEU B O   1 
ATOM   6070 C  CB  . LEU B  1 395 ? 22.619  77.470  -2.805  1.00 54.07  ? 395 LEU B CB  1 
ATOM   6071 C  CG  . LEU B  1 395 ? 22.536  75.946  -2.933  1.00 56.23  ? 395 LEU B CG  1 
ATOM   6072 C  CD1 . LEU B  1 395 ? 21.313  75.532  -3.740  1.00 58.26  ? 395 LEU B CD1 1 
ATOM   6073 C  CD2 . LEU B  1 395 ? 23.802  75.368  -3.554  1.00 54.04  ? 395 LEU B CD2 1 
ATOM   6074 N  N   . VAL B  1 396 ? 23.546  79.570  -0.719  1.00 54.75  ? 396 VAL B N   1 
ATOM   6075 C  CA  . VAL B  1 396 ? 24.410  80.753  -0.681  1.00 54.04  ? 396 VAL B CA  1 
ATOM   6076 C  C   . VAL B  1 396 ? 25.783  80.343  -1.188  1.00 48.73  ? 396 VAL B C   1 
ATOM   6077 O  O   . VAL B  1 396 ? 26.080  79.151  -1.300  1.00 51.58  ? 396 VAL B O   1 
ATOM   6078 C  CB  . VAL B  1 396 ? 24.526  81.388  0.725   1.00 53.50  ? 396 VAL B CB  1 
ATOM   6079 C  CG1 . VAL B  1 396 ? 23.211  82.047  1.108   1.00 54.44  ? 396 VAL B CG1 1 
ATOM   6080 C  CG2 . VAL B  1 396 ? 24.965  80.378  1.783   1.00 53.79  ? 396 VAL B CG2 1 
ATOM   6081 N  N   . SER B  1 397 ? 26.611  81.331  -1.504  1.00 48.29  ? 397 SER B N   1 
ATOM   6082 C  CA  . SER B  1 397 ? 27.943  81.060  -2.026  1.00 49.07  ? 397 SER B CA  1 
ATOM   6083 C  C   . SER B  1 397 ? 28.836  80.538  -0.911  1.00 50.96  ? 397 SER B C   1 
ATOM   6084 O  O   . SER B  1 397 ? 28.689  80.926  0.252   1.00 50.95  ? 397 SER B O   1 
ATOM   6085 C  CB  . SER B  1 397 ? 28.559  82.310  -2.657  1.00 49.79  ? 397 SER B CB  1 
ATOM   6086 O  OG  . SER B  1 397 ? 28.702  83.355  -1.716  1.00 45.89  ? 397 SER B OG  1 
ATOM   6087 N  N   . ARG B  1 398 ? 29.748  79.642  -1.277  1.00 59.50  ? 398 ARG B N   1 
ATOM   6088 C  CA  . ARG B  1 398 ? 30.782  79.156  -0.351  1.00 58.80  ? 398 ARG B CA  1 
ATOM   6089 C  C   . ARG B  1 398 ? 31.756  80.251  0.098   1.00 55.98  ? 398 ARG B C   1 
ATOM   6090 O  O   . ARG B  1 398 ? 32.412  80.111  1.125   1.00 59.90  ? 398 ARG B O   1 
ATOM   6091 C  CB  . ARG B  1 398 ? 31.539  77.955  -0.939  1.00 58.21  ? 398 ARG B CB  1 
ATOM   6092 C  CG  . ARG B  1 398 ? 32.267  78.188  -2.257  1.00 64.71  ? 398 ARG B CG  1 
ATOM   6093 C  CD  . ARG B  1 398 ? 32.250  76.935  -3.122  1.00 66.80  ? 398 ARG B CD  1 
ATOM   6094 N  NE  . ARG B  1 398 ? 32.919  75.812  -2.466  1.00 67.04  ? 398 ARG B NE  1 
ATOM   6095 C  CZ  . ARG B  1 398 ? 34.241  75.643  -2.380  1.00 69.27  ? 398 ARG B CZ  1 
ATOM   6096 N  NH1 . ARG B  1 398 ? 35.089  76.524  -2.916  1.00 66.75  ? 398 ARG B NH1 1 
ATOM   6097 N  NH2 . ARG B  1 398 ? 34.726  74.574  -1.754  1.00 73.63  ? 398 ARG B NH2 1 
ATOM   6098 N  N   . GLU B  1 399 ? 31.843  81.333  -0.673  1.00 59.82  ? 399 GLU B N   1 
ATOM   6099 C  CA  . GLU B  1 399 ? 32.543  82.547  -0.258  1.00 66.82  ? 399 GLU B CA  1 
ATOM   6100 C  C   . GLU B  1 399 ? 31.808  83.271  0.880   1.00 69.12  ? 399 GLU B C   1 
ATOM   6101 O  O   . GLU B  1 399 ? 32.424  83.656  1.872   1.00 66.49  ? 399 GLU B O   1 
ATOM   6102 C  CB  . GLU B  1 399 ? 32.686  83.488  -1.454  1.00 70.51  ? 399 GLU B CB  1 
ATOM   6103 C  CG  . GLU B  1 399 ? 33.653  84.647  -1.230  1.00 71.09  ? 399 GLU B CG  1 
ATOM   6104 C  CD  . GLU B  1 399 ? 33.520  85.749  -2.268  1.00 70.44  ? 399 GLU B CD  1 
ATOM   6105 O  OE1 . GLU B  1 399 ? 34.564  86.274  -2.709  1.00 73.67  ? 399 GLU B OE1 1 
ATOM   6106 O  OE2 . GLU B  1 399 ? 32.380  86.102  -2.644  1.00 74.15  ? 399 GLU B OE2 1 
ATOM   6107 N  N   . GLU B  1 400 ? 30.502  83.473  0.708   1.00 71.95  ? 400 GLU B N   1 
ATOM   6108 C  CA  . GLU B  1 400 ? 29.650  84.145  1.708   1.00 70.68  ? 400 GLU B CA  1 
ATOM   6109 C  C   . GLU B  1 400 ? 29.498  83.324  2.988   1.00 71.94  ? 400 GLU B C   1 
ATOM   6110 O  O   . GLU B  1 400 ? 29.673  83.843  4.090   1.00 72.53  ? 400 GLU B O   1 
ATOM   6111 C  CB  . GLU B  1 400 ? 28.261  84.431  1.114   1.00 72.98  ? 400 GLU B CB  1 
ATOM   6112 C  CG  . GLU B  1 400 ? 27.260  85.136  2.032   1.00 78.45  ? 400 GLU B CG  1 
ATOM   6113 C  CD  . GLU B  1 400 ? 27.706  86.524  2.461   1.00 83.68  ? 400 GLU B CD  1 
ATOM   6114 O  OE1 . GLU B  1 400 ? 28.247  87.272  1.619   1.00 86.68  ? 400 GLU B OE1 1 
ATOM   6115 O  OE2 . GLU B  1 400 ? 27.504  86.873  3.644   1.00 80.13  ? 400 GLU B OE2 1 
ATOM   6116 N  N   . ALA B  1 401 ? 29.157  82.048  2.823   1.00 67.76  ? 401 ALA B N   1 
ATOM   6117 C  CA  . ALA B  1 401 ? 28.903  81.128  3.942   1.00 63.34  ? 401 ALA B CA  1 
ATOM   6118 C  C   . ALA B  1 401 ? 30.028  81.042  4.986   1.00 66.90  ? 401 ALA B C   1 
ATOM   6119 O  O   . ALA B  1 401 ? 29.758  80.771  6.158   1.00 65.97  ? 401 ALA B O   1 
ATOM   6120 C  CB  . ALA B  1 401 ? 28.576  79.743  3.408   1.00 62.75  ? 401 ALA B CB  1 
ATOM   6121 N  N   . THR B  1 402 ? 31.275  81.260  4.560   1.00 68.33  ? 402 THR B N   1 
ATOM   6122 C  CA  . THR B  1 402 ? 32.404  81.416  5.491   1.00 71.61  ? 402 THR B CA  1 
ATOM   6123 C  C   . THR B  1 402 ? 32.234  82.672  6.340   1.00 70.26  ? 402 THR B C   1 
ATOM   6124 O  O   . THR B  1 402 ? 32.360  82.624  7.564   1.00 71.05  ? 402 THR B O   1 
ATOM   6125 C  CB  . THR B  1 402 ? 33.758  81.523  4.762   1.00 71.84  ? 402 THR B CB  1 
ATOM   6126 O  OG1 . THR B  1 402 ? 33.726  82.609  3.829   1.00 85.49  ? 402 THR B OG1 1 
ATOM   6127 C  CG2 . THR B  1 402 ? 34.089  80.237  4.029   1.00 71.30  ? 402 THR B CG2 1 
ATOM   6128 N  N   . LEU B  1 403 ? 31.951  83.789  5.671   1.00 70.36  ? 403 LEU B N   1 
ATOM   6129 C  CA  . LEU B  1 403 ? 31.687  85.072  6.341   1.00 70.45  ? 403 LEU B CA  1 
ATOM   6130 C  C   . LEU B  1 403 ? 30.487  85.007  7.293   1.00 68.19  ? 403 LEU B C   1 
ATOM   6131 O  O   . LEU B  1 403 ? 30.491  85.660  8.337   1.00 62.56  ? 403 LEU B O   1 
ATOM   6132 C  CB  . LEU B  1 403 ? 31.497  86.207  5.321   1.00 71.86  ? 403 LEU B CB  1 
ATOM   6133 C  CG  . LEU B  1 403 ? 32.772  86.929  4.876   1.00 76.93  ? 403 LEU B CG  1 
ATOM   6134 C  CD1 . LEU B  1 403 ? 33.770  85.993  4.209   1.00 78.50  ? 403 LEU B CD1 1 
ATOM   6135 C  CD2 . LEU B  1 403 ? 32.408  88.071  3.941   1.00 80.35  ? 403 LEU B CD2 1 
ATOM   6136 N  N   . ARG B  1 404 ? 29.474  84.219  6.925   1.00 66.17  ? 404 ARG B N   1 
ATOM   6137 C  CA  . ARG B  1 404 ? 28.303  83.976  7.784   1.00 64.72  ? 404 ARG B CA  1 
ATOM   6138 C  C   . ARG B  1 404 ? 28.704  83.265  9.077   1.00 61.92  ? 404 ARG B C   1 
ATOM   6139 O  O   . ARG B  1 404 ? 28.203  83.592  10.155  1.00 63.96  ? 404 ARG B O   1 
ATOM   6140 C  CB  . ARG B  1 404 ? 27.258  83.112  7.065   1.00 65.85  ? 404 ARG B CB  1 
ATOM   6141 C  CG  . ARG B  1 404 ? 26.683  83.689  5.780   1.00 67.60  ? 404 ARG B CG  1 
ATOM   6142 C  CD  . ARG B  1 404 ? 25.567  84.684  6.027   1.00 67.13  ? 404 ARG B CD  1 
ATOM   6143 N  NE  . ARG B  1 404 ? 24.997  85.149  4.761   1.00 67.59  ? 404 ARG B NE  1 
ATOM   6144 C  CZ  . ARG B  1 404 ? 24.008  84.556  4.086   1.00 66.25  ? 404 ARG B CZ  1 
ATOM   6145 N  NH1 . ARG B  1 404 ? 23.423  83.446  4.538   1.00 68.76  ? 404 ARG B NH1 1 
ATOM   6146 N  NH2 . ARG B  1 404 ? 23.593  85.086  2.938   1.00 70.19  ? 404 ARG B NH2 1 
ATOM   6147 N  N   . ALA B  1 405 ? 29.598  82.286  8.945   1.00 62.29  ? 405 ALA B N   1 
ATOM   6148 C  CA  . ALA B  1 405 ? 30.101  81.506  10.078  1.00 64.06  ? 405 ALA B CA  1 
ATOM   6149 C  C   . ALA B  1 405 ? 31.016  82.323  10.982  1.00 62.77  ? 405 ALA B C   1 
ATOM   6150 O  O   . ALA B  1 405 ? 30.946  82.210  12.207  1.00 63.29  ? 405 ALA B O   1 
ATOM   6151 C  CB  . ALA B  1 405 ? 30.841  80.277  9.573   1.00 69.15  ? 405 ALA B CB  1 
ATOM   6152 N  N   . LEU B  1 406 ? 31.887  83.123  10.372  1.00 65.12  ? 406 LEU B N   1 
ATOM   6153 C  CA  . LEU B  1 406 ? 32.767  84.029  11.113  1.00 70.59  ? 406 LEU B CA  1 
ATOM   6154 C  C   . LEU B  1 406 ? 31.999  85.129  11.859  1.00 74.20  ? 406 LEU B C   1 
ATOM   6155 O  O   . LEU B  1 406 ? 32.437  85.573  12.922  1.00 73.91  ? 406 LEU B O   1 
ATOM   6156 C  CB  . LEU B  1 406 ? 33.809  84.645  10.173  1.00 71.06  ? 406 LEU B CB  1 
ATOM   6157 C  CG  . LEU B  1 406 ? 34.818  83.666  9.559   1.00 69.99  ? 406 LEU B CG  1 
ATOM   6158 C  CD1 . LEU B  1 406 ? 35.600  84.338  8.441   1.00 68.97  ? 406 LEU B CD1 1 
ATOM   6159 C  CD2 . LEU B  1 406 ? 35.770  83.100  10.602  1.00 71.45  ? 406 LEU B CD2 1 
ATOM   6160 N  N   . ARG B  1 407 ? 30.863  85.556  11.305  1.00 72.78  ? 407 ARG B N   1 
ATOM   6161 C  CA  . ARG B  1 407 ? 29.975  86.511  11.982  1.00 69.13  ? 407 ARG B CA  1 
ATOM   6162 C  C   . ARG B  1 407 ? 29.202  85.828  13.119  1.00 64.67  ? 407 ARG B C   1 
ATOM   6163 O  O   . ARG B  1 407 ? 28.922  86.457  14.142  1.00 75.65  ? 407 ARG B O   1 
ATOM   6164 C  CB  . ARG B  1 407 ? 29.010  87.176  10.987  1.00 72.62  ? 407 ARG B CB  1 
ATOM   6165 C  CG  . ARG B  1 407 ? 28.614  88.603  11.367  1.00 76.42  ? 407 ARG B CG  1 
ATOM   6166 C  CD  . ARG B  1 407 ? 27.634  89.249  10.390  1.00 74.59  ? 407 ARG B CD  1 
ATOM   6167 N  NE  . ARG B  1 407 ? 27.985  88.998  8.985   1.00 76.87  ? 407 ARG B NE  1 
ATOM   6168 C  CZ  . ARG B  1 407 ? 27.336  88.189  8.138   1.00 73.03  ? 407 ARG B CZ  1 
ATOM   6169 N  NH1 . ARG B  1 407 ? 26.241  87.515  8.501   1.00 70.64  ? 407 ARG B NH1 1 
ATOM   6170 N  NH2 . ARG B  1 407 ? 27.790  88.061  6.891   1.00 67.18  ? 407 ARG B NH2 1 
ATOM   6171 N  N   . LEU B  1 408 ? 28.851  84.553  12.930  1.00 60.17  ? 408 LEU B N   1 
ATOM   6172 C  CA  . LEU B  1 408 ? 28.256  83.732  13.998  1.00 61.61  ? 408 LEU B CA  1 
ATOM   6173 C  C   . LEU B  1 408 ? 29.243  83.462  15.136  1.00 67.73  ? 408 LEU B C   1 
ATOM   6174 O  O   . LEU B  1 408 ? 28.858  83.486  16.311  1.00 69.53  ? 408 LEU B O   1 
ATOM   6175 C  CB  . LEU B  1 408 ? 27.734  82.400  13.443  1.00 60.14  ? 408 LEU B CB  1 
ATOM   6176 C  CG  . LEU B  1 408 ? 27.184  81.393  14.468  1.00 58.78  ? 408 LEU B CG  1 
ATOM   6177 C  CD1 . LEU B  1 408 ? 25.904  81.912  15.106  1.00 58.86  ? 408 LEU B CD1 1 
ATOM   6178 C  CD2 . LEU B  1 408 ? 26.950  80.035  13.829  1.00 59.48  ? 408 LEU B CD2 1 
ATOM   6179 N  N   . ALA B  1 409 ? 30.495  83.182  14.783  1.00 66.54  ? 409 ALA B N   1 
ATOM   6180 C  CA  . ALA B  1 409 ? 31.570  83.024  15.767  1.00 66.77  ? 409 ALA B CA  1 
ATOM   6181 C  C   . ALA B  1 409 ? 31.831  84.319  16.551  1.00 69.25  ? 409 ALA B C   1 
ATOM   6182 O  O   . ALA B  1 409 ? 32.113  84.280  17.751  1.00 71.28  ? 409 ALA B O   1 
ATOM   6183 C  CB  . ALA B  1 409 ? 32.843  82.564  15.078  1.00 63.76  ? 409 ALA B CB  1 
ATOM   6184 N  N   . GLU B  1 410 ? 31.738  85.452  15.855  1.00 70.20  ? 410 GLU B N   1 
ATOM   6185 C  CA  . GLU B  1 410 ? 31.903  86.785  16.446  1.00 69.92  ? 410 GLU B CA  1 
ATOM   6186 C  C   . GLU B  1 410 ? 30.799  87.120  17.456  1.00 65.84  ? 410 GLU B C   1 
ATOM   6187 O  O   . GLU B  1 410 ? 31.072  87.689  18.516  1.00 66.35  ? 410 GLU B O   1 
ATOM   6188 C  CB  . GLU B  1 410 ? 31.939  87.838  15.330  1.00 75.84  ? 410 GLU B CB  1 
ATOM   6189 C  CG  . GLU B  1 410 ? 32.206  89.268  15.789  1.00 76.95  ? 410 GLU B CG  1 
ATOM   6190 C  CD  . GLU B  1 410 ? 32.627  90.192  14.655  1.00 76.91  ? 410 GLU B CD  1 
ATOM   6191 O  OE1 . GLU B  1 410 ? 32.265  89.930  13.486  1.00 73.49  ? 410 GLU B OE1 1 
ATOM   6192 O  OE2 . GLU B  1 410 ? 33.321  91.191  14.937  1.00 74.09  ? 410 GLU B OE2 1 
ATOM   6193 N  N   . ALA B  1 411 ? 29.563  86.767  17.109  1.00 60.08  ? 411 ALA B N   1 
ATOM   6194 C  CA  . ALA B  1 411 ? 28.386  87.002  17.956  1.00 59.29  ? 411 ALA B CA  1 
ATOM   6195 C  C   . ALA B  1 411 ? 28.434  86.245  19.289  1.00 61.06  ? 411 ALA B C   1 
ATOM   6196 O  O   . ALA B  1 411 ? 28.114  86.805  20.341  1.00 57.83  ? 411 ALA B O   1 
ATOM   6197 C  CB  . ALA B  1 411 ? 27.126  86.626  17.190  1.00 56.47  ? 411 ALA B CB  1 
ATOM   6198 N  N   . VAL B  1 412 ? 28.838  84.979  19.227  1.00 69.05  ? 412 VAL B N   1 
ATOM   6199 C  CA  . VAL B  1 412 ? 28.879  84.084  20.395  1.00 68.21  ? 412 VAL B CA  1 
ATOM   6200 C  C   . VAL B  1 412 ? 30.122  84.325  21.279  1.00 67.61  ? 412 VAL B C   1 
ATOM   6201 O  O   . VAL B  1 412 ? 30.148  83.918  22.447  1.00 65.30  ? 412 VAL B O   1 
ATOM   6202 C  CB  . VAL B  1 412 ? 28.774  82.606  19.932  1.00 70.01  ? 412 VAL B CB  1 
ATOM   6203 C  CG1 . VAL B  1 412 ? 28.783  81.631  21.099  1.00 74.96  ? 412 VAL B CG1 1 
ATOM   6204 C  CG2 . VAL B  1 412 ? 27.483  82.395  19.151  1.00 71.40  ? 412 VAL B CG2 1 
ATOM   6205 N  N   . GLY B  1 413 ? 31.126  85.011  20.734  1.00 67.16  ? 413 GLY B N   1 
ATOM   6206 C  CA  . GLY B  1 413 ? 32.342  85.369  21.473  1.00 63.60  ? 413 GLY B CA  1 
ATOM   6207 C  C   . GLY B  1 413 ? 33.518  84.436  21.241  1.00 62.81  ? 413 GLY B C   1 
ATOM   6208 O  O   . GLY B  1 413 ? 34.338  84.238  22.142  1.00 62.78  ? 413 GLY B O   1 
ATOM   6209 N  N   . CYS B  1 414 ? 33.600  83.871  20.035  1.00 69.87  ? 414 CYS B N   1 
ATOM   6210 C  CA  . CYS B  1 414 ? 34.702  82.989  19.627  1.00 70.18  ? 414 CYS B CA  1 
ATOM   6211 C  C   . CYS B  1 414 ? 35.655  83.704  18.660  1.00 65.91  ? 414 CYS B C   1 
ATOM   6212 O  O   . CYS B  1 414 ? 35.316  84.772  18.141  1.00 53.98  ? 414 CYS B O   1 
ATOM   6213 C  CB  . CYS B  1 414 ? 34.145  81.727  18.959  1.00 72.41  ? 414 CYS B CB  1 
ATOM   6214 S  SG  . CYS B  1 414 ? 33.419  80.527  20.102  1.00 86.30  ? 414 CYS B SG  1 
ATOM   6215 N  N   . PRO B  1 415 ? 36.857  83.125  18.426  1.00 66.06  ? 415 PRO B N   1 
ATOM   6216 C  CA  . PRO B  1 415 ? 37.749  83.644  17.383  1.00 63.31  ? 415 PRO B CA  1 
ATOM   6217 C  C   . PRO B  1 415 ? 37.107  83.636  15.993  1.00 62.04  ? 415 PRO B C   1 
ATOM   6218 O  O   . PRO B  1 415 ? 36.481  82.646  15.606  1.00 57.90  ? 415 PRO B O   1 
ATOM   6219 C  CB  . PRO B  1 415 ? 38.959  82.690  17.425  1.00 60.15  ? 415 PRO B CB  1 
ATOM   6220 C  CG  . PRO B  1 415 ? 38.582  81.575  18.336  1.00 61.14  ? 415 PRO B CG  1 
ATOM   6221 C  CD  . PRO B  1 415 ? 37.540  82.117  19.255  1.00 62.60  ? 415 PRO B CD  1 
ATOM   6222 N  N   . HIS B  1 416 ? 37.277  84.740  15.271  1.00 63.35  ? 416 HIS B N   1 
ATOM   6223 C  CA  . HIS B  1 416 ? 36.649  84.955  13.957  1.00 65.65  ? 416 HIS B CA  1 
ATOM   6224 C  C   . HIS B  1 416 ? 37.693  85.404  12.921  1.00 63.20  ? 416 HIS B C   1 
ATOM   6225 O  O   . HIS B  1 416 ? 37.416  86.250  12.065  1.00 57.81  ? 416 HIS B O   1 
ATOM   6226 C  CB  . HIS B  1 416 ? 35.502  85.980  14.074  1.00 72.01  ? 416 HIS B CB  1 
ATOM   6227 C  CG  . HIS B  1 416 ? 35.869  87.207  14.848  1.00 80.27  ? 416 HIS B CG  1 
ATOM   6228 N  ND1 . HIS B  1 416 ? 35.220  87.582  16.006  1.00 86.72  ? 416 HIS B ND1 1 
ATOM   6229 C  CD2 . HIS B  1 416 ? 36.833  88.130  14.644  1.00 91.77  ? 416 HIS B CD2 1 
ATOM   6230 C  CE1 . HIS B  1 416 ? 35.802  88.664  16.490  1.00 95.24  ? 416 HIS B CE1 1 
ATOM   6231 N  NE2 . HIS B  1 416 ? 36.655  89.104  15.588  1.00 102.81 ? 416 HIS B NE2 1 
ATOM   6232 N  N   . GLU B  1 417 ? 38.886  84.815  13.000  1.00 63.02  ? 417 GLU B N   1 
ATOM   6233 C  CA  . GLU B  1 417 ? 39.991  85.128  12.088  1.00 66.29  ? 417 GLU B CA  1 
ATOM   6234 C  C   . GLU B  1 417 ? 39.970  84.142  10.905  1.00 64.89  ? 417 GLU B C   1 
ATOM   6235 O  O   . GLU B  1 417 ? 40.067  82.933  11.128  1.00 65.52  ? 417 GLU B O   1 
ATOM   6236 C  CB  . GLU B  1 417 ? 41.325  85.033  12.846  1.00 71.32  ? 417 GLU B CB  1 
ATOM   6237 C  CG  . GLU B  1 417 ? 42.559  85.528  12.093  1.00 79.96  ? 417 GLU B CG  1 
ATOM   6238 C  CD  . GLU B  1 417 ? 42.528  87.015  11.778  1.00 88.07  ? 417 GLU B CD  1 
ATOM   6239 O  OE1 . GLU B  1 417 ? 42.217  87.819  12.683  1.00 90.85  ? 417 GLU B OE1 1 
ATOM   6240 O  OE2 . GLU B  1 417 ? 42.827  87.383  10.621  1.00 86.71  ? 417 GLU B OE2 1 
ATOM   6241 N  N   . PRO B  1 418 ? 39.833  84.642  9.650   1.00 68.43  ? 418 PRO B N   1 
ATOM   6242 C  CA  . PRO B  1 418 ? 39.837  83.723  8.490   1.00 71.27  ? 418 PRO B CA  1 
ATOM   6243 C  C   . PRO B  1 418 ? 41.177  83.012  8.226   1.00 74.34  ? 418 PRO B C   1 
ATOM   6244 O  O   . PRO B  1 418 ? 41.197  81.962  7.580   1.00 75.56  ? 418 PRO B O   1 
ATOM   6245 C  CB  . PRO B  1 418 ? 39.455  84.627  7.307   1.00 66.05  ? 418 PRO B CB  1 
ATOM   6246 C  CG  . PRO B  1 418 ? 39.763  86.011  7.746   1.00 63.27  ? 418 PRO B CG  1 
ATOM   6247 C  CD  . PRO B  1 418 ? 39.601  86.041  9.237   1.00 66.37  ? 418 PRO B CD  1 
ATOM   6248 N  N   . SER B  1 419 ? 42.272  83.597  8.707   1.00 75.32  ? 419 SER B N   1 
ATOM   6249 C  CA  . SER B  1 419 ? 43.595  82.970  8.676   1.00 73.09  ? 419 SER B CA  1 
ATOM   6250 C  C   . SER B  1 419 ? 43.691  81.696  9.530   1.00 68.93  ? 419 SER B C   1 
ATOM   6251 O  O   . SER B  1 419 ? 44.440  80.779  9.185   1.00 67.41  ? 419 SER B O   1 
ATOM   6252 C  CB  . SER B  1 419 ? 44.653  83.979  9.135   1.00 76.84  ? 419 SER B CB  1 
ATOM   6253 O  OG  . SER B  1 419 ? 45.965  83.484  8.924   1.00 82.52  ? 419 SER B OG  1 
ATOM   6254 N  N   . LYS B  1 420 ? 42.943  81.653  10.636  1.00 69.71  ? 420 LYS B N   1 
ATOM   6255 C  CA  . LYS B  1 420 ? 42.942  80.511  11.568  1.00 72.08  ? 420 LYS B CA  1 
ATOM   6256 C  C   . LYS B  1 420 ? 41.519  80.000  11.835  1.00 75.99  ? 420 LYS B C   1 
ATOM   6257 O  O   . LYS B  1 420 ? 40.855  80.447  12.776  1.00 83.76  ? 420 LYS B O   1 
ATOM   6258 C  CB  . LYS B  1 420 ? 43.628  80.912  12.879  1.00 70.30  ? 420 LYS B CB  1 
ATOM   6259 C  CG  . LYS B  1 420 ? 45.137  81.071  12.743  1.00 73.75  ? 420 LYS B CG  1 
ATOM   6260 C  CD  . LYS B  1 420 ? 45.729  82.041  13.755  1.00 73.69  ? 420 LYS B CD  1 
ATOM   6261 C  CE  . LYS B  1 420 ? 47.166  82.387  13.394  1.00 73.35  ? 420 LYS B CE  1 
ATOM   6262 N  NZ  . LYS B  1 420 ? 47.745  83.448  14.263  1.00 75.67  ? 420 LYS B NZ  1 
ATOM   6263 N  N   . LEU B  1 421 ? 41.071  79.056  11.007  1.00 71.94  ? 421 LEU B N   1 
ATOM   6264 C  CA  . LEU B  1 421 ? 39.694  78.533  11.063  1.00 71.45  ? 421 LEU B CA  1 
ATOM   6265 C  C   . LEU B  1 421 ? 39.488  77.386  12.062  1.00 70.61  ? 421 LEU B C   1 
ATOM   6266 O  O   . LEU B  1 421 ? 38.356  77.129  12.475  1.00 73.99  ? 421 LEU B O   1 
ATOM   6267 C  CB  . LEU B  1 421 ? 39.239  78.077  9.671   1.00 67.37  ? 421 LEU B CB  1 
ATOM   6268 C  CG  . LEU B  1 421 ? 39.217  79.127  8.551   1.00 66.76  ? 421 LEU B CG  1 
ATOM   6269 C  CD1 . LEU B  1 421 ? 38.947  78.446  7.219   1.00 63.56  ? 421 LEU B CD1 1 
ATOM   6270 C  CD2 . LEU B  1 421 ? 38.189  80.224  8.795   1.00 66.21  ? 421 LEU B CD2 1 
ATOM   6271 N  N   . SER B  1 422 ? 40.566  76.696  12.433  1.00 68.82  ? 422 SER B N   1 
ATOM   6272 C  CA  . SER B  1 422 ? 40.500  75.587  13.395  1.00 72.46  ? 422 SER B CA  1 
ATOM   6273 C  C   . SER B  1 422 ? 40.091  76.038  14.803  1.00 73.95  ? 422 SER B C   1 
ATOM   6274 O  O   . SER B  1 422 ? 39.362  75.323  15.493  1.00 64.72  ? 422 SER B O   1 
ATOM   6275 C  CB  . SER B  1 422 ? 41.843  74.855  13.452  1.00 76.81  ? 422 SER B CB  1 
ATOM   6276 O  OG  . SER B  1 422 ? 42.143  74.244  12.209  1.00 79.22  ? 422 SER B OG  1 
ATOM   6277 N  N   . ASP B  1 423 ? 40.569  77.209  15.221  1.00 82.93  ? 423 ASP B N   1 
ATOM   6278 C  CA  . ASP B  1 423 ? 40.191  77.804  16.514  1.00 83.86  ? 423 ASP B CA  1 
ATOM   6279 C  C   . ASP B  1 423 ? 38.715  78.229  16.559  1.00 74.57  ? 423 ASP B C   1 
ATOM   6280 O  O   . ASP B  1 423 ? 38.083  78.174  17.617  1.00 69.09  ? 423 ASP B O   1 
ATOM   6281 C  CB  . ASP B  1 423 ? 41.090  79.007  16.839  1.00 87.48  ? 423 ASP B CB  1 
ATOM   6282 C  CG  . ASP B  1 423 ? 42.498  78.600  17.263  1.00 83.70  ? 423 ASP B CG  1 
ATOM   6283 O  OD1 . ASP B  1 423 ? 42.958  77.502  16.881  1.00 84.40  ? 423 ASP B OD1 1 
ATOM   6284 O  OD2 . ASP B  1 423 ? 43.149  79.390  17.980  1.00 76.62  ? 423 ASP B OD2 1 
ATOM   6285 N  N   . ALA B  1 424 ? 38.187  78.652  15.410  1.00 68.68  ? 424 ALA B N   1 
ATOM   6286 C  CA  . ALA B  1 424 ? 36.784  79.057  15.279  1.00 63.29  ? 424 ALA B CA  1 
ATOM   6287 C  C   . ALA B  1 424 ? 35.834  77.873  15.418  1.00 62.76  ? 424 ALA B C   1 
ATOM   6288 O  O   . ALA B  1 424 ? 34.891  77.925  16.211  1.00 63.29  ? 424 ALA B O   1 
ATOM   6289 C  CB  . ALA B  1 424 ? 36.557  79.746  13.944  1.00 62.56  ? 424 ALA B CB  1 
ATOM   6290 N  N   . VAL B  1 425 ? 36.085  76.820  14.641  0.91 60.55  ? 425 VAL B N   1 
ATOM   6291 C  CA  . VAL B  1 425 ? 35.240  75.617  14.671  0.91 63.95  ? 425 VAL B CA  1 
ATOM   6292 C  C   . VAL B  1 425 ? 35.326  74.870  16.013  0.91 64.85  ? 425 VAL B C   1 
ATOM   6293 O  O   . VAL B  1 425 ? 34.325  74.330  16.477  0.91 67.06  ? 425 VAL B O   1 
ATOM   6294 C  CB  . VAL B  1 425 ? 35.520  74.665  13.474  0.91 67.39  ? 425 VAL B CB  1 
ATOM   6295 C  CG1 . VAL B  1 425 ? 36.839  73.914  13.631  0.91 71.84  ? 425 VAL B CG1 1 
ATOM   6296 C  CG2 . VAL B  1 425 ? 34.363  73.692  13.280  0.91 67.94  ? 425 VAL B CG2 1 
ATOM   6297 N  N   . GLU B  1 426 ? 36.514  74.849  16.621  1.00 68.64  ? 426 GLU B N   1 
ATOM   6298 C  CA  . GLU B  1 426 ? 36.715  74.244  17.950  1.00 70.68  ? 426 GLU B CA  1 
ATOM   6299 C  C   . GLU B  1 426 ? 35.926  74.968  19.039  1.00 65.34  ? 426 GLU B C   1 
ATOM   6300 O  O   . GLU B  1 426 ? 35.223  74.335  19.830  1.00 63.83  ? 426 GLU B O   1 
ATOM   6301 C  CB  . GLU B  1 426 ? 38.200  74.231  18.334  1.00 75.12  ? 426 GLU B CB  1 
ATOM   6302 C  CG  . GLU B  1 426 ? 38.977  73.040  17.787  1.00 75.79  ? 426 GLU B CG  1 
ATOM   6303 C  CD  . GLU B  1 426 ? 40.427  73.002  18.245  1.00 74.52  ? 426 GLU B CD  1 
ATOM   6304 O  OE1 . GLU B  1 426 ? 40.728  73.450  19.374  1.00 75.66  ? 426 GLU B OE1 1 
ATOM   6305 O  OE2 . GLU B  1 426 ? 41.275  72.506  17.473  1.00 71.39  ? 426 GLU B OE2 1 
ATOM   6306 N  N   . CYS B  1 427 ? 36.072  76.292  19.077  1.00 63.85  ? 427 CYS B N   1 
ATOM   6307 C  CA  . CYS B  1 427 ? 35.342  77.141  20.024  1.00 65.38  ? 427 CYS B CA  1 
ATOM   6308 C  C   . CYS B  1 427 ? 33.832  77.028  19.834  1.00 65.69  ? 427 CYS B C   1 
ATOM   6309 O  O   . CYS B  1 427 ? 33.088  76.943  20.812  1.00 66.33  ? 427 CYS B O   1 
ATOM   6310 C  CB  . CYS B  1 427 ? 35.769  78.604  19.875  1.00 67.07  ? 427 CYS B CB  1 
ATOM   6311 S  SG  . CYS B  1 427 ? 35.017  79.732  21.079  1.00 72.60  ? 427 CYS B SG  1 
ATOM   6312 N  N   . LEU B  1 428 ? 33.394  77.026  18.575  1.00 65.36  ? 428 LEU B N   1 
ATOM   6313 C  CA  . LEU B  1 428 ? 31.973  76.865  18.234  1.00 62.44  ? 428 LEU B CA  1 
ATOM   6314 C  C   . LEU B  1 428 ? 31.408  75.506  18.656  1.00 54.43  ? 428 LEU B C   1 
ATOM   6315 O  O   . LEU B  1 428 ? 30.251  75.428  19.064  1.00 50.12  ? 428 LEU B O   1 
ATOM   6316 C  CB  . LEU B  1 428 ? 31.731  77.098  16.733  1.00 64.88  ? 428 LEU B CB  1 
ATOM   6317 C  CG  . LEU B  1 428 ? 31.560  78.563  16.307  1.00 68.07  ? 428 LEU B CG  1 
ATOM   6318 C  CD1 . LEU B  1 428 ? 31.759  78.728  14.807  1.00 69.29  ? 428 LEU B CD1 1 
ATOM   6319 C  CD2 . LEU B  1 428 ? 30.198  79.115  16.713  1.00 69.54  ? 428 LEU B CD2 1 
ATOM   6320 N  N   . ARG B  1 429 ? 32.219  74.453  18.553  1.00 58.93  ? 429 ARG B N   1 
ATOM   6321 C  CA  . ARG B  1 429 ? 31.832  73.111  19.029  1.00 62.05  ? 429 ARG B CA  1 
ATOM   6322 C  C   . ARG B  1 429 ? 31.619  73.047  20.550  1.00 62.84  ? 429 ARG B C   1 
ATOM   6323 O  O   . ARG B  1 429 ? 30.824  72.239  21.034  1.00 62.51  ? 429 ARG B O   1 
ATOM   6324 C  CB  . ARG B  1 429 ? 32.861  72.049  18.598  1.00 59.55  ? 429 ARG B CB  1 
ATOM   6325 C  CG  . ARG B  1 429 ? 32.697  71.565  17.161  1.00 58.44  ? 429 ARG B CG  1 
ATOM   6326 C  CD  . ARG B  1 429 ? 33.350  70.211  16.932  1.00 56.89  ? 429 ARG B CD  1 
ATOM   6327 N  NE  . ARG B  1 429 ? 34.783  70.210  17.236  1.00 54.09  ? 429 ARG B NE  1 
ATOM   6328 C  CZ  . ARG B  1 429 ? 35.769  70.458  16.370  1.00 52.04  ? 429 ARG B CZ  1 
ATOM   6329 N  NH1 . ARG B  1 429 ? 35.527  70.747  15.090  1.00 54.68  ? 429 ARG B NH1 1 
ATOM   6330 N  NH2 . ARG B  1 429 ? 37.030  70.416  16.795  1.00 49.92  ? 429 ARG B NH2 1 
ATOM   6331 N  N   . GLY B  1 430 ? 32.334  73.897  21.286  1.00 61.43  ? 430 GLY B N   1 
ATOM   6332 C  CA  . GLY B  1 430 ? 32.216  73.988  22.745  1.00 60.42  ? 430 GLY B CA  1 
ATOM   6333 C  C   . GLY B  1 430 ? 30.983  74.701  23.285  1.00 55.71  ? 430 GLY B C   1 
ATOM   6334 O  O   . GLY B  1 430 ? 30.502  74.362  24.368  1.00 57.93  ? 430 GLY B O   1 
ATOM   6335 N  N   . LYS B  1 431 ? 30.481  75.689  22.544  1.00 53.70  ? 431 LYS B N   1 
ATOM   6336 C  CA  . LYS B  1 431 ? 29.333  76.497  22.984  1.00 54.98  ? 431 LYS B CA  1 
ATOM   6337 C  C   . LYS B  1 431 ? 28.011  75.724  22.971  1.00 56.28  ? 431 LYS B C   1 
ATOM   6338 O  O   . LYS B  1 431 ? 27.874  74.710  22.285  1.00 57.75  ? 431 LYS B O   1 
ATOM   6339 C  CB  . LYS B  1 431 ? 29.205  77.761  22.127  1.00 53.25  ? 431 LYS B CB  1 
ATOM   6340 C  CG  . LYS B  1 431 ? 30.406  78.696  22.202  1.00 52.50  ? 431 LYS B CG  1 
ATOM   6341 C  CD  . LYS B  1 431 ? 30.502  79.415  23.539  1.00 56.19  ? 431 LYS B CD  1 
ATOM   6342 C  CE  . LYS B  1 431 ? 31.711  80.334  23.583  1.00 53.98  ? 431 LYS B CE  1 
ATOM   6343 N  NZ  . LYS B  1 431 ? 31.868  80.998  24.906  1.00 48.80  ? 431 LYS B NZ  1 
ATOM   6344 N  N   . ASP B  1 432 ? 27.051  76.226  23.746  1.00 61.01  ? 432 ASP B N   1 
ATOM   6345 C  CA  . ASP B  1 432 ? 25.726  75.615  23.893  1.00 55.48  ? 432 ASP B CA  1 
ATOM   6346 C  C   . ASP B  1 432 ? 24.972  75.689  22.558  1.00 55.70  ? 432 ASP B C   1 
ATOM   6347 O  O   . ASP B  1 432 ? 25.065  76.706  21.866  1.00 55.05  ? 432 ASP B O   1 
ATOM   6348 C  CB  . ASP B  1 432 ? 24.950  76.351  24.996  1.00 56.95  ? 432 ASP B CB  1 
ATOM   6349 C  CG  . ASP B  1 432 ? 23.601  75.717  25.302  1.00 56.20  ? 432 ASP B CG  1 
ATOM   6350 O  OD1 . ASP B  1 432 ? 22.631  75.981  24.562  1.00 53.38  ? 432 ASP B OD1 1 
ATOM   6351 O  OD2 . ASP B  1 432 ? 23.507  74.968  26.296  1.00 56.22  ? 432 ASP B OD2 1 
ATOM   6352 N  N   . PRO B  1 433 ? 24.241  74.616  22.181  1.00 54.94  ? 433 PRO B N   1 
ATOM   6353 C  CA  . PRO B  1 433 ? 23.558  74.613  20.874  1.00 57.20  ? 433 PRO B CA  1 
ATOM   6354 C  C   . PRO B  1 433 ? 22.453  75.672  20.696  1.00 57.52  ? 433 PRO B C   1 
ATOM   6355 O  O   . PRO B  1 433 ? 22.223  76.126  19.572  1.00 54.65  ? 433 PRO B O   1 
ATOM   6356 C  CB  . PRO B  1 433 ? 22.980  73.192  20.783  1.00 54.95  ? 433 PRO B CB  1 
ATOM   6357 C  CG  . PRO B  1 433 ? 22.889  72.719  22.190  1.00 52.53  ? 433 PRO B CG  1 
ATOM   6358 C  CD  . PRO B  1 433 ? 24.080  73.320  22.868  1.00 53.46  ? 433 PRO B CD  1 
ATOM   6359 N  N   . HIS B  1 434 ? 21.791  76.054  21.787  1.00 57.82  ? 434 HIS B N   1 
ATOM   6360 C  CA  . HIS B  1 434 ? 20.740  77.080  21.750  1.00 54.41  ? 434 HIS B CA  1 
ATOM   6361 C  C   . HIS B  1 434 ? 21.294  78.495  21.588  1.00 54.81  ? 434 HIS B C   1 
ATOM   6362 O  O   . HIS B  1 434 ? 20.646  79.342  20.972  1.00 58.50  ? 434 HIS B O   1 
ATOM   6363 C  CB  . HIS B  1 434 ? 19.849  76.993  22.990  1.00 49.95  ? 434 HIS B CB  1 
ATOM   6364 C  CG  . HIS B  1 434 ? 19.023  75.746  23.039  1.00 44.24  ? 434 HIS B CG  1 
ATOM   6365 N  ND1 . HIS B  1 434 ? 19.407  74.627  23.744  1.00 41.83  ? 434 HIS B ND1 1 
ATOM   6366 C  CD2 . HIS B  1 434 ? 17.846  75.434  22.448  1.00 40.87  ? 434 HIS B CD2 1 
ATOM   6367 C  CE1 . HIS B  1 434 ? 18.495  73.683  23.597  1.00 42.87  ? 434 HIS B CE1 1 
ATOM   6368 N  NE2 . HIS B  1 434 ? 17.537  74.148  22.815  1.00 42.01  ? 434 HIS B NE2 1 
ATOM   6369 N  N   . VAL B  1 435 ? 22.477  78.745  22.149  1.00 52.61  ? 435 VAL B N   1 
ATOM   6370 C  CA  . VAL B  1 435 ? 23.201  80.007  21.940  1.00 51.42  ? 435 VAL B CA  1 
ATOM   6371 C  C   . VAL B  1 435 ? 23.482  80.208  20.448  1.00 53.55  ? 435 VAL B C   1 
ATOM   6372 O  O   . VAL B  1 435 ? 23.267  81.297  19.911  1.00 54.81  ? 435 VAL B O   1 
ATOM   6373 C  CB  . VAL B  1 435 ? 24.528  80.041  22.743  1.00 48.98  ? 435 VAL B CB  1 
ATOM   6374 C  CG1 . VAL B  1 435 ? 25.417  81.213  22.333  1.00 46.79  ? 435 VAL B CG1 1 
ATOM   6375 C  CG2 . VAL B  1 435 ? 24.238  80.113  24.234  1.00 48.52  ? 435 VAL B CG2 1 
ATOM   6376 N  N   . LEU B  1 436 ? 23.967  79.149  19.802  1.00 50.69  ? 436 LEU B N   1 
ATOM   6377 C  CA  . LEU B  1 436 ? 24.289  79.168  18.369  1.00 52.06  ? 436 LEU B CA  1 
ATOM   6378 C  C   . LEU B  1 436 ? 23.101  79.568  17.486  1.00 58.15  ? 436 LEU B C   1 
ATOM   6379 O  O   . LEU B  1 436 ? 23.211  80.503  16.694  1.00 63.33  ? 436 LEU B O   1 
ATOM   6380 C  CB  . LEU B  1 436 ? 24.873  77.816  17.921  1.00 49.55  ? 436 LEU B CB  1 
ATOM   6381 C  CG  . LEU B  1 436 ? 26.405  77.689  17.936  1.00 48.78  ? 436 LEU B CG  1 
ATOM   6382 C  CD1 . LEU B  1 436 ? 27.058  78.184  19.222  1.00 49.22  ? 436 LEU B CD1 1 
ATOM   6383 C  CD2 . LEU B  1 436 ? 26.806  76.246  17.683  1.00 46.63  ? 436 LEU B CD2 1 
ATOM   6384 N  N   . VAL B  1 437 ? 21.981  78.865  17.636  1.00 56.01  ? 437 VAL B N   1 
ATOM   6385 C  CA  . VAL B  1 437 ? 20.789  79.106  16.796  1.00 55.11  ? 437 VAL B CA  1 
ATOM   6386 C  C   . VAL B  1 437 ? 20.132  80.476  17.027  1.00 54.56  ? 437 VAL B C   1 
ATOM   6387 O  O   . VAL B  1 437 ? 19.606  81.078  16.087  1.00 56.38  ? 437 VAL B O   1 
ATOM   6388 C  CB  . VAL B  1 437 ? 19.729  77.976  16.911  1.00 58.39  ? 437 VAL B CB  1 
ATOM   6389 C  CG1 . VAL B  1 437 ? 20.320  76.651  16.452  1.00 60.85  ? 437 VAL B CG1 1 
ATOM   6390 C  CG2 . VAL B  1 437 ? 19.157  77.853  18.320  1.00 61.63  ? 437 VAL B CG2 1 
ATOM   6391 N  N   . ASN B  1 438 ? 20.183  80.959  18.268  1.00 54.84  ? 438 ASN B N   1 
ATOM   6392 C  CA  . ASN B  1 438 ? 19.587  82.250  18.646  1.00 50.90  ? 438 ASN B CA  1 
ATOM   6393 C  C   . ASN B  1 438 ? 20.480  83.483  18.392  1.00 50.08  ? 438 ASN B C   1 
ATOM   6394 O  O   . ASN B  1 438 ? 20.076  84.604  18.713  1.00 51.83  ? 438 ASN B O   1 
ATOM   6395 C  CB  . ASN B  1 438 ? 19.130  82.207  20.115  1.00 49.81  ? 438 ASN B CB  1 
ATOM   6396 C  CG  . ASN B  1 438 ? 17.835  81.432  20.301  1.00 51.42  ? 438 ASN B CG  1 
ATOM   6397 O  OD1 . ASN B  1 438 ? 16.754  81.918  19.963  1.00 48.78  ? 438 ASN B OD1 1 
ATOM   6398 N  ND2 . ASN B  1 438 ? 17.935  80.227  20.852  1.00 46.73  ? 438 ASN B ND2 1 
ATOM   6399 N  N   . ASN B  1 439 ? 21.675  83.286  17.822  1.00 51.59  ? 439 ASN B N   1 
ATOM   6400 C  CA  . ASN B  1 439 ? 22.539  84.405  17.388  1.00 50.38  ? 439 ASN B CA  1 
ATOM   6401 C  C   . ASN B  1 439 ? 23.011  84.284  15.921  1.00 47.75  ? 439 ASN B C   1 
ATOM   6402 O  O   . ASN B  1 439 ? 24.146  84.642  15.591  1.00 44.41  ? 439 ASN B O   1 
ATOM   6403 C  CB  . ASN B  1 439 ? 23.741  84.547  18.337  1.00 50.08  ? 439 ASN B CB  1 
ATOM   6404 C  CG  . ASN B  1 439 ? 23.326  84.781  19.782  1.00 47.37  ? 439 ASN B CG  1 
ATOM   6405 O  OD1 . ASN B  1 439 ? 23.829  84.124  20.693  1.00 45.95  ? 439 ASN B OD1 1 
ATOM   6406 N  ND2 . ASN B  1 439 ? 22.411  85.720  19.997  1.00 48.07  ? 439 ASN B ND2 1 
ATOM   6407 N  N   . GLU B  1 440 ? 22.123  83.793  15.053  1.00 57.75  ? 440 GLU B N   1 
ATOM   6408 C  CA  . GLU B  1 440 ? 22.359  83.714  13.595  1.00 63.56  ? 440 GLU B CA  1 
ATOM   6409 C  C   . GLU B  1 440 ? 21.775  84.891  12.803  1.00 69.29  ? 440 GLU B C   1 
ATOM   6410 O  O   . GLU B  1 440 ? 22.282  85.230  11.729  1.00 68.47  ? 440 GLU B O   1 
ATOM   6411 C  CB  . GLU B  1 440 ? 21.749  82.429  13.026  1.00 65.61  ? 440 GLU B CB  1 
ATOM   6412 C  CG  . GLU B  1 440 ? 22.219  81.150  13.694  1.00 67.75  ? 440 GLU B CG  1 
ATOM   6413 C  CD  . GLU B  1 440 ? 21.662  79.892  13.052  1.00 65.01  ? 440 GLU B CD  1 
ATOM   6414 O  OE1 . GLU B  1 440 ? 22.127  78.796  13.427  1.00 55.20  ? 440 GLU B OE1 1 
ATOM   6415 O  OE2 . GLU B  1 440 ? 20.769  79.984  12.180  1.00 63.03  ? 440 GLU B OE2 1 
ATOM   6416 N  N   . TRP B  1 441 ? 20.713  85.497  13.333  1.00 71.04  ? 441 TRP B N   1 
ATOM   6417 C  CA  . TRP B  1 441 ? 19.888  86.465  12.601  1.00 70.35  ? 441 TRP B CA  1 
ATOM   6418 C  C   . TRP B  1 441 ? 20.320  87.917  12.833  1.00 69.45  ? 441 TRP B C   1 
ATOM   6419 O  O   . TRP B  1 441 ? 19.689  88.657  13.595  1.00 69.49  ? 441 TRP B O   1 
ATOM   6420 C  CB  . TRP B  1 441 ? 18.418  86.276  12.991  1.00 72.29  ? 441 TRP B CB  1 
ATOM   6421 C  CG  . TRP B  1 441 ? 17.915  84.887  12.752  1.00 67.62  ? 441 TRP B CG  1 
ATOM   6422 C  CD1 . TRP B  1 441 ? 18.021  83.821  13.598  1.00 68.80  ? 441 TRP B CD1 1 
ATOM   6423 C  CD2 . TRP B  1 441 ? 17.228  84.410  11.591  1.00 63.33  ? 441 TRP B CD2 1 
ATOM   6424 N  NE1 . TRP B  1 441 ? 17.444  82.710  13.036  1.00 68.41  ? 441 TRP B NE1 1 
ATOM   6425 C  CE2 . TRP B  1 441 ? 16.949  83.043  11.804  1.00 62.44  ? 441 TRP B CE2 1 
ATOM   6426 C  CE3 . TRP B  1 441 ? 16.821  85.006  10.389  1.00 68.78  ? 441 TRP B CE3 1 
ATOM   6427 C  CZ2 . TRP B  1 441 ? 16.279  82.260  10.862  1.00 61.71  ? 441 TRP B CZ2 1 
ATOM   6428 C  CZ3 . TRP B  1 441 ? 16.153  84.224  9.448   1.00 69.32  ? 441 TRP B CZ3 1 
ATOM   6429 C  CH2 . TRP B  1 441 ? 15.890  82.864  9.693   1.00 66.39  ? 441 TRP B CH2 1 
ATOM   6430 N  N   . GLY B  1 442 ? 21.397  88.314  12.159  1.00 72.38  ? 442 GLY B N   1 
ATOM   6431 C  CA  . GLY B  1 442 ? 21.920  89.682  12.247  1.00 79.56  ? 442 GLY B CA  1 
ATOM   6432 C  C   . GLY B  1 442 ? 21.104  90.674  11.435  1.00 84.22  ? 442 GLY B C   1 
ATOM   6433 O  O   . GLY B  1 442 ? 20.030  91.100  11.867  1.00 80.63  ? 442 GLY B O   1 
ATOM   6434 N  N   . THR B  1 443 ? 21.627  91.046  10.264  1.00 83.82  ? 443 THR B N   1 
ATOM   6435 C  CA  . THR B  1 443 ? 20.936  91.930  9.316   1.00 89.39  ? 443 THR B CA  1 
ATOM   6436 C  C   . THR B  1 443 ? 20.794  91.219  7.971   1.00 80.89  ? 443 THR B C   1 
ATOM   6437 O  O   . THR B  1 443 ? 21.566  91.455  7.034   1.00 70.33  ? 443 THR B O   1 
ATOM   6438 C  CB  . THR B  1 443 ? 21.655  93.289  9.140   1.00 98.15  ? 443 THR B CB  1 
ATOM   6439 O  OG1 . THR B  1 443 ? 23.062  93.078  8.963   1.00 96.60  ? 443 THR B OG1 1 
ATOM   6440 C  CG2 . THR B  1 443 ? 21.422  94.184  10.354  1.00 101.17 ? 443 THR B CG2 1 
ATOM   6441 N  N   . LEU B  1 444 ? 19.800  90.335  7.910   1.00 77.83  ? 444 LEU B N   1 
ATOM   6442 C  CA  . LEU B  1 444 ? 19.477  89.565  6.709   1.00 75.67  ? 444 LEU B CA  1 
ATOM   6443 C  C   . LEU B  1 444 ? 18.097  89.958  6.190   1.00 71.15  ? 444 LEU B C   1 
ATOM   6444 O  O   . LEU B  1 444 ? 17.136  90.032  6.958   1.00 68.61  ? 444 LEU B O   1 
ATOM   6445 C  CB  . LEU B  1 444 ? 19.517  88.073  7.026   1.00 78.34  ? 444 LEU B CB  1 
ATOM   6446 C  CG  . LEU B  1 444 ? 20.923  87.536  7.333   1.00 76.88  ? 444 LEU B CG  1 
ATOM   6447 C  CD1 . LEU B  1 444 ? 20.884  86.428  8.374   1.00 77.92  ? 444 LEU B CD1 1 
ATOM   6448 C  CD2 . LEU B  1 444 ? 21.620  87.070  6.059   1.00 69.07  ? 444 LEU B CD2 1 
ATOM   6449 N  N   . GLY B  1 445 ? 18.012  90.208  4.884   1.00 66.23  ? 445 GLY B N   1 
ATOM   6450 C  CA  . GLY B  1 445 ? 16.780  90.680  4.243   1.00 66.40  ? 445 GLY B CA  1 
ATOM   6451 C  C   . GLY B  1 445 ? 15.675  89.644  4.131   1.00 66.79  ? 445 GLY B C   1 
ATOM   6452 O  O   . GLY B  1 445 ? 15.752  88.568  4.731   1.00 69.57  ? 445 GLY B O   1 
ATOM   6453 N  N   . ILE B  1 446 ? 14.638  89.982  3.363   1.00 69.78  ? 446 ILE B N   1 
ATOM   6454 C  CA  . ILE B  1 446 ? 13.480  89.093  3.191   1.00 65.95  ? 446 ILE B CA  1 
ATOM   6455 C  C   . ILE B  1 446 ? 13.866  87.837  2.408   1.00 64.54  ? 446 ILE B C   1 
ATOM   6456 O  O   . ILE B  1 446 ? 14.647  87.909  1.455   1.00 71.30  ? 446 ILE B O   1 
ATOM   6457 C  CB  . ILE B  1 446 ? 12.254  89.787  2.527   1.00 64.16  ? 446 ILE B CB  1 
ATOM   6458 C  CG1 . ILE B  1 446 ? 11.041  88.842  2.546   1.00 63.48  ? 446 ILE B CG1 1 
ATOM   6459 C  CG2 . ILE B  1 446 ? 12.551  90.250  1.099   1.00 61.62  ? 446 ILE B CG2 1 
ATOM   6460 C  CD1 . ILE B  1 446 ? 9.704   89.530  2.402   1.00 65.43  ? 446 ILE B CD1 1 
ATOM   6461 N  N   . CYS B  1 447 ? 13.312  86.701  2.831   1.00 61.53  ? 447 CYS B N   1 
ATOM   6462 C  CA  . CYS B  1 447 ? 13.512  85.402  2.175   1.00 59.30  ? 447 CYS B CA  1 
ATOM   6463 C  C   . CYS B  1 447 ? 14.986  85.119  1.842   1.00 53.77  ? 447 CYS B C   1 
ATOM   6464 O  O   . CYS B  1 447 ? 15.334  84.811  0.701   1.00 55.13  ? 447 CYS B O   1 
ATOM   6465 C  CB  . CYS B  1 447 ? 12.632  85.305  0.922   1.00 59.40  ? 447 CYS B CB  1 
ATOM   6466 S  SG  . CYS B  1 447 ? 10.855  85.358  1.251   1.00 61.04  ? 447 CYS B SG  1 
ATOM   6467 N  N   . GLU B  1 448 ? 15.844  85.283  2.845   1.00 54.59  ? 448 GLU B N   1 
ATOM   6468 C  CA  . GLU B  1 448 ? 17.239  84.843  2.774   1.00 57.03  ? 448 GLU B CA  1 
ATOM   6469 C  C   . GLU B  1 448 ? 17.699  84.432  4.168   1.00 58.75  ? 448 GLU B C   1 
ATOM   6470 O  O   . GLU B  1 448 ? 17.720  85.244  5.097   1.00 52.19  ? 448 GLU B O   1 
ATOM   6471 C  CB  . GLU B  1 448 ? 18.158  85.905  2.157   1.00 58.55  ? 448 GLU B CB  1 
ATOM   6472 C  CG  . GLU B  1 448 ? 18.084  87.302  2.754   1.00 58.96  ? 448 GLU B CG  1 
ATOM   6473 C  CD  . GLU B  1 448 ? 18.936  88.310  1.996   1.00 64.69  ? 448 GLU B CD  1 
ATOM   6474 O  OE1 . GLU B  1 448 ? 19.535  87.957  0.956   1.00 60.46  ? 448 GLU B OE1 1 
ATOM   6475 O  OE2 . GLU B  1 448 ? 19.014  89.471  2.444   1.00 70.25  ? 448 GLU B OE2 1 
ATOM   6476 N  N   . PHE B  1 449 ? 18.059  83.156  4.295   1.00 63.60  ? 449 PHE B N   1 
ATOM   6477 C  CA  . PHE B  1 449 ? 18.275  82.512  5.591   1.00 61.00  ? 449 PHE B CA  1 
ATOM   6478 C  C   . PHE B  1 449 ? 19.773  82.314  5.840   1.00 61.92  ? 449 PHE B C   1 
ATOM   6479 O  O   . PHE B  1 449 ? 20.517  82.021  4.899   1.00 63.82  ? 449 PHE B O   1 
ATOM   6480 C  CB  . PHE B  1 449 ? 17.525  81.180  5.634   1.00 59.39  ? 449 PHE B CB  1 
ATOM   6481 C  CG  . PHE B  1 449 ? 16.111  81.272  5.124   1.00 54.36  ? 449 PHE B CG  1 
ATOM   6482 C  CD1 . PHE B  1 449 ? 15.211  82.168  5.695   1.00 54.03  ? 449 PHE B CD1 1 
ATOM   6483 C  CD2 . PHE B  1 449 ? 15.679  80.477  4.066   1.00 51.29  ? 449 PHE B CD2 1 
ATOM   6484 C  CE1 . PHE B  1 449 ? 13.908  82.267  5.226   1.00 52.91  ? 449 PHE B CE1 1 
ATOM   6485 C  CE2 . PHE B  1 449 ? 14.377  80.570  3.596   1.00 52.35  ? 449 PHE B CE2 1 
ATOM   6486 C  CZ  . PHE B  1 449 ? 13.491  81.465  4.175   1.00 52.12  ? 449 PHE B CZ  1 
ATOM   6487 N  N   . PRO B  1 450 ? 20.218  82.467  7.107   1.00 66.42  ? 450 PRO B N   1 
ATOM   6488 C  CA  . PRO B  1 450 ? 21.650  82.568  7.434   1.00 65.07  ? 450 PRO B CA  1 
ATOM   6489 C  C   . PRO B  1 450 ? 22.490  81.325  7.126   1.00 65.01  ? 450 PRO B C   1 
ATOM   6490 O  O   . PRO B  1 450 ? 23.633  81.466  6.683   1.00 67.63  ? 450 PRO B O   1 
ATOM   6491 C  CB  . PRO B  1 450 ? 21.649  82.859  8.941   1.00 67.72  ? 450 PRO B CB  1 
ATOM   6492 C  CG  . PRO B  1 450 ? 20.368  82.297  9.439   1.00 73.12  ? 450 PRO B CG  1 
ATOM   6493 C  CD  . PRO B  1 450 ? 19.382  82.471  8.325   1.00 70.40  ? 450 PRO B CD  1 
ATOM   6494 N  N   . PHE B  1 451 ? 21.936  80.137  7.367   1.00 60.31  ? 451 PHE B N   1 
ATOM   6495 C  CA  . PHE B  1 451 ? 22.638  78.870  7.101   1.00 53.90  ? 451 PHE B CA  1 
ATOM   6496 C  C   . PHE B  1 451 ? 21.755  77.890  6.332   1.00 49.98  ? 451 PHE B C   1 
ATOM   6497 O  O   . PHE B  1 451 ? 20.760  77.378  6.850   1.00 52.26  ? 451 PHE B O   1 
ATOM   6498 C  CB  . PHE B  1 451 ? 23.161  78.260  8.398   1.00 50.66  ? 451 PHE B CB  1 
ATOM   6499 C  CG  . PHE B  1 451 ? 24.126  79.154  9.116   1.00 51.23  ? 451 PHE B CG  1 
ATOM   6500 C  CD1 . PHE B  1 451 ? 25.471  79.173  8.764   1.00 49.41  ? 451 PHE B CD1 1 
ATOM   6501 C  CD2 . PHE B  1 451 ? 23.681  80.020  10.109  1.00 51.08  ? 451 PHE B CD2 1 
ATOM   6502 C  CE1 . PHE B  1 451 ? 26.360  80.018  9.412   1.00 50.66  ? 451 PHE B CE1 1 
ATOM   6503 C  CE2 . PHE B  1 451 ? 24.566  80.866  10.762  1.00 51.08  ? 451 PHE B CE2 1 
ATOM   6504 C  CZ  . PHE B  1 451 ? 25.908  80.864  10.412  1.00 49.45  ? 451 PHE B CZ  1 
ATOM   6505 N  N   . VAL B  1 452 ? 22.156  77.654  5.085   1.00 49.76  ? 452 VAL B N   1 
ATOM   6506 C  CA  . VAL B  1 452 ? 21.402  76.892  4.089   1.00 49.24  ? 452 VAL B CA  1 
ATOM   6507 C  C   . VAL B  1 452 ? 22.423  76.059  3.303   1.00 46.04  ? 452 VAL B C   1 
ATOM   6508 O  O   . VAL B  1 452 ? 23.627  76.181  3.552   1.00 44.14  ? 452 VAL B O   1 
ATOM   6509 C  CB  . VAL B  1 452 ? 20.614  77.838  3.138   1.00 51.63  ? 452 VAL B CB  1 
ATOM   6510 C  CG1 . VAL B  1 452 ? 19.392  78.413  3.836   1.00 54.56  ? 452 VAL B CG1 1 
ATOM   6511 C  CG2 . VAL B  1 452 ? 21.489  78.963  2.596   1.00 52.26  ? 452 VAL B CG2 1 
ATOM   6512 N  N   . PRO B  1 453 ? 21.960  75.193  2.372   1.00 43.99  ? 453 PRO B N   1 
ATOM   6513 C  CA  . PRO B  1 453 ? 22.853  74.441  1.482   1.00 48.31  ? 453 PRO B CA  1 
ATOM   6514 C  C   . PRO B  1 453 ? 23.975  75.230  0.778   1.00 46.64  ? 453 PRO B C   1 
ATOM   6515 O  O   . PRO B  1 453 ? 23.923  76.460  0.676   1.00 48.94  ? 453 PRO B O   1 
ATOM   6516 C  CB  . PRO B  1 453 ? 21.884  73.870  0.446   1.00 49.76  ? 453 PRO B CB  1 
ATOM   6517 C  CG  . PRO B  1 453 ? 20.625  73.643  1.208   1.00 50.43  ? 453 PRO B CG  1 
ATOM   6518 C  CD  . PRO B  1 453 ? 20.603  74.611  2.359   1.00 47.81  ? 453 PRO B CD  1 
ATOM   6519 N  N   . VAL B  1 454 ? 24.971  74.492  0.294   1.00 41.83  ? 454 VAL B N   1 
ATOM   6520 C  CA  . VAL B  1 454 ? 26.140  75.063  -0.374  1.00 43.04  ? 454 VAL B CA  1 
ATOM   6521 C  C   . VAL B  1 454 ? 26.740  74.036  -1.343  1.00 43.78  ? 454 VAL B C   1 
ATOM   6522 O  O   . VAL B  1 454 ? 26.608  72.829  -1.135  1.00 43.40  ? 454 VAL B O   1 
ATOM   6523 C  CB  . VAL B  1 454 ? 27.188  75.557  0.662   1.00 41.83  ? 454 VAL B CB  1 
ATOM   6524 C  CG1 . VAL B  1 454 ? 28.023  74.415  1.233   1.00 43.08  ? 454 VAL B CG1 1 
ATOM   6525 C  CG2 . VAL B  1 454 ? 28.100  76.610  0.055   1.00 44.85  ? 454 VAL B CG2 1 
ATOM   6526 N  N   . VAL B  1 455 ? 27.393  74.522  -2.397  1.00 44.71  ? 455 VAL B N   1 
ATOM   6527 C  CA  . VAL B  1 455 ? 28.072  73.653  -3.368  1.00 43.60  ? 455 VAL B CA  1 
ATOM   6528 C  C   . VAL B  1 455 ? 29.413  73.228  -2.754  1.00 43.97  ? 455 VAL B C   1 
ATOM   6529 O  O   . VAL B  1 455 ? 30.342  74.034  -2.660  1.00 46.00  ? 455 VAL B O   1 
ATOM   6530 C  CB  . VAL B  1 455 ? 28.289  74.350  -4.735  1.00 44.38  ? 455 VAL B CB  1 
ATOM   6531 C  CG1 . VAL B  1 455 ? 28.870  73.376  -5.755  1.00 43.81  ? 455 VAL B CG1 1 
ATOM   6532 C  CG2 . VAL B  1 455 ? 26.982  74.919  -5.275  1.00 42.26  ? 455 VAL B CG2 1 
ATOM   6533 N  N   . ASP B  1 456 ? 29.498  71.959  -2.353  1.00 43.75  ? 456 ASP B N   1 
ATOM   6534 C  CA  . ASP B  1 456 ? 30.616  71.456  -1.526  1.00 42.34  ? 456 ASP B CA  1 
ATOM   6535 C  C   . ASP B  1 456 ? 31.723  70.735  -2.304  1.00 43.67  ? 456 ASP B C   1 
ATOM   6536 O  O   . ASP B  1 456 ? 32.907  70.983  -2.063  1.00 51.62  ? 456 ASP B O   1 
ATOM   6537 C  CB  . ASP B  1 456 ? 30.105  70.570  -0.372  1.00 44.61  ? 456 ASP B CB  1 
ATOM   6538 C  CG  . ASP B  1 456 ? 29.266  69.392  -0.842  1.00 44.67  ? 456 ASP B CG  1 
ATOM   6539 O  OD1 . ASP B  1 456 ? 28.346  69.607  -1.661  1.00 43.37  ? 456 ASP B OD1 1 
ATOM   6540 O  OD2 . ASP B  1 456 ? 29.524  68.254  -0.392  1.00 45.90  ? 456 ASP B OD2 1 
ATOM   6541 N  N   . GLY B  1 457 ? 31.335  69.854  -3.225  1.00 46.13  ? 457 GLY B N   1 
ATOM   6542 C  CA  . GLY B  1 457 ? 32.279  69.034  -3.997  1.00 42.62  ? 457 GLY B CA  1 
ATOM   6543 C  C   . GLY B  1 457 ? 31.921  67.556  -4.019  1.00 42.15  ? 457 GLY B C   1 
ATOM   6544 O  O   . GLY B  1 457 ? 32.278  66.843  -4.960  1.00 37.82  ? 457 GLY B O   1 
ATOM   6545 N  N   . ALA B  1 458 ? 31.226  67.101  -2.975  1.00 41.61  ? 458 ALA B N   1 
ATOM   6546 C  CA  . ALA B  1 458 ? 30.803  65.703  -2.834  1.00 41.71  ? 458 ALA B CA  1 
ATOM   6547 C  C   . ALA B  1 458 ? 29.313  65.524  -3.113  1.00 39.75  ? 458 ALA B C   1 
ATOM   6548 O  O   . ALA B  1 458 ? 28.933  64.756  -4.000  1.00 38.55  ? 458 ALA B O   1 
ATOM   6549 C  CB  . ALA B  1 458 ? 31.153  65.185  -1.447  1.00 44.01  ? 458 ALA B CB  1 
ATOM   6550 N  N   . PHE B  1 459 ? 28.481  66.223  -2.344  1.00 39.20  ? 459 PHE B N   1 
ATOM   6551 C  CA  . PHE B  1 459 ? 27.031  66.226  -2.564  1.00 42.59  ? 459 PHE B CA  1 
ATOM   6552 C  C   . PHE B  1 459 ? 26.682  66.961  -3.852  1.00 44.91  ? 459 PHE B C   1 
ATOM   6553 O  O   . PHE B  1 459 ? 25.919  66.455  -4.678  1.00 44.33  ? 459 PHE B O   1 
ATOM   6554 C  CB  . PHE B  1 459 ? 26.285  66.869  -1.392  1.00 43.14  ? 459 PHE B CB  1 
ATOM   6555 C  CG  . PHE B  1 459 ? 24.820  66.524  -1.358  1.00 47.55  ? 459 PHE B CG  1 
ATOM   6556 C  CD1 . PHE B  1 459 ? 24.406  65.251  -0.977  1.00 50.72  ? 459 PHE B CD1 1 
ATOM   6557 C  CD2 . PHE B  1 459 ? 23.852  67.456  -1.725  1.00 46.65  ? 459 PHE B CD2 1 
ATOM   6558 C  CE1 . PHE B  1 459 ? 23.058  64.916  -0.954  1.00 46.44  ? 459 PHE B CE1 1 
ATOM   6559 C  CE2 . PHE B  1 459 ? 22.503  67.127  -1.703  1.00 44.95  ? 459 PHE B CE2 1 
ATOM   6560 C  CZ  . PHE B  1 459 ? 22.105  65.855  -1.317  1.00 43.48  ? 459 PHE B CZ  1 
ATOM   6561 N  N   . LEU B  1 460 ? 27.240  68.161  -3.993  1.00 46.87  ? 460 LEU B N   1 
ATOM   6562 C  CA  . LEU B  1 460 ? 27.113  68.971  -5.206  1.00 47.74  ? 460 LEU B CA  1 
ATOM   6563 C  C   . LEU B  1 460 ? 28.482  69.536  -5.588  1.00 48.94  ? 460 LEU B C   1 
ATOM   6564 O  O   . LEU B  1 460 ? 29.117  70.213  -4.777  1.00 50.75  ? 460 LEU B O   1 
ATOM   6565 C  CB  . LEU B  1 460 ? 26.135  70.130  -4.980  1.00 46.96  ? 460 LEU B CB  1 
ATOM   6566 C  CG  . LEU B  1 460 ? 24.700  69.771  -4.571  1.00 45.74  ? 460 LEU B CG  1 
ATOM   6567 C  CD1 . LEU B  1 460 ? 23.950  70.983  -4.038  1.00 44.96  ? 460 LEU B CD1 1 
ATOM   6568 C  CD2 . LEU B  1 460 ? 23.930  69.139  -5.719  1.00 45.17  ? 460 LEU B CD2 1 
ATOM   6569 N  N   . ASP B  1 461 ? 28.926  69.251  -6.813  1.00 49.05  ? 461 ASP B N   1 
ATOM   6570 C  CA  . ASP B  1 461 ? 30.187  69.813  -7.358  1.00 49.95  ? 461 ASP B CA  1 
ATOM   6571 C  C   . ASP B  1 461 ? 29.972  70.889  -8.444  1.00 49.98  ? 461 ASP B C   1 
ATOM   6572 O  O   . ASP B  1 461 ? 30.912  71.283  -9.140  1.00 53.13  ? 461 ASP B O   1 
ATOM   6573 C  CB  . ASP B  1 461 ? 31.152  68.707  -7.835  1.00 47.99  ? 461 ASP B CB  1 
ATOM   6574 C  CG  . ASP B  1 461 ? 30.494  67.679  -8.733  1.00 48.11  ? 461 ASP B CG  1 
ATOM   6575 O  OD1 . ASP B  1 461 ? 29.683  68.057  -9.606  1.00 48.84  ? 461 ASP B OD1 1 
ATOM   6576 O  OD2 . ASP B  1 461 ? 30.802  66.480  -8.578  1.00 53.58  ? 461 ASP B OD2 1 
ATOM   6577 N  N   . GLU B  1 462 ? 28.733  71.356  -8.573  1.00 45.85  ? 462 GLU B N   1 
ATOM   6578 C  CA  . GLU B  1 462 ? 28.413  72.514  -9.406  1.00 45.00  ? 462 GLU B CA  1 
ATOM   6579 C  C   . GLU B  1 462 ? 27.110  73.147  -8.940  1.00 45.88  ? 462 GLU B C   1 
ATOM   6580 O  O   . GLU B  1 462 ? 26.302  72.498  -8.266  1.00 49.72  ? 462 GLU B O   1 
ATOM   6581 C  CB  . GLU B  1 462 ? 28.317  72.124  -10.882 1.00 44.30  ? 462 GLU B CB  1 
ATOM   6582 C  CG  . GLU B  1 462 ? 27.316  71.021  -11.195 1.00 43.20  ? 462 GLU B CG  1 
ATOM   6583 C  CD  . GLU B  1 462 ? 27.173  70.758  -12.682 1.00 43.28  ? 462 GLU B CD  1 
ATOM   6584 O  OE1 . GLU B  1 462 ? 27.873  71.402  -13.495 1.00 39.74  ? 462 GLU B OE1 1 
ATOM   6585 O  OE2 . GLU B  1 462 ? 26.358  69.887  -13.050 1.00 42.45  ? 462 GLU B OE2 1 
ATOM   6586 N  N   . THR B  1 463 ? 26.913  74.413  -9.300  1.00 49.41  ? 463 THR B N   1 
ATOM   6587 C  CA  . THR B  1 463 ? 25.687  75.132  -8.947  1.00 51.78  ? 463 THR B CA  1 
ATOM   6588 C  C   . THR B  1 463 ? 24.476  74.485  -9.634  1.00 49.55  ? 463 THR B C   1 
ATOM   6589 O  O   . THR B  1 463 ? 24.618  73.944  -10.736 1.00 50.26  ? 463 THR B O   1 
ATOM   6590 C  CB  . THR B  1 463 ? 25.753  76.620  -9.348  1.00 51.31  ? 463 THR B CB  1 
ATOM   6591 O  OG1 . THR B  1 463 ? 26.035  76.732  -10.748 1.00 52.51  ? 463 THR B OG1 1 
ATOM   6592 C  CG2 . THR B  1 463 ? 26.828  77.352  -8.553  1.00 49.59  ? 463 THR B CG2 1 
ATOM   6593 N  N   . PRO B  1 464 ? 23.289  74.524  -8.989  1.00 47.69  ? 464 PRO B N   1 
ATOM   6594 C  CA  . PRO B  1 464 ? 22.088  73.956  -9.613  1.00 47.08  ? 464 PRO B CA  1 
ATOM   6595 C  C   . PRO B  1 464 ? 21.749  74.524  -10.993 1.00 50.88  ? 464 PRO B C   1 
ATOM   6596 O  O   . PRO B  1 464 ? 21.248  73.790  -11.840 1.00 49.41  ? 464 PRO B O   1 
ATOM   6597 C  CB  . PRO B  1 464 ? 20.980  74.297  -8.616  1.00 47.83  ? 464 PRO B CB  1 
ATOM   6598 C  CG  . PRO B  1 464 ? 21.670  74.399  -7.310  1.00 48.10  ? 464 PRO B CG  1 
ATOM   6599 C  CD  . PRO B  1 464 ? 23.008  75.000  -7.620  1.00 48.73  ? 464 PRO B CD  1 
ATOM   6600 N  N   . GLN B  1 465 ? 22.023  75.810  -11.210 1.00 51.80  ? 465 GLN B N   1 
ATOM   6601 C  CA  . GLN B  1 465 ? 21.804  76.442  -12.517 1.00 52.83  ? 465 GLN B CA  1 
ATOM   6602 C  C   . GLN B  1 465 ? 22.633  75.786  -13.638 1.00 53.53  ? 465 GLN B C   1 
ATOM   6603 O  O   . GLN B  1 465 ? 22.114  75.559  -14.735 1.00 54.24  ? 465 GLN B O   1 
ATOM   6604 C  CB  . GLN B  1 465 ? 22.087  77.950  -12.454 1.00 56.84  ? 465 GLN B CB  1 
ATOM   6605 C  CG  . GLN B  1 465 ? 20.988  78.780  -11.792 1.00 59.88  ? 465 GLN B CG  1 
ATOM   6606 C  CD  . GLN B  1 465 ? 21.187  78.979  -10.297 1.00 62.59  ? 465 GLN B CD  1 
ATOM   6607 O  OE1 . GLN B  1 465 ? 21.667  78.090  -9.593  1.00 62.94  ? 465 GLN B OE1 1 
ATOM   6608 N  NE2 . GLN B  1 465 ? 20.807  80.154  -9.804  1.00 55.54  ? 465 GLN B NE2 1 
ATOM   6609 N  N   . ARG B  1 466 ? 23.905  75.490  -13.359 1.00 55.76  ? 466 ARG B N   1 
ATOM   6610 C  CA  . ARG B  1 466 ? 24.797  74.810  -14.323 1.00 57.86  ? 466 ARG B CA  1 
ATOM   6611 C  C   . ARG B  1 466 ? 24.369  73.372  -14.650 1.00 58.06  ? 466 ARG B C   1 
ATOM   6612 O  O   . ARG B  1 466 ? 24.513  72.922  -15.789 1.00 58.80  ? 466 ARG B O   1 
ATOM   6613 C  CB  . ARG B  1 466 ? 26.246  74.805  -13.816 1.00 58.17  ? 466 ARG B CB  1 
ATOM   6614 C  CG  . ARG B  1 466 ? 26.996  76.107  -14.060 1.00 64.41  ? 466 ARG B CG  1 
ATOM   6615 C  CD  . ARG B  1 466 ? 28.385  76.072  -13.439 1.00 70.06  ? 466 ARG B CD  1 
ATOM   6616 N  NE  . ARG B  1 466 ? 29.074  77.365  -13.507 1.00 76.15  ? 466 ARG B NE  1 
ATOM   6617 C  CZ  . ARG B  1 466 ? 28.842  78.417  -12.716 1.00 76.14  ? 466 ARG B CZ  1 
ATOM   6618 N  NH1 . ARG B  1 466 ? 29.549  79.533  -12.882 1.00 75.19  ? 466 ARG B NH1 1 
ATOM   6619 N  NH2 . ARG B  1 466 ? 27.909  78.380  -11.763 1.00 81.82  ? 466 ARG B NH2 1 
ATOM   6620 N  N   . SER B  1 467 ? 23.866  72.661  -13.644 1.00 57.63  ? 467 SER B N   1 
ATOM   6621 C  CA  . SER B  1 467 ? 23.361  71.292  -13.814 1.00 58.15  ? 467 SER B CA  1 
ATOM   6622 C  C   . SER B  1 467 ? 22.043  71.250  -14.596 1.00 54.16  ? 467 SER B C   1 
ATOM   6623 O  O   . SER B  1 467 ? 21.774  70.281  -15.309 1.00 52.39  ? 467 SER B O   1 
ATOM   6624 C  CB  . SER B  1 467 ? 23.190  70.613  -12.453 1.00 60.93  ? 467 SER B CB  1 
ATOM   6625 O  OG  . SER B  1 467 ? 22.226  71.281  -11.659 1.00 68.01  ? 467 SER B OG  1 
ATOM   6626 N  N   . LEU B  1 468 ? 21.229  72.293  -14.448 1.00 61.43  ? 468 LEU B N   1 
ATOM   6627 C  CA  . LEU B  1 468 ? 20.018  72.467  -15.256 1.00 64.18  ? 468 LEU B CA  1 
ATOM   6628 C  C   . LEU B  1 468 ? 20.360  72.901  -16.680 1.00 63.10  ? 468 LEU B C   1 
ATOM   6629 O  O   . LEU B  1 468 ? 19.723  72.453  -17.632 1.00 61.69  ? 468 LEU B O   1 
ATOM   6630 C  CB  . LEU B  1 468 ? 19.079  73.484  -14.607 1.00 61.49  ? 468 LEU B CB  1 
ATOM   6631 C  CG  . LEU B  1 468 ? 18.531  73.064  -13.238 1.00 60.07  ? 468 LEU B CG  1 
ATOM   6632 C  CD1 . LEU B  1 468 ? 18.044  74.276  -12.460 1.00 64.86  ? 468 LEU B CD1 1 
ATOM   6633 C  CD2 . LEU B  1 468 ? 17.430  72.025  -13.368 1.00 62.79  ? 468 LEU B CD2 1 
ATOM   6634 N  N   . ALA B  1 469 ? 21.357  73.776  -16.814 1.00 56.20  ? 469 ALA B N   1 
ATOM   6635 C  CA  . ALA B  1 469 ? 21.888  74.190  -18.121 1.00 51.96  ? 469 ALA B CA  1 
ATOM   6636 C  C   . ALA B  1 469 ? 22.370  73.011  -18.978 1.00 53.23  ? 469 ALA B C   1 
ATOM   6637 O  O   . ALA B  1 469 ? 22.164  72.998  -20.194 1.00 53.80  ? 469 ALA B O   1 
ATOM   6638 C  CB  . ALA B  1 469 ? 23.022  75.186  -17.929 1.00 50.10  ? 469 ALA B CB  1 
ATOM   6639 N  N   . SER B  1 470 ? 22.999  72.032  -18.329 1.00 53.55  ? 470 SER B N   1 
ATOM   6640 C  CA  . SER B  1 470 ? 23.591  70.860  -18.991 1.00 50.88  ? 470 SER B CA  1 
ATOM   6641 C  C   . SER B  1 470 ? 22.691  69.618  -19.034 1.00 44.63  ? 470 SER B C   1 
ATOM   6642 O  O   . SER B  1 470 ? 23.038  68.626  -19.683 1.00 43.35  ? 470 SER B O   1 
ATOM   6643 C  CB  . SER B  1 470 ? 24.889  70.490  -18.274 1.00 52.05  ? 470 SER B CB  1 
ATOM   6644 O  OG  . SER B  1 470 ? 24.647  70.262  -16.896 1.00 53.68  ? 470 SER B OG  1 
ATOM   6645 N  N   . GLY B  1 471 ? 21.552  69.670  -18.350 1.00 48.05  ? 471 GLY B N   1 
ATOM   6646 C  CA  . GLY B  1 471 ? 20.663  68.512  -18.224 1.00 52.01  ? 471 GLY B CA  1 
ATOM   6647 C  C   . GLY B  1 471 ? 21.194  67.415  -17.313 1.00 50.45  ? 471 GLY B C   1 
ATOM   6648 O  O   . GLY B  1 471 ? 20.860  66.243  -17.494 1.00 59.66  ? 471 GLY B O   1 
ATOM   6649 N  N   . ARG B  1 472 ? 22.013  67.800  -16.333 1.00 51.33  ? 472 ARG B N   1 
ATOM   6650 C  CA  . ARG B  1 472 ? 22.604  66.861  -15.370 1.00 50.38  ? 472 ARG B CA  1 
ATOM   6651 C  C   . ARG B  1 472 ? 21.723  66.678  -14.122 1.00 50.53  ? 472 ARG B C   1 
ATOM   6652 O  O   . ARG B  1 472 ? 21.972  67.269  -13.067 1.00 46.94  ? 472 ARG B O   1 
ATOM   6653 C  CB  . ARG B  1 472 ? 24.024  67.311  -14.986 1.00 50.57  ? 472 ARG B CB  1 
ATOM   6654 C  CG  . ARG B  1 472 ? 25.087  66.941  -16.013 1.00 53.75  ? 472 ARG B CG  1 
ATOM   6655 C  CD  . ARG B  1 472 ? 26.494  67.127  -15.464 1.00 54.34  ? 472 ARG B CD  1 
ATOM   6656 N  NE  . ARG B  1 472 ? 26.866  68.541  -15.394 1.00 54.77  ? 472 ARG B NE  1 
ATOM   6657 C  CZ  . ARG B  1 472 ? 27.489  69.238  -16.351 1.00 51.71  ? 472 ARG B CZ  1 
ATOM   6658 N  NH1 . ARG B  1 472 ? 27.843  68.675  -17.509 1.00 52.46  ? 472 ARG B NH1 1 
ATOM   6659 N  NH2 . ARG B  1 472 ? 27.758  70.527  -16.154 1.00 45.59  ? 472 ARG B NH2 1 
ATOM   6660 N  N   . PHE B  1 473 ? 20.687  65.854  -14.268 1.00 48.17  ? 473 PHE B N   1 
ATOM   6661 C  CA  . PHE B  1 473 ? 19.804  65.478  -13.153 1.00 48.09  ? 473 PHE B CA  1 
ATOM   6662 C  C   . PHE B  1 473 ? 19.082  64.169  -13.452 1.00 51.55  ? 473 PHE B C   1 
ATOM   6663 O  O   . PHE B  1 473 ? 19.160  63.651  -14.570 1.00 53.97  ? 473 PHE B O   1 
ATOM   6664 C  CB  . PHE B  1 473 ? 18.800  66.596  -12.845 1.00 48.74  ? 473 PHE B CB  1 
ATOM   6665 C  CG  . PHE B  1 473 ? 18.123  67.164  -14.058 1.00 48.44  ? 473 PHE B CG  1 
ATOM   6666 C  CD1 . PHE B  1 473 ? 17.058  66.499  -14.657 1.00 49.55  ? 473 PHE B CD1 1 
ATOM   6667 C  CD2 . PHE B  1 473 ? 18.538  68.379  -14.593 1.00 49.21  ? 473 PHE B CD2 1 
ATOM   6668 C  CE1 . PHE B  1 473 ? 16.425  67.030  -15.769 1.00 49.76  ? 473 PHE B CE1 1 
ATOM   6669 C  CE2 . PHE B  1 473 ? 17.909  68.915  -15.706 1.00 49.91  ? 473 PHE B CE2 1 
ATOM   6670 C  CZ  . PHE B  1 473 ? 16.851  68.240  -16.295 1.00 51.13  ? 473 PHE B CZ  1 
ATOM   6671 N  N   . LYS B  1 474 ? 18.385  63.641  -12.447 1.00 52.84  ? 474 LYS B N   1 
ATOM   6672 C  CA  . LYS B  1 474 ? 17.729  62.336  -12.563 1.00 59.45  ? 474 LYS B CA  1 
ATOM   6673 C  C   . LYS B  1 474 ? 16.594  62.359  -13.585 1.00 58.08  ? 474 LYS B C   1 
ATOM   6674 O  O   . LYS B  1 474 ? 15.709  63.215  -13.524 1.00 64.59  ? 474 LYS B O   1 
ATOM   6675 C  CB  . LYS B  1 474 ? 17.193  61.839  -11.214 1.00 63.63  ? 474 LYS B CB  1 
ATOM   6676 C  CG  . LYS B  1 474 ? 16.935  60.334  -11.206 1.00 67.72  ? 474 LYS B CG  1 
ATOM   6677 C  CD  . LYS B  1 474 ? 16.443  59.812  -9.865  1.00 69.70  ? 474 LYS B CD  1 
ATOM   6678 C  CE  . LYS B  1 474 ? 16.489  58.288  -9.801  1.00 73.80  ? 474 LYS B CE  1 
ATOM   6679 N  NZ  . LYS B  1 474 ? 15.362  57.594  -10.486 1.00 75.40  ? 474 LYS B NZ  1 
ATOM   6680 N  N   . LYS B  1 475 ? 16.640  61.411  -14.519 1.00 56.95  ? 475 LYS B N   1 
ATOM   6681 C  CA  . LYS B  1 475 ? 15.585  61.237  -15.519 1.00 59.52  ? 475 LYS B CA  1 
ATOM   6682 C  C   . LYS B  1 475 ? 14.408  60.500  -14.899 1.00 58.30  ? 475 LYS B C   1 
ATOM   6683 O  O   . LYS B  1 475 ? 14.395  59.267  -14.830 1.00 61.43  ? 475 LYS B O   1 
ATOM   6684 C  CB  . LYS B  1 475 ? 16.116  60.493  -16.757 1.00 63.47  ? 475 LYS B CB  1 
ATOM   6685 C  CG  . LYS B  1 475 ? 16.708  61.377  -17.856 1.00 77.03  ? 475 LYS B CG  1 
ATOM   6686 C  CD  . LYS B  1 475 ? 17.374  62.661  -17.366 1.00 83.16  ? 475 LYS B CD  1 
ATOM   6687 C  CE  . LYS B  1 475 ? 17.961  63.450  -18.521 1.00 84.31  ? 475 LYS B CE  1 
ATOM   6688 N  NZ  . LYS B  1 475 ? 18.832  64.553  -18.034 1.00 84.56  ? 475 LYS B NZ  1 
ATOM   6689 N  N   . THR B  1 476 ? 13.436  61.272  -14.421 1.00 55.69  ? 476 THR B N   1 
ATOM   6690 C  CA  . THR B  1 476 ? 12.207  60.716  -13.865 1.00 52.97  ? 476 THR B CA  1 
ATOM   6691 C  C   . THR B  1 476 ? 11.082  61.739  -13.900 1.00 54.46  ? 476 THR B C   1 
ATOM   6692 O  O   . THR B  1 476 ? 11.255  62.879  -14.339 1.00 52.07  ? 476 THR B O   1 
ATOM   6693 C  CB  . THR B  1 476 ? 12.387  60.210  -12.408 1.00 51.49  ? 476 THR B CB  1 
ATOM   6694 O  OG1 . THR B  1 476 ? 13.742  60.372  -11.972 1.00 54.58  ? 476 THR B OG1 1 
ATOM   6695 C  CG2 . THR B  1 476 ? 11.985  58.738  -12.309 1.00 51.60  ? 476 THR B CG2 1 
ATOM   6696 N  N   . GLU B  1 477 ? 9.928   61.298  -13.416 1.00 54.50  ? 477 GLU B N   1 
ATOM   6697 C  CA  . GLU B  1 477 ? 8.723   62.094  -13.369 1.00 55.44  ? 477 GLU B CA  1 
ATOM   6698 C  C   . GLU B  1 477 ? 8.808   63.113  -12.238 1.00 56.49  ? 477 GLU B C   1 
ATOM   6699 O  O   . GLU B  1 477 ? 9.551   62.922  -11.271 1.00 57.32  ? 477 GLU B O   1 
ATOM   6700 C  CB  . GLU B  1 477 ? 7.513   61.177  -13.173 1.00 59.85  ? 477 GLU B CB  1 
ATOM   6701 C  CG  . GLU B  1 477 ? 7.314   60.143  -14.289 1.00 65.55  ? 477 GLU B CG  1 
ATOM   6702 C  CD  . GLU B  1 477 ? 7.982   58.787  -14.056 1.00 66.85  ? 477 GLU B CD  1 
ATOM   6703 O  OE1 . GLU B  1 477 ? 8.443   58.500  -12.931 1.00 60.53  ? 477 GLU B OE1 1 
ATOM   6704 O  OE2 . GLU B  1 477 ? 8.042   57.995  -15.020 1.00 69.17  ? 477 GLU B OE2 1 
ATOM   6705 N  N   . ILE B  1 478 ? 8.043   64.193  -12.377 1.00 55.81  ? 478 ILE B N   1 
ATOM   6706 C  CA  . ILE B  1 478 ? 8.016   65.288  -11.405 1.00 51.68  ? 478 ILE B CA  1 
ATOM   6707 C  C   . ILE B  1 478 ? 6.579   65.756  -11.197 1.00 47.79  ? 478 ILE B C   1 
ATOM   6708 O  O   . ILE B  1 478 ? 5.832   65.934  -12.159 1.00 50.76  ? 478 ILE B O   1 
ATOM   6709 C  CB  . ILE B  1 478 ? 8.919   66.462  -11.876 1.00 55.74  ? 478 ILE B CB  1 
ATOM   6710 C  CG1 . ILE B  1 478 ? 10.408  66.110  -11.707 1.00 57.44  ? 478 ILE B CG1 1 
ATOM   6711 C  CG2 . ILE B  1 478 ? 8.600   67.774  -11.158 1.00 58.13  ? 478 ILE B CG2 1 
ATOM   6712 C  CD1 . ILE B  1 478 ? 10.875  65.850  -10.286 1.00 59.65  ? 478 ILE B CD1 1 
ATOM   6713 N  N   . LEU B  1 479 ? 6.204   65.943  -9.932  1.00 45.80  ? 479 LEU B N   1 
ATOM   6714 C  CA  . LEU B  1 479 ? 4.916   66.533  -9.565  1.00 47.60  ? 479 LEU B CA  1 
ATOM   6715 C  C   . LEU B  1 479 ? 5.199   67.731  -8.669  1.00 49.70  ? 479 LEU B C   1 
ATOM   6716 O  O   . LEU B  1 479 ? 5.501   67.576  -7.488  1.00 51.40  ? 479 LEU B O   1 
ATOM   6717 C  CB  . LEU B  1 479 ? 4.010   65.512  -8.864  1.00 45.02  ? 479 LEU B CB  1 
ATOM   6718 C  CG  . LEU B  1 479 ? 2.527   65.906  -8.731  1.00 47.43  ? 479 LEU B CG  1 
ATOM   6719 C  CD1 . LEU B  1 479 ? 1.626   64.687  -8.871  1.00 49.19  ? 479 LEU B CD1 1 
ATOM   6720 C  CD2 . LEU B  1 479 ? 2.219   66.635  -7.427  1.00 47.53  ? 479 LEU B CD2 1 
ATOM   6721 N  N   . THR B  1 480 ? 5.108   68.926  -9.242  1.00 47.89  ? 480 THR B N   1 
ATOM   6722 C  CA  . THR B  1 480 ? 5.479   70.153  -8.539  1.00 48.28  ? 480 THR B CA  1 
ATOM   6723 C  C   . THR B  1 480 ? 4.389   71.213  -8.670  1.00 47.66  ? 480 THR B C   1 
ATOM   6724 O  O   . THR B  1 480 ? 3.443   71.052  -9.439  1.00 44.36  ? 480 THR B O   1 
ATOM   6725 C  CB  . THR B  1 480 ? 6.849   70.678  -9.033  1.00 48.16  ? 480 THR B CB  1 
ATOM   6726 O  OG1 . THR B  1 480 ? 7.325   71.703  -8.150  1.00 50.53  ? 480 THR B OG1 1 
ATOM   6727 C  CG2 . THR B  1 480 ? 6.775   71.215  -10.469 1.00 46.31  ? 480 THR B CG2 1 
ATOM   6728 N  N   . GLY B  1 481 ? 4.521   72.285  -7.896  1.00 45.81  ? 481 GLY B N   1 
ATOM   6729 C  CA  . GLY B  1 481 ? 3.569   73.389  -7.959  1.00 46.08  ? 481 GLY B CA  1 
ATOM   6730 C  C   . GLY B  1 481 ? 3.764   74.483  -6.933  1.00 47.30  ? 481 GLY B C   1 
ATOM   6731 O  O   . GLY B  1 481 ? 4.763   74.515  -6.210  1.00 45.19  ? 481 GLY B O   1 
ATOM   6732 N  N   . SER B  1 482 ? 2.786   75.385  -6.895  1.00 48.96  ? 482 SER B N   1 
ATOM   6733 C  CA  . SER B  1 482 ? 2.802   76.566  -6.034  1.00 46.43  ? 482 SER B CA  1 
ATOM   6734 C  C   . SER B  1 482 ? 1.406   76.892  -5.517  1.00 42.95  ? 482 SER B C   1 
ATOM   6735 O  O   . SER B  1 482 ? 0.413   76.292  -5.935  1.00 39.69  ? 482 SER B O   1 
ATOM   6736 C  CB  . SER B  1 482 ? 3.329   77.774  -6.812  1.00 53.59  ? 482 SER B CB  1 
ATOM   6737 O  OG  . SER B  1 482 ? 4.573   77.489  -7.426  1.00 63.24  ? 482 SER B OG  1 
ATOM   6738 N  N   . ASN B  1 483 ? 1.359   77.845  -4.591  1.00 43.01  ? 483 ASN B N   1 
ATOM   6739 C  CA  . ASN B  1 483 ? 0.112   78.465  -4.131  1.00 43.30  ? 483 ASN B CA  1 
ATOM   6740 C  C   . ASN B  1 483 ? 0.012   79.882  -4.695  1.00 41.91  ? 483 ASN B C   1 
ATOM   6741 O  O   . ASN B  1 483 ? 0.979   80.408  -5.257  1.00 44.07  ? 483 ASN B O   1 
ATOM   6742 C  CB  . ASN B  1 483 ? 0.057   78.519  -2.601  1.00 43.87  ? 483 ASN B CB  1 
ATOM   6743 C  CG  . ASN B  1 483 ? 0.193   77.152  -1.951  1.00 41.83  ? 483 ASN B CG  1 
ATOM   6744 O  OD1 . ASN B  1 483 ? 0.504   76.158  -2.608  1.00 41.94  ? 483 ASN B OD1 1 
ATOM   6745 N  ND2 . ASN B  1 483 ? -0.038  77.101  -0.644  1.00 44.02  ? 483 ASN B ND2 1 
ATOM   6746 N  N   . THR B  1 484 ? -1.158  80.492  -4.538  1.00 43.13  ? 484 THR B N   1 
ATOM   6747 C  CA  . THR B  1 484 ? -1.409  81.847  -5.050  1.00 46.24  ? 484 THR B CA  1 
ATOM   6748 C  C   . THR B  1 484 ? -0.724  82.955  -4.238  1.00 47.98  ? 484 THR B C   1 
ATOM   6749 O  O   . THR B  1 484 ? -0.240  83.930  -4.819  1.00 47.62  ? 484 THR B O   1 
ATOM   6750 C  CB  . THR B  1 484 ? -2.918  82.149  -5.145  1.00 44.81  ? 484 THR B CB  1 
ATOM   6751 O  OG1 . THR B  1 484 ? -3.540  81.928  -3.876  1.00 45.92  ? 484 THR B OG1 1 
ATOM   6752 C  CG2 . THR B  1 484 ? -3.566  81.256  -6.177  1.00 44.67  ? 484 THR B CG2 1 
ATOM   6753 N  N   . GLU B  1 485 ? -0.687  82.800  -2.912  1.00 54.32  ? 485 GLU B N   1 
ATOM   6754 C  CA  . GLU B  1 485 ? -0.122  83.813  -1.998  1.00 56.93  ? 485 GLU B CA  1 
ATOM   6755 C  C   . GLU B  1 485 ? 1.098   83.282  -1.228  1.00 60.64  ? 485 GLU B C   1 
ATOM   6756 O  O   . GLU B  1 485 ? 1.092   83.162  -0.004  1.00 57.67  ? 485 GLU B O   1 
ATOM   6757 C  CB  . GLU B  1 485 ? -1.198  84.356  -1.041  1.00 55.09  ? 485 GLU B CB  1 
ATOM   6758 C  CG  . GLU B  1 485 ? -2.113  85.408  -1.654  1.00 52.38  ? 485 GLU B CG  1 
ATOM   6759 C  CD  . GLU B  1 485 ? -3.101  84.833  -2.648  1.00 52.89  ? 485 GLU B CD  1 
ATOM   6760 O  OE1 . GLU B  1 485 ? -3.934  83.996  -2.241  1.00 50.81  ? 485 GLU B OE1 1 
ATOM   6761 O  OE2 . GLU B  1 485 ? -3.053  85.223  -3.835  1.00 47.97  ? 485 GLU B OE2 1 
ATOM   6762 N  N   . GLU B  1 486 ? 2.156   82.993  -1.975  1.00 62.40  ? 486 GLU B N   1 
ATOM   6763 C  CA  . GLU B  1 486 ? 3.421   82.508  -1.411  1.00 59.11  ? 486 GLU B CA  1 
ATOM   6764 C  C   . GLU B  1 486 ? 4.168   83.550  -0.561  1.00 63.06  ? 486 GLU B C   1 
ATOM   6765 O  O   . GLU B  1 486 ? 4.906   83.187  0.357   1.00 65.92  ? 486 GLU B O   1 
ATOM   6766 C  CB  . GLU B  1 486 ? 4.343   82.034  -2.541  1.00 58.77  ? 486 GLU B CB  1 
ATOM   6767 C  CG  . GLU B  1 486 ? 3.808   80.861  -3.356  1.00 59.66  ? 486 GLU B CG  1 
ATOM   6768 C  CD  . GLU B  1 486 ? 4.088   79.506  -2.728  1.00 62.02  ? 486 GLU B CD  1 
ATOM   6769 O  OE1 . GLU B  1 486 ? 4.240   78.523  -3.491  1.00 54.20  ? 486 GLU B OE1 1 
ATOM   6770 O  OE2 . GLU B  1 486 ? 4.151   79.408  -1.483  1.00 62.40  ? 486 GLU B OE2 1 
ATOM   6771 N  N   . GLY B  1 487 ? 3.969   84.832  -0.868  1.00 64.57  ? 487 GLY B N   1 
ATOM   6772 C  CA  . GLY B  1 487 ? 4.762   85.922  -0.286  1.00 61.65  ? 487 GLY B CA  1 
ATOM   6773 C  C   . GLY B  1 487 ? 4.334   86.455  1.071   1.00 57.31  ? 487 GLY B C   1 
ATOM   6774 O  O   . GLY B  1 487 ? 5.174   86.596  1.963   1.00 53.63  ? 487 GLY B O   1 
ATOM   6775 N  N   . TYR B  1 488 ? 3.041   86.760  1.218   1.00 58.51  ? 488 TYR B N   1 
ATOM   6776 C  CA  . TYR B  1 488 ? 2.479   87.404  2.430   1.00 58.69  ? 488 TYR B CA  1 
ATOM   6777 C  C   . TYR B  1 488 ? 3.108   86.929  3.739   1.00 61.01  ? 488 TYR B C   1 
ATOM   6778 O  O   . TYR B  1 488 ? 3.508   87.746  4.571   1.00 58.74  ? 488 TYR B O   1 
ATOM   6779 C  CB  . TYR B  1 488 ? 0.963   87.176  2.527   1.00 58.03  ? 488 TYR B CB  1 
ATOM   6780 C  CG  . TYR B  1 488 ? 0.082   88.121  1.724   1.00 58.68  ? 488 TYR B CG  1 
ATOM   6781 C  CD1 . TYR B  1 488 ? 0.241   89.509  1.793   1.00 60.40  ? 488 TYR B CD1 1 
ATOM   6782 C  CD2 . TYR B  1 488 ? -0.946  87.624  0.926   1.00 58.46  ? 488 TYR B CD2 1 
ATOM   6783 C  CE1 . TYR B  1 488 ? -0.584  90.364  1.071   1.00 61.42  ? 488 TYR B CE1 1 
ATOM   6784 C  CE2 . TYR B  1 488 ? -1.774  88.467  0.202   1.00 61.41  ? 488 TYR B CE2 1 
ATOM   6785 C  CZ  . TYR B  1 488 ? -1.591  89.833  0.275   1.00 62.41  ? 488 TYR B CZ  1 
ATOM   6786 O  OH  . TYR B  1 488 ? -2.421  90.650  -0.449  1.00 64.56  ? 488 TYR B OH  1 
ATOM   6787 N  N   . TYR B  1 489 ? 3.186   85.608  3.898   1.00 61.41  ? 489 TYR B N   1 
ATOM   6788 C  CA  . TYR B  1 489 ? 3.779   84.956  5.078   1.00 55.37  ? 489 TYR B CA  1 
ATOM   6789 C  C   . TYR B  1 489 ? 5.142   85.545  5.465   1.00 51.82  ? 489 TYR B C   1 
ATOM   6790 O  O   . TYR B  1 489 ? 5.381   85.844  6.633   1.00 52.79  ? 489 TYR B O   1 
ATOM   6791 C  CB  . TYR B  1 489 ? 3.908   83.444  4.837   1.00 57.93  ? 489 TYR B CB  1 
ATOM   6792 C  CG  . TYR B  1 489 ? 4.294   82.647  6.069   1.00 58.83  ? 489 TYR B CG  1 
ATOM   6793 C  CD1 . TYR B  1 489 ? 3.337   82.279  7.018   1.00 57.47  ? 489 TYR B CD1 1 
ATOM   6794 C  CD2 . TYR B  1 489 ? 5.617   82.260  6.288   1.00 58.63  ? 489 TYR B CD2 1 
ATOM   6795 C  CE1 . TYR B  1 489 ? 3.688   81.552  8.149   1.00 61.43  ? 489 TYR B CE1 1 
ATOM   6796 C  CE2 . TYR B  1 489 ? 5.978   81.532  7.415   1.00 61.66  ? 489 TYR B CE2 1 
ATOM   6797 C  CZ  . TYR B  1 489 ? 5.012   81.180  8.342   1.00 64.53  ? 489 TYR B CZ  1 
ATOM   6798 O  OH  . TYR B  1 489 ? 5.366   80.459  9.459   1.00 67.90  ? 489 TYR B OH  1 
ATOM   6799 N  N   . PHE B  1 490 ? 6.008   85.730  4.472   1.00 50.73  ? 490 PHE B N   1 
ATOM   6800 C  CA  . PHE B  1 490 ? 7.352   86.293  4.675   1.00 54.02  ? 490 PHE B CA  1 
ATOM   6801 C  C   . PHE B  1 490 ? 7.353   87.821  4.750   1.00 56.55  ? 490 PHE B C   1 
ATOM   6802 O  O   . PHE B  1 490 ? 8.286   88.411  5.296   1.00 58.39  ? 490 PHE B O   1 
ATOM   6803 C  CB  . PHE B  1 490 ? 8.299   85.820  3.570   1.00 55.59  ? 490 PHE B CB  1 
ATOM   6804 C  CG  . PHE B  1 490 ? 8.548   84.341  3.592   1.00 57.97  ? 490 PHE B CG  1 
ATOM   6805 C  CD1 . PHE B  1 490 ? 7.672   83.464  2.958   1.00 63.02  ? 490 PHE B CD1 1 
ATOM   6806 C  CD2 . PHE B  1 490 ? 9.649   83.819  4.262   1.00 58.96  ? 490 PHE B CD2 1 
ATOM   6807 C  CE1 . PHE B  1 490 ? 7.892   82.096  2.989   1.00 62.66  ? 490 PHE B CE1 1 
ATOM   6808 C  CE2 . PHE B  1 490 ? 9.876   82.452  4.293   1.00 59.09  ? 490 PHE B CE2 1 
ATOM   6809 C  CZ  . PHE B  1 490 ? 8.997   81.589  3.655   1.00 59.20  ? 490 PHE B CZ  1 
ATOM   6810 N  N   . ILE B  1 491 ? 6.314   88.449  4.198   1.00 58.39  ? 491 ILE B N   1 
ATOM   6811 C  CA  . ILE B  1 491 ? 6.116   89.908  4.294   1.00 59.12  ? 491 ILE B CA  1 
ATOM   6812 C  C   . ILE B  1 491 ? 5.421   90.278  5.613   1.00 56.53  ? 491 ILE B C   1 
ATOM   6813 O  O   . ILE B  1 491 ? 5.390   91.448  5.991   1.00 63.14  ? 491 ILE B O   1 
ATOM   6814 C  CB  . ILE B  1 491 ? 5.310   90.488  3.099   1.00 60.02  ? 491 ILE B CB  1 
ATOM   6815 C  CG1 . ILE B  1 491 ? 5.852   89.971  1.761   1.00 60.77  ? 491 ILE B CG1 1 
ATOM   6816 C  CG2 . ILE B  1 491 ? 5.389   92.017  3.066   1.00 58.82  ? 491 ILE B CG2 1 
ATOM   6817 C  CD1 . ILE B  1 491 ? 4.861   90.071  0.626   1.00 59.57  ? 491 ILE B CD1 1 
ATOM   6818 N  N   . ILE B  1 492 ? 4.855   89.294  6.308   1.00 54.26  ? 492 ILE B N   1 
ATOM   6819 C  CA  . ILE B  1 492 ? 4.291   89.521  7.641   1.00 59.69  ? 492 ILE B CA  1 
ATOM   6820 C  C   . ILE B  1 492 ? 5.399   89.546  8.705   1.00 64.67  ? 492 ILE B C   1 
ATOM   6821 O  O   . ILE B  1 492 ? 5.456   90.478  9.511   1.00 72.66  ? 492 ILE B O   1 
ATOM   6822 C  CB  . ILE B  1 492 ? 3.172   88.498  7.960   1.00 59.58  ? 492 ILE B CB  1 
ATOM   6823 C  CG1 . ILE B  1 492 ? 1.895   88.889  7.200   1.00 61.25  ? 492 ILE B CG1 1 
ATOM   6824 C  CG2 . ILE B  1 492 ? 2.855   88.456  9.450   1.00 64.16  ? 492 ILE B CG2 1 
ATOM   6825 C  CD1 . ILE B  1 492 ? 0.852   87.796  7.103   1.00 63.33  ? 492 ILE B CD1 1 
ATOM   6826 N  N   . TYR B  1 493 ? 6.267   88.535  8.699   1.00 66.20  ? 493 TYR B N   1 
ATOM   6827 C  CA  . TYR B  1 493 ? 7.332   88.408  9.712   1.00 63.81  ? 493 TYR B CA  1 
ATOM   6828 C  C   . TYR B  1 493 ? 8.431   89.449  9.506   1.00 65.65  ? 493 TYR B C   1 
ATOM   6829 O  O   . TYR B  1 493 ? 8.705   90.255  10.398  1.00 74.01  ? 493 TYR B O   1 
ATOM   6830 C  CB  . TYR B  1 493 ? 7.922   86.995  9.717   1.00 59.78  ? 493 TYR B CB  1 
ATOM   6831 C  CG  . TYR B  1 493 ? 7.116   86.017  10.533  1.00 54.15  ? 493 TYR B CG  1 
ATOM   6832 C  CD1 . TYR B  1 493 ? 6.044   85.322  9.977   1.00 58.19  ? 493 TYR B CD1 1 
ATOM   6833 C  CD2 . TYR B  1 493 ? 7.421   85.790  11.870  1.00 54.10  ? 493 TYR B CD2 1 
ATOM   6834 C  CE1 . TYR B  1 493 ? 5.302   84.422  10.730  1.00 63.60  ? 493 TYR B CE1 1 
ATOM   6835 C  CE2 . TYR B  1 493 ? 6.689   84.897  12.630  1.00 56.33  ? 493 TYR B CE2 1 
ATOM   6836 C  CZ  . TYR B  1 493 ? 5.632   84.212  12.060  1.00 61.33  ? 493 TYR B CZ  1 
ATOM   6837 O  OH  . TYR B  1 493 ? 4.906   83.325  12.819  1.00 65.69  ? 493 TYR B OH  1 
ATOM   6838 N  N   . TYR B  1 494 ? 9.063   89.411  8.336   1.00 65.86  ? 494 TYR B N   1 
ATOM   6839 C  CA  . TYR B  1 494 ? 9.859   90.538  7.836   1.00 64.62  ? 494 TYR B CA  1 
ATOM   6840 C  C   . TYR B  1 494 ? 8.884   91.655  7.458   1.00 65.50  ? 494 TYR B C   1 
ATOM   6841 O  O   . TYR B  1 494 ? 7.760   91.365  7.070   1.00 64.74  ? 494 TYR B O   1 
ATOM   6842 C  CB  . TYR B  1 494 ? 10.670  90.105  6.612   1.00 62.03  ? 494 TYR B CB  1 
ATOM   6843 C  CG  . TYR B  1 494 ? 11.786  91.045  6.229   1.00 56.84  ? 494 TYR B CG  1 
ATOM   6844 C  CD1 . TYR B  1 494 ? 11.557  92.112  5.361   1.00 59.62  ? 494 TYR B CD1 1 
ATOM   6845 C  CD2 . TYR B  1 494 ? 13.080  90.857  6.714   1.00 54.92  ? 494 TYR B CD2 1 
ATOM   6846 C  CE1 . TYR B  1 494 ? 12.582  92.973  4.997   1.00 63.61  ? 494 TYR B CE1 1 
ATOM   6847 C  CE2 . TYR B  1 494 ? 14.112  91.713  6.358   1.00 54.60  ? 494 TYR B CE2 1 
ATOM   6848 C  CZ  . TYR B  1 494 ? 13.860  92.770  5.498   1.00 57.85  ? 494 TYR B CZ  1 
ATOM   6849 O  OH  . TYR B  1 494 ? 14.880  93.621  5.142   1.00 57.83  ? 494 TYR B OH  1 
ATOM   6850 N  N   . LEU B  1 495 ? 9.309   92.916  7.559   1.00 63.16  ? 495 LEU B N   1 
ATOM   6851 C  CA  . LEU B  1 495 ? 8.415   94.089  7.377   1.00 64.40  ? 495 LEU B CA  1 
ATOM   6852 C  C   . LEU B  1 495 ? 7.130   93.970  8.217   1.00 62.21  ? 495 LEU B C   1 
ATOM   6853 O  O   . LEU B  1 495 ? 6.039   93.760  7.680   1.00 53.64  ? 495 LEU B O   1 
ATOM   6854 C  CB  . LEU B  1 495 ? 8.051   94.323  5.891   1.00 62.36  ? 495 LEU B CB  1 
ATOM   6855 C  CG  . LEU B  1 495 ? 9.036   94.934  4.878   1.00 64.17  ? 495 LEU B CG  1 
ATOM   6856 C  CD1 . LEU B  1 495 ? 8.254   95.680  3.799   1.00 63.18  ? 495 LEU B CD1 1 
ATOM   6857 C  CD2 . LEU B  1 495 ? 10.063  95.867  5.506   1.00 65.77  ? 495 LEU B CD2 1 
ATOM   6858 N  N   . THR B  1 496 ? 7.280   94.094  9.533   1.00 64.09  ? 496 THR B N   1 
ATOM   6859 C  CA  . THR B  1 496 ? 6.156   93.918  10.479  1.00 64.31  ? 496 THR B CA  1 
ATOM   6860 C  C   . THR B  1 496 ? 5.487   95.227  10.926  1.00 66.24  ? 496 THR B C   1 
ATOM   6861 O  O   . THR B  1 496 ? 4.333   95.211  11.364  1.00 58.51  ? 496 THR B O   1 
ATOM   6862 C  CB  . THR B  1 496 ? 6.567   93.081  11.716  1.00 63.36  ? 496 THR B CB  1 
ATOM   6863 O  OG1 . THR B  1 496 ? 5.402   92.760  12.490  1.00 65.07  ? 496 THR B OG1 1 
ATOM   6864 C  CG2 . THR B  1 496 ? 7.589   93.808  12.606  1.00 65.25  ? 496 THR B CG2 1 
ATOM   6865 N  N   . GLU B  1 497 ? 6.220   96.337  10.841  1.00 72.31  ? 497 GLU B N   1 
ATOM   6866 C  CA  . GLU B  1 497 ? 5.671   97.678  11.095  1.00 75.40  ? 497 GLU B CA  1 
ATOM   6867 C  C   . GLU B  1 497 ? 4.479   97.994  10.172  1.00 70.72  ? 497 GLU B C   1 
ATOM   6868 O  O   . GLU B  1 497 ? 3.466   98.540  10.619  1.00 70.82  ? 497 GLU B O   1 
ATOM   6869 C  CB  . GLU B  1 497 ? 6.775   98.762  11.017  1.00 83.50  ? 497 GLU B CB  1 
ATOM   6870 C  CG  . GLU B  1 497 ? 7.301   99.175  9.633   1.00 94.47  ? 497 GLU B CG  1 
ATOM   6871 C  CD  . GLU B  1 497 ? 8.222   98.162  8.962   1.00 90.73  ? 497 GLU B CD  1 
ATOM   6872 O  OE1 . GLU B  1 497 ? 8.479   97.082  9.539   1.00 97.63  ? 497 GLU B OE1 1 
ATOM   6873 O  OE2 . GLU B  1 497 ? 8.691   98.449  7.839   1.00 80.75  ? 497 GLU B OE2 1 
ATOM   6874 N  N   . LEU B  1 498 ? 4.621   97.630  8.898   1.00 72.93  ? 498 LEU B N   1 
ATOM   6875 C  CA  . LEU B  1 498 ? 3.539   97.675  7.914   1.00 77.59  ? 498 LEU B CA  1 
ATOM   6876 C  C   . LEU B  1 498 ? 2.968   96.269  7.787   1.00 82.92  ? 498 LEU B C   1 
ATOM   6877 O  O   . LEU B  1 498 ? 3.636   95.295  8.141   1.00 105.83 ? 498 LEU B O   1 
ATOM   6878 C  CB  . LEU B  1 498 ? 4.083   98.138  6.556   1.00 78.08  ? 498 LEU B CB  1 
ATOM   6879 C  CG  . LEU B  1 498 ? 3.134   98.250  5.355   1.00 77.65  ? 498 LEU B CG  1 
ATOM   6880 C  CD1 . LEU B  1 498 ? 2.045   99.288  5.584   1.00 84.40  ? 498 LEU B CD1 1 
ATOM   6881 C  CD2 . LEU B  1 498 ? 3.930   98.595  4.107   1.00 77.24  ? 498 LEU B CD2 1 
ATOM   6882 N  N   . LEU B  1 499 ? 1.735   96.169  7.295   1.00 76.96  ? 499 LEU B N   1 
ATOM   6883 C  CA  . LEU B  1 499 ? 1.126   94.878  6.933   1.00 79.65  ? 499 LEU B CA  1 
ATOM   6884 C  C   . LEU B  1 499 ? 1.029   93.910  8.132   1.00 74.85  ? 499 LEU B C   1 
ATOM   6885 O  O   . LEU B  1 499 ? 1.293   92.710  8.007   1.00 68.26  ? 499 LEU B O   1 
ATOM   6886 C  CB  . LEU B  1 499 ? 1.918   94.248  5.770   1.00 77.80  ? 499 LEU B CB  1 
ATOM   6887 C  CG  . LEU B  1 499 ? 1.207   93.237  4.867   1.00 78.96  ? 499 LEU B CG  1 
ATOM   6888 C  CD1 . LEU B  1 499 ? 0.176   93.930  3.993   1.00 86.86  ? 499 LEU B CD1 1 
ATOM   6889 C  CD2 . LEU B  1 499 ? 2.209   92.493  4.000   1.00 73.96  ? 499 LEU B CD2 1 
ATOM   6890 N  N   . ARG B  1 500 ? 0.640   94.450  9.286   1.00 74.02  ? 500 ARG B N   1 
ATOM   6891 C  CA  . ARG B  1 500 ? 0.624   93.691  10.544  1.00 71.25  ? 500 ARG B CA  1 
ATOM   6892 C  C   . ARG B  1 500 ? -0.517  92.674  10.615  1.00 66.13  ? 500 ARG B C   1 
ATOM   6893 O  O   . ARG B  1 500 ? -1.461  92.718  9.820   1.00 65.86  ? 500 ARG B O   1 
ATOM   6894 C  CB  . ARG B  1 500 ? 0.597   94.632  11.763  1.00 72.10  ? 500 ARG B CB  1 
ATOM   6895 C  CG  . ARG B  1 500 ? -0.657  95.486  11.918  1.00 78.73  ? 500 ARG B CG  1 
ATOM   6896 C  CD  . ARG B  1 500 ? -0.553  96.462  13.083  1.00 85.57  ? 500 ARG B CD  1 
ATOM   6897 N  NE  . ARG B  1 500 ? 0.445   97.515  12.873  1.00 86.46  ? 500 ARG B NE  1 
ATOM   6898 C  CZ  . ARG B  1 500 ? 0.604   98.589  13.652  1.00 90.11  ? 500 ARG B CZ  1 
ATOM   6899 N  NH1 . ARG B  1 500 ? -0.169  98.789  14.721  1.00 96.63  ? 500 ARG B NH1 1 
ATOM   6900 N  NH2 . ARG B  1 500 ? 1.550   99.479  13.359  1.00 88.04  ? 500 ARG B NH2 1 
ATOM   6901 N  N   . LYS B  1 501 ? -0.404  91.759  11.574  1.00 65.10  ? 501 LYS B N   1 
ATOM   6902 C  CA  . LYS B  1 501 ? -1.369  90.675  11.752  1.00 70.57  ? 501 LYS B CA  1 
ATOM   6903 C  C   . LYS B  1 501 ? -2.703  91.197  12.303  1.00 72.72  ? 501 LYS B C   1 
ATOM   6904 O  O   . LYS B  1 501 ? -2.933  91.208  13.516  1.00 77.56  ? 501 LYS B O   1 
ATOM   6905 C  CB  . LYS B  1 501 ? -0.778  89.594  12.667  1.00 73.81  ? 501 LYS B CB  1 
ATOM   6906 C  CG  . LYS B  1 501 ? -1.613  88.319  12.773  1.00 76.05  ? 501 LYS B CG  1 
ATOM   6907 C  CD  . LYS B  1 501 ? -1.286  87.502  14.019  1.00 74.99  ? 501 LYS B CD  1 
ATOM   6908 C  CE  . LYS B  1 501 ? -1.724  88.154  15.331  1.00 66.70  ? 501 LYS B CE  1 
ATOM   6909 N  NZ  . LYS B  1 501 ? -3.175  88.487  15.432  1.00 58.15  ? 501 LYS B NZ  1 
ATOM   6910 N  N   . GLU B  1 502 ? -3.567  91.635  11.392  1.00 79.18  ? 502 GLU B N   1 
ATOM   6911 C  CA  . GLU B  1 502 ? -4.937  92.045  11.720  1.00 76.85  ? 502 GLU B CA  1 
ATOM   6912 C  C   . GLU B  1 502 ? -5.808  92.052  10.462  1.00 76.23  ? 502 GLU B C   1 
ATOM   6913 O  O   . GLU B  1 502 ? -5.293  92.130  9.344   1.00 81.33  ? 502 GLU B O   1 
ATOM   6914 C  CB  . GLU B  1 502 ? -4.951  93.425  12.393  1.00 72.72  ? 502 GLU B CB  1 
ATOM   6915 C  CG  . GLU B  1 502 ? -4.322  94.541  11.567  1.00 77.71  ? 502 GLU B CG  1 
ATOM   6916 C  CD  . GLU B  1 502 ? -4.188  95.848  12.329  1.00 77.83  ? 502 GLU B CD  1 
ATOM   6917 O  OE1 . GLU B  1 502 ? -4.526  96.906  11.756  1.00 80.99  ? 502 GLU B OE1 1 
ATOM   6918 O  OE2 . GLU B  1 502 ? -3.745  95.826  13.499  1.00 71.14  ? 502 GLU B OE2 1 
ATOM   6919 N  N   . GLU B  1 503 ? -7.122  91.971  10.657  1.00 67.27  ? 503 GLU B N   1 
ATOM   6920 C  CA  . GLU B  1 503 ? -8.082  91.963  9.540   1.00 62.07  ? 503 GLU B CA  1 
ATOM   6921 C  C   . GLU B  1 503 ? -8.098  93.286  8.762   1.00 66.99  ? 503 GLU B C   1 
ATOM   6922 O  O   . GLU B  1 503 ? -7.851  94.356  9.327   1.00 74.54  ? 503 GLU B O   1 
ATOM   6923 C  CB  . GLU B  1 503 ? -9.505  91.627  10.027  1.00 58.80  ? 503 GLU B CB  1 
ATOM   6924 C  CG  . GLU B  1 503 ? -9.959  90.200  9.734   1.00 62.58  ? 503 GLU B CG  1 
ATOM   6925 C  CD  . GLU B  1 503 ? -9.133  89.126  10.424  1.00 72.01  ? 503 GLU B CD  1 
ATOM   6926 O  OE1 . GLU B  1 503 ? -8.272  89.448  11.272  1.00 82.50  ? 503 GLU B OE1 1 
ATOM   6927 O  OE2 . GLU B  1 503 ? -9.357  87.936  10.118  1.00 77.73  ? 503 GLU B OE2 1 
ATOM   6928 N  N   . GLY B  1 504 ? -8.394  93.183  7.468   1.00 66.74  ? 504 GLY B N   1 
ATOM   6929 C  CA  . GLY B  1 504 ? -8.575  94.336  6.578   1.00 64.25  ? 504 GLY B CA  1 
ATOM   6930 C  C   . GLY B  1 504 ? -7.475  95.383  6.500   1.00 64.33  ? 504 GLY B C   1 
ATOM   6931 O  O   . GLY B  1 504 ? -7.774  96.570  6.343   1.00 68.08  ? 504 GLY B O   1 
ATOM   6932 N  N   . VAL B  1 505 ? -6.213  94.962  6.605   1.00 67.50  ? 505 VAL B N   1 
ATOM   6933 C  CA  . VAL B  1 505 ? -5.076  95.881  6.408   1.00 71.07  ? 505 VAL B CA  1 
ATOM   6934 C  C   . VAL B  1 505 ? -4.835  96.105  4.907   1.00 67.82  ? 505 VAL B C   1 
ATOM   6935 O  O   . VAL B  1 505 ? -5.113  95.225  4.087   1.00 58.75  ? 505 VAL B O   1 
ATOM   6936 C  CB  . VAL B  1 505 ? -3.782  95.395  7.123   1.00 74.72  ? 505 VAL B CB  1 
ATOM   6937 C  CG1 . VAL B  1 505 ? -3.014  94.366  6.298   1.00 68.97  ? 505 VAL B CG1 1 
ATOM   6938 C  CG2 . VAL B  1 505 ? -2.876  96.573  7.465   1.00 75.59  ? 505 VAL B CG2 1 
ATOM   6939 N  N   . THR B  1 506 ? -4.320  97.288  4.569   1.00 67.27  ? 506 THR B N   1 
ATOM   6940 C  CA  . THR B  1 506 ? -4.003  97.666  3.181   1.00 63.82  ? 506 THR B CA  1 
ATOM   6941 C  C   . THR B  1 506 ? -2.730  98.512  3.082   1.00 61.93  ? 506 THR B C   1 
ATOM   6942 O  O   . THR B  1 506 ? -2.242  99.043  4.083   1.00 60.53  ? 506 THR B O   1 
ATOM   6943 C  CB  . THR B  1 506 ? -5.164  98.439  2.518   1.00 63.65  ? 506 THR B CB  1 
ATOM   6944 O  OG1 . THR B  1 506 ? -5.673  99.427  3.424   1.00 67.48  ? 506 THR B OG1 1 
ATOM   6945 C  CG2 . THR B  1 506 ? -6.285  97.497  2.119   1.00 64.90  ? 506 THR B CG2 1 
ATOM   6946 N  N   . VAL B  1 507 ? -2.216  98.626  1.858   1.00 55.47  ? 507 VAL B N   1 
ATOM   6947 C  CA  . VAL B  1 507 ? -0.958  99.325  1.569   1.00 55.11  ? 507 VAL B CA  1 
ATOM   6948 C  C   . VAL B  1 507 ? -1.190  100.436 0.545   1.00 56.00  ? 507 VAL B C   1 
ATOM   6949 O  O   . VAL B  1 507 ? -1.539  100.157 -0.599  1.00 56.17  ? 507 VAL B O   1 
ATOM   6950 C  CB  . VAL B  1 507 ? 0.107   98.342  1.027   1.00 53.73  ? 507 VAL B CB  1 
ATOM   6951 C  CG1 . VAL B  1 507 ? 1.408   99.062  0.682   1.00 53.61  ? 507 VAL B CG1 1 
ATOM   6952 C  CG2 . VAL B  1 507 ? 0.378   97.240  2.042   1.00 53.02  ? 507 VAL B CG2 1 
ATOM   6953 N  N   . THR B  1 508 ? -0.972  101.685 0.957   1.00 55.52  ? 508 THR B N   1 
ATOM   6954 C  CA  . THR B  1 508 ? -1.063  102.840 0.053   1.00 49.68  ? 508 THR B CA  1 
ATOM   6955 C  C   . THR B  1 508 ? 0.112   102.891 -0.924  1.00 48.65  ? 508 THR B C   1 
ATOM   6956 O  O   . THR B  1 508 ? 1.106   102.179 -0.761  1.00 43.19  ? 508 THR B O   1 
ATOM   6957 C  CB  . THR B  1 508 ? -1.147  104.169 0.832   1.00 44.37  ? 508 THR B CB  1 
ATOM   6958 O  OG1 . THR B  1 508 ? -0.085  104.237 1.792   1.00 40.44  ? 508 THR B OG1 1 
ATOM   6959 C  CG2 . THR B  1 508 ? -2.481  104.277 1.543   1.00 46.48  ? 508 THR B CG2 1 
ATOM   6960 N  N   . ARG B  1 509 ? -0.022  103.741 -1.939  1.00 54.66  ? 509 ARG B N   1 
ATOM   6961 C  CA  . ARG B  1 509 ? 0.940   103.816 -3.041  1.00 61.78  ? 509 ARG B CA  1 
ATOM   6962 C  C   . ARG B  1 509 ? 2.363   104.153 -2.592  1.00 65.92  ? 509 ARG B C   1 
ATOM   6963 O  O   . ARG B  1 509 ? 3.324   103.547 -3.067  1.00 60.18  ? 509 ARG B O   1 
ATOM   6964 C  CB  . ARG B  1 509 ? 0.464   104.822 -4.104  1.00 62.92  ? 509 ARG B CB  1 
ATOM   6965 C  CG  . ARG B  1 509 ? 1.218   104.777 -5.432  1.00 63.07  ? 509 ARG B CG  1 
ATOM   6966 C  CD  . ARG B  1 509 ? 1.150   103.401 -6.078  1.00 68.06  ? 509 ARG B CD  1 
ATOM   6967 N  NE  . ARG B  1 509 ? 1.920   103.305 -7.317  1.00 73.18  ? 509 ARG B NE  1 
ATOM   6968 C  CZ  . ARG B  1 509 ? 2.252   102.162 -7.923  1.00 74.73  ? 509 ARG B CZ  1 
ATOM   6969 N  NH1 . ARG B  1 509 ? 1.886   100.981 -7.418  1.00 78.33  ? 509 ARG B NH1 1 
ATOM   6970 N  NH2 . ARG B  1 509 ? 2.961   102.197 -9.048  1.00 75.97  ? 509 ARG B NH2 1 
ATOM   6971 N  N   . GLU B  1 510 ? 2.485   105.111 -1.678  1.00 68.20  ? 510 GLU B N   1 
ATOM   6972 C  CA  . GLU B  1 510 ? 3.790   105.508 -1.145  1.00 67.32  ? 510 GLU B CA  1 
ATOM   6973 C  C   . GLU B  1 510 ? 4.402   104.423 -0.257  1.00 60.01  ? 510 GLU B C   1 
ATOM   6974 O  O   . GLU B  1 510 ? 5.620   104.224 -0.271  1.00 53.57  ? 510 GLU B O   1 
ATOM   6975 C  CB  . GLU B  1 510 ? 3.683   106.837 -0.389  1.00 70.17  ? 510 GLU B CB  1 
ATOM   6976 C  CG  . GLU B  1 510 ? 3.335   108.030 -1.277  1.00 72.66  ? 510 GLU B CG  1 
ATOM   6977 C  CD  . GLU B  1 510 ? 4.346   108.284 -2.389  1.00 73.82  ? 510 GLU B CD  1 
ATOM   6978 O  OE1 . GLU B  1 510 ? 5.554   108.029 -2.186  1.00 75.73  ? 510 GLU B OE1 1 
ATOM   6979 O  OE2 . GLU B  1 510 ? 3.929   108.748 -3.472  1.00 69.57  ? 510 GLU B OE2 1 
ATOM   6980 N  N   . GLU B  1 511 ? 3.557   103.729 0.504   1.00 57.70  ? 511 GLU B N   1 
ATOM   6981 C  CA  . GLU B  1 511 ? 3.984   102.565 1.286   1.00 63.21  ? 511 GLU B CA  1 
ATOM   6982 C  C   . GLU B  1 511 ? 4.446   101.399 0.402   1.00 66.40  ? 511 GLU B C   1 
ATOM   6983 O  O   . GLU B  1 511 ? 5.367   100.670 0.775   1.00 70.20  ? 511 GLU B O   1 
ATOM   6984 C  CB  . GLU B  1 511 ? 2.864   102.113 2.226   1.00 62.23  ? 511 GLU B CB  1 
ATOM   6985 C  CG  . GLU B  1 511 ? 2.604   103.080 3.371   1.00 60.00  ? 511 GLU B CG  1 
ATOM   6986 C  CD  . GLU B  1 511 ? 1.546   102.584 4.340   1.00 62.23  ? 511 GLU B CD  1 
ATOM   6987 O  OE1 . GLU B  1 511 ? 0.511   102.050 3.886   1.00 61.24  ? 511 GLU B OE1 1 
ATOM   6988 O  OE2 . GLU B  1 511 ? 1.744   102.741 5.563   1.00 73.49  ? 511 GLU B OE2 1 
ATOM   6989 N  N   . PHE B  1 512 ? 3.804   101.229 -0.755  1.00 62.27  ? 512 PHE B N   1 
ATOM   6990 C  CA  . PHE B  1 512 ? 4.243   100.256 -1.761  1.00 57.87  ? 512 PHE B CA  1 
ATOM   6991 C  C   . PHE B  1 512 ? 5.582   100.671 -2.368  1.00 60.70  ? 512 PHE B C   1 
ATOM   6992 O  O   . PHE B  1 512 ? 6.495   99.853  -2.483  1.00 57.38  ? 512 PHE B O   1 
ATOM   6993 C  CB  . PHE B  1 512 ? 3.199   100.108 -2.871  1.00 62.41  ? 512 PHE B CB  1 
ATOM   6994 C  CG  . PHE B  1 512 ? 3.672   99.284  -4.037  1.00 61.20  ? 512 PHE B CG  1 
ATOM   6995 C  CD1 . PHE B  1 512 ? 3.626   97.897  -3.987  1.00 61.26  ? 512 PHE B CD1 1 
ATOM   6996 C  CD2 . PHE B  1 512 ? 4.184   99.895  -5.178  1.00 62.27  ? 512 PHE B CD2 1 
ATOM   6997 C  CE1 . PHE B  1 512 ? 4.073   97.133  -5.055  1.00 61.08  ? 512 PHE B CE1 1 
ATOM   6998 C  CE2 . PHE B  1 512 ? 4.634   99.138  -6.248  1.00 61.36  ? 512 PHE B CE2 1 
ATOM   6999 C  CZ  . PHE B  1 512 ? 4.579   97.755  -6.186  1.00 61.36  ? 512 PHE B CZ  1 
ATOM   7000 N  N   . LEU B  1 513 ? 5.672   101.935 -2.780  1.00 67.87  ? 513 LEU B N   1 
ATOM   7001 C  CA  . LEU B  1 513 ? 6.937   102.524 -3.271  1.00 69.94  ? 513 LEU B CA  1 
ATOM   7002 C  C   . LEU B  1 513 ? 8.114   102.408 -2.279  1.00 69.70  ? 513 LEU B C   1 
ATOM   7003 O  O   . LEU B  1 513 ? 9.265   102.286 -2.704  1.00 75.23  ? 513 LEU B O   1 
ATOM   7004 C  CB  . LEU B  1 513 ? 6.754   103.998 -3.691  1.00 74.35  ? 513 LEU B CB  1 
ATOM   7005 C  CG  . LEU B  1 513 ? 6.531   104.338 -5.176  1.00 75.23  ? 513 LEU B CG  1 
ATOM   7006 C  CD1 . LEU B  1 513 ? 7.715   103.943 -6.055  1.00 76.42  ? 513 LEU B CD1 1 
ATOM   7007 C  CD2 . LEU B  1 513 ? 5.247   103.730 -5.715  1.00 72.16  ? 513 LEU B CD2 1 
ATOM   7008 N  N   . GLN B  1 514 ? 7.828   102.472 -0.977  1.00 67.58  ? 514 GLN B N   1 
ATOM   7009 C  CA  . GLN B  1 514 ? 8.859   102.262 0.063   1.00 62.99  ? 514 GLN B CA  1 
ATOM   7010 C  C   . GLN B  1 514 ? 9.156   100.779 0.286   1.00 61.84  ? 514 GLN B C   1 
ATOM   7011 O  O   . GLN B  1 514 ? 10.295  100.408 0.574   1.00 68.47  ? 514 GLN B O   1 
ATOM   7012 C  CB  . GLN B  1 514 ? 8.474   102.920 1.402   1.00 63.07  ? 514 GLN B CB  1 
ATOM   7013 C  CG  . GLN B  1 514 ? 9.209   104.225 1.696   1.00 65.26  ? 514 GLN B CG  1 
ATOM   7014 C  CD  . GLN B  1 514 ? 10.676  104.042 2.075   1.00 63.32  ? 514 GLN B CD  1 
ATOM   7015 O  OE1 . GLN B  1 514 ? 11.252  102.962 1.924   1.00 56.46  ? 514 GLN B OE1 1 
ATOM   7016 N  NE2 . GLN B  1 514 ? 11.288  105.111 2.571   1.00 60.22  ? 514 GLN B NE2 1 
ATOM   7017 N  N   . ALA B  1 515 ? 8.121   99.949  0.175   1.00 59.09  ? 515 ALA B N   1 
ATOM   7018 C  CA  . ALA B  1 515 ? 8.234   98.495  0.346   1.00 57.29  ? 515 ALA B CA  1 
ATOM   7019 C  C   . ALA B  1 515 ? 9.153   97.827  -0.680  1.00 56.56  ? 515 ALA B C   1 
ATOM   7020 O  O   . ALA B  1 515 ? 9.970   96.982  -0.319  1.00 57.40  ? 515 ALA B O   1 
ATOM   7021 C  CB  . ALA B  1 515 ? 6.854   97.857  0.305   1.00 55.04  ? 515 ALA B CB  1 
ATOM   7022 N  N   . VAL B  1 516 ? 9.025   98.217  -1.947  1.00 57.31  ? 516 VAL B N   1 
ATOM   7023 C  CA  . VAL B  1 516 ? 9.877   97.669  -3.023  1.00 57.74  ? 516 VAL B CA  1 
ATOM   7024 C  C   . VAL B  1 516 ? 11.381  97.915  -2.825  1.00 56.54  ? 516 VAL B C   1 
ATOM   7025 O  O   . VAL B  1 516 ? 12.204  97.126  -3.292  1.00 52.63  ? 516 VAL B O   1 
ATOM   7026 C  CB  . VAL B  1 516 ? 9.470   98.176  -4.428  1.00 61.65  ? 516 VAL B CB  1 
ATOM   7027 C  CG1 . VAL B  1 516 ? 8.062   97.715  -4.769  1.00 63.38  ? 516 VAL B CG1 1 
ATOM   7028 C  CG2 . VAL B  1 516 ? 9.595   99.690  -4.548  1.00 65.75  ? 516 VAL B CG2 1 
ATOM   7029 N  N   . ARG B  1 517 ? 11.726  99.012  -2.150  1.00 62.26  ? 517 ARG B N   1 
ATOM   7030 C  CA  . ARG B  1 517 ? 13.120  99.315  -1.790  1.00 72.38  ? 517 ARG B CA  1 
ATOM   7031 C  C   . ARG B  1 517 ? 13.657  98.358  -0.715  1.00 75.90  ? 517 ARG B C   1 
ATOM   7032 O  O   . ARG B  1 517 ? 14.796  97.894  -0.802  1.00 66.74  ? 517 ARG B O   1 
ATOM   7033 C  CB  . ARG B  1 517 ? 13.248  100.765 -1.304  1.00 76.35  ? 517 ARG B CB  1 
ATOM   7034 C  CG  . ARG B  1 517 ? 12.968  101.818 -2.369  1.00 87.46  ? 517 ARG B CG  1 
ATOM   7035 C  CD  . ARG B  1 517 ? 12.950  103.223 -1.780  1.00 95.01  ? 517 ARG B CD  1 
ATOM   7036 N  NE  . ARG B  1 517 ? 12.500  104.233 -2.747  1.00 100.32 ? 517 ARG B NE  1 
ATOM   7037 C  CZ  . ARG B  1 517 ? 13.279  104.904 -3.604  1.00 100.84 ? 517 ARG B CZ  1 
ATOM   7038 N  NH1 . ARG B  1 517 ? 14.596  104.701 -3.661  1.00 101.77 ? 517 ARG B NH1 1 
ATOM   7039 N  NH2 . ARG B  1 517 ? 12.728  105.797 -4.426  1.00 95.69  ? 517 ARG B NH2 1 
ATOM   7040 N  N   . GLU B  1 518 ? 12.826  98.079  0.288   1.00 81.26  ? 518 GLU B N   1 
ATOM   7041 C  CA  . GLU B  1 518 ? 13.183  97.205  1.415   1.00 80.24  ? 518 GLU B CA  1 
ATOM   7042 C  C   . GLU B  1 518 ? 13.092  95.698  1.114   1.00 79.27  ? 518 GLU B C   1 
ATOM   7043 O  O   . GLU B  1 518 ? 13.786  94.901  1.752   1.00 90.88  ? 518 GLU B O   1 
ATOM   7044 C  CB  . GLU B  1 518 ? 12.325  97.564  2.634   1.00 78.96  ? 518 GLU B CB  1 
ATOM   7045 C  CG  . GLU B  1 518 ? 12.524  99.001  3.102   1.00 80.47  ? 518 GLU B CG  1 
ATOM   7046 C  CD  . GLU B  1 518 ? 11.736  99.339  4.355   1.00 85.98  ? 518 GLU B CD  1 
ATOM   7047 O  OE1 . GLU B  1 518 ? 11.859  98.605  5.358   1.00 94.68  ? 518 GLU B OE1 1 
ATOM   7048 O  OE2 . GLU B  1 518 ? 11.001  100.350 4.342   1.00 77.08  ? 518 GLU B OE2 1 
ATOM   7049 N  N   . LEU B  1 519 ? 12.244  95.318  0.156   1.00 69.07  ? 519 LEU B N   1 
ATOM   7050 C  CA  . LEU B  1 519 ? 12.140  93.922  -0.307  1.00 65.69  ? 519 LEU B CA  1 
ATOM   7051 C  C   . LEU B  1 519 ? 13.138  93.567  -1.426  1.00 62.07  ? 519 LEU B C   1 
ATOM   7052 O  O   . LEU B  1 519 ? 13.384  92.384  -1.680  1.00 62.79  ? 519 LEU B O   1 
ATOM   7053 C  CB  . LEU B  1 519 ? 10.713  93.615  -0.773  1.00 66.56  ? 519 LEU B CB  1 
ATOM   7054 C  CG  . LEU B  1 519 ? 9.570   93.855  0.222   1.00 64.76  ? 519 LEU B CG  1 
ATOM   7055 C  CD1 . LEU B  1 519 ? 8.241   93.509  -0.431  1.00 68.76  ? 519 LEU B CD1 1 
ATOM   7056 C  CD2 . LEU B  1 519 ? 9.743   93.072  1.512   1.00 64.96  ? 519 LEU B CD2 1 
ATOM   7057 N  N   . ASN B  1 520 ? 13.681  94.585  -2.096  1.00 64.59  ? 520 ASN B N   1 
ATOM   7058 C  CA  . ASN B  1 520 ? 14.770  94.430  -3.074  1.00 70.14  ? 520 ASN B CA  1 
ATOM   7059 C  C   . ASN B  1 520 ? 15.818  95.540  -2.856  1.00 72.63  ? 520 ASN B C   1 
ATOM   7060 O  O   . ASN B  1 520 ? 15.804  96.548  -3.568  1.00 73.00  ? 520 ASN B O   1 
ATOM   7061 C  CB  . ASN B  1 520 ? 14.220  94.492  -4.507  1.00 76.43  ? 520 ASN B CB  1 
ATOM   7062 C  CG  . ASN B  1 520 ? 13.444  93.247  -4.896  1.00 86.55  ? 520 ASN B CG  1 
ATOM   7063 O  OD1 . ASN B  1 520 ? 13.972  92.126  -4.839  1.00 96.75  ? 520 ASN B OD1 1 
ATOM   7064 N  ND2 . ASN B  1 520 ? 12.190  93.436  -5.307  1.00 83.59  ? 520 ASN B ND2 1 
ATOM   7065 N  N   . PRO B  1 521 ? 16.723  95.367  -1.864  1.00 74.42  ? 521 PRO B N   1 
ATOM   7066 C  CA  . PRO B  1 521 ? 17.739  96.380  -1.540  1.00 70.87  ? 521 PRO B CA  1 
ATOM   7067 C  C   . PRO B  1 521 ? 19.083  96.246  -2.282  1.00 69.39  ? 521 PRO B C   1 
ATOM   7068 O  O   . PRO B  1 521 ? 19.967  97.083  -2.086  1.00 67.84  ? 521 PRO B O   1 
ATOM   7069 C  CB  . PRO B  1 521 ? 17.943  96.176  -0.037  1.00 68.42  ? 521 PRO B CB  1 
ATOM   7070 C  CG  . PRO B  1 521 ? 17.677  94.723  0.184   1.00 70.49  ? 521 PRO B CG  1 
ATOM   7071 C  CD  . PRO B  1 521 ? 16.827  94.212  -0.952  1.00 72.64  ? 521 PRO B CD  1 
ATOM   7072 N  N   . TYR B  1 522 ? 19.225  95.216  -3.116  1.00 70.45  ? 522 TYR B N   1 
ATOM   7073 C  CA  . TYR B  1 522 ? 20.456  94.967  -3.886  1.00 70.31  ? 522 TYR B CA  1 
ATOM   7074 C  C   . TYR B  1 522 ? 20.453  95.579  -5.294  1.00 68.17  ? 522 TYR B C   1 
ATOM   7075 O  O   . TYR B  1 522 ? 21.517  95.861  -5.851  1.00 61.55  ? 522 TYR B O   1 
ATOM   7076 C  CB  . TYR B  1 522 ? 20.704  93.462  -3.978  1.00 69.46  ? 522 TYR B CB  1 
ATOM   7077 C  CG  . TYR B  1 522 ? 20.732  92.791  -2.624  1.00 71.13  ? 522 TYR B CG  1 
ATOM   7078 C  CD1 . TYR B  1 522 ? 21.815  92.967  -1.761  1.00 74.91  ? 522 TYR B CD1 1 
ATOM   7079 C  CD2 . TYR B  1 522 ? 19.668  91.996  -2.193  1.00 73.25  ? 522 TYR B CD2 1 
ATOM   7080 C  CE1 . TYR B  1 522 ? 21.843  92.361  -0.511  1.00 73.23  ? 522 TYR B CE1 1 
ATOM   7081 C  CE2 . TYR B  1 522 ? 19.687  91.387  -0.946  1.00 76.87  ? 522 TYR B CE2 1 
ATOM   7082 C  CZ  . TYR B  1 522 ? 20.776  91.572  -0.109  1.00 73.82  ? 522 TYR B CZ  1 
ATOM   7083 O  OH  . TYR B  1 522 ? 20.802  90.970  1.128   1.00 71.00  ? 522 TYR B OH  1 
ATOM   7084 N  N   . VAL B  1 523 ? 19.261  95.771  -5.859  1.00 72.34  ? 523 VAL B N   1 
ATOM   7085 C  CA  . VAL B  1 523 ? 19.100  96.348  -7.204  1.00 72.15  ? 523 VAL B CA  1 
ATOM   7086 C  C   . VAL B  1 523 ? 19.428  97.845  -7.249  1.00 77.47  ? 523 VAL B C   1 
ATOM   7087 O  O   . VAL B  1 523 ? 19.462  98.522  -6.217  1.00 74.55  ? 523 VAL B O   1 
ATOM   7088 C  CB  . VAL B  1 523 ? 17.689  96.082  -7.797  1.00 72.39  ? 523 VAL B CB  1 
ATOM   7089 C  CG1 . VAL B  1 523 ? 17.436  94.583  -7.911  1.00 66.65  ? 523 VAL B CG1 1 
ATOM   7090 C  CG2 . VAL B  1 523 ? 16.583  96.778  -7.002  1.00 72.72  ? 523 VAL B CG2 1 
ATOM   7091 N  N   . ASN B  1 524 ? 19.645  98.342  -8.467  1.00 84.35  ? 524 ASN B N   1 
ATOM   7092 C  CA  . ASN B  1 524 ? 20.265  99.664  -8.702  1.00 87.49  ? 524 ASN B CA  1 
ATOM   7093 C  C   . ASN B  1 524 ? 19.335  100.880 -8.894  1.00 85.99  ? 524 ASN B C   1 
ATOM   7094 O  O   . ASN B  1 524 ? 19.830  102.004 -9.011  1.00 89.63  ? 524 ASN B O   1 
ATOM   7095 C  CB  . ASN B  1 524 ? 21.260  99.575  -9.875  1.00 88.19  ? 524 ASN B CB  1 
ATOM   7096 C  CG  . ASN B  1 524 ? 20.597  99.228  -11.199 1.00 86.94  ? 524 ASN B CG  1 
ATOM   7097 O  OD1 . ASN B  1 524 ? 19.889  100.044 -11.789 1.00 80.16  ? 524 ASN B OD1 1 
ATOM   7098 N  ND2 . ASN B  1 524 ? 20.839  98.013  -11.680 1.00 89.68  ? 524 ASN B ND2 1 
ATOM   7099 N  N   . GLY B  1 525 ? 18.019  100.670 -8.946  1.00 77.48  ? 525 GLY B N   1 
ATOM   7100 C  CA  . GLY B  1 525 ? 17.052  101.784 -9.013  1.00 84.11  ? 525 GLY B CA  1 
ATOM   7101 C  C   . GLY B  1 525 ? 16.349  101.934 -10.350 1.00 87.09  ? 525 GLY B C   1 
ATOM   7102 O  O   . GLY B  1 525 ? 15.146  102.197 -10.397 1.00 91.12  ? 525 GLY B O   1 
ATOM   7103 N  N   . ALA B  1 526 ? 17.104  101.787 -11.436 1.00 83.47  ? 526 ALA B N   1 
ATOM   7104 C  CA  . ALA B  1 526 ? 16.526  101.608 -12.773 1.00 77.90  ? 526 ALA B CA  1 
ATOM   7105 C  C   . ALA B  1 526 ? 15.768  100.273 -12.860 1.00 79.61  ? 526 ALA B C   1 
ATOM   7106 O  O   . ALA B  1 526 ? 14.820  100.134 -13.637 1.00 78.04  ? 526 ALA B O   1 
ATOM   7107 C  CB  . ALA B  1 526 ? 17.614  101.670 -13.832 1.00 75.65  ? 526 ALA B CB  1 
ATOM   7108 N  N   . ALA B  1 527 ? 16.213  99.302  -12.062 1.00 78.08  ? 527 ALA B N   1 
ATOM   7109 C  CA  . ALA B  1 527 ? 15.543  98.013  -11.890 1.00 71.74  ? 527 ALA B CA  1 
ATOM   7110 C  C   . ALA B  1 527 ? 14.306  98.095  -10.989 1.00 64.67  ? 527 ALA B C   1 
ATOM   7111 O  O   . ALA B  1 527 ? 13.341  97.361  -11.207 1.00 67.55  ? 527 ALA B O   1 
ATOM   7112 C  CB  . ALA B  1 527 ? 16.525  97.002  -11.327 1.00 74.02  ? 527 ALA B CB  1 
ATOM   7113 N  N   . ARG B  1 528 ? 14.346  98.957  -9.971  1.00 59.91  ? 528 ARG B N   1 
ATOM   7114 C  CA  . ARG B  1 528 ? 13.172  99.229  -9.123  1.00 59.93  ? 528 ARG B CA  1 
ATOM   7115 C  C   . ARG B  1 528 ? 11.970  99.740  -9.923  1.00 57.50  ? 528 ARG B C   1 
ATOM   7116 O  O   . ARG B  1 528 ? 10.838  99.337  -9.660  1.00 54.00  ? 528 ARG B O   1 
ATOM   7117 C  CB  . ARG B  1 528 ? 13.510  100.223 -8.002  1.00 64.77  ? 528 ARG B CB  1 
ATOM   7118 C  CG  . ARG B  1 528 ? 14.245  99.605  -6.818  1.00 74.95  ? 528 ARG B CG  1 
ATOM   7119 C  CD  . ARG B  1 528 ? 14.120  100.452 -5.559  1.00 76.56  ? 528 ARG B CD  1 
ATOM   7120 N  NE  . ARG B  1 528 ? 14.799  101.743 -5.693  1.00 78.89  ? 528 ARG B NE  1 
ATOM   7121 C  CZ  . ARG B  1 528 ? 16.090  101.979 -5.440  1.00 80.79  ? 528 ARG B CZ  1 
ATOM   7122 N  NH1 . ARG B  1 528 ? 16.913  101.015 -5.021  1.00 81.59  ? 528 ARG B NH1 1 
ATOM   7123 N  NH2 . ARG B  1 528 ? 16.571  103.209 -5.610  1.00 83.55  ? 528 ARG B NH2 1 
ATOM   7124 N  N   . GLN B  1 529 ? 12.233  100.620 -10.889 1.00 60.50  ? 529 GLN B N   1 
ATOM   7125 C  CA  . GLN B  1 529 ? 11.205  101.144 -11.802 1.00 62.44  ? 529 GLN B CA  1 
ATOM   7126 C  C   . GLN B  1 529 ? 10.508  100.044 -12.615 1.00 58.91  ? 529 GLN B C   1 
ATOM   7127 O  O   . GLN B  1 529 ? 9.315   100.140 -12.911 1.00 54.45  ? 529 GLN B O   1 
ATOM   7128 C  CB  . GLN B  1 529 ? 11.828  102.147 -12.771 1.00 73.04  ? 529 GLN B CB  1 
ATOM   7129 C  CG  . GLN B  1 529 ? 12.310  103.442 -12.134 1.00 78.99  ? 529 GLN B CG  1 
ATOM   7130 C  CD  . GLN B  1 529 ? 13.146  104.290 -13.081 1.00 89.89  ? 529 GLN B CD  1 
ATOM   7131 O  OE1 . GLN B  1 529 ? 13.270  103.989 -14.270 1.00 98.20  ? 529 GLN B OE1 1 
ATOM   7132 N  NE2 . GLN B  1 529 ? 13.727  105.360 -12.553 1.00 94.22  ? 529 GLN B NE2 1 
ATOM   7133 N  N   . ALA B  1 530 ? 11.273  99.022  -12.992 1.00 59.57  ? 530 ALA B N   1 
ATOM   7134 C  CA  . ALA B  1 530 ? 10.751  97.861  -13.716 1.00 62.14  ? 530 ALA B CA  1 
ATOM   7135 C  C   . ALA B  1 530 ? 9.891   96.956  -12.832 1.00 63.71  ? 530 ALA B C   1 
ATOM   7136 O  O   . ALA B  1 530 ? 8.887   96.408  -13.295 1.00 65.82  ? 530 ALA B O   1 
ATOM   7137 C  CB  . ALA B  1 530 ? 11.898  97.068  -14.324 1.00 60.14  ? 530 ALA B CB  1 
ATOM   7138 N  N   . ILE B  1 531 ? 10.295  96.796  -11.570 1.00 61.71  ? 531 ILE B N   1 
ATOM   7139 C  CA  . ILE B  1 531 ? 9.553   95.979  -10.599 1.00 62.22  ? 531 ILE B CA  1 
ATOM   7140 C  C   . ILE B  1 531 ? 8.218   96.642  -10.254 1.00 64.51  ? 531 ILE B C   1 
ATOM   7141 O  O   . ILE B  1 531 ? 7.183   95.972  -10.253 1.00 56.55  ? 531 ILE B O   1 
ATOM   7142 C  CB  . ILE B  1 531 ? 10.364  95.725  -9.301  1.00 64.12  ? 531 ILE B CB  1 
ATOM   7143 C  CG1 . ILE B  1 531 ? 11.650  94.945  -9.603  1.00 62.38  ? 531 ILE B CG1 1 
ATOM   7144 C  CG2 . ILE B  1 531 ? 9.551   94.920  -8.283  1.00 64.11  ? 531 ILE B CG2 1 
ATOM   7145 C  CD1 . ILE B  1 531 ? 12.719  95.099  -8.542  1.00 63.27  ? 531 ILE B CD1 1 
ATOM   7146 N  N   . VAL B  1 532 ? 8.249   97.943  -9.950  1.00 69.30  ? 532 VAL B N   1 
ATOM   7147 C  CA  . VAL B  1 532 ? 7.009   98.692  -9.657  1.00 71.48  ? 532 VAL B CA  1 
ATOM   7148 C  C   . VAL B  1 532 ? 6.047   98.674  -10.841 1.00 66.55  ? 532 VAL B C   1 
ATOM   7149 O  O   . VAL B  1 532 ? 4.848   98.531  -10.646 1.00 60.80  ? 532 VAL B O   1 
ATOM   7150 C  CB  . VAL B  1 532 ? 7.225   100.160 -9.185  1.00 72.95  ? 532 VAL B CB  1 
ATOM   7151 C  CG1 . VAL B  1 532 ? 7.997   100.193 -7.878  1.00 75.29  ? 532 VAL B CG1 1 
ATOM   7152 C  CG2 . VAL B  1 532 ? 7.909   101.027 -10.232 1.00 75.82  ? 532 VAL B CG2 1 
ATOM   7153 N  N   . PHE B  1 533 ? 6.583   98.803  -12.056 1.00 67.38  ? 533 PHE B N   1 
ATOM   7154 C  CA  . PHE B  1 533 ? 5.780   98.718  -13.276 1.00 69.43  ? 533 PHE B CA  1 
ATOM   7155 C  C   . PHE B  1 533 ? 5.137   97.338  -13.445 1.00 69.44  ? 533 PHE B C   1 
ATOM   7156 O  O   . PHE B  1 533 ? 3.934   97.235  -13.698 1.00 71.53  ? 533 PHE B O   1 
ATOM   7157 C  CB  . PHE B  1 533 ? 6.617   99.043  -14.520 1.00 68.56  ? 533 PHE B CB  1 
ATOM   7158 C  CG  . PHE B  1 533 ? 5.916   98.708  -15.810 1.00 69.54  ? 533 PHE B CG  1 
ATOM   7159 C  CD1 . PHE B  1 533 ? 4.920   99.540  -16.308 1.00 68.19  ? 533 PHE B CD1 1 
ATOM   7160 C  CD2 . PHE B  1 533 ? 6.215   97.535  -16.501 1.00 70.52  ? 533 PHE B CD2 1 
ATOM   7161 C  CE1 . PHE B  1 533 ? 4.252   99.225  -17.482 1.00 68.27  ? 533 PHE B CE1 1 
ATOM   7162 C  CE2 . PHE B  1 533 ? 5.549   97.213  -17.674 1.00 71.39  ? 533 PHE B CE2 1 
ATOM   7163 C  CZ  . PHE B  1 533 ? 4.566   98.059  -18.165 1.00 71.03  ? 533 PHE B CZ  1 
ATOM   7164 N  N   . GLU B  1 534 ? 5.952   96.291  -13.336 1.00 65.98  ? 534 GLU B N   1 
ATOM   7165 C  CA  . GLU B  1 534 ? 5.478   94.906  -13.487 1.00 64.97  ? 534 GLU B CA  1 
ATOM   7166 C  C   . GLU B  1 534 ? 4.508   94.477  -12.376 1.00 63.13  ? 534 GLU B C   1 
ATOM   7167 O  O   . GLU B  1 534 ? 3.645   93.625  -12.608 1.00 54.04  ? 534 GLU B O   1 
ATOM   7168 C  CB  . GLU B  1 534 ? 6.667   93.931  -13.569 1.00 65.44  ? 534 GLU B CB  1 
ATOM   7169 C  CG  . GLU B  1 534 ? 6.306   92.467  -13.842 1.00 62.21  ? 534 GLU B CG  1 
ATOM   7170 C  CD  . GLU B  1 534 ? 5.544   92.252  -15.139 1.00 62.76  ? 534 GLU B CD  1 
ATOM   7171 O  OE1 . GLU B  1 534 ? 5.809   92.971  -16.128 1.00 63.35  ? 534 GLU B OE1 1 
ATOM   7172 O  OE2 . GLU B  1 534 ? 4.680   91.352  -15.170 1.00 54.98  ? 534 GLU B OE2 1 
ATOM   7173 N  N   . TYR B  1 535 ? 4.654   95.066  -11.188 1.00 65.15  ? 535 TYR B N   1 
ATOM   7174 C  CA  . TYR B  1 535 ? 3.779   94.774  -10.045 1.00 61.01  ? 535 TYR B CA  1 
ATOM   7175 C  C   . TYR B  1 535 ? 2.976   95.991  -9.577  1.00 63.71  ? 535 TYR B C   1 
ATOM   7176 O  O   . TYR B  1 535 ? 2.959   96.327  -8.393  1.00 62.19  ? 535 TYR B O   1 
ATOM   7177 C  CB  . TYR B  1 535 ? 4.603   94.174  -8.905  1.00 51.90  ? 535 TYR B CB  1 
ATOM   7178 C  CG  . TYR B  1 535 ? 5.135   92.810  -9.254  1.00 45.59  ? 535 TYR B CG  1 
ATOM   7179 C  CD1 . TYR B  1 535 ? 4.311   91.687  -9.186  1.00 45.91  ? 535 TYR B CD1 1 
ATOM   7180 C  CD2 . TYR B  1 535 ? 6.452   92.636  -9.678  1.00 39.93  ? 535 TYR B CD2 1 
ATOM   7181 C  CE1 . TYR B  1 535 ? 4.786   90.427  -9.515  1.00 46.83  ? 535 TYR B CE1 1 
ATOM   7182 C  CE2 . TYR B  1 535 ? 6.938   91.379  -10.009 1.00 40.42  ? 535 TYR B CE2 1 
ATOM   7183 C  CZ  . TYR B  1 535 ? 6.103   90.278  -9.927  1.00 42.41  ? 535 TYR B CZ  1 
ATOM   7184 O  OH  . TYR B  1 535 ? 6.586   89.031  -10.255 1.00 37.68  ? 535 TYR B OH  1 
ATOM   7185 N  N   . THR B  1 536 ? 2.317   96.651  -10.525 1.00 64.17  ? 536 THR B N   1 
ATOM   7186 C  CA  . THR B  1 536 ? 1.284   97.642  -10.213 1.00 66.16  ? 536 THR B CA  1 
ATOM   7187 C  C   . THR B  1 536 ? 0.066   97.397  -11.105 1.00 58.58  ? 536 THR B C   1 
ATOM   7188 O  O   . THR B  1 536 ? 0.201   97.042  -12.280 1.00 53.96  ? 536 THR B O   1 
ATOM   7189 C  CB  . THR B  1 536 ? 1.788   99.101  -10.331 1.00 70.60  ? 536 THR B CB  1 
ATOM   7190 O  OG1 . THR B  1 536 ? 0.780   100.002 -9.850  1.00 85.51  ? 536 THR B OG1 1 
ATOM   7191 C  CG2 . THR B  1 536 ? 2.140   99.470  -11.748 1.00 70.79  ? 536 THR B CG2 1 
ATOM   7192 N  N   . ASP B  1 537 ? -1.115  97.577  -10.524 1.00 61.53  ? 537 ASP B N   1 
ATOM   7193 C  CA  . ASP B  1 537 ? -2.382  97.386  -11.218 1.00 62.79  ? 537 ASP B CA  1 
ATOM   7194 C  C   . ASP B  1 537 ? -2.734  98.667  -11.971 1.00 63.22  ? 537 ASP B C   1 
ATOM   7195 O  O   . ASP B  1 537 ? -3.199  99.627  -11.375 1.00 60.44  ? 537 ASP B O   1 
ATOM   7196 C  CB  . ASP B  1 537 ? -3.461  97.025  -10.190 1.00 64.15  ? 537 ASP B CB  1 
ATOM   7197 C  CG  . ASP B  1 537 ? -4.841  96.827  -10.804 1.00 68.63  ? 537 ASP B CG  1 
ATOM   7198 O  OD1 . ASP B  1 537 ? -4.938  96.339  -11.951 1.00 75.55  ? 537 ASP B OD1 1 
ATOM   7199 O  OD2 . ASP B  1 537 ? -5.838  97.152  -10.123 1.00 66.95  ? 537 ASP B OD2 1 
ATOM   7200 N  N   . TRP B  1 538 ? -2.512  98.671  -13.282 1.00 63.73  ? 538 TRP B N   1 
ATOM   7201 C  CA  . TRP B  1 538 ? -2.768  99.853  -14.121 1.00 61.65  ? 538 TRP B CA  1 
ATOM   7202 C  C   . TRP B  1 538 ? -4.257  100.152 -14.360 1.00 66.34  ? 538 TRP B C   1 
ATOM   7203 O  O   . TRP B  1 538 ? -4.608  101.224 -14.860 1.00 73.63  ? 538 TRP B O   1 
ATOM   7204 C  CB  . TRP B  1 538 ? -2.003  99.721  -15.438 1.00 58.30  ? 538 TRP B CB  1 
ATOM   7205 C  CG  . TRP B  1 538 ? -0.528  99.814  -15.211 1.00 54.01  ? 538 TRP B CG  1 
ATOM   7206 C  CD1 . TRP B  1 538 ? 0.383   98.802  -15.293 1.00 51.25  ? 538 TRP B CD1 1 
ATOM   7207 C  CD2 . TRP B  1 538 ? 0.200   100.980 -14.808 1.00 53.89  ? 538 TRP B CD2 1 
ATOM   7208 N  NE1 . TRP B  1 538 ? 1.641   99.271  -14.990 1.00 50.99  ? 538 TRP B NE1 1 
ATOM   7209 C  CE2 . TRP B  1 538 ? 1.558   100.607 -14.695 1.00 54.69  ? 538 TRP B CE2 1 
ATOM   7210 C  CE3 . TRP B  1 538 ? -0.162  102.312 -14.552 1.00 53.37  ? 538 TRP B CE3 1 
ATOM   7211 C  CZ2 . TRP B  1 538 ? 2.561   101.519 -14.323 1.00 55.31  ? 538 TRP B CZ2 1 
ATOM   7212 C  CZ3 . TRP B  1 538 ? 0.837   103.221 -14.185 1.00 55.53  ? 538 TRP B CZ3 1 
ATOM   7213 C  CH2 . TRP B  1 538 ? 2.181   102.815 -14.073 1.00 54.11  ? 538 TRP B CH2 1 
ATOM   7214 N  N   . THR B  1 539 ? -5.113  99.193  -14.012 1.00 63.89  ? 539 THR B N   1 
ATOM   7215 C  CA  . THR B  1 539 ? -6.556  99.401  -13.892 1.00 61.99  ? 539 THR B CA  1 
ATOM   7216 C  C   . THR B  1 539 ? -6.867  100.467 -12.834 1.00 59.67  ? 539 THR B C   1 
ATOM   7217 O  O   . THR B  1 539 ? -7.666  101.373 -13.074 1.00 59.71  ? 539 THR B O   1 
ATOM   7218 C  CB  . THR B  1 539 ? -7.248  98.080  -13.498 1.00 65.61  ? 539 THR B CB  1 
ATOM   7219 O  OG1 . THR B  1 539 ? -6.809  97.029  -14.370 1.00 61.33  ? 539 THR B OG1 1 
ATOM   7220 C  CG2 . THR B  1 539 ? -8.767  98.192  -13.577 1.00 72.03  ? 539 THR B CG2 1 
ATOM   7221 N  N   . GLU B  1 540 ? -6.239  100.328 -11.665 1.00 59.90  ? 540 GLU B N   1 
ATOM   7222 C  CA  . GLU B  1 540 ? -6.334  101.306 -10.570 1.00 62.37  ? 540 GLU B CA  1 
ATOM   7223 C  C   . GLU B  1 540 ? -5.000  101.363 -9.793  1.00 57.34  ? 540 GLU B C   1 
ATOM   7224 O  O   . GLU B  1 540 ? -4.848  100.677 -8.777  1.00 53.13  ? 540 GLU B O   1 
ATOM   7225 C  CB  . GLU B  1 540 ? -7.504  100.964 -9.631  1.00 69.95  ? 540 GLU B CB  1 
ATOM   7226 C  CG  . GLU B  1 540 ? -7.859  102.087 -8.658  1.00 75.30  ? 540 GLU B CG  1 
ATOM   7227 C  CD  . GLU B  1 540 ? -8.947  101.719 -7.659  1.00 74.77  ? 540 GLU B CD  1 
ATOM   7228 O  OE1 . GLU B  1 540 ? -9.763  100.816 -7.947  1.00 72.54  ? 540 GLU B OE1 1 
ATOM   7229 O  OE2 . GLU B  1 540 ? -8.988  102.344 -6.576  1.00 71.74  ? 540 GLU B OE2 1 
ATOM   7230 N  N   . PRO B  1 541 ? -4.020  102.163 -10.282 1.00 61.14  ? 541 PRO B N   1 
ATOM   7231 C  CA  . PRO B  1 541 ? -2.657  102.258 -9.708  1.00 64.29  ? 541 PRO B CA  1 
ATOM   7232 C  C   . PRO B  1 541 ? -2.547  102.523 -8.199  1.00 64.48  ? 541 PRO B C   1 
ATOM   7233 O  O   . PRO B  1 541 ? -1.671  101.948 -7.547  1.00 59.79  ? 541 PRO B O   1 
ATOM   7234 C  CB  . PRO B  1 541 ? -2.035  103.422 -10.485 1.00 63.04  ? 541 PRO B CB  1 
ATOM   7235 C  CG  . PRO B  1 541 ? -2.721  103.397 -11.802 1.00 63.20  ? 541 PRO B CG  1 
ATOM   7236 C  CD  . PRO B  1 541 ? -4.125  102.932 -11.540 1.00 61.87  ? 541 PRO B CD  1 
ATOM   7237 N  N   . ASP B  1 542 ? -3.425  103.373 -7.665  1.00 62.67  ? 542 ASP B N   1 
ATOM   7238 C  CA  . ASP B  1 542 ? -3.399  103.759 -6.240  1.00 57.72  ? 542 ASP B CA  1 
ATOM   7239 C  C   . ASP B  1 542 ? -4.446  103.040 -5.367  1.00 60.21  ? 542 ASP B C   1 
ATOM   7240 O  O   . ASP B  1 542 ? -4.799  103.540 -4.295  1.00 59.81  ? 542 ASP B O   1 
ATOM   7241 C  CB  . ASP B  1 542 ? -3.574  105.282 -6.103  1.00 58.36  ? 542 ASP B CB  1 
ATOM   7242 C  CG  . ASP B  1 542 ? -2.562  106.075 -6.922  1.00 61.54  ? 542 ASP B CG  1 
ATOM   7243 O  OD1 . ASP B  1 542 ? -1.534  105.506 -7.351  1.00 59.78  ? 542 ASP B OD1 1 
ATOM   7244 O  OD2 . ASP B  1 542 ? -2.800  107.283 -7.136  1.00 66.00  ? 542 ASP B OD2 1 
ATOM   7245 N  N   . ASN B  1 543 ? -4.935  101.878 -5.812  1.00 61.99  ? 543 ASN B N   1 
ATOM   7246 C  CA  . ASN B  1 543 ? -5.841  101.050 -5.000  1.00 61.63  ? 543 ASN B CA  1 
ATOM   7247 C  C   . ASN B  1 543 ? -5.058  100.457 -3.823  1.00 60.40  ? 543 ASN B C   1 
ATOM   7248 O  O   . ASN B  1 543 ? -4.069  99.754  -4.048  1.00 64.15  ? 543 ASN B O   1 
ATOM   7249 C  CB  . ASN B  1 543 ? -6.459  99.919  -5.834  1.00 59.31  ? 543 ASN B CB  1 
ATOM   7250 C  CG  . ASN B  1 543 ? -7.650  99.256  -5.146  1.00 58.07  ? 543 ASN B CG  1 
ATOM   7251 O  OD1 . ASN B  1 543 ? -7.644  99.022  -3.937  1.00 51.36  ? 543 ASN B OD1 1 
ATOM   7252 N  ND2 . ASN B  1 543 ? -8.678  98.942  -5.926  1.00 56.84  ? 543 ASN B ND2 1 
ATOM   7253 N  N   . PRO B  1 544 ? -5.483  100.741 -2.572  1.00 59.50  ? 544 PRO B N   1 
ATOM   7254 C  CA  . PRO B  1 544 ? -4.762  100.173 -1.423  1.00 57.85  ? 544 PRO B CA  1 
ATOM   7255 C  C   . PRO B  1 544 ? -4.772  98.637  -1.325  1.00 52.51  ? 544 PRO B C   1 
ATOM   7256 O  O   . PRO B  1 544 ? -3.799  98.053  -0.842  1.00 48.63  ? 544 PRO B O   1 
ATOM   7257 C  CB  . PRO B  1 544 ? -5.471  100.797 -0.213  1.00 62.22  ? 544 PRO B CB  1 
ATOM   7258 C  CG  . PRO B  1 544 ? -6.138  102.018 -0.738  1.00 62.93  ? 544 PRO B CG  1 
ATOM   7259 C  CD  . PRO B  1 544 ? -6.546  101.667 -2.133  1.00 60.79  ? 544 PRO B CD  1 
ATOM   7260 N  N   . ASN B  1 545 ? -5.856  98.003  -1.774  1.00 48.45  ? 545 ASN B N   1 
ATOM   7261 C  CA  . ASN B  1 545 ? -5.966  96.532  -1.788  1.00 48.51  ? 545 ASN B CA  1 
ATOM   7262 C  C   . ASN B  1 545 ? -5.040  95.913  -2.831  1.00 48.40  ? 545 ASN B C   1 
ATOM   7263 O  O   . ASN B  1 545 ? -4.358  94.923  -2.563  1.00 48.79  ? 545 ASN B O   1 
ATOM   7264 C  CB  . ASN B  1 545 ? -7.404  96.087  -2.090  1.00 47.08  ? 545 ASN B CB  1 
ATOM   7265 C  CG  . ASN B  1 545 ? -8.345  96.289  -0.919  1.00 45.81  ? 545 ASN B CG  1 
ATOM   7266 O  OD1 . ASN B  1 545 ? -8.086  95.822  0.190   1.00 43.66  ? 545 ASN B OD1 1 
ATOM   7267 N  ND2 . ASN B  1 545 ? -9.460  96.970  -1.167  1.00 54.03  ? 545 ASN B ND2 1 
ATOM   7268 N  N   . SER B  1 546 ? -5.046  96.500  -4.024  1.00 48.43  ? 546 SER B N   1 
ATOM   7269 C  CA  . SER B  1 546 ? -4.248  96.012  -5.147  1.00 48.35  ? 546 SER B CA  1 
ATOM   7270 C  C   . SER B  1 546 ? -2.740  96.225  -4.947  1.00 45.67  ? 546 SER B C   1 
ATOM   7271 O  O   . SER B  1 546 ? -1.936  95.383  -5.351  1.00 43.24  ? 546 SER B O   1 
ATOM   7272 C  CB  . SER B  1 546 ? -4.713  96.673  -6.448  1.00 48.99  ? 546 SER B CB  1 
ATOM   7273 O  OG  . SER B  1 546 ? -4.432  95.839  -7.556  1.00 52.26  ? 546 SER B OG  1 
ATOM   7274 N  N   . ASN B  1 547 ? -2.370  97.351  -4.335  1.00 42.89  ? 547 ASN B N   1 
ATOM   7275 C  CA  . ASN B  1 547 ? -0.965  97.634  -3.973  1.00 45.22  ? 547 ASN B CA  1 
ATOM   7276 C  C   . ASN B  1 547 ? -0.416  96.664  -2.909  1.00 53.08  ? 547 ASN B C   1 
ATOM   7277 O  O   . ASN B  1 547 ? 0.783   96.375  -2.894  1.00 51.00  ? 547 ASN B O   1 
ATOM   7278 C  CB  . ASN B  1 547 ? -0.795  99.088  -3.487  1.00 42.93  ? 547 ASN B CB  1 
ATOM   7279 C  CG  . ASN B  1 547 ? -0.416  100.049 -4.603  1.00 41.34  ? 547 ASN B CG  1 
ATOM   7280 O  OD1 . ASN B  1 547 ? 0.663   99.945  -5.189  1.00 41.31  ? 547 ASN B OD1 1 
ATOM   7281 N  ND2 . ASN B  1 547 ? -1.294  101.007 -4.885  1.00 42.57  ? 547 ASN B ND2 1 
ATOM   7282 N  N   . ARG B  1 548 ? -1.291  96.188  -2.022  1.00 56.48  ? 548 ARG B N   1 
ATOM   7283 C  CA  . ARG B  1 548 ? -0.937  95.184  -1.008  1.00 55.82  ? 548 ARG B CA  1 
ATOM   7284 C  C   . ARG B  1 548 ? -0.653  93.827  -1.650  1.00 56.97  ? 548 ARG B C   1 
ATOM   7285 O  O   . ARG B  1 548 ? 0.373   93.204  -1.371  1.00 52.83  ? 548 ARG B O   1 
ATOM   7286 C  CB  . ARG B  1 548 ? -2.065  95.049  0.027   1.00 55.90  ? 548 ARG B CB  1 
ATOM   7287 C  CG  . ARG B  1 548 ? -1.984  93.812  0.922   1.00 56.02  ? 548 ARG B CG  1 
ATOM   7288 C  CD  . ARG B  1 548 ? -3.107  93.734  1.949   1.00 57.03  ? 548 ARG B CD  1 
ATOM   7289 N  NE  . ARG B  1 548 ? -4.431  93.971  1.369   1.00 53.52  ? 548 ARG B NE  1 
ATOM   7290 C  CZ  . ARG B  1 548 ? -5.128  93.101  0.633   1.00 49.77  ? 548 ARG B CZ  1 
ATOM   7291 N  NH1 . ARG B  1 548 ? -4.650  91.889  0.350   1.00 54.79  ? 548 ARG B NH1 1 
ATOM   7292 N  NH2 . ARG B  1 548 ? -6.325  93.451  0.166   1.00 49.45  ? 548 ARG B NH2 1 
ATOM   7293 N  N   . ASP B  1 549 ? -1.582  93.376  -2.490  1.00 57.04  ? 549 ASP B N   1 
ATOM   7294 C  CA  . ASP B  1 549 ? -1.453  92.099  -3.206  1.00 56.84  ? 549 ASP B CA  1 
ATOM   7295 C  C   . ASP B  1 549 ? -0.235  92.074  -4.133  1.00 57.56  ? 549 ASP B C   1 
ATOM   7296 O  O   . ASP B  1 549 ? 0.355   91.021  -4.353  1.00 54.67  ? 549 ASP B O   1 
ATOM   7297 C  CB  . ASP B  1 549 ? -2.728  91.803  -4.005  1.00 57.77  ? 549 ASP B CB  1 
ATOM   7298 C  CG  . ASP B  1 549 ? -2.803  90.359  -4.485  1.00 58.72  ? 549 ASP B CG  1 
ATOM   7299 O  OD1 . ASP B  1 549 ? -2.737  89.442  -3.638  1.00 54.39  ? 549 ASP B OD1 1 
ATOM   7300 O  OD2 . ASP B  1 549 ? -2.936  90.145  -5.709  1.00 57.98  ? 549 ASP B OD2 1 
ATOM   7301 N  N   . ALA B  1 550 ? 0.126   93.238  -4.671  1.00 58.01  ? 550 ALA B N   1 
ATOM   7302 C  CA  . ALA B  1 550 ? 1.332   93.395  -5.487  1.00 55.77  ? 550 ALA B CA  1 
ATOM   7303 C  C   . ALA B  1 550 ? 2.630   93.053  -4.744  1.00 57.51  ? 550 ALA B C   1 
ATOM   7304 O  O   . ALA B  1 550 ? 3.581   92.560  -5.356  1.00 65.03  ? 550 ALA B O   1 
ATOM   7305 C  CB  . ALA B  1 550 ? 1.404   94.808  -6.036  1.00 55.26  ? 550 ALA B CB  1 
ATOM   7306 N  N   . LEU B  1 551 ? 2.665   93.322  -3.438  1.00 56.71  ? 551 LEU B N   1 
ATOM   7307 C  CA  . LEU B  1 551 ? 3.811   92.955  -2.596  1.00 54.84  ? 551 LEU B CA  1 
ATOM   7308 C  C   . LEU B  1 551 ? 3.897   91.446  -2.379  1.00 53.36  ? 551 LEU B C   1 
ATOM   7309 O  O   . LEU B  1 551 ? 4.987   90.878  -2.420  1.00 57.86  ? 551 LEU B O   1 
ATOM   7310 C  CB  . LEU B  1 551 ? 3.766   93.677  -1.245  1.00 56.11  ? 551 LEU B CB  1 
ATOM   7311 C  CG  . LEU B  1 551 ? 3.917   95.199  -1.303  1.00 57.56  ? 551 LEU B CG  1 
ATOM   7312 C  CD1 . LEU B  1 551 ? 3.594   95.826  0.045   1.00 58.73  ? 551 LEU B CD1 1 
ATOM   7313 C  CD2 . LEU B  1 551 ? 5.313   95.604  -1.757  1.00 55.95  ? 551 LEU B CD2 1 
ATOM   7314 N  N   . ASP B  1 552 ? 2.751   90.811  -2.136  1.00 50.11  ? 552 ASP B N   1 
ATOM   7315 C  CA  . ASP B  1 552 ? 2.671   89.345  -2.057  1.00 48.59  ? 552 ASP B CA  1 
ATOM   7316 C  C   . ASP B  1 552 ? 3.265   88.671  -3.294  1.00 46.44  ? 552 ASP B C   1 
ATOM   7317 O  O   . ASP B  1 552 ? 4.017   87.698  -3.179  1.00 43.70  ? 552 ASP B O   1 
ATOM   7318 C  CB  . ASP B  1 552 ? 1.219   88.886  -1.877  1.00 48.49  ? 552 ASP B CB  1 
ATOM   7319 C  CG  . ASP B  1 552 ? 1.030   87.409  -2.188  1.00 46.84  ? 552 ASP B CG  1 
ATOM   7320 O  OD1 . ASP B  1 552 ? 1.439   86.568  -1.360  1.00 46.20  ? 552 ASP B OD1 1 
ATOM   7321 O  OD2 . ASP B  1 552 ? 0.483   87.096  -3.268  1.00 52.88  ? 552 ASP B OD2 1 
ATOM   7322 N  N   . LYS B  1 553 ? 2.924   89.199  -4.466  1.00 45.58  ? 553 LYS B N   1 
ATOM   7323 C  CA  . LYS B  1 553 ? 3.311   88.591  -5.737  1.00 46.29  ? 553 LYS B CA  1 
ATOM   7324 C  C   . LYS B  1 553 ? 4.792   88.759  -6.061  1.00 45.16  ? 553 LYS B C   1 
ATOM   7325 O  O   . LYS B  1 553 ? 5.438   87.794  -6.455  1.00 44.62  ? 553 LYS B O   1 
ATOM   7326 C  CB  . LYS B  1 553 ? 2.447   89.129  -6.883  1.00 49.26  ? 553 LYS B CB  1 
ATOM   7327 C  CG  . LYS B  1 553 ? 0.960   88.808  -6.766  1.00 50.78  ? 553 LYS B CG  1 
ATOM   7328 C  CD  . LYS B  1 553 ? 0.661   87.313  -6.765  1.00 50.02  ? 553 LYS B CD  1 
ATOM   7329 C  CE  . LYS B  1 553 ? -0.831  87.036  -6.678  1.00 53.77  ? 553 LYS B CE  1 
ATOM   7330 N  NZ  . LYS B  1 553 ? -1.349  87.157  -5.287  1.00 55.90  ? 553 LYS B NZ  1 
ATOM   7331 N  N   . MET B  1 554 ? 5.330   89.965  -5.887  1.00 46.73  ? 554 MET B N   1 
ATOM   7332 C  CA  . MET B  1 554 ? 6.753   90.216  -6.188  1.00 53.23  ? 554 MET B CA  1 
ATOM   7333 C  C   . MET B  1 554 ? 7.714   89.347  -5.366  1.00 53.67  ? 554 MET B C   1 
ATOM   7334 O  O   . MET B  1 554 ? 8.785   88.977  -5.851  1.00 59.89  ? 554 MET B O   1 
ATOM   7335 C  CB  . MET B  1 554 ? 7.116   91.696  -6.028  1.00 55.03  ? 554 MET B CB  1 
ATOM   7336 C  CG  . MET B  1 554 ? 7.013   92.234  -4.615  1.00 60.49  ? 554 MET B CG  1 
ATOM   7337 S  SD  . MET B  1 554 ? 7.398   93.990  -4.543  1.00 73.55  ? 554 MET B SD  1 
ATOM   7338 C  CE  . MET B  1 554 ? 9.188   93.932  -4.580  1.00 70.34  ? 554 MET B CE  1 
ATOM   7339 N  N   . VAL B  1 555 ? 7.321   89.029  -4.134  1.00 50.06  ? 555 VAL B N   1 
ATOM   7340 C  CA  . VAL B  1 555 ? 8.093   88.137  -3.262  1.00 48.24  ? 555 VAL B CA  1 
ATOM   7341 C  C   . VAL B  1 555 ? 7.734   86.676  -3.552  1.00 48.75  ? 555 VAL B C   1 
ATOM   7342 O  O   . VAL B  1 555 ? 8.618   85.823  -3.622  1.00 52.01  ? 555 VAL B O   1 
ATOM   7343 C  CB  . VAL B  1 555 ? 7.862   88.469  -1.770  1.00 45.81  ? 555 VAL B CB  1 
ATOM   7344 C  CG1 . VAL B  1 555 ? 8.743   87.618  -0.864  1.00 43.81  ? 555 VAL B CG1 1 
ATOM   7345 C  CG2 . VAL B  1 555 ? 8.158   89.938  -1.505  1.00 47.84  ? 555 VAL B CG2 1 
ATOM   7346 N  N   . GLY B  1 556 ? 6.443   86.398  -3.715  1.00 50.61  ? 556 GLY B N   1 
ATOM   7347 C  CA  . GLY B  1 556 ? 5.962   85.049  -4.040  1.00 53.43  ? 556 GLY B CA  1 
ATOM   7348 C  C   . GLY B  1 556 ? 6.429   84.496  -5.381  1.00 55.59  ? 556 GLY B C   1 
ATOM   7349 O  O   . GLY B  1 556 ? 6.606   83.286  -5.526  1.00 50.10  ? 556 GLY B O   1 
ATOM   7350 N  N   . ASP B  1 557 ? 6.625   85.380  -6.357  1.00 59.00  ? 557 ASP B N   1 
ATOM   7351 C  CA  . ASP B  1 557 ? 7.088   84.992  -7.694  1.00 55.07  ? 557 ASP B CA  1 
ATOM   7352 C  C   . ASP B  1 557 ? 8.590   84.736  -7.698  1.00 49.34  ? 557 ASP B C   1 
ATOM   7353 O  O   . ASP B  1 557 ? 9.041   83.651  -8.065  1.00 52.89  ? 557 ASP B O   1 
ATOM   7354 C  CB  . ASP B  1 557 ? 6.743   86.080  -8.725  1.00 50.72  ? 557 ASP B CB  1 
ATOM   7355 C  CG  . ASP B  1 557 ? 5.256   86.130  -9.065  1.00 48.04  ? 557 ASP B CG  1 
ATOM   7356 O  OD1 . ASP B  1 557 ? 4.496   85.208  -8.690  1.00 41.33  ? 557 ASP B OD1 1 
ATOM   7357 O  OD2 . ASP B  1 557 ? 4.836   87.105  -9.720  1.00 45.95  ? 557 ASP B OD2 1 
ATOM   7358 N  N   . TYR B  1 558 ? 9.345   85.743  -7.266  1.00 44.01  ? 558 TYR B N   1 
ATOM   7359 C  CA  . TYR B  1 558 ? 10.814  85.736  -7.306  1.00 44.15  ? 558 TYR B CA  1 
ATOM   7360 C  C   . TYR B  1 558 ? 11.432  84.600  -6.483  1.00 45.25  ? 558 TYR B C   1 
ATOM   7361 O  O   . TYR B  1 558 ? 12.368  83.940  -6.939  1.00 42.72  ? 558 TYR B O   1 
ATOM   7362 C  CB  . TYR B  1 558 ? 11.339  87.097  -6.823  1.00 44.12  ? 558 TYR B CB  1 
ATOM   7363 C  CG  . TYR B  1 558 ? 12.849  87.237  -6.737  1.00 44.02  ? 558 TYR B CG  1 
ATOM   7364 C  CD1 . TYR B  1 558 ? 13.632  87.354  -7.887  1.00 46.77  ? 558 TYR B CD1 1 
ATOM   7365 C  CD2 . TYR B  1 558 ? 13.493  87.283  -5.500  1.00 40.97  ? 558 TYR B CD2 1 
ATOM   7366 C  CE1 . TYR B  1 558 ? 15.012  87.495  -7.804  1.00 46.11  ? 558 TYR B CE1 1 
ATOM   7367 C  CE2 . TYR B  1 558 ? 14.870  87.424  -5.405  1.00 40.96  ? 558 TYR B CE2 1 
ATOM   7368 C  CZ  . TYR B  1 558 ? 15.627  87.530  -6.559  1.00 43.84  ? 558 TYR B CZ  1 
ATOM   7369 O  OH  . TYR B  1 558 ? 16.993  87.669  -6.471  1.00 43.71  ? 558 TYR B OH  1 
ATOM   7370 N  N   . HIS B  1 559 ? 10.891  84.379  -5.286  1.00 47.22  ? 559 HIS B N   1 
ATOM   7371 C  CA  . HIS B  1 559 ? 11.415  83.377  -4.346  1.00 44.26  ? 559 HIS B CA  1 
ATOM   7372 C  C   . HIS B  1 559 ? 10.820  81.974  -4.476  1.00 42.47  ? 559 HIS B C   1 
ATOM   7373 O  O   . HIS B  1 559 ? 11.486  81.002  -4.110  1.00 46.61  ? 559 HIS B O   1 
ATOM   7374 C  CB  . HIS B  1 559 ? 11.246  83.869  -2.906  1.00 43.29  ? 559 HIS B CB  1 
ATOM   7375 C  CG  . HIS B  1 559 ? 12.069  85.077  -2.588  1.00 41.14  ? 559 HIS B CG  1 
ATOM   7376 N  ND1 . HIS B  1 559 ? 13.424  85.009  -2.345  1.00 40.44  ? 559 HIS B ND1 1 
ATOM   7377 C  CD2 . HIS B  1 559 ? 11.733  86.384  -2.482  1.00 41.00  ? 559 HIS B CD2 1 
ATOM   7378 C  CE1 . HIS B  1 559 ? 13.888  86.222  -2.106  1.00 41.36  ? 559 HIS B CE1 1 
ATOM   7379 N  NE2 . HIS B  1 559 ? 12.881  87.074  -2.177  1.00 42.84  ? 559 HIS B NE2 1 
ATOM   7380 N  N   . PHE B  1 560 ? 9.593   81.861  -4.986  1.00 44.21  ? 560 PHE B N   1 
ATOM   7381 C  CA  . PHE B  1 560 ? 8.896   80.562  -5.033  1.00 48.85  ? 560 PHE B CA  1 
ATOM   7382 C  C   . PHE B  1 560 ? 8.389   80.170  -6.425  1.00 54.08  ? 560 PHE B C   1 
ATOM   7383 O  O   . PHE B  1 560 ? 9.004   79.328  -7.081  1.00 59.42  ? 560 PHE B O   1 
ATOM   7384 C  CB  . PHE B  1 560 ? 7.779   80.521  -3.980  1.00 47.23  ? 560 PHE B CB  1 
ATOM   7385 C  CG  . PHE B  1 560 ? 8.267   80.817  -2.593  1.00 50.31  ? 560 PHE B CG  1 
ATOM   7386 C  CD1 . PHE B  1 560 ? 8.774   79.801  -1.790  1.00 52.43  ? 560 PHE B CD1 1 
ATOM   7387 C  CD2 . PHE B  1 560 ? 8.265   82.120  -2.103  1.00 54.86  ? 560 PHE B CD2 1 
ATOM   7388 C  CE1 . PHE B  1 560 ? 9.245   80.074  -0.514  1.00 51.63  ? 560 PHE B CE1 1 
ATOM   7389 C  CE2 . PHE B  1 560 ? 8.736   82.399  -0.828  1.00 55.28  ? 560 PHE B CE2 1 
ATOM   7390 C  CZ  . PHE B  1 560 ? 9.227   81.374  -0.032  1.00 52.92  ? 560 PHE B CZ  1 
ATOM   7391 N  N   . THR B  1 561 ? 7.297   80.791  -6.875  1.00 57.33  ? 561 THR B N   1 
ATOM   7392 C  CA  . THR B  1 561 ? 6.559   80.355  -8.078  1.00 52.69  ? 561 THR B CA  1 
ATOM   7393 C  C   . THR B  1 561 ? 7.429   80.186  -9.333  1.00 52.65  ? 561 THR B C   1 
ATOM   7394 O  O   . THR B  1 561 ? 7.294   79.199  -10.059 1.00 50.22  ? 561 THR B O   1 
ATOM   7395 C  CB  . THR B  1 561 ? 5.396   81.328  -8.402  1.00 48.89  ? 561 THR B CB  1 
ATOM   7396 O  OG1 . THR B  1 561 ? 4.602   81.542  -7.226  1.00 42.50  ? 561 THR B OG1 1 
ATOM   7397 C  CG2 . THR B  1 561 ? 4.496   80.785  -9.517  1.00 49.73  ? 561 THR B CG2 1 
ATOM   7398 N  N   . CYS B  1 562 ? 8.316   81.147  -9.570  1.00 50.62  ? 562 CYS B N   1 
ATOM   7399 C  CA  . CYS B  1 562 ? 9.083   81.220  -10.824 1.00 51.47  ? 562 CYS B CA  1 
ATOM   7400 C  C   . CYS B  1 562 ? 10.273  80.270  -10.891 1.00 47.82  ? 562 CYS B C   1 
ATOM   7401 O  O   . CYS B  1 562 ? 10.752  79.940  -11.978 1.00 48.52  ? 562 CYS B O   1 
ATOM   7402 C  CB  . CYS B  1 562 ? 9.529   82.658  -11.069 1.00 53.58  ? 562 CYS B CB  1 
ATOM   7403 S  SG  . CYS B  1 562 ? 8.109   83.756  -11.257 1.00 65.33  ? 562 CYS B SG  1 
ATOM   7404 N  N   . ASN B  1 563 ? 10.736  79.838  -9.726  1.00 52.14  ? 563 ASN B N   1 
ATOM   7405 C  CA  . ASN B  1 563 ? 11.792  78.839  -9.616  1.00 48.80  ? 563 ASN B CA  1 
ATOM   7406 C  C   . ASN B  1 563 ? 11.198  77.437  -9.769  1.00 46.73  ? 563 ASN B C   1 
ATOM   7407 O  O   . ASN B  1 563 ? 11.834  76.550  -10.343 1.00 49.34  ? 563 ASN B O   1 
ATOM   7408 C  CB  . ASN B  1 563 ? 12.509  79.000  -8.279  1.00 49.39  ? 563 ASN B CB  1 
ATOM   7409 C  CG  . ASN B  1 563 ? 13.007  80.420  -8.058  1.00 54.27  ? 563 ASN B CG  1 
ATOM   7410 O  OD1 . ASN B  1 563 ? 13.756  80.961  -8.872  1.00 56.60  ? 563 ASN B OD1 1 
ATOM   7411 N  ND2 . ASN B  1 563 ? 12.585  81.035  -6.958  1.00 54.78  ? 563 ASN B ND2 1 
ATOM   7412 N  N   . VAL B  1 564 ? 9.986   77.249  -9.244  1.00 42.08  ? 564 VAL B N   1 
ATOM   7413 C  CA  . VAL B  1 564 ? 9.203   76.024  -9.460  1.00 41.24  ? 564 VAL B CA  1 
ATOM   7414 C  C   . VAL B  1 564 ? 8.927   75.816  -10.955 1.00 45.01  ? 564 VAL B C   1 
ATOM   7415 O  O   . VAL B  1 564 ? 9.016   74.694  -11.459 1.00 43.82  ? 564 VAL B O   1 
ATOM   7416 C  CB  . VAL B  1 564 ? 7.862   76.065  -8.682  1.00 39.04  ? 564 VAL B CB  1 
ATOM   7417 C  CG1 . VAL B  1 564 ? 6.950   74.905  -9.068  1.00 38.31  ? 564 VAL B CG1 1 
ATOM   7418 C  CG2 . VAL B  1 564 ? 8.115   76.025  -7.182  1.00 41.63  ? 564 VAL B CG2 1 
ATOM   7419 N  N   . ASN B  1 565 ? 8.582   76.906  -11.639 1.00 46.69  ? 565 ASN B N   1 
ATOM   7420 C  CA  . ASN B  1 565 ? 8.292   76.885  -13.077 1.00 43.69  ? 565 ASN B CA  1 
ATOM   7421 C  C   . ASN B  1 565 ? 9.524   76.536  -13.917 1.00 42.52  ? 565 ASN B C   1 
ATOM   7422 O  O   . ASN B  1 565 ? 9.426   75.751  -14.863 1.00 42.84  ? 565 ASN B O   1 
ATOM   7423 C  CB  . ASN B  1 565 ? 7.712   78.234  -13.531 1.00 44.24  ? 565 ASN B CB  1 
ATOM   7424 C  CG  . ASN B  1 565 ? 6.267   78.433  -13.100 1.00 45.11  ? 565 ASN B CG  1 
ATOM   7425 O  OD1 . ASN B  1 565 ? 5.763   77.751  -12.205 1.00 46.14  ? 565 ASN B OD1 1 
ATOM   7426 N  ND2 . ASN B  1 565 ? 5.591   79.380  -13.741 1.00 45.92  ? 565 ASN B ND2 1 
ATOM   7427 N  N   . GLU B  1 566 ? 10.669  77.122  -13.566 1.00 44.56  ? 566 GLU B N   1 
ATOM   7428 C  CA  . GLU B  1 566 ? 11.938  76.860  -14.256 1.00 44.11  ? 566 GLU B CA  1 
ATOM   7429 C  C   . GLU B  1 566 ? 12.379  75.400  -14.122 1.00 43.99  ? 566 GLU B C   1 
ATOM   7430 O  O   . GLU B  1 566 ? 12.862  74.807  -15.089 1.00 44.41  ? 566 GLU B O   1 
ATOM   7431 C  CB  . GLU B  1 566 ? 13.045  77.775  -13.720 1.00 44.18  ? 566 GLU B CB  1 
ATOM   7432 C  CG  . GLU B  1 566 ? 14.351  77.716  -14.511 1.00 48.06  ? 566 GLU B CG  1 
ATOM   7433 C  CD  . GLU B  1 566 ? 15.504  78.403  -13.803 1.00 49.39  ? 566 GLU B CD  1 
ATOM   7434 O  OE1 . GLU B  1 566 ? 16.636  77.872  -13.855 1.00 45.04  ? 566 GLU B OE1 1 
ATOM   7435 O  OE2 . GLU B  1 566 ? 15.284  79.471  -13.190 1.00 54.19  ? 566 GLU B OE2 1 
ATOM   7436 N  N   . PHE B  1 567 ? 12.219  74.838  -12.926 1.00 48.05  ? 567 PHE B N   1 
ATOM   7437 C  CA  . PHE B  1 567 ? 12.584  73.440  -12.662 1.00 49.70  ? 567 PHE B CA  1 
ATOM   7438 C  C   . PHE B  1 567 ? 11.692  72.483  -13.449 1.00 47.68  ? 567 PHE B C   1 
ATOM   7439 O  O   . PHE B  1 567 ? 12.178  71.514  -14.032 1.00 42.97  ? 567 PHE B O   1 
ATOM   7440 C  CB  . PHE B  1 567 ? 12.502  73.127  -11.163 1.00 51.29  ? 567 PHE B CB  1 
ATOM   7441 C  CG  . PHE B  1 567 ? 13.144  71.817  -10.774 1.00 49.77  ? 567 PHE B CG  1 
ATOM   7442 C  CD1 . PHE B  1 567 ? 14.529  71.709  -10.664 1.00 47.04  ? 567 PHE B CD1 1 
ATOM   7443 C  CD2 . PHE B  1 567 ? 12.367  70.692  -10.507 1.00 51.90  ? 567 PHE B CD2 1 
ATOM   7444 C  CE1 . PHE B  1 567 ? 15.124  70.507  -10.300 1.00 47.53  ? 567 PHE B CE1 1 
ATOM   7445 C  CE2 . PHE B  1 567 ? 12.957  69.488  -10.144 1.00 49.95  ? 567 PHE B CE2 1 
ATOM   7446 C  CZ  . PHE B  1 567 ? 14.337  69.396  -10.038 1.00 48.65  ? 567 PHE B CZ  1 
ATOM   7447 N  N   . ALA B  1 568 ? 10.392  72.772  -13.456 1.00 48.53  ? 568 ALA B N   1 
ATOM   7448 C  CA  . ALA B  1 568 ? 9.411   72.015  -14.236 1.00 50.73  ? 568 ALA B CA  1 
ATOM   7449 C  C   . ALA B  1 568 ? 9.642   72.130  -15.745 1.00 54.21  ? 568 ALA B C   1 
ATOM   7450 O  O   . ALA B  1 568 ? 9.406   71.176  -16.488 1.00 57.65  ? 568 ALA B O   1 
ATOM   7451 C  CB  . ALA B  1 568 ? 8.007   72.486  -13.894 1.00 47.49  ? 568 ALA B CB  1 
ATOM   7452 N  N   . GLN B  1 569 ? 10.099  73.303  -16.181 1.00 53.72  ? 569 GLN B N   1 
ATOM   7453 C  CA  . GLN B  1 569 ? 10.324  73.588  -17.598 1.00 52.42  ? 569 GLN B CA  1 
ATOM   7454 C  C   . GLN B  1 569 ? 11.488  72.771  -18.148 1.00 47.57  ? 569 GLN B C   1 
ATOM   7455 O  O   . GLN B  1 569 ? 11.333  72.059  -19.141 1.00 51.53  ? 569 GLN B O   1 
ATOM   7456 C  CB  . GLN B  1 569 ? 10.583  75.090  -17.800 1.00 59.07  ? 569 GLN B CB  1 
ATOM   7457 C  CG  . GLN B  1 569 ? 10.847  75.537  -19.237 1.00 64.21  ? 569 GLN B CG  1 
ATOM   7458 C  CD  . GLN B  1 569 ? 9.719   75.196  -20.197 1.00 68.31  ? 569 GLN B CD  1 
ATOM   7459 O  OE1 . GLN B  1 569 ? 8.549   75.149  -19.814 1.00 67.88  ? 569 GLN B OE1 1 
ATOM   7460 N  NE2 . GLN B  1 569 ? 10.068  74.967  -21.457 1.00 63.78  ? 569 GLN B NE2 1 
ATOM   7461 N  N   . ARG B  1 570 ? 12.645  72.889  -17.498 1.00 47.30  ? 570 ARG B N   1 
ATOM   7462 C  CA  . ARG B  1 570 ? 13.852  72.155  -17.899 1.00 47.07  ? 570 ARG B CA  1 
ATOM   7463 C  C   . ARG B  1 570 ? 13.656  70.641  -17.855 1.00 50.45  ? 570 ARG B C   1 
ATOM   7464 O  O   . ARG B  1 570 ? 14.198  69.924  -18.695 1.00 55.31  ? 570 ARG B O   1 
ATOM   7465 C  CB  . ARG B  1 570 ? 15.048  72.542  -17.024 1.00 44.54  ? 570 ARG B CB  1 
ATOM   7466 C  CG  . ARG B  1 570 ? 15.549  73.967  -17.223 1.00 47.87  ? 570 ARG B CG  1 
ATOM   7467 C  CD  . ARG B  1 570 ? 16.212  74.203  -18.577 1.00 49.33  ? 570 ARG B CD  1 
ATOM   7468 N  NE  . ARG B  1 570 ? 17.333  73.284  -18.823 1.00 50.42  ? 570 ARG B NE  1 
ATOM   7469 C  CZ  . ARG B  1 570 ? 17.400  72.343  -19.774 1.00 43.50  ? 570 ARG B CZ  1 
ATOM   7470 N  NH1 . ARG B  1 570 ? 16.414  72.155  -20.644 1.00 41.92  ? 570 ARG B NH1 1 
ATOM   7471 N  NH2 . ARG B  1 570 ? 18.487  71.580  -19.864 1.00 41.94  ? 570 ARG B NH2 1 
ATOM   7472 N  N   . TYR B  1 571 ? 12.885  70.167  -16.878 1.00 52.94  ? 571 TYR B N   1 
ATOM   7473 C  CA  . TYR B  1 571 ? 12.521  68.746  -16.804 1.00 50.75  ? 571 TYR B CA  1 
ATOM   7474 C  C   . TYR B  1 571 ? 11.656  68.347  -17.993 1.00 50.64  ? 571 TYR B C   1 
ATOM   7475 O  O   . TYR B  1 571 ? 11.958  67.377  -18.688 1.00 50.73  ? 571 TYR B O   1 
ATOM   7476 C  CB  . TYR B  1 571 ? 11.809  68.400  -15.486 1.00 45.83  ? 571 TYR B CB  1 
ATOM   7477 C  CG  . TYR B  1 571 ? 12.696  67.648  -14.523 1.00 41.63  ? 571 TYR B CG  1 
ATOM   7478 C  CD1 . TYR B  1 571 ? 13.654  68.314  -13.761 1.00 41.76  ? 571 TYR B CD1 1 
ATOM   7479 C  CD2 . TYR B  1 571 ? 12.595  66.263  -14.389 1.00 39.92  ? 571 TYR B CD2 1 
ATOM   7480 C  CE1 . TYR B  1 571 ? 14.477  67.624  -12.884 1.00 40.51  ? 571 TYR B CE1 1 
ATOM   7481 C  CE2 . TYR B  1 571 ? 13.414  65.564  -13.514 1.00 39.32  ? 571 TYR B CE2 1 
ATOM   7482 C  CZ  . TYR B  1 571 ? 14.352  66.249  -12.763 1.00 38.81  ? 571 TYR B CZ  1 
ATOM   7483 O  OH  . TYR B  1 571 ? 15.169  65.563  -11.896 1.00 39.89  ? 571 TYR B OH  1 
ATOM   7484 N  N   . ALA B  1 572 ? 10.597  69.120  -18.222 1.00 48.46  ? 572 ALA B N   1 
ATOM   7485 C  CA  . ALA B  1 572 ? 9.667   68.888  -19.332 1.00 52.51  ? 572 ALA B CA  1 
ATOM   7486 C  C   . ALA B  1 572 ? 10.356  68.812  -20.698 1.00 51.15  ? 572 ALA B C   1 
ATOM   7487 O  O   . ALA B  1 572 ? 10.025  67.944  -21.510 1.00 50.67  ? 572 ALA B O   1 
ATOM   7488 C  CB  . ALA B  1 572 ? 8.590   69.964  -19.345 1.00 55.97  ? 572 ALA B CB  1 
ATOM   7489 N  N   . GLU B  1 573 ? 11.322  69.703  -20.931 1.00 51.34  ? 573 GLU B N   1 
ATOM   7490 C  CA  . GLU B  1 573 ? 12.018  69.789  -22.229 1.00 55.72  ? 573 GLU B CA  1 
ATOM   7491 C  C   . GLU B  1 573 ? 13.297  68.932  -22.319 1.00 54.54  ? 573 GLU B C   1 
ATOM   7492 O  O   . GLU B  1 573 ? 14.077  69.078  -23.264 1.00 57.10  ? 573 GLU B O   1 
ATOM   7493 C  CB  . GLU B  1 573 ? 12.293  71.254  -22.601 1.00 57.95  ? 573 GLU B CB  1 
ATOM   7494 C  CG  . GLU B  1 573 ? 13.410  71.934  -21.825 1.00 53.83  ? 573 GLU B CG  1 
ATOM   7495 C  CD  . GLU B  1 573 ? 13.435  73.449  -21.998 1.00 55.31  ? 573 GLU B CD  1 
ATOM   7496 O  OE1 . GLU B  1 573 ? 12.413  74.049  -22.396 1.00 61.85  ? 573 GLU B OE1 1 
ATOM   7497 O  OE2 . GLU B  1 573 ? 14.496  74.051  -21.728 1.00 55.36  ? 573 GLU B OE2 1 
ATOM   7498 N  N   . GLU B  1 574 ? 13.501  68.057  -21.332 1.00 56.45  ? 574 GLU B N   1 
ATOM   7499 C  CA  . GLU B  1 574 ? 14.457  66.947  -21.418 1.00 54.74  ? 574 GLU B CA  1 
ATOM   7500 C  C   . GLU B  1 574 ? 13.708  65.603  -21.503 1.00 53.80  ? 574 GLU B C   1 
ATOM   7501 O  O   . GLU B  1 574 ? 14.245  64.553  -21.138 1.00 53.24  ? 574 GLU B O   1 
ATOM   7502 C  CB  . GLU B  1 574 ? 15.412  66.976  -20.217 1.00 54.13  ? 574 GLU B CB  1 
ATOM   7503 C  CG  . GLU B  1 574 ? 16.365  68.168  -20.204 1.00 57.30  ? 574 GLU B CG  1 
ATOM   7504 C  CD  . GLU B  1 574 ? 17.482  68.076  -21.233 1.00 60.24  ? 574 GLU B CD  1 
ATOM   7505 O  OE1 . GLU B  1 574 ? 17.978  66.960  -21.504 1.00 66.99  ? 574 GLU B OE1 1 
ATOM   7506 O  OE2 . GLU B  1 574 ? 17.876  69.134  -21.770 1.00 54.62  ? 574 GLU B OE2 1 
ATOM   7507 N  N   . GLY B  1 575 ? 12.468  65.647  -21.995 1.00 52.20  ? 575 GLY B N   1 
ATOM   7508 C  CA  . GLY B  1 575 ? 11.655  64.450  -22.227 1.00 51.38  ? 575 GLY B CA  1 
ATOM   7509 C  C   . GLY B  1 575 ? 11.006  63.799  -21.015 1.00 51.59  ? 575 GLY B C   1 
ATOM   7510 O  O   . GLY B  1 575 ? 10.509  62.675  -21.121 1.00 53.79  ? 575 GLY B O   1 
ATOM   7511 N  N   . ASN B  1 576 ? 10.994  64.493  -19.876 1.00 53.95  ? 576 ASN B N   1 
ATOM   7512 C  CA  . ASN B  1 576 ? 10.415  63.955  -18.639 1.00 55.26  ? 576 ASN B CA  1 
ATOM   7513 C  C   . ASN B  1 576 ? 8.952   64.353  -18.488 1.00 53.96  ? 576 ASN B C   1 
ATOM   7514 O  O   . ASN B  1 576 ? 8.552   65.453  -18.878 1.00 54.15  ? 576 ASN B O   1 
ATOM   7515 C  CB  . ASN B  1 576 ? 11.197  64.437  -17.418 1.00 57.10  ? 576 ASN B CB  1 
ATOM   7516 C  CG  . ASN B  1 576 ? 12.615  63.907  -17.390 1.00 55.29  ? 576 ASN B CG  1 
ATOM   7517 O  OD1 . ASN B  1 576 ? 12.838  62.698  -17.472 1.00 56.28  ? 576 ASN B OD1 1 
ATOM   7518 N  ND2 . ASN B  1 576 ? 13.585  64.810  -17.264 1.00 57.42  ? 576 ASN B ND2 1 
ATOM   7519 N  N   . ASN B  1 577 ? 8.168   63.450  -17.905 1.00 51.84  ? 577 ASN B N   1 
ATOM   7520 C  CA  . ASN B  1 577 ? 6.745   63.681  -17.663 1.00 57.48  ? 577 ASN B CA  1 
ATOM   7521 C  C   . ASN B  1 577 ? 6.560   64.506  -16.388 1.00 57.95  ? 577 ASN B C   1 
ATOM   7522 O  O   . ASN B  1 577 ? 6.705   63.985  -15.279 1.00 61.01  ? 577 ASN B O   1 
ATOM   7523 C  CB  . ASN B  1 577 ? 5.992   62.350  -17.546 1.00 60.04  ? 577 ASN B CB  1 
ATOM   7524 C  CG  . ASN B  1 577 ? 6.014   61.545  -18.835 1.00 59.26  ? 577 ASN B CG  1 
ATOM   7525 O  OD1 . ASN B  1 577 ? 5.050   61.552  -19.600 1.00 55.05  ? 577 ASN B OD1 1 
ATOM   7526 N  ND2 . ASN B  1 577 ? 7.118   60.847  -19.080 1.00 59.28  ? 577 ASN B ND2 1 
ATOM   7527 N  N   . VAL B  1 578 ? 6.244   65.789  -16.556 1.00 56.57  ? 578 VAL B N   1 
ATOM   7528 C  CA  . VAL B  1 578 ? 6.044   66.710  -15.431 1.00 52.80  ? 578 VAL B CA  1 
ATOM   7529 C  C   . VAL B  1 578 ? 4.551   66.956  -15.237 1.00 53.46  ? 578 VAL B C   1 
ATOM   7530 O  O   . VAL B  1 578 ? 3.774   66.896  -16.194 1.00 61.16  ? 578 VAL B O   1 
ATOM   7531 C  CB  . VAL B  1 578 ? 6.773   68.054  -15.657 1.00 52.65  ? 578 VAL B CB  1 
ATOM   7532 C  CG1 . VAL B  1 578 ? 6.697   68.948  -14.424 1.00 52.98  ? 578 VAL B CG1 1 
ATOM   7533 C  CG2 . VAL B  1 578 ? 8.234   67.812  -15.999 1.00 56.33  ? 578 VAL B CG2 1 
ATOM   7534 N  N   . TYR B  1 579 ? 4.164   67.226  -13.993 1.00 52.40  ? 579 TYR B N   1 
ATOM   7535 C  CA  . TYR B  1 579 ? 2.792   67.590  -13.647 1.00 50.74  ? 579 TYR B CA  1 
ATOM   7536 C  C   . TYR B  1 579 ? 2.823   68.810  -12.735 1.00 48.26  ? 579 TYR B C   1 
ATOM   7537 O  O   . TYR B  1 579 ? 3.383   68.755  -11.641 1.00 52.52  ? 579 TYR B O   1 
ATOM   7538 C  CB  . TYR B  1 579 ? 2.085   66.424  -12.960 1.00 51.32  ? 579 TYR B CB  1 
ATOM   7539 C  CG  . TYR B  1 579 ? 1.848   65.253  -13.884 1.00 52.62  ? 579 TYR B CG  1 
ATOM   7540 C  CD1 . TYR B  1 579 ? 2.807   64.251  -14.031 1.00 55.42  ? 579 TYR B CD1 1 
ATOM   7541 C  CD2 . TYR B  1 579 ? 0.668   65.151  -14.626 1.00 54.91  ? 579 TYR B CD2 1 
ATOM   7542 C  CE1 . TYR B  1 579 ? 2.597   63.176  -14.885 1.00 61.59  ? 579 TYR B CE1 1 
ATOM   7543 C  CE2 . TYR B  1 579 ? 0.449   64.080  -15.485 1.00 57.27  ? 579 TYR B CE2 1 
ATOM   7544 C  CZ  . TYR B  1 579 ? 1.416   63.094  -15.610 1.00 59.40  ? 579 TYR B CZ  1 
ATOM   7545 O  OH  . TYR B  1 579 ? 1.210   62.033  -16.459 1.00 51.95  ? 579 TYR B OH  1 
ATOM   7546 N  N   . MET B  1 580 ? 2.222   69.904  -13.197 1.00 46.30  ? 580 MET B N   1 
ATOM   7547 C  CA  . MET B  1 580 ? 2.225   71.169  -12.467 1.00 46.77  ? 580 MET B CA  1 
ATOM   7548 C  C   . MET B  1 580 ? 0.867   71.377  -11.807 1.00 47.68  ? 580 MET B C   1 
ATOM   7549 O  O   . MET B  1 580 ? -0.165  71.006  -12.373 1.00 45.84  ? 580 MET B O   1 
ATOM   7550 C  CB  . MET B  1 580 ? 2.545   72.330  -13.414 1.00 46.89  ? 580 MET B CB  1 
ATOM   7551 C  CG  . MET B  1 580 ? 2.682   73.695  -12.744 1.00 50.42  ? 580 MET B CG  1 
ATOM   7552 S  SD  . MET B  1 580 ? 4.104   73.860  -11.645 1.00 57.19  ? 580 MET B SD  1 
ATOM   7553 C  CE  . MET B  1 580 ? 5.377   74.411  -12.774 1.00 54.90  ? 580 MET B CE  1 
ATOM   7554 N  N   . TYR B  1 581 ? 0.878   71.963  -10.608 1.00 51.16  ? 581 TYR B N   1 
ATOM   7555 C  CA  . TYR B  1 581 ? -0.355  72.379  -9.927  1.00 55.11  ? 581 TYR B CA  1 
ATOM   7556 C  C   . TYR B  1 581 ? -0.308  73.847  -9.524  1.00 55.09  ? 581 TYR B C   1 
ATOM   7557 O  O   . TYR B  1 581 ? 0.761   74.461  -9.466  1.00 53.90  ? 581 TYR B O   1 
ATOM   7558 C  CB  . TYR B  1 581 ? -0.681  71.492  -8.704  1.00 60.36  ? 581 TYR B CB  1 
ATOM   7559 C  CG  . TYR B  1 581 ? 0.135   71.728  -7.440  1.00 65.48  ? 581 TYR B CG  1 
ATOM   7560 C  CD1 . TYR B  1 581 ? -0.156  72.791  -6.577  1.00 64.56  ? 581 TYR B CD1 1 
ATOM   7561 C  CD2 . TYR B  1 581 ? 1.167   70.858  -7.078  1.00 71.09  ? 581 TYR B CD2 1 
ATOM   7562 C  CE1 . TYR B  1 581 ? 0.579   73.000  -5.417  1.00 65.13  ? 581 TYR B CE1 1 
ATOM   7563 C  CE2 . TYR B  1 581 ? 1.906   71.061  -5.918  1.00 68.13  ? 581 TYR B CE2 1 
ATOM   7564 C  CZ  . TYR B  1 581 ? 1.608   72.131  -5.091  1.00 65.39  ? 581 TYR B CZ  1 
ATOM   7565 O  OH  . TYR B  1 581 ? 2.333   72.338  -3.941  1.00 64.73  ? 581 TYR B OH  1 
ATOM   7566 N  N   . LEU B  1 582 ? -1.492  74.388  -9.252  1.00 57.63  ? 582 LEU B N   1 
ATOM   7567 C  CA  . LEU B  1 582 ? -1.651  75.691  -8.617  1.00 57.79  ? 582 LEU B CA  1 
ATOM   7568 C  C   . LEU B  1 582 ? -2.734  75.545  -7.553  1.00 60.30  ? 582 LEU B C   1 
ATOM   7569 O  O   . LEU B  1 582 ? -3.916  75.415  -7.873  1.00 72.47  ? 582 LEU B O   1 
ATOM   7570 C  CB  . LEU B  1 582 ? -2.026  76.771  -9.637  1.00 55.99  ? 582 LEU B CB  1 
ATOM   7571 C  CG  . LEU B  1 582 ? -2.235  78.196  -9.101  1.00 60.29  ? 582 LEU B CG  1 
ATOM   7572 C  CD1 . LEU B  1 582 ? -1.030  78.717  -8.328  1.00 63.22  ? 582 LEU B CD1 1 
ATOM   7573 C  CD2 . LEU B  1 582 ? -2.563  79.129  -10.254 1.00 63.29  ? 582 LEU B CD2 1 
ATOM   7574 N  N   . TYR B  1 583 ? -2.315  75.547  -6.289  1.00 56.71  ? 583 TYR B N   1 
ATOM   7575 C  CA  . TYR B  1 583 ? -3.212  75.342  -5.155  1.00 54.52  ? 583 TYR B CA  1 
ATOM   7576 C  C   . TYR B  1 583 ? -3.939  76.655  -4.831  1.00 51.85  ? 583 TYR B C   1 
ATOM   7577 O  O   . TYR B  1 583 ? -3.299  77.657  -4.508  1.00 51.90  ? 583 TYR B O   1 
ATOM   7578 C  CB  . TYR B  1 583 ? -2.399  74.843  -3.959  1.00 53.21  ? 583 TYR B CB  1 
ATOM   7579 C  CG  . TYR B  1 583 ? -3.215  74.367  -2.781  1.00 52.41  ? 583 TYR B CG  1 
ATOM   7580 C  CD1 . TYR B  1 583 ? -3.651  73.044  -2.691  1.00 52.60  ? 583 TYR B CD1 1 
ATOM   7581 C  CD2 . TYR B  1 583 ? -3.532  75.235  -1.743  1.00 53.46  ? 583 TYR B CD2 1 
ATOM   7582 C  CE1 . TYR B  1 583 ? -4.394  72.608  -1.602  1.00 50.98  ? 583 TYR B CE1 1 
ATOM   7583 C  CE2 . TYR B  1 583 ? -4.273  74.812  -0.651  1.00 52.24  ? 583 TYR B CE2 1 
ATOM   7584 C  CZ  . TYR B  1 583 ? -4.703  73.501  -0.586  1.00 50.14  ? 583 TYR B CZ  1 
ATOM   7585 O  OH  . TYR B  1 583 ? -5.436  73.086  0.496   1.00 54.82  ? 583 TYR B OH  1 
ATOM   7586 N  N   . THR B  1 584 ? -5.271  76.631  -4.917  1.00 48.94  ? 584 THR B N   1 
ATOM   7587 C  CA  . THR B  1 584 ? -6.108  77.841  -4.820  1.00 50.40  ? 584 THR B CA  1 
ATOM   7588 C  C   . THR B  1 584 ? -7.243  77.713  -3.786  1.00 51.73  ? 584 THR B C   1 
ATOM   7589 O  O   . THR B  1 584 ? -8.352  78.208  -4.016  1.00 58.64  ? 584 THR B O   1 
ATOM   7590 C  CB  . THR B  1 584 ? -6.742  78.176  -6.193  1.00 50.15  ? 584 THR B CB  1 
ATOM   7591 O  OG1 . THR B  1 584 ? -7.575  77.089  -6.618  1.00 52.96  ? 584 THR B OG1 1 
ATOM   7592 C  CG2 . THR B  1 584 ? -5.683  78.431  -7.248  1.00 49.53  ? 584 THR B CG2 1 
ATOM   7593 N  N   . HIS B  1 585 ? -6.961  77.080  -2.644  1.00 52.81  ? 585 HIS B N   1 
ATOM   7594 C  CA  . HIS B  1 585 ? -8.000  76.777  -1.635  1.00 57.47  ? 585 HIS B CA  1 
ATOM   7595 C  C   . HIS B  1 585 ? -7.695  77.297  -0.220  1.00 57.27  ? 585 HIS B C   1 
ATOM   7596 O  O   . HIS B  1 585 ? -6.607  77.077  0.315   1.00 51.97  ? 585 HIS B O   1 
ATOM   7597 C  CB  . HIS B  1 585 ? -8.261  75.266  -1.576  1.00 60.00  ? 585 HIS B CB  1 
ATOM   7598 C  CG  . HIS B  1 585 ? -9.186  74.855  -0.472  1.00 61.52  ? 585 HIS B CG  1 
ATOM   7599 N  ND1 . HIS B  1 585 ? -10.479 75.321  -0.369  1.00 62.07  ? 585 HIS B ND1 1 
ATOM   7600 C  CD2 . HIS B  1 585 ? -9.000  74.028  0.584   1.00 60.45  ? 585 HIS B CD2 1 
ATOM   7601 C  CE1 . HIS B  1 585 ? -11.053 74.789  0.695   1.00 63.99  ? 585 HIS B CE1 1 
ATOM   7602 N  NE2 . HIS B  1 585 ? -10.175 74.006  1.295   1.00 61.42  ? 585 HIS B NE2 1 
ATOM   7603 N  N   . ARG B  1 586 ? -8.687  77.972  0.366   1.00 64.83  ? 586 ARG B N   1 
ATOM   7604 C  CA  . ARG B  1 586 ? -8.656  78.445  1.758   1.00 65.24  ? 586 ARG B CA  1 
ATOM   7605 C  C   . ARG B  1 586 ? -9.372  77.461  2.678   1.00 62.93  ? 586 ARG B C   1 
ATOM   7606 O  O   . ARG B  1 586 ? -10.471 77.012  2.361   1.00 58.88  ? 586 ARG B O   1 
ATOM   7607 C  CB  . ARG B  1 586 ? -9.379  79.790  1.882   1.00 69.13  ? 586 ARG B CB  1 
ATOM   7608 C  CG  . ARG B  1 586 ? -8.532  81.014  1.588   1.00 71.32  ? 586 ARG B CG  1 
ATOM   7609 C  CD  . ARG B  1 586 ? -7.753  81.501  2.803   1.00 70.16  ? 586 ARG B CD  1 
ATOM   7610 N  NE  . ARG B  1 586 ? -8.597  81.998  3.894   1.00 64.70  ? 586 ARG B NE  1 
ATOM   7611 C  CZ  . ARG B  1 586 ? -8.182  82.778  4.897   1.00 69.73  ? 586 ARG B CZ  1 
ATOM   7612 N  NH1 . ARG B  1 586 ? -6.914  83.191  4.980   1.00 67.33  ? 586 ARG B NH1 1 
ATOM   7613 N  NH2 . ARG B  1 586 ? -9.050  83.161  5.832   1.00 73.97  ? 586 ARG B NH2 1 
ATOM   7614 N  N   . SER B  1 587 ? -8.771  77.167  3.829   1.00 62.98  ? 587 SER B N   1 
ATOM   7615 C  CA  . SER B  1 587 ? -9.474  76.469  4.904   1.00 63.45  ? 587 SER B CA  1 
ATOM   7616 C  C   . SER B  1 587 ? -10.564 77.391  5.457   1.00 68.64  ? 587 SER B C   1 
ATOM   7617 O  O   . SER B  1 587 ? -10.347 78.595  5.608   1.00 68.22  ? 587 SER B O   1 
ATOM   7618 C  CB  . SER B  1 587 ? -8.506  76.071  6.017   1.00 64.38  ? 587 SER B CB  1 
ATOM   7619 O  OG  . SER B  1 587 ? -7.638  75.034  5.593   1.00 63.16  ? 587 SER B OG  1 
ATOM   7620 N  N   . LYS B  1 588 ? -11.732 76.818  5.741   1.00 75.79  ? 588 LYS B N   1 
ATOM   7621 C  CA  . LYS B  1 588 ? -12.897 77.582  6.204   1.00 80.11  ? 588 LYS B CA  1 
ATOM   7622 C  C   . LYS B  1 588 ? -12.686 78.205  7.592   1.00 84.77  ? 588 LYS B C   1 
ATOM   7623 O  O   . LYS B  1 588 ? -13.234 79.271  7.883   1.00 92.74  ? 588 LYS B O   1 
ATOM   7624 C  CB  . LYS B  1 588 ? -14.144 76.689  6.216   1.00 84.14  ? 588 LYS B CB  1 
ATOM   7625 C  CG  . LYS B  1 588 ? -15.463 77.453  6.154   1.00 84.39  ? 588 LYS B CG  1 
ATOM   7626 C  CD  . LYS B  1 588 ? -16.595 76.721  6.862   1.00 82.09  ? 588 LYS B CD  1 
ATOM   7627 C  CE  . LYS B  1 588 ? -16.517 76.887  8.374   1.00 80.78  ? 588 LYS B CE  1 
ATOM   7628 N  NZ  . LYS B  1 588 ? -17.641 76.204  9.070   1.00 79.38  ? 588 LYS B NZ  1 
ATOM   7629 N  N   . GLY B  1 589 ? -11.897 77.533  8.430   1.00 85.50  ? 589 GLY B N   1 
ATOM   7630 C  CA  . GLY B  1 589 ? -11.550 78.020  9.770   1.00 89.69  ? 589 GLY B CA  1 
ATOM   7631 C  C   . GLY B  1 589 ? -10.075 78.355  9.879   1.00 88.65  ? 589 GLY B C   1 
ATOM   7632 O  O   . GLY B  1 589 ? -9.389  77.881  10.787  1.00 98.30  ? 589 GLY B O   1 
ATOM   7633 N  N   . ASN B  1 590 ? -9.595  79.180  8.950   1.00 83.10  ? 590 ASN B N   1 
ATOM   7634 C  CA  . ASN B  1 590 ? -8.190  79.583  8.906   1.00 77.67  ? 590 ASN B CA  1 
ATOM   7635 C  C   . ASN B  1 590 ? -7.979  80.715  9.915   1.00 74.98  ? 590 ASN B C   1 
ATOM   7636 O  O   . ASN B  1 590 ? -8.650  81.746  9.819   1.00 79.79  ? 590 ASN B O   1 
ATOM   7637 C  CB  . ASN B  1 590 ? -7.807  80.048  7.495   1.00 77.88  ? 590 ASN B CB  1 
ATOM   7638 C  CG  . ASN B  1 590 ? -6.300  80.130  7.282   1.00 78.48  ? 590 ASN B CG  1 
ATOM   7639 O  OD1 . ASN B  1 590 ? -5.543  80.499  8.179   1.00 82.13  ? 590 ASN B OD1 1 
ATOM   7640 N  ND2 . ASN B  1 590 ? -5.861  79.793  6.072   1.00 71.52  ? 590 ASN B ND2 1 
ATOM   7641 N  N   . PRO B  1 591 ? -7.058  80.531  10.885  1.00 69.07  ? 591 PRO B N   1 
ATOM   7642 C  CA  . PRO B  1 591 ? -6.831  81.574  11.894  1.00 67.12  ? 591 PRO B CA  1 
ATOM   7643 C  C   . PRO B  1 591 ? -6.141  82.835  11.370  1.00 67.13  ? 591 PRO B C   1 
ATOM   7644 O  O   . PRO B  1 591 ? -6.302  83.900  11.970  1.00 69.97  ? 591 PRO B O   1 
ATOM   7645 C  CB  . PRO B  1 591 ? -5.948  80.873  12.930  1.00 69.96  ? 591 PRO B CB  1 
ATOM   7646 C  CG  . PRO B  1 591 ? -5.236  79.819  12.165  1.00 71.80  ? 591 PRO B CG  1 
ATOM   7647 C  CD  . PRO B  1 591 ? -6.208  79.349  11.128  1.00 70.83  ? 591 PRO B CD  1 
ATOM   7648 N  N   . TRP B  1 592 ? -5.389  82.718  10.274  1.00 68.39  ? 592 TRP B N   1 
ATOM   7649 C  CA  . TRP B  1 592 ? -4.747  83.881  9.648   1.00 67.53  ? 592 TRP B CA  1 
ATOM   7650 C  C   . TRP B  1 592 ? -5.789  84.860  9.087   1.00 67.37  ? 592 TRP B C   1 
ATOM   7651 O  O   . TRP B  1 592 ? -6.944  84.476  8.880   1.00 70.12  ? 592 TRP B O   1 
ATOM   7652 C  CB  . TRP B  1 592 ? -3.800  83.446  8.527   1.00 61.42  ? 592 TRP B CB  1 
ATOM   7653 C  CG  . TRP B  1 592 ? -2.564  82.762  9.008   1.00 58.40  ? 592 TRP B CG  1 
ATOM   7654 C  CD1 . TRP B  1 592 ? -2.351  81.417  9.086   1.00 58.83  ? 592 TRP B CD1 1 
ATOM   7655 C  CD2 . TRP B  1 592 ? -1.364  83.388  9.479   1.00 59.27  ? 592 TRP B CD2 1 
ATOM   7656 N  NE1 . TRP B  1 592 ? -1.091  81.164  9.572   1.00 60.32  ? 592 TRP B NE1 1 
ATOM   7657 C  CE2 . TRP B  1 592 ? -0.461  82.356  9.818   1.00 60.85  ? 592 TRP B CE2 1 
ATOM   7658 C  CE3 . TRP B  1 592 ? -0.958  84.723  9.633   1.00 64.33  ? 592 TRP B CE3 1 
ATOM   7659 C  CZ2 . TRP B  1 592 ? 0.824   82.615  10.316  1.00 64.60  ? 592 TRP B CZ2 1 
ATOM   7660 C  CZ3 . TRP B  1 592 ? 0.323   84.982  10.128  1.00 63.72  ? 592 TRP B CZ3 1 
ATOM   7661 C  CH2 . TRP B  1 592 ? 1.197   83.929  10.463  1.00 65.48  ? 592 TRP B CH2 1 
ATOM   7662 N  N   . PRO B  1 593 ? -5.388  86.127  8.836   1.00 62.16  ? 593 PRO B N   1 
ATOM   7663 C  CA  . PRO B  1 593 ? -6.327  87.116  8.283   1.00 65.79  ? 593 PRO B CA  1 
ATOM   7664 C  C   . PRO B  1 593 ? -6.952  86.747  6.928   1.00 67.14  ? 593 PRO B C   1 
ATOM   7665 O  O   . PRO B  1 593 ? -6.456  85.872  6.217   1.00 59.23  ? 593 PRO B O   1 
ATOM   7666 C  CB  . PRO B  1 593 ? -5.471  88.383  8.151   1.00 65.89  ? 593 PRO B CB  1 
ATOM   7667 C  CG  . PRO B  1 593 ? -4.378  88.214  9.142   1.00 62.97  ? 593 PRO B CG  1 
ATOM   7668 C  CD  . PRO B  1 593 ? -4.093  86.745  9.185   1.00 59.28  ? 593 PRO B CD  1 
ATOM   7669 N  N   . ARG B  1 594 ? -8.041  87.433  6.600   1.00 68.83  ? 594 ARG B N   1 
ATOM   7670 C  CA  . ARG B  1 594 ? -8.810  87.171  5.378   1.00 69.70  ? 594 ARG B CA  1 
ATOM   7671 C  C   . ARG B  1 594 ? -8.054  87.609  4.117   1.00 67.76  ? 594 ARG B C   1 
ATOM   7672 O  O   . ARG B  1 594 ? -8.133  86.949  3.078   1.00 59.82  ? 594 ARG B O   1 
ATOM   7673 C  CB  . ARG B  1 594 ? -10.174 87.867  5.447   1.00 74.48  ? 594 ARG B CB  1 
ATOM   7674 C  CG  . ARG B  1 594 ? -10.975 87.548  6.704   1.00 79.17  ? 594 ARG B CG  1 
ATOM   7675 C  CD  . ARG B  1 594 ? -12.463 87.776  6.511   1.00 88.74  ? 594 ARG B CD  1 
ATOM   7676 N  NE  . ARG B  1 594 ? -13.223 87.476  7.730   1.00 101.68 ? 594 ARG B NE  1 
ATOM   7677 C  CZ  . ARG B  1 594 ? -13.515 88.342  8.706   1.00 110.27 ? 594 ARG B CZ  1 
ATOM   7678 N  NH1 . ARG B  1 594 ? -13.126 89.617  8.652   1.00 113.32 ? 594 ARG B NH1 1 
ATOM   7679 N  NH2 . ARG B  1 594 ? -14.216 87.925  9.758   1.00 114.42 ? 594 ARG B NH2 1 
ATOM   7680 N  N   . TRP B  1 595 ? -7.327  88.719  4.226   1.00 63.70  ? 595 TRP B N   1 
ATOM   7681 C  CA  . TRP B  1 595 ? -6.502  89.248  3.123   1.00 58.70  ? 595 TRP B CA  1 
ATOM   7682 C  C   . TRP B  1 595 ? -5.283  88.400  2.736   1.00 60.71  ? 595 TRP B C   1 
ATOM   7683 O  O   . TRP B  1 595 ? -4.760  88.551  1.629   1.00 58.65  ? 595 TRP B O   1 
ATOM   7684 C  CB  . TRP B  1 595 ? -6.042  90.684  3.415   1.00 55.61  ? 595 TRP B CB  1 
ATOM   7685 C  CG  . TRP B  1 595 ? -5.277  90.879  4.695   1.00 56.28  ? 595 TRP B CG  1 
ATOM   7686 C  CD1 . TRP B  1 595 ? -5.791  91.271  5.894   1.00 58.28  ? 595 TRP B CD1 1 
ATOM   7687 C  CD2 . TRP B  1 595 ? -3.866  90.723  4.897   1.00 56.28  ? 595 TRP B CD2 1 
ATOM   7688 N  NE1 . TRP B  1 595 ? -4.799  91.356  6.834   1.00 59.03  ? 595 TRP B NE1 1 
ATOM   7689 C  CE2 . TRP B  1 595 ? -3.606  91.021  6.253   1.00 56.74  ? 595 TRP B CE2 1 
ATOM   7690 C  CE3 . TRP B  1 595 ? -2.798  90.351  4.071   1.00 55.99  ? 595 TRP B CE3 1 
ATOM   7691 C  CZ2 . TRP B  1 595 ? -2.320  90.973  6.801   1.00 57.23  ? 595 TRP B CZ2 1 
ATOM   7692 C  CZ3 . TRP B  1 595 ? -1.514  90.297  4.623   1.00 55.05  ? 595 TRP B CZ3 1 
ATOM   7693 C  CH2 . TRP B  1 595 ? -1.292  90.607  5.974   1.00 53.89  ? 595 TRP B CH2 1 
ATOM   7694 N  N   . THR B  1 596 ? -4.828  87.532  3.638   1.00 60.93  ? 596 THR B N   1 
ATOM   7695 C  CA  . THR B  1 596 ? -3.662  86.679  3.383   1.00 55.53  ? 596 THR B CA  1 
ATOM   7696 C  C   . THR B  1 596 ? -3.897  85.656  2.271   1.00 56.19  ? 596 THR B C   1 
ATOM   7697 O  O   . THR B  1 596 ? -2.960  85.267  1.578   1.00 55.54  ? 596 THR B O   1 
ATOM   7698 C  CB  . THR B  1 596 ? -3.219  85.920  4.650   1.00 52.05  ? 596 THR B CB  1 
ATOM   7699 O  OG1 . THR B  1 596 ? -4.303  85.128  5.149   1.00 49.67  ? 596 THR B OG1 1 
ATOM   7700 C  CG2 . THR B  1 596 ? -2.745  86.886  5.722   1.00 50.06  ? 596 THR B CG2 1 
ATOM   7701 N  N   . GLY B  1 597 ? -5.142  85.208  2.124   1.00 57.12  ? 597 GLY B N   1 
ATOM   7702 C  CA  . GLY B  1 597 ? -5.511  84.278  1.058   1.00 56.36  ? 597 GLY B CA  1 
ATOM   7703 C  C   . GLY B  1 597 ? -4.874  82.912  1.246   1.00 54.63  ? 597 GLY B C   1 
ATOM   7704 O  O   . GLY B  1 597 ? -4.620  82.487  2.377   1.00 53.10  ? 597 GLY B O   1 
ATOM   7705 N  N   . VAL B  1 598 ? -4.597  82.237  0.134   1.00 57.97  ? 598 VAL B N   1 
ATOM   7706 C  CA  . VAL B  1 598 ? -4.025  80.887  0.157   1.00 59.14  ? 598 VAL B CA  1 
ATOM   7707 C  C   . VAL B  1 598 ? -2.509  80.997  0.319   1.00 62.47  ? 598 VAL B C   1 
ATOM   7708 O  O   . VAL B  1 598 ? -1.764  81.048  -0.665  1.00 61.33  ? 598 VAL B O   1 
ATOM   7709 C  CB  . VAL B  1 598 ? -4.376  80.088  -1.114  1.00 55.43  ? 598 VAL B CB  1 
ATOM   7710 C  CG1 . VAL B  1 598 ? -3.900  78.649  -0.990  1.00 52.47  ? 598 VAL B CG1 1 
ATOM   7711 C  CG2 . VAL B  1 598 ? -5.874  80.114  -1.369  1.00 60.59  ? 598 VAL B CG2 1 
ATOM   7712 N  N   . MET B  1 599 ? -2.066  81.011  1.572   1.00 60.81  ? 599 MET B N   1 
ATOM   7713 C  CA  . MET B  1 599 ? -0.668  81.318  1.895   1.00 60.71  ? 599 MET B CA  1 
ATOM   7714 C  C   . MET B  1 599 ? 0.293   80.152  1.663   1.00 59.56  ? 599 MET B C   1 
ATOM   7715 O  O   . MET B  1 599 ? -0.114  79.053  1.291   1.00 61.29  ? 599 MET B O   1 
ATOM   7716 C  CB  . MET B  1 599 ? -0.533  81.870  3.327   1.00 67.77  ? 599 MET B CB  1 
ATOM   7717 C  CG  . MET B  1 599 ? -0.504  83.391  3.385   1.00 69.81  ? 599 MET B CG  1 
ATOM   7718 S  SD  . MET B  1 599 ? 0.231   84.037  4.895   1.00 62.80  ? 599 MET B SD  1 
ATOM   7719 C  CE  . MET B  1 599 ? -0.875  83.342  6.114   1.00 62.54  ? 599 MET B CE  1 
ATOM   7720 N  N   . HIS B  1 600 ? 1.577   80.438  1.854   1.00 57.40  ? 600 HIS B N   1 
ATOM   7721 C  CA  . HIS B  1 600 ? 2.650   79.448  1.748   1.00 59.22  ? 600 HIS B CA  1 
ATOM   7722 C  C   . HIS B  1 600 ? 2.493   78.272  2.727   1.00 57.24  ? 600 HIS B C   1 
ATOM   7723 O  O   . HIS B  1 600 ? 2.253   78.476  3.919   1.00 59.94  ? 600 HIS B O   1 
ATOM   7724 C  CB  . HIS B  1 600 ? 3.990   80.145  1.985   1.00 60.31  ? 600 HIS B CB  1 
ATOM   7725 C  CG  . HIS B  1 600 ? 5.175   79.253  1.813   1.00 55.41  ? 600 HIS B CG  1 
ATOM   7726 N  ND1 . HIS B  1 600 ? 5.609   78.819  0.579   1.00 54.45  ? 600 HIS B ND1 1 
ATOM   7727 C  CD2 . HIS B  1 600 ? 6.022   78.716  2.720   1.00 50.32  ? 600 HIS B CD2 1 
ATOM   7728 C  CE1 . HIS B  1 600 ? 6.670   78.050  0.734   1.00 54.98  ? 600 HIS B CE1 1 
ATOM   7729 N  NE2 . HIS B  1 600 ? 6.943   77.975  2.023   1.00 51.65  ? 600 HIS B NE2 1 
ATOM   7730 N  N   . GLY B  1 601 ? 2.634   77.051  2.209   1.00 57.84  ? 601 GLY B N   1 
ATOM   7731 C  CA  . GLY B  1 601 ? 2.508   75.829  3.015   1.00 55.61  ? 601 GLY B CA  1 
ATOM   7732 C  C   . GLY B  1 601 ? 1.104   75.516  3.517   1.00 56.51  ? 601 GLY B C   1 
ATOM   7733 O  O   . GLY B  1 601 ? 0.946   74.760  4.478   1.00 55.89  ? 601 GLY B O   1 
ATOM   7734 N  N   . ASP B  1 602 ? 0.088   76.084  2.863   1.00 56.96  ? 602 ASP B N   1 
ATOM   7735 C  CA  . ASP B  1 602 ? -1.324  75.891  3.255   1.00 54.01  ? 602 ASP B CA  1 
ATOM   7736 C  C   . ASP B  1 602 ? -1.867  74.528  2.823   1.00 48.69  ? 602 ASP B C   1 
ATOM   7737 O  O   . ASP B  1 602 ? -2.804  74.003  3.430   1.00 46.52  ? 602 ASP B O   1 
ATOM   7738 C  CB  . ASP B  1 602 ? -2.222  77.003  2.677   1.00 52.69  ? 602 ASP B CB  1 
ATOM   7739 C  CG  . ASP B  1 602 ? -2.434  78.165  3.645   1.00 54.26  ? 602 ASP B CG  1 
ATOM   7740 O  OD1 . ASP B  1 602 ? -1.560  78.428  4.502   1.00 53.33  ? 602 ASP B OD1 1 
ATOM   7741 O  OD2 . ASP B  1 602 ? -3.489  78.826  3.540   1.00 57.92  ? 602 ASP B OD2 1 
ATOM   7742 N  N   . GLU B  1 603 ? -1.274  73.973  1.770   1.00 44.07  ? 603 GLU B N   1 
ATOM   7743 C  CA  . GLU B  1 603 ? -1.679  72.681  1.207   1.00 42.90  ? 603 GLU B CA  1 
ATOM   7744 C  C   . GLU B  1 603 ? -1.282  71.441  2.020   1.00 43.14  ? 603 GLU B C   1 
ATOM   7745 O  O   . GLU B  1 603 ? -1.789  70.349  1.752   1.00 46.09  ? 603 GLU B O   1 
ATOM   7746 C  CB  . GLU B  1 603 ? -1.144  72.546  -0.232  1.00 42.66  ? 603 GLU B CB  1 
ATOM   7747 C  CG  . GLU B  1 603 ? 0.314   72.101  -0.383  1.00 44.11  ? 603 GLU B CG  1 
ATOM   7748 C  CD  . GLU B  1 603 ? 1.325   73.161  0.012   1.00 50.00  ? 603 GLU B CD  1 
ATOM   7749 O  OE1 . GLU B  1 603 ? 1.197   74.320  -0.433  1.00 53.92  ? 603 GLU B OE1 1 
ATOM   7750 O  OE2 . GLU B  1 603 ? 2.254   72.832  0.770   1.00 47.76  ? 603 GLU B OE2 1 
ATOM   7751 N  N   . ILE B  1 604 ? -0.378  71.605  2.986   1.00 44.41  ? 604 ILE B N   1 
ATOM   7752 C  CA  . ILE B  1 604 ? 0.215   70.473  3.711   1.00 39.98  ? 604 ILE B CA  1 
ATOM   7753 C  C   . ILE B  1 604 ? -0.838  69.678  4.491   1.00 42.10  ? 604 ILE B C   1 
ATOM   7754 O  O   . ILE B  1 604 ? -0.791  68.446  4.537   1.00 43.07  ? 604 ILE B O   1 
ATOM   7755 C  CB  . ILE B  1 604 ? 1.334   70.943  4.670   1.00 39.13  ? 604 ILE B CB  1 
ATOM   7756 C  CG1 . ILE B  1 604 ? 2.478   71.596  3.871   1.00 35.89  ? 604 ILE B CG1 1 
ATOM   7757 C  CG2 . ILE B  1 604 ? 1.857   69.771  5.498   1.00 42.11  ? 604 ILE B CG2 1 
ATOM   7758 C  CD1 . ILE B  1 604 ? 3.569   72.239  4.703   1.00 31.71  ? 604 ILE B CD1 1 
ATOM   7759 N  N   . ASN B  1 605 ? -1.777  70.398  5.099   1.00 45.74  ? 605 ASN B N   1 
ATOM   7760 C  CA  . ASN B  1 605 ? -2.857  69.798  5.895   1.00 42.68  ? 605 ASN B CA  1 
ATOM   7761 C  C   . ASN B  1 605 ? -3.704  68.843  5.049   1.00 40.21  ? 605 ASN B C   1 
ATOM   7762 O  O   . ASN B  1 605 ? -4.098  67.774  5.518   1.00 37.76  ? 605 ASN B O   1 
ATOM   7763 C  CB  . ASN B  1 605 ? -3.769  70.880  6.496   1.00 44.61  ? 605 ASN B CB  1 
ATOM   7764 C  CG  . ASN B  1 605 ? -3.014  71.884  7.355   1.00 43.48  ? 605 ASN B CG  1 
ATOM   7765 O  OD1 . ASN B  1 605 ? -1.999  72.438  6.930   1.00 43.39  ? 605 ASN B OD1 1 
ATOM   7766 N  ND2 . ASN B  1 605 ? -3.518  72.136  8.559   1.00 44.10  ? 605 ASN B ND2 1 
ATOM   7767 N  N   . TYR B  1 606 ? -3.954  69.234  3.800   1.00 41.97  ? 606 TYR B N   1 
ATOM   7768 C  CA  . TYR B  1 606 ? -4.791  68.464  2.876   1.00 43.87  ? 606 TYR B CA  1 
ATOM   7769 C  C   . TYR B  1 606 ? -4.068  67.266  2.232   1.00 44.50  ? 606 TYR B C   1 
ATOM   7770 O  O   . TYR B  1 606 ? -4.691  66.222  2.027   1.00 44.67  ? 606 TYR B O   1 
ATOM   7771 C  CB  . TYR B  1 606 ? -5.383  69.385  1.802   1.00 41.63  ? 606 TYR B CB  1 
ATOM   7772 C  CG  . TYR B  1 606 ? -6.408  70.364  2.341   1.00 41.33  ? 606 TYR B CG  1 
ATOM   7773 C  CD1 . TYR B  1 606 ? -6.013  71.549  2.965   1.00 40.11  ? 606 TYR B CD1 1 
ATOM   7774 C  CD2 . TYR B  1 606 ? -7.777  70.103  2.235   1.00 41.10  ? 606 TYR B CD2 1 
ATOM   7775 C  CE1 . TYR B  1 606 ? -6.950  72.449  3.457   1.00 42.84  ? 606 TYR B CE1 1 
ATOM   7776 C  CE2 . TYR B  1 606 ? -8.723  70.996  2.728   1.00 39.40  ? 606 TYR B CE2 1 
ATOM   7777 C  CZ  . TYR B  1 606 ? -8.306  72.166  3.339   1.00 42.93  ? 606 TYR B CZ  1 
ATOM   7778 O  OH  . TYR B  1 606 ? -9.237  73.053  3.828   1.00 43.16  ? 606 TYR B OH  1 
ATOM   7779 N  N   . VAL B  1 607 ? -2.780  67.410  1.905   1.00 47.09  ? 607 VAL B N   1 
ATOM   7780 C  CA  . VAL B  1 607 ? -1.987  66.271  1.378   1.00 46.91  ? 607 VAL B CA  1 
ATOM   7781 C  C   . VAL B  1 607 ? -1.732  65.182  2.425   1.00 43.41  ? 607 VAL B C   1 
ATOM   7782 O  O   . VAL B  1 607 ? -1.566  64.018  2.065   1.00 43.46  ? 607 VAL B O   1 
ATOM   7783 C  CB  . VAL B  1 607 ? -0.624  66.678  0.744   1.00 47.29  ? 607 VAL B CB  1 
ATOM   7784 C  CG1 . VAL B  1 607 ? -0.822  67.657  -0.400  1.00 50.15  ? 607 VAL B CG1 1 
ATOM   7785 C  CG2 . VAL B  1 607 ? 0.338   67.255  1.768   1.00 50.28  ? 607 VAL B CG2 1 
ATOM   7786 N  N   . PHE B  1 608 ? -1.681  65.564  3.702   1.00 43.04  ? 608 PHE B N   1 
ATOM   7787 C  CA  . PHE B  1 608 ? -1.475  64.604  4.802   1.00 48.70  ? 608 PHE B CA  1 
ATOM   7788 C  C   . PHE B  1 608 ? -2.765  64.078  5.454   1.00 50.57  ? 608 PHE B C   1 
ATOM   7789 O  O   . PHE B  1 608 ? -2.702  63.266  6.379   1.00 45.25  ? 608 PHE B O   1 
ATOM   7790 C  CB  . PHE B  1 608 ? -0.538  65.201  5.860   1.00 49.60  ? 608 PHE B CB  1 
ATOM   7791 C  CG  . PHE B  1 608 ? 0.910   64.904  5.611   1.00 48.03  ? 608 PHE B CG  1 
ATOM   7792 C  CD1 . PHE B  1 608 ? 1.474   63.721  6.072   1.00 48.15  ? 608 PHE B CD1 1 
ATOM   7793 C  CD2 . PHE B  1 608 ? 1.706   65.794  4.902   1.00 50.58  ? 608 PHE B CD2 1 
ATOM   7794 C  CE1 . PHE B  1 608 ? 2.809   63.434  5.840   1.00 47.45  ? 608 PHE B CE1 1 
ATOM   7795 C  CE2 . PHE B  1 608 ? 3.043   65.514  4.665   1.00 52.05  ? 608 PHE B CE2 1 
ATOM   7796 C  CZ  . PHE B  1 608 ? 3.594   64.331  5.137   1.00 51.67  ? 608 PHE B CZ  1 
ATOM   7797 N  N   . GLY B  1 609 ? -3.921  64.528  4.972   1.00 50.13  ? 609 GLY B N   1 
ATOM   7798 C  CA  . GLY B  1 609 ? -5.218  64.020  5.429   1.00 50.49  ? 609 GLY B CA  1 
ATOM   7799 C  C   . GLY B  1 609 ? -5.667  64.509  6.794   1.00 48.63  ? 609 GLY B C   1 
ATOM   7800 O  O   . GLY B  1 609 ? -6.292  63.761  7.549   1.00 47.93  ? 609 GLY B O   1 
ATOM   7801 N  N   . GLU B  1 610 ? -5.351  65.763  7.108   1.00 49.49  ? 610 GLU B N   1 
ATOM   7802 C  CA  . GLU B  1 610 ? -5.777  66.390  8.363   1.00 52.60  ? 610 GLU B CA  1 
ATOM   7803 C  C   . GLU B  1 610 ? -7.288  66.681  8.421   1.00 58.17  ? 610 GLU B C   1 
ATOM   7804 O  O   . GLU B  1 610 ? -7.866  66.642  9.511   1.00 57.96  ? 610 GLU B O   1 
ATOM   7805 C  CB  . GLU B  1 610 ? -4.976  67.672  8.616   1.00 54.77  ? 610 GLU B CB  1 
ATOM   7806 C  CG  . GLU B  1 610 ? -5.124  68.246  10.020  1.00 55.46  ? 610 GLU B CG  1 
ATOM   7807 C  CD  . GLU B  1 610 ? -4.294  69.499  10.228  1.00 60.35  ? 610 GLU B CD  1 
ATOM   7808 O  OE1 . GLU B  1 610 ? -3.087  69.482  9.909   1.00 61.42  ? 610 GLU B OE1 1 
ATOM   7809 O  OE2 . GLU B  1 610 ? -4.849  70.507  10.718  1.00 63.22  ? 610 GLU B OE2 1 
ATOM   7810 N  N   . PRO B  1 611 ? -7.932  66.984  7.265   1.00 60.09  ? 611 PRO B N   1 
ATOM   7811 C  CA  . PRO B  1 611 ? -9.398  67.118  7.258   1.00 59.25  ? 611 PRO B CA  1 
ATOM   7812 C  C   . PRO B  1 611 ? -10.192 65.878  7.681   1.00 59.37  ? 611 PRO B C   1 
ATOM   7813 O  O   . PRO B  1 611 ? -11.309 66.014  8.181   1.00 72.66  ? 611 PRO B O   1 
ATOM   7814 C  CB  . PRO B  1 611 ? -9.701  67.486  5.803   1.00 55.75  ? 611 PRO B CB  1 
ATOM   7815 C  CG  . PRO B  1 611 ? -8.499  68.252  5.388   1.00 56.75  ? 611 PRO B CG  1 
ATOM   7816 C  CD  . PRO B  1 611 ? -7.357  67.499  6.006   1.00 58.56  ? 611 PRO B CD  1 
ATOM   7817 N  N   . LEU B  1 612 ? -9.608  64.696  7.504   1.00 54.03  ? 612 LEU B N   1 
ATOM   7818 C  CA  . LEU B  1 612 ? -10.236 63.437  7.928   1.00 53.95  ? 612 LEU B CA  1 
ATOM   7819 C  C   . LEU B  1 612 ? -10.293 63.225  9.457   1.00 54.07  ? 612 LEU B C   1 
ATOM   7820 O  O   . LEU B  1 612 ? -10.934 62.281  9.924   1.00 52.97  ? 612 LEU B O   1 
ATOM   7821 C  CB  . LEU B  1 612 ? -9.548  62.248  7.240   1.00 51.47  ? 612 LEU B CB  1 
ATOM   7822 C  CG  . LEU B  1 612 ? -9.988  61.965  5.797   1.00 50.18  ? 612 LEU B CG  1 
ATOM   7823 C  CD1 . LEU B  1 612 ? -9.801  63.146  4.851   1.00 49.25  ? 612 LEU B CD1 1 
ATOM   7824 C  CD2 . LEU B  1 612 ? -9.226  60.758  5.281   1.00 53.85  ? 612 LEU B CD2 1 
ATOM   7825 N  N   . ASN B  1 613 ? -9.629  64.094  10.220  1.00 49.78  ? 613 ASN B N   1 
ATOM   7826 C  CA  . ASN B  1 613 ? -9.686  64.085  11.686  1.00 54.30  ? 613 ASN B CA  1 
ATOM   7827 C  C   . ASN B  1 613 ? -11.041 64.630  12.193  1.00 61.18  ? 613 ASN B C   1 
ATOM   7828 O  O   . ASN B  1 613 ? -11.342 65.811  11.984  1.00 68.62  ? 613 ASN B O   1 
ATOM   7829 C  CB  . ASN B  1 613 ? -8.528  64.932  12.233  1.00 54.67  ? 613 ASN B CB  1 
ATOM   7830 C  CG  . ASN B  1 613 ? -8.271  64.718  13.717  1.00 53.47  ? 613 ASN B CG  1 
ATOM   7831 O  OD1 . ASN B  1 613 ? -9.081  64.133  14.439  1.00 50.85  ? 613 ASN B OD1 1 
ATOM   7832 N  ND2 . ASN B  1 613 ? -7.122  65.198  14.179  1.00 51.53  ? 613 ASN B ND2 1 
ATOM   7833 N  N   . PRO B  1 614 ? -11.858 63.778  12.857  1.00 62.76  ? 614 PRO B N   1 
ATOM   7834 C  CA  . PRO B  1 614 ? -13.186 64.212  13.318  1.00 61.94  ? 614 PRO B CA  1 
ATOM   7835 C  C   . PRO B  1 614 ? -13.194 65.151  14.532  1.00 61.27  ? 614 PRO B C   1 
ATOM   7836 O  O   . PRO B  1 614 ? -14.188 65.850  14.742  1.00 61.09  ? 614 PRO B O   1 
ATOM   7837 C  CB  . PRO B  1 614 ? -13.885 62.894  13.662  1.00 62.59  ? 614 PRO B CB  1 
ATOM   7838 C  CG  . PRO B  1 614 ? -12.782 61.982  14.051  1.00 66.11  ? 614 PRO B CG  1 
ATOM   7839 C  CD  . PRO B  1 614 ? -11.606 62.365  13.202  1.00 66.22  ? 614 PRO B CD  1 
ATOM   7840 N  N   . THR B  1 615 ? -12.120 65.157  15.324  1.00 66.53  ? 615 THR B N   1 
ATOM   7841 C  CA  . THR B  1 615 ? -11.961 66.144  16.409  1.00 70.22  ? 615 THR B CA  1 
ATOM   7842 C  C   . THR B  1 615 ? -11.852 67.579  15.871  1.00 71.80  ? 615 THR B C   1 
ATOM   7843 O  O   . THR B  1 615 ? -12.227 68.532  16.559  1.00 63.02  ? 615 THR B O   1 
ATOM   7844 C  CB  . THR B  1 615 ? -10.741 65.845  17.308  1.00 68.44  ? 615 THR B CB  1 
ATOM   7845 O  OG1 . THR B  1 615 ? -9.572  65.656  16.503  1.00 72.27  ? 615 THR B OG1 1 
ATOM   7846 C  CG2 . THR B  1 615 ? -10.984 64.609  18.149  1.00 67.28  ? 615 THR B CG2 1 
ATOM   7847 N  N   . LEU B  1 616 ? -11.335 67.714  14.648  1.00 69.79  ? 616 LEU B N   1 
ATOM   7848 C  CA  . LEU B  1 616 ? -11.281 68.998  13.940  1.00 63.69  ? 616 LEU B CA  1 
ATOM   7849 C  C   . LEU B  1 616 ? -12.567 69.248  13.148  1.00 58.95  ? 616 LEU B C   1 
ATOM   7850 O  O   . LEU B  1 616 ? -13.317 68.315  12.849  1.00 49.53  ? 616 LEU B O   1 
ATOM   7851 C  CB  . LEU B  1 616 ? -10.054 69.050  13.020  1.00 54.38  ? 616 LEU B CB  1 
ATOM   7852 C  CG  . LEU B  1 616 ? -8.712  68.717  13.693  1.00 47.66  ? 616 LEU B CG  1 
ATOM   7853 C  CD1 . LEU B  1 616 ? -7.583  68.622  12.680  1.00 44.11  ? 616 LEU B CD1 1 
ATOM   7854 C  CD2 . LEU B  1 616 ? -8.361  69.741  14.761  1.00 49.09  ? 616 LEU B CD2 1 
ATOM   7855 N  N   . GLY B  1 617 ? -12.792 70.515  12.803  1.00 60.66  ? 617 GLY B N   1 
ATOM   7856 C  CA  . GLY B  1 617 ? -14.065 70.979  12.223  1.00 63.52  ? 617 GLY B CA  1 
ATOM   7857 C  C   . GLY B  1 617 ? -14.010 71.325  10.746  1.00 62.97  ? 617 GLY B C   1 
ATOM   7858 O  O   . GLY B  1 617 ? -14.572 72.337  10.319  1.00 60.52  ? 617 GLY B O   1 
ATOM   7859 N  N   . TYR B  1 618 ? -13.337 70.479  9.970   1.00 63.40  ? 618 TYR B N   1 
ATOM   7860 C  CA  . TYR B  1 618 ? -13.275 70.628  8.516   1.00 63.27  ? 618 TYR B CA  1 
ATOM   7861 C  C   . TYR B  1 618 ? -14.609 70.220  7.892   1.00 60.84  ? 618 TYR B C   1 
ATOM   7862 O  O   . TYR B  1 618 ? -15.298 69.331  8.403   1.00 56.03  ? 618 TYR B O   1 
ATOM   7863 C  CB  . TYR B  1 618 ? -12.144 69.777  7.922   1.00 65.95  ? 618 TYR B CB  1 
ATOM   7864 C  CG  . TYR B  1 618 ? -10.751 70.354  8.097   1.00 64.74  ? 618 TYR B CG  1 
ATOM   7865 C  CD1 . TYR B  1 618 ? -10.024 70.137  9.270   1.00 64.05  ? 618 TYR B CD1 1 
ATOM   7866 C  CD2 . TYR B  1 618 ? -10.146 71.096  7.077   1.00 62.62  ? 618 TYR B CD2 1 
ATOM   7867 C  CE1 . TYR B  1 618 ? -8.744  70.650  9.428   1.00 62.49  ? 618 TYR B CE1 1 
ATOM   7868 C  CE2 . TYR B  1 618 ? -8.865  71.615  7.228   1.00 58.86  ? 618 TYR B CE2 1 
ATOM   7869 C  CZ  . TYR B  1 618 ? -8.168  71.390  8.405   1.00 60.55  ? 618 TYR B CZ  1 
ATOM   7870 O  OH  . TYR B  1 618 ? -6.900  71.902  8.563   1.00 62.12  ? 618 TYR B OH  1 
ATOM   7871 N  N   . THR B  1 619 ? -14.953 70.867  6.781   1.00 61.55  ? 619 THR B N   1 
ATOM   7872 C  CA  . THR B  1 619 ? -16.212 70.600  6.079   1.00 64.17  ? 619 THR B CA  1 
ATOM   7873 C  C   . THR B  1 619 ? -16.099 69.313  5.267   1.00 66.01  ? 619 THR B C   1 
ATOM   7874 O  O   . THR B  1 619 ? -14.999 68.803  5.040   1.00 70.44  ? 619 THR B O   1 
ATOM   7875 C  CB  . THR B  1 619 ? -16.616 71.754  5.134   1.00 62.65  ? 619 THR B CB  1 
ATOM   7876 O  OG1 . THR B  1 619 ? -15.683 71.854  4.052   1.00 64.28  ? 619 THR B OG1 1 
ATOM   7877 C  CG2 . THR B  1 619 ? -16.679 73.087  5.876   1.00 61.05  ? 619 THR B CG2 1 
ATOM   7878 N  N   . GLU B  1 620 ? -17.245 68.801  4.827   1.00 73.34  ? 620 GLU B N   1 
ATOM   7879 C  CA  . GLU B  1 620 ? -17.300 67.557  4.045   1.00 79.10  ? 620 GLU B CA  1 
ATOM   7880 C  C   . GLU B  1 620 ? -16.748 67.751  2.627   1.00 78.74  ? 620 GLU B C   1 
ATOM   7881 O  O   . GLU B  1 620 ? -16.229 66.807  2.028   1.00 80.42  ? 620 GLU B O   1 
ATOM   7882 C  CB  . GLU B  1 620 ? -18.730 67.003  3.991   1.00 81.39  ? 620 GLU B CB  1 
ATOM   7883 C  CG  . GLU B  1 620 ? -18.817 65.497  3.730   1.00 81.47  ? 620 GLU B CG  1 
ATOM   7884 C  CD  . GLU B  1 620 ? -18.356 64.632  4.899   1.00 80.56  ? 620 GLU B CD  1 
ATOM   7885 O  OE1 . GLU B  1 620 ? -18.085 63.433  4.671   1.00 79.31  ? 620 GLU B OE1 1 
ATOM   7886 O  OE2 . GLU B  1 620 ? -18.262 65.133  6.041   1.00 72.25  ? 620 GLU B OE2 1 
ATOM   7887 N  N   . ASP B  1 621 ? -16.872 68.970  2.101   1.00 75.07  ? 621 ASP B N   1 
ATOM   7888 C  CA  . ASP B  1 621 ? -16.248 69.349  0.826   1.00 69.96  ? 621 ASP B CA  1 
ATOM   7889 C  C   . ASP B  1 621 ? -14.726 69.380  0.957   1.00 64.44  ? 621 ASP B C   1 
ATOM   7890 O  O   . ASP B  1 621 ? -14.007 68.950  0.053   1.00 65.68  ? 621 ASP B O   1 
ATOM   7891 C  CB  . ASP B  1 621 ? -16.743 70.726  0.369   1.00 70.45  ? 621 ASP B CB  1 
ATOM   7892 C  CG  . ASP B  1 621 ? -18.216 70.732  -0.013  1.00 72.44  ? 621 ASP B CG  1 
ATOM   7893 O  OD1 . ASP B  1 621 ? -18.936 69.757  0.295   1.00 73.64  ? 621 ASP B OD1 1 
ATOM   7894 O  OD2 . ASP B  1 621 ? -18.657 71.729  -0.624  1.00 72.61  ? 621 ASP B OD2 1 
ATOM   7895 N  N   . GLU B  1 622 ? -14.252 69.905  2.084   1.00 59.26  ? 622 GLU B N   1 
ATOM   7896 C  CA  . GLU B  1 622 ? -12.825 69.919  2.410   1.00 57.88  ? 622 GLU B CA  1 
ATOM   7897 C  C   . GLU B  1 622 ? -12.253 68.516  2.655   1.00 61.01  ? 622 GLU B C   1 
ATOM   7898 O  O   . GLU B  1 622 ? -11.090 68.260  2.339   1.00 68.35  ? 622 GLU B O   1 
ATOM   7899 C  CB  . GLU B  1 622 ? -12.569 70.826  3.616   1.00 56.73  ? 622 GLU B CB  1 
ATOM   7900 C  CG  . GLU B  1 622 ? -12.644 72.308  3.272   1.00 58.77  ? 622 GLU B CG  1 
ATOM   7901 C  CD  . GLU B  1 622 ? -12.529 73.230  4.477   1.00 65.54  ? 622 GLU B CD  1 
ATOM   7902 O  OE1 . GLU B  1 622 ? -12.699 72.771  5.629   1.00 65.12  ? 622 GLU B OE1 1 
ATOM   7903 O  OE2 . GLU B  1 622 ? -12.269 74.434  4.267   1.00 64.38  ? 622 GLU B OE2 1 
ATOM   7904 N  N   . LYS B  1 623 ? -13.065 67.623  3.223   1.00 62.52  ? 623 LYS B N   1 
ATOM   7905 C  CA  . LYS B  1 623 ? -12.693 66.206  3.383   1.00 62.37  ? 623 LYS B CA  1 
ATOM   7906 C  C   . LYS B  1 623 ? -12.532 65.479  2.038   1.00 59.62  ? 623 LYS B C   1 
ATOM   7907 O  O   . LYS B  1 623 ? -11.620 64.666  1.875   1.00 53.89  ? 623 LYS B O   1 
ATOM   7908 C  CB  . LYS B  1 623 ? -13.723 65.467  4.248   1.00 60.82  ? 623 LYS B CB  1 
ATOM   7909 C  CG  . LYS B  1 623 ? -13.607 65.732  5.741   1.00 60.28  ? 623 LYS B CG  1 
ATOM   7910 C  CD  . LYS B  1 623 ? -14.682 64.981  6.514   1.00 64.87  ? 623 LYS B CD  1 
ATOM   7911 C  CE  . LYS B  1 623 ? -14.657 65.297  8.003   1.00 60.24  ? 623 LYS B CE  1 
ATOM   7912 N  NZ  . LYS B  1 623 ? -15.712 64.552  8.745   1.00 55.99  ? 623 LYS B NZ  1 
ATOM   7913 N  N   . ASP B  1 624 ? -13.433 65.769  1.097   1.00 60.62  ? 624 ASP B N   1 
ATOM   7914 C  CA  . ASP B  1 624 ? -13.370 65.235  -0.274  1.00 62.21  ? 624 ASP B CA  1 
ATOM   7915 C  C   . ASP B  1 624 ? -12.128 65.740  -1.008  1.00 61.62  ? 624 ASP B C   1 
ATOM   7916 O  O   . ASP B  1 624 ? -11.397 64.959  -1.622  1.00 56.23  ? 624 ASP B O   1 
ATOM   7917 C  CB  . ASP B  1 624 ? -14.618 65.647  -1.069  1.00 62.77  ? 624 ASP B CB  1 
ATOM   7918 C  CG  . ASP B  1 624 ? -15.870 64.874  -0.665  1.00 65.10  ? 624 ASP B CG  1 
ATOM   7919 O  OD1 . ASP B  1 624 ? -15.908 64.299  0.443   1.00 68.47  ? 624 ASP B OD1 1 
ATOM   7920 O  OD2 . ASP B  1 624 ? -16.830 64.850  -1.465  1.00 61.58  ? 624 ASP B OD2 1 
ATOM   7921 N  N   . PHE B  1 625 ? -11.919 67.053  -0.941  1.00 61.07  ? 625 PHE B N   1 
ATOM   7922 C  CA  . PHE B  1 625 ? -10.744 67.723  -1.520  1.00 56.14  ? 625 PHE B CA  1 
ATOM   7923 C  C   . PHE B  1 625 ? -9.403  67.166  -1.023  1.00 56.56  ? 625 PHE B C   1 
ATOM   7924 O  O   . PHE B  1 625 ? -8.425  67.142  -1.772  1.00 59.26  ? 625 PHE B O   1 
ATOM   7925 C  CB  . PHE B  1 625 ? -10.817 69.226  -1.229  1.00 52.64  ? 625 PHE B CB  1 
ATOM   7926 C  CG  . PHE B  1 625 ? -9.758  70.039  -1.929  1.00 55.75  ? 625 PHE B CG  1 
ATOM   7927 C  CD1 . PHE B  1 625 ? -9.656  70.033  -3.318  1.00 54.05  ? 625 PHE B CD1 1 
ATOM   7928 C  CD2 . PHE B  1 625 ? -8.865  70.822  -1.201  1.00 55.82  ? 625 PHE B CD2 1 
ATOM   7929 C  CE1 . PHE B  1 625 ? -8.680  70.780  -3.964  1.00 53.40  ? 625 PHE B CE1 1 
ATOM   7930 C  CE2 . PHE B  1 625 ? -7.890  71.575  -1.842  1.00 53.98  ? 625 PHE B CE2 1 
ATOM   7931 C  CZ  . PHE B  1 625 ? -7.798  71.555  -3.226  1.00 51.49  ? 625 PHE B CZ  1 
ATOM   7932 N  N   . SER B  1 626 ? -9.368  66.730  0.234   1.00 56.74  ? 626 SER B N   1 
ATOM   7933 C  CA  . SER B  1 626 ? -8.173  66.121  0.827   1.00 55.40  ? 626 SER B CA  1 
ATOM   7934 C  C   . SER B  1 626 ? -7.928  64.726  0.260   1.00 53.28  ? 626 SER B C   1 
ATOM   7935 O  O   . SER B  1 626 ? -6.815  64.406  -0.161  1.00 47.36  ? 626 SER B O   1 
ATOM   7936 C  CB  . SER B  1 626 ? -8.323  66.039  2.343   1.00 58.86  ? 626 SER B CB  1 
ATOM   7937 O  OG  . SER B  1 626 ? -7.091  65.716  2.959   1.00 64.48  ? 626 SER B OG  1 
ATOM   7938 N  N   . ARG B  1 627 ? -8.981  63.911  0.262   1.00 58.19  ? 627 ARG B N   1 
ATOM   7939 C  CA  . ARG B  1 627 ? -8.974  62.588  -0.383  1.00 59.00  ? 627 ARG B CA  1 
ATOM   7940 C  C   . ARG B  1 627 ? -8.678  62.660  -1.886  1.00 60.71  ? 627 ARG B C   1 
ATOM   7941 O  O   . ARG B  1 627 ? -8.097  61.730  -2.449  1.00 57.26  ? 627 ARG B O   1 
ATOM   7942 C  CB  . ARG B  1 627 ? -10.308 61.860  -0.150  1.00 59.88  ? 627 ARG B CB  1 
ATOM   7943 C  CG  . ARG B  1 627 ? -10.395 61.154  1.195   1.00 65.99  ? 627 ARG B CG  1 
ATOM   7944 C  CD  . ARG B  1 627 ? -11.789 60.604  1.461   1.00 65.08  ? 627 ARG B CD  1 
ATOM   7945 N  NE  . ARG B  1 627 ? -12.749 61.659  1.793   1.00 65.30  ? 627 ARG B NE  1 
ATOM   7946 C  CZ  . ARG B  1 627 ? -14.079 61.525  1.795   1.00 67.75  ? 627 ARG B CZ  1 
ATOM   7947 N  NH1 . ARG B  1 627 ? -14.666 60.370  1.472   1.00 71.06  ? 627 ARG B NH1 1 
ATOM   7948 N  NH2 . ARG B  1 627 ? -14.837 62.567  2.123   1.00 65.96  ? 627 ARG B NH2 1 
ATOM   7949 N  N   . LYS B  1 628 ? -9.091  63.757  -2.522  1.00 66.08  ? 628 LYS B N   1 
ATOM   7950 C  CA  . LYS B  1 628 ? -8.829  64.000  -3.943  1.00 69.15  ? 628 LYS B CA  1 
ATOM   7951 C  C   . LYS B  1 628 ? -7.333  64.115  -4.235  1.00 66.15  ? 628 LYS B C   1 
ATOM   7952 O  O   . LYS B  1 628 ? -6.803  63.375  -5.065  1.00 64.66  ? 628 LYS B O   1 
ATOM   7953 C  CB  . LYS B  1 628 ? -9.555  65.271  -4.410  1.00 76.25  ? 628 LYS B CB  1 
ATOM   7954 C  CG  . LYS B  1 628 ? -9.497  65.541  -5.910  1.00 78.42  ? 628 LYS B CG  1 
ATOM   7955 C  CD  . LYS B  1 628 ? -10.330 66.761  -6.280  1.00 82.70  ? 628 LYS B CD  1 
ATOM   7956 C  CE  . LYS B  1 628 ? -10.019 67.247  -7.687  1.00 83.18  ? 628 LYS B CE  1 
ATOM   7957 N  NZ  . LYS B  1 628 ? -10.883 68.383  -8.120  1.00 77.50  ? 628 LYS B NZ  1 
ATOM   7958 N  N   . ILE B  1 629 ? -6.666  65.042  -3.550  1.00 63.63  ? 629 ILE B N   1 
ATOM   7959 C  CA  . ILE B  1 629 ? -5.233  65.291  -3.783  1.00 65.28  ? 629 ILE B CA  1 
ATOM   7960 C  C   . ILE B  1 629 ? -4.334  64.209  -3.181  1.00 61.82  ? 629 ILE B C   1 
ATOM   7961 O  O   . ILE B  1 629 ? -3.246  63.960  -3.694  1.00 58.99  ? 629 ILE B O   1 
ATOM   7962 C  CB  . ILE B  1 629 ? -4.781  66.707  -3.345  1.00 69.75  ? 629 ILE B CB  1 
ATOM   7963 C  CG1 . ILE B  1 629 ? -4.847  66.906  -1.826  1.00 75.79  ? 629 ILE B CG1 1 
ATOM   7964 C  CG2 . ILE B  1 629 ? -5.617  67.755  -4.066  1.00 74.70  ? 629 ILE B CG2 1 
ATOM   7965 C  CD1 . ILE B  1 629 ? -4.177  68.187  -1.375  1.00 80.96  ? 629 ILE B CD1 1 
ATOM   7966 N  N   . MET B  1 630 ? -4.784  63.571  -2.103  1.00 60.31  ? 630 MET B N   1 
ATOM   7967 C  CA  . MET B  1 630 ? -4.085  62.398  -1.560  1.00 60.94  ? 630 MET B CA  1 
ATOM   7968 C  C   . MET B  1 630 ? -4.023  61.244  -2.567  1.00 52.41  ? 630 MET B C   1 
ATOM   7969 O  O   . MET B  1 630 ? -3.062  60.472  -2.571  1.00 42.00  ? 630 MET B O   1 
ATOM   7970 C  CB  . MET B  1 630 ? -4.745  61.922  -0.267  1.00 65.27  ? 630 MET B CB  1 
ATOM   7971 C  CG  . MET B  1 630 ? -4.374  62.755  0.947   1.00 68.40  ? 630 MET B CG  1 
ATOM   7972 S  SD  . MET B  1 630 ? -5.519  62.521  2.317   1.00 76.16  ? 630 MET B SD  1 
ATOM   7973 C  CE  . MET B  1 630 ? -5.272  60.782  2.650   1.00 73.75  ? 630 MET B CE  1 
ATOM   7974 N  N   . ARG B  1 631 ? -5.052  61.139  -3.407  1.00 55.38  ? 631 ARG B N   1 
ATOM   7975 C  CA  . ARG B  1 631 ? -5.099  60.149  -4.482  1.00 57.62  ? 631 ARG B CA  1 
ATOM   7976 C  C   . ARG B  1 631 ? -4.112  60.489  -5.587  1.00 56.59  ? 631 ARG B C   1 
ATOM   7977 O  O   . ARG B  1 631 ? -3.333  59.634  -5.994  1.00 51.65  ? 631 ARG B O   1 
ATOM   7978 C  CB  . ARG B  1 631 ? -6.506  60.059  -5.070  1.00 55.74  ? 631 ARG B CB  1 
ATOM   7979 C  CG  . ARG B  1 631 ? -6.745  58.826  -5.934  1.00 58.48  ? 631 ARG B CG  1 
ATOM   7980 C  CD  . ARG B  1 631 ? -6.917  57.561  -5.108  1.00 61.81  ? 631 ARG B CD  1 
ATOM   7981 N  NE  . ARG B  1 631 ? -8.126  57.596  -4.283  1.00 66.59  ? 631 ARG B NE  1 
ATOM   7982 C  CZ  . ARG B  1 631 ? -8.570  56.585  -3.535  1.00 63.59  ? 631 ARG B CZ  1 
ATOM   7983 N  NH1 . ARG B  1 631 ? -7.915  55.425  -3.490  1.00 63.55  ? 631 ARG B NH1 1 
ATOM   7984 N  NH2 . ARG B  1 631 ? -9.687  56.736  -2.824  1.00 60.58  ? 631 ARG B NH2 1 
ATOM   7985 N  N   . TYR B  1 632 ? -4.163  61.731  -6.069  1.00 56.55  ? 632 TYR B N   1 
ATOM   7986 C  CA  . TYR B  1 632 ? -3.210  62.237  -7.067  1.00 56.30  ? 632 TYR B CA  1 
ATOM   7987 C  C   . TYR B  1 632 ? -1.761  61.971  -6.662  1.00 56.70  ? 632 TYR B C   1 
ATOM   7988 O  O   . TYR B  1 632 ? -0.973  61.433  -7.441  1.00 53.10  ? 632 TYR B O   1 
ATOM   7989 C  CB  . TYR B  1 632 ? -3.372  63.755  -7.240  1.00 58.43  ? 632 TYR B CB  1 
ATOM   7990 C  CG  . TYR B  1 632 ? -4.562  64.236  -8.054  1.00 60.38  ? 632 TYR B CG  1 
ATOM   7991 C  CD1 . TYR B  1 632 ? -5.003  63.548  -9.186  1.00 60.83  ? 632 TYR B CD1 1 
ATOM   7992 C  CD2 . TYR B  1 632 ? -5.215  65.424  -7.719  1.00 62.62  ? 632 TYR B CD2 1 
ATOM   7993 C  CE1 . TYR B  1 632 ? -6.076  64.004  -9.935  1.00 58.94  ? 632 TYR B CE1 1 
ATOM   7994 C  CE2 . TYR B  1 632 ? -6.290  65.891  -8.465  1.00 63.89  ? 632 TYR B CE2 1 
ATOM   7995 C  CZ  . TYR B  1 632 ? -6.716  65.177  -9.572  1.00 61.01  ? 632 TYR B CZ  1 
ATOM   7996 O  OH  . TYR B  1 632 ? -7.778  65.630  -10.316 1.00 57.65  ? 632 TYR B OH  1 
ATOM   7997 N  N   . TRP B  1 633 ? -1.436  62.361  -5.433  1.00 58.25  ? 633 TRP B N   1 
ATOM   7998 C  CA  . TRP B  1 633 ? -0.080  62.241  -4.878  1.00 53.92  ? 633 TRP B CA  1 
ATOM   7999 C  C   . TRP B  1 633 ? 0.370   60.781  -4.821  1.00 53.69  ? 633 TRP B C   1 
ATOM   8000 O  O   . TRP B  1 633 ? 1.457   60.437  -5.287  1.00 57.79  ? 633 TRP B O   1 
ATOM   8001 C  CB  . TRP B  1 633 ? -0.021  62.831  -3.462  1.00 50.22  ? 633 TRP B CB  1 
ATOM   8002 C  CG  . TRP B  1 633 ? 0.445   64.264  -3.339  1.00 45.37  ? 633 TRP B CG  1 
ATOM   8003 C  CD1 . TRP B  1 633 ? 1.423   64.722  -2.505  1.00 45.05  ? 633 TRP B CD1 1 
ATOM   8004 C  CD2 . TRP B  1 633 ? -0.058  65.418  -4.035  1.00 46.08  ? 633 TRP B CD2 1 
ATOM   8005 N  NE1 . TRP B  1 633 ? 1.569   66.080  -2.638  1.00 42.77  ? 633 TRP B NE1 1 
ATOM   8006 C  CE2 . TRP B  1 633 ? 0.674   66.535  -3.570  1.00 46.20  ? 633 TRP B CE2 1 
ATOM   8007 C  CE3 . TRP B  1 633 ? -1.047  65.620  -5.010  1.00 46.56  ? 633 TRP B CE3 1 
ATOM   8008 C  CZ2 . TRP B  1 633 ? 0.448   67.834  -4.046  1.00 47.27  ? 633 TRP B CZ2 1 
ATOM   8009 C  CZ3 . TRP B  1 633 ? -1.275  66.914  -5.481  1.00 46.63  ? 633 TRP B CZ3 1 
ATOM   8010 C  CH2 . TRP B  1 633 ? -0.528  68.002  -4.998  1.00 47.94  ? 633 TRP B CH2 1 
ATOM   8011 N  N   . SER B  1 634 ? -0.473  59.943  -4.225  1.00 52.76  ? 634 SER B N   1 
ATOM   8012 C  CA  . SER B  1 634 ? -0.207  58.507  -4.113  1.00 51.76  ? 634 SER B CA  1 
ATOM   8013 C  C   . SER B  1 634 ? -0.210  57.793  -5.467  1.00 53.23  ? 634 SER B C   1 
ATOM   8014 O  O   . SER B  1 634 ? 0.570   56.866  -5.670  1.00 54.44  ? 634 SER B O   1 
ATOM   8015 C  CB  . SER B  1 634 ? -1.222  57.847  -3.179  1.00 55.91  ? 634 SER B CB  1 
ATOM   8016 O  OG  . SER B  1 634 ? -2.532  57.899  -3.720  1.00 62.27  ? 634 SER B OG  1 
ATOM   8017 N  N   . ASN B  1 635 ? -1.086  58.222  -6.378  1.00 53.97  ? 635 ASN B N   1 
ATOM   8018 C  CA  . ASN B  1 635 ? -1.110  57.697  -7.755  1.00 53.20  ? 635 ASN B CA  1 
ATOM   8019 C  C   . ASN B  1 635 ? 0.197   58.015  -8.475  1.00 51.03  ? 635 ASN B C   1 
ATOM   8020 O  O   . ASN B  1 635 ? 0.762   57.150  -9.150  1.00 53.29  ? 635 ASN B O   1 
ATOM   8021 C  CB  . ASN B  1 635 ? -2.295  58.260  -8.562  1.00 54.40  ? 635 ASN B CB  1 
ATOM   8022 C  CG  . ASN B  1 635 ? -3.622  57.585  -8.231  1.00 55.32  ? 635 ASN B CG  1 
ATOM   8023 O  OD1 . ASN B  1 635 ? -3.693  56.678  -7.399  1.00 63.29  ? 635 ASN B OD1 1 
ATOM   8024 N  ND2 . ASN B  1 635 ? -4.685  58.035  -8.888  1.00 54.78  ? 635 ASN B ND2 1 
ATOM   8025 N  N   . PHE B  1 636 ? 0.666   59.253  -8.323  1.00 52.06  ? 636 PHE B N   1 
ATOM   8026 C  CA  . PHE B  1 636 ? 1.968   59.668  -8.850  1.00 57.31  ? 636 PHE B CA  1 
ATOM   8027 C  C   . PHE B  1 636 ? 3.105   58.835  -8.262  1.00 59.48  ? 636 PHE B C   1 
ATOM   8028 O  O   . PHE B  1 636 ? 3.953   58.326  -8.998  1.00 62.02  ? 636 PHE B O   1 
ATOM   8029 C  CB  . PHE B  1 636 ? 2.227   61.146  -8.557  1.00 57.13  ? 636 PHE B CB  1 
ATOM   8030 C  CG  . PHE B  1 636 ? 3.568   61.629  -9.034  1.00 57.39  ? 636 PHE B CG  1 
ATOM   8031 C  CD1 . PHE B  1 636 ? 3.754   62.000  -10.361 1.00 59.35  ? 636 PHE B CD1 1 
ATOM   8032 C  CD2 . PHE B  1 636 ? 4.651   61.698  -8.161  1.00 56.02  ? 636 PHE B CD2 1 
ATOM   8033 C  CE1 . PHE B  1 636 ? 4.992   62.438  -10.808 1.00 56.82  ? 636 PHE B CE1 1 
ATOM   8034 C  CE2 . PHE B  1 636 ? 5.891   62.133  -8.601  1.00 55.93  ? 636 PHE B CE2 1 
ATOM   8035 C  CZ  . PHE B  1 636 ? 6.061   62.505  -9.925  1.00 55.39  ? 636 PHE B CZ  1 
ATOM   8036 N  N   . ALA B  1 637 ? 3.113   58.722  -6.936  1.00 60.98  ? 637 ALA B N   1 
ATOM   8037 C  CA  . ALA B  1 637 ? 4.097   57.913  -6.209  1.00 55.58  ? 637 ALA B CA  1 
ATOM   8038 C  C   . ALA B  1 637 ? 4.128   56.453  -6.669  1.00 54.79  ? 637 ALA B C   1 
ATOM   8039 O  O   . ALA B  1 637 ? 5.194   55.841  -6.743  1.00 58.66  ? 637 ALA B O   1 
ATOM   8040 C  CB  . ALA B  1 637 ? 3.818   57.976  -4.716  1.00 52.09  ? 637 ALA B CB  1 
ATOM   8041 N  N   . LYS B  1 638 ? 2.949   55.914  -6.969  1.00 55.18  ? 638 LYS B N   1 
ATOM   8042 C  CA  . LYS B  1 638 ? 2.801   54.532  -7.423  1.00 56.70  ? 638 LYS B CA  1 
ATOM   8043 C  C   . LYS B  1 638 ? 3.222   54.356  -8.881  1.00 55.85  ? 638 LYS B C   1 
ATOM   8044 O  O   . LYS B  1 638 ? 4.051   53.499  -9.199  1.00 58.47  ? 638 LYS B O   1 
ATOM   8045 C  CB  . LYS B  1 638 ? 1.342   54.082  -7.270  1.00 58.21  ? 638 LYS B CB  1 
ATOM   8046 C  CG  . LYS B  1 638 ? 0.908   53.787  -5.837  1.00 60.60  ? 638 LYS B CG  1 
ATOM   8047 C  CD  . LYS B  1 638 ? -0.610  53.819  -5.694  1.00 62.08  ? 638 LYS B CD  1 
ATOM   8048 C  CE  . LYS B  1 638 ? -1.056  53.751  -4.241  1.00 63.10  ? 638 LYS B CE  1 
ATOM   8049 N  NZ  . LYS B  1 638 ? -2.501  54.083  -4.093  1.00 63.86  ? 638 LYS B NZ  1 
ATOM   8050 N  N   . THR B  1 639 ? 2.639   55.180  -9.748  1.00 49.87  ? 639 THR B N   1 
ATOM   8051 C  CA  . THR B  1 639 ? 2.692   54.991  -11.207 1.00 48.43  ? 639 THR B CA  1 
ATOM   8052 C  C   . THR B  1 639 ? 3.536   55.996  -12.013 1.00 51.67  ? 639 THR B C   1 
ATOM   8053 O  O   . THR B  1 639 ? 3.975   55.680  -13.121 1.00 50.94  ? 639 THR B O   1 
ATOM   8054 C  CB  . THR B  1 639 ? 1.263   55.020  -11.791 1.00 47.86  ? 639 THR B CB  1 
ATOM   8055 O  OG1 . THR B  1 639 ? 0.717   56.342  -11.681 1.00 47.18  ? 639 THR B OG1 1 
ATOM   8056 C  CG2 . THR B  1 639 ? 0.351   54.035  -11.060 1.00 48.38  ? 639 THR B CG2 1 
ATOM   8057 N  N   . GLY B  1 640 ? 3.753   57.189  -11.462 1.00 54.36  ? 640 GLY B N   1 
ATOM   8058 C  CA  . GLY B  1 640 ? 4.361   58.318  -12.186 1.00 50.75  ? 640 GLY B CA  1 
ATOM   8059 C  C   . GLY B  1 640 ? 3.349   59.216  -12.887 1.00 51.83  ? 640 GLY B C   1 
ATOM   8060 O  O   . GLY B  1 640 ? 3.721   60.032  -13.735 1.00 49.40  ? 640 GLY B O   1 
ATOM   8061 N  N   . ASN B  1 641 ? 2.075   59.061  -12.527 1.00 50.83  ? 641 ASN B N   1 
ATOM   8062 C  CA  . ASN B  1 641 ? 0.971   59.818  -13.112 1.00 53.62  ? 641 ASN B CA  1 
ATOM   8063 C  C   . ASN B  1 641 ? -0.108  59.998  -12.032 1.00 51.22  ? 641 ASN B C   1 
ATOM   8064 O  O   . ASN B  1 641 ? -0.581  59.001  -11.482 1.00 49.72  ? 641 ASN B O   1 
ATOM   8065 C  CB  . ASN B  1 641 ? 0.405   59.047  -14.314 1.00 57.91  ? 641 ASN B CB  1 
ATOM   8066 C  CG  . ASN B  1 641 ? -0.539  59.878  -15.169 1.00 57.92  ? 641 ASN B CG  1 
ATOM   8067 O  OD1 . ASN B  1 641 ? -1.304  60.702  -14.665 1.00 60.45  ? 641 ASN B OD1 1 
ATOM   8068 N  ND2 . ASN B  1 641 ? -0.486  59.661  -16.479 1.00 57.98  ? 641 ASN B ND2 1 
ATOM   8069 N  N   . PRO B  1 642 ? -0.493  61.254  -11.714 1.00 54.73  ? 642 PRO B N   1 
ATOM   8070 C  CA  . PRO B  1 642 ? -1.555  61.460  -10.717 1.00 55.52  ? 642 PRO B CA  1 
ATOM   8071 C  C   . PRO B  1 642 ? -2.951  61.034  -11.184 1.00 57.67  ? 642 PRO B C   1 
ATOM   8072 O  O   . PRO B  1 642 ? -3.778  60.640  -10.354 1.00 52.64  ? 642 PRO B O   1 
ATOM   8073 C  CB  . PRO B  1 642 ? -1.513  62.972  -10.467 1.00 55.84  ? 642 PRO B CB  1 
ATOM   8074 C  CG  . PRO B  1 642 ? -0.972  63.541  -11.726 1.00 57.44  ? 642 PRO B CG  1 
ATOM   8075 C  CD  . PRO B  1 642 ? 0.026   62.538  -12.221 1.00 56.48  ? 642 PRO B CD  1 
ATOM   8076 N  N   . ASN B  1 643 ? -3.192  61.097  -12.494 1.00 63.04  ? 643 ASN B N   1 
ATOM   8077 C  CA  . ASN B  1 643 ? -4.484  60.709  -13.076 1.00 64.15  ? 643 ASN B CA  1 
ATOM   8078 C  C   . ASN B  1 643 ? -4.799  59.232  -12.832 1.00 68.08  ? 643 ASN B C   1 
ATOM   8079 O  O   . ASN B  1 643 ? -3.909  58.386  -12.977 1.00 69.46  ? 643 ASN B O   1 
ATOM   8080 C  CB  . ASN B  1 643 ? -4.505  60.954  -14.586 1.00 62.33  ? 643 ASN B CB  1 
ATOM   8081 C  CG  . ASN B  1 643 ? -4.361  62.415  -14.946 1.00 59.82  ? 643 ASN B CG  1 
ATOM   8082 O  OD1 . ASN B  1 643 ? -5.098  63.264  -14.446 1.00 55.93  ? 643 ASN B OD1 1 
ATOM   8083 N  ND2 . ASN B  1 643 ? -3.419  62.716  -15.831 1.00 57.00  ? 643 ASN B ND2 1 
ATOM   8084 N  N   . PRO B  1 644 ? -6.058  58.913  -12.465 1.00 70.65  ? 644 PRO B N   1 
ATOM   8085 C  CA  . PRO B  1 644 ? -6.435  57.508  -12.308 1.00 73.60  ? 644 PRO B CA  1 
ATOM   8086 C  C   . PRO B  1 644 ? -6.597  56.777  -13.641 1.00 75.20  ? 644 PRO B C   1 
ATOM   8087 O  O   . PRO B  1 644 ? -6.968  57.387  -14.648 1.00 72.17  ? 644 PRO B O   1 
ATOM   8088 C  CB  . PRO B  1 644 ? -7.783  57.586  -11.582 1.00 74.24  ? 644 PRO B CB  1 
ATOM   8089 C  CG  . PRO B  1 644 ? -8.343  58.903  -11.980 1.00 74.04  ? 644 PRO B CG  1 
ATOM   8090 C  CD  . PRO B  1 644 ? -7.162  59.818  -12.088 1.00 72.71  ? 644 PRO B CD  1 
ATOM   8091 N  N   . ASN B  1 645 ? -6.312  55.476  -13.625 1.00 82.42  ? 645 ASN B N   1 
ATOM   8092 C  CA  . ASN B  1 645 ? -6.592  54.593  -14.757 1.00 86.46  ? 645 ASN B CA  1 
ATOM   8093 C  C   . ASN B  1 645 ? -8.106  54.377  -14.818 1.00 94.27  ? 645 ASN B C   1 
ATOM   8094 O  O   . ASN B  1 645 ? -8.743  54.188  -13.781 1.00 103.85 ? 645 ASN B O   1 
ATOM   8095 C  CB  . ASN B  1 645 ? -5.868  53.251  -14.586 1.00 84.62  ? 645 ASN B CB  1 
ATOM   8096 C  CG  . ASN B  1 645 ? -5.559  52.573  -15.911 1.00 82.29  ? 645 ASN B CG  1 
ATOM   8097 O  OD1 . ASN B  1 645 ? -6.184  51.576  -16.274 1.00 76.49  ? 645 ASN B OD1 1 
ATOM   8098 N  ND2 . ASN B  1 645 ? -4.590  53.115  -16.640 1.00 83.96  ? 645 ASN B ND2 1 
ATOM   8099 N  N   . THR B  1 646 ? -8.658  54.420  -16.034 1.00 92.45  ? 646 THR B N   1 
ATOM   8100 C  CA  . THR B  1 646 ? -10.123 54.419  -16.316 1.00 100.21 ? 646 THR B CA  1 
ATOM   8101 C  C   . THR B  1 646 ? -10.739 55.842  -16.373 1.00 99.04  ? 646 THR B C   1 
ATOM   8102 O  O   . THR B  1 646 ? -11.803 56.024  -16.971 1.00 93.15  ? 646 THR B O   1 
ATOM   8103 C  CB  . THR B  1 646 ? -10.958 53.509  -15.361 1.00 101.04 ? 646 THR B CB  1 
ATOM   8104 O  OG1 . THR B  1 646 ? -10.216 52.329  -15.024 1.00 92.30  ? 646 THR B OG1 1 
ATOM   8105 C  CG2 . THR B  1 646 ? -12.278 53.074  -16.008 1.00 96.05  ? 646 THR B CG2 1 
ATOM   8106 N  N   . ALA B  1 647 ? -10.067 56.828  -15.769 1.00 96.46  ? 647 ALA B N   1 
ATOM   8107 C  CA  . ALA B  1 647 ? -10.481 58.245  -15.776 1.00 99.70  ? 647 ALA B CA  1 
ATOM   8108 C  C   . ALA B  1 647 ? -11.853 58.472  -15.126 1.00 103.80 ? 647 ALA B C   1 
ATOM   8109 O  O   . ALA B  1 647 ? -12.878 58.542  -15.810 1.00 103.53 ? 647 ALA B O   1 
ATOM   8110 C  CB  . ALA B  1 647 ? -10.436 58.826  -17.188 1.00 98.80  ? 647 ALA B CB  1 
ATOM   8111 N  N   . SER B  1 648 ? -11.848 58.580  -13.799 1.00 112.64 ? 648 SER B N   1 
ATOM   8112 C  CA  . SER B  1 648 ? -13.064 58.811  -13.012 1.00 118.76 ? 648 SER B CA  1 
ATOM   8113 C  C   . SER B  1 648 ? -13.628 60.221  -13.255 1.00 119.85 ? 648 SER B C   1 
ATOM   8114 O  O   . SER B  1 648 ? -12.886 61.140  -13.599 1.00 116.76 ? 648 SER B O   1 
ATOM   8115 C  CB  . SER B  1 648 ? -12.767 58.595  -11.522 1.00 113.60 ? 648 SER B CB  1 
ATOM   8116 O  OG  . SER B  1 648 ? -13.926 58.775  -10.724 1.00 101.48 ? 648 SER B OG  1 
ATOM   8117 N  N   . SER B  1 649 ? -14.940 60.371  -13.086 1.00 123.67 ? 649 SER B N   1 
ATOM   8118 C  CA  . SER B  1 649 ? -15.627 61.660  -13.298 1.00 122.00 ? 649 SER B CA  1 
ATOM   8119 C  C   . SER B  1 649 ? -15.364 62.666  -12.168 1.00 117.69 ? 649 SER B C   1 
ATOM   8120 O  O   . SER B  1 649 ? -15.204 63.863  -12.418 1.00 95.58  ? 649 SER B O   1 
ATOM   8121 C  CB  . SER B  1 649 ? -17.136 61.443  -13.463 1.00 120.20 ? 649 SER B CB  1 
ATOM   8122 O  OG  . SER B  1 649 ? -17.420 60.722  -14.650 1.00 107.01 ? 649 SER B OG  1 
ATOM   8123 N  N   . GLU B  1 650 ? -15.332 62.166  -10.933 1.00 117.03 ? 650 GLU B N   1 
ATOM   8124 C  CA  . GLU B  1 650 ? -15.040 62.974  -9.740  1.00 109.78 ? 650 GLU B CA  1 
ATOM   8125 C  C   . GLU B  1 650 ? -13.592 63.490  -9.686  1.00 117.36 ? 650 GLU B C   1 
ATOM   8126 O  O   . GLU B  1 650 ? -13.323 64.498  -9.031  1.00 113.26 ? 650 GLU B O   1 
ATOM   8127 C  CB  . GLU B  1 650 ? -15.335 62.159  -8.475  1.00 107.73 ? 650 GLU B CB  1 
ATOM   8128 C  CG  . GLU B  1 650 ? -16.801 61.770  -8.301  1.00 106.49 ? 650 GLU B CG  1 
ATOM   8129 C  CD  . GLU B  1 650 ? -17.054 60.856  -7.109  1.00 102.70 ? 650 GLU B CD  1 
ATOM   8130 O  OE1 . GLU B  1 650 ? -18.239 60.579  -6.826  1.00 97.32  ? 650 GLU B OE1 1 
ATOM   8131 O  OE2 . GLU B  1 650 ? -16.087 60.411  -6.453  1.00 91.74  ? 650 GLU B OE2 1 
ATOM   8132 N  N   . PHE B  1 651 ? -12.677 62.775  -10.348 1.00 115.33 ? 651 PHE B N   1 
ATOM   8133 C  CA  . PHE B  1 651 ? -11.265 63.164  -10.486 1.00 98.76  ? 651 PHE B CA  1 
ATOM   8134 C  C   . PHE B  1 651 ? -11.010 63.756  -11.875 1.00 86.40  ? 651 PHE B C   1 
ATOM   8135 O  O   . PHE B  1 651 ? -10.913 63.002  -12.848 1.00 80.87  ? 651 PHE B O   1 
ATOM   8136 C  CB  . PHE B  1 651 ? -10.359 61.941  -10.308 1.00 104.50 ? 651 PHE B CB  1 
ATOM   8137 C  CG  . PHE B  1 651 ? -10.316 61.413  -8.907  1.00 111.42 ? 651 PHE B CG  1 
ATOM   8138 C  CD1 . PHE B  1 651 ? -9.373  61.887  -8.002  1.00 108.96 ? 651 PHE B CD1 1 
ATOM   8139 C  CD2 . PHE B  1 651 ? -11.213 60.434  -8.489  1.00 115.75 ? 651 PHE B CD2 1 
ATOM   8140 C  CE1 . PHE B  1 651 ? -9.329  61.399  -6.705  1.00 116.91 ? 651 PHE B CE1 1 
ATOM   8141 C  CE2 . PHE B  1 651 ? -11.175 59.942  -7.191  1.00 110.18 ? 651 PHE B CE2 1 
ATOM   8142 C  CZ  . PHE B  1 651 ? -10.230 60.425  -6.298  1.00 115.31 ? 651 PHE B CZ  1 
ATOM   8143 N  N   . PRO B  1 652 ? -10.896 65.097  -11.987 1.00 80.23  ? 652 PRO B N   1 
ATOM   8144 C  CA  . PRO B  1 652 ? -10.640 65.682  -13.311 1.00 76.41  ? 652 PRO B CA  1 
ATOM   8145 C  C   . PRO B  1 652 ? -9.290  65.307  -13.941 1.00 68.51  ? 652 PRO B C   1 
ATOM   8146 O  O   . PRO B  1 652 ? -8.386  64.818  -13.257 1.00 65.09  ? 652 PRO B O   1 
ATOM   8147 C  CB  . PRO B  1 652 ? -10.704 67.195  -13.049 1.00 75.06  ? 652 PRO B CB  1 
ATOM   8148 C  CG  . PRO B  1 652 ? -11.490 67.340  -11.796 1.00 70.61  ? 652 PRO B CG  1 
ATOM   8149 C  CD  . PRO B  1 652 ? -11.130 66.144  -10.976 1.00 74.32  ? 652 PRO B CD  1 
ATOM   8150 N  N   . GLU B  1 653 ? -9.189  65.543  -15.247 1.00 67.29  ? 653 GLU B N   1 
ATOM   8151 C  CA  . GLU B  1 653 ? -7.957  65.328  -16.003 1.00 66.11  ? 653 GLU B CA  1 
ATOM   8152 C  C   . GLU B  1 653 ? -6.889  66.326  -15.550 1.00 65.82  ? 653 GLU B C   1 
ATOM   8153 O  O   . GLU B  1 653 ? -7.098  67.541  -15.613 1.00 77.45  ? 653 GLU B O   1 
ATOM   8154 C  CB  . GLU B  1 653 ? -8.222  65.492  -17.508 1.00 64.45  ? 653 GLU B CB  1 
ATOM   8155 C  CG  . GLU B  1 653 ? -7.032  65.219  -18.432 1.00 67.99  ? 653 GLU B CG  1 
ATOM   8156 C  CD  . GLU B  1 653 ? -6.794  63.741  -18.698 1.00 75.72  ? 653 GLU B CD  1 
ATOM   8157 O  OE1 . GLU B  1 653 ? -7.728  63.055  -19.164 1.00 84.74  ? 653 GLU B OE1 1 
ATOM   8158 O  OE2 . GLU B  1 653 ? -5.663  63.265  -18.455 1.00 73.70  ? 653 GLU B OE2 1 
ATOM   8159 N  N   . TRP B  1 654 ? -5.774  65.791  -15.060 1.00 55.33  ? 654 TRP B N   1 
ATOM   8160 C  CA  . TRP B  1 654 ? -4.544  66.548  -14.844 1.00 53.16  ? 654 TRP B CA  1 
ATOM   8161 C  C   . TRP B  1 654 ? -3.635  66.318  -16.062 1.00 53.26  ? 654 TRP B C   1 
ATOM   8162 O  O   . TRP B  1 654 ? -3.000  65.265  -16.165 1.00 52.84  ? 654 TRP B O   1 
ATOM   8163 C  CB  . TRP B  1 654 ? -3.858  66.078  -13.555 1.00 52.35  ? 654 TRP B CB  1 
ATOM   8164 C  CG  . TRP B  1 654 ? -2.789  66.998  -13.018 1.00 48.83  ? 654 TRP B CG  1 
ATOM   8165 C  CD1 . TRP B  1 654 ? -2.065  67.932  -13.710 1.00 48.38  ? 654 TRP B CD1 1 
ATOM   8166 C  CD2 . TRP B  1 654 ? -2.303  67.038  -11.673 1.00 47.32  ? 654 TRP B CD2 1 
ATOM   8167 N  NE1 . TRP B  1 654 ? -1.176  68.558  -12.875 1.00 49.64  ? 654 TRP B NE1 1 
ATOM   8168 C  CE2 . TRP B  1 654 ? -1.299  68.029  -11.619 1.00 48.22  ? 654 TRP B CE2 1 
ATOM   8169 C  CE3 . TRP B  1 654 ? -2.625  66.337  -10.503 1.00 44.06  ? 654 TRP B CE3 1 
ATOM   8170 C  CZ2 . TRP B  1 654 ? -0.612  68.334  -10.444 1.00 47.34  ? 654 TRP B CZ2 1 
ATOM   8171 C  CZ3 . TRP B  1 654 ? -1.941  66.643  -9.332  1.00 45.27  ? 654 TRP B CZ3 1 
ATOM   8172 C  CH2 . TRP B  1 654 ? -0.947  67.636  -9.313  1.00 46.61  ? 654 TRP B CH2 1 
ATOM   8173 N  N   . PRO B  1 655 ? -3.574  67.291  -16.994 1.00 50.85  ? 655 PRO B N   1 
ATOM   8174 C  CA  . PRO B  1 655 ? -2.678  67.118  -18.143 1.00 50.86  ? 655 PRO B CA  1 
ATOM   8175 C  C   . PRO B  1 655 ? -1.204  67.303  -17.778 1.00 50.57  ? 655 PRO B C   1 
ATOM   8176 O  O   . PRO B  1 655 ? -0.884  67.994  -16.809 1.00 56.28  ? 655 PRO B O   1 
ATOM   8177 C  CB  . PRO B  1 655 ? -3.137  68.208  -19.115 1.00 52.03  ? 655 PRO B CB  1 
ATOM   8178 C  CG  . PRO B  1 655 ? -3.732  69.258  -18.251 1.00 53.14  ? 655 PRO B CG  1 
ATOM   8179 C  CD  . PRO B  1 655 ? -4.347  68.544  -17.087 1.00 51.59  ? 655 PRO B CD  1 
ATOM   8180 N  N   . LYS B  1 656 ? -0.327  66.685  -18.562 1.00 51.57  ? 656 LYS B N   1 
ATOM   8181 C  CA  . LYS B  1 656 ? 1.119   66.799  -18.363 1.00 54.14  ? 656 LYS B CA  1 
ATOM   8182 C  C   . LYS B  1 656 ? 1.597   68.231  -18.608 1.00 57.11  ? 656 LYS B C   1 
ATOM   8183 O  O   . LYS B  1 656 ? 1.216   68.852  -19.603 1.00 52.15  ? 656 LYS B O   1 
ATOM   8184 C  CB  . LYS B  1 656 ? 1.864   65.850  -19.306 1.00 56.80  ? 656 LYS B CB  1 
ATOM   8185 C  CG  . LYS B  1 656 ? 1.607   64.375  -19.042 1.00 62.31  ? 656 LYS B CG  1 
ATOM   8186 C  CD  . LYS B  1 656 ? 2.143   63.504  -20.166 1.00 67.12  ? 656 LYS B CD  1 
ATOM   8187 C  CE  . LYS B  1 656 ? 1.762   62.047  -19.964 1.00 69.67  ? 656 LYS B CE  1 
ATOM   8188 N  NZ  . LYS B  1 656 ? 2.093   61.207  -21.148 1.00 70.99  ? 656 LYS B NZ  1 
ATOM   8189 N  N   . HIS B  1 657 ? 2.422   68.746  -17.696 1.00 58.29  ? 657 HIS B N   1 
ATOM   8190 C  CA  . HIS B  1 657 ? 3.092   70.038  -17.884 1.00 54.09  ? 657 HIS B CA  1 
ATOM   8191 C  C   . HIS B  1 657 ? 4.214   69.879  -18.913 1.00 56.91  ? 657 HIS B C   1 
ATOM   8192 O  O   . HIS B  1 657 ? 5.396   69.752  -18.576 1.00 54.31  ? 657 HIS B O   1 
ATOM   8193 C  CB  . HIS B  1 657 ? 3.624   70.600  -16.562 1.00 49.37  ? 657 HIS B CB  1 
ATOM   8194 C  CG  . HIS B  1 657 ? 4.126   72.010  -16.664 1.00 46.05  ? 657 HIS B CG  1 
ATOM   8195 N  ND1 . HIS B  1 657 ? 3.297   73.105  -16.551 1.00 47.88  ? 657 HIS B ND1 1 
ATOM   8196 C  CD2 . HIS B  1 657 ? 5.372   72.501  -16.867 1.00 46.82  ? 657 HIS B CD2 1 
ATOM   8197 C  CE1 . HIS B  1 657 ? 4.010   74.210  -16.680 1.00 48.23  ? 657 HIS B CE1 1 
ATOM   8198 N  NE2 . HIS B  1 657 ? 5.272   73.871  -16.874 1.00 47.88  ? 657 HIS B NE2 1 
ATOM   8199 N  N   . THR B  1 658 ? 3.802   69.884  -20.175 1.00 54.33  ? 658 THR B N   1 
ATOM   8200 C  CA  . THR B  1 658 ? 4.707   69.705  -21.314 1.00 52.34  ? 658 THR B CA  1 
ATOM   8201 C  C   . THR B  1 658 ? 5.481   70.995  -21.610 1.00 52.12  ? 658 THR B C   1 
ATOM   8202 O  O   . THR B  1 658 ? 5.089   72.085  -21.182 1.00 47.00  ? 658 THR B O   1 
ATOM   8203 C  CB  . THR B  1 658 ? 3.968   69.178  -22.578 1.00 57.36  ? 658 THR B CB  1 
ATOM   8204 O  OG1 . THR B  1 658 ? 4.848   69.207  -23.710 1.00 69.50  ? 658 THR B OG1 1 
ATOM   8205 C  CG2 . THR B  1 658 ? 2.700   69.979  -22.899 1.00 65.04  ? 658 THR B CG2 1 
ATOM   8206 N  N   . ALA B  1 659 ? 6.587   70.842  -22.334 1.00 56.12  ? 659 ALA B N   1 
ATOM   8207 C  CA  . ALA B  1 659 ? 7.495   71.951  -22.666 1.00 60.38  ? 659 ALA B CA  1 
ATOM   8208 C  C   . ALA B  1 659 ? 6.852   73.024  -23.558 1.00 67.12  ? 659 ALA B C   1 
ATOM   8209 O  O   . ALA B  1 659 ? 7.127   74.217  -23.409 1.00 55.85  ? 659 ALA B O   1 
ATOM   8210 C  CB  . ALA B  1 659 ? 8.745   71.400  -23.335 1.00 56.13  ? 659 ALA B CB  1 
ATOM   8211 N  N   . HIS B  1 660 ? 5.999   72.578  -24.477 1.00 80.60  ? 660 HIS B N   1 
ATOM   8212 C  CA  . HIS B  1 660 ? 5.324   73.436  -25.450 1.00 86.49  ? 660 HIS B CA  1 
ATOM   8213 C  C   . HIS B  1 660 ? 4.152   74.185  -24.805 1.00 80.08  ? 660 HIS B C   1 
ATOM   8214 O  O   . HIS B  1 660 ? 4.095   75.416  -24.827 1.00 69.39  ? 660 HIS B O   1 
ATOM   8215 C  CB  . HIS B  1 660 ? 4.841   72.553  -26.613 1.00 102.92 ? 660 HIS B CB  1 
ATOM   8216 C  CG  . HIS B  1 660 ? 4.058   73.279  -27.663 1.00 110.67 ? 660 HIS B CG  1 
ATOM   8217 N  ND1 . HIS B  1 660 ? 4.655   73.940  -28.715 1.00 115.39 ? 660 HIS B ND1 1 
ATOM   8218 C  CD2 . HIS B  1 660 ? 2.722   73.420  -27.840 1.00 111.16 ? 660 HIS B CD2 1 
ATOM   8219 C  CE1 . HIS B  1 660 ? 3.722   74.470  -29.485 1.00 119.45 ? 660 HIS B CE1 1 
ATOM   8220 N  NE2 . HIS B  1 660 ? 2.541   74.170  -28.977 1.00 121.82 ? 660 HIS B NE2 1 
ATOM   8221 N  N   . GLY B  1 661 ? 3.232   73.415  -24.230 1.00 79.01  ? 661 GLY B N   1 
ATOM   8222 C  CA  . GLY B  1 661 ? 1.986   73.927  -23.644 1.00 79.99  ? 661 GLY B CA  1 
ATOM   8223 C  C   . GLY B  1 661 ? 2.084   74.536  -22.252 1.00 78.55  ? 661 GLY B C   1 
ATOM   8224 O  O   . GLY B  1 661 ? 1.446   75.557  -21.982 1.00 83.86  ? 661 GLY B O   1 
ATOM   8225 N  N   . ARG B  1 662 ? 2.862   73.898  -21.373 1.00 73.08  ? 662 ARG B N   1 
ATOM   8226 C  CA  . ARG B  1 662 ? 3.063   74.332  -19.970 1.00 65.55  ? 662 ARG B CA  1 
ATOM   8227 C  C   . ARG B  1 662 ? 1.774   74.312  -19.130 1.00 65.05  ? 662 ARG B C   1 
ATOM   8228 O  O   . ARG B  1 662 ? 1.531   75.219  -18.326 1.00 69.35  ? 662 ARG B O   1 
ATOM   8229 C  CB  . ARG B  1 662 ? 3.724   75.720  -19.902 1.00 62.29  ? 662 ARG B CB  1 
ATOM   8230 C  CG  . ARG B  1 662 ? 5.033   75.832  -20.662 1.00 62.24  ? 662 ARG B CG  1 
ATOM   8231 C  CD  . ARG B  1 662 ? 5.595   77.239  -20.564 1.00 60.60  ? 662 ARG B CD  1 
ATOM   8232 N  NE  . ARG B  1 662 ? 6.774   77.436  -21.412 1.00 63.05  ? 662 ARG B NE  1 
ATOM   8233 C  CZ  . ARG B  1 662 ? 6.760   77.599  -22.740 1.00 59.35  ? 662 ARG B CZ  1 
ATOM   8234 N  NH1 . ARG B  1 662 ? 5.622   77.581  -23.437 1.00 58.77  ? 662 ARG B NH1 1 
ATOM   8235 N  NH2 . ARG B  1 662 ? 7.911   77.775  -23.387 1.00 57.85  ? 662 ARG B NH2 1 
ATOM   8236 N  N   . HIS B  1 663 ? 0.968   73.266  -19.305 1.00 66.83  ? 663 HIS B N   1 
ATOM   8237 C  CA  . HIS B  1 663 ? -0.324  73.156  -18.617 1.00 64.65  ? 663 HIS B CA  1 
ATOM   8238 C  C   . HIS B  1 663 ? -0.156  72.862  -17.121 1.00 61.42  ? 663 HIS B C   1 
ATOM   8239 O  O   . HIS B  1 663 ? 0.693   72.058  -16.731 1.00 62.00  ? 663 HIS B O   1 
ATOM   8240 C  CB  . HIS B  1 663 ? -1.211  72.073  -19.252 1.00 68.32  ? 663 HIS B CB  1 
ATOM   8241 C  CG  . HIS B  1 663 ? -1.770  72.442  -20.594 1.00 72.43  ? 663 HIS B CG  1 
ATOM   8242 N  ND1 . HIS B  1 663 ? -2.443  73.623  -20.828 1.00 69.27  ? 663 HIS B ND1 1 
ATOM   8243 C  CD2 . HIS B  1 663 ? -1.785  71.764  -21.767 1.00 70.11  ? 663 HIS B CD2 1 
ATOM   8244 C  CE1 . HIS B  1 663 ? -2.829  73.666  -22.092 1.00 69.15  ? 663 HIS B CE1 1 
ATOM   8245 N  NE2 . HIS B  1 663 ? -2.443  72.549  -22.683 1.00 72.52  ? 663 HIS B NE2 1 
ATOM   8246 N  N   . TYR B  1 664 ? -0.969  73.534  -16.305 1.00 56.08  ? 664 TYR B N   1 
ATOM   8247 C  CA  . TYR B  1 664 ? -1.068  73.267  -14.865 1.00 51.41  ? 664 TYR B CA  1 
ATOM   8248 C  C   . TYR B  1 664 ? -2.524  73.031  -14.476 1.00 48.17  ? 664 TYR B C   1 
ATOM   8249 O  O   . TYR B  1 664 ? -3.431  73.594  -15.094 1.00 49.09  ? 664 TYR B O   1 
ATOM   8250 C  CB  . TYR B  1 664 ? -0.486  74.429  -14.045 1.00 54.11  ? 664 TYR B CB  1 
ATOM   8251 C  CG  . TYR B  1 664 ? -1.313  75.709  -14.024 1.00 53.72  ? 664 TYR B CG  1 
ATOM   8252 C  CD1 . TYR B  1 664 ? -2.354  75.882  -13.105 1.00 50.66  ? 664 TYR B CD1 1 
ATOM   8253 C  CD2 . TYR B  1 664 ? -1.037  76.755  -14.903 1.00 54.44  ? 664 TYR B CD2 1 
ATOM   8254 C  CE1 . TYR B  1 664 ? -3.104  77.052  -13.079 1.00 48.35  ? 664 TYR B CE1 1 
ATOM   8255 C  CE2 . TYR B  1 664 ? -1.780  77.930  -14.880 1.00 52.67  ? 664 TYR B CE2 1 
ATOM   8256 C  CZ  . TYR B  1 664 ? -2.811  78.073  -13.969 1.00 47.77  ? 664 TYR B CZ  1 
ATOM   8257 O  OH  . TYR B  1 664 ? -3.546  79.237  -13.950 1.00 44.58  ? 664 TYR B OH  1 
ATOM   8258 N  N   . LEU B  1 665 ? -2.739  72.212  -13.448 1.00 50.19  ? 665 LEU B N   1 
ATOM   8259 C  CA  . LEU B  1 665 ? -4.079  71.990  -12.888 1.00 54.02  ? 665 LEU B CA  1 
ATOM   8260 C  C   . LEU B  1 665 ? -4.319  72.937  -11.712 1.00 55.75  ? 665 LEU B C   1 
ATOM   8261 O  O   . LEU B  1 665 ? -3.453  73.093  -10.850 1.00 48.92  ? 665 LEU B O   1 
ATOM   8262 C  CB  . LEU B  1 665 ? -4.252  70.532  -12.433 1.00 52.69  ? 665 LEU B CB  1 
ATOM   8263 C  CG  . LEU B  1 665 ? -5.596  70.115  -11.809 1.00 50.31  ? 665 LEU B CG  1 
ATOM   8264 C  CD1 . LEU B  1 665 ? -6.738  70.240  -12.804 1.00 53.51  ? 665 LEU B CD1 1 
ATOM   8265 C  CD2 . LEU B  1 665 ? -5.523  68.691  -11.282 1.00 51.05  ? 665 LEU B CD2 1 
ATOM   8266 N  N   . GLU B  1 666 ? -5.491  73.569  -11.690 1.00 57.19  ? 666 GLU B N   1 
ATOM   8267 C  CA  . GLU B  1 666 ? -5.936  74.333  -10.527 1.00 54.88  ? 666 GLU B CA  1 
ATOM   8268 C  C   . GLU B  1 666 ? -6.525  73.365  -9.503  1.00 55.05  ? 666 GLU B C   1 
ATOM   8269 O  O   . GLU B  1 666 ? -7.491  72.657  -9.803  1.00 55.81  ? 666 GLU B O   1 
ATOM   8270 C  CB  . GLU B  1 666 ? -6.970  75.389  -10.920 1.00 55.51  ? 666 GLU B CB  1 
ATOM   8271 C  CG  . GLU B  1 666 ? -7.250  76.401  -9.813  1.00 58.20  ? 666 GLU B CG  1 
ATOM   8272 C  CD  . GLU B  1 666 ? -8.114  77.574  -10.250 1.00 65.35  ? 666 GLU B CD  1 
ATOM   8273 O  OE1 . GLU B  1 666 ? -8.038  77.991  -11.425 1.00 74.81  ? 666 GLU B OE1 1 
ATOM   8274 O  OE2 . GLU B  1 666 ? -8.863  78.101  -9.400  1.00 68.52  ? 666 GLU B OE2 1 
ATOM   8275 N  N   . LEU B  1 667 ? -5.930  73.330  -8.311  1.00 49.79  ? 667 LEU B N   1 
ATOM   8276 C  CA  . LEU B  1 667 ? -6.443  72.532  -7.196  1.00 50.42  ? 667 LEU B CA  1 
ATOM   8277 C  C   . LEU B  1 667 ? -7.260  73.409  -6.249  1.00 50.08  ? 667 LEU B C   1 
ATOM   8278 O  O   . LEU B  1 667 ? -6.709  74.100  -5.387  1.00 45.07  ? 667 LEU B O   1 
ATOM   8279 C  CB  . LEU B  1 667 ? -5.302  71.828  -6.450  1.00 50.32  ? 667 LEU B CB  1 
ATOM   8280 C  CG  . LEU B  1 667 ? -4.641  70.665  -7.201  1.00 49.20  ? 667 LEU B CG  1 
ATOM   8281 C  CD1 . LEU B  1 667 ? -3.375  70.215  -6.486  1.00 50.38  ? 667 LEU B CD1 1 
ATOM   8282 C  CD2 . LEU B  1 667 ? -5.595  69.489  -7.377  1.00 46.21  ? 667 LEU B CD2 1 
ATOM   8283 N  N   . GLY B  1 668 ? -8.576  73.379  -6.448  1.00 53.22  ? 668 GLY B N   1 
ATOM   8284 C  CA  . GLY B  1 668 ? -9.549  74.033  -5.570  1.00 54.43  ? 668 GLY B CA  1 
ATOM   8285 C  C   . GLY B  1 668 ? -10.751 73.132  -5.342  1.00 54.77  ? 668 GLY B C   1 
ATOM   8286 O  O   . GLY B  1 668 ? -10.801 72.006  -5.847  1.00 45.62  ? 668 GLY B O   1 
ATOM   8287 N  N   . LEU B  1 669 ? -11.723 73.636  -4.586  1.00 61.17  ? 669 LEU B N   1 
ATOM   8288 C  CA  . LEU B  1 669 ? -12.921 72.866  -4.234  1.00 63.25  ? 669 LEU B CA  1 
ATOM   8289 C  C   . LEU B  1 669 ? -13.826 72.590  -5.429  1.00 60.65  ? 669 LEU B C   1 
ATOM   8290 O  O   . LEU B  1 669 ? -14.133 71.432  -5.729  1.00 54.79  ? 669 LEU B O   1 
ATOM   8291 C  CB  . LEU B  1 669 ? -13.738 73.590  -3.154  1.00 67.48  ? 669 LEU B CB  1 
ATOM   8292 C  CG  . LEU B  1 669 ? -13.272 73.482  -1.701  1.00 67.94  ? 669 LEU B CG  1 
ATOM   8293 C  CD1 . LEU B  1 669 ? -14.128 74.384  -0.827  1.00 70.20  ? 669 LEU B CD1 1 
ATOM   8294 C  CD2 . LEU B  1 669 ? -13.334 72.046  -1.201  1.00 65.16  ? 669 LEU B CD2 1 
ATOM   8295 N  N   . ASN B  1 670 ? -14.241 73.663  -6.099  1.00 61.66  ? 670 ASN B N   1 
ATOM   8296 C  CA  . ASN B  1 670 ? -15.283 73.602  -7.131  1.00 69.02  ? 670 ASN B CA  1 
ATOM   8297 C  C   . ASN B  1 670 ? -14.762 74.015  -8.519  1.00 68.40  ? 670 ASN B C   1 
ATOM   8298 O  O   . ASN B  1 670 ? -15.459 74.692  -9.284  1.00 65.09  ? 670 ASN B O   1 
ATOM   8299 C  CB  . ASN B  1 670 ? -16.468 74.490  -6.708  1.00 73.26  ? 670 ASN B CB  1 
ATOM   8300 C  CG  . ASN B  1 670 ? -17.756 74.153  -7.447  1.00 85.40  ? 670 ASN B CG  1 
ATOM   8301 O  OD1 . ASN B  1 670 ? -17.914 73.052  -7.983  1.00 85.19  ? 670 ASN B OD1 1 
ATOM   8302 N  ND2 . ASN B  1 670 ? -18.691 75.106  -7.473  1.00 100.15 ? 670 ASN B ND2 1 
ATOM   8303 N  N   . THR B  1 671 ? -13.542 73.588  -8.841  1.00 69.21  ? 671 THR B N   1 
ATOM   8304 C  CA  . THR B  1 671 ? -12.902 73.943  -10.114 1.00 69.58  ? 671 THR B CA  1 
ATOM   8305 C  C   . THR B  1 671 ? -11.973 72.833  -10.614 1.00 62.89  ? 671 THR B C   1 
ATOM   8306 O  O   . THR B  1 671 ? -11.298 72.168  -9.823  1.00 60.49  ? 671 THR B O   1 
ATOM   8307 C  CB  . THR B  1 671 ? -12.136 75.291  -10.023 1.00 72.68  ? 671 THR B CB  1 
ATOM   8308 O  OG1 . THR B  1 671 ? -11.691 75.686  -11.328 1.00 68.61  ? 671 THR B OG1 1 
ATOM   8309 C  CG2 . THR B  1 671 ? -10.932 75.210  -9.075  1.00 73.57  ? 671 THR B CG2 1 
ATOM   8310 N  N   . SER B  1 672 ? -11.977 72.636  -11.931 1.00 65.87  ? 672 SER B N   1 
ATOM   8311 C  CA  . SER B  1 672 ? -11.014 71.778  -12.625 1.00 62.22  ? 672 SER B CA  1 
ATOM   8312 C  C   . SER B  1 672 ? -10.356 72.575  -13.758 1.00 62.86  ? 672 SER B C   1 
ATOM   8313 O  O   . SER B  1 672 ? -10.137 72.059  -14.859 1.00 59.49  ? 672 SER B O   1 
ATOM   8314 C  CB  . SER B  1 672 ? -11.718 70.534  -13.169 1.00 60.01  ? 672 SER B CB  1 
ATOM   8315 O  OG  . SER B  1 672 ? -12.762 70.884  -14.062 1.00 62.02  ? 672 SER B OG  1 
ATOM   8316 N  N   . PHE B  1 673 ? -10.038 73.837  -13.465 1.00 62.45  ? 673 PHE B N   1 
ATOM   8317 C  CA  . PHE B  1 673 ? -9.516  74.771  -14.460 1.00 59.09  ? 673 PHE B CA  1 
ATOM   8318 C  C   . PHE B  1 673 ? -8.070  74.428  -14.791 1.00 59.12  ? 673 PHE B C   1 
ATOM   8319 O  O   . PHE B  1 673 ? -7.246  74.246  -13.892 1.00 59.19  ? 673 PHE B O   1 
ATOM   8320 C  CB  . PHE B  1 673 ? -9.606  76.216  -13.949 1.00 60.06  ? 673 PHE B CB  1 
ATOM   8321 C  CG  . PHE B  1 673 ? -8.973  77.236  -14.867 1.00 64.02  ? 673 PHE B CG  1 
ATOM   8322 C  CD1 . PHE B  1 673 ? -9.675  77.745  -15.958 1.00 64.29  ? 673 PHE B CD1 1 
ATOM   8323 C  CD2 . PHE B  1 673 ? -7.676  77.695  -14.636 1.00 59.98  ? 673 PHE B CD2 1 
ATOM   8324 C  CE1 . PHE B  1 673 ? -9.095  78.684  -16.801 1.00 61.42  ? 673 PHE B CE1 1 
ATOM   8325 C  CE2 . PHE B  1 673 ? -7.092  78.633  -15.477 1.00 57.28  ? 673 PHE B CE2 1 
ATOM   8326 C  CZ  . PHE B  1 673 ? -7.802  79.129  -16.561 1.00 58.99  ? 673 PHE B CZ  1 
ATOM   8327 N  N   . VAL B  1 674 ? -7.786  74.343  -16.088 1.00 61.03  ? 674 VAL B N   1 
ATOM   8328 C  CA  . VAL B  1 674 ? -6.444  74.079  -16.597 1.00 57.89  ? 674 VAL B CA  1 
ATOM   8329 C  C   . VAL B  1 674 ? -5.936  75.318  -17.329 1.00 59.50  ? 674 VAL B C   1 
ATOM   8330 O  O   . VAL B  1 674 ? -6.503  75.718  -18.349 1.00 60.19  ? 674 VAL B O   1 
ATOM   8331 C  CB  . VAL B  1 674 ? -6.442  72.852  -17.528 1.00 56.01  ? 674 VAL B CB  1 
ATOM   8332 C  CG1 . VAL B  1 674 ? -5.104  72.694  -18.246 1.00 52.48  ? 674 VAL B CG1 1 
ATOM   8333 C  CG2 . VAL B  1 674 ? -6.767  71.600  -16.724 1.00 57.80  ? 674 VAL B CG2 1 
ATOM   8334 N  N   . GLY B  1 675 ? -4.861  75.905  -16.803 1.00 63.62  ? 675 GLY B N   1 
ATOM   8335 C  CA  . GLY B  1 675 ? -4.263  77.125  -17.350 1.00 66.76  ? 675 GLY B CA  1 
ATOM   8336 C  C   . GLY B  1 675 ? -2.890  76.869  -17.940 1.00 67.25  ? 675 GLY B C   1 
ATOM   8337 O  O   . GLY B  1 675 ? -2.559  75.734  -18.287 1.00 66.04  ? 675 GLY B O   1 
ATOM   8338 N  N   . ARG B  1 676 ? -2.104  77.937  -18.056 1.00 68.59  ? 676 ARG B N   1 
ATOM   8339 C  CA  . ARG B  1 676 ? -0.735  77.879  -18.575 1.00 68.43  ? 676 ARG B CA  1 
ATOM   8340 C  C   . ARG B  1 676 ? 0.213   78.622  -17.637 1.00 66.81  ? 676 ARG B C   1 
ATOM   8341 O  O   . ARG B  1 676 ? 0.013   79.806  -17.363 1.00 73.85  ? 676 ARG B O   1 
ATOM   8342 C  CB  . ARG B  1 676 ? -0.668  78.492  -19.976 1.00 71.22  ? 676 ARG B CB  1 
ATOM   8343 C  CG  . ARG B  1 676 ? -1.390  77.674  -21.035 1.00 77.33  ? 676 ARG B CG  1 
ATOM   8344 C  CD  . ARG B  1 676 ? -1.383  78.357  -22.394 1.00 83.84  ? 676 ARG B CD  1 
ATOM   8345 N  NE  . ARG B  1 676 ? -2.199  77.634  -23.375 1.00 91.33  ? 676 ARG B NE  1 
ATOM   8346 C  CZ  . ARG B  1 676 ? -3.533  77.674  -23.462 1.00 97.36  ? 676 ARG B CZ  1 
ATOM   8347 N  NH1 . ARG B  1 676 ? -4.269  78.406  -22.622 1.00 97.21  ? 676 ARG B NH1 1 
ATOM   8348 N  NH2 . ARG B  1 676 ? -4.148  76.963  -24.406 1.00 91.90  ? 676 ARG B NH2 1 
ATOM   8349 N  N   . GLY B  1 677 ? 1.230   77.914  -17.143 1.00 62.83  ? 677 GLY B N   1 
ATOM   8350 C  CA  . GLY B  1 677 ? 2.262   78.489  -16.273 1.00 63.54  ? 677 GLY B CA  1 
ATOM   8351 C  C   . GLY B  1 677 ? 2.294   77.865  -14.881 1.00 59.42  ? 677 GLY B C   1 
ATOM   8352 O  O   . GLY B  1 677 ? 2.749   76.728  -14.745 1.00 55.53  ? 677 GLY B O   1 
ATOM   8353 N  N   . PRO B  1 678 ? 1.822   78.564  -13.841 1.00 53.12  ? 678 PRO B N   1 
ATOM   8354 C  CA  . PRO B  1 678 ? 1.158   79.863  -13.932 1.00 51.58  ? 678 PRO B CA  1 
ATOM   8355 C  C   . PRO B  1 678 ? 2.117   81.052  -13.911 1.00 49.85  ? 678 PRO B C   1 
ATOM   8356 O  O   . PRO B  1 678 ? 3.299   80.898  -13.587 1.00 52.19  ? 678 PRO B O   1 
ATOM   8357 C  CB  . PRO B  1 678 ? 0.312   79.882  -12.663 1.00 52.04  ? 678 PRO B CB  1 
ATOM   8358 C  CG  . PRO B  1 678 ? 1.138   79.130  -11.670 1.00 50.21  ? 678 PRO B CG  1 
ATOM   8359 C  CD  . PRO B  1 678 ? 2.007   78.163  -12.435 1.00 51.16  ? 678 PRO B CD  1 
ATOM   8360 N  N   . ARG B  1 679 ? 1.582   82.222  -14.257 1.00 45.30  ? 679 ARG B N   1 
ATOM   8361 C  CA  . ARG B  1 679 ? 2.284   83.507  -14.142 1.00 43.35  ? 679 ARG B CA  1 
ATOM   8362 C  C   . ARG B  1 679 ? 3.587   83.557  -14.949 1.00 43.55  ? 679 ARG B C   1 
ATOM   8363 O  O   . ARG B  1 679 ? 4.611   84.042  -14.464 1.00 41.39  ? 679 ARG B O   1 
ATOM   8364 C  CB  . ARG B  1 679 ? 2.545   83.840  -12.665 1.00 45.64  ? 679 ARG B CB  1 
ATOM   8365 C  CG  . ARG B  1 679 ? 1.296   83.804  -11.795 1.00 49.35  ? 679 ARG B CG  1 
ATOM   8366 C  CD  . ARG B  1 679 ? 1.599   84.137  -10.345 1.00 47.69  ? 679 ARG B CD  1 
ATOM   8367 N  NE  . ARG B  1 679 ? 2.165   85.475  -10.201 1.00 43.22  ? 679 ARG B NE  1 
ATOM   8368 C  CZ  . ARG B  1 679 ? 1.484   86.618  -10.281 1.00 40.23  ? 679 ARG B CZ  1 
ATOM   8369 N  NH1 . ARG B  1 679 ? 0.170   86.627  -10.502 1.00 43.82  ? 679 ARG B NH1 1 
ATOM   8370 N  NH2 . ARG B  1 679 ? 2.127   87.773  -10.129 1.00 37.19  ? 679 ARG B NH2 1 
ATOM   8371 N  N   . LEU B  1 680 ? 3.526   83.065  -16.187 1.00 48.29  ? 680 LEU B N   1 
ATOM   8372 C  CA  . LEU B  1 680 ? 4.696   83.003  -17.083 1.00 48.50  ? 680 LEU B CA  1 
ATOM   8373 C  C   . LEU B  1 680 ? 5.267   84.376  -17.437 1.00 45.21  ? 680 LEU B C   1 
ATOM   8374 O  O   . LEU B  1 680 ? 6.484   84.532  -17.567 1.00 44.16  ? 680 LEU B O   1 
ATOM   8375 C  CB  . LEU B  1 680 ? 4.344   82.258  -18.377 1.00 50.68  ? 680 LEU B CB  1 
ATOM   8376 C  CG  . LEU B  1 680 ? 4.283   80.731  -18.272 1.00 52.27  ? 680 LEU B CG  1 
ATOM   8377 C  CD1 . LEU B  1 680 ? 3.476   80.132  -19.414 1.00 55.12  ? 680 LEU B CD1 1 
ATOM   8378 C  CD2 . LEU B  1 680 ? 5.681   80.130  -18.235 1.00 52.08  ? 680 LEU B CD2 1 
ATOM   8379 N  N   . ARG B  1 681 ? 4.379   85.353  -17.604 1.00 44.21  ? 681 ARG B N   1 
ATOM   8380 C  CA  . ARG B  1 681 ? 4.764   86.733  -17.902 1.00 46.37  ? 681 ARG B CA  1 
ATOM   8381 C  C   . ARG B  1 681 ? 5.565   87.343  -16.749 1.00 49.51  ? 681 ARG B C   1 
ATOM   8382 O  O   . ARG B  1 681 ? 6.598   87.981  -16.965 1.00 48.33  ? 681 ARG B O   1 
ATOM   8383 C  CB  . ARG B  1 681 ? 3.517   87.583  -18.148 1.00 48.72  ? 681 ARG B CB  1 
ATOM   8384 C  CG  . ARG B  1 681 ? 3.767   88.867  -18.938 1.00 47.99  ? 681 ARG B CG  1 
ATOM   8385 C  CD  . ARG B  1 681 ? 3.321   90.118  -18.193 1.00 49.65  ? 681 ARG B CD  1 
ATOM   8386 N  NE  . ARG B  1 681 ? 1.991   89.989  -17.592 1.00 50.29  ? 681 ARG B NE  1 
ATOM   8387 C  CZ  . ARG B  1 681 ? 1.486   90.795  -16.656 1.00 51.35  ? 681 ARG B CZ  1 
ATOM   8388 N  NH1 . ARG B  1 681 ? 2.181   91.829  -16.180 1.00 51.54  ? 681 ARG B NH1 1 
ATOM   8389 N  NH2 . ARG B  1 681 ? 0.262   90.564  -16.187 1.00 53.74  ? 681 ARG B NH2 1 
ATOM   8390 N  N   . GLN B  1 682 ? 5.067   87.140  -15.531 1.00 53.31  ? 682 GLN B N   1 
ATOM   8391 C  CA  . GLN B  1 682 ? 5.736   87.604  -14.307 1.00 51.96  ? 682 GLN B CA  1 
ATOM   8392 C  C   . GLN B  1 682 ? 7.034   86.853  -14.001 1.00 51.97  ? 682 GLN B C   1 
ATOM   8393 O  O   . GLN B  1 682 ? 7.916   87.397  -13.340 1.00 52.80  ? 682 GLN B O   1 
ATOM   8394 C  CB  . GLN B  1 682 ? 4.800   87.510  -13.094 1.00 51.20  ? 682 GLN B CB  1 
ATOM   8395 C  CG  . GLN B  1 682 ? 3.664   88.528  -13.090 1.00 51.76  ? 682 GLN B CG  1 
ATOM   8396 C  CD  . GLN B  1 682 ? 2.403   88.058  -13.800 1.00 49.15  ? 682 GLN B CD  1 
ATOM   8397 O  OE1 . GLN B  1 682 ? 2.403   87.055  -14.517 1.00 44.78  ? 682 GLN B OE1 1 
ATOM   8398 N  NE2 . GLN B  1 682 ? 1.315   88.797  -13.607 1.00 50.40  ? 682 GLN B NE2 1 
ATOM   8399 N  N   . CYS B  1 683 ? 7.133   85.605  -14.453 1.00 49.58  ? 683 CYS B N   1 
ATOM   8400 C  CA  . CYS B  1 683 ? 8.369   84.816  -14.320 1.00 50.24  ? 683 CYS B CA  1 
ATOM   8401 C  C   . CYS B  1 683 ? 9.404   85.098  -15.410 1.00 49.46  ? 683 CYS B C   1 
ATOM   8402 O  O   . CYS B  1 683 ? 10.606  84.957  -15.169 1.00 47.22  ? 683 CYS B O   1 
ATOM   8403 C  CB  . CYS B  1 683 ? 8.042   83.326  -14.250 1.00 51.73  ? 683 CYS B CB  1 
ATOM   8404 S  SG  . CYS B  1 683 ? 7.062   82.921  -12.786 1.00 60.91  ? 683 CYS B SG  1 
ATOM   8405 N  N   . ALA B  1 684 ? 8.944   85.487  -16.599 1.00 50.68  ? 684 ALA B N   1 
ATOM   8406 C  CA  . ALA B  1 684 ? 9.831   86.013  -17.646 1.00 50.41  ? 684 ALA B CA  1 
ATOM   8407 C  C   . ALA B  1 684 ? 10.463  87.352  -17.245 1.00 52.06  ? 684 ALA B C   1 
ATOM   8408 O  O   . ALA B  1 684 ? 11.540  87.704  -17.726 1.00 48.27  ? 684 ALA B O   1 
ATOM   8409 C  CB  . ALA B  1 684 ? 9.076   86.165  -18.956 1.00 47.03  ? 684 ALA B CB  1 
ATOM   8410 N  N   . PHE B  1 685 ? 9.784   88.095  -16.375 1.00 50.26  ? 685 PHE B N   1 
ATOM   8411 C  CA  . PHE B  1 685 ? 10.319  89.331  -15.819 1.00 48.95  ? 685 PHE B CA  1 
ATOM   8412 C  C   . PHE B  1 685 ? 11.580  89.068  -14.992 1.00 51.32  ? 685 PHE B C   1 
ATOM   8413 O  O   . PHE B  1 685 ? 12.622  89.687  -15.221 1.00 50.55  ? 685 PHE B O   1 
ATOM   8414 C  CB  . PHE B  1 685 ? 9.264   90.008  -14.945 1.00 48.51  ? 685 PHE B CB  1 
ATOM   8415 C  CG  . PHE B  1 685 ? 9.749   91.260  -14.282 1.00 48.31  ? 685 PHE B CG  1 
ATOM   8416 C  CD1 . PHE B  1 685 ? 9.852   92.443  -15.004 1.00 46.75  ? 685 PHE B CD1 1 
ATOM   8417 C  CD2 . PHE B  1 685 ? 10.112  91.259  -12.938 1.00 44.12  ? 685 PHE B CD2 1 
ATOM   8418 C  CE1 . PHE B  1 685 ? 10.306  93.604  -14.401 1.00 45.99  ? 685 PHE B CE1 1 
ATOM   8419 C  CE2 . PHE B  1 685 ? 10.568  92.416  -12.329 1.00 46.16  ? 685 PHE B CE2 1 
ATOM   8420 C  CZ  . PHE B  1 685 ? 10.663  93.591  -13.060 1.00 47.20  ? 685 PHE B CZ  1 
ATOM   8421 N  N   . TRP B  1 686 ? 11.466  88.151  -14.034 1.00 58.23  ? 686 TRP B N   1 
ATOM   8422 C  CA  . TRP B  1 686 ? 12.556  87.836  -13.100 1.00 56.06  ? 686 TRP B CA  1 
ATOM   8423 C  C   . TRP B  1 686 ? 13.703  87.020  -13.701 1.00 58.62  ? 686 TRP B C   1 
ATOM   8424 O  O   . TRP B  1 686 ? 14.858  87.207  -13.312 1.00 60.42  ? 686 TRP B O   1 
ATOM   8425 C  CB  . TRP B  1 686 ? 12.011  87.092  -11.875 1.00 54.42  ? 686 TRP B CB  1 
ATOM   8426 C  CG  . TRP B  1 686 ? 11.135  87.932  -11.001 1.00 56.23  ? 686 TRP B CG  1 
ATOM   8427 C  CD1 . TRP B  1 686 ? 9.803   87.759  -10.768 1.00 53.88  ? 686 TRP B CD1 1 
ATOM   8428 C  CD2 . TRP B  1 686 ? 11.529  89.084  -10.246 1.00 55.74  ? 686 TRP B CD2 1 
ATOM   8429 N  NE1 . TRP B  1 686 ? 9.340   88.728  -9.913  1.00 55.26  ? 686 TRP B NE1 1 
ATOM   8430 C  CE2 . TRP B  1 686 ? 10.378  89.557  -9.577  1.00 55.95  ? 686 TRP B CE2 1 
ATOM   8431 C  CE3 . TRP B  1 686 ? 12.742  89.765  -10.070 1.00 56.69  ? 686 TRP B CE3 1 
ATOM   8432 C  CZ2 . TRP B  1 686 ? 10.404  90.679  -8.740  1.00 59.30  ? 686 TRP B CZ2 1 
ATOM   8433 C  CZ3 . TRP B  1 686 ? 12.767  90.882  -9.235  1.00 58.79  ? 686 TRP B CZ3 1 
ATOM   8434 C  CH2 . TRP B  1 686 ? 11.604  91.328  -8.584  1.00 60.17  ? 686 TRP B CH2 1 
ATOM   8435 N  N   . LYS B  1 687 ? 13.381  86.110  -14.621 1.00 66.47  ? 687 LYS B N   1 
ATOM   8436 C  CA  . LYS B  1 687 ? 14.369  85.182  -15.201 1.00 67.19  ? 687 LYS B CA  1 
ATOM   8437 C  C   . LYS B  1 687 ? 14.974  85.656  -16.539 1.00 60.70  ? 687 LYS B C   1 
ATOM   8438 O  O   . LYS B  1 687 ? 16.128  85.329  -16.833 1.00 58.31  ? 687 LYS B O   1 
ATOM   8439 C  CB  . LYS B  1 687 ? 13.753  83.770  -15.327 1.00 69.46  ? 687 LYS B CB  1 
ATOM   8440 C  CG  . LYS B  1 687 ? 14.631  82.692  -15.971 1.00 76.30  ? 687 LYS B CG  1 
ATOM   8441 C  CD  . LYS B  1 687 ? 15.908  82.389  -15.190 1.00 81.11  ? 687 LYS B CD  1 
ATOM   8442 C  CE  . LYS B  1 687 ? 17.031  81.874  -16.085 1.00 76.92  ? 687 LYS B CE  1 
ATOM   8443 N  NZ  . LYS B  1 687 ? 16.783  80.514  -16.640 1.00 74.07  ? 687 LYS B NZ  1 
ATOM   8444 N  N   . LYS B  1 688 ? 14.210  86.410  -17.336 1.00 58.73  ? 688 LYS B N   1 
ATOM   8445 C  CA  . LYS B  1 688 ? 14.653  86.867  -18.671 1.00 57.08  ? 688 LYS B CA  1 
ATOM   8446 C  C   . LYS B  1 688 ? 14.977  88.367  -18.743 1.00 55.41  ? 688 LYS B C   1 
ATOM   8447 O  O   . LYS B  1 688 ? 16.098  88.735  -19.101 1.00 56.43  ? 688 LYS B O   1 
ATOM   8448 C  CB  . LYS B  1 688 ? 13.621  86.493  -19.752 1.00 60.96  ? 688 LYS B CB  1 
ATOM   8449 C  CG  . LYS B  1 688 ? 13.927  85.214  -20.519 1.00 64.90  ? 688 LYS B CG  1 
ATOM   8450 C  CD  . LYS B  1 688 ? 13.688  83.969  -19.682 1.00 70.36  ? 688 LYS B CD  1 
ATOM   8451 C  CE  . LYS B  1 688 ? 14.198  82.723  -20.389 1.00 75.51  ? 688 LYS B CE  1 
ATOM   8452 N  NZ  . LYS B  1 688 ? 14.065  81.500  -19.550 1.00 76.70  ? 688 LYS B NZ  1 
ATOM   8453 N  N   . TYR B  1 689 ? 14.011  89.220  -18.403 1.00 52.98  ? 689 TYR B N   1 
ATOM   8454 C  CA  . TYR B  1 689 ? 14.157  90.674  -18.612 1.00 52.42  ? 689 TYR B CA  1 
ATOM   8455 C  C   . TYR B  1 689 ? 15.063  91.372  -17.591 1.00 54.52  ? 689 TYR B C   1 
ATOM   8456 O  O   . TYR B  1 689 ? 15.992  92.083  -17.978 1.00 61.35  ? 689 TYR B O   1 
ATOM   8457 C  CB  . TYR B  1 689 ? 12.795  91.382  -18.659 1.00 54.32  ? 689 TYR B CB  1 
ATOM   8458 C  CG  . TYR B  1 689 ? 12.919  92.892  -18.809 1.00 53.14  ? 689 TYR B CG  1 
ATOM   8459 C  CD1 . TYR B  1 689 ? 13.504  93.454  -19.947 1.00 51.75  ? 689 TYR B CD1 1 
ATOM   8460 C  CD2 . TYR B  1 689 ? 12.475  93.758  -17.804 1.00 55.99  ? 689 TYR B CD2 1 
ATOM   8461 C  CE1 . TYR B  1 689 ? 13.634  94.830  -20.083 1.00 54.02  ? 689 TYR B CE1 1 
ATOM   8462 C  CE2 . TYR B  1 689 ? 12.599  95.136  -17.934 1.00 55.27  ? 689 TYR B CE2 1 
ATOM   8463 C  CZ  . TYR B  1 689 ? 13.177  95.667  -19.074 1.00 58.81  ? 689 TYR B CZ  1 
ATOM   8464 O  OH  . TYR B  1 689 ? 13.302  97.030  -19.204 1.00 61.73  ? 689 TYR B OH  1 
ATOM   8465 N  N   . LEU B  1 690 ? 14.774  91.201  -16.303 1.00 57.26  ? 690 LEU B N   1 
ATOM   8466 C  CA  . LEU B  1 690 ? 15.499  91.936  -15.251 1.00 58.12  ? 690 LEU B CA  1 
ATOM   8467 C  C   . LEU B  1 690 ? 16.998  91.605  -15.173 1.00 62.03  ? 690 LEU B C   1 
ATOM   8468 O  O   . LEU B  1 690 ? 17.803  92.503  -14.919 1.00 68.64  ? 690 LEU B O   1 
ATOM   8469 C  CB  . LEU B  1 690 ? 14.852  91.753  -13.872 1.00 58.17  ? 690 LEU B CB  1 
ATOM   8470 C  CG  . LEU B  1 690 ? 15.246  92.833  -12.848 1.00 61.20  ? 690 LEU B CG  1 
ATOM   8471 C  CD1 . LEU B  1 690 ? 14.422  94.094  -13.052 1.00 63.22  ? 690 LEU B CD1 1 
ATOM   8472 C  CD2 . LEU B  1 690 ? 15.092  92.342  -11.419 1.00 62.80  ? 690 LEU B CD2 1 
ATOM   8473 N  N   . PRO B  1 691 ? 17.378  90.326  -15.378 1.00 64.50  ? 691 PRO B N   1 
ATOM   8474 C  CA  . PRO B  1 691 ? 18.804  89.987  -15.430 1.00 64.37  ? 691 PRO B CA  1 
ATOM   8475 C  C   . PRO B  1 691 ? 19.594  90.760  -16.486 1.00 63.56  ? 691 PRO B C   1 
ATOM   8476 O  O   . PRO B  1 691 ? 20.667  91.284  -16.183 1.00 73.88  ? 691 PRO B O   1 
ATOM   8477 C  CB  . PRO B  1 691 ? 18.788  88.493  -15.752 1.00 66.17  ? 691 PRO B CB  1 
ATOM   8478 C  CG  . PRO B  1 691 ? 17.545  88.015  -15.096 1.00 65.20  ? 691 PRO B CG  1 
ATOM   8479 C  CD  . PRO B  1 691 ? 16.549  89.106  -15.360 1.00 63.40  ? 691 PRO B CD  1 
ATOM   8480 N  N   . GLN B  1 692 ? 19.058  90.830  -17.703 1.00 67.04  ? 692 GLN B N   1 
ATOM   8481 C  CA  . GLN B  1 692 ? 19.695  91.596  -18.785 1.00 76.84  ? 692 GLN B CA  1 
ATOM   8482 C  C   . GLN B  1 692 ? 19.545  93.125  -18.645 1.00 76.17  ? 692 GLN B C   1 
ATOM   8483 O  O   . GLN B  1 692 ? 20.283  93.871  -19.292 1.00 81.31  ? 692 GLN B O   1 
ATOM   8484 C  CB  . GLN B  1 692 ? 19.241  91.098  -20.170 1.00 81.47  ? 692 GLN B CB  1 
ATOM   8485 C  CG  . GLN B  1 692 ? 17.791  91.367  -20.557 1.00 80.88  ? 692 GLN B CG  1 
ATOM   8486 C  CD  . GLN B  1 692 ? 17.385  90.692  -21.862 1.00 84.69  ? 692 GLN B CD  1 
ATOM   8487 O  OE1 . GLN B  1 692 ? 18.135  89.900  -22.437 1.00 78.18  ? 692 GLN B OE1 1 
ATOM   8488 N  NE2 . GLN B  1 692 ? 16.183  91.005  -22.333 1.00 92.63  ? 692 GLN B NE2 1 
ATOM   8489 N  N   . LEU B  1 693 ? 18.605  93.583  -17.814 1.00 76.31  ? 693 LEU B N   1 
ATOM   8490 C  CA  . LEU B  1 693 ? 18.512  95.009  -17.443 1.00 80.10  ? 693 LEU B CA  1 
ATOM   8491 C  C   . LEU B  1 693 ? 19.650  95.404  -16.504 1.00 79.21  ? 693 LEU B C   1 
ATOM   8492 O  O   . LEU B  1 693 ? 20.408  96.329  -16.797 1.00 81.86  ? 693 LEU B O   1 
ATOM   8493 C  CB  . LEU B  1 693 ? 17.157  95.342  -16.795 1.00 78.34  ? 693 LEU B CB  1 
ATOM   8494 C  CG  . LEU B  1 693 ? 16.985  96.712  -16.103 1.00 76.51  ? 693 LEU B CG  1 
ATOM   8495 C  CD1 . LEU B  1 693 ? 17.427  97.887  -16.966 1.00 74.73  ? 693 LEU B CD1 1 
ATOM   8496 C  CD2 . LEU B  1 693 ? 15.539  96.916  -15.684 1.00 78.92  ? 693 LEU B CD2 1 
ATOM   8497 N  N   . VAL B  1 694 ? 19.749  94.706  -15.375 1.00 81.13  ? 694 VAL B N   1 
ATOM   8498 C  CA  . VAL B  1 694 ? 20.803  94.959  -14.372 1.00 80.69  ? 694 VAL B CA  1 
ATOM   8499 C  C   . VAL B  1 694 ? 22.198  94.982  -15.023 1.00 79.06  ? 694 VAL B C   1 
ATOM   8500 O  O   . VAL B  1 694 ? 23.016  95.848  -14.713 1.00 61.89  ? 694 VAL B O   1 
ATOM   8501 C  CB  . VAL B  1 694 ? 20.737  93.933  -13.209 1.00 76.44  ? 694 VAL B CB  1 
ATOM   8502 C  CG1 . VAL B  1 694 ? 21.937  94.049  -12.273 1.00 76.83  ? 694 VAL B CG1 1 
ATOM   8503 C  CG2 . VAL B  1 694 ? 19.460  94.130  -12.402 1.00 75.59  ? 694 VAL B CG2 1 
ATOM   8504 N  N   . ALA B  1 695 ? 22.436  94.042  -15.937 1.00 81.30  ? 695 ALA B N   1 
ATOM   8505 C  CA  . ALA B  1 695 ? 23.695  93.947  -16.690 1.00 75.79  ? 695 ALA B CA  1 
ATOM   8506 C  C   . ALA B  1 695 ? 23.903  95.119  -17.657 1.00 72.86  ? 695 ALA B C   1 
ATOM   8507 O  O   . ALA B  1 695 ? 25.034  95.573  -17.853 1.00 69.53  ? 695 ALA B O   1 
ATOM   8508 C  CB  . ALA B  1 695 ? 23.744  92.629  -17.449 1.00 71.75  ? 695 ALA B CB  1 
ATOM   8509 N  N   . ALA B  1 696 ? 22.813  95.582  -18.266 1.00 65.95  ? 696 ALA B N   1 
ATOM   8510 C  CA  . ALA B  1 696 ? 22.823  96.782  -19.109 1.00 66.85  ? 696 ALA B CA  1 
ATOM   8511 C  C   . ALA B  1 696 ? 23.112  98.061  -18.315 1.00 75.71  ? 696 ALA B C   1 
ATOM   8512 O  O   . ALA B  1 696 ? 23.932  98.880  -18.737 1.00 79.94  ? 696 ALA B O   1 
ATOM   8513 C  CB  . ALA B  1 696 ? 21.502  96.914  -19.854 1.00 64.90  ? 696 ALA B CB  1 
ATOM   8514 N  N   . THR B  1 697 ? 22.446  98.220  -17.171 1.00 84.05  ? 697 THR B N   1 
ATOM   8515 C  CA  . THR B  1 697 ? 22.535  99.452  -16.372 1.00 82.57  ? 697 THR B CA  1 
ATOM   8516 C  C   . THR B  1 697 ? 23.774  99.530  -15.485 1.00 90.88  ? 697 THR B C   1 
ATOM   8517 O  O   . THR B  1 697 ? 24.485  100.538 -15.508 1.00 107.43 ? 697 THR B O   1 
ATOM   8518 C  CB  . THR B  1 697 ? 21.296  99.642  -15.473 1.00 79.11  ? 697 THR B CB  1 
ATOM   8519 O  OG1 . THR B  1 697 ? 20.972  98.407  -14.820 1.00 79.04  ? 697 THR B OG1 1 
ATOM   8520 C  CG2 . THR B  1 697 ? 20.110  100.109 -16.297 1.00 80.87  ? 697 THR B CG2 1 
ATOM   8521 N  N   . SER B  1 698 ? 24.016  98.483  -14.698 1.00 99.27  ? 698 SER B N   1 
ATOM   8522 C  CA  . SER B  1 698 ? 25.114  98.487  -13.720 1.00 111.32 ? 698 SER B CA  1 
ATOM   8523 C  C   . SER B  1 698 ? 26.493  98.599  -14.386 1.00 121.46 ? 698 SER B C   1 
ATOM   8524 O  O   . SER B  1 698 ? 26.821  97.820  -15.284 1.00 122.07 ? 698 SER B O   1 
ATOM   8525 C  CB  . SER B  1 698 ? 25.059  97.242  -12.829 1.00 108.89 ? 698 SER B CB  1 
ATOM   8526 O  OG  . SER B  1 698 ? 25.344  96.063  -13.564 1.00 113.02 ? 698 SER B OG  1 
ATOM   8527 N  N   . ASN B  1 699 ? 27.279  99.578  -13.933 1.00 122.85 ? 699 ASN B N   1 
ATOM   8528 C  CA  . ASN B  1 699 ? 28.611  99.873  -14.483 1.00 115.77 ? 699 ASN B CA  1 
ATOM   8529 C  C   . ASN B  1 699 ? 29.705  99.250  -13.620 1.00 111.76 ? 699 ASN B C   1 
ATOM   8530 O  O   . ASN B  1 699 ? 30.854  99.120  -14.055 1.00 93.80  ? 699 ASN B O   1 
ATOM   8531 C  CB  . ASN B  1 699 ? 28.829  101.391 -14.574 1.00 103.33 ? 699 ASN B CB  1 
ATOM   8532 C  CG  . ASN B  1 699 ? 27.771  102.093 -15.414 1.00 95.14  ? 699 ASN B CG  1 
ATOM   8533 O  OD1 . ASN B  1 699 ? 27.267  101.542 -16.394 1.00 85.83  ? 699 ASN B OD1 1 
ATOM   8534 N  ND2 . ASN B  1 699 ? 27.437  103.322 -15.035 1.00 84.72  ? 699 ASN B ND2 1 
HETATM 8535 C  C1  . NAG C  2 .   ? 26.320  38.482  -26.569 1.00 90.06  ? 1   NAG C C1  1 
HETATM 8536 C  C2  . NAG C  2 .   ? 25.226  37.438  -26.382 1.00 97.26  ? 1   NAG C C2  1 
HETATM 8537 C  C3  . NAG C  2 .   ? 24.286  37.443  -27.608 1.00 104.53 ? 1   NAG C C3  1 
HETATM 8538 C  C4  . NAG C  2 .   ? 24.750  38.207  -28.882 1.00 107.17 ? 1   NAG C C4  1 
HETATM 8539 C  C5  . NAG C  2 .   ? 25.674  39.418  -28.599 1.00 95.09  ? 1   NAG C C5  1 
HETATM 8540 C  C6  . NAG C  2 .   ? 25.300  40.766  -29.229 1.00 92.12  ? 1   NAG C C6  1 
HETATM 8541 C  C7  . NAG C  2 .   ? 25.137  35.022  -25.797 1.00 92.95  ? 1   NAG C C7  1 
HETATM 8542 C  C8  . NAG C  2 .   ? 25.960  33.784  -25.573 1.00 85.52  ? 1   NAG C C8  1 
HETATM 8543 N  N2  . NAG C  2 .   ? 25.828  36.125  -26.128 1.00 96.49  ? 1   NAG C N2  1 
HETATM 8544 O  O3  . NAG C  2 .   ? 23.010  37.970  -27.207 1.00 110.80 ? 1   NAG C O3  1 
HETATM 8545 O  O4  . NAG C  2 .   ? 25.526  37.326  -29.762 1.00 122.15 ? 1   NAG C O4  1 
HETATM 8546 O  O5  . NAG C  2 .   ? 25.758  39.617  -27.198 1.00 87.33  ? 1   NAG C O5  1 
HETATM 8547 O  O6  . NAG C  2 .   ? 25.000  41.754  -28.218 1.00 79.42  ? 1   NAG C O6  1 
HETATM 8548 O  O7  . NAG C  2 .   ? 23.917  34.998  -25.679 1.00 100.01 ? 1   NAG C O7  1 
HETATM 8549 C  C1  . NAG C  2 .   ? 24.675  36.312  -30.508 1.00 119.77 ? 2   NAG C C1  1 
HETATM 8550 C  C2  . NAG C  2 .   ? 25.312  35.838  -31.806 1.00 113.14 ? 2   NAG C C2  1 
HETATM 8551 C  C3  . NAG C  2 .   ? 25.570  34.338  -31.843 1.00 110.28 ? 2   NAG C C3  1 
HETATM 8552 C  C4  . NAG C  2 .   ? 24.318  33.577  -31.408 1.00 111.29 ? 2   NAG C C4  1 
HETATM 8553 C  C5  . NAG C  2 .   ? 23.745  34.010  -30.048 1.00 108.48 ? 2   NAG C C5  1 
HETATM 8554 C  C6  . NAG C  2 .   ? 24.343  33.252  -28.869 1.00 104.04 ? 2   NAG C C6  1 
HETATM 8555 C  C7  . NAG C  2 .   ? 23.823  37.495  -32.966 1.00 102.56 ? 2   NAG C C7  1 
HETATM 8556 C  C8  . NAG C  2 .   ? 22.776  37.633  -34.018 1.00 99.17  ? 2   NAG C C8  1 
HETATM 8557 N  N2  . NAG C  2 .   ? 24.317  36.233  -32.814 1.00 107.82 ? 2   NAG C N2  1 
HETATM 8558 O  O3  . NAG C  2 .   ? 26.691  34.000  -31.011 1.00 100.80 ? 2   NAG C O3  1 
HETATM 8559 O  O4  . NAG C  2 .   ? 23.307  33.751  -32.410 1.00 109.98 ? 2   NAG C O4  1 
HETATM 8560 O  O5  . NAG C  2 .   ? 23.880  35.396  -29.707 1.00 110.71 ? 2   NAG C O5  1 
HETATM 8561 O  O6  . NAG C  2 .   ? 24.092  31.845  -28.979 1.00 96.34  ? 2   NAG C O6  1 
HETATM 8562 O  O7  . NAG C  2 .   ? 24.168  38.485  -32.314 1.00 100.43 ? 2   NAG C O7  1 
HETATM 8563 C  C1  . NAG D  2 .   ? 9.813   48.060  26.024  1.00 89.00  ? 1   NAG D C1  1 
HETATM 8564 C  C2  . NAG D  2 .   ? 8.937   46.885  25.578  1.00 89.57  ? 1   NAG D C2  1 
HETATM 8565 C  C3  . NAG D  2 .   ? 8.786   45.845  26.687  1.00 90.96  ? 1   NAG D C3  1 
HETATM 8566 C  C4  . NAG D  2 .   ? 10.084  45.585  27.465  1.00 94.32  ? 1   NAG D C4  1 
HETATM 8567 C  C5  . NAG D  2 .   ? 10.740  46.897  27.899  1.00 92.45  ? 1   NAG D C5  1 
HETATM 8568 C  C6  . NAG D  2 .   ? 12.060  46.701  28.642  1.00 93.53  ? 1   NAG D C6  1 
HETATM 8569 C  C7  . NAG D  2 .   ? 6.720   46.681  24.492  1.00 105.78 ? 1   NAG D C7  1 
HETATM 8570 C  C8  . NAG D  2 .   ? 5.440   47.406  24.187  1.00 105.92 ? 1   NAG D C8  1 
HETATM 8571 N  N2  . NAG D  2 .   ? 7.627   47.390  25.174  1.00 101.32 ? 1   NAG D N2  1 
HETATM 8572 O  O3  . NAG D  2 .   ? 8.395   44.598  26.102  1.00 86.89  ? 1   NAG D O3  1 
HETATM 8573 O  O4  . NAG D  2 .   ? 9.891   44.640  28.544  1.00 103.18 ? 1   NAG D O4  1 
HETATM 8574 O  O5  . NAG D  2 .   ? 10.999  47.655  26.714  1.00 83.01  ? 1   NAG D O5  1 
HETATM 8575 O  O6  . NAG D  2 .   ? 13.075  46.234  27.744  1.00 94.37  ? 1   NAG D O6  1 
HETATM 8576 O  O7  . NAG D  2 .   ? 6.898   45.527  24.134  1.00 104.78 ? 1   NAG D O7  1 
HETATM 8577 C  C1  . NAG D  2 .   ? 9.051   45.016  29.659  1.00 110.79 ? 2   NAG D C1  1 
HETATM 8578 C  C2  . NAG D  2 .   ? 8.061   43.867  29.882  1.00 111.26 ? 2   NAG D C2  1 
HETATM 8579 C  C3  . NAG D  2 .   ? 7.348   43.928  31.233  1.00 113.17 ? 2   NAG D C3  1 
HETATM 8580 C  C4  . NAG D  2 .   ? 8.260   44.346  32.383  1.00 114.31 ? 2   NAG D C4  1 
HETATM 8581 C  C5  . NAG D  2 .   ? 9.069   45.582  32.001  1.00 105.00 ? 2   NAG D C5  1 
HETATM 8582 C  C6  . NAG D  2 .   ? 10.017  46.044  33.111  1.00 91.94  ? 2   NAG D C6  1 
HETATM 8583 C  C7  . NAG D  2 .   ? 6.776   42.828  28.027  1.00 98.76  ? 2   NAG D C7  1 
HETATM 8584 C  C8  . NAG D  2 .   ? 5.671   43.054  27.034  1.00 93.92  ? 2   NAG D C8  1 
HETATM 8585 N  N2  . NAG D  2 .   ? 7.039   43.862  28.839  1.00 108.33 ? 2   NAG D N2  1 
HETATM 8586 O  O3  . NAG D  2 .   ? 6.790   42.641  31.525  1.00 109.28 ? 2   NAG D O3  1 
HETATM 8587 O  O4  . NAG D  2 .   ? 7.453   44.603  33.539  1.00 125.65 ? 2   NAG D O4  1 
HETATM 8588 O  O5  . NAG D  2 .   ? 9.830   45.268  30.831  1.00 112.33 ? 2   NAG D O5  1 
HETATM 8589 O  O6  . NAG D  2 .   ? 9.982   47.472  33.217  1.00 74.08  ? 2   NAG D O6  1 
HETATM 8590 O  O7  . NAG D  2 .   ? 7.377   41.763  28.060  1.00 95.39  ? 2   NAG D O7  1 
HETATM 8591 C  C1  . NAG E  3 .   ? 61.664  21.435  8.008   1.00 114.38 ? 801 NAG A C1  1 
HETATM 8592 C  C2  . NAG E  3 .   ? 62.148  21.609  9.453   1.00 115.34 ? 801 NAG A C2  1 
HETATM 8593 C  C3  . NAG E  3 .   ? 61.742  20.398  10.290  1.00 118.39 ? 801 NAG A C3  1 
HETATM 8594 C  C4  . NAG E  3 .   ? 62.153  19.102  9.589   1.00 122.22 ? 801 NAG A C4  1 
HETATM 8595 C  C5  . NAG E  3 .   ? 61.690  19.062  8.124   1.00 123.94 ? 801 NAG A C5  1 
HETATM 8596 C  C6  . NAG E  3 .   ? 60.873  17.808  7.811   1.00 117.56 ? 801 NAG A C6  1 
HETATM 8597 C  C7  . NAG E  3 .   ? 64.344  22.386  10.385  1.00 102.91 ? 801 NAG A C7  1 
HETATM 8598 C  C8  . NAG E  3 .   ? 63.678  23.132  11.504  1.00 94.54  ? 801 NAG A C8  1 
HETATM 8599 N  N2  . NAG E  3 .   ? 63.605  21.723  9.486   1.00 109.22 ? 801 NAG A N2  1 
HETATM 8600 O  O3  . NAG E  3 .   ? 60.327  20.402  10.507  1.00 115.34 ? 801 NAG A O3  1 
HETATM 8601 O  O4  . NAG E  3 .   ? 63.580  18.972  9.648   1.00 117.78 ? 801 NAG A O4  1 
HETATM 8602 O  O5  . NAG E  3 .   ? 60.918  20.230  7.819   1.00 124.73 ? 801 NAG A O5  1 
HETATM 8603 O  O6  . NAG E  3 .   ? 60.268  17.913  6.514   1.00 104.75 ? 801 NAG A O6  1 
HETATM 8604 O  O7  . NAG E  3 .   ? 65.561  22.389  10.292  1.00 104.87 ? 801 NAG A O7  1 
HETATM 8605 S  S   . SO4 F  4 .   ? 30.039  29.447  5.163   1.00 66.37  ? 802 SO4 A S   1 
HETATM 8606 O  O1  . SO4 F  4 .   ? 28.628  29.761  4.846   1.00 63.62  ? 802 SO4 A O1  1 
HETATM 8607 O  O2  . SO4 F  4 .   ? 30.891  29.784  3.999   1.00 65.24  ? 802 SO4 A O2  1 
HETATM 8608 O  O3  . SO4 F  4 .   ? 30.166  28.004  5.466   1.00 66.37  ? 802 SO4 A O3  1 
HETATM 8609 O  O4  . SO4 F  4 .   ? 30.471  30.236  6.339   1.00 63.49  ? 802 SO4 A O4  1 
HETATM 8610 S  S   . SO4 G  4 .   ? 71.723  70.995  9.639   1.00 124.97 ? 803 SO4 A S   1 
HETATM 8611 O  O1  . SO4 G  4 .   ? 71.013  70.646  8.387   1.00 120.32 ? 803 SO4 A O1  1 
HETATM 8612 O  O2  . SO4 G  4 .   ? 73.116  70.502  9.569   1.00 114.30 ? 803 SO4 A O2  1 
HETATM 8613 O  O3  . SO4 G  4 .   ? 71.039  70.372  10.792  1.00 117.45 ? 803 SO4 A O3  1 
HETATM 8614 O  O4  . SO4 G  4 .   ? 71.728  72.466  9.805   1.00 115.30 ? 803 SO4 A O4  1 
HETATM 8615 S  S   . SO4 H  4 .   ? 45.433  69.932  6.258   1.00 120.56 ? 804 SO4 A S   1 
HETATM 8616 O  O1  . SO4 H  4 .   ? 44.534  71.083  6.513   1.00 123.81 ? 804 SO4 A O1  1 
HETATM 8617 O  O2  . SO4 H  4 .   ? 45.723  69.851  4.809   1.00 113.89 ? 804 SO4 A O2  1 
HETATM 8618 O  O3  . SO4 H  4 .   ? 44.773  68.682  6.696   1.00 100.27 ? 804 SO4 A O3  1 
HETATM 8619 O  O4  . SO4 H  4 .   ? 46.697  70.116  7.006   1.00 103.25 ? 804 SO4 A O4  1 
HETATM 8620 S  S   . SO4 I  4 .   ? 50.758  37.221  25.772  1.00 140.50 ? 805 SO4 A S   1 
HETATM 8621 O  O1  . SO4 I  4 .   ? 49.800  37.509  24.681  1.00 135.80 ? 805 SO4 A O1  1 
HETATM 8622 O  O2  . SO4 I  4 .   ? 51.675  36.138  25.352  1.00 132.43 ? 805 SO4 A O2  1 
HETATM 8623 O  O3  . SO4 I  4 .   ? 50.014  36.799  26.980  1.00 142.27 ? 805 SO4 A O3  1 
HETATM 8624 O  O4  . SO4 I  4 .   ? 51.543  38.438  26.074  1.00 138.43 ? 805 SO4 A O4  1 
HETATM 8625 S  S   . SO4 J  4 .   ? 38.759  64.511  19.549  1.00 87.66  ? 806 SO4 A S   1 
HETATM 8626 O  O1  . SO4 J  4 .   ? 39.591  63.822  18.537  1.00 89.61  ? 806 SO4 A O1  1 
HETATM 8627 O  O2  . SO4 J  4 .   ? 38.205  65.756  18.970  1.00 86.36  ? 806 SO4 A O2  1 
HETATM 8628 O  O3  . SO4 J  4 .   ? 39.590  64.842  20.728  1.00 80.98  ? 806 SO4 A O3  1 
HETATM 8629 O  O4  . SO4 J  4 .   ? 37.652  63.621  19.963  1.00 71.01  ? 806 SO4 A O4  1 
HETATM 8630 S  S   . SO4 K  4 .   ? 30.761  51.386  14.429  1.00 90.88  ? 807 SO4 A S   1 
HETATM 8631 O  O1  . SO4 K  4 .   ? 31.750  50.294  14.301  1.00 91.16  ? 807 SO4 A O1  1 
HETATM 8632 O  O2  . SO4 K  4 .   ? 30.534  51.997  13.097  1.00 82.04  ? 807 SO4 A O2  1 
HETATM 8633 O  O3  . SO4 K  4 .   ? 31.273  52.411  15.366  1.00 92.22  ? 807 SO4 A O3  1 
HETATM 8634 O  O4  . SO4 K  4 .   ? 29.486  50.840  14.945  1.00 83.93  ? 807 SO4 A O4  1 
HETATM 8635 S  S   . SO4 L  4 .   ? 38.268  80.172  -7.494  1.00 120.91 ? 808 SO4 A S   1 
HETATM 8636 O  O1  . SO4 L  4 .   ? 37.717  78.799  -7.424  1.00 117.14 ? 808 SO4 A O1  1 
HETATM 8637 O  O2  . SO4 L  4 .   ? 38.594  80.502  -8.899  1.00 109.80 ? 808 SO4 A O2  1 
HETATM 8638 O  O3  . SO4 L  4 .   ? 39.493  80.258  -6.667  1.00 105.78 ? 808 SO4 A O3  1 
HETATM 8639 O  O4  . SO4 L  4 .   ? 37.264  81.130  -6.980  1.00 127.15 ? 808 SO4 A O4  1 
HETATM 8640 S  S   . SO4 M  4 .   ? 73.060  44.255  15.605  1.00 89.53  ? 809 SO4 A S   1 
HETATM 8641 O  O1  . SO4 M  4 .   ? 73.720  45.526  15.229  1.00 74.99  ? 809 SO4 A O1  1 
HETATM 8642 O  O2  . SO4 M  4 .   ? 73.433  43.199  14.637  1.00 92.07  ? 809 SO4 A O2  1 
HETATM 8643 O  O3  . SO4 M  4 .   ? 71.591  44.439  15.596  1.00 91.66  ? 809 SO4 A O3  1 
HETATM 8644 O  O4  . SO4 M  4 .   ? 73.499  43.855  16.961  1.00 80.48  ? 809 SO4 A O4  1 
HETATM 8645 S  S   . SO4 N  4 .   ? 73.941  36.896  -2.956  1.00 125.02 ? 810 SO4 A S   1 
HETATM 8646 O  O1  . SO4 N  4 .   ? 73.640  37.344  -4.335  1.00 121.83 ? 810 SO4 A O1  1 
HETATM 8647 O  O2  . SO4 N  4 .   ? 74.899  35.769  -3.003  1.00 114.37 ? 810 SO4 A O2  1 
HETATM 8648 O  O3  . SO4 N  4 .   ? 74.535  38.015  -2.191  1.00 111.77 ? 810 SO4 A O3  1 
HETATM 8649 O  O4  . SO4 N  4 .   ? 72.693  36.455  -2.295  1.00 123.11 ? 810 SO4 A O4  1 
HETATM 8650 S  S   . SO4 O  4 .   ? 39.300  38.101  -13.385 1.00 93.70  ? 811 SO4 A S   1 
HETATM 8651 O  O1  . SO4 O  4 .   ? 39.876  39.292  -14.052 1.00 82.97  ? 811 SO4 A O1  1 
HETATM 8652 O  O2  . SO4 O  4 .   ? 39.366  36.936  -14.297 1.00 93.77  ? 811 SO4 A O2  1 
HETATM 8653 O  O3  . SO4 O  4 .   ? 37.889  38.373  -13.031 1.00 99.44  ? 811 SO4 A O3  1 
HETATM 8654 O  O4  . SO4 O  4 .   ? 40.067  37.804  -12.152 1.00 94.52  ? 811 SO4 A O4  1 
HETATM 8655 S  S   . SO4 P  4 .   ? 54.526  64.914  -22.646 1.00 105.16 ? 812 SO4 A S   1 
HETATM 8656 O  O1  . SO4 P  4 .   ? 55.147  64.314  -23.848 1.00 104.32 ? 812 SO4 A O1  1 
HETATM 8657 O  O2  . SO4 P  4 .   ? 53.939  66.227  -22.996 1.00 102.92 ? 812 SO4 A O2  1 
HETATM 8658 O  O3  . SO4 P  4 .   ? 53.462  64.018  -22.140 1.00 100.34 ? 812 SO4 A O3  1 
HETATM 8659 O  O4  . SO4 P  4 .   ? 55.560  65.096  -21.604 1.00 101.17 ? 812 SO4 A O4  1 
HETATM 8660 S  S   . SO4 Q  4 .   ? 38.113  52.333  -25.399 1.00 92.56  ? 813 SO4 A S   1 
HETATM 8661 O  O1  . SO4 Q  4 .   ? 37.820  52.662  -26.814 1.00 95.22  ? 813 SO4 A O1  1 
HETATM 8662 O  O2  . SO4 Q  4 .   ? 38.656  50.957  -25.307 1.00 82.53  ? 813 SO4 A O2  1 
HETATM 8663 O  O3  . SO4 Q  4 .   ? 36.871  52.429  -24.600 1.00 84.74  ? 813 SO4 A O3  1 
HETATM 8664 O  O4  . SO4 Q  4 .   ? 39.107  53.296  -24.876 1.00 80.47  ? 813 SO4 A O4  1 
HETATM 8665 S  S   . SO4 R  4 .   ? 60.893  61.399  -9.478  1.00 104.64 ? 814 SO4 A S   1 
HETATM 8666 O  O1  . SO4 R  4 .   ? 61.998  62.127  -10.139 1.00 103.56 ? 814 SO4 A O1  1 
HETATM 8667 O  O2  . SO4 R  4 .   ? 60.068  60.721  -10.502 1.00 90.71  ? 814 SO4 A O2  1 
HETATM 8668 O  O3  . SO4 R  4 .   ? 61.453  60.391  -8.550  1.00 99.09  ? 814 SO4 A O3  1 
HETATM 8669 O  O4  . SO4 R  4 .   ? 60.050  62.349  -8.720  1.00 94.93  ? 814 SO4 A O4  1 
HETATM 8670 CO CO  . CO  S  5 .   ? 52.529  80.520  -15.699 1.00 127.38 ? 815 CO  A CO  1 
HETATM 8671 C  C1  . NAG T  3 .   ? -19.972 74.974  -8.133  1.00 117.41 ? 801 NAG B C1  1 
HETATM 8672 C  C2  . NAG T  3 .   ? -21.079 74.353  -7.275  1.00 126.70 ? 801 NAG B C2  1 
HETATM 8673 C  C3  . NAG T  3 .   ? -22.376 74.256  -8.085  1.00 129.01 ? 801 NAG B C3  1 
HETATM 8674 C  C4  . NAG T  3 .   ? -22.728 75.569  -8.789  1.00 128.71 ? 801 NAG B C4  1 
HETATM 8675 C  C5  . NAG T  3 .   ? -21.522 76.187  -9.501  1.00 122.18 ? 801 NAG B C5  1 
HETATM 8676 C  C6  . NAG T  3 .   ? -21.827 77.590  -10.021 1.00 117.92 ? 801 NAG B C6  1 
HETATM 8677 C  C7  . NAG T  3 .   ? -21.056 72.503  -5.624  1.00 121.77 ? 801 NAG B C7  1 
HETATM 8678 C  C8  . NAG T  3 .   ? -20.530 71.124  -5.338  1.00 110.75 ? 801 NAG B C8  1 
HETATM 8679 N  N2  . NAG T  3 .   ? -20.684 73.030  -6.799  1.00 132.22 ? 801 NAG B N2  1 
HETATM 8680 O  O3  . NAG T  3 .   ? -23.460 73.886  -7.222  1.00 114.48 ? 801 NAG B O3  1 
HETATM 8681 O  O4  . NAG T  3 .   ? -23.768 75.332  -9.745  1.00 126.00 ? 801 NAG B O4  1 
HETATM 8682 O  O5  . NAG T  3 .   ? -20.410 76.254  -8.603  1.00 119.25 ? 801 NAG B O5  1 
HETATM 8683 O  O6  . NAG T  3 .   ? -22.323 77.514  -11.363 1.00 112.42 ? 801 NAG B O6  1 
HETATM 8684 O  O7  . NAG T  3 .   ? -21.772 73.081  -4.820  1.00 123.18 ? 801 NAG B O7  1 
HETATM 8685 S  S   . SO4 U  4 .   ? 19.830  59.223  -14.506 1.00 108.28 ? 802 SO4 B S   1 
HETATM 8686 O  O1  . SO4 U  4 .   ? 20.039  58.016  -15.338 1.00 108.41 ? 802 SO4 B O1  1 
HETATM 8687 O  O2  . SO4 U  4 .   ? 20.139  60.432  -15.302 1.00 100.77 ? 802 SO4 B O2  1 
HETATM 8688 O  O3  . SO4 U  4 .   ? 18.419  59.271  -14.059 1.00 105.40 ? 802 SO4 B O3  1 
HETATM 8689 O  O4  . SO4 U  4 .   ? 20.724  59.159  -13.329 1.00 95.55  ? 802 SO4 B O4  1 
HETATM 8690 S  S   . SO4 V  4 .   ? 0.130   49.700  -6.091  1.00 78.26  ? 803 SO4 B S   1 
HETATM 8691 O  O1  . SO4 V  4 .   ? -0.635  48.541  -6.603  1.00 75.30  ? 803 SO4 B O1  1 
HETATM 8692 O  O2  . SO4 V  4 .   ? 0.443   50.617  -7.210  1.00 77.83  ? 803 SO4 B O2  1 
HETATM 8693 O  O3  . SO4 V  4 .   ? 1.387   49.225  -5.471  1.00 64.52  ? 803 SO4 B O3  1 
HETATM 8694 O  O4  . SO4 V  4 .   ? -0.678  50.416  -5.079  1.00 76.50  ? 803 SO4 B O4  1 
HETATM 8695 S  S   . SO4 W  4 .   ? 29.236  71.333  -19.253 1.00 83.82  ? 804 SO4 B S   1 
HETATM 8696 O  O1  . SO4 W  4 .   ? 27.933  70.662  -19.481 1.00 81.39  ? 804 SO4 B O1  1 
HETATM 8697 O  O2  . SO4 W  4 .   ? 30.200  70.909  -20.294 1.00 83.55  ? 804 SO4 B O2  1 
HETATM 8698 O  O3  . SO4 W  4 .   ? 29.763  70.958  -17.922 1.00 85.52  ? 804 SO4 B O3  1 
HETATM 8699 O  O4  . SO4 W  4 .   ? 29.057  72.803  -19.318 1.00 77.35  ? 804 SO4 B O4  1 
HETATM 8700 S  S   . SO4 X  4 .   ? 30.158  79.567  -5.356  1.00 124.38 ? 805 SO4 B S   1 
HETATM 8701 O  O1  . SO4 X  4 .   ? 30.614  78.580  -6.359  1.00 120.89 ? 805 SO4 B O1  1 
HETATM 8702 O  O2  . SO4 X  4 .   ? 29.150  80.462  -5.968  1.00 126.61 ? 805 SO4 B O2  1 
HETATM 8703 O  O3  . SO4 X  4 .   ? 29.556  78.857  -4.206  1.00 118.96 ? 805 SO4 B O3  1 
HETATM 8704 O  O4  . SO4 X  4 .   ? 31.312  80.374  -4.898  1.00 108.25 ? 805 SO4 B O4  1 
HETATM 8705 S  S   . SO4 Y  4 .   ? -12.203 91.597  4.701   1.00 111.04 ? 806 SO4 B S   1 
HETATM 8706 O  O1  . SO4 Y  4 .   ? -13.442 90.807  4.521   1.00 100.77 ? 806 SO4 B O1  1 
HETATM 8707 O  O2  . SO4 Y  4 .   ? -11.351 91.461  3.499   1.00 109.59 ? 806 SO4 B O2  1 
HETATM 8708 O  O3  . SO4 Y  4 .   ? -12.551 93.023  4.901   1.00 101.77 ? 806 SO4 B O3  1 
HETATM 8709 O  O4  . SO4 Y  4 .   ? -11.466 91.100  5.884   1.00 108.41 ? 806 SO4 B O4  1 
HETATM 8710 S  S   . SO4 Z  4 .   ? 20.603  102.986 -5.911  1.00 111.17 ? 807 SO4 B S   1 
HETATM 8711 O  O1  . SO4 Z  4 .   ? 21.461  101.797 -6.117  1.00 112.77 ? 807 SO4 B O1  1 
HETATM 8712 O  O2  . SO4 Z  4 .   ? 20.854  103.970 -6.990  1.00 104.90 ? 807 SO4 B O2  1 
HETATM 8713 O  O3  . SO4 Z  4 .   ? 20.916  103.602 -4.602  1.00 104.37 ? 807 SO4 B O3  1 
HETATM 8714 O  O4  . SO4 Z  4 .   ? 19.185  102.571 -5.939  1.00 103.81 ? 807 SO4 B O4  1 
HETATM 8715 S  S   . SO4 AA 4 .   ? -13.459 91.449  12.184  1.00 116.88 ? 808 SO4 B S   1 
HETATM 8716 O  O1  . SO4 AA 4 .   ? -13.395 92.728  11.441  1.00 114.48 ? 808 SO4 B O1  1 
HETATM 8717 O  O2  . SO4 AA 4 .   ? -13.183 90.324  11.266  1.00 106.73 ? 808 SO4 B O2  1 
HETATM 8718 O  O3  . SO4 AA 4 .   ? -12.456 91.459  13.272  1.00 111.11 ? 808 SO4 B O3  1 
HETATM 8719 O  O4  . SO4 AA 4 .   ? -14.814 91.282  12.761  1.00 113.90 ? 808 SO4 B O4  1 
HETATM 8720 S  S   . SO4 BA 4 .   ? -5.176  42.572  9.525   1.00 123.22 ? 809 SO4 B S   1 
HETATM 8721 O  O1  . SO4 BA 4 .   ? -5.823  42.638  8.196   1.00 120.76 ? 809 SO4 B O1  1 
HETATM 8722 O  O2  . SO4 BA 4 .   ? -3.919  43.355  9.515   1.00 114.15 ? 809 SO4 B O2  1 
HETATM 8723 O  O3  . SO4 BA 4 .   ? -6.099  43.124  10.541  1.00 125.13 ? 809 SO4 B O3  1 
HETATM 8724 O  O4  . SO4 BA 4 .   ? -4.873  41.161  9.854   1.00 114.52 ? 809 SO4 B O4  1 
HETATM 8725 S  S   . SO4 CA 4 .   ? -9.331  56.168  -8.280  1.00 142.12 ? 810 SO4 B S   1 
HETATM 8726 O  O1  . SO4 CA 4 .   ? -10.377 55.897  -9.293  1.00 133.23 ? 810 SO4 B O1  1 
HETATM 8727 O  O2  . SO4 CA 4 .   ? -8.035  55.630  -8.752  1.00 137.47 ? 810 SO4 B O2  1 
HETATM 8728 O  O3  . SO4 CA 4 .   ? -9.700  55.519  -7.001  1.00 132.43 ? 810 SO4 B O3  1 
HETATM 8729 O  O4  . SO4 CA 4 .   ? -9.211  57.629  -8.078  1.00 136.40 ? 810 SO4 B O4  1 
HETATM 8730 S  S   . SO4 DA 4 .   ? 21.308  40.089  20.282  1.00 95.16  ? 811 SO4 B S   1 
HETATM 8731 O  O1  . SO4 DA 4 .   ? 20.533  39.766  19.063  1.00 84.95  ? 811 SO4 B O1  1 
HETATM 8732 O  O2  . SO4 DA 4 .   ? 22.179  41.256  20.018  1.00 93.91  ? 811 SO4 B O2  1 
HETATM 8733 O  O3  . SO4 DA 4 .   ? 22.143  38.926  20.659  1.00 98.85  ? 811 SO4 B O3  1 
HETATM 8734 O  O4  . SO4 DA 4 .   ? 20.379  40.408  21.389  1.00 84.75  ? 811 SO4 B O4  1 
HETATM 8735 S  S   . SO4 EA 4 .   ? 13.104  42.232  24.951  1.00 98.15  ? 812 SO4 B S   1 
HETATM 8736 O  O1  . SO4 EA 4 .   ? 12.384  41.584  23.831  1.00 77.86  ? 812 SO4 B O1  1 
HETATM 8737 O  O2  . SO4 EA 4 .   ? 14.413  42.737  24.475  1.00 88.32  ? 812 SO4 B O2  1 
HETATM 8738 O  O3  . SO4 EA 4 .   ? 12.297  43.360  25.464  1.00 91.90  ? 812 SO4 B O3  1 
HETATM 8739 O  O4  . SO4 EA 4 .   ? 13.319  41.247  26.036  1.00 83.57  ? 812 SO4 B O4  1 
HETATM 8740 S  S   . SO4 FA 4 .   ? -2.724  95.262  -14.788 1.00 112.49 ? 813 SO4 B S   1 
HETATM 8741 O  O1  . SO4 FA 4 .   ? -3.237  94.406  -15.883 1.00 102.22 ? 813 SO4 B O1  1 
HETATM 8742 O  O2  . SO4 FA 4 .   ? -1.258  95.410  -14.917 1.00 118.45 ? 813 SO4 B O2  1 
HETATM 8743 O  O3  . SO4 FA 4 .   ? -3.365  96.594  -14.862 1.00 116.89 ? 813 SO4 B O3  1 
HETATM 8744 O  O4  . SO4 FA 4 .   ? -3.035  94.628  -13.487 1.00 128.81 ? 813 SO4 B O4  1 
HETATM 8745 S  S   . SO4 GA 4 .   ? 15.839  36.839  21.870  1.00 104.95 ? 814 SO4 B S   1 
HETATM 8746 O  O1  . SO4 GA 4 .   ? 14.757  37.794  21.537  1.00 88.02  ? 814 SO4 B O1  1 
HETATM 8747 O  O2  . SO4 GA 4 .   ? 16.800  36.773  20.745  1.00 96.46  ? 814 SO4 B O2  1 
HETATM 8748 O  O3  . SO4 GA 4 .   ? 16.540  37.293  23.091  1.00 97.34  ? 814 SO4 B O3  1 
HETATM 8749 O  O4  . SO4 GA 4 .   ? 15.260  35.497  22.103  1.00 100.70 ? 814 SO4 B O4  1 
HETATM 8750 S  S   . SO4 HA 4 .   ? -6.424  105.696 -9.489  1.00 94.98  ? 815 SO4 B S   1 
HETATM 8751 O  O1  . SO4 HA 4 .   ? -5.009  105.905 -9.875  1.00 72.56  ? 815 SO4 B O1  1 
HETATM 8752 O  O2  . SO4 HA 4 .   ? -7.112  104.906 -10.535 1.00 82.13  ? 815 SO4 B O2  1 
HETATM 8753 O  O3  . SO4 HA 4 .   ? -6.483  104.972 -8.199  1.00 86.35  ? 815 SO4 B O3  1 
HETATM 8754 O  O4  . SO4 HA 4 .   ? -7.095  107.007 -9.347  1.00 88.68  ? 815 SO4 B O4  1 
HETATM 8755 S  S   . SO4 IA 4 .   ? 24.777  80.864  -5.342  1.00 97.08  ? 816 SO4 B S   1 
HETATM 8756 O  O1  . SO4 IA 4 .   ? 23.941  81.980  -5.837  1.00 91.13  ? 816 SO4 B O1  1 
HETATM 8757 O  O2  . SO4 IA 4 .   ? 24.727  79.744  -6.308  1.00 85.46  ? 816 SO4 B O2  1 
HETATM 8758 O  O3  . SO4 IA 4 .   ? 24.263  80.408  -4.032  1.00 83.37  ? 816 SO4 B O3  1 
HETATM 8759 O  O4  . SO4 IA 4 .   ? 26.176  81.325  -5.193  1.00 82.93  ? 816 SO4 B O4  1 
HETATM 8760 S  S   . SO4 JA 4 .   ? 24.275  63.184  -14.583 1.00 100.45 ? 817 SO4 B S   1 
HETATM 8761 O  O1  . SO4 JA 4 .   ? 25.221  63.098  -15.717 1.00 100.70 ? 817 SO4 B O1  1 
HETATM 8762 O  O2  . SO4 JA 4 .   ? 22.905  63.412  -15.093 1.00 91.67  ? 817 SO4 B O2  1 
HETATM 8763 O  O3  . SO4 JA 4 .   ? 24.304  61.922  -13.811 1.00 103.75 ? 817 SO4 B O3  1 
HETATM 8764 O  O4  . SO4 JA 4 .   ? 24.669  64.303  -13.696 1.00 107.89 ? 817 SO4 B O4  1 
HETATM 8765 CO CO  . CO  KA 5 .   ? 36.543  90.912  15.710  1.00 111.44 ? 818 CO  B CO  1 
HETATM 8766 O  O   . HOH LA 6 .   ? 39.237  79.148  -4.173  1.00 32.58  ? 901 HOH A O   1 
HETATM 8767 O  O   . HOH LA 6 .   ? 23.386  50.295  -6.796  1.00 45.21  ? 902 HOH A O   1 
HETATM 8768 O  O   . HOH LA 6 .   ? 86.496  48.164  9.236   1.00 30.49  ? 903 HOH A O   1 
HETATM 8769 O  O   . HOH LA 6 .   ? 41.968  64.916  17.667  1.00 29.74  ? 904 HOH A O   1 
HETATM 8770 O  O   . HOH LA 6 .   ? 40.601  75.571  3.929   1.00 45.32  ? 905 HOH A O   1 
HETATM 8771 O  O   . HOH LA 6 .   ? 53.592  81.565  -14.814 1.00 58.08  ? 906 HOH A O   1 
HETATM 8772 O  O   . HOH LA 6 .   ? 61.559  30.971  0.988   1.00 36.74  ? 907 HOH A O   1 
HETATM 8773 O  O   . HOH LA 6 .   ? 54.685  45.138  -6.087  1.00 28.65  ? 908 HOH A O   1 
HETATM 8774 O  O   . HOH LA 6 .   ? 59.283  58.490  -5.878  1.00 29.75  ? 909 HOH A O   1 
HETATM 8775 O  O   . HOH LA 6 .   ? 68.244  39.196  1.449   1.00 33.09  ? 910 HOH A O   1 
HETATM 8776 O  O   . HOH LA 6 .   ? 62.427  57.655  24.043  1.00 39.67  ? 911 HOH A O   1 
HETATM 8777 O  O   . HOH LA 6 .   ? 33.350  56.605  14.927  1.00 14.54  ? 912 HOH A O   1 
HETATM 8778 O  O   . HOH LA 6 .   ? 66.332  43.162  16.454  1.00 28.09  ? 913 HOH A O   1 
HETATM 8779 O  O   . HOH LA 6 .   ? 42.466  69.122  8.796   1.00 39.84  ? 914 HOH A O   1 
HETATM 8780 O  O   . HOH LA 6 .   ? 32.578  76.121  -18.006 1.00 43.97  ? 915 HOH A O   1 
HETATM 8781 O  O   . HOH LA 6 .   ? 51.644  81.137  -17.081 1.00 50.19  ? 916 HOH A O   1 
HETATM 8782 O  O   . HOH LA 6 .   ? 57.971  52.752  -8.758  1.00 29.19  ? 917 HOH A O   1 
HETATM 8783 O  O   . HOH LA 6 .   ? 27.325  45.537  7.460   1.00 33.85  ? 918 HOH A O   1 
HETATM 8784 O  O   . HOH LA 6 .   ? 83.870  46.726  10.302  1.00 27.87  ? 919 HOH A O   1 
HETATM 8785 O  O   . HOH LA 6 .   ? 44.229  33.078  19.958  1.00 32.37  ? 920 HOH A O   1 
HETATM 8786 O  O   . HOH LA 6 .   ? 53.575  67.808  -8.810  1.00 35.71  ? 921 HOH A O   1 
HETATM 8787 O  O   . HOH LA 6 .   ? 22.843  47.882  -24.972 1.00 30.52  ? 922 HOH A O   1 
HETATM 8788 O  O   . HOH LA 6 .   ? 51.626  83.052  -13.001 1.00 33.68  ? 923 HOH A O   1 
HETATM 8789 O  O   . HOH MA 6 .   ? 13.673  39.230  23.613  1.00 33.41  ? 901 HOH B O   1 
HETATM 8790 O  O   . HOH MA 6 .   ? -7.193  87.742  13.127  1.00 33.79  ? 902 HOH B O   1 
HETATM 8791 O  O   . HOH MA 6 .   ? 4.661   63.338  16.837  1.00 34.53  ? 903 HOH B O   1 
HETATM 8792 O  O   . HOH MA 6 .   ? 20.428  80.207  -4.859  1.00 30.72  ? 904 HOH B O   1 
HETATM 8793 O  O   . HOH MA 6 .   ? 27.203  69.280  -21.744 1.00 43.07  ? 905 HOH B O   1 
HETATM 8794 O  O   . HOH MA 6 .   ? 0.494   82.516  -17.598 1.00 42.42  ? 906 HOH B O   1 
HETATM 8795 O  O   . HOH MA 6 .   ? -11.726 55.037  -3.624  1.00 30.63  ? 907 HOH B O   1 
HETATM 8796 O  O   . HOH MA 6 .   ? 10.643  83.892  17.920  1.00 45.28  ? 908 HOH B O   1 
HETATM 8797 O  O   . HOH MA 6 .   ? 21.542  51.192  6.290   1.00 21.99  ? 909 HOH B O   1 
HETATM 8798 O  O   . HOH MA 6 .   ? 6.599   69.897  -25.792 1.00 24.78  ? 910 HOH B O   1 
HETATM 8799 O  O   . HOH MA 6 .   ? 20.650  83.748  -0.451  1.00 39.89  ? 911 HOH B O   1 
HETATM 8800 O  O   . HOH MA 6 .   ? 16.248  89.021  9.550   1.00 50.16  ? 912 HOH B O   1 
HETATM 8801 O  O   . HOH MA 6 .   ? 7.677   68.194  -23.238 1.00 27.06  ? 913 HOH B O   1 
HETATM 8802 O  O   . HOH MA 6 .   ? -5.676  88.036  -1.110  1.00 30.67  ? 914 HOH B O   1 
HETATM 8803 O  O   . HOH MA 6 .   ? -11.510 94.964  11.198  1.00 37.77  ? 915 HOH B O   1 
HETATM 8804 O  O   . HOH MA 6 .   ? 35.929  92.520  15.490  1.00 44.56  ? 916 HOH B O   1 
HETATM 8805 O  O   . HOH MA 6 .   ? 37.096  91.621  17.188  1.00 43.13  ? 917 HOH B O   1 
HETATM 8806 O  O   . HOH MA 6 .   ? 9.672   60.600  -17.495 1.00 26.27  ? 918 HOH B O   1 
HETATM 8807 O  O   . HOH MA 6 .   ? 21.420  62.093  -17.511 1.00 56.66  ? 919 HOH B O   1 
HETATM 8808 O  O   . HOH MA 6 .   ? -11.983 76.849  -2.651  1.00 35.13  ? 920 HOH B O   1 
HETATM 8809 O  O   . HOH MA 6 .   ? 6.867   51.794  -10.646 1.00 48.15  ? 921 HOH B O   1 
HETATM 8810 O  O   . HOH MA 6 .   ? 16.545  88.732  -1.146  1.00 34.31  ? 922 HOH B O   1 
HETATM 8811 O  O   . HOH MA 6 .   ? 13.215  39.686  12.276  1.00 54.11  ? 923 HOH B O   1 
HETATM 8812 O  O   . HOH MA 6 .   ? 21.171  70.114  -22.118 1.00 31.61  ? 924 HOH B O   1 
HETATM 8813 O  O   . HOH MA 6 .   ? 22.136  51.899  -0.197  1.00 41.52  ? 925 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   ?   ?   ?   A . n 
A 1 3   ILE 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   LEU 6   6   ?   ?   ?   A . n 
A 1 7   LEU 7   7   ?   ?   ?   A . n 
A 1 8   MET 8   8   ?   ?   ?   A . n 
A 1 9   GLY 9   9   ?   ?   ?   A . n 
A 1 10  ARG 10  10  ?   ?   ?   A . n 
A 1 11  LEU 11  11  ?   ?   ?   A . n 
A 1 12  ARG 12  12  ?   ?   ?   A . n 
A 1 13  LEU 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  ARG 15  15  ?   ?   ?   A . n 
A 1 16  ARG 16  16  ?   ?   ?   A . n 
A 1 17  MET 17  17  ?   ?   ?   A . n 
A 1 18  VAL 18  18  ?   ?   ?   A . n 
A 1 19  PRO 19  19  ?   ?   ?   A . n 
A 1 20  LEU 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  LEU 22  22  ?   ?   ?   A . n 
A 1 23  LEU 23  23  ?   ?   ?   A . n 
A 1 24  GLY 24  24  ?   ?   ?   A . n 
A 1 25  VAL 25  25  ?   ?   ?   A . n 
A 1 26  THR 26  26  ?   ?   ?   A . n 
A 1 27  ALA 27  27  ?   ?   ?   A . n 
A 1 28  LEU 28  28  ?   ?   ?   A . n 
A 1 29  LEU 29  29  ?   ?   ?   A . n 
A 1 30  LEU 30  30  ?   ?   ?   A . n 
A 1 31  ILE 31  31  ?   ?   ?   A . n 
A 1 32  LEU 32  32  ?   ?   ?   A . n 
A 1 33  PRO 33  33  ?   ?   ?   A . n 
A 1 34  PRO 34  34  ?   ?   ?   A . n 
A 1 35  PHE 35  35  ?   ?   ?   A . n 
A 1 36  ALA 36  36  ?   ?   ?   A . n 
A 1 37  LEU 37  37  ?   ?   ?   A . n 
A 1 38  VAL 38  38  ?   ?   ?   A . n 
A 1 39  GLN 39  39  ?   ?   ?   A . n 
A 1 40  GLY 40  40  ?   ?   ?   A . n 
A 1 41  ARG 41  41  ?   ?   ?   A . n 
A 1 42  HIS 42  42  ?   ?   ?   A . n 
A 1 43  HIS 43  43  ?   ?   ?   A . n 
A 1 44  GLU 44  44  ?   ?   ?   A . n 
A 1 45  LEU 45  45  ?   ?   ?   A . n 
A 1 46  ASN 46  46  ?   ?   ?   A . n 
A 1 47  ASN 47  47  ?   ?   ?   A . n 
A 1 48  GLY 48  48  ?   ?   ?   A . n 
A 1 49  ALA 49  49  ?   ?   ?   A . n 
A 1 50  ALA 50  50  ?   ?   ?   A . n 
A 1 51  ILE 51  51  ?   ?   ?   A . n 
A 1 52  GLY 52  52  ?   ?   ?   A . n 
A 1 53  SER 53  53  ?   ?   ?   A . n 
A 1 54  HIS 54  54  ?   ?   ?   A . n 
A 1 55  GLN 55  55  ?   ?   ?   A . n 
A 1 56  LEU 56  56  ?   ?   ?   A . n 
A 1 57  SER 57  57  ?   ?   ?   A . n 
A 1 58  ALA 58  58  ?   ?   ?   A . n 
A 1 59  ALA 59  59  ?   ?   ?   A . n 
A 1 60  ALA 60  60  ?   ?   ?   A . n 
A 1 61  GLY 61  61  ?   ?   ?   A . n 
A 1 62  VAL 62  62  ?   ?   ?   A . n 
A 1 63  GLY 63  63  ?   ?   ?   A . n 
A 1 64  LEU 64  64  ?   ?   ?   A . n 
A 1 65  ALA 65  65  ?   ?   ?   A . n 
A 1 66  SER 66  66  ?   ?   ?   A . n 
A 1 67  GLN 67  67  ?   ?   ?   A . n 
A 1 68  SER 68  68  ?   ?   ?   A . n 
A 1 69  ALA 69  69  ?   ?   ?   A . n 
A 1 70  GLN 70  70  ?   ?   ?   A . n 
A 1 71  SER 71  71  ?   ?   ?   A . n 
A 1 72  GLY 72  72  ?   ?   ?   A . n 
A 1 73  SER 73  73  ?   ?   ?   A . n 
A 1 74  LEU 74  74  ?   ?   ?   A . n 
A 1 75  ALA 75  75  ?   ?   ?   A . n 
A 1 76  SER 76  76  ?   ?   ?   A . n 
A 1 77  GLY 77  77  ?   ?   ?   A . n 
A 1 78  VAL 78  78  ?   ?   ?   A . n 
A 1 79  MET 79  79  ?   ?   ?   A . n 
A 1 80  SER 80  80  ?   ?   ?   A . n 
A 1 81  SER 81  81  ?   ?   ?   A . n 
A 1 82  VAL 82  82  ?   ?   ?   A . n 
A 1 83  PRO 83  83  ?   ?   ?   A . n 
A 1 84  ALA 84  84  ?   ?   ?   A . n 
A 1 85  ALA 85  85  ?   ?   ?   A . n 
A 1 86  GLY 86  86  ?   ?   ?   A . n 
A 1 87  ALA 87  87  ?   ?   ?   A . n 
A 1 88  SER 88  88  ?   ?   ?   A . n 
A 1 89  SER 89  89  ?   ?   ?   A . n 
A 1 90  SER 90  90  ?   ?   ?   A . n 
A 1 91  SER 91  91  ?   ?   ?   A . n 
A 1 92  SER 92  92  ?   ?   ?   A . n 
A 1 93  SER 93  93  ?   ?   ?   A . n 
A 1 94  SER 94  94  ?   ?   ?   A . n 
A 1 95  LEU 95  95  ?   ?   ?   A . n 
A 1 96  LEU 96  96  ?   ?   ?   A . n 
A 1 97  SER 97  97  ?   ?   ?   A . n 
A 1 98  SER 98  98  ?   ?   ?   A . n 
A 1 99  SER 99  99  ?   ?   ?   A . n 
A 1 100 ALA 100 100 ?   ?   ?   A . n 
A 1 101 GLU 101 101 ?   ?   ?   A . n 
A 1 102 ASP 102 102 ?   ?   ?   A . n 
A 1 103 ASP 103 103 ?   ?   ?   A . n 
A 1 104 VAL 104 104 ?   ?   ?   A . n 
A 1 105 ALA 105 105 ?   ?   ?   A . n 
A 1 106 ARG 106 106 ?   ?   ?   A . n 
A 1 107 ILE 107 107 ?   ?   ?   A . n 
A 1 108 THR 108 108 ?   ?   ?   A . n 
A 1 109 LEU 109 109 ?   ?   ?   A . n 
A 1 110 SER 110 110 ?   ?   ?   A . n 
A 1 111 LYS 111 111 ?   ?   ?   A . n 
A 1 112 ASP 112 112 ?   ?   ?   A . n 
A 1 113 ALA 113 113 ?   ?   ?   A . n 
A 1 114 ASP 114 114 ?   ?   ?   A . n 
A 1 115 ALA 115 115 ?   ?   ?   A . n 
A 1 116 PHE 116 116 ?   ?   ?   A . n 
A 1 117 PHE 117 117 ?   ?   ?   A . n 
A 1 118 THR 118 118 ?   ?   ?   A . n 
A 1 119 PRO 119 119 ?   ?   ?   A . n 
A 1 120 TYR 120 120 ?   ?   ?   A . n 
A 1 121 ILE 121 121 ?   ?   ?   A . n 
A 1 122 GLY 122 122 ?   ?   ?   A . n 
A 1 123 HIS 123 123 ?   ?   ?   A . n 
A 1 124 GLY 124 124 ?   ?   ?   A . n 
A 1 125 GLU 125 125 ?   ?   ?   A . n 
A 1 126 SER 126 126 ?   ?   ?   A . n 
A 1 127 VAL 127 127 ?   ?   ?   A . n 
A 1 128 ARG 128 128 ?   ?   ?   A . n 
A 1 129 ILE 129 129 ?   ?   ?   A . n 
A 1 130 ILE 130 130 ?   ?   ?   A . n 
A 1 131 ASP 131 131 ?   ?   ?   A . n 
A 1 132 ALA 132 132 ?   ?   ?   A . n 
A 1 133 GLU 133 133 ?   ?   ?   A . n 
A 1 134 LEU 134 134 ?   ?   ?   A . n 
A 1 135 GLY 135 135 ?   ?   ?   A . n 
A 1 136 THR 136 136 ?   ?   ?   A . n 
A 1 137 LEU 137 137 ?   ?   ?   A . n 
A 1 138 GLU 138 138 ?   ?   ?   A . n 
A 1 139 HIS 139 139 ?   ?   ?   A . n 
A 1 140 VAL 140 140 ?   ?   ?   A . n 
A 1 141 HIS 141 141 ?   ?   ?   A . n 
A 1 142 SER 142 142 ?   ?   ?   A . n 
A 1 143 GLY 143 143 ?   ?   ?   A . n 
A 1 144 ALA 144 144 ?   ?   ?   A . n 
A 1 145 THR 145 145 ?   ?   ?   A . n 
A 1 146 PRO 146 146 ?   ?   ?   A . n 
A 1 147 ARG 147 147 ?   ?   ?   A . n 
A 1 148 ARG 148 148 ?   ?   ?   A . n 
A 1 149 ARG 149 149 ?   ?   ?   A . n 
A 1 150 GLY 150 150 ?   ?   ?   A . n 
A 1 151 LEU 151 151 ?   ?   ?   A . n 
A 1 152 THR 152 152 ?   ?   ?   A . n 
A 1 153 ARG 153 153 ?   ?   ?   A . n 
A 1 154 ARG 154 154 ?   ?   ?   A . n 
A 1 155 GLU 155 155 ?   ?   ?   A . n 
A 1 156 SER 156 156 ?   ?   ?   A . n 
A 1 157 ASN 157 157 ?   ?   ?   A . n 
A 1 158 SER 158 158 ?   ?   ?   A . n 
A 1 159 ASP 159 159 ?   ?   ?   A . n 
A 1 160 ALA 160 160 ?   ?   ?   A . n 
A 1 161 ASN 161 161 ?   ?   ?   A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 TRP 191 191 191 TRP TRP A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 PHE 206 206 206 PHE PHE A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ARG 210 210 210 ARG ARG A . n 
A 1 211 PRO 211 211 211 PRO PRO A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 TRP 215 215 215 TRP TRP A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 CYS 228 228 228 CYS CYS A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 ILE 231 231 231 ILE ILE A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 PHE 236 236 236 PHE PHE A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 PRO 240 240 240 PRO PRO A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 TRP 245 245 245 TRP TRP A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 GLU 253 253 253 GLU GLU A . n 
A 1 254 ASP 254 254 254 ASP ASP A . n 
A 1 255 CYS 255 255 255 CYS CYS A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 ASN 259 259 259 ASN ASN A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 ARG 264 264 264 ARG ARG A . n 
A 1 265 PRO 265 265 265 PRO PRO A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 ASN 269 269 269 ASN ASN A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 MET 273 273 273 MET MET A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 TRP 275 275 275 TRP TRP A . n 
A 1 276 ILE 276 276 276 ILE ILE A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 SER 283 283 283 SER SER A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 VAL 290 290 290 VAL VAL A . n 
A 1 291 TYR 291 291 291 TYR TYR A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 HIS 293 293 293 HIS HIS A . n 
A 1 294 ARG 294 294 294 ARG ARG A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 ALA 297 297 297 ALA ALA A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 ASN 301 301 301 ASN ASN A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 TYR 309 309 309 TYR TYR A . n 
A 1 310 ARG 310 310 310 ARG ARG A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 SER 313 313 313 SER SER A . n 
A 1 314 LEU 314 314 314 LEU LEU A . n 
A 1 315 GLY 315 315 315 GLY GLY A . n 
A 1 316 PHE 316 316 316 PHE PHE A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 THR 321 321 321 THR THR A . n 
A 1 322 PRO 322 322 322 PRO PRO A . n 
A 1 323 GLU 323 323 323 GLU GLU A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 PRO 325 325 325 PRO PRO A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 ASN 327 327 327 ASN ASN A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 GLN 333 333 333 GLN GLN A . n 
A 1 334 ASN 334 334 334 ASN ASN A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 LEU 337 337 337 LEU LEU A . n 
A 1 338 ARG 338 338 338 ARG ARG A . n 
A 1 339 TRP 339 339 339 TRP TRP A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 ASN 343 343 343 ASN ASN A . n 
A 1 344 ILE 344 344 344 ILE ILE A . n 
A 1 345 HIS 345 345 345 HIS HIS A . n 
A 1 346 ARG 346 346 346 ARG ARG A . n 
A 1 347 PHE 347 347 347 PHE PHE A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 GLY 349 349 349 GLY GLY A . n 
A 1 350 ASP 350 350 350 ASP ASP A . n 
A 1 351 PRO 351 351 351 PRO PRO A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 VAL 354 354 354 VAL VAL A . n 
A 1 355 THR 355 355 355 THR THR A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 PHE 357 357 357 PHE PHE A . n 
A 1 358 GLY 358 358 358 GLY GLY A . n 
A 1 359 GLU 359 359 359 GLU GLU A . n 
A 1 360 SEB 360 360 360 SEB SEB A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 VAL 364 364 364 VAL VAL A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 SER 367 367 367 SER SER A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 HIS 369 369 369 HIS HIS A . n 
A 1 370 LEU 370 370 370 LEU LEU A . n 
A 1 371 LEU 371 371 371 LEU LEU A . n 
A 1 372 SER 372 372 372 SER SER A . n 
A 1 373 ALA 373 373 373 ALA ALA A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 SER 375 375 375 SER SER A . n 
A 1 376 ARG 376 376 376 ARG ARG A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 LEU 378 378 378 LEU LEU A . n 
A 1 379 PHE 379 379 379 PHE PHE A . n 
A 1 380 GLN 380 380 380 GLN GLN A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 ALA 382 382 382 ALA ALA A . n 
A 1 383 ILE 383 383 383 ILE ILE A . n 
A 1 384 LEU 384 384 384 LEU LEU A . n 
A 1 385 GLN 385 385 385 GLN GLN A . n 
A 1 386 SER 386 386 386 SER SER A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 SER 388 388 388 SER SER A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 THR 390 390 390 THR THR A . n 
A 1 391 ALA 391 391 391 ALA ALA A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 TRP 393 393 393 TRP TRP A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 LEU 395 395 395 LEU LEU A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 SER 397 397 397 SER SER A . n 
A 1 398 ARG 398 398 398 ARG ARG A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 GLU 400 400 400 GLU GLU A . n 
A 1 401 ALA 401 401 401 ALA ALA A . n 
A 1 402 THR 402 402 402 THR THR A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 ARG 404 404 404 ARG ARG A . n 
A 1 405 ALA 405 405 405 ALA ALA A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 ARG 407 407 407 ARG ARG A . n 
A 1 408 LEU 408 408 408 LEU LEU A . n 
A 1 409 ALA 409 409 409 ALA ALA A . n 
A 1 410 GLU 410 410 410 GLU GLU A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 VAL 412 412 412 VAL VAL A . n 
A 1 413 GLY 413 413 413 GLY GLY A . n 
A 1 414 CYS 414 414 414 CYS CYS A . n 
A 1 415 PRO 415 415 415 PRO PRO A . n 
A 1 416 HIS 416 416 416 HIS HIS A . n 
A 1 417 GLU 417 417 417 GLU GLU A . n 
A 1 418 PRO 418 418 418 PRO PRO A . n 
A 1 419 SER 419 419 419 SER SER A . n 
A 1 420 LYS 420 420 420 LYS LYS A . n 
A 1 421 LEU 421 421 421 LEU LEU A . n 
A 1 422 SER 422 422 422 SER SER A . n 
A 1 423 ASP 423 423 423 ASP ASP A . n 
A 1 424 ALA 424 424 424 ALA ALA A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 GLU 426 426 426 GLU GLU A . n 
A 1 427 CYS 427 427 427 CYS CYS A . n 
A 1 428 LEU 428 428 428 LEU LEU A . n 
A 1 429 ARG 429 429 429 ARG ARG A . n 
A 1 430 GLY 430 430 430 GLY GLY A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 ASP 432 432 432 ASP ASP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 HIS 434 434 434 HIS HIS A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 LEU 436 436 436 LEU LEU A . n 
A 1 437 VAL 437 437 437 VAL VAL A . n 
A 1 438 ASN 438 438 438 ASN ASN A . n 
A 1 439 ASN 439 439 439 ASN ASN A . n 
A 1 440 GLU 440 440 440 GLU GLU A . n 
A 1 441 TRP 441 441 441 TRP TRP A . n 
A 1 442 GLY 442 442 442 GLY GLY A . n 
A 1 443 THR 443 443 443 THR THR A . n 
A 1 444 LEU 444 444 444 LEU LEU A . n 
A 1 445 GLY 445 445 445 GLY GLY A . n 
A 1 446 ILE 446 446 446 ILE ILE A . n 
A 1 447 CYS 447 447 447 CYS CYS A . n 
A 1 448 GLU 448 448 448 GLU GLU A . n 
A 1 449 PHE 449 449 449 PHE PHE A . n 
A 1 450 PRO 450 450 450 PRO PRO A . n 
A 1 451 PHE 451 451 451 PHE PHE A . n 
A 1 452 VAL 452 452 452 VAL VAL A . n 
A 1 453 PRO 453 453 453 PRO PRO A . n 
A 1 454 VAL 454 454 454 VAL VAL A . n 
A 1 455 VAL 455 455 455 VAL VAL A . n 
A 1 456 ASP 456 456 456 ASP ASP A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 ALA 458 458 458 ALA ALA A . n 
A 1 459 PHE 459 459 459 PHE PHE A . n 
A 1 460 LEU 460 460 460 LEU LEU A . n 
A 1 461 ASP 461 461 461 ASP ASP A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 THR 463 463 463 THR THR A . n 
A 1 464 PRO 464 464 464 PRO PRO A . n 
A 1 465 GLN 465 465 465 GLN GLN A . n 
A 1 466 ARG 466 466 466 ARG ARG A . n 
A 1 467 SER 467 467 467 SER SER A . n 
A 1 468 LEU 468 468 468 LEU LEU A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 GLY 471 471 471 GLY GLY A . n 
A 1 472 ARG 472 472 472 ARG ARG A . n 
A 1 473 PHE 473 473 473 PHE PHE A . n 
A 1 474 LYS 474 474 474 LYS LYS A . n 
A 1 475 LYS 475 475 475 LYS LYS A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 GLU 477 477 477 GLU GLU A . n 
A 1 478 ILE 478 478 478 ILE ILE A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 THR 480 480 480 THR THR A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 SER 482 482 482 SER SER A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 THR 484 484 484 THR THR A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 GLU 486 486 486 GLU GLU A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 TYR 488 488 488 TYR TYR A . n 
A 1 489 TYR 489 489 489 TYR TYR A . n 
A 1 490 PHE 490 490 490 PHE PHE A . n 
A 1 491 ILE 491 491 491 ILE ILE A . n 
A 1 492 ILE 492 492 492 ILE ILE A . n 
A 1 493 TYR 493 493 493 TYR TYR A . n 
A 1 494 TYR 494 494 494 TYR TYR A . n 
A 1 495 LEU 495 495 495 LEU LEU A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 GLU 497 497 497 GLU GLU A . n 
A 1 498 LEU 498 498 498 LEU LEU A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 ARG 500 500 500 ARG ARG A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 GLU 502 502 502 GLU GLU A . n 
A 1 503 GLU 503 503 503 GLU GLU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 VAL 505 505 505 VAL VAL A . n 
A 1 506 THR 506 506 506 THR THR A . n 
A 1 507 VAL 507 507 507 VAL VAL A . n 
A 1 508 THR 508 508 508 THR THR A . n 
A 1 509 ARG 509 509 509 ARG ARG A . n 
A 1 510 GLU 510 510 510 GLU GLU A . n 
A 1 511 GLU 511 511 511 GLU GLU A . n 
A 1 512 PHE 512 512 512 PHE PHE A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ALA 515 515 515 ALA ALA A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 GLU 518 518 518 GLU GLU A . n 
A 1 519 LEU 519 519 519 LEU LEU A . n 
A 1 520 ASN 520 520 520 ASN ASN A . n 
A 1 521 PRO 521 521 521 PRO PRO A . n 
A 1 522 TYR 522 522 522 TYR TYR A . n 
A 1 523 VAL 523 523 523 VAL VAL A . n 
A 1 524 ASN 524 524 524 ASN ASN A . n 
A 1 525 GLY 525 525 525 GLY GLY A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 ALA 527 527 527 ALA ALA A . n 
A 1 528 ARG 528 528 528 ARG ARG A . n 
A 1 529 GLN 529 529 529 GLN GLN A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 ILE 531 531 531 ILE ILE A . n 
A 1 532 VAL 532 532 532 VAL VAL A . n 
A 1 533 PHE 533 533 533 PHE PHE A . n 
A 1 534 GLU 534 534 534 GLU GLU A . n 
A 1 535 TYR 535 535 535 TYR TYR A . n 
A 1 536 THR 536 536 536 THR THR A . n 
A 1 537 ASP 537 537 537 ASP ASP A . n 
A 1 538 TRP 538 538 538 TRP TRP A . n 
A 1 539 THR 539 539 539 THR THR A . n 
A 1 540 GLU 540 540 540 GLU GLU A . n 
A 1 541 PRO 541 541 541 PRO PRO A . n 
A 1 542 ASP 542 542 542 ASP ASP A . n 
A 1 543 ASN 543 543 543 ASN ASN A . n 
A 1 544 PRO 544 544 544 PRO PRO A . n 
A 1 545 ASN 545 545 545 ASN ASN A . n 
A 1 546 SER 546 546 546 SER SER A . n 
A 1 547 ASN 547 547 547 ASN ASN A . n 
A 1 548 ARG 548 548 548 ARG ARG A . n 
A 1 549 ASP 549 549 549 ASP ASP A . n 
A 1 550 ALA 550 550 550 ALA ALA A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 ASP 552 552 552 ASP ASP A . n 
A 1 553 LYS 553 553 553 LYS LYS A . n 
A 1 554 MET 554 554 554 MET MET A . n 
A 1 555 VAL 555 555 555 VAL VAL A . n 
A 1 556 GLY 556 556 556 GLY GLY A . n 
A 1 557 ASP 557 557 557 ASP ASP A . n 
A 1 558 TYR 558 558 558 TYR TYR A . n 
A 1 559 HIS 559 559 559 HIS HIS A . n 
A 1 560 PHE 560 560 560 PHE PHE A . n 
A 1 561 THR 561 561 561 THR THR A . n 
A 1 562 CYS 562 562 562 CYS CYS A . n 
A 1 563 ASN 563 563 563 ASN ASN A . n 
A 1 564 VAL 564 564 564 VAL VAL A . n 
A 1 565 ASN 565 565 565 ASN ASN A . n 
A 1 566 GLU 566 566 566 GLU GLU A . n 
A 1 567 PHE 567 567 567 PHE PHE A . n 
A 1 568 ALA 568 568 568 ALA ALA A . n 
A 1 569 GLN 569 569 569 GLN GLN A . n 
A 1 570 ARG 570 570 570 ARG ARG A . n 
A 1 571 TYR 571 571 571 TYR TYR A . n 
A 1 572 ALA 572 572 572 ALA ALA A . n 
A 1 573 GLU 573 573 573 GLU GLU A . n 
A 1 574 GLU 574 574 574 GLU GLU A . n 
A 1 575 GLY 575 575 575 GLY GLY A . n 
A 1 576 ASN 576 576 576 ASN ASN A . n 
A 1 577 ASN 577 577 577 ASN ASN A . n 
A 1 578 VAL 578 578 578 VAL VAL A . n 
A 1 579 TYR 579 579 579 TYR TYR A . n 
A 1 580 MET 580 580 580 MET MET A . n 
A 1 581 TYR 581 581 581 TYR TYR A . n 
A 1 582 LEU 582 582 582 LEU LEU A . n 
A 1 583 TYR 583 583 583 TYR TYR A . n 
A 1 584 THR 584 584 584 THR THR A . n 
A 1 585 HIS 585 585 585 HIS HIS A . n 
A 1 586 ARG 586 586 586 ARG ARG A . n 
A 1 587 SER 587 587 587 SER SER A . n 
A 1 588 LYS 588 588 588 LYS LYS A . n 
A 1 589 GLY 589 589 589 GLY GLY A . n 
A 1 590 ASN 590 590 590 ASN ASN A . n 
A 1 591 PRO 591 591 591 PRO PRO A . n 
A 1 592 TRP 592 592 592 TRP TRP A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 ARG 594 594 594 ARG ARG A . n 
A 1 595 TRP 595 595 595 TRP TRP A . n 
A 1 596 THR 596 596 596 THR THR A . n 
A 1 597 GLY 597 597 597 GLY GLY A . n 
A 1 598 VAL 598 598 598 VAL VAL A . n 
A 1 599 MET 599 599 599 MET MET A . n 
A 1 600 HIS 600 600 600 HIS HIS A . n 
A 1 601 GLY 601 601 601 GLY GLY A . n 
A 1 602 ASP 602 602 602 ASP ASP A . n 
A 1 603 GLU 603 603 603 GLU GLU A . n 
A 1 604 ILE 604 604 604 ILE ILE A . n 
A 1 605 ASN 605 605 605 ASN ASN A . n 
A 1 606 TYR 606 606 606 TYR TYR A . n 
A 1 607 VAL 607 607 607 VAL VAL A . n 
A 1 608 PHE 608 608 608 PHE PHE A . n 
A 1 609 GLY 609 609 609 GLY GLY A . n 
A 1 610 GLU 610 610 610 GLU GLU A . n 
A 1 611 PRO 611 611 611 PRO PRO A . n 
A 1 612 LEU 612 612 612 LEU LEU A . n 
A 1 613 ASN 613 613 613 ASN ASN A . n 
A 1 614 PRO 614 614 614 PRO PRO A . n 
A 1 615 THR 615 615 615 THR THR A . n 
A 1 616 LEU 616 616 616 LEU LEU A . n 
A 1 617 GLY 617 617 617 GLY GLY A . n 
A 1 618 TYR 618 618 618 TYR TYR A . n 
A 1 619 THR 619 619 619 THR THR A . n 
A 1 620 GLU 620 620 620 GLU GLU A . n 
A 1 621 ASP 621 621 621 ASP ASP A . n 
A 1 622 GLU 622 622 622 GLU GLU A . n 
A 1 623 LYS 623 623 623 LYS LYS A . n 
A 1 624 ASP 624 624 624 ASP ASP A . n 
A 1 625 PHE 625 625 625 PHE PHE A . n 
A 1 626 SER 626 626 626 SER SER A . n 
A 1 627 ARG 627 627 627 ARG ARG A . n 
A 1 628 LYS 628 628 628 LYS LYS A . n 
A 1 629 ILE 629 629 629 ILE ILE A . n 
A 1 630 MET 630 630 630 MET MET A . n 
A 1 631 ARG 631 631 631 ARG ARG A . n 
A 1 632 TYR 632 632 632 TYR TYR A . n 
A 1 633 TRP 633 633 633 TRP TRP A . n 
A 1 634 SER 634 634 634 SER SER A . n 
A 1 635 ASN 635 635 635 ASN ASN A . n 
A 1 636 PHE 636 636 636 PHE PHE A . n 
A 1 637 ALA 637 637 637 ALA ALA A . n 
A 1 638 LYS 638 638 638 LYS LYS A . n 
A 1 639 THR 639 639 639 THR THR A . n 
A 1 640 GLY 640 640 640 GLY GLY A . n 
A 1 641 ASN 641 641 641 ASN ASN A . n 
A 1 642 PRO 642 642 642 PRO PRO A . n 
A 1 643 ASN 643 643 643 ASN ASN A . n 
A 1 644 PRO 644 644 644 PRO PRO A . n 
A 1 645 ASN 645 645 645 ASN ASN A . n 
A 1 646 THR 646 646 646 THR THR A . n 
A 1 647 ALA 647 647 647 ALA ALA A . n 
A 1 648 SER 648 648 648 SER SER A . n 
A 1 649 SER 649 649 649 SER SER A . n 
A 1 650 GLU 650 650 650 GLU GLU A . n 
A 1 651 PHE 651 651 651 PHE PHE A . n 
A 1 652 PRO 652 652 652 PRO PRO A . n 
A 1 653 GLU 653 653 653 GLU GLU A . n 
A 1 654 TRP 654 654 654 TRP TRP A . n 
A 1 655 PRO 655 655 655 PRO PRO A . n 
A 1 656 LYS 656 656 656 LYS LYS A . n 
A 1 657 HIS 657 657 657 HIS HIS A . n 
A 1 658 THR 658 658 658 THR THR A . n 
A 1 659 ALA 659 659 659 ALA ALA A . n 
A 1 660 HIS 660 660 660 HIS HIS A . n 
A 1 661 GLY 661 661 661 GLY GLY A . n 
A 1 662 ARG 662 662 662 ARG ARG A . n 
A 1 663 HIS 663 663 663 HIS HIS A . n 
A 1 664 TYR 664 664 664 TYR TYR A . n 
A 1 665 LEU 665 665 665 LEU LEU A . n 
A 1 666 GLU 666 666 666 GLU GLU A . n 
A 1 667 LEU 667 667 667 LEU LEU A . n 
A 1 668 GLY 668 668 668 GLY GLY A . n 
A 1 669 LEU 669 669 669 LEU LEU A . n 
A 1 670 ASN 670 670 670 ASN ASN A . n 
A 1 671 THR 671 671 671 THR THR A . n 
A 1 672 SER 672 672 672 SER SER A . n 
A 1 673 PHE 673 673 673 PHE PHE A . n 
A 1 674 VAL 674 674 674 VAL VAL A . n 
A 1 675 GLY 675 675 675 GLY GLY A . n 
A 1 676 ARG 676 676 676 ARG ARG A . n 
A 1 677 GLY 677 677 677 GLY GLY A . n 
A 1 678 PRO 678 678 678 PRO PRO A . n 
A 1 679 ARG 679 679 679 ARG ARG A . n 
A 1 680 LEU 680 680 680 LEU LEU A . n 
A 1 681 ARG 681 681 681 ARG ARG A . n 
A 1 682 GLN 682 682 682 GLN GLN A . n 
A 1 683 CYS 683 683 683 CYS CYS A . n 
A 1 684 ALA 684 684 684 ALA ALA A . n 
A 1 685 PHE 685 685 685 PHE PHE A . n 
A 1 686 TRP 686 686 686 TRP TRP A . n 
A 1 687 LYS 687 687 687 LYS LYS A . n 
A 1 688 LYS 688 688 688 LYS LYS A . n 
A 1 689 TYR 689 689 689 TYR TYR A . n 
A 1 690 LEU 690 690 690 LEU LEU A . n 
A 1 691 PRO 691 691 691 PRO PRO A . n 
A 1 692 GLN 692 692 692 GLN GLN A . n 
A 1 693 LEU 693 693 693 LEU LEU A . n 
A 1 694 VAL 694 694 694 VAL VAL A . n 
A 1 695 ALA 695 695 695 ALA ALA A . n 
A 1 696 ALA 696 696 696 ALA ALA A . n 
A 1 697 THR 697 697 697 THR THR A . n 
A 1 698 SER 698 698 698 SER SER A . n 
A 1 699 ASN 699 699 699 ASN ASN A . n 
A 1 700 LEU 700 700 ?   ?   ?   A . n 
A 1 701 PRO 701 701 ?   ?   ?   A . n 
A 1 702 GLY 702 702 ?   ?   ?   A . n 
A 1 703 PRO 703 703 ?   ?   ?   A . n 
A 1 704 ALA 704 704 ?   ?   ?   A . n 
A 1 705 PRO 705 705 ?   ?   ?   A . n 
A 1 706 PRO 706 706 ?   ?   ?   A . n 
A 1 707 SER 707 707 ?   ?   ?   A . n 
A 1 708 GLU 708 708 ?   ?   ?   A . n 
A 1 709 PRO 709 709 ?   ?   ?   A . n 
A 1 710 CYS 710 710 ?   ?   ?   A . n 
A 1 711 GLU 711 711 ?   ?   ?   A . n 
A 1 712 SER 712 712 ?   ?   ?   A . n 
A 1 713 SER 713 713 ?   ?   ?   A . n 
A 1 714 ALA 714 714 ?   ?   ?   A . n 
A 1 715 PHE 715 715 ?   ?   ?   A . n 
A 1 716 PHE 716 716 ?   ?   ?   A . n 
A 1 717 TYR 717 717 ?   ?   ?   A . n 
A 1 718 ARG 718 718 ?   ?   ?   A . n 
A 1 719 PRO 719 719 ?   ?   ?   A . n 
A 1 720 ASP 720 720 ?   ?   ?   A . n 
A 1 721 LEU 721 721 ?   ?   ?   A . n 
A 1 722 ILE 722 722 ?   ?   ?   A . n 
A 1 723 VAL 723 723 ?   ?   ?   A . n 
A 1 724 LEU 724 724 ?   ?   ?   A . n 
A 1 725 LEU 725 725 ?   ?   ?   A . n 
A 1 726 VAL 726 726 ?   ?   ?   A . n 
A 1 727 SER 727 727 ?   ?   ?   A . n 
A 1 728 LEU 728 728 ?   ?   ?   A . n 
A 1 729 LEU 729 729 ?   ?   ?   A . n 
A 1 730 THR 730 730 ?   ?   ?   A . n 
A 1 731 ALA 731 731 ?   ?   ?   A . n 
A 1 732 THR 732 732 ?   ?   ?   A . n 
A 1 733 VAL 733 733 ?   ?   ?   A . n 
A 1 734 ARG 734 734 ?   ?   ?   A . n 
A 1 735 PHE 735 735 ?   ?   ?   A . n 
A 1 736 ILE 736 736 ?   ?   ?   A . n 
A 1 737 GLN 737 737 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   GLU 2   2   ?   ?   ?   B . n 
B 1 3   ILE 3   3   ?   ?   ?   B . n 
B 1 4   ARG 4   4   ?   ?   ?   B . n 
B 1 5   GLY 5   5   ?   ?   ?   B . n 
B 1 6   LEU 6   6   ?   ?   ?   B . n 
B 1 7   LEU 7   7   ?   ?   ?   B . n 
B 1 8   MET 8   8   ?   ?   ?   B . n 
B 1 9   GLY 9   9   ?   ?   ?   B . n 
B 1 10  ARG 10  10  ?   ?   ?   B . n 
B 1 11  LEU 11  11  ?   ?   ?   B . n 
B 1 12  ARG 12  12  ?   ?   ?   B . n 
B 1 13  LEU 13  13  ?   ?   ?   B . n 
B 1 14  GLY 14  14  ?   ?   ?   B . n 
B 1 15  ARG 15  15  ?   ?   ?   B . n 
B 1 16  ARG 16  16  ?   ?   ?   B . n 
B 1 17  MET 17  17  ?   ?   ?   B . n 
B 1 18  VAL 18  18  ?   ?   ?   B . n 
B 1 19  PRO 19  19  ?   ?   ?   B . n 
B 1 20  LEU 20  20  ?   ?   ?   B . n 
B 1 21  GLY 21  21  ?   ?   ?   B . n 
B 1 22  LEU 22  22  ?   ?   ?   B . n 
B 1 23  LEU 23  23  ?   ?   ?   B . n 
B 1 24  GLY 24  24  ?   ?   ?   B . n 
B 1 25  VAL 25  25  ?   ?   ?   B . n 
B 1 26  THR 26  26  ?   ?   ?   B . n 
B 1 27  ALA 27  27  ?   ?   ?   B . n 
B 1 28  LEU 28  28  ?   ?   ?   B . n 
B 1 29  LEU 29  29  ?   ?   ?   B . n 
B 1 30  LEU 30  30  ?   ?   ?   B . n 
B 1 31  ILE 31  31  ?   ?   ?   B . n 
B 1 32  LEU 32  32  ?   ?   ?   B . n 
B 1 33  PRO 33  33  ?   ?   ?   B . n 
B 1 34  PRO 34  34  ?   ?   ?   B . n 
B 1 35  PHE 35  35  ?   ?   ?   B . n 
B 1 36  ALA 36  36  ?   ?   ?   B . n 
B 1 37  LEU 37  37  ?   ?   ?   B . n 
B 1 38  VAL 38  38  ?   ?   ?   B . n 
B 1 39  GLN 39  39  ?   ?   ?   B . n 
B 1 40  GLY 40  40  ?   ?   ?   B . n 
B 1 41  ARG 41  41  ?   ?   ?   B . n 
B 1 42  HIS 42  42  ?   ?   ?   B . n 
B 1 43  HIS 43  43  ?   ?   ?   B . n 
B 1 44  GLU 44  44  ?   ?   ?   B . n 
B 1 45  LEU 45  45  ?   ?   ?   B . n 
B 1 46  ASN 46  46  ?   ?   ?   B . n 
B 1 47  ASN 47  47  ?   ?   ?   B . n 
B 1 48  GLY 48  48  ?   ?   ?   B . n 
B 1 49  ALA 49  49  ?   ?   ?   B . n 
B 1 50  ALA 50  50  ?   ?   ?   B . n 
B 1 51  ILE 51  51  ?   ?   ?   B . n 
B 1 52  GLY 52  52  ?   ?   ?   B . n 
B 1 53  SER 53  53  ?   ?   ?   B . n 
B 1 54  HIS 54  54  ?   ?   ?   B . n 
B 1 55  GLN 55  55  ?   ?   ?   B . n 
B 1 56  LEU 56  56  ?   ?   ?   B . n 
B 1 57  SER 57  57  ?   ?   ?   B . n 
B 1 58  ALA 58  58  ?   ?   ?   B . n 
B 1 59  ALA 59  59  ?   ?   ?   B . n 
B 1 60  ALA 60  60  ?   ?   ?   B . n 
B 1 61  GLY 61  61  ?   ?   ?   B . n 
B 1 62  VAL 62  62  ?   ?   ?   B . n 
B 1 63  GLY 63  63  ?   ?   ?   B . n 
B 1 64  LEU 64  64  ?   ?   ?   B . n 
B 1 65  ALA 65  65  ?   ?   ?   B . n 
B 1 66  SER 66  66  ?   ?   ?   B . n 
B 1 67  GLN 67  67  ?   ?   ?   B . n 
B 1 68  SER 68  68  ?   ?   ?   B . n 
B 1 69  ALA 69  69  ?   ?   ?   B . n 
B 1 70  GLN 70  70  ?   ?   ?   B . n 
B 1 71  SER 71  71  ?   ?   ?   B . n 
B 1 72  GLY 72  72  ?   ?   ?   B . n 
B 1 73  SER 73  73  ?   ?   ?   B . n 
B 1 74  LEU 74  74  ?   ?   ?   B . n 
B 1 75  ALA 75  75  ?   ?   ?   B . n 
B 1 76  SER 76  76  ?   ?   ?   B . n 
B 1 77  GLY 77  77  ?   ?   ?   B . n 
B 1 78  VAL 78  78  ?   ?   ?   B . n 
B 1 79  MET 79  79  ?   ?   ?   B . n 
B 1 80  SER 80  80  ?   ?   ?   B . n 
B 1 81  SER 81  81  ?   ?   ?   B . n 
B 1 82  VAL 82  82  ?   ?   ?   B . n 
B 1 83  PRO 83  83  ?   ?   ?   B . n 
B 1 84  ALA 84  84  ?   ?   ?   B . n 
B 1 85  ALA 85  85  ?   ?   ?   B . n 
B 1 86  GLY 86  86  ?   ?   ?   B . n 
B 1 87  ALA 87  87  ?   ?   ?   B . n 
B 1 88  SER 88  88  ?   ?   ?   B . n 
B 1 89  SER 89  89  ?   ?   ?   B . n 
B 1 90  SER 90  90  ?   ?   ?   B . n 
B 1 91  SER 91  91  ?   ?   ?   B . n 
B 1 92  SER 92  92  ?   ?   ?   B . n 
B 1 93  SER 93  93  ?   ?   ?   B . n 
B 1 94  SER 94  94  ?   ?   ?   B . n 
B 1 95  LEU 95  95  ?   ?   ?   B . n 
B 1 96  LEU 96  96  ?   ?   ?   B . n 
B 1 97  SER 97  97  ?   ?   ?   B . n 
B 1 98  SER 98  98  ?   ?   ?   B . n 
B 1 99  SER 99  99  ?   ?   ?   B . n 
B 1 100 ALA 100 100 ?   ?   ?   B . n 
B 1 101 GLU 101 101 ?   ?   ?   B . n 
B 1 102 ASP 102 102 ?   ?   ?   B . n 
B 1 103 ASP 103 103 ?   ?   ?   B . n 
B 1 104 VAL 104 104 ?   ?   ?   B . n 
B 1 105 ALA 105 105 ?   ?   ?   B . n 
B 1 106 ARG 106 106 ?   ?   ?   B . n 
B 1 107 ILE 107 107 ?   ?   ?   B . n 
B 1 108 THR 108 108 ?   ?   ?   B . n 
B 1 109 LEU 109 109 ?   ?   ?   B . n 
B 1 110 SER 110 110 ?   ?   ?   B . n 
B 1 111 LYS 111 111 ?   ?   ?   B . n 
B 1 112 ASP 112 112 ?   ?   ?   B . n 
B 1 113 ALA 113 113 ?   ?   ?   B . n 
B 1 114 ASP 114 114 ?   ?   ?   B . n 
B 1 115 ALA 115 115 ?   ?   ?   B . n 
B 1 116 PHE 116 116 ?   ?   ?   B . n 
B 1 117 PHE 117 117 ?   ?   ?   B . n 
B 1 118 THR 118 118 ?   ?   ?   B . n 
B 1 119 PRO 119 119 ?   ?   ?   B . n 
B 1 120 TYR 120 120 ?   ?   ?   B . n 
B 1 121 ILE 121 121 ?   ?   ?   B . n 
B 1 122 GLY 122 122 ?   ?   ?   B . n 
B 1 123 HIS 123 123 ?   ?   ?   B . n 
B 1 124 GLY 124 124 ?   ?   ?   B . n 
B 1 125 GLU 125 125 ?   ?   ?   B . n 
B 1 126 SER 126 126 ?   ?   ?   B . n 
B 1 127 VAL 127 127 ?   ?   ?   B . n 
B 1 128 ARG 128 128 ?   ?   ?   B . n 
B 1 129 ILE 129 129 ?   ?   ?   B . n 
B 1 130 ILE 130 130 ?   ?   ?   B . n 
B 1 131 ASP 131 131 ?   ?   ?   B . n 
B 1 132 ALA 132 132 ?   ?   ?   B . n 
B 1 133 GLU 133 133 ?   ?   ?   B . n 
B 1 134 LEU 134 134 ?   ?   ?   B . n 
B 1 135 GLY 135 135 ?   ?   ?   B . n 
B 1 136 THR 136 136 ?   ?   ?   B . n 
B 1 137 LEU 137 137 ?   ?   ?   B . n 
B 1 138 GLU 138 138 ?   ?   ?   B . n 
B 1 139 HIS 139 139 ?   ?   ?   B . n 
B 1 140 VAL 140 140 ?   ?   ?   B . n 
B 1 141 HIS 141 141 ?   ?   ?   B . n 
B 1 142 SER 142 142 ?   ?   ?   B . n 
B 1 143 GLY 143 143 ?   ?   ?   B . n 
B 1 144 ALA 144 144 ?   ?   ?   B . n 
B 1 145 THR 145 145 ?   ?   ?   B . n 
B 1 146 PRO 146 146 ?   ?   ?   B . n 
B 1 147 ARG 147 147 ?   ?   ?   B . n 
B 1 148 ARG 148 148 ?   ?   ?   B . n 
B 1 149 ARG 149 149 ?   ?   ?   B . n 
B 1 150 GLY 150 150 ?   ?   ?   B . n 
B 1 151 LEU 151 151 ?   ?   ?   B . n 
B 1 152 THR 152 152 ?   ?   ?   B . n 
B 1 153 ARG 153 153 ?   ?   ?   B . n 
B 1 154 ARG 154 154 ?   ?   ?   B . n 
B 1 155 GLU 155 155 ?   ?   ?   B . n 
B 1 156 SER 156 156 ?   ?   ?   B . n 
B 1 157 ASN 157 157 ?   ?   ?   B . n 
B 1 158 SER 158 158 ?   ?   ?   B . n 
B 1 159 ASP 159 159 ?   ?   ?   B . n 
B 1 160 ALA 160 160 ?   ?   ?   B . n 
B 1 161 ASN 161 161 ?   ?   ?   B . n 
B 1 162 ASP 162 162 162 ASP ASP B . n 
B 1 163 ASN 163 163 163 ASN ASN B . n 
B 1 164 ASP 164 164 164 ASP ASP B . n 
B 1 165 PRO 165 165 165 PRO PRO B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 VAL 167 167 167 VAL VAL B . n 
B 1 168 VAL 168 168 168 VAL VAL B . n 
B 1 169 ASN 169 169 169 ASN ASN B . n 
B 1 170 THR 170 170 170 THR THR B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 LYS 172 172 172 LYS LYS B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 ARG 176 176 176 ARG ARG B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 ILE 178 178 178 ILE ILE B . n 
B 1 179 THR 179 179 179 THR THR B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 ALA 182 182 182 ALA ALA B . n 
B 1 183 PRO 183 183 183 PRO PRO B . n 
B 1 184 SER 184 184 184 SER SER B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 LYS 187 187 187 LYS LYS B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 ASP 189 189 189 ASP ASP B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 TRP 191 191 191 TRP TRP B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 ILE 194 194 194 ILE ILE B . n 
B 1 195 PRO 195 195 195 PRO PRO B . n 
B 1 196 TYR 196 196 196 TYR TYR B . n 
B 1 197 ALA 197 197 197 ALA ALA B . n 
B 1 198 GLN 198 198 198 GLN GLN B . n 
B 1 199 PRO 199 199 199 PRO PRO B . n 
B 1 200 PRO 200 200 200 PRO PRO B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 PRO 203 203 203 PRO PRO B . n 
B 1 204 LEU 204 204 204 LEU LEU B . n 
B 1 205 ARG 205 205 205 ARG ARG B . n 
B 1 206 PHE 206 206 206 PHE PHE B . n 
B 1 207 ARG 207 207 207 ARG ARG B . n 
B 1 208 HIS 208 208 208 HIS HIS B . n 
B 1 209 PRO 209 209 209 PRO PRO B . n 
B 1 210 ARG 210 210 210 ARG ARG B . n 
B 1 211 PRO 211 211 211 PRO PRO B . n 
B 1 212 ALA 212 212 212 ALA ALA B . n 
B 1 213 GLU 213 213 213 GLU GLU B . n 
B 1 214 LYS 214 214 214 LYS LYS B . n 
B 1 215 TRP 215 215 215 TRP TRP B . n 
B 1 216 THR 216 216 216 THR THR B . n 
B 1 217 GLY 217 217 217 GLY GLY B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 ASN 220 220 220 ASN ASN B . n 
B 1 221 THR 221 221 221 THR THR B . n 
B 1 222 THR 222 222 222 THR THR B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 PRO 224 224 224 PRO PRO B . n 
B 1 225 PRO 225 225 225 PRO PRO B . n 
B 1 226 ASN 226 226 226 ASN ASN B . n 
B 1 227 SER 227 227 227 SER SER B . n 
B 1 228 CYS 228 228 228 CYS CYS B . n 
B 1 229 VAL 229 229 229 VAL VAL B . n 
B 1 230 GLN 230 230 230 GLN GLN B . n 
B 1 231 ILE 231 231 231 ILE ILE B . n 
B 1 232 VAL 232 232 232 VAL VAL B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 VAL 235 235 235 VAL VAL B . n 
B 1 236 PHE 236 236 236 PHE PHE B . n 
B 1 237 GLY 237 237 237 GLY GLY B . n 
B 1 238 ASP 238 238 238 ASP ASP B . n 
B 1 239 PHE 239 239 239 PHE PHE B . n 
B 1 240 PRO 240 240 240 PRO PRO B . n 
B 1 241 GLY 241 241 241 GLY GLY B . n 
B 1 242 ALA 242 242 242 ALA ALA B . n 
B 1 243 THR 243 243 243 THR THR B . n 
B 1 244 MET 244 244 244 MET MET B . n 
B 1 245 TRP 245 245 245 TRP TRP B . n 
B 1 246 ASN 246 246 246 ASN ASN B . n 
B 1 247 PRO 247 247 247 PRO PRO B . n 
B 1 248 ASN 248 248 248 ASN ASN B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 PRO 250 250 250 PRO PRO B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 SER 252 252 252 SER SER B . n 
B 1 253 GLU 253 253 253 GLU GLU B . n 
B 1 254 ASP 254 254 254 ASP ASP B . n 
B 1 255 CYS 255 255 255 CYS CYS B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 TYR 257 257 257 TYR TYR B . n 
B 1 258 ILE 258 258 258 ILE ILE B . n 
B 1 259 ASN 259 259 259 ASN ASN B . n 
B 1 260 VAL 260 260 260 VAL VAL B . n 
B 1 261 VAL 261 261 261 VAL VAL B . n 
B 1 262 ALA 262 262 262 ALA ALA B . n 
B 1 263 PRO 263 263 263 PRO PRO B . n 
B 1 264 ARG 264 264 264 ARG ARG B . n 
B 1 265 PRO 265 265 265 PRO PRO B . n 
B 1 266 ARG 266 266 266 ARG ARG B . n 
B 1 267 PRO 267 267 267 PRO PRO B . n 
B 1 268 LYS 268 268 268 LYS LYS B . n 
B 1 269 ASN 269 269 269 ASN ASN B . n 
B 1 270 ALA 270 270 270 ALA ALA B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 VAL 272 272 272 VAL VAL B . n 
B 1 273 MET 273 273 273 MET MET B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 TRP 275 275 275 TRP TRP B . n 
B 1 276 ILE 276 276 276 ILE ILE B . n 
B 1 277 PHE 277 277 277 PHE PHE B . n 
B 1 278 GLY 278 278 278 GLY GLY B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 GLY 280 280 280 GLY GLY B . n 
B 1 281 PHE 281 281 281 PHE PHE B . n 
B 1 282 TYR 282 282 282 TYR TYR B . n 
B 1 283 SER 283 283 283 SER SER B . n 
B 1 284 GLY 284 284 284 GLY GLY B . n 
B 1 285 THR 285 285 285 THR THR B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 THR 287 287 287 THR THR B . n 
B 1 288 LEU 288 288 288 LEU LEU B . n 
B 1 289 ASP 289 289 289 ASP ASP B . n 
B 1 290 VAL 290 290 290 VAL VAL B . n 
B 1 291 TYR 291 291 291 TYR TYR B . n 
B 1 292 ASP 292 292 292 ASP ASP B . n 
B 1 293 HIS 293 293 293 HIS HIS B . n 
B 1 294 ARG 294 294 294 ARG ARG B . n 
B 1 295 ALA 295 295 295 ALA ALA B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 ALA 297 297 297 ALA ALA B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 GLU 299 299 299 GLU GLU B . n 
B 1 300 GLU 300 300 300 GLU GLU B . n 
B 1 301 ASN 301 301 301 ASN ASN B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 ILE 303 303 303 ILE ILE B . n 
B 1 304 VAL 304 304 304 VAL VAL B . n 
B 1 305 VAL 305 305 305 VAL VAL B . n 
B 1 306 SER 306 306 306 SER SER B . n 
B 1 307 LEU 307 307 307 LEU LEU B . n 
B 1 308 GLN 308 308 308 GLN GLN B . n 
B 1 309 TYR 309 309 309 TYR TYR B . n 
B 1 310 ARG 310 310 310 ARG ARG B . n 
B 1 311 VAL 311 311 311 VAL VAL B . n 
B 1 312 ALA 312 312 312 ALA ALA B . n 
B 1 313 SER 313 313 313 SER SER B . n 
B 1 314 LEU 314 314 314 LEU LEU B . n 
B 1 315 GLY 315 315 315 GLY GLY B . n 
B 1 316 PHE 316 316 316 PHE PHE B . n 
B 1 317 LEU 317 317 317 LEU LEU B . n 
B 1 318 PHE 318 318 318 PHE PHE B . n 
B 1 319 LEU 319 319 319 LEU LEU B . n 
B 1 320 GLY 320 320 320 GLY GLY B . n 
B 1 321 THR 321 321 321 THR THR B . n 
B 1 322 PRO 322 322 322 PRO PRO B . n 
B 1 323 GLU 323 323 323 GLU GLU B . n 
B 1 324 ALA 324 324 324 ALA ALA B . n 
B 1 325 PRO 325 325 325 PRO PRO B . n 
B 1 326 GLY 326 326 326 GLY GLY B . n 
B 1 327 ASN 327 327 327 ASN ASN B . n 
B 1 328 ALA 328 328 328 ALA ALA B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 PHE 331 331 331 PHE PHE B . n 
B 1 332 ASP 332 332 332 ASP ASP B . n 
B 1 333 GLN 333 333 333 GLN GLN B . n 
B 1 334 ASN 334 334 334 ASN ASN B . n 
B 1 335 LEU 335 335 335 LEU LEU B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 LEU 337 337 337 LEU LEU B . n 
B 1 338 ARG 338 338 338 ARG ARG B . n 
B 1 339 TRP 339 339 339 TRP TRP B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 ARG 341 341 341 ARG ARG B . n 
B 1 342 ASP 342 342 342 ASP ASP B . n 
B 1 343 ASN 343 343 343 ASN ASN B . n 
B 1 344 ILE 344 344 344 ILE ILE B . n 
B 1 345 HIS 345 345 345 HIS HIS B . n 
B 1 346 ARG 346 346 346 ARG ARG B . n 
B 1 347 PHE 347 347 347 PHE PHE B . n 
B 1 348 GLY 348 348 348 GLY GLY B . n 
B 1 349 GLY 349 349 349 GLY GLY B . n 
B 1 350 ASP 350 350 350 ASP ASP B . n 
B 1 351 PRO 351 351 351 PRO PRO B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 ARG 353 353 353 ARG ARG B . n 
B 1 354 VAL 354 354 354 VAL VAL B . n 
B 1 355 THR 355 355 355 THR THR B . n 
B 1 356 LEU 356 356 356 LEU LEU B . n 
B 1 357 PHE 357 357 357 PHE PHE B . n 
B 1 358 GLY 358 358 358 GLY GLY B . n 
B 1 359 GLU 359 359 359 GLU GLU B . n 
B 1 360 SEB 360 360 360 SEB SEB B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 ALA 363 363 363 ALA ALA B . n 
B 1 364 VAL 364 364 364 VAL VAL B . n 
B 1 365 SER 365 365 365 SER SER B . n 
B 1 366 VAL 366 366 366 VAL VAL B . n 
B 1 367 SER 367 367 367 SER SER B . n 
B 1 368 LEU 368 368 368 LEU LEU B . n 
B 1 369 HIS 369 369 369 HIS HIS B . n 
B 1 370 LEU 370 370 370 LEU LEU B . n 
B 1 371 LEU 371 371 371 LEU LEU B . n 
B 1 372 SER 372 372 372 SER SER B . n 
B 1 373 ALA 373 373 373 ALA ALA B . n 
B 1 374 LEU 374 374 374 LEU LEU B . n 
B 1 375 SER 375 375 375 SER SER B . n 
B 1 376 ARG 376 376 376 ARG ARG B . n 
B 1 377 ASP 377 377 377 ASP ASP B . n 
B 1 378 LEU 378 378 378 LEU LEU B . n 
B 1 379 PHE 379 379 379 PHE PHE B . n 
B 1 380 GLN 380 380 380 GLN GLN B . n 
B 1 381 ARG 381 381 381 ARG ARG B . n 
B 1 382 ALA 382 382 382 ALA ALA B . n 
B 1 383 ILE 383 383 383 ILE ILE B . n 
B 1 384 LEU 384 384 384 LEU LEU B . n 
B 1 385 GLN 385 385 385 GLN GLN B . n 
B 1 386 SER 386 386 386 SER SER B . n 
B 1 387 GLY 387 387 387 GLY GLY B . n 
B 1 388 SER 388 388 388 SER SER B . n 
B 1 389 PRO 389 389 389 PRO PRO B . n 
B 1 390 THR 390 390 390 THR THR B . n 
B 1 391 ALA 391 391 391 ALA ALA B . n 
B 1 392 PRO 392 392 392 PRO PRO B . n 
B 1 393 TRP 393 393 393 TRP TRP B . n 
B 1 394 ALA 394 394 394 ALA ALA B . n 
B 1 395 LEU 395 395 395 LEU LEU B . n 
B 1 396 VAL 396 396 396 VAL VAL B . n 
B 1 397 SER 397 397 397 SER SER B . n 
B 1 398 ARG 398 398 398 ARG ARG B . n 
B 1 399 GLU 399 399 399 GLU GLU B . n 
B 1 400 GLU 400 400 400 GLU GLU B . n 
B 1 401 ALA 401 401 401 ALA ALA B . n 
B 1 402 THR 402 402 402 THR THR B . n 
B 1 403 LEU 403 403 403 LEU LEU B . n 
B 1 404 ARG 404 404 404 ARG ARG B . n 
B 1 405 ALA 405 405 405 ALA ALA B . n 
B 1 406 LEU 406 406 406 LEU LEU B . n 
B 1 407 ARG 407 407 407 ARG ARG B . n 
B 1 408 LEU 408 408 408 LEU LEU B . n 
B 1 409 ALA 409 409 409 ALA ALA B . n 
B 1 410 GLU 410 410 410 GLU GLU B . n 
B 1 411 ALA 411 411 411 ALA ALA B . n 
B 1 412 VAL 412 412 412 VAL VAL B . n 
B 1 413 GLY 413 413 413 GLY GLY B . n 
B 1 414 CYS 414 414 414 CYS CYS B . n 
B 1 415 PRO 415 415 415 PRO PRO B . n 
B 1 416 HIS 416 416 416 HIS HIS B . n 
B 1 417 GLU 417 417 417 GLU GLU B . n 
B 1 418 PRO 418 418 418 PRO PRO B . n 
B 1 419 SER 419 419 419 SER SER B . n 
B 1 420 LYS 420 420 420 LYS LYS B . n 
B 1 421 LEU 421 421 421 LEU LEU B . n 
B 1 422 SER 422 422 422 SER SER B . n 
B 1 423 ASP 423 423 423 ASP ASP B . n 
B 1 424 ALA 424 424 424 ALA ALA B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 GLU 426 426 426 GLU GLU B . n 
B 1 427 CYS 427 427 427 CYS CYS B . n 
B 1 428 LEU 428 428 428 LEU LEU B . n 
B 1 429 ARG 429 429 429 ARG ARG B . n 
B 1 430 GLY 430 430 430 GLY GLY B . n 
B 1 431 LYS 431 431 431 LYS LYS B . n 
B 1 432 ASP 432 432 432 ASP ASP B . n 
B 1 433 PRO 433 433 433 PRO PRO B . n 
B 1 434 HIS 434 434 434 HIS HIS B . n 
B 1 435 VAL 435 435 435 VAL VAL B . n 
B 1 436 LEU 436 436 436 LEU LEU B . n 
B 1 437 VAL 437 437 437 VAL VAL B . n 
B 1 438 ASN 438 438 438 ASN ASN B . n 
B 1 439 ASN 439 439 439 ASN ASN B . n 
B 1 440 GLU 440 440 440 GLU GLU B . n 
B 1 441 TRP 441 441 441 TRP TRP B . n 
B 1 442 GLY 442 442 442 GLY GLY B . n 
B 1 443 THR 443 443 443 THR THR B . n 
B 1 444 LEU 444 444 444 LEU LEU B . n 
B 1 445 GLY 445 445 445 GLY GLY B . n 
B 1 446 ILE 446 446 446 ILE ILE B . n 
B 1 447 CYS 447 447 447 CYS CYS B . n 
B 1 448 GLU 448 448 448 GLU GLU B . n 
B 1 449 PHE 449 449 449 PHE PHE B . n 
B 1 450 PRO 450 450 450 PRO PRO B . n 
B 1 451 PHE 451 451 451 PHE PHE B . n 
B 1 452 VAL 452 452 452 VAL VAL B . n 
B 1 453 PRO 453 453 453 PRO PRO B . n 
B 1 454 VAL 454 454 454 VAL VAL B . n 
B 1 455 VAL 455 455 455 VAL VAL B . n 
B 1 456 ASP 456 456 456 ASP ASP B . n 
B 1 457 GLY 457 457 457 GLY GLY B . n 
B 1 458 ALA 458 458 458 ALA ALA B . n 
B 1 459 PHE 459 459 459 PHE PHE B . n 
B 1 460 LEU 460 460 460 LEU LEU B . n 
B 1 461 ASP 461 461 461 ASP ASP B . n 
B 1 462 GLU 462 462 462 GLU GLU B . n 
B 1 463 THR 463 463 463 THR THR B . n 
B 1 464 PRO 464 464 464 PRO PRO B . n 
B 1 465 GLN 465 465 465 GLN GLN B . n 
B 1 466 ARG 466 466 466 ARG ARG B . n 
B 1 467 SER 467 467 467 SER SER B . n 
B 1 468 LEU 468 468 468 LEU LEU B . n 
B 1 469 ALA 469 469 469 ALA ALA B . n 
B 1 470 SER 470 470 470 SER SER B . n 
B 1 471 GLY 471 471 471 GLY GLY B . n 
B 1 472 ARG 472 472 472 ARG ARG B . n 
B 1 473 PHE 473 473 473 PHE PHE B . n 
B 1 474 LYS 474 474 474 LYS LYS B . n 
B 1 475 LYS 475 475 475 LYS LYS B . n 
B 1 476 THR 476 476 476 THR THR B . n 
B 1 477 GLU 477 477 477 GLU GLU B . n 
B 1 478 ILE 478 478 478 ILE ILE B . n 
B 1 479 LEU 479 479 479 LEU LEU B . n 
B 1 480 THR 480 480 480 THR THR B . n 
B 1 481 GLY 481 481 481 GLY GLY B . n 
B 1 482 SER 482 482 482 SER SER B . n 
B 1 483 ASN 483 483 483 ASN ASN B . n 
B 1 484 THR 484 484 484 THR THR B . n 
B 1 485 GLU 485 485 485 GLU GLU B . n 
B 1 486 GLU 486 486 486 GLU GLU B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 TYR 488 488 488 TYR TYR B . n 
B 1 489 TYR 489 489 489 TYR TYR B . n 
B 1 490 PHE 490 490 490 PHE PHE B . n 
B 1 491 ILE 491 491 491 ILE ILE B . n 
B 1 492 ILE 492 492 492 ILE ILE B . n 
B 1 493 TYR 493 493 493 TYR TYR B . n 
B 1 494 TYR 494 494 494 TYR TYR B . n 
B 1 495 LEU 495 495 495 LEU LEU B . n 
B 1 496 THR 496 496 496 THR THR B . n 
B 1 497 GLU 497 497 497 GLU GLU B . n 
B 1 498 LEU 498 498 498 LEU LEU B . n 
B 1 499 LEU 499 499 499 LEU LEU B . n 
B 1 500 ARG 500 500 500 ARG ARG B . n 
B 1 501 LYS 501 501 501 LYS LYS B . n 
B 1 502 GLU 502 502 502 GLU GLU B . n 
B 1 503 GLU 503 503 503 GLU GLU B . n 
B 1 504 GLY 504 504 504 GLY GLY B . n 
B 1 505 VAL 505 505 505 VAL VAL B . n 
B 1 506 THR 506 506 506 THR THR B . n 
B 1 507 VAL 507 507 507 VAL VAL B . n 
B 1 508 THR 508 508 508 THR THR B . n 
B 1 509 ARG 509 509 509 ARG ARG B . n 
B 1 510 GLU 510 510 510 GLU GLU B . n 
B 1 511 GLU 511 511 511 GLU GLU B . n 
B 1 512 PHE 512 512 512 PHE PHE B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 GLN 514 514 514 GLN GLN B . n 
B 1 515 ALA 515 515 515 ALA ALA B . n 
B 1 516 VAL 516 516 516 VAL VAL B . n 
B 1 517 ARG 517 517 517 ARG ARG B . n 
B 1 518 GLU 518 518 518 GLU GLU B . n 
B 1 519 LEU 519 519 519 LEU LEU B . n 
B 1 520 ASN 520 520 520 ASN ASN B . n 
B 1 521 PRO 521 521 521 PRO PRO B . n 
B 1 522 TYR 522 522 522 TYR TYR B . n 
B 1 523 VAL 523 523 523 VAL VAL B . n 
B 1 524 ASN 524 524 524 ASN ASN B . n 
B 1 525 GLY 525 525 525 GLY GLY B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 ALA 527 527 527 ALA ALA B . n 
B 1 528 ARG 528 528 528 ARG ARG B . n 
B 1 529 GLN 529 529 529 GLN GLN B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 ILE 531 531 531 ILE ILE B . n 
B 1 532 VAL 532 532 532 VAL VAL B . n 
B 1 533 PHE 533 533 533 PHE PHE B . n 
B 1 534 GLU 534 534 534 GLU GLU B . n 
B 1 535 TYR 535 535 535 TYR TYR B . n 
B 1 536 THR 536 536 536 THR THR B . n 
B 1 537 ASP 537 537 537 ASP ASP B . n 
B 1 538 TRP 538 538 538 TRP TRP B . n 
B 1 539 THR 539 539 539 THR THR B . n 
B 1 540 GLU 540 540 540 GLU GLU B . n 
B 1 541 PRO 541 541 541 PRO PRO B . n 
B 1 542 ASP 542 542 542 ASP ASP B . n 
B 1 543 ASN 543 543 543 ASN ASN B . n 
B 1 544 PRO 544 544 544 PRO PRO B . n 
B 1 545 ASN 545 545 545 ASN ASN B . n 
B 1 546 SER 546 546 546 SER SER B . n 
B 1 547 ASN 547 547 547 ASN ASN B . n 
B 1 548 ARG 548 548 548 ARG ARG B . n 
B 1 549 ASP 549 549 549 ASP ASP B . n 
B 1 550 ALA 550 550 550 ALA ALA B . n 
B 1 551 LEU 551 551 551 LEU LEU B . n 
B 1 552 ASP 552 552 552 ASP ASP B . n 
B 1 553 LYS 553 553 553 LYS LYS B . n 
B 1 554 MET 554 554 554 MET MET B . n 
B 1 555 VAL 555 555 555 VAL VAL B . n 
B 1 556 GLY 556 556 556 GLY GLY B . n 
B 1 557 ASP 557 557 557 ASP ASP B . n 
B 1 558 TYR 558 558 558 TYR TYR B . n 
B 1 559 HIS 559 559 559 HIS HIS B . n 
B 1 560 PHE 560 560 560 PHE PHE B . n 
B 1 561 THR 561 561 561 THR THR B . n 
B 1 562 CYS 562 562 562 CYS CYS B . n 
B 1 563 ASN 563 563 563 ASN ASN B . n 
B 1 564 VAL 564 564 564 VAL VAL B . n 
B 1 565 ASN 565 565 565 ASN ASN B . n 
B 1 566 GLU 566 566 566 GLU GLU B . n 
B 1 567 PHE 567 567 567 PHE PHE B . n 
B 1 568 ALA 568 568 568 ALA ALA B . n 
B 1 569 GLN 569 569 569 GLN GLN B . n 
B 1 570 ARG 570 570 570 ARG ARG B . n 
B 1 571 TYR 571 571 571 TYR TYR B . n 
B 1 572 ALA 572 572 572 ALA ALA B . n 
B 1 573 GLU 573 573 573 GLU GLU B . n 
B 1 574 GLU 574 574 574 GLU GLU B . n 
B 1 575 GLY 575 575 575 GLY GLY B . n 
B 1 576 ASN 576 576 576 ASN ASN B . n 
B 1 577 ASN 577 577 577 ASN ASN B . n 
B 1 578 VAL 578 578 578 VAL VAL B . n 
B 1 579 TYR 579 579 579 TYR TYR B . n 
B 1 580 MET 580 580 580 MET MET B . n 
B 1 581 TYR 581 581 581 TYR TYR B . n 
B 1 582 LEU 582 582 582 LEU LEU B . n 
B 1 583 TYR 583 583 583 TYR TYR B . n 
B 1 584 THR 584 584 584 THR THR B . n 
B 1 585 HIS 585 585 585 HIS HIS B . n 
B 1 586 ARG 586 586 586 ARG ARG B . n 
B 1 587 SER 587 587 587 SER SER B . n 
B 1 588 LYS 588 588 588 LYS LYS B . n 
B 1 589 GLY 589 589 589 GLY GLY B . n 
B 1 590 ASN 590 590 590 ASN ASN B . n 
B 1 591 PRO 591 591 591 PRO PRO B . n 
B 1 592 TRP 592 592 592 TRP TRP B . n 
B 1 593 PRO 593 593 593 PRO PRO B . n 
B 1 594 ARG 594 594 594 ARG ARG B . n 
B 1 595 TRP 595 595 595 TRP TRP B . n 
B 1 596 THR 596 596 596 THR THR B . n 
B 1 597 GLY 597 597 597 GLY GLY B . n 
B 1 598 VAL 598 598 598 VAL VAL B . n 
B 1 599 MET 599 599 599 MET MET B . n 
B 1 600 HIS 600 600 600 HIS HIS B . n 
B 1 601 GLY 601 601 601 GLY GLY B . n 
B 1 602 ASP 602 602 602 ASP ASP B . n 
B 1 603 GLU 603 603 603 GLU GLU B . n 
B 1 604 ILE 604 604 604 ILE ILE B . n 
B 1 605 ASN 605 605 605 ASN ASN B . n 
B 1 606 TYR 606 606 606 TYR TYR B . n 
B 1 607 VAL 607 607 607 VAL VAL B . n 
B 1 608 PHE 608 608 608 PHE PHE B . n 
B 1 609 GLY 609 609 609 GLY GLY B . n 
B 1 610 GLU 610 610 610 GLU GLU B . n 
B 1 611 PRO 611 611 611 PRO PRO B . n 
B 1 612 LEU 612 612 612 LEU LEU B . n 
B 1 613 ASN 613 613 613 ASN ASN B . n 
B 1 614 PRO 614 614 614 PRO PRO B . n 
B 1 615 THR 615 615 615 THR THR B . n 
B 1 616 LEU 616 616 616 LEU LEU B . n 
B 1 617 GLY 617 617 617 GLY GLY B . n 
B 1 618 TYR 618 618 618 TYR TYR B . n 
B 1 619 THR 619 619 619 THR THR B . n 
B 1 620 GLU 620 620 620 GLU GLU B . n 
B 1 621 ASP 621 621 621 ASP ASP B . n 
B 1 622 GLU 622 622 622 GLU GLU B . n 
B 1 623 LYS 623 623 623 LYS LYS B . n 
B 1 624 ASP 624 624 624 ASP ASP B . n 
B 1 625 PHE 625 625 625 PHE PHE B . n 
B 1 626 SER 626 626 626 SER SER B . n 
B 1 627 ARG 627 627 627 ARG ARG B . n 
B 1 628 LYS 628 628 628 LYS LYS B . n 
B 1 629 ILE 629 629 629 ILE ILE B . n 
B 1 630 MET 630 630 630 MET MET B . n 
B 1 631 ARG 631 631 631 ARG ARG B . n 
B 1 632 TYR 632 632 632 TYR TYR B . n 
B 1 633 TRP 633 633 633 TRP TRP B . n 
B 1 634 SER 634 634 634 SER SER B . n 
B 1 635 ASN 635 635 635 ASN ASN B . n 
B 1 636 PHE 636 636 636 PHE PHE B . n 
B 1 637 ALA 637 637 637 ALA ALA B . n 
B 1 638 LYS 638 638 638 LYS LYS B . n 
B 1 639 THR 639 639 639 THR THR B . n 
B 1 640 GLY 640 640 640 GLY GLY B . n 
B 1 641 ASN 641 641 641 ASN ASN B . n 
B 1 642 PRO 642 642 642 PRO PRO B . n 
B 1 643 ASN 643 643 643 ASN ASN B . n 
B 1 644 PRO 644 644 644 PRO PRO B . n 
B 1 645 ASN 645 645 645 ASN ASN B . n 
B 1 646 THR 646 646 646 THR THR B . n 
B 1 647 ALA 647 647 647 ALA ALA B . n 
B 1 648 SER 648 648 648 SER SER B . n 
B 1 649 SER 649 649 649 SER SER B . n 
B 1 650 GLU 650 650 650 GLU GLU B . n 
B 1 651 PHE 651 651 651 PHE PHE B . n 
B 1 652 PRO 652 652 652 PRO PRO B . n 
B 1 653 GLU 653 653 653 GLU GLU B . n 
B 1 654 TRP 654 654 654 TRP TRP B . n 
B 1 655 PRO 655 655 655 PRO PRO B . n 
B 1 656 LYS 656 656 656 LYS LYS B . n 
B 1 657 HIS 657 657 657 HIS HIS B . n 
B 1 658 THR 658 658 658 THR THR B . n 
B 1 659 ALA 659 659 659 ALA ALA B . n 
B 1 660 HIS 660 660 660 HIS HIS B . n 
B 1 661 GLY 661 661 661 GLY GLY B . n 
B 1 662 ARG 662 662 662 ARG ARG B . n 
B 1 663 HIS 663 663 663 HIS HIS B . n 
B 1 664 TYR 664 664 664 TYR TYR B . n 
B 1 665 LEU 665 665 665 LEU LEU B . n 
B 1 666 GLU 666 666 666 GLU GLU B . n 
B 1 667 LEU 667 667 667 LEU LEU B . n 
B 1 668 GLY 668 668 668 GLY GLY B . n 
B 1 669 LEU 669 669 669 LEU LEU B . n 
B 1 670 ASN 670 670 670 ASN ASN B . n 
B 1 671 THR 671 671 671 THR THR B . n 
B 1 672 SER 672 672 672 SER SER B . n 
B 1 673 PHE 673 673 673 PHE PHE B . n 
B 1 674 VAL 674 674 674 VAL VAL B . n 
B 1 675 GLY 675 675 675 GLY GLY B . n 
B 1 676 ARG 676 676 676 ARG ARG B . n 
B 1 677 GLY 677 677 677 GLY GLY B . n 
B 1 678 PRO 678 678 678 PRO PRO B . n 
B 1 679 ARG 679 679 679 ARG ARG B . n 
B 1 680 LEU 680 680 680 LEU LEU B . n 
B 1 681 ARG 681 681 681 ARG ARG B . n 
B 1 682 GLN 682 682 682 GLN GLN B . n 
B 1 683 CYS 683 683 683 CYS CYS B . n 
B 1 684 ALA 684 684 684 ALA ALA B . n 
B 1 685 PHE 685 685 685 PHE PHE B . n 
B 1 686 TRP 686 686 686 TRP TRP B . n 
B 1 687 LYS 687 687 687 LYS LYS B . n 
B 1 688 LYS 688 688 688 LYS LYS B . n 
B 1 689 TYR 689 689 689 TYR TYR B . n 
B 1 690 LEU 690 690 690 LEU LEU B . n 
B 1 691 PRO 691 691 691 PRO PRO B . n 
B 1 692 GLN 692 692 692 GLN GLN B . n 
B 1 693 LEU 693 693 693 LEU LEU B . n 
B 1 694 VAL 694 694 694 VAL VAL B . n 
B 1 695 ALA 695 695 695 ALA ALA B . n 
B 1 696 ALA 696 696 696 ALA ALA B . n 
B 1 697 THR 697 697 697 THR THR B . n 
B 1 698 SER 698 698 698 SER SER B . n 
B 1 699 ASN 699 699 699 ASN ASN B . n 
B 1 700 LEU 700 700 ?   ?   ?   B . n 
B 1 701 PRO 701 701 ?   ?   ?   B . n 
B 1 702 GLY 702 702 ?   ?   ?   B . n 
B 1 703 PRO 703 703 ?   ?   ?   B . n 
B 1 704 ALA 704 704 ?   ?   ?   B . n 
B 1 705 PRO 705 705 ?   ?   ?   B . n 
B 1 706 PRO 706 706 ?   ?   ?   B . n 
B 1 707 SER 707 707 ?   ?   ?   B . n 
B 1 708 GLU 708 708 ?   ?   ?   B . n 
B 1 709 PRO 709 709 ?   ?   ?   B . n 
B 1 710 CYS 710 710 ?   ?   ?   B . n 
B 1 711 GLU 711 711 ?   ?   ?   B . n 
B 1 712 SER 712 712 ?   ?   ?   B . n 
B 1 713 SER 713 713 ?   ?   ?   B . n 
B 1 714 ALA 714 714 ?   ?   ?   B . n 
B 1 715 PHE 715 715 ?   ?   ?   B . n 
B 1 716 PHE 716 716 ?   ?   ?   B . n 
B 1 717 TYR 717 717 ?   ?   ?   B . n 
B 1 718 ARG 718 718 ?   ?   ?   B . n 
B 1 719 PRO 719 719 ?   ?   ?   B . n 
B 1 720 ASP 720 720 ?   ?   ?   B . n 
B 1 721 LEU 721 721 ?   ?   ?   B . n 
B 1 722 ILE 722 722 ?   ?   ?   B . n 
B 1 723 VAL 723 723 ?   ?   ?   B . n 
B 1 724 LEU 724 724 ?   ?   ?   B . n 
B 1 725 LEU 725 725 ?   ?   ?   B . n 
B 1 726 VAL 726 726 ?   ?   ?   B . n 
B 1 727 SER 727 727 ?   ?   ?   B . n 
B 1 728 LEU 728 728 ?   ?   ?   B . n 
B 1 729 LEU 729 729 ?   ?   ?   B . n 
B 1 730 THR 730 730 ?   ?   ?   B . n 
B 1 731 ALA 731 731 ?   ?   ?   B . n 
B 1 732 THR 732 732 ?   ?   ?   B . n 
B 1 733 VAL 733 733 ?   ?   ?   B . n 
B 1 734 ARG 734 734 ?   ?   ?   B . n 
B 1 735 PHE 735 735 ?   ?   ?   B . n 
B 1 736 ILE 736 736 ?   ?   ?   B . n 
B 1 737 GLN 737 737 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E  3 NAG 1  801 1  NAG NAG A . 
F  4 SO4 1  802 2  SO4 SO4 A . 
G  4 SO4 1  803 5  SO4 SO4 A . 
H  4 SO4 1  804 6  SO4 SO4 A . 
I  4 SO4 1  805 8  SO4 SO4 A . 
J  4 SO4 1  806 12 SO4 SO4 A . 
K  4 SO4 1  807 14 SO4 SO4 A . 
L  4 SO4 1  808 18 SO4 SO4 A . 
M  4 SO4 1  809 21 SO4 SO4 A . 
N  4 SO4 1  810 23 SO4 SO4 A . 
O  4 SO4 1  811 24 SO4 SO4 A . 
P  4 SO4 1  812 27 SO4 SO4 A . 
Q  4 SO4 1  813 29 SO4 SO4 A . 
R  4 SO4 1  814 30 SO4 SO4 A . 
S  5 CO  1  815 2  CO  CO  A . 
T  3 NAG 1  801 1  NAG NAG B . 
U  4 SO4 1  802 1  SO4 SO4 B . 
V  4 SO4 1  803 3  SO4 SO4 B . 
W  4 SO4 1  804 4  SO4 SO4 B . 
X  4 SO4 1  805 7  SO4 SO4 B . 
Y  4 SO4 1  806 9  SO4 SO4 B . 
Z  4 SO4 1  807 10 SO4 SO4 B . 
AA 4 SO4 1  808 13 SO4 SO4 B . 
BA 4 SO4 1  809 15 SO4 SO4 B . 
CA 4 SO4 1  810 16 SO4 SO4 B . 
DA 4 SO4 1  811 17 SO4 SO4 B . 
EA 4 SO4 1  812 19 SO4 SO4 B . 
FA 4 SO4 1  813 20 SO4 SO4 B . 
GA 4 SO4 1  814 22 SO4 SO4 B . 
HA 4 SO4 1  815 25 SO4 SO4 B . 
IA 4 SO4 1  816 26 SO4 SO4 B . 
JA 4 SO4 1  817 28 SO4 SO4 B . 
KA 5 CO  1  818 1  CO  CO  B . 
LA 6 HOH 1  901 5  HOH HOH A . 
LA 6 HOH 2  902 41 HOH HOH A . 
LA 6 HOH 3  903 44 HOH HOH A . 
LA 6 HOH 4  904 40 HOH HOH A . 
LA 6 HOH 5  905 48 HOH HOH A . 
LA 6 HOH 6  906 3  HOH HOH A . 
LA 6 HOH 7  907 20 HOH HOH A . 
LA 6 HOH 8  908 23 HOH HOH A . 
LA 6 HOH 9  909 29 HOH HOH A . 
LA 6 HOH 10 910 7  HOH HOH A . 
LA 6 HOH 11 911 31 HOH HOH A . 
LA 6 HOH 12 912 8  HOH HOH A . 
LA 6 HOH 13 913 39 HOH HOH A . 
LA 6 HOH 14 914 25 HOH HOH A . 
LA 6 HOH 15 915 27 HOH HOH A . 
LA 6 HOH 16 916 4  HOH HOH A . 
LA 6 HOH 17 917 42 HOH HOH A . 
LA 6 HOH 18 918 19 HOH HOH A . 
LA 6 HOH 19 919 14 HOH HOH A . 
LA 6 HOH 20 920 38 HOH HOH A . 
LA 6 HOH 21 921 6  HOH HOH A . 
LA 6 HOH 22 922 34 HOH HOH A . 
LA 6 HOH 23 923 22 HOH HOH A . 
MA 6 HOH 1  901 26 HOH HOH B . 
MA 6 HOH 2  902 30 HOH HOH B . 
MA 6 HOH 3  903 28 HOH HOH B . 
MA 6 HOH 4  904 45 HOH HOH B . 
MA 6 HOH 5  905 47 HOH HOH B . 
MA 6 HOH 6  906 33 HOH HOH B . 
MA 6 HOH 7  907 10 HOH HOH B . 
MA 6 HOH 8  908 11 HOH HOH B . 
MA 6 HOH 9  909 9  HOH HOH B . 
MA 6 HOH 10 910 37 HOH HOH B . 
MA 6 HOH 11 911 46 HOH HOH B . 
MA 6 HOH 12 912 21 HOH HOH B . 
MA 6 HOH 13 913 35 HOH HOH B . 
MA 6 HOH 14 914 15 HOH HOH B . 
MA 6 HOH 15 915 24 HOH HOH B . 
MA 6 HOH 16 916 1  HOH HOH B . 
MA 6 HOH 17 917 2  HOH HOH B . 
MA 6 HOH 18 918 16 HOH HOH B . 
MA 6 HOH 19 919 17 HOH HOH B . 
MA 6 HOH 20 920 12 HOH HOH B . 
MA 6 HOH 21 921 13 HOH HOH B . 
MA 6 HOH 22 922 32 HOH HOH B . 
MA 6 HOH 23 923 36 HOH HOH B . 
MA 6 HOH 24 924 43 HOH HOH B . 
MA 6 HOH 25 925 18 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A SEB 360 A SEB 360 ? SER 'modified residue' 
2 B SEB 360 B SEB 360 ? SER 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 B,D,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,MA 
1 2 A,C,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,LA                  
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8140  ? 
1 MORE         -354  ? 
1 'SSA (A^2)'  41760 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000  
1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000   
2 'crystal symmetry operation' 5_564 y,-x+y+1,z-1/6 0.5000000000 0.8660254038 0.0000000000 -73.8250000000 -0.8660254038 
0.5000000000 0.0000000000 127.8686508688 0.0000000000 0.0000000000 1.0000000000 -37.3633333333 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A  HIS 416 ? A HIS 416 ? 1_555 CO ? S  CO . ? A CO 815 ? 1_555 O ? LA HOH . ? A HOH 906 ? 1_555 104.7 ? 
2 NE2 ? A  HIS 416 ? A HIS 416 ? 1_555 CO ? S  CO . ? A CO 815 ? 1_555 O ? LA HOH . ? A HOH 916 ? 1_555 134.0 ? 
3 O   ? LA HOH .   ? A HOH 906 ? 1_555 CO ? S  CO . ? A CO 815 ? 1_555 O ? LA HOH . ? A HOH 916 ? 1_555 120.0 ? 
4 NE2 ? B  HIS 416 ? B HIS 416 ? 1_555 CO ? KA CO . ? B CO 818 ? 1_555 O ? MA HOH . ? B HOH 916 ? 1_555 159.4 ? 
5 NE2 ? B  HIS 416 ? B HIS 416 ? 1_555 CO ? KA CO . ? B CO 818 ? 1_555 O ? MA HOH . ? B HOH 917 ? 1_555 116.5 ? 
6 O   ? MA HOH .   ? B HOH 916 ? 1_555 CO ? KA CO . ? B CO 818 ? 1_555 O ? MA HOH . ? B HOH 917 ? 1_555 80.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-03-07 
2 'Structure model' 1 1 2019-11-20 
3 'Structure model' 2 0 2020-07-29 
4 'Structure model' 3 0 2021-06-02 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations' 
2 3 'Structure model' 'Atomic model'         
3 3 'Structure model' 'Data collection'      
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' 'Structure summary'    
6 4 'Structure model' 'Atomic model'         
7 4 'Structure model' 'Data collection'      
8 4 'Structure model' 'Derived calculations' 
9 4 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' pdbx_struct_conn_angle        
2  2 'Structure model' struct_conn                   
3  3 'Structure model' atom_site                     
4  3 'Structure model' chem_comp                     
5  3 'Structure model' entity                        
6  3 'Structure model' pdbx_branch_scheme            
7  3 'Structure model' pdbx_chem_comp_identifier     
8  3 'Structure model' pdbx_entity_branch            
9  3 'Structure model' pdbx_entity_branch_descriptor 
10 3 'Structure model' pdbx_entity_branch_link       
11 3 'Structure model' pdbx_entity_branch_list       
12 3 'Structure model' pdbx_entity_nonpoly           
13 3 'Structure model' pdbx_nonpoly_scheme           
14 3 'Structure model' pdbx_struct_assembly_gen      
15 3 'Structure model' pdbx_struct_conn_angle        
16 3 'Structure model' struct_asym                   
17 3 'Structure model' struct_conn                   
18 3 'Structure model' struct_site                   
19 3 'Structure model' struct_site_gen               
20 4 'Structure model' atom_site                     
21 4 'Structure model' chem_comp                     
22 4 'Structure model' pdbx_nonpoly_scheme           
23 4 'Structure model' pdbx_struct_assembly_gen      
24 4 'Structure model' pdbx_struct_assembly_prop     
25 4 'Structure model' pdbx_struct_conn_angle        
26 4 'Structure model' pdbx_struct_oper_list         
27 4 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  3 'Structure model' '_atom_site.Cartn_x'                          
3  3 'Structure model' '_atom_site.Cartn_y'                          
4  3 'Structure model' '_atom_site.Cartn_z'                          
5  3 'Structure model' '_atom_site.auth_asym_id'                     
6  3 'Structure model' '_atom_site.auth_atom_id'                     
7  3 'Structure model' '_atom_site.auth_comp_id'                     
8  3 'Structure model' '_atom_site.auth_seq_id'                      
9  3 'Structure model' '_atom_site.label_asym_id'                    
10 3 'Structure model' '_atom_site.label_atom_id'                    
11 3 'Structure model' '_atom_site.label_comp_id'                    
12 3 'Structure model' '_atom_site.label_entity_id'                  
13 3 'Structure model' '_atom_site.type_symbol'                      
14 3 'Structure model' '_chem_comp.name'                             
15 3 'Structure model' '_chem_comp.type'                             
16 3 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
17 3 'Structure model' '_pdbx_entity_nonpoly.name'                   
18 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
24 3 'Structure model' '_pdbx_struct_conn_angle.value'               
25 3 'Structure model' '_struct_conn.conn_type_id'                   
26 3 'Structure model' '_struct_conn.id'                             
27 3 'Structure model' '_struct_conn.pdbx_dist_value'                
28 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
29 3 'Structure model' '_struct_conn.pdbx_role'                      
30 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
31 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
32 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
33 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
34 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
35 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
36 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
37 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
38 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
39 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
40 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
41 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
42 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
43 3 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
44 4 'Structure model' '_atom_site.auth_seq_id'                      
45 4 'Structure model' '_chem_comp.pdbx_synonyms'                    
46 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'            
47 4 'Structure model' '_pdbx_struct_assembly_prop.value'            
48 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
49 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
50 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC    ? ? ? 5.8.0158 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP    ? ? ? .        4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 206 ? ? 73.30   -21.02  
2  1 ASP A 238 ? ? -102.67 50.42   
3  1 LYS A 268 ? ? -103.05 -67.42  
4  1 TYR A 291 ? ? -95.90  35.41   
5  1 ALA A 312 ? ? 62.92   -153.48 
6  1 PHE A 316 ? ? -143.28 28.05   
7  1 SEB A 360 ? ? 58.32   -124.11 
8  1 GLN A 380 ? ? -111.08 -74.89  
9  1 VAL A 455 ? ? -68.97  99.02   
10 1 GLU A 485 ? ? -114.48 77.68   
11 1 LEU A 495 ? ? 49.57   79.25   
12 1 TYR A 535 ? ? -113.84 65.46   
13 1 GLU A 540 ? ? -150.63 74.94   
14 1 PHE A 560 ? ? -136.50 -72.57  
15 1 SER A 672 ? ? -149.57 38.75   
16 1 PHE B 206 ? ? 69.86   -21.33  
17 1 ASP B 233 ? ? -68.96  99.07   
18 1 ASP B 238 ? ? -118.37 60.03   
19 1 ASN B 269 ? ? -154.47 46.75   
20 1 PHE B 281 ? ? 58.08   11.09   
21 1 TYR B 291 ? ? -88.40  36.42   
22 1 ALA B 312 ? ? 70.04   -160.38 
23 1 PHE B 316 ? ? -142.73 30.41   
24 1 SEB B 360 ? ? 54.75   -120.20 
25 1 GLN B 380 ? ? -109.40 -73.65  
26 1 PRO B 453 ? ? -47.40  161.95  
27 1 GLU B 485 ? ? -117.12 65.07   
28 1 LEU B 495 ? ? 49.84   70.41   
29 1 TYR B 535 ? ? -117.20 50.24   
30 1 PHE B 560 ? ? -126.19 -75.68  
31 1 THR B 646 ? ? 89.85   -20.91  
32 1 ALA B 647 ? ? 60.91   83.36   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A GLU 2   ? A GLU 2   
3   1 Y 1 A ILE 3   ? A ILE 3   
4   1 Y 1 A ARG 4   ? A ARG 4   
5   1 Y 1 A GLY 5   ? A GLY 5   
6   1 Y 1 A LEU 6   ? A LEU 6   
7   1 Y 1 A LEU 7   ? A LEU 7   
8   1 Y 1 A MET 8   ? A MET 8   
9   1 Y 1 A GLY 9   ? A GLY 9   
10  1 Y 1 A ARG 10  ? A ARG 10  
11  1 Y 1 A LEU 11  ? A LEU 11  
12  1 Y 1 A ARG 12  ? A ARG 12  
13  1 Y 1 A LEU 13  ? A LEU 13  
14  1 Y 1 A GLY 14  ? A GLY 14  
15  1 Y 1 A ARG 15  ? A ARG 15  
16  1 Y 1 A ARG 16  ? A ARG 16  
17  1 Y 1 A MET 17  ? A MET 17  
18  1 Y 1 A VAL 18  ? A VAL 18  
19  1 Y 1 A PRO 19  ? A PRO 19  
20  1 Y 1 A LEU 20  ? A LEU 20  
21  1 Y 1 A GLY 21  ? A GLY 21  
22  1 Y 1 A LEU 22  ? A LEU 22  
23  1 Y 1 A LEU 23  ? A LEU 23  
24  1 Y 1 A GLY 24  ? A GLY 24  
25  1 Y 1 A VAL 25  ? A VAL 25  
26  1 Y 1 A THR 26  ? A THR 26  
27  1 Y 1 A ALA 27  ? A ALA 27  
28  1 Y 1 A LEU 28  ? A LEU 28  
29  1 Y 1 A LEU 29  ? A LEU 29  
30  1 Y 1 A LEU 30  ? A LEU 30  
31  1 Y 1 A ILE 31  ? A ILE 31  
32  1 Y 1 A LEU 32  ? A LEU 32  
33  1 Y 1 A PRO 33  ? A PRO 33  
34  1 Y 1 A PRO 34  ? A PRO 34  
35  1 Y 1 A PHE 35  ? A PHE 35  
36  1 Y 1 A ALA 36  ? A ALA 36  
37  1 Y 1 A LEU 37  ? A LEU 37  
38  1 Y 1 A VAL 38  ? A VAL 38  
39  1 Y 1 A GLN 39  ? A GLN 39  
40  1 Y 1 A GLY 40  ? A GLY 40  
41  1 Y 1 A ARG 41  ? A ARG 41  
42  1 Y 1 A HIS 42  ? A HIS 42  
43  1 Y 1 A HIS 43  ? A HIS 43  
44  1 Y 1 A GLU 44  ? A GLU 44  
45  1 Y 1 A LEU 45  ? A LEU 45  
46  1 Y 1 A ASN 46  ? A ASN 46  
47  1 Y 1 A ASN 47  ? A ASN 47  
48  1 Y 1 A GLY 48  ? A GLY 48  
49  1 Y 1 A ALA 49  ? A ALA 49  
50  1 Y 1 A ALA 50  ? A ALA 50  
51  1 Y 1 A ILE 51  ? A ILE 51  
52  1 Y 1 A GLY 52  ? A GLY 52  
53  1 Y 1 A SER 53  ? A SER 53  
54  1 Y 1 A HIS 54  ? A HIS 54  
55  1 Y 1 A GLN 55  ? A GLN 55  
56  1 Y 1 A LEU 56  ? A LEU 56  
57  1 Y 1 A SER 57  ? A SER 57  
58  1 Y 1 A ALA 58  ? A ALA 58  
59  1 Y 1 A ALA 59  ? A ALA 59  
60  1 Y 1 A ALA 60  ? A ALA 60  
61  1 Y 1 A GLY 61  ? A GLY 61  
62  1 Y 1 A VAL 62  ? A VAL 62  
63  1 Y 1 A GLY 63  ? A GLY 63  
64  1 Y 1 A LEU 64  ? A LEU 64  
65  1 Y 1 A ALA 65  ? A ALA 65  
66  1 Y 1 A SER 66  ? A SER 66  
67  1 Y 1 A GLN 67  ? A GLN 67  
68  1 Y 1 A SER 68  ? A SER 68  
69  1 Y 1 A ALA 69  ? A ALA 69  
70  1 Y 1 A GLN 70  ? A GLN 70  
71  1 Y 1 A SER 71  ? A SER 71  
72  1 Y 1 A GLY 72  ? A GLY 72  
73  1 Y 1 A SER 73  ? A SER 73  
74  1 Y 1 A LEU 74  ? A LEU 74  
75  1 Y 1 A ALA 75  ? A ALA 75  
76  1 Y 1 A SER 76  ? A SER 76  
77  1 Y 1 A GLY 77  ? A GLY 77  
78  1 Y 1 A VAL 78  ? A VAL 78  
79  1 Y 1 A MET 79  ? A MET 79  
80  1 Y 1 A SER 80  ? A SER 80  
81  1 Y 1 A SER 81  ? A SER 81  
82  1 Y 1 A VAL 82  ? A VAL 82  
83  1 Y 1 A PRO 83  ? A PRO 83  
84  1 Y 1 A ALA 84  ? A ALA 84  
85  1 Y 1 A ALA 85  ? A ALA 85  
86  1 Y 1 A GLY 86  ? A GLY 86  
87  1 Y 1 A ALA 87  ? A ALA 87  
88  1 Y 1 A SER 88  ? A SER 88  
89  1 Y 1 A SER 89  ? A SER 89  
90  1 Y 1 A SER 90  ? A SER 90  
91  1 Y 1 A SER 91  ? A SER 91  
92  1 Y 1 A SER 92  ? A SER 92  
93  1 Y 1 A SER 93  ? A SER 93  
94  1 Y 1 A SER 94  ? A SER 94  
95  1 Y 1 A LEU 95  ? A LEU 95  
96  1 Y 1 A LEU 96  ? A LEU 96  
97  1 Y 1 A SER 97  ? A SER 97  
98  1 Y 1 A SER 98  ? A SER 98  
99  1 Y 1 A SER 99  ? A SER 99  
100 1 Y 1 A ALA 100 ? A ALA 100 
101 1 Y 1 A GLU 101 ? A GLU 101 
102 1 Y 1 A ASP 102 ? A ASP 102 
103 1 Y 1 A ASP 103 ? A ASP 103 
104 1 Y 1 A VAL 104 ? A VAL 104 
105 1 Y 1 A ALA 105 ? A ALA 105 
106 1 Y 1 A ARG 106 ? A ARG 106 
107 1 Y 1 A ILE 107 ? A ILE 107 
108 1 Y 1 A THR 108 ? A THR 108 
109 1 Y 1 A LEU 109 ? A LEU 109 
110 1 Y 1 A SER 110 ? A SER 110 
111 1 Y 1 A LYS 111 ? A LYS 111 
112 1 Y 1 A ASP 112 ? A ASP 112 
113 1 Y 1 A ALA 113 ? A ALA 113 
114 1 Y 1 A ASP 114 ? A ASP 114 
115 1 Y 1 A ALA 115 ? A ALA 115 
116 1 Y 1 A PHE 116 ? A PHE 116 
117 1 Y 1 A PHE 117 ? A PHE 117 
118 1 Y 1 A THR 118 ? A THR 118 
119 1 Y 1 A PRO 119 ? A PRO 119 
120 1 Y 1 A TYR 120 ? A TYR 120 
121 1 Y 1 A ILE 121 ? A ILE 121 
122 1 Y 1 A GLY 122 ? A GLY 122 
123 1 Y 1 A HIS 123 ? A HIS 123 
124 1 Y 1 A GLY 124 ? A GLY 124 
125 1 Y 1 A GLU 125 ? A GLU 125 
126 1 Y 1 A SER 126 ? A SER 126 
127 1 Y 1 A VAL 127 ? A VAL 127 
128 1 Y 1 A ARG 128 ? A ARG 128 
129 1 Y 1 A ILE 129 ? A ILE 129 
130 1 Y 1 A ILE 130 ? A ILE 130 
131 1 Y 1 A ASP 131 ? A ASP 131 
132 1 Y 1 A ALA 132 ? A ALA 132 
133 1 Y 1 A GLU 133 ? A GLU 133 
134 1 Y 1 A LEU 134 ? A LEU 134 
135 1 Y 1 A GLY 135 ? A GLY 135 
136 1 Y 1 A THR 136 ? A THR 136 
137 1 Y 1 A LEU 137 ? A LEU 137 
138 1 Y 1 A GLU 138 ? A GLU 138 
139 1 Y 1 A HIS 139 ? A HIS 139 
140 1 Y 1 A VAL 140 ? A VAL 140 
141 1 Y 1 A HIS 141 ? A HIS 141 
142 1 Y 1 A SER 142 ? A SER 142 
143 1 Y 1 A GLY 143 ? A GLY 143 
144 1 Y 1 A ALA 144 ? A ALA 144 
145 1 Y 1 A THR 145 ? A THR 145 
146 1 Y 1 A PRO 146 ? A PRO 146 
147 1 Y 1 A ARG 147 ? A ARG 147 
148 1 Y 1 A ARG 148 ? A ARG 148 
149 1 Y 1 A ARG 149 ? A ARG 149 
150 1 Y 1 A GLY 150 ? A GLY 150 
151 1 Y 1 A LEU 151 ? A LEU 151 
152 1 Y 1 A THR 152 ? A THR 152 
153 1 Y 1 A ARG 153 ? A ARG 153 
154 1 Y 1 A ARG 154 ? A ARG 154 
155 1 Y 1 A GLU 155 ? A GLU 155 
156 1 Y 1 A SER 156 ? A SER 156 
157 1 Y 1 A ASN 157 ? A ASN 157 
158 1 Y 1 A SER 158 ? A SER 158 
159 1 Y 1 A ASP 159 ? A ASP 159 
160 1 Y 1 A ALA 160 ? A ALA 160 
161 1 Y 1 A ASN 161 ? A ASN 161 
162 1 Y 1 A LEU 700 ? A LEU 700 
163 1 Y 1 A PRO 701 ? A PRO 701 
164 1 Y 1 A GLY 702 ? A GLY 702 
165 1 Y 1 A PRO 703 ? A PRO 703 
166 1 Y 1 A ALA 704 ? A ALA 704 
167 1 Y 1 A PRO 705 ? A PRO 705 
168 1 Y 1 A PRO 706 ? A PRO 706 
169 1 Y 1 A SER 707 ? A SER 707 
170 1 Y 1 A GLU 708 ? A GLU 708 
171 1 Y 1 A PRO 709 ? A PRO 709 
172 1 Y 1 A CYS 710 ? A CYS 710 
173 1 Y 1 A GLU 711 ? A GLU 711 
174 1 Y 1 A SER 712 ? A SER 712 
175 1 Y 1 A SER 713 ? A SER 713 
176 1 Y 1 A ALA 714 ? A ALA 714 
177 1 Y 1 A PHE 715 ? A PHE 715 
178 1 Y 1 A PHE 716 ? A PHE 716 
179 1 Y 1 A TYR 717 ? A TYR 717 
180 1 Y 1 A ARG 718 ? A ARG 718 
181 1 Y 1 A PRO 719 ? A PRO 719 
182 1 Y 1 A ASP 720 ? A ASP 720 
183 1 Y 1 A LEU 721 ? A LEU 721 
184 1 Y 1 A ILE 722 ? A ILE 722 
185 1 Y 1 A VAL 723 ? A VAL 723 
186 1 Y 1 A LEU 724 ? A LEU 724 
187 1 Y 1 A LEU 725 ? A LEU 725 
188 1 Y 1 A VAL 726 ? A VAL 726 
189 1 Y 1 A SER 727 ? A SER 727 
190 1 Y 1 A LEU 728 ? A LEU 728 
191 1 Y 1 A LEU 729 ? A LEU 729 
192 1 Y 1 A THR 730 ? A THR 730 
193 1 Y 1 A ALA 731 ? A ALA 731 
194 1 Y 1 A THR 732 ? A THR 732 
195 1 Y 1 A VAL 733 ? A VAL 733 
196 1 Y 1 A ARG 734 ? A ARG 734 
197 1 Y 1 A PHE 735 ? A PHE 735 
198 1 Y 1 A ILE 736 ? A ILE 736 
199 1 Y 1 A GLN 737 ? A GLN 737 
200 1 Y 1 B MET 1   ? B MET 1   
201 1 Y 1 B GLU 2   ? B GLU 2   
202 1 Y 1 B ILE 3   ? B ILE 3   
203 1 Y 1 B ARG 4   ? B ARG 4   
204 1 Y 1 B GLY 5   ? B GLY 5   
205 1 Y 1 B LEU 6   ? B LEU 6   
206 1 Y 1 B LEU 7   ? B LEU 7   
207 1 Y 1 B MET 8   ? B MET 8   
208 1 Y 1 B GLY 9   ? B GLY 9   
209 1 Y 1 B ARG 10  ? B ARG 10  
210 1 Y 1 B LEU 11  ? B LEU 11  
211 1 Y 1 B ARG 12  ? B ARG 12  
212 1 Y 1 B LEU 13  ? B LEU 13  
213 1 Y 1 B GLY 14  ? B GLY 14  
214 1 Y 1 B ARG 15  ? B ARG 15  
215 1 Y 1 B ARG 16  ? B ARG 16  
216 1 Y 1 B MET 17  ? B MET 17  
217 1 Y 1 B VAL 18  ? B VAL 18  
218 1 Y 1 B PRO 19  ? B PRO 19  
219 1 Y 1 B LEU 20  ? B LEU 20  
220 1 Y 1 B GLY 21  ? B GLY 21  
221 1 Y 1 B LEU 22  ? B LEU 22  
222 1 Y 1 B LEU 23  ? B LEU 23  
223 1 Y 1 B GLY 24  ? B GLY 24  
224 1 Y 1 B VAL 25  ? B VAL 25  
225 1 Y 1 B THR 26  ? B THR 26  
226 1 Y 1 B ALA 27  ? B ALA 27  
227 1 Y 1 B LEU 28  ? B LEU 28  
228 1 Y 1 B LEU 29  ? B LEU 29  
229 1 Y 1 B LEU 30  ? B LEU 30  
230 1 Y 1 B ILE 31  ? B ILE 31  
231 1 Y 1 B LEU 32  ? B LEU 32  
232 1 Y 1 B PRO 33  ? B PRO 33  
233 1 Y 1 B PRO 34  ? B PRO 34  
234 1 Y 1 B PHE 35  ? B PHE 35  
235 1 Y 1 B ALA 36  ? B ALA 36  
236 1 Y 1 B LEU 37  ? B LEU 37  
237 1 Y 1 B VAL 38  ? B VAL 38  
238 1 Y 1 B GLN 39  ? B GLN 39  
239 1 Y 1 B GLY 40  ? B GLY 40  
240 1 Y 1 B ARG 41  ? B ARG 41  
241 1 Y 1 B HIS 42  ? B HIS 42  
242 1 Y 1 B HIS 43  ? B HIS 43  
243 1 Y 1 B GLU 44  ? B GLU 44  
244 1 Y 1 B LEU 45  ? B LEU 45  
245 1 Y 1 B ASN 46  ? B ASN 46  
246 1 Y 1 B ASN 47  ? B ASN 47  
247 1 Y 1 B GLY 48  ? B GLY 48  
248 1 Y 1 B ALA 49  ? B ALA 49  
249 1 Y 1 B ALA 50  ? B ALA 50  
250 1 Y 1 B ILE 51  ? B ILE 51  
251 1 Y 1 B GLY 52  ? B GLY 52  
252 1 Y 1 B SER 53  ? B SER 53  
253 1 Y 1 B HIS 54  ? B HIS 54  
254 1 Y 1 B GLN 55  ? B GLN 55  
255 1 Y 1 B LEU 56  ? B LEU 56  
256 1 Y 1 B SER 57  ? B SER 57  
257 1 Y 1 B ALA 58  ? B ALA 58  
258 1 Y 1 B ALA 59  ? B ALA 59  
259 1 Y 1 B ALA 60  ? B ALA 60  
260 1 Y 1 B GLY 61  ? B GLY 61  
261 1 Y 1 B VAL 62  ? B VAL 62  
262 1 Y 1 B GLY 63  ? B GLY 63  
263 1 Y 1 B LEU 64  ? B LEU 64  
264 1 Y 1 B ALA 65  ? B ALA 65  
265 1 Y 1 B SER 66  ? B SER 66  
266 1 Y 1 B GLN 67  ? B GLN 67  
267 1 Y 1 B SER 68  ? B SER 68  
268 1 Y 1 B ALA 69  ? B ALA 69  
269 1 Y 1 B GLN 70  ? B GLN 70  
270 1 Y 1 B SER 71  ? B SER 71  
271 1 Y 1 B GLY 72  ? B GLY 72  
272 1 Y 1 B SER 73  ? B SER 73  
273 1 Y 1 B LEU 74  ? B LEU 74  
274 1 Y 1 B ALA 75  ? B ALA 75  
275 1 Y 1 B SER 76  ? B SER 76  
276 1 Y 1 B GLY 77  ? B GLY 77  
277 1 Y 1 B VAL 78  ? B VAL 78  
278 1 Y 1 B MET 79  ? B MET 79  
279 1 Y 1 B SER 80  ? B SER 80  
280 1 Y 1 B SER 81  ? B SER 81  
281 1 Y 1 B VAL 82  ? B VAL 82  
282 1 Y 1 B PRO 83  ? B PRO 83  
283 1 Y 1 B ALA 84  ? B ALA 84  
284 1 Y 1 B ALA 85  ? B ALA 85  
285 1 Y 1 B GLY 86  ? B GLY 86  
286 1 Y 1 B ALA 87  ? B ALA 87  
287 1 Y 1 B SER 88  ? B SER 88  
288 1 Y 1 B SER 89  ? B SER 89  
289 1 Y 1 B SER 90  ? B SER 90  
290 1 Y 1 B SER 91  ? B SER 91  
291 1 Y 1 B SER 92  ? B SER 92  
292 1 Y 1 B SER 93  ? B SER 93  
293 1 Y 1 B SER 94  ? B SER 94  
294 1 Y 1 B LEU 95  ? B LEU 95  
295 1 Y 1 B LEU 96  ? B LEU 96  
296 1 Y 1 B SER 97  ? B SER 97  
297 1 Y 1 B SER 98  ? B SER 98  
298 1 Y 1 B SER 99  ? B SER 99  
299 1 Y 1 B ALA 100 ? B ALA 100 
300 1 Y 1 B GLU 101 ? B GLU 101 
301 1 Y 1 B ASP 102 ? B ASP 102 
302 1 Y 1 B ASP 103 ? B ASP 103 
303 1 Y 1 B VAL 104 ? B VAL 104 
304 1 Y 1 B ALA 105 ? B ALA 105 
305 1 Y 1 B ARG 106 ? B ARG 106 
306 1 Y 1 B ILE 107 ? B ILE 107 
307 1 Y 1 B THR 108 ? B THR 108 
308 1 Y 1 B LEU 109 ? B LEU 109 
309 1 Y 1 B SER 110 ? B SER 110 
310 1 Y 1 B LYS 111 ? B LYS 111 
311 1 Y 1 B ASP 112 ? B ASP 112 
312 1 Y 1 B ALA 113 ? B ALA 113 
313 1 Y 1 B ASP 114 ? B ASP 114 
314 1 Y 1 B ALA 115 ? B ALA 115 
315 1 Y 1 B PHE 116 ? B PHE 116 
316 1 Y 1 B PHE 117 ? B PHE 117 
317 1 Y 1 B THR 118 ? B THR 118 
318 1 Y 1 B PRO 119 ? B PRO 119 
319 1 Y 1 B TYR 120 ? B TYR 120 
320 1 Y 1 B ILE 121 ? B ILE 121 
321 1 Y 1 B GLY 122 ? B GLY 122 
322 1 Y 1 B HIS 123 ? B HIS 123 
323 1 Y 1 B GLY 124 ? B GLY 124 
324 1 Y 1 B GLU 125 ? B GLU 125 
325 1 Y 1 B SER 126 ? B SER 126 
326 1 Y 1 B VAL 127 ? B VAL 127 
327 1 Y 1 B ARG 128 ? B ARG 128 
328 1 Y 1 B ILE 129 ? B ILE 129 
329 1 Y 1 B ILE 130 ? B ILE 130 
330 1 Y 1 B ASP 131 ? B ASP 131 
331 1 Y 1 B ALA 132 ? B ALA 132 
332 1 Y 1 B GLU 133 ? B GLU 133 
333 1 Y 1 B LEU 134 ? B LEU 134 
334 1 Y 1 B GLY 135 ? B GLY 135 
335 1 Y 1 B THR 136 ? B THR 136 
336 1 Y 1 B LEU 137 ? B LEU 137 
337 1 Y 1 B GLU 138 ? B GLU 138 
338 1 Y 1 B HIS 139 ? B HIS 139 
339 1 Y 1 B VAL 140 ? B VAL 140 
340 1 Y 1 B HIS 141 ? B HIS 141 
341 1 Y 1 B SER 142 ? B SER 142 
342 1 Y 1 B GLY 143 ? B GLY 143 
343 1 Y 1 B ALA 144 ? B ALA 144 
344 1 Y 1 B THR 145 ? B THR 145 
345 1 Y 1 B PRO 146 ? B PRO 146 
346 1 Y 1 B ARG 147 ? B ARG 147 
347 1 Y 1 B ARG 148 ? B ARG 148 
348 1 Y 1 B ARG 149 ? B ARG 149 
349 1 Y 1 B GLY 150 ? B GLY 150 
350 1 Y 1 B LEU 151 ? B LEU 151 
351 1 Y 1 B THR 152 ? B THR 152 
352 1 Y 1 B ARG 153 ? B ARG 153 
353 1 Y 1 B ARG 154 ? B ARG 154 
354 1 Y 1 B GLU 155 ? B GLU 155 
355 1 Y 1 B SER 156 ? B SER 156 
356 1 Y 1 B ASN 157 ? B ASN 157 
357 1 Y 1 B SER 158 ? B SER 158 
358 1 Y 1 B ASP 159 ? B ASP 159 
359 1 Y 1 B ALA 160 ? B ALA 160 
360 1 Y 1 B ASN 161 ? B ASN 161 
361 1 Y 1 B LEU 700 ? B LEU 700 
362 1 Y 1 B PRO 701 ? B PRO 701 
363 1 Y 1 B GLY 702 ? B GLY 702 
364 1 Y 1 B PRO 703 ? B PRO 703 
365 1 Y 1 B ALA 704 ? B ALA 704 
366 1 Y 1 B PRO 705 ? B PRO 705 
367 1 Y 1 B PRO 706 ? B PRO 706 
368 1 Y 1 B SER 707 ? B SER 707 
369 1 Y 1 B GLU 708 ? B GLU 708 
370 1 Y 1 B PRO 709 ? B PRO 709 
371 1 Y 1 B CYS 710 ? B CYS 710 
372 1 Y 1 B GLU 711 ? B GLU 711 
373 1 Y 1 B SER 712 ? B SER 712 
374 1 Y 1 B SER 713 ? B SER 713 
375 1 Y 1 B ALA 714 ? B ALA 714 
376 1 Y 1 B PHE 715 ? B PHE 715 
377 1 Y 1 B PHE 716 ? B PHE 716 
378 1 Y 1 B TYR 717 ? B TYR 717 
379 1 Y 1 B ARG 718 ? B ARG 718 
380 1 Y 1 B PRO 719 ? B PRO 719 
381 1 Y 1 B ASP 720 ? B ASP 720 
382 1 Y 1 B LEU 721 ? B LEU 721 
383 1 Y 1 B ILE 722 ? B ILE 722 
384 1 Y 1 B VAL 723 ? B VAL 723 
385 1 Y 1 B LEU 724 ? B LEU 724 
386 1 Y 1 B LEU 725 ? B LEU 725 
387 1 Y 1 B VAL 726 ? B VAL 726 
388 1 Y 1 B SER 727 ? B SER 727 
389 1 Y 1 B LEU 728 ? B LEU 728 
390 1 Y 1 B LEU 729 ? B LEU 729 
391 1 Y 1 B THR 730 ? B THR 730 
392 1 Y 1 B ALA 731 ? B ALA 731 
393 1 Y 1 B THR 732 ? B THR 732 
394 1 Y 1 B VAL 733 ? B VAL 733 
395 1 Y 1 B ARG 734 ? B ARG 734 
396 1 Y 1 B PHE 735 ? B PHE 735 
397 1 Y 1 B ILE 736 ? B ILE 736 
398 1 Y 1 B GLN 737 ? B GLN 737 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Natural Science Foundation of China' China           31472186 1 
NIH                                            'United States' AI082581 2 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 D NAG 1 n 
C 2 NAG 2 C NAG 2 D NAG 2 n 
D 2 NAG 1 D NAG 1 E NAG 1 n 
D 2 NAG 2 D NAG 2 E NAG 2 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 'SULFATE ION'                            SO4 
5 'COBALT (II) ION'                        CO  
6 water                                    HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#