data_5YUS
# 
_entry.id   5YUS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5YUS         
WWPDB D_1300005335 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5YUS 
_pdbx_database_status.recvd_initial_deposition_date   2017-11-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kottur, J.' 1 ? 
'Nair, D.T.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                5875 
_citation.page_last                 5885 
_citation.title                     'Pyrophosphate hydrolysis is an intrinsic and critical step of the DNA synthesis reaction' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky402 
_citation.pdbx_database_id_PubMed   29850882 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kottur, J.' 1 ? 
primary 'Nair, D.T.' 2 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5YUS 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     86.840 
_cell.length_a_esd                 ? 
_cell.length_b                     57.120 
_cell.length_b_esd                 ? 
_cell.length_c                     110.550 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5YUS 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'         39589.895 2   2.7.7.7 ? ? ? 
2 polymer     syn DTN                         5492.554  4   ?       ? ? ? 
3 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE" 482.168   2   ?       ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'             24.305    4   ?       ? ? ? 
5 water       nat water                       18.015    682 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV,Translesion synthesis polymerase IV,TSL polymerase IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAY
KEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPN
GQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERL
RKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKT
WDERRGGRGVRLVGLHVTLLDPQMERQLVLGL
;
;GSRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAY
KEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPN
GQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERL
RKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKT
WDERRGGRGVRLVGLHVTLLDPQMERQLVLGL
;
F,A     ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DT)(DA)(DG)(DG)(DG)(DT)(DC)(DC)(DT)(DA)(DG)(DG)(DA)(DC)(DC)(DC)' TCTAGGGTCCTAGGACCC 
G,H,B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ARG n 
1 4   LYS n 
1 5   ILE n 
1 6   ILE n 
1 7   HIS n 
1 8   VAL n 
1 9   ASP n 
1 10  MET n 
1 11  ASP n 
1 12  CYS n 
1 13  PHE n 
1 14  PHE n 
1 15  ALA n 
1 16  ALA n 
1 17  VAL n 
1 18  GLU n 
1 19  MET n 
1 20  ARG n 
1 21  ASP n 
1 22  ASN n 
1 23  PRO n 
1 24  ALA n 
1 25  LEU n 
1 26  ARG n 
1 27  ASP n 
1 28  ILE n 
1 29  PRO n 
1 30  ILE n 
1 31  ALA n 
1 32  ILE n 
1 33  GLY n 
1 34  GLY n 
1 35  SER n 
1 36  ARG n 
1 37  GLU n 
1 38  ARG n 
1 39  ARG n 
1 40  GLY n 
1 41  VAL n 
1 42  ILE n 
1 43  SER n 
1 44  THR n 
1 45  ALA n 
1 46  ASN n 
1 47  TYR n 
1 48  PRO n 
1 49  ALA n 
1 50  ARG n 
1 51  LYS n 
1 52  PHE n 
1 53  GLY n 
1 54  VAL n 
1 55  ARG n 
1 56  SER n 
1 57  ALA n 
1 58  MET n 
1 59  PRO n 
1 60  THR n 
1 61  GLY n 
1 62  MET n 
1 63  ALA n 
1 64  LEU n 
1 65  LYS n 
1 66  LEU n 
1 67  CYS n 
1 68  PRO n 
1 69  HIS n 
1 70  LEU n 
1 71  THR n 
1 72  LEU n 
1 73  LEU n 
1 74  PRO n 
1 75  GLY n 
1 76  ARG n 
1 77  PHE n 
1 78  ASP n 
1 79  ALA n 
1 80  TYR n 
1 81  LYS n 
1 82  GLU n 
1 83  ALA n 
1 84  SER n 
1 85  ASN n 
1 86  HIS n 
1 87  ILE n 
1 88  ARG n 
1 89  GLU n 
1 90  ILE n 
1 91  PHE n 
1 92  SER n 
1 93  ARG n 
1 94  TYR n 
1 95  THR n 
1 96  SER n 
1 97  ARG n 
1 98  ILE n 
1 99  GLU n 
1 100 PRO n 
1 101 LEU n 
1 102 SER n 
1 103 LEU n 
1 104 ASP n 
1 105 GLU n 
1 106 ALA n 
1 107 TYR n 
1 108 LEU n 
1 109 ASP n 
1 110 VAL n 
1 111 THR n 
1 112 ASP n 
1 113 SER n 
1 114 VAL n 
1 115 HIS n 
1 116 CYS n 
1 117 HIS n 
1 118 GLY n 
1 119 SER n 
1 120 ALA n 
1 121 THR n 
1 122 LEU n 
1 123 ILE n 
1 124 ALA n 
1 125 GLN n 
1 126 GLU n 
1 127 ILE n 
1 128 ARG n 
1 129 GLN n 
1 130 THR n 
1 131 ILE n 
1 132 PHE n 
1 133 ASN n 
1 134 GLU n 
1 135 LEU n 
1 136 GLN n 
1 137 LEU n 
1 138 THR n 
1 139 ALA n 
1 140 SER n 
1 141 ALA n 
1 142 GLY n 
1 143 VAL n 
1 144 ALA n 
1 145 PRO n 
1 146 VAL n 
1 147 LYS n 
1 148 PHE n 
1 149 LEU n 
1 150 ALA n 
1 151 LYS n 
1 152 ILE n 
1 153 ALA n 
1 154 SER n 
1 155 ASP n 
1 156 MET n 
1 157 ASN n 
1 158 LYS n 
1 159 PRO n 
1 160 ASN n 
1 161 GLY n 
1 162 GLN n 
1 163 PHE n 
1 164 VAL n 
1 165 ILE n 
1 166 THR n 
1 167 PRO n 
1 168 ALA n 
1 169 GLU n 
1 170 VAL n 
1 171 PRO n 
1 172 ALA n 
1 173 PHE n 
1 174 LEU n 
1 175 GLN n 
1 176 THR n 
1 177 LEU n 
1 178 PRO n 
1 179 LEU n 
1 180 ALA n 
1 181 LYS n 
1 182 ILE n 
1 183 PRO n 
1 184 GLY n 
1 185 VAL n 
1 186 GLY n 
1 187 LYS n 
1 188 VAL n 
1 189 SER n 
1 190 ALA n 
1 191 ALA n 
1 192 LYS n 
1 193 LEU n 
1 194 GLU n 
1 195 ALA n 
1 196 MET n 
1 197 GLY n 
1 198 LEU n 
1 199 ARG n 
1 200 THR n 
1 201 CYS n 
1 202 GLY n 
1 203 ASP n 
1 204 VAL n 
1 205 GLN n 
1 206 LYS n 
1 207 CYS n 
1 208 ASP n 
1 209 LEU n 
1 210 VAL n 
1 211 MET n 
1 212 LEU n 
1 213 LEU n 
1 214 LYS n 
1 215 ARG n 
1 216 PHE n 
1 217 GLY n 
1 218 LYS n 
1 219 PHE n 
1 220 GLY n 
1 221 ARG n 
1 222 ILE n 
1 223 LEU n 
1 224 TRP n 
1 225 GLU n 
1 226 ARG n 
1 227 SER n 
1 228 GLN n 
1 229 GLY n 
1 230 ILE n 
1 231 ASP n 
1 232 GLU n 
1 233 ARG n 
1 234 ASP n 
1 235 VAL n 
1 236 ASN n 
1 237 SER n 
1 238 GLU n 
1 239 ARG n 
1 240 LEU n 
1 241 ARG n 
1 242 LYS n 
1 243 SER n 
1 244 VAL n 
1 245 GLY n 
1 246 VAL n 
1 247 GLU n 
1 248 ARG n 
1 249 THR n 
1 250 MET n 
1 251 ALA n 
1 252 GLU n 
1 253 ASP n 
1 254 ILE n 
1 255 HIS n 
1 256 HIS n 
1 257 TRP n 
1 258 SER n 
1 259 GLU n 
1 260 CYS n 
1 261 GLU n 
1 262 ALA n 
1 263 ILE n 
1 264 ILE n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 TYR n 
1 269 PRO n 
1 270 GLU n 
1 271 LEU n 
1 272 GLU n 
1 273 ARG n 
1 274 ARG n 
1 275 LEU n 
1 276 ALA n 
1 277 LYS n 
1 278 VAL n 
1 279 LYS n 
1 280 PRO n 
1 281 ASP n 
1 282 LEU n 
1 283 LEU n 
1 284 ILE n 
1 285 ALA n 
1 286 ARG n 
1 287 GLN n 
1 288 GLY n 
1 289 VAL n 
1 290 LYS n 
1 291 LEU n 
1 292 LYS n 
1 293 PHE n 
1 294 ASP n 
1 295 ASP n 
1 296 PHE n 
1 297 GLN n 
1 298 GLN n 
1 299 THR n 
1 300 THR n 
1 301 GLN n 
1 302 GLU n 
1 303 HIS n 
1 304 VAL n 
1 305 TRP n 
1 306 PRO n 
1 307 ARG n 
1 308 LEU n 
1 309 ASN n 
1 310 LYS n 
1 311 ALA n 
1 312 ASP n 
1 313 LEU n 
1 314 ILE n 
1 315 ALA n 
1 316 THR n 
1 317 ALA n 
1 318 ARG n 
1 319 LYS n 
1 320 THR n 
1 321 TRP n 
1 322 ASP n 
1 323 GLU n 
1 324 ARG n 
1 325 ARG n 
1 326 GLY n 
1 327 GLY n 
1 328 ARG n 
1 329 GLY n 
1 330 VAL n 
1 331 ARG n 
1 332 LEU n 
1 333 VAL n 
1 334 GLY n 
1 335 LEU n 
1 336 HIS n 
1 337 VAL n 
1 338 THR n 
1 339 LEU n 
1 340 LEU n 
1 341 ASP n 
1 342 PRO n 
1 343 GLN n 
1 344 MET n 
1 345 GLU n 
1 346 ARG n 
1 347 GLN n 
1 348 LEU n 
1 349 VAL n 
1 350 LEU n 
1 351 GLY n 
1 352 LEU n 
2 1   DT  n 
2 2   DC  n 
2 3   DT  n 
2 4   DA  n 
2 5   DG  n 
2 6   DG  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DT  n 
2 12  DA  n 
2 13  DG  n 
2 14  DG  n 
2 15  DA  n 
2 16  DC  n 
2 17  DC  n 
2 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   352 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dinB, dinP, b0231, JW0221' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     83333 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               K-12 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       18 
_pdbx_entity_src_syn.organism_scientific    'Escherichia coli' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       562 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPO4_ECOLI Q47155 ? 1 
;RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKE
ASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQ
FVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRK
SVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWD
ERRGGRGVRLVGLHVTLLDPQMERQLVLGL
;
2 
2 PDB 5YUS       5YUS   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5YUS F 3 ? 352 ? Q47155 2   ? 351 ? 2   351 
2 1 5YUS A 3 ? 352 ? Q47155 2   ? 351 ? 2   351 
3 2 5YUS G 1 ? 18  ? 5YUS   837 ? 854 ? 837 854 
4 2 5YUS H 1 ? 18  ? 5YUS   856 ? 873 ? 856 873 
5 2 5YUS B 1 ? 18  ? 5YUS   837 ? 854 ? 837 854 
6 2 5YUS C 1 ? 18  ? 5YUS   856 ? 873 ? 856 873 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5YUS GLY F 1 ? UNP Q47155 ? ? 'expression tag' 0 1 
1 5YUS SER F 2 ? UNP Q47155 ? ? 'expression tag' 1 2 
2 5YUS GLY A 1 ? UNP Q47155 ? ? 'expression tag' 0 3 
2 5YUS SER A 2 ? UNP Q47155 ? ? 'expression tag' 1 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"          ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5YUS 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.70 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.45 
_exptl_crystal.description                 'THE ENTRY CONTAINS FRIEDEL PAIRS IN I/F_PLUS/MINUS COLUMNS.' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15% MPD , pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR CCD 130 mm' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-09-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95372 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.95372 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5YUS 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.94 
_reflns.d_resolution_low                 57.12 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       80323 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.94 
_reflns_shell.d_res_low                   2.04 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           11636 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.571 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.749 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  'SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS.' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5YUS 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.940 
_refine.ls_d_res_low                             44.721 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     80158 
_refine.ls_number_reflns_R_free                  7791 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.78 
_refine.ls_percent_reflns_R_free                 4.98 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1918 
_refine.ls_R_factor_R_free                       0.2277 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1899 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.02 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.41 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5374 
_refine_hist.pdbx_number_atoms_nucleic_acid   1356 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             682 
_refine_hist.number_atoms_total               7474 
_refine_hist.d_res_high                       1.940 
_refine_hist.d_res_low                        44.721 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 7053 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.019  ? 9825 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 18.492 ? 4040 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.055  ? 1102 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 1031 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9400 1.9620  . . 263 4976 100.00 . . . 0.3655 . 0.3231 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9620 1.9851  . . 231 4887 100.00 . . . 0.3198 . 0.2955 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9851 2.0093  . . 273 4963 100.00 . . . 0.3231 . 0.2961 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0093 2.0348  . . 269 5038 100.00 . . . 0.3304 . 0.2839 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0348 2.0615  . . 247 4908 100.00 . . . 0.3058 . 0.2858 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0615 2.0898  . . 225 4977 100.00 . . . 0.3193 . 0.2762 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0898 2.1196  . . 230 5068 100.00 . . . 0.2845 . 0.2551 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1196 2.1513  . . 256 4896 100.00 . . . 0.2691 . 0.2316 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1513 2.1849  . . 247 5004 100.00 . . . 0.2677 . 0.2286 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1849 2.2207  . . 246 4965 100.00 . . . 0.2816 . 0.2306 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2207 2.2590  . . 274 4994 100.00 . . . 0.2962 . 0.2456 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2590 2.3001  . . 274 4896 100.00 . . . 0.2859 . 0.2292 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3001 2.3443  . . 275 4946 100.00 . . . 0.2848 . 0.2260 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3443 2.3922  . . 272 4996 100.00 . . . 0.2747 . 0.2330 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3922 2.4442  . . 241 4934 100.00 . . . 0.2835 . 0.2278 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4442 2.5010  . . 262 4934 100.00 . . . 0.2723 . 0.2225 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5010 2.5636  . . 288 5003 100.00 . . . 0.2840 . 0.2135 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5636 2.6329  . . 262 4927 100.00 . . . 0.2226 . 0.2085 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6329 2.7103  . . 291 4976 100.00 . . . 0.2489 . 0.2037 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7103 2.7978  . . 285 4873 100.00 . . . 0.2460 . 0.2069 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7978 2.8978  . . 265 4989 100.00 . . . 0.2555 . 0.2132 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8978 3.0138  . . 241 4948 100.00 . . . 0.2490 . 0.1988 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0138 3.1509  . . 254 5005 100.00 . . . 0.2317 . 0.1882 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1509 3.3170  . . 238 4958 100.00 . . . 0.2233 . 0.1737 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3170 3.5247  . . 237 4974 100.00 . . . 0.1739 . 0.1683 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5247 3.7968  . . 275 4963 100.00 . . . 0.2263 . 0.1640 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7968 4.1786  . . 268 4964 100.00 . . . 0.2066 . 0.1550 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1786 4.7826  . . 242 5003 100.00 . . . 0.2011 . 0.1413 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7826 6.0233  . . 282 4898 100.00 . . . 0.1842 . 0.1615 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.0233 44.7326 . . 278 4650 94.00  . . . 0.1603 . 0.1618 . . . . . . . . . . 
# 
_struct.entry_id                     5YUS 
_struct.title                        'DNA polymerase IV - DNA ternary complex 2' 
_struct.pdbx_descriptor              'DNA polymerase IV/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5YUS 
_struct_keywords.text            'DNA POLYMERASE, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 12  ? ASP A 21  ? CYS F 11  ASP F 20  1 ? 10 
HELX_P HELX_P2  AA2 ASN A 22  ? ARG A 26  ? ASN F 21  ARG F 25  5 ? 5  
HELX_P HELX_P3  AA3 ASN A 46  ? LYS A 51  ? ASN F 45  LYS F 50  1 ? 6  
HELX_P HELX_P4  AA4 PRO A 59  ? CYS A 67  ? PRO F 58  CYS F 66  1 ? 9  
HELX_P HELX_P5  AA5 ARG A 76  ? ARG A 93  ? ARG F 75  ARG F 92  1 ? 18 
HELX_P HELX_P6  AA6 SER A 119 ? GLN A 136 ? SER F 118 GLN F 135 1 ? 18 
HELX_P HELX_P7  AA7 VAL A 146 ? ASN A 157 ? VAL F 145 ASN F 156 1 ? 12 
HELX_P HELX_P8  AA8 THR A 166 ? ALA A 168 ? THR F 165 ALA F 167 5 ? 3  
HELX_P HELX_P9  AA9 GLU A 169 ? THR A 176 ? GLU F 168 THR F 175 1 ? 8  
HELX_P HELX_P10 AB1 PRO A 178 ? ILE A 182 ? PRO F 177 ILE F 181 5 ? 5  
HELX_P HELX_P11 AB2 GLY A 186 ? ALA A 195 ? GLY F 185 ALA F 194 1 ? 10 
HELX_P HELX_P12 AB3 THR A 200 ? LYS A 206 ? THR F 199 LYS F 205 1 ? 7  
HELX_P HELX_P13 AB4 ASP A 208 ? GLY A 217 ? ASP F 207 GLY F 216 1 ? 10 
HELX_P HELX_P14 AB5 GLY A 217 ? SER A 227 ? GLY F 216 SER F 226 1 ? 11 
HELX_P HELX_P15 AB6 HIS A 256 ? LYS A 279 ? HIS F 255 LYS F 278 1 ? 24 
HELX_P HELX_P16 AB7 ASN A 309 ? ARG A 325 ? ASN F 308 ARG F 324 1 ? 17 
HELX_P HELX_P17 AB8 CYS B 12  ? ASN B 22  ? CYS A 11  ASN A 21  1 ? 11 
HELX_P HELX_P18 AB9 PRO B 23  ? ARG B 26  ? PRO A 22  ARG A 25  5 ? 4  
HELX_P HELX_P19 AC1 ASN B 46  ? LYS B 51  ? ASN A 45  LYS A 50  1 ? 6  
HELX_P HELX_P20 AC2 PRO B 59  ? CYS B 67  ? PRO A 58  CYS A 66  1 ? 9  
HELX_P HELX_P21 AC3 ARG B 76  ? ARG B 93  ? ARG A 75  ARG A 92  1 ? 18 
HELX_P HELX_P22 AC4 SER B 119 ? GLN B 136 ? SER A 118 GLN A 135 1 ? 18 
HELX_P HELX_P23 AC5 VAL B 146 ? ASN B 157 ? VAL A 145 ASN A 156 1 ? 12 
HELX_P HELX_P24 AC6 THR B 166 ? ALA B 168 ? THR A 165 ALA A 167 5 ? 3  
HELX_P HELX_P25 AC7 GLU B 169 ? THR B 176 ? GLU A 168 THR A 175 1 ? 8  
HELX_P HELX_P26 AC8 PRO B 178 ? ILE B 182 ? PRO A 177 ILE A 181 5 ? 5  
HELX_P HELX_P27 AC9 GLY B 186 ? MET B 196 ? GLY A 185 MET A 195 1 ? 11 
HELX_P HELX_P28 AD1 THR B 200 ? LYS B 206 ? THR A 199 LYS A 205 1 ? 7  
HELX_P HELX_P29 AD2 ASP B 208 ? GLY B 217 ? ASP A 207 GLY A 216 1 ? 10 
HELX_P HELX_P30 AD3 GLY B 217 ? SER B 227 ? GLY A 216 SER A 226 1 ? 11 
HELX_P HELX_P31 AD4 HIS B 256 ? LYS B 279 ? HIS A 255 LYS A 278 1 ? 24 
HELX_P HELX_P32 AD5 ASN B 309 ? ARG B 325 ? ASN A 308 ARG A 324 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 9   OD1   ? ? ? 1_555 H MG  .  MG ? ? F ASP 8   F MG  901  1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc2  metalc ? ? A MET 10  O     ? ? ? 1_555 H MG  .  MG ? ? F MET 9   F MG  901  1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc3  metalc ? ? A ASP 104 OD1   ? ? ? 1_555 I MG  .  MG ? ? F ASP 103 F MG  902  1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc4  metalc ? ? A ASP 104 OD2   ? ? ? 1_555 H MG  .  MG ? ? F ASP 103 F MG  901  1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc5  metalc ? ? A GLU 105 OE1   ? ? ? 1_555 I MG  .  MG ? ? F GLU 104 F MG  902  1_555 ? ? ? ? ? ? ?            1.912 ? 
metalc6  metalc ? ? B ASP 9   OD1   ? ? ? 1_555 K MG  .  MG ? ? A ASP 8   A MG  901  1_555 ? ? ? ? ? ? ?            2.234 ? 
metalc7  metalc ? ? B ASP 9   OD2   ? ? ? 1_555 L MG  .  MG ? ? A ASP 8   A MG  902  1_555 ? ? ? ? ? ? ?            2.573 ? 
metalc8  metalc ? ? B MET 10  O     ? ? ? 1_555 K MG  .  MG ? ? A MET 9   A MG  901  1_555 ? ? ? ? ? ? ?            2.291 ? 
metalc9  metalc ? ? B ASP 104 OD1   ? ? ? 1_555 L MG  .  MG ? ? A ASP 103 A MG  902  1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc10 metalc ? ? B ASP 104 OD2   ? ? ? 1_555 K MG  .  MG ? ? A ASP 103 A MG  901  1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc11 metalc ? ? B ASP 104 OD2   ? ? ? 1_555 L MG  .  MG ? ? A ASP 103 A MG  902  1_555 ? ? ? ? ? ? ?            2.988 ? 
metalc12 metalc ? ? B GLU 105 OE2   ? ? ? 1_555 L MG  .  MG ? ? A GLU 104 A MG  902  1_555 ? ? ? ? ? ? ?            1.900 ? 
metalc13 metalc ? ? D DC  18  "O3'" ? ? ? 1_555 I MG  .  MG ? ? H DC  873 F MG  902  1_555 ? ? ? ? ? ? ?            2.904 ? 
metalc14 metalc ? ? G TTP .   O1A   ? ? ? 1_555 I MG  .  MG ? ? F TTP 900 F MG  902  1_555 ? ? ? ? ? ? ?            2.632 ? 
metalc15 metalc ? ? G TTP .   O1A   ? ? ? 1_555 H MG  .  MG ? ? F TTP 900 F MG  901  1_555 ? ? ? ? ? ? ?            2.151 ? 
metalc16 metalc ? ? G TTP .   O2B   ? ? ? 1_555 H MG  .  MG ? ? F TTP 900 F MG  901  1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc17 metalc ? ? G TTP .   O1G   ? ? ? 1_555 H MG  .  MG ? ? F TTP 900 F MG  901  1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc18 metalc ? ? I MG  .   MG    ? ? ? 1_555 M HOH .  O  ? ? F MG  902 F HOH 1028 1_555 ? ? ? ? ? ? ?            2.564 ? 
metalc19 metalc ? ? J TTP .   O1A   ? ? ? 1_555 K MG  .  MG ? ? A TTP 900 A MG  901  1_555 ? ? ? ? ? ? ?            2.158 ? 
metalc20 metalc ? ? J TTP .   O1A   ? ? ? 1_555 L MG  .  MG ? ? A TTP 900 A MG  902  1_555 ? ? ? ? ? ? ?            2.458 ? 
metalc21 metalc ? ? J TTP .   O2B   ? ? ? 1_555 K MG  .  MG ? ? A TTP 900 A MG  901  1_555 ? ? ? ? ? ? ?            2.272 ? 
metalc22 metalc ? ? J TTP .   O1G   ? ? ? 1_555 K MG  .  MG ? ? A TTP 900 A MG  901  1_555 ? ? ? ? ? ? ?            2.414 ? 
metalc23 metalc ? ? L MG  .   MG    ? ? ? 1_555 N HOH .  O  ? ? A MG  902 A HOH 1017 1_555 ? ? ? ? ? ? ?            2.687 ? 
hydrog1  hydrog ? ? E DG  5   N1    ? ? ? 1_555 F DC  18 N3 ? ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? E DG  5   N2    ? ? ? 1_555 F DC  18 O2 ? ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? E DG  5   O6    ? ? ? 1_555 F DC  18 N4 ? ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? E DG  6   N1    ? ? ? 1_555 F DC  17 N3 ? ? B DG  842 C DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? E DG  6   N2    ? ? ? 1_555 F DC  17 O2 ? ? B DG  842 C DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? E DG  6   O6    ? ? ? 1_555 F DC  17 N4 ? ? B DG  842 C DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? E DG  7   N1    ? ? ? 1_555 F DC  16 N3 ? ? B DG  843 C DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? E DG  7   N2    ? ? ? 1_555 F DC  16 O2 ? ? B DG  843 C DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? E DG  7   O6    ? ? ? 1_555 F DC  16 N4 ? ? B DG  843 C DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? E DT  8   N3    ? ? ? 1_555 F DA  15 N1 ? ? B DT  844 C DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? E DT  8   O4    ? ? ? 1_555 F DA  15 N6 ? ? B DT  844 C DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? E DC  9   N3    ? ? ? 1_555 F DG  14 N1 ? ? B DC  845 C DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? E DC  9   N4    ? ? ? 1_555 F DG  14 O6 ? ? B DC  845 C DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? E DC  9   O2    ? ? ? 1_555 F DG  14 N2 ? ? B DC  845 C DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? E DC  10  N3    ? ? ? 1_555 F DG  13 N1 ? ? B DC  846 C DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? E DC  10  N4    ? ? ? 1_555 F DG  13 O6 ? ? B DC  846 C DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? E DC  10  O2    ? ? ? 1_555 F DG  13 N2 ? ? B DC  846 C DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? E DT  11  N3    ? ? ? 1_555 F DA  12 N1 ? ? B DT  847 C DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? E DT  11  O4    ? ? ? 1_555 F DA  12 N6 ? ? B DT  847 C DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? E DA  12  N1    ? ? ? 1_555 F DT  11 N3 ? ? B DA  848 C DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? E DA  12  N6    ? ? ? 1_555 F DT  11 O4 ? ? B DA  848 C DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? E DG  13  N1    ? ? ? 1_555 F DC  10 N3 ? ? B DG  849 C DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? E DG  13  N2    ? ? ? 1_555 F DC  10 O2 ? ? B DG  849 C DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? E DG  13  O6    ? ? ? 1_555 F DC  10 N4 ? ? B DG  849 C DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? E DG  14  N1    ? ? ? 1_555 F DC  9  N3 ? ? B DG  850 C DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? E DG  14  N2    ? ? ? 1_555 F DC  9  O2 ? ? B DG  850 C DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? E DG  14  O6    ? ? ? 1_555 F DC  9  N4 ? ? B DG  850 C DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? E DA  15  N1    ? ? ? 1_555 F DT  8  N3 ? ? B DA  851 C DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E DA  15  N6    ? ? ? 1_555 F DT  8  O4 ? ? B DA  851 C DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E DC  16  N3    ? ? ? 1_555 F DG  7  N1 ? ? B DC  852 C DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DC  16  N4    ? ? ? 1_555 F DG  7  O6 ? ? B DC  852 C DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DC  16  O2    ? ? ? 1_555 F DG  7  N2 ? ? B DC  852 C DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DC  17  N3    ? ? ? 1_555 F DG  6  N1 ? ? B DC  853 C DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DC  17  N4    ? ? ? 1_555 F DG  6  O6 ? ? B DC  853 C DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DC  17  O2    ? ? ? 1_555 F DG  6  N2 ? ? B DC  853 C DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DC  18  N3    ? ? ? 1_555 F DG  5  N1 ? ? B DC  854 C DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DC  18  N4    ? ? ? 1_555 F DG  5  O6 ? ? B DC  854 C DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DC  18  O2    ? ? ? 1_555 F DG  5  N2 ? ? B DC  854 C DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG  5   N1    ? ? ? 1_555 D DC  18 N3 ? ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DG  5   N2    ? ? ? 1_555 D DC  18 O2 ? ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG  5   O6    ? ? ? 1_555 D DC  18 N4 ? ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DG  6   N1    ? ? ? 1_555 D DC  17 N3 ? ? G DG  842 H DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DG  6   N2    ? ? ? 1_555 D DC  17 O2 ? ? G DG  842 H DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DG  6   O6    ? ? ? 1_555 D DC  17 N4 ? ? G DG  842 H DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DG  7   N1    ? ? ? 1_555 D DC  16 N3 ? ? G DG  843 H DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DG  7   N2    ? ? ? 1_555 D DC  16 O2 ? ? G DG  843 H DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DG  7   O6    ? ? ? 1_555 D DC  16 N4 ? ? G DG  843 H DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DT  8   N3    ? ? ? 1_555 D DA  15 N1 ? ? G DT  844 H DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DT  8   O4    ? ? ? 1_555 D DA  15 N6 ? ? G DT  844 H DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DC  9   N3    ? ? ? 1_555 D DG  14 N1 ? ? G DC  845 H DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DC  9   N4    ? ? ? 1_555 D DG  14 O6 ? ? G DC  845 H DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DC  9   O2    ? ? ? 1_555 D DG  14 N2 ? ? G DC  845 H DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? C DC  10  N3    ? ? ? 1_555 D DG  13 N1 ? ? G DC  846 H DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? C DC  10  N4    ? ? ? 1_555 D DG  13 O6 ? ? G DC  846 H DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? C DC  10  O2    ? ? ? 1_555 D DG  13 N2 ? ? G DC  846 H DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? C DT  11  N3    ? ? ? 1_555 D DA  12 N1 ? ? G DT  847 H DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? C DT  11  O4    ? ? ? 1_555 D DA  12 N6 ? ? G DT  847 H DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? C DA  12  N1    ? ? ? 1_555 D DT  11 N3 ? ? G DA  848 H DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? C DA  12  N6    ? ? ? 1_555 D DT  11 O4 ? ? G DA  848 H DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? C DG  13  N1    ? ? ? 1_555 D DC  10 N3 ? ? G DG  849 H DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? C DG  13  N2    ? ? ? 1_555 D DC  10 O2 ? ? G DG  849 H DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? C DG  13  O6    ? ? ? 1_555 D DC  10 N4 ? ? G DG  849 H DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? C DG  14  N1    ? ? ? 1_555 D DC  9  N3 ? ? G DG  850 H DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? C DG  14  N2    ? ? ? 1_555 D DC  9  O2 ? ? G DG  850 H DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? C DG  14  O6    ? ? ? 1_555 D DC  9  N4 ? ? G DG  850 H DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? C DA  15  N1    ? ? ? 1_555 D DT  8  N3 ? ? G DA  851 H DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? C DA  15  N6    ? ? ? 1_555 D DT  8  O4 ? ? G DA  851 H DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? C DC  16  N3    ? ? ? 1_555 D DG  7  N1 ? ? G DC  852 H DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? C DC  16  N4    ? ? ? 1_555 D DG  7  O6 ? ? G DC  852 H DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? C DC  16  O2    ? ? ? 1_555 D DG  7  N2 ? ? G DC  852 H DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? C DC  17  N3    ? ? ? 1_555 D DG  6  N1 ? ? G DC  853 H DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? C DC  17  N4    ? ? ? 1_555 D DG  6  O6 ? ? G DC  853 H DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? C DC  17  O2    ? ? ? 1_555 D DG  6  N2 ? ? G DC  853 H DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? C DC  18  N3    ? ? ? 1_555 D DG  5  N1 ? ? G DC  854 H DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? C DC  18  N4    ? ? ? 1_555 D DG  5  O6 ? ? G DC  854 H DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? C DC  18  O2    ? ? ? 1_555 D DG  5  N2 ? ? G DC  854 H DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 158 A . ? LYS 157 F PRO 159 A ? PRO 158 F 1 0.66 
2 LYS 158 B . ? LYS 157 A PRO 159 B ? PRO 158 A 1 1.50 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 98  ? SER A 102 ? ILE F 97  SER F 101 
AA1 2 GLU A 105 ? ASP A 109 ? GLU F 104 ASP F 108 
AA1 3 ILE A 5   ? MET A 10  ? ILE F 4   MET F 9   
AA1 4 ALA A 139 ? ALA A 144 ? ALA F 138 ALA F 143 
AA1 5 GLN A 162 ? VAL A 164 ? GLN F 161 VAL F 163 
AA2 1 ILE A 42  ? ALA A 45  ? ILE F 41  ALA F 44  
AA2 2 ILE A 30  ? GLY A 33  ? ILE F 29  GLY F 32  
AA2 3 THR A 71  ? LEU A 73  ? THR F 70  LEU F 72  
AA3 1 SER A 243 ? ILE A 254 ? SER F 242 ILE F 253 
AA3 2 VAL A 330 ? THR A 338 ? VAL F 329 THR F 337 
AA3 3 ARG A 286 ? PHE A 293 ? ARG F 285 PHE F 292 
AA3 4 GLN A 298 ? VAL A 304 ? GLN F 297 VAL F 303 
AA4 1 ILE B 98  ? SER B 102 ? ILE A 97  SER A 101 
AA4 2 GLU B 105 ? ASP B 109 ? GLU A 104 ASP A 108 
AA4 3 ILE B 5   ? MET B 10  ? ILE A 4   MET A 9   
AA4 4 ALA B 139 ? ALA B 144 ? ALA A 138 ALA A 143 
AA4 5 GLN B 162 ? VAL B 164 ? GLN A 161 VAL A 163 
AA5 1 ILE B 42  ? ALA B 45  ? ILE A 41  ALA A 44  
AA5 2 ILE B 30  ? GLY B 33  ? ILE A 29  GLY A 32  
AA5 3 THR B 71  ? LEU B 73  ? THR A 70  LEU A 72  
AA6 1 SER B 243 ? ILE B 254 ? SER A 242 ILE A 253 
AA6 2 VAL B 330 ? THR B 338 ? VAL A 329 THR A 337 
AA6 3 ARG B 286 ? PHE B 293 ? ARG A 285 PHE A 292 
AA6 4 GLN B 298 ? VAL B 304 ? GLN A 297 VAL A 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 99  ? N GLU F 98  O TYR A 107 ? O TYR F 106 
AA1 2 3 O LEU A 108 ? O LEU F 107 N ILE A 6   ? N ILE F 5   
AA1 3 4 N ASP A 9   ? N ASP F 8   O SER A 140 ? O SER F 139 
AA1 4 5 N VAL A 143 ? N VAL F 142 O PHE A 163 ? O PHE F 162 
AA2 1 2 O SER A 43  ? O SER F 42  N ILE A 32  ? N ILE F 31  
AA2 2 3 N ALA A 31  ? N ALA F 30  O LEU A 73  ? O LEU F 72  
AA3 1 2 N VAL A 246 ? N VAL F 245 O LEU A 335 ? O LEU F 334 
AA3 2 3 O HIS A 336 ? O HIS F 335 N GLY A 288 ? N GLY F 287 
AA3 3 4 N LEU A 291 ? N LEU F 290 O THR A 299 ? O THR F 298 
AA4 1 2 N GLU B 99  ? N GLU A 98  O TYR B 107 ? O TYR A 106 
AA4 2 3 O LEU B 108 ? O LEU A 107 N ILE B 6   ? N ILE A 5   
AA4 3 4 N ASP B 9   ? N ASP A 8   O SER B 140 ? O SER A 139 
AA4 4 5 N VAL B 143 ? N VAL A 142 O PHE B 163 ? O PHE A 162 
AA5 1 2 O SER B 43  ? O SER A 42  N ILE B 32  ? N ILE A 31  
AA5 2 3 N ALA B 31  ? N ALA A 30  O LEU B 73  ? O LEU A 72  
AA6 1 2 N VAL B 246 ? N VAL A 245 O LEU B 335 ? O LEU A 334 
AA6 2 3 O THR B 338 ? O THR A 337 N ARG B 286 ? N ARG A 285 
AA6 3 4 N LEU B 291 ? N LEU A 290 O THR B 299 ? O THR A 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software F TTP 900 ? 22 'binding site for residue TTP F 900' 
AC2 Software F MG  901 ? 5  'binding site for residue MG F 901'  
AC3 Software F MG  902 ? 7  'binding site for residue MG F 902'  
AC4 Software A TTP 900 ? 20 'binding site for residue TTP A 900' 
AC5 Software A MG  901 ? 5  'binding site for residue MG A 901'  
AC6 Software A MG  902 ? 7  'binding site for residue MG A 902'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 ASP A 9   ? ASP F 8    . ? 1_555 ? 
2  AC1 22 MET A 10  ? MET F 9    . ? 1_555 ? 
3  AC1 22 ASP A 11  ? ASP F 10   . ? 1_555 ? 
4  AC1 22 CYS A 12  ? CYS F 11   . ? 1_555 ? 
5  AC1 22 PHE A 13  ? PHE F 12   . ? 1_555 ? 
6  AC1 22 PHE A 14  ? PHE F 13   . ? 1_555 ? 
7  AC1 22 SER A 43  ? SER F 42   . ? 1_555 ? 
8  AC1 22 THR A 44  ? THR F 43   . ? 1_555 ? 
9  AC1 22 ARG A 50  ? ARG F 49   . ? 1_555 ? 
10 AC1 22 ASP A 104 ? ASP F 103  . ? 1_555 ? 
11 AC1 22 LYS A 158 ? LYS F 157  . ? 1_555 ? 
12 AC1 22 MG  H .   ? MG  F 901  . ? 1_555 ? 
13 AC1 22 MG  I .   ? MG  F 902  . ? 1_555 ? 
14 AC1 22 HOH M .   ? HOH F 1024 . ? 1_555 ? 
15 AC1 22 HOH M .   ? HOH F 1028 . ? 1_555 ? 
16 AC1 22 HOH M .   ? HOH F 1056 . ? 1_555 ? 
17 AC1 22 HOH M .   ? HOH F 1103 . ? 1_555 ? 
18 AC1 22 HOH M .   ? HOH F 1140 . ? 1_555 ? 
19 AC1 22 HOH M .   ? HOH F 1171 . ? 1_555 ? 
20 AC1 22 DA  C 4   ? DA  G 840  . ? 1_555 ? 
21 AC1 22 DG  C 5   ? DG  G 841  . ? 1_555 ? 
22 AC1 22 DC  D 18  ? DC  H 873  . ? 1_555 ? 
23 AC2 5  ASP A 9   ? ASP F 8    . ? 1_555 ? 
24 AC2 5  MET A 10  ? MET F 9    . ? 1_555 ? 
25 AC2 5  ASP A 104 ? ASP F 103  . ? 1_555 ? 
26 AC2 5  TTP G .   ? TTP F 900  . ? 1_555 ? 
27 AC2 5  MG  I .   ? MG  F 902  . ? 1_555 ? 
28 AC3 7  ASP A 9   ? ASP F 8    . ? 1_555 ? 
29 AC3 7  ASP A 104 ? ASP F 103  . ? 1_555 ? 
30 AC3 7  GLU A 105 ? GLU F 104  . ? 1_555 ? 
31 AC3 7  TTP G .   ? TTP F 900  . ? 1_555 ? 
32 AC3 7  MG  H .   ? MG  F 901  . ? 1_555 ? 
33 AC3 7  HOH M .   ? HOH F 1028 . ? 1_555 ? 
34 AC3 7  DC  D 18  ? DC  H 873  . ? 1_555 ? 
35 AC4 20 ASP B 9   ? ASP A 8    . ? 1_555 ? 
36 AC4 20 MET B 10  ? MET A 9    . ? 1_555 ? 
37 AC4 20 ASP B 11  ? ASP A 10   . ? 1_555 ? 
38 AC4 20 CYS B 12  ? CYS A 11   . ? 1_555 ? 
39 AC4 20 PHE B 13  ? PHE A 12   . ? 1_555 ? 
40 AC4 20 PHE B 14  ? PHE A 13   . ? 1_555 ? 
41 AC4 20 SER B 43  ? SER A 42   . ? 1_555 ? 
42 AC4 20 THR B 44  ? THR A 43   . ? 1_555 ? 
43 AC4 20 ARG B 50  ? ARG A 49   . ? 1_555 ? 
44 AC4 20 ASP B 104 ? ASP A 103  . ? 1_555 ? 
45 AC4 20 LYS B 158 ? LYS A 157  . ? 1_555 ? 
46 AC4 20 MG  K .   ? MG  A 901  . ? 1_555 ? 
47 AC4 20 MG  L .   ? MG  A 902  . ? 1_555 ? 
48 AC4 20 HOH N .   ? HOH A 1017 . ? 1_555 ? 
49 AC4 20 HOH N .   ? HOH A 1035 . ? 1_555 ? 
50 AC4 20 HOH N .   ? HOH A 1036 . ? 1_555 ? 
51 AC4 20 HOH N .   ? HOH A 1102 . ? 1_555 ? 
52 AC4 20 HOH N .   ? HOH A 1167 . ? 1_555 ? 
53 AC4 20 DA  E 4   ? DA  B 840  . ? 1_555 ? 
54 AC4 20 DC  F 18  ? DC  C 873  . ? 1_555 ? 
55 AC5 5  ASP B 9   ? ASP A 8    . ? 1_555 ? 
56 AC5 5  MET B 10  ? MET A 9    . ? 1_555 ? 
57 AC5 5  ASP B 104 ? ASP A 103  . ? 1_555 ? 
58 AC5 5  TTP J .   ? TTP A 900  . ? 1_555 ? 
59 AC5 5  MG  L .   ? MG  A 902  . ? 1_555 ? 
60 AC6 7  ASP B 9   ? ASP A 8    . ? 1_555 ? 
61 AC6 7  ASP B 104 ? ASP A 103  . ? 1_555 ? 
62 AC6 7  GLU B 105 ? GLU A 104  . ? 1_555 ? 
63 AC6 7  TTP J .   ? TTP A 900  . ? 1_555 ? 
64 AC6 7  MG  K .   ? MG  A 901  . ? 1_555 ? 
65 AC6 7  HOH N .   ? HOH A 1017 . ? 1_555 ? 
66 AC6 7  DC  F 18  ? DC  C 873  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5YUS 
_atom_sites.fract_transf_matrix[1][1]   0.011515 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001007 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017507 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009080 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 59.192  -0.330  166.613 1.00 82.73  ? 0    GLY F N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 60.359  -0.813  167.332 1.00 84.12  ? 0    GLY F CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 61.374  0.269   167.670 1.00 75.41  ? 0    GLY F C     1 
ATOM   4    O  O     . GLY A 1 1   ? 62.583  0.079   167.492 1.00 79.03  ? 0    GLY F O     1 
ATOM   5    N  N     . SER A 1 2   ? 60.893  1.404   168.175 1.00 73.18  ? 1    SER F N     1 
ATOM   6    C  CA    . SER A 1 2   ? 61.760  2.547   168.442 1.00 71.93  ? 1    SER F CA    1 
ATOM   7    C  C     . SER A 1 2   ? 62.388  2.453   169.828 1.00 66.87  ? 1    SER F C     1 
ATOM   8    O  O     . SER A 1 2   ? 61.698  2.188   170.819 1.00 76.91  ? 1    SER F O     1 
ATOM   9    C  CB    . SER A 1 2   ? 60.985  3.860   168.307 1.00 70.32  ? 1    SER F CB    1 
ATOM   10   O  OG    . SER A 1 2   ? 60.787  4.183   166.945 1.00 65.51  ? 1    SER F OG    1 
ATOM   11   N  N     . ARG A 1 3   ? 63.697  2.674   169.888 1.00 61.36  ? 2    ARG F N     1 
ATOM   12   C  CA    . ARG A 1 3   ? 64.396  2.827   171.150 1.00 44.06  ? 2    ARG F CA    1 
ATOM   13   C  C     . ARG A 1 3   ? 64.249  4.264   171.645 1.00 44.36  ? 2    ARG F C     1 
ATOM   14   O  O     . ARG A 1 3   ? 63.933  5.177   170.882 1.00 42.34  ? 2    ARG F O     1 
ATOM   15   C  CB    . ARG A 1 3   ? 65.873  2.480   170.984 1.00 35.96  ? 2    ARG F CB    1 
ATOM   16   C  CG    . ARG A 1 3   ? 66.173  0.990   170.810 1.00 48.24  ? 2    ARG F CG    1 
ATOM   17   C  CD    . ARG A 1 3   ? 67.664  0.816   170.528 1.00 53.08  ? 2    ARG F CD    1 
ATOM   18   N  NE    . ARG A 1 3   ? 67.979  1.300   169.184 1.00 56.57  ? 2    ARG F NE    1 
ATOM   19   C  CZ    . ARG A 1 3   ? 69.164  1.747   168.775 1.00 48.26  ? 2    ARG F CZ    1 
ATOM   20   N  NH1   . ARG A 1 3   ? 70.215  1.806   169.602 1.00 39.15  ? 2    ARG F NH1   1 
ATOM   21   N  NH2   . ARG A 1 3   ? 69.290  2.146   167.517 1.00 49.66  ? 2    ARG F NH2   1 
ATOM   22   N  N     . LYS A 1 4   ? 64.474  4.461   172.940 1.00 49.07  ? 3    LYS F N     1 
ATOM   23   C  CA    . LYS A 1 4   ? 64.583  5.802   173.506 1.00 39.81  ? 3    LYS F CA    1 
ATOM   24   C  C     . LYS A 1 4   ? 66.003  5.963   174.038 1.00 36.62  ? 3    LYS F C     1 
ATOM   25   O  O     . LYS A 1 4   ? 66.392  5.295   175.001 1.00 41.61  ? 3    LYS F O     1 
ATOM   26   C  CB    . LYS A 1 4   ? 63.555  6.042   174.608 1.00 47.29  ? 3    LYS F CB    1 
ATOM   27   C  CG    . LYS A 1 4   ? 62.101  5.743   174.224 1.00 54.45  ? 3    LYS F CG    1 
ATOM   28   C  CD    . LYS A 1 4   ? 61.220  5.767   175.469 1.00 58.46  ? 3    LYS F CD    1 
ATOM   29   C  CE    . LYS A 1 4   ? 60.181  4.647   175.463 1.00 69.68  ? 3    LYS F CE    1 
ATOM   30   N  NZ    . LYS A 1 4   ? 59.895  4.154   176.851 1.00 72.54  ? 3    LYS F NZ    1 
ATOM   31   N  N     . ILE A 1 5   ? 66.762  6.869   173.433 1.00 37.94  ? 4    ILE F N     1 
ATOM   32   C  CA    . ILE A 1 5   ? 68.158  7.092   173.785 1.00 38.09  ? 4    ILE F CA    1 
ATOM   33   C  C     . ILE A 1 5   ? 68.324  8.531   174.253 1.00 40.40  ? 4    ILE F C     1 
ATOM   34   O  O     . ILE A 1 5   ? 67.826  9.468   173.612 1.00 38.33  ? 4    ILE F O     1 
ATOM   35   C  CB    . ILE A 1 5   ? 69.084  6.760   172.603 1.00 27.31  ? 4    ILE F CB    1 
ATOM   36   C  CG1   . ILE A 1 5   ? 68.944  5.258   172.323 1.00 47.46  ? 4    ILE F CG1   1 
ATOM   37   C  CG2   . ILE A 1 5   ? 70.564  7.146   172.915 1.00 29.49  ? 4    ILE F CG2   1 
ATOM   38   C  CD1   . ILE A 1 5   ? 69.174  4.860   170.930 1.00 52.31  ? 4    ILE F CD1   1 
ATOM   39   N  N     . ILE A 1 6   ? 68.968  8.696   175.399 1.00 28.31  ? 5    ILE F N     1 
ATOM   40   C  CA    . ILE A 1 6   ? 69.308  10.013  175.921 1.00 30.26  ? 5    ILE F CA    1 
ATOM   41   C  C     . ILE A 1 6   ? 70.812  10.176  175.786 1.00 35.66  ? 5    ILE F C     1 
ATOM   42   O  O     . ILE A 1 6   ? 71.568  9.212   175.961 1.00 34.28  ? 5    ILE F O     1 
ATOM   43   C  CB    . ILE A 1 6   ? 68.854  10.199  177.383 1.00 33.77  ? 5    ILE F CB    1 
ATOM   44   C  CG1   . ILE A 1 6   ? 67.331  10.049  177.506 1.00 36.57  ? 5    ILE F CG1   1 
ATOM   45   C  CG2   . ILE A 1 6   ? 69.253  11.576  177.897 1.00 31.05  ? 5    ILE F CG2   1 
ATOM   46   C  CD1   . ILE A 1 6   ? 66.830  9.840   178.935 1.00 34.61  ? 5    ILE F CD1   1 
ATOM   47   N  N     . HIS A 1 7   ? 71.238  11.376  175.413 1.00 29.75  ? 6    HIS F N     1 
ATOM   48   C  CA    . HIS A 1 7   ? 72.636  11.765  175.498 1.00 31.13  ? 6    HIS F CA    1 
ATOM   49   C  C     . HIS A 1 7   ? 72.726  12.938  176.463 1.00 33.18  ? 6    HIS F C     1 
ATOM   50   O  O     . HIS A 1 7   ? 72.129  13.985  176.215 1.00 31.65  ? 6    HIS F O     1 
ATOM   51   C  CB    . HIS A 1 7   ? 73.196  12.138  174.125 1.00 28.00  ? 6    HIS F CB    1 
ATOM   52   C  CG    . HIS A 1 7   ? 74.638  12.563  174.162 1.00 28.37  ? 6    HIS F CG    1 
ATOM   53   N  ND1   . HIS A 1 7   ? 75.023  13.889  174.167 1.00 27.08  ? 6    HIS F ND1   1 
ATOM   54   C  CD2   . HIS A 1 7   ? 75.781  11.840  174.196 1.00 32.22  ? 6    HIS F CD2   1 
ATOM   55   C  CE1   . HIS A 1 7   ? 76.345  13.964  174.200 1.00 29.10  ? 6    HIS F CE1   1 
ATOM   56   N  NE2   . HIS A 1 7   ? 76.828  12.733  174.220 1.00 32.46  ? 6    HIS F NE2   1 
ATOM   57   N  N     . VAL A 1 8   ? 73.437  12.749  177.577 1.00 30.97  ? 7    VAL F N     1 
ATOM   58   C  CA    . VAL A 1 8   ? 73.616  13.790  178.585 1.00 29.59  ? 7    VAL F CA    1 
ATOM   59   C  C     . VAL A 1 8   ? 75.015  14.360  178.425 1.00 28.94  ? 7    VAL F C     1 
ATOM   60   O  O     . VAL A 1 8   ? 75.976  13.610  178.243 1.00 30.87  ? 7    VAL F O     1 
ATOM   61   C  CB    . VAL A 1 8   ? 73.401  13.238  180.008 1.00 32.79  ? 7    VAL F CB    1 
ATOM   62   C  CG1   . VAL A 1 8   ? 73.470  14.362  181.026 1.00 30.40  ? 7    VAL F CG1   1 
ATOM   63   C  CG2   . VAL A 1 8   ? 72.060  12.469  180.091 1.00 30.49  ? 7    VAL F CG2   1 
ATOM   64   N  N     . ASP A 1 9   ? 75.135  15.686  178.496 1.00 32.63  ? 8    ASP F N     1 
ATOM   65   C  CA    . ASP A 1 9   ? 76.385  16.374  178.178 1.00 32.88  ? 8    ASP F CA    1 
ATOM   66   C  C     . ASP A 1 9   ? 76.557  17.571  179.103 1.00 26.64  ? 8    ASP F C     1 
ATOM   67   O  O     . ASP A 1 9   ? 75.746  18.495  179.052 1.00 30.31  ? 8    ASP F O     1 
ATOM   68   C  CB    . ASP A 1 9   ? 76.389  16.839  176.715 1.00 37.32  ? 8    ASP F CB    1 
ATOM   69   C  CG    . ASP A 1 9   ? 77.775  17.257  176.233 1.00 39.50  ? 8    ASP F CG    1 
ATOM   70   O  OD1   . ASP A 1 9   ? 78.556  17.813  177.023 1.00 41.83  ? 8    ASP F OD1   1 
ATOM   71   O  OD2   . ASP A 1 9   ? 78.094  17.007  175.057 1.00 47.54  ? 8    ASP F OD2   1 
ATOM   72   N  N     . MET A 1 10  ? 77.616  17.574  179.917 1.00 27.65  ? 9    MET F N     1 
ATOM   73   C  CA    . MET A 1 10  ? 77.807  18.656  180.881 1.00 28.63  ? 9    MET F CA    1 
ATOM   74   C  C     . MET A 1 10  ? 78.159  19.946  180.154 1.00 30.65  ? 9    MET F C     1 
ATOM   75   O  O     . MET A 1 10  ? 78.876  19.934  179.148 1.00 31.98  ? 9    MET F O     1 
ATOM   76   C  CB    . MET A 1 10  ? 78.910  18.328  181.891 1.00 30.36  ? 9    MET F CB    1 
ATOM   77   C  CG    . MET A 1 10  ? 78.650  17.080  182.741 1.00 33.99  ? 9    MET F CG    1 
ATOM   78   S  SD    . MET A 1 10  ? 77.163  17.157  183.750 1.00 35.60  ? 9    MET F SD    1 
ATOM   79   C  CE    . MET A 1 10  ? 77.597  18.480  184.873 1.00 29.98  ? 9    MET F CE    1 
ATOM   80   N  N     . ASP A 1 11  ? 77.644  21.063  180.670 1.00 27.32  ? 10   ASP F N     1 
ATOM   81   C  CA    . ASP A 1 11  ? 77.917  22.375  180.078 1.00 23.79  ? 10   ASP F CA    1 
ATOM   82   C  C     . ASP A 1 11  ? 79.306  22.878  180.475 1.00 29.36  ? 10   ASP F C     1 
ATOM   83   O  O     . ASP A 1 11  ? 79.636  22.922  181.666 1.00 28.97  ? 10   ASP F O     1 
ATOM   84   C  CB    . ASP A 1 11  ? 76.860  23.387  180.527 1.00 24.99  ? 10   ASP F CB    1 
ATOM   85   C  CG    . ASP A 1 11  ? 75.443  23.000  180.081 1.00 31.88  ? 10   ASP F CG    1 
ATOM   86   O  OD1   . ASP A 1 11  ? 75.251  22.621  178.904 1.00 31.16  ? 10   ASP F OD1   1 
ATOM   87   O  OD2   . ASP A 1 11  ? 74.523  23.094  180.906 1.00 33.04  ? 10   ASP F OD2   1 
ATOM   88   N  N     . CYS A 1 12  ? 80.102  23.277  179.480 1.00 26.47  ? 11   CYS F N     1 
ATOM   89   C  CA    . CYS A 1 12  ? 81.440  23.842  179.670 1.00 29.98  ? 11   CYS F CA    1 
ATOM   90   C  C     . CYS A 1 12  ? 82.191  23.155  180.807 1.00 32.12  ? 11   CYS F C     1 
ATOM   91   O  O     . CYS A 1 12  ? 82.666  23.803  181.745 1.00 27.93  ? 11   CYS F O     1 
ATOM   92   C  CB    . CYS A 1 12  ? 81.366  25.349  179.943 1.00 41.04  ? 11   CYS F CB    1 
ATOM   93   S  SG    . CYS A 1 12  ? 80.617  26.273  178.630 1.00 44.88  ? 11   CYS F SG    1 
ATOM   94   N  N     . PHE A 1 13  ? 82.311  21.825  180.685 1.00 29.89  ? 12   PHE F N     1 
ATOM   95   C  CA    . PHE A 1 13  ? 82.542  20.973  181.851 1.00 30.90  ? 12   PHE F CA    1 
ATOM   96   C  C     . PHE A 1 13  ? 83.703  21.462  182.723 1.00 25.12  ? 12   PHE F C     1 
ATOM   97   O  O     . PHE A 1 13  ? 83.494  21.821  183.889 1.00 31.53  ? 12   PHE F O     1 
ATOM   98   C  CB    . PHE A 1 13  ? 82.765  19.517  181.417 1.00 30.04  ? 12   PHE F CB    1 
ATOM   99   C  CG    . PHE A 1 13  ? 82.924  18.568  182.572 1.00 31.99  ? 12   PHE F CG    1 
ATOM   100  C  CD1   . PHE A 1 13  ? 82.080  18.653  183.670 1.00 35.55  ? 12   PHE F CD1   1 
ATOM   101  C  CD2   . PHE A 1 13  ? 83.935  17.606  182.578 1.00 29.09  ? 12   PHE F CD2   1 
ATOM   102  C  CE1   . PHE A 1 13  ? 82.236  17.793  184.748 1.00 41.94  ? 12   PHE F CE1   1 
ATOM   103  C  CE2   . PHE A 1 13  ? 84.090  16.747  183.649 1.00 27.10  ? 12   PHE F CE2   1 
ATOM   104  C  CZ    . PHE A 1 13  ? 83.246  16.835  184.730 1.00 34.55  ? 12   PHE F CZ    1 
ATOM   105  N  N     . PHE A 1 14  ? 84.942  21.446  182.201 1.00 26.97  ? 13   PHE F N     1 
ATOM   106  C  CA    . PHE A 1 14  ? 86.081  21.812  183.049 1.00 31.75  ? 13   PHE F CA    1 
ATOM   107  C  C     . PHE A 1 14  ? 85.889  23.211  183.640 1.00 33.50  ? 13   PHE F C     1 
ATOM   108  O  O     . PHE A 1 14  ? 86.175  23.443  184.822 1.00 33.21  ? 13   PHE F O     1 
ATOM   109  C  CB    . PHE A 1 14  ? 87.417  21.782  182.285 1.00 28.73  ? 13   PHE F CB    1 
ATOM   110  C  CG    . PHE A 1 14  ? 87.881  20.422  181.838 1.00 29.13  ? 13   PHE F CG    1 
ATOM   111  C  CD1   . PHE A 1 14  ? 87.112  19.281  182.017 1.00 24.08  ? 13   PHE F CD1   1 
ATOM   112  C  CD2   . PHE A 1 14  ? 89.126  20.299  181.221 1.00 28.95  ? 13   PHE F CD2   1 
ATOM   113  C  CE1   . PHE A 1 14  ? 87.573  18.038  181.561 1.00 29.95  ? 13   PHE F CE1   1 
ATOM   114  C  CE2   . PHE A 1 14  ? 89.600  19.080  180.791 1.00 29.52  ? 13   PHE F CE2   1 
ATOM   115  C  CZ    . PHE A 1 14  ? 88.829  17.949  180.941 1.00 24.13  ? 13   PHE F CZ    1 
ATOM   116  N  N     . ALA A 1 15  ? 85.405  24.151  182.828 1.00 31.12  ? 14   ALA F N     1 
ATOM   117  C  CA    . ALA A 1 15  ? 85.231  25.527  183.299 1.00 38.06  ? 14   ALA F CA    1 
ATOM   118  C  C     . ALA A 1 15  ? 84.082  25.644  184.297 1.00 36.38  ? 14   ALA F C     1 
ATOM   119  O  O     . ALA A 1 15  ? 84.158  26.434  185.245 1.00 37.20  ? 14   ALA F O     1 
ATOM   120  C  CB    . ALA A 1 15  ? 84.996  26.468  182.115 1.00 32.16  ? 14   ALA F CB    1 
ATOM   121  N  N     . ALA A 1 16  ? 82.994  24.892  184.083 1.00 37.04  ? 15   ALA F N     1 
ATOM   122  C  CA    . ALA A 1 16  ? 81.896  24.905  185.047 1.00 40.80  ? 15   ALA F CA    1 
ATOM   123  C  C     . ALA A 1 16  ? 82.365  24.413  186.409 1.00 37.28  ? 15   ALA F C     1 
ATOM   124  O  O     . ALA A 1 16  ? 81.907  24.899  187.447 1.00 37.02  ? 15   ALA F O     1 
ATOM   125  C  CB    . ALA A 1 16  ? 80.737  24.044  184.543 1.00 38.15  ? 15   ALA F CB    1 
ATOM   126  N  N     . VAL A 1 17  ? 83.268  23.432  186.423 1.00 38.27  ? 16   VAL F N     1 
ATOM   127  C  CA    . VAL A 1 17  ? 83.773  22.919  187.690 1.00 35.17  ? 16   VAL F CA    1 
ATOM   128  C  C     . VAL A 1 17  ? 84.619  23.979  188.383 1.00 36.04  ? 16   VAL F C     1 
ATOM   129  O  O     . VAL A 1 17  ? 84.501  24.183  189.597 1.00 40.36  ? 16   VAL F O     1 
ATOM   130  C  CB    . VAL A 1 17  ? 84.561  21.613  187.468 1.00 36.78  ? 16   VAL F CB    1 
ATOM   131  C  CG1   . VAL A 1 17  ? 85.402  21.294  188.689 1.00 31.10  ? 16   VAL F CG1   1 
ATOM   132  C  CG2   . VAL A 1 17  ? 83.610  20.431  187.123 1.00 31.84  ? 16   VAL F CG2   1 
ATOM   133  N  N     . GLU A 1 18  ? 85.472  24.684  187.623 1.00 37.16  ? 17   GLU F N     1 
ATOM   134  C  CA    . GLU A 1 18  ? 86.311  25.724  188.223 1.00 37.38  ? 17   GLU F CA    1 
ATOM   135  C  C     . GLU A 1 18  ? 85.492  26.900  188.749 1.00 41.26  ? 17   GLU F C     1 
ATOM   136  O  O     . GLU A 1 18  ? 85.902  27.552  189.717 1.00 46.71  ? 17   GLU F O     1 
ATOM   137  C  CB    . GLU A 1 18  ? 87.356  26.239  187.223 1.00 37.97  ? 17   GLU F CB    1 
ATOM   138  C  CG    . GLU A 1 18  ? 88.305  25.173  186.635 1.00 35.38  ? 17   GLU F CG    1 
ATOM   139  C  CD    . GLU A 1 18  ? 89.165  24.472  187.684 1.00 41.70  ? 17   GLU F CD    1 
ATOM   140  O  OE1   . GLU A 1 18  ? 89.290  24.992  188.813 1.00 42.97  ? 17   GLU F OE1   1 
ATOM   141  O  OE2   . GLU A 1 18  ? 89.710  23.391  187.373 1.00 36.32  ? 17   GLU F OE2   1 
ATOM   142  N  N     . MET A 1 19  ? 84.350  27.200  188.137 1.00 42.53  ? 18   MET F N     1 
ATOM   143  C  CA    . MET A 1 19  ? 83.552  28.338  188.600 1.00 45.34  ? 18   MET F CA    1 
ATOM   144  C  C     . MET A 1 19  ? 82.775  28.006  189.867 1.00 47.17  ? 18   MET F C     1 
ATOM   145  O  O     . MET A 1 19  ? 82.664  28.843  190.775 1.00 48.76  ? 18   MET F O     1 
ATOM   146  C  CB    . MET A 1 19  ? 82.588  28.785  187.505 1.00 40.73  ? 18   MET F CB    1 
ATOM   147  C  CG    . MET A 1 19  ? 83.191  29.711  186.460 1.00 42.20  ? 18   MET F CG    1 
ATOM   148  S  SD    . MET A 1 19  ? 82.007  29.837  185.125 1.00 46.61  ? 18   MET F SD    1 
ATOM   149  C  CE    . MET A 1 19  ? 82.371  31.370  184.407 1.00 65.10  ? 18   MET F CE    1 
ATOM   150  N  N     . ARG A 1 20  ? 82.208  26.801  189.932 1.00 47.64  ? 19   ARG F N     1 
ATOM   151  C  CA    . ARG A 1 20  ? 81.625  26.316  191.174 1.00 42.10  ? 19   ARG F CA    1 
ATOM   152  C  C     . ARG A 1 20  ? 82.629  26.404  192.312 1.00 51.45  ? 19   ARG F C     1 
ATOM   153  O  O     . ARG A 1 20  ? 82.320  26.923  193.391 1.00 62.30  ? 19   ARG F O     1 
ATOM   154  C  CB    . ARG A 1 20  ? 81.151  24.873  190.997 1.00 41.13  ? 19   ARG F CB    1 
ATOM   155  C  CG    . ARG A 1 20  ? 80.660  24.235  192.292 1.00 43.01  ? 19   ARG F CG    1 
ATOM   156  C  CD    . ARG A 1 20  ? 80.494  22.736  192.141 1.00 38.01  ? 19   ARG F CD    1 
ATOM   157  N  NE    . ARG A 1 20  ? 81.774  22.042  192.150 1.00 44.13  ? 19   ARG F NE    1 
ATOM   158  C  CZ    . ARG A 1 20  ? 81.921  20.764  191.820 1.00 46.23  ? 19   ARG F CZ    1 
ATOM   159  N  NH1   . ARG A 1 20  ? 80.869  20.052  191.452 1.00 42.76  ? 19   ARG F NH1   1 
ATOM   160  N  NH2   . ARG A 1 20  ? 83.120  20.197  191.857 1.00 45.78  ? 19   ARG F NH2   1 
ATOM   161  N  N     . ASP A 1 21  ? 83.853  25.924  192.078 1.00 45.27  ? 20   ASP F N     1 
ATOM   162  C  CA    . ASP A 1 21  ? 84.873  25.865  193.120 1.00 44.93  ? 20   ASP F CA    1 
ATOM   163  C  C     . ASP A 1 21  ? 85.604  27.187  193.335 1.00 52.87  ? 20   ASP F C     1 
ATOM   164  O  O     . ASP A 1 21  ? 86.540  27.225  194.138 1.00 54.05  ? 20   ASP F O     1 
ATOM   165  C  CB    . ASP A 1 21  ? 85.874  24.756  192.801 1.00 39.98  ? 20   ASP F CB    1 
ATOM   166  C  CG    . ASP A 1 21  ? 85.227  23.390  192.807 1.00 45.98  ? 20   ASP F CG    1 
ATOM   167  O  OD1   . ASP A 1 21  ? 83.995  23.329  192.995 1.00 55.55  ? 20   ASP F OD1   1 
ATOM   168  O  OD2   . ASP A 1 21  ? 85.938  22.388  192.627 1.00 54.42  ? 20   ASP F OD2   1 
ATOM   169  N  N     . ASN A 1 22  ? 85.201  28.259  192.652 1.00 52.33  ? 21   ASN F N     1 
ATOM   170  C  CA    . ASN A 1 22  ? 85.755  29.595  192.860 1.00 50.06  ? 21   ASN F CA    1 
ATOM   171  C  C     . ASN A 1 22  ? 84.814  30.609  192.229 1.00 54.61  ? 21   ASN F C     1 
ATOM   172  O  O     . ASN A 1 22  ? 85.034  31.022  191.084 1.00 56.53  ? 21   ASN F O     1 
ATOM   173  C  CB    . ASN A 1 22  ? 87.151  29.727  192.251 1.00 50.88  ? 21   ASN F CB    1 
ATOM   174  C  CG    . ASN A 1 22  ? 87.787  31.093  192.522 1.00 63.29  ? 21   ASN F CG    1 
ATOM   175  O  OD1   . ASN A 1 22  ? 87.159  31.990  193.089 1.00 64.20  ? 21   ASN F OD1   1 
ATOM   176  N  ND2   . ASN A 1 22  ? 89.037  31.251  192.107 1.00 61.74  ? 21   ASN F ND2   1 
ATOM   177  N  N     . PRO A 1 23  ? 83.761  31.034  192.935 1.00 56.86  ? 22   PRO F N     1 
ATOM   178  C  CA    . PRO A 1 23  ? 82.728  31.864  192.292 1.00 59.40  ? 22   PRO F CA    1 
ATOM   179  C  C     . PRO A 1 23  ? 83.248  33.179  191.745 1.00 60.21  ? 22   PRO F C     1 
ATOM   180  O  O     . PRO A 1 23  ? 82.519  33.844  190.997 1.00 66.00  ? 22   PRO F O     1 
ATOM   181  C  CB    . PRO A 1 23  ? 81.710  32.092  193.417 1.00 67.52  ? 22   PRO F CB    1 
ATOM   182  C  CG    . PRO A 1 23  ? 81.951  30.961  194.378 1.00 66.57  ? 22   PRO F CG    1 
ATOM   183  C  CD    . PRO A 1 23  ? 83.427  30.719  194.332 1.00 62.07  ? 22   PRO F CD    1 
ATOM   184  N  N     . ALA A 1 24  ? 84.480  33.569  192.081 1.00 60.35  ? 23   ALA F N     1 
ATOM   185  C  CA    . ALA A 1 24  ? 85.057  34.784  191.516 1.00 62.97  ? 23   ALA F CA    1 
ATOM   186  C  C     . ALA A 1 24  ? 85.288  34.667  190.017 1.00 63.12  ? 23   ALA F C     1 
ATOM   187  O  O     . ALA A 1 24  ? 85.472  35.688  189.348 1.00 60.99  ? 23   ALA F O     1 
ATOM   188  C  CB    . ALA A 1 24  ? 86.376  35.119  192.216 1.00 64.39  ? 23   ALA F CB    1 
ATOM   189  N  N     . LEU A 1 25  ? 85.289  33.452  189.478 1.00 57.27  ? 24   LEU F N     1 
ATOM   190  C  CA    . LEU A 1 25  ? 85.487  33.232  188.054 1.00 50.64  ? 24   LEU F CA    1 
ATOM   191  C  C     . LEU A 1 25  ? 84.183  33.207  187.271 1.00 56.15  ? 24   LEU F C     1 
ATOM   192  O  O     . LEU A 1 25  ? 84.225  33.065  186.046 1.00 59.37  ? 24   LEU F O     1 
ATOM   193  C  CB    . LEU A 1 25  ? 86.242  31.920  187.836 1.00 50.20  ? 24   LEU F CB    1 
ATOM   194  C  CG    . LEU A 1 25  ? 87.463  31.735  188.736 1.00 51.33  ? 24   LEU F CG    1 
ATOM   195  C  CD1   . LEU A 1 25  ? 87.993  30.300  188.635 1.00 50.76  ? 24   LEU F CD1   1 
ATOM   196  C  CD2   . LEU A 1 25  ? 88.532  32.738  188.362 1.00 47.53  ? 24   LEU F CD2   1 
ATOM   197  N  N     . ARG A 1 26  ? 83.038  33.384  187.943 1.00 56.40  ? 25   ARG F N     1 
ATOM   198  C  CA    . ARG A 1 26  ? 81.736  33.179  187.308 1.00 58.36  ? 25   ARG F CA    1 
ATOM   199  C  C     . ARG A 1 26  ? 81.496  34.142  186.146 1.00 58.91  ? 25   ARG F C     1 
ATOM   200  O  O     . ARG A 1 26  ? 80.887  33.768  185.140 1.00 53.62  ? 25   ARG F O     1 
ATOM   201  C  CB    . ARG A 1 26  ? 80.624  33.312  188.352 1.00 65.97  ? 25   ARG F CB    1 
ATOM   202  C  CG    . ARG A 1 26  ? 79.193  33.242  187.814 1.00 70.17  ? 25   ARG F CG    1 
ATOM   203  C  CD    . ARG A 1 26  ? 78.785  31.821  187.439 1.00 71.23  ? 25   ARG F CD    1 
ATOM   204  N  NE    . ARG A 1 26  ? 79.014  30.877  188.532 1.00 74.94  ? 25   ARG F NE    1 
ATOM   205  C  CZ    . ARG A 1 26  ? 79.028  29.555  188.386 1.00 65.86  ? 25   ARG F CZ    1 
ATOM   206  N  NH1   . ARG A 1 26  ? 78.826  29.017  187.187 1.00 46.10  ? 25   ARG F NH1   1 
ATOM   207  N  NH2   . ARG A 1 26  ? 79.253  28.770  189.434 1.00 65.60  ? 25   ARG F NH2   1 
ATOM   208  N  N     . ASP A 1 27  ? 81.940  35.389  186.249 1.00 58.09  ? 26   ASP F N     1 
ATOM   209  C  CA    . ASP A 1 27  ? 81.518  36.358  185.244 1.00 59.22  ? 26   ASP F CA    1 
ATOM   210  C  C     . ASP A 1 27  ? 82.666  36.938  184.429 1.00 56.33  ? 26   ASP F C     1 
ATOM   211  O  O     . ASP A 1 27  ? 82.428  37.810  183.581 1.00 54.12  ? 26   ASP F O     1 
ATOM   212  C  CB    . ASP A 1 27  ? 80.698  37.472  185.904 1.00 65.78  ? 26   ASP F CB    1 
ATOM   213  C  CG    . ASP A 1 27  ? 79.485  36.926  186.644 1.00 68.72  ? 26   ASP F CG    1 
ATOM   214  O  OD1   . ASP A 1 27  ? 78.622  36.289  185.998 1.00 59.67  ? 26   ASP F OD1   1 
ATOM   215  O  OD2   . ASP A 1 27  ? 79.401  37.121  187.874 1.00 72.49  ? 26   ASP F OD2   1 
ATOM   216  N  N     . ILE A 1 28  ? 83.889  36.465  184.634 1.00 48.15  ? 27   ILE F N     1 
ATOM   217  C  CA    . ILE A 1 28  ? 85.019  36.900  183.819 1.00 50.69  ? 27   ILE F CA    1 
ATOM   218  C  C     . ILE A 1 28  ? 85.344  35.815  182.797 1.00 45.52  ? 27   ILE F C     1 
ATOM   219  O  O     . ILE A 1 28  ? 85.042  34.632  183.022 1.00 47.05  ? 27   ILE F O     1 
ATOM   220  C  CB    . ILE A 1 28  ? 86.244  37.223  184.686 1.00 48.59  ? 27   ILE F CB    1 
ATOM   221  C  CG1   . ILE A 1 28  ? 86.562  36.049  185.614 1.00 45.30  ? 27   ILE F CG1   1 
ATOM   222  C  CG2   . ILE A 1 28  ? 86.036  38.525  185.462 1.00 49.10  ? 27   ILE F CG2   1 
ATOM   223  C  CD1   . ILE A 1 28  ? 87.862  36.231  186.377 1.00 50.67  ? 27   ILE F CD1   1 
ATOM   224  N  N     . PRO A 1 29  ? 85.945  36.171  181.661 1.00 45.27  ? 28   PRO F N     1 
ATOM   225  C  CA    . PRO A 1 29  ? 86.348  35.151  180.680 1.00 37.82  ? 28   PRO F CA    1 
ATOM   226  C  C     . PRO A 1 29  ? 87.464  34.285  181.244 1.00 37.51  ? 28   PRO F C     1 
ATOM   227  O  O     . PRO A 1 29  ? 88.508  34.793  181.659 1.00 39.53  ? 28   PRO F O     1 
ATOM   228  C  CB    . PRO A 1 29  ? 86.821  35.981  179.483 1.00 37.88  ? 28   PRO F CB    1 
ATOM   229  C  CG    . PRO A 1 29  ? 87.245  37.295  180.077 1.00 44.69  ? 28   PRO F CG    1 
ATOM   230  C  CD    . PRO A 1 29  ? 86.300  37.538  181.227 1.00 43.86  ? 28   PRO F CD    1 
ATOM   231  N  N     . ILE A 1 30  ? 87.232  32.972  181.285 1.00 34.83  ? 29   ILE F N     1 
ATOM   232  C  CA    . ILE A 1 30  ? 88.226  32.021  181.770 1.00 32.88  ? 29   ILE F CA    1 
ATOM   233  C  C     . ILE A 1 30  ? 88.322  30.850  180.803 1.00 36.44  ? 29   ILE F C     1 
ATOM   234  O  O     . ILE A 1 30  ? 87.390  30.540  180.058 1.00 33.90  ? 29   ILE F O     1 
ATOM   235  C  CB    . ILE A 1 30  ? 87.908  31.475  183.180 1.00 36.24  ? 29   ILE F CB    1 
ATOM   236  C  CG1   . ILE A 1 30  ? 86.788  30.436  183.107 1.00 31.43  ? 29   ILE F CG1   1 
ATOM   237  C  CG2   . ILE A 1 30  ? 87.536  32.598  184.133 1.00 45.47  ? 29   ILE F CG2   1 
ATOM   238  C  CD1   . ILE A 1 30  ? 86.641  29.633  184.365 1.00 40.97  ? 29   ILE F CD1   1 
ATOM   239  N  N     . ALA A 1 31  ? 89.462  30.170  180.848 1.00 36.56  ? 30   ALA F N     1 
ATOM   240  C  CA    . ALA A 1 31  ? 89.647  28.966  180.056 1.00 35.78  ? 30   ALA F CA    1 
ATOM   241  C  C     . ALA A 1 31  ? 90.621  28.061  180.787 1.00 41.11  ? 30   ALA F C     1 
ATOM   242  O  O     . ALA A 1 31  ? 91.500  28.534  181.511 1.00 38.71  ? 30   ALA F O     1 
ATOM   243  C  CB    . ALA A 1 31  ? 90.185  29.264  178.652 1.00 26.29  ? 30   ALA F CB    1 
ATOM   244  N  N     . ILE A 1 32  ? 90.443  26.758  180.605 1.00 32.78  ? 31   ILE F N     1 
ATOM   245  C  CA    . ILE A 1 32  ? 91.446  25.777  181.000 1.00 30.10  ? 31   ILE F CA    1 
ATOM   246  C  C     . ILE A 1 32  ? 92.339  25.563  179.789 1.00 30.31  ? 31   ILE F C     1 
ATOM   247  O  O     . ILE A 1 32  ? 91.847  25.210  178.711 1.00 34.43  ? 31   ILE F O     1 
ATOM   248  C  CB    . ILE A 1 32  ? 90.813  24.449  181.453 1.00 33.76  ? 31   ILE F CB    1 
ATOM   249  C  CG1   . ILE A 1 32  ? 90.092  24.607  182.797 1.00 32.20  ? 31   ILE F CG1   1 
ATOM   250  C  CG2   . ILE A 1 32  ? 91.913  23.377  181.584 1.00 33.19  ? 31   ILE F CG2   1 
ATOM   251  C  CD1   . ILE A 1 32  ? 88.743  25.273  182.710 1.00 36.04  ? 31   ILE F CD1   1 
ATOM   252  N  N     . GLY A 1 33  ? 93.637  25.766  179.958 1.00 31.91  ? 32   GLY F N     1 
ATOM   253  C  CA    . GLY A 1 33  ? 94.558  25.560  178.863 1.00 34.17  ? 32   GLY F CA    1 
ATOM   254  C  C     . GLY A 1 33  ? 95.959  25.985  179.250 1.00 38.70  ? 32   GLY F C     1 
ATOM   255  O  O     . GLY A 1 33  ? 96.158  26.777  180.176 1.00 35.53  ? 32   GLY F O     1 
ATOM   256  N  N     . GLY A 1 34  ? 96.925  25.462  178.499 1.00 35.60  ? 33   GLY F N     1 
ATOM   257  C  CA    . GLY A 1 34  ? 98.309  25.808  178.745 1.00 34.17  ? 33   GLY F CA    1 
ATOM   258  C  C     . GLY A 1 34  ? 98.622  27.236  178.339 1.00 41.65  ? 33   GLY F C     1 
ATOM   259  O  O     . GLY A 1 34  ? 98.019  27.806  177.427 1.00 38.41  ? 33   GLY F O     1 
ATOM   260  N  N     . SER A 1 35  ? 99.599  27.819  179.025 1.00 34.81  ? 34   SER F N     1 
ATOM   261  C  CA    . SER A 1 35  ? 99.971  29.190  178.734 1.00 38.18  ? 34   SER F CA    1 
ATOM   262  C  C     . SER A 1 35  ? 100.548 29.308  177.325 1.00 38.76  ? 34   SER F C     1 
ATOM   263  O  O     . SER A 1 35  ? 100.999 28.330  176.719 1.00 39.31  ? 34   SER F O     1 
ATOM   264  C  CB    . SER A 1 35  ? 100.978 29.695  179.758 1.00 42.31  ? 34   SER F CB    1 
ATOM   265  O  OG    . SER A 1 35  ? 102.189 28.979  179.631 1.00 41.64  ? 34   SER F OG    1 
ATOM   266  N  N     . ARG A 1 36  ? 100.498 30.531  176.796 1.00 36.09  ? 35   ARG F N     1 
ATOM   267  C  CA    . ARG A 1 36  ? 101.173 30.828  175.537 1.00 36.71  ? 35   ARG F CA    1 
ATOM   268  C  C     . ARG A 1 36  ? 102.650 30.461  175.607 1.00 47.01  ? 35   ARG F C     1 
ATOM   269  O  O     . ARG A 1 36  ? 103.216 29.970  174.623 1.00 42.19  ? 35   ARG F O     1 
ATOM   270  C  CB    . ARG A 1 36  ? 100.986 32.310  175.182 1.00 40.06  ? 35   ARG F CB    1 
ATOM   271  C  CG    . ARG A 1 36  ? 101.931 32.820  174.092 1.00 49.29  ? 35   ARG F CG    1 
ATOM   272  C  CD    . ARG A 1 36  ? 101.360 33.991  173.301 1.00 57.76  ? 35   ARG F CD    1 
ATOM   273  N  NE    . ARG A 1 36  ? 101.007 35.136  174.136 1.00 66.99  ? 35   ARG F NE    1 
ATOM   274  C  CZ    . ARG A 1 36  ? 100.167 36.101  173.762 1.00 78.39  ? 35   ARG F CZ    1 
ATOM   275  N  NH1   . ARG A 1 36  ? 99.583  36.054  172.567 1.00 77.68  ? 35   ARG F NH1   1 
ATOM   276  N  NH2   . ARG A 1 36  ? 99.900  37.114  174.580 1.00 75.44  ? 35   ARG F NH2   1 
ATOM   277  N  N     . GLU A 1 37  ? 103.277 30.660  176.773 1.00 45.51  ? 36   GLU F N     1 
ATOM   278  C  CA    . GLU A 1 37  ? 104.688 30.327  176.944 1.00 46.73  ? 36   GLU F CA    1 
ATOM   279  C  C     . GLU A 1 37  ? 104.903 28.817  176.993 1.00 38.48  ? 36   GLU F C     1 
ATOM   280  O  O     . GLU A 1 37  ? 105.957 28.329  176.571 1.00 44.44  ? 36   GLU F O     1 
ATOM   281  C  CB    . GLU A 1 37  ? 105.232 30.997  178.209 1.00 48.41  ? 36   GLU F CB    1 
ATOM   282  C  CG    . GLU A 1 37  ? 105.342 32.546  178.141 1.00 61.96  ? 36   GLU F CG    1 
ATOM   283  C  CD    . GLU A 1 37  ? 104.010 33.304  178.352 1.00 73.24  ? 36   GLU F CD    1 
ATOM   284  O  OE1   . GLU A 1 37  ? 102.973 32.684  178.691 1.00 53.99  ? 36   GLU F OE1   1 
ATOM   285  O  OE2   . GLU A 1 37  ? 104.007 34.545  178.177 1.00 82.55  ? 36   GLU F OE2   1 
ATOM   286  N  N     . ARG A 1 38  ? 103.924 28.059  177.492 1.00 36.00  ? 37   ARG F N     1 
ATOM   287  C  CA    . ARG A 1 38  ? 103.977 26.604  177.375 1.00 39.45  ? 37   ARG F CA    1 
ATOM   288  C  C     . ARG A 1 38  ? 103.477 26.102  176.013 1.00 41.56  ? 37   ARG F C     1 
ATOM   289  O  O     . ARG A 1 38  ? 103.360 24.885  175.831 1.00 35.97  ? 37   ARG F O     1 
ATOM   290  C  CB    . ARG A 1 38  ? 103.171 25.941  178.508 1.00 37.19  ? 37   ARG F CB    1 
ATOM   291  C  CG    . ARG A 1 38  ? 103.794 26.058  179.912 1.00 47.59  ? 37   ARG F CG    1 
ATOM   292  C  CD    . ARG A 1 38  ? 104.883 25.009  180.155 1.00 48.52  ? 37   ARG F CD    1 
ATOM   293  N  NE    . ARG A 1 38  ? 104.355 23.666  179.927 1.00 48.43  ? 37   ARG F NE    1 
ATOM   294  C  CZ    . ARG A 1 38  ? 103.738 22.928  180.846 1.00 54.84  ? 37   ARG F CZ    1 
ATOM   295  N  NH1   . ARG A 1 38  ? 103.589 23.390  182.082 1.00 64.18  ? 37   ARG F NH1   1 
ATOM   296  N  NH2   . ARG A 1 38  ? 103.272 21.721  180.528 1.00 46.72  ? 37   ARG F NH2   1 
ATOM   297  N  N     . ARG A 1 39  ? 103.179 26.999  175.064 1.00 43.61  ? 38   ARG F N     1 
ATOM   298  C  CA    . ARG A 1 39  ? 102.708 26.630  173.719 1.00 43.11  ? 38   ARG F CA    1 
ATOM   299  C  C     . ARG A 1 39  ? 101.397 25.840  173.772 1.00 37.28  ? 38   ARG F C     1 
ATOM   300  O  O     . ARG A 1 39  ? 101.178 24.902  173.003 1.00 32.71  ? 38   ARG F O     1 
ATOM   301  C  CB    . ARG A 1 39  ? 103.780 25.858  172.949 1.00 36.09  ? 38   ARG F CB    1 
ATOM   302  C  CG    . ARG A 1 39  ? 105.066 26.658  172.784 1.00 42.89  ? 38   ARG F CG    1 
ATOM   303  C  CD    . ARG A 1 39  ? 105.869 26.182  171.592 1.00 45.23  ? 38   ARG F CD    1 
ATOM   304  N  NE    . ARG A 1 39  ? 106.656 24.999  171.913 1.00 40.15  ? 38   ARG F NE    1 
ATOM   305  C  CZ    . ARG A 1 39  ? 107.626 24.516  171.141 1.00 44.38  ? 38   ARG F CZ    1 
ATOM   306  N  NH1   . ARG A 1 39  ? 107.920 25.119  169.997 1.00 41.72  ? 38   ARG F NH1   1 
ATOM   307  N  NH2   . ARG A 1 39  ? 108.304 23.432  171.514 1.00 39.50  ? 38   ARG F NH2   1 
ATOM   308  N  N     . GLY A 1 40  ? 100.508 26.246  174.673 1.00 38.29  ? 39   GLY F N     1 
ATOM   309  C  CA    . GLY A 1 40  ? 99.309  25.485  174.947 1.00 39.55  ? 39   GLY F CA    1 
ATOM   310  C  C     . GLY A 1 40  ? 98.147  25.817  174.028 1.00 34.28  ? 39   GLY F C     1 
ATOM   311  O  O     . GLY A 1 40  ? 98.206  26.731  173.198 1.00 33.46  ? 39   GLY F O     1 
ATOM   312  N  N     . VAL A 1 41  ? 97.087  25.012  174.161 1.00 33.56  ? 40   VAL F N     1 
ATOM   313  C  CA    . VAL A 1 41  ? 95.804  25.269  173.528 1.00 42.37  ? 40   VAL F CA    1 
ATOM   314  C  C     . VAL A 1 41  ? 94.736  25.261  174.612 1.00 37.00  ? 40   VAL F C     1 
ATOM   315  O  O     . VAL A 1 41  ? 94.971  24.858  175.754 1.00 30.43  ? 40   VAL F O     1 
ATOM   316  C  CB    . VAL A 1 41  ? 95.435  24.248  172.425 1.00 45.81  ? 40   VAL F CB    1 
ATOM   317  C  CG1   . VAL A 1 41  ? 96.588  23.980  171.484 1.00 30.84  ? 40   VAL F CG1   1 
ATOM   318  C  CG2   . VAL A 1 41  ? 94.925  22.992  173.027 1.00 45.51  ? 40   VAL F CG2   1 
ATOM   319  N  N     . ILE A 1 42  ? 93.551  25.722  174.230 1.00 26.06  ? 41   ILE F N     1 
ATOM   320  C  CA    . ILE A 1 42  ? 92.427  25.804  175.147 1.00 24.23  ? 41   ILE F CA    1 
ATOM   321  C  C     . ILE A 1 42  ? 91.767  24.443  175.233 1.00 25.54  ? 41   ILE F C     1 
ATOM   322  O  O     . ILE A 1 42  ? 91.387  23.868  174.208 1.00 27.62  ? 41   ILE F O     1 
ATOM   323  C  CB    . ILE A 1 42  ? 91.416  26.858  174.671 1.00 25.39  ? 41   ILE F CB    1 
ATOM   324  C  CG1   . ILE A 1 42  ? 92.058  28.264  174.633 1.00 30.06  ? 41   ILE F CG1   1 
ATOM   325  C  CG2   . ILE A 1 42  ? 90.139  26.770  175.499 1.00 25.85  ? 41   ILE F CG2   1 
ATOM   326  C  CD1   . ILE A 1 42  ? 92.754  28.619  175.902 1.00 28.59  ? 41   ILE F CD1   1 
ATOM   327  N  N     . SER A 1 43  ? 91.582  23.939  176.453 1.00 28.91  ? 42   SER F N     1 
ATOM   328  C  CA    . SER A 1 43  ? 90.772  22.733  176.597 1.00 23.17  ? 42   SER F CA    1 
ATOM   329  C  C     . SER A 1 43  ? 89.299  23.086  176.515 1.00 23.20  ? 42   SER F C     1 
ATOM   330  O  O     . SER A 1 43  ? 88.520  22.412  175.824 1.00 30.17  ? 42   SER F O     1 
ATOM   331  C  CB    . SER A 1 43  ? 91.068  22.016  177.924 1.00 21.25  ? 42   SER F CB    1 
ATOM   332  O  OG    . SER A 1 43  ? 92.227  21.207  177.836 1.00 28.08  ? 42   SER F OG    1 
ATOM   333  N  N     . THR A 1 44  ? 88.901  24.124  177.242 1.00 28.50  ? 43   THR F N     1 
ATOM   334  C  CA    . THR A 1 44  ? 87.549  24.650  177.156 1.00 32.59  ? 43   THR F CA    1 
ATOM   335  C  C     . THR A 1 44  ? 87.513  26.028  177.798 1.00 28.11  ? 43   THR F C     1 
ATOM   336  O  O     . THR A 1 44  ? 88.418  26.425  178.533 1.00 29.75  ? 43   THR F O     1 
ATOM   337  C  CB    . THR A 1 44  ? 86.537  23.722  177.823 1.00 26.72  ? 43   THR F CB    1 
ATOM   338  O  OG1   . THR A 1 44  ? 85.231  24.072  177.364 1.00 31.63  ? 43   THR F OG1   1 
ATOM   339  C  CG2   . THR A 1 44  ? 86.589  23.855  179.340 1.00 28.18  ? 43   THR F CG2   1 
ATOM   340  N  N     . ALA A 1 45  ? 86.436  26.748  177.518 1.00 26.82  ? 44   ALA F N     1 
ATOM   341  C  CA    . ALA A 1 45  ? 86.264  28.110  177.990 1.00 29.56  ? 44   ALA F CA    1 
ATOM   342  C  C     . ALA A 1 45  ? 84.845  28.257  178.509 1.00 31.86  ? 44   ALA F C     1 
ATOM   343  O  O     . ALA A 1 45  ? 83.936  27.524  178.112 1.00 34.53  ? 44   ALA F O     1 
ATOM   344  C  CB    . ALA A 1 45  ? 86.531  29.128  176.881 1.00 34.31  ? 44   ALA F CB    1 
ATOM   345  N  N     . ASN A 1 46  ? 84.661  29.221  179.399 1.00 30.67  ? 45   ASN F N     1 
ATOM   346  C  CA    . ASN A 1 46  ? 83.325  29.532  179.856 1.00 32.13  ? 45   ASN F CA    1 
ATOM   347  C  C     . ASN A 1 46  ? 82.615  30.398  178.809 1.00 33.57  ? 45   ASN F C     1 
ATOM   348  O  O     . ASN A 1 46  ? 83.190  30.760  177.774 1.00 35.19  ? 45   ASN F O     1 
ATOM   349  C  CB    . ASN A 1 46  ? 83.391  30.181  181.231 1.00 32.17  ? 45   ASN F CB    1 
ATOM   350  C  CG    . ASN A 1 46  ? 84.102  31.550  181.217 1.00 32.98  ? 45   ASN F CG    1 
ATOM   351  O  OD1   . ASN A 1 46  ? 84.629  32.000  180.206 1.00 39.74  ? 45   ASN F OD1   1 
ATOM   352  N  ND2   . ASN A 1 46  ? 84.090  32.202  182.339 1.00 34.02  ? 45   ASN F ND2   1 
ATOM   353  N  N     . TYR A 1 47  ? 81.331  30.710  179.056 1.00 35.15  ? 46   TYR F N     1 
ATOM   354  C  CA    . TYR A 1 47  ? 80.567  31.532  178.116 1.00 31.24  ? 46   TYR F CA    1 
ATOM   355  C  C     . TYR A 1 47  ? 81.077  32.975  178.049 1.00 30.98  ? 46   TYR F C     1 
ATOM   356  O  O     . TYR A 1 47  ? 81.140  33.538  176.950 1.00 34.25  ? 46   TYR F O     1 
ATOM   357  C  CB    . TYR A 1 47  ? 79.067  31.486  178.438 1.00 31.75  ? 46   TYR F CB    1 
ATOM   358  C  CG    . TYR A 1 47  ? 78.426  30.276  177.783 1.00 33.46  ? 46   TYR F CG    1 
ATOM   359  C  CD1   . TYR A 1 47  ? 78.135  30.279  176.427 1.00 37.91  ? 46   TYR F CD1   1 
ATOM   360  C  CD2   . TYR A 1 47  ? 78.197  29.097  178.499 1.00 35.53  ? 46   TYR F CD2   1 
ATOM   361  C  CE1   . TYR A 1 47  ? 77.596  29.164  175.810 1.00 34.58  ? 46   TYR F CE1   1 
ATOM   362  C  CE2   . TYR A 1 47  ? 77.656  27.985  177.888 1.00 35.89  ? 46   TYR F CE2   1 
ATOM   363  C  CZ    . TYR A 1 47  ? 77.369  28.026  176.539 1.00 33.92  ? 46   TYR F CZ    1 
ATOM   364  O  OH    . TYR A 1 47  ? 76.813  26.951  175.897 1.00 33.12  ? 46   TYR F OH    1 
ATOM   365  N  N     . PRO A 1 48  ? 81.473  33.612  179.148 1.00 31.14  ? 47   PRO F N     1 
ATOM   366  C  CA    . PRO A 1 48  ? 82.109  34.937  178.981 1.00 45.43  ? 47   PRO F CA    1 
ATOM   367  C  C     . PRO A 1 48  ? 83.299  34.932  178.028 1.00 41.72  ? 47   PRO F C     1 
ATOM   368  O  O     . PRO A 1 48  ? 83.432  35.868  177.237 1.00 35.73  ? 47   PRO F O     1 
ATOM   369  C  CB    . PRO A 1 48  ? 82.512  35.309  180.409 1.00 42.44  ? 47   PRO F CB    1 
ATOM   370  C  CG    . PRO A 1 48  ? 81.445  34.713  181.232 1.00 39.89  ? 47   PRO F CG    1 
ATOM   371  C  CD    . PRO A 1 48  ? 81.146  33.355  180.564 1.00 37.65  ? 47   PRO F CD    1 
ATOM   372  N  N     . ALA A 1 49  ? 84.144  33.896  178.047 1.00 36.32  ? 48   ALA F N     1 
ATOM   373  C  CA    . ALA A 1 49  ? 85.252  33.809  177.097 1.00 36.71  ? 48   ALA F CA    1 
ATOM   374  C  C     . ALA A 1 49  ? 84.793  33.420  175.689 1.00 33.48  ? 48   ALA F C     1 
ATOM   375  O  O     . ALA A 1 49  ? 85.348  33.929  174.706 1.00 29.82  ? 48   ALA F O     1 
ATOM   376  C  CB    . ALA A 1 49  ? 86.314  32.810  177.602 1.00 30.24  ? 48   ALA F CB    1 
ATOM   377  N  N     . ARG A 1 50  ? 83.811  32.502  175.566 1.00 28.42  ? 49   ARG F N     1 
ATOM   378  C  CA    . ARG A 1 50  ? 83.281  32.107  174.254 1.00 28.54  ? 49   ARG F CA    1 
ATOM   379  C  C     . ARG A 1 50  ? 82.724  33.292  173.478 1.00 33.03  ? 49   ARG F C     1 
ATOM   380  O  O     . ARG A 1 50  ? 82.800  33.321  172.243 1.00 30.38  ? 49   ARG F O     1 
ATOM   381  C  CB    . ARG A 1 50  ? 82.170  31.055  174.408 1.00 26.77  ? 49   ARG F CB    1 
ATOM   382  C  CG    . ARG A 1 50  ? 82.714  29.719  174.851 1.00 28.48  ? 49   ARG F CG    1 
ATOM   383  C  CD    . ARG A 1 50  ? 81.657  28.604  174.952 1.00 25.70  ? 49   ARG F CD    1 
ATOM   384  N  NE    . ARG A 1 50  ? 82.298  27.439  175.556 1.00 32.70  ? 49   ARG F NE    1 
ATOM   385  C  CZ    . ARG A 1 50  ? 81.775  26.216  175.609 1.00 45.97  ? 49   ARG F CZ    1 
ATOM   386  N  NH1   . ARG A 1 50  ? 80.574  25.973  175.103 1.00 48.72  ? 49   ARG F NH1   1 
ATOM   387  N  NH2   . ARG A 1 50  ? 82.454  25.235  176.194 1.00 37.97  ? 49   ARG F NH2   1 
ATOM   388  N  N     . LYS A 1 51  ? 82.134  34.255  174.184 1.00 31.66  ? 50   LYS F N     1 
ATOM   389  C  CA    . LYS A 1 51  ? 81.647  35.478  173.551 1.00 35.63  ? 50   LYS F CA    1 
ATOM   390  C  C     . LYS A 1 51  ? 82.726  36.176  172.730 1.00 39.78  ? 50   LYS F C     1 
ATOM   391  O  O     . LYS A 1 51  ? 82.411  36.843  171.747 1.00 37.08  ? 50   LYS F O     1 
ATOM   392  C  CB    . LYS A 1 51  ? 81.125  36.423  174.630 1.00 44.45  ? 50   LYS F CB    1 
ATOM   393  C  CG    . LYS A 1 51  ? 80.500  37.699  174.125 1.00 46.34  ? 50   LYS F CG    1 
ATOM   394  C  CD    . LYS A 1 51  ? 80.091  38.569  175.300 1.00 44.85  ? 50   LYS F CD    1 
ATOM   395  C  CE    . LYS A 1 51  ? 81.296  39.141  176.038 1.00 49.49  ? 50   LYS F CE    1 
ATOM   396  N  NZ    . LYS A 1 51  ? 80.837  40.152  177.025 1.00 51.60  ? 50   LYS F NZ    1 
ATOM   397  N  N     . PHE A 1 52  ? 83.996  36.061  173.123 1.00 40.60  ? 51   PHE F N     1 
ATOM   398  C  CA    . PHE A 1 52  ? 85.074  36.654  172.338 1.00 41.64  ? 51   PHE F CA    1 
ATOM   399  C  C     . PHE A 1 52  ? 85.539  35.772  171.193 1.00 43.28  ? 51   PHE F C     1 
ATOM   400  O  O     . PHE A 1 52  ? 86.431  36.191  170.452 1.00 36.82  ? 51   PHE F O     1 
ATOM   401  C  CB    . PHE A 1 52  ? 86.291  36.963  173.217 1.00 35.79  ? 51   PHE F CB    1 
ATOM   402  C  CG    . PHE A 1 52  ? 86.046  38.025  174.234 1.00 33.65  ? 51   PHE F CG    1 
ATOM   403  C  CD1   . PHE A 1 52  ? 85.358  37.728  175.403 1.00 36.78  ? 51   PHE F CD1   1 
ATOM   404  C  CD2   . PHE A 1 52  ? 86.508  39.332  174.029 1.00 34.22  ? 51   PHE F CD2   1 
ATOM   405  C  CE1   . PHE A 1 52  ? 85.123  38.723  176.354 1.00 41.72  ? 51   PHE F CE1   1 
ATOM   406  C  CE2   . PHE A 1 52  ? 86.286  40.319  174.971 1.00 41.32  ? 51   PHE F CE2   1 
ATOM   407  C  CZ    . PHE A 1 52  ? 85.590  40.016  176.137 1.00 45.01  ? 51   PHE F CZ    1 
ATOM   408  N  N     . GLY A 1 53  ? 84.988  34.567  171.038 1.00 42.01  ? 52   GLY F N     1 
ATOM   409  C  CA    . GLY A 1 53  ? 85.471  33.623  170.050 1.00 36.25  ? 52   GLY F CA    1 
ATOM   410  C  C     . GLY A 1 53  ? 86.370  32.526  170.598 1.00 36.04  ? 52   GLY F C     1 
ATOM   411  O  O     . GLY A 1 53  ? 86.826  31.674  169.823 1.00 34.46  ? 52   GLY F O     1 
ATOM   412  N  N     . VAL A 1 54  ? 86.642  32.524  171.903 1.00 28.59  ? 53   VAL F N     1 
ATOM   413  C  CA    . VAL A 1 54  ? 87.485  31.493  172.486 1.00 33.02  ? 53   VAL F CA    1 
ATOM   414  C  C     . VAL A 1 54  ? 86.792  30.141  172.388 1.00 34.75  ? 53   VAL F C     1 
ATOM   415  O  O     . VAL A 1 54  ? 85.616  30.014  172.749 1.00 33.11  ? 53   VAL F O     1 
ATOM   416  C  CB    . VAL A 1 54  ? 87.846  31.832  173.940 1.00 34.62  ? 53   VAL F CB    1 
ATOM   417  C  CG1   . VAL A 1 54  ? 88.715  30.704  174.536 1.00 29.73  ? 53   VAL F CG1   1 
ATOM   418  C  CG2   . VAL A 1 54  ? 88.573  33.184  174.013 1.00 40.46  ? 53   VAL F CG2   1 
ATOM   419  N  N     . ARG A 1 55  ? 87.523  29.122  171.899 1.00 29.66  ? 54   ARG F N     1 
ATOM   420  C  CA    . ARG A 1 55  ? 86.961  27.790  171.643 1.00 34.57  ? 54   ARG F CA    1 
ATOM   421  C  C     . ARG A 1 55  ? 87.941  26.714  172.095 1.00 30.42  ? 54   ARG F C     1 
ATOM   422  O  O     . ARG A 1 55  ? 89.149  26.952  172.190 1.00 30.36  ? 54   ARG F O     1 
ATOM   423  C  CB    . ARG A 1 55  ? 86.660  27.562  170.152 1.00 29.07  ? 54   ARG F CB    1 
ATOM   424  C  CG    . ARG A 1 55  ? 85.633  28.494  169.541 1.00 42.60  ? 54   ARG F CG    1 
ATOM   425  C  CD    . ARG A 1 55  ? 84.245  28.260  170.110 1.00 52.74  ? 54   ARG F CD    1 
ATOM   426  N  NE    . ARG A 1 55  ? 83.250  29.127  169.467 1.00 56.36  ? 54   ARG F NE    1 
ATOM   427  C  CZ    . ARG A 1 55  ? 82.941  30.350  169.887 1.00 60.90  ? 54   ARG F CZ    1 
ATOM   428  N  NH1   . ARG A 1 55  ? 83.541  30.856  170.959 1.00 41.69  ? 54   ARG F NH1   1 
ATOM   429  N  NH2   . ARG A 1 55  ? 82.026  31.064  169.242 1.00 62.70  ? 54   ARG F NH2   1 
ATOM   430  N  N     . SER A 1 56  ? 87.413  25.508  172.330 1.00 26.66  ? 55   SER F N     1 
ATOM   431  C  CA    . SER A 1 56  ? 88.274  24.346  172.524 1.00 25.51  ? 55   SER F CA    1 
ATOM   432  C  C     . SER A 1 56  ? 89.156  24.130  171.303 1.00 26.13  ? 55   SER F C     1 
ATOM   433  O  O     . SER A 1 56  ? 88.752  24.392  170.166 1.00 25.71  ? 55   SER F O     1 
ATOM   434  C  CB    . SER A 1 56  ? 87.443  23.072  172.772 1.00 27.79  ? 55   SER F CB    1 
ATOM   435  O  OG    . SER A 1 56  ? 86.635  23.188  173.933 1.00 30.25  ? 55   SER F OG    1 
ATOM   436  N  N     . ALA A 1 57  ? 90.366  23.627  171.553 1.00 30.03  ? 56   ALA F N     1 
ATOM   437  C  CA    . ALA A 1 57  ? 91.411  23.323  170.578 1.00 30.55  ? 56   ALA F CA    1 
ATOM   438  C  C     . ALA A 1 57  ? 92.044  24.568  169.981 1.00 34.25  ? 56   ALA F C     1 
ATOM   439  O  O     . ALA A 1 57  ? 92.913  24.440  169.124 1.00 38.94  ? 56   ALA F O     1 
ATOM   440  C  CB    . ALA A 1 57  ? 90.922  22.428  169.433 1.00 31.54  ? 56   ALA F CB    1 
ATOM   441  N  N     . MET A 1 58  ? 91.628  25.765  170.380 1.00 24.06  ? 57   MET F N     1 
ATOM   442  C  CA    . MET A 1 58  ? 92.251  26.957  169.860 1.00 24.01  ? 57   MET F CA    1 
ATOM   443  C  C     . MET A 1 58  ? 93.620  27.147  170.504 1.00 27.46  ? 57   MET F C     1 
ATOM   444  O  O     . MET A 1 58  ? 93.758  26.943  171.717 1.00 37.11  ? 57   MET F O     1 
ATOM   445  C  CB    . MET A 1 58  ? 91.365  28.170  170.132 1.00 26.76  ? 57   MET F CB    1 
ATOM   446  C  CG    . MET A 1 58  ? 92.003  29.478  169.700 1.00 30.06  ? 57   MET F CG    1 
ATOM   447  S  SD    . MET A 1 58  ? 90.751  30.757  169.512 1.00 42.74  ? 57   MET F SD    1 
ATOM   448  C  CE    . MET A 1 58  ? 90.291  30.936  171.165 1.00 38.32  ? 57   MET F CE    1 
ATOM   449  N  N     . PRO A 1 59  ? 94.654  27.502  169.738 1.00 33.17  ? 58   PRO F N     1 
ATOM   450  C  CA    . PRO A 1 59  ? 95.950  27.810  170.360 1.00 31.17  ? 58   PRO F CA    1 
ATOM   451  C  C     . PRO A 1 59  ? 95.811  28.987  171.310 1.00 32.14  ? 58   PRO F C     1 
ATOM   452  O  O     . PRO A 1 59  ? 95.096  29.958  171.032 1.00 37.23  ? 58   PRO F O     1 
ATOM   453  C  CB    . PRO A 1 59  ? 96.852  28.152  169.167 1.00 30.80  ? 58   PRO F CB    1 
ATOM   454  C  CG    . PRO A 1 59  ? 96.223  27.466  168.017 1.00 41.46  ? 58   PRO F CG    1 
ATOM   455  C  CD    . PRO A 1 59  ? 94.734  27.516  168.268 1.00 38.09  ? 58   PRO F CD    1 
ATOM   456  N  N     . THR A 1 60  ? 96.494  28.888  172.448 1.00 34.67  ? 59   THR F N     1 
ATOM   457  C  CA    . THR A 1 60  ? 96.281  29.868  173.505 1.00 37.70  ? 59   THR F CA    1 
ATOM   458  C  C     . THR A 1 60  ? 96.699  31.268  173.067 1.00 36.80  ? 59   THR F C     1 
ATOM   459  O  O     . THR A 1 60  ? 96.063  32.250  173.467 1.00 37.31  ? 59   THR F O     1 
ATOM   460  C  CB    . THR A 1 60  ? 96.998  29.413  174.776 1.00 33.49  ? 59   THR F CB    1 
ATOM   461  O  OG1   . THR A 1 60  ? 96.385  28.204  175.229 1.00 35.04  ? 59   THR F OG1   1 
ATOM   462  C  CG2   . THR A 1 60  ? 96.875  30.448  175.879 1.00 34.42  ? 59   THR F CG2   1 
ATOM   463  N  N     . GLY A 1 61  ? 97.723  31.381  172.215 1.00 37.57  ? 60   GLY F N     1 
ATOM   464  C  CA    . GLY A 1 61  ? 98.079  32.681  171.673 1.00 38.59  ? 60   GLY F CA    1 
ATOM   465  C  C     . GLY A 1 61  ? 96.956  33.315  170.873 1.00 47.12  ? 60   GLY F C     1 
ATOM   466  O  O     . GLY A 1 61  ? 96.776  34.538  170.903 1.00 42.09  ? 60   GLY F O     1 
ATOM   467  N  N     . MET A 1 62  ? 96.178  32.500  170.156 1.00 40.74  ? 61   MET F N     1 
ATOM   468  C  CA    . MET A 1 62  ? 95.027  33.034  169.441 1.00 40.66  ? 61   MET F CA    1 
ATOM   469  C  C     . MET A 1 62  ? 93.910  33.408  170.408 1.00 46.51  ? 61   MET F C     1 
ATOM   470  O  O     . MET A 1 62  ? 93.238  34.432  170.222 1.00 39.86  ? 61   MET F O     1 
ATOM   471  C  CB    . MET A 1 62  ? 94.539  32.023  168.400 1.00 38.43  ? 61   MET F CB    1 
ATOM   472  C  CG    . MET A 1 62  ? 93.184  32.362  167.791 1.00 45.99  ? 61   MET F CG    1 
ATOM   473  S  SD    . MET A 1 62  ? 92.887  31.668  166.146 1.00 65.04  ? 61   MET F SD    1 
ATOM   474  C  CE    . MET A 1 62  ? 92.761  29.909  166.409 1.00 66.85  ? 61   MET F CE    1 
ATOM   475  N  N     . ALA A 1 63  ? 93.707  32.602  171.454 1.00 45.17  ? 62   ALA F N     1 
ATOM   476  C  CA    . ALA A 1 63  ? 92.671  32.916  172.433 1.00 42.39  ? 62   ALA F CA    1 
ATOM   477  C  C     . ALA A 1 63  ? 92.944  34.254  173.101 1.00 38.55  ? 62   ALA F C     1 
ATOM   478  O  O     . ALA A 1 63  ? 92.032  35.074  173.271 1.00 39.30  ? 62   ALA F O     1 
ATOM   479  C  CB    . ALA A 1 63  ? 92.564  31.798  173.482 1.00 27.82  ? 62   ALA F CB    1 
ATOM   480  N  N     . LEU A 1 64  ? 94.204  34.499  173.460 1.00 38.05  ? 63   LEU F N     1 
ATOM   481  C  CA    . LEU A 1 64  ? 94.548  35.722  174.165 1.00 39.52  ? 63   LEU F CA    1 
ATOM   482  C  C     . LEU A 1 64  ? 94.477  36.941  173.252 1.00 50.67  ? 63   LEU F C     1 
ATOM   483  O  O     . LEU A 1 64  ? 94.219  38.051  173.727 1.00 41.51  ? 63   LEU F O     1 
ATOM   484  C  CB    . LEU A 1 64  ? 95.943  35.590  174.774 1.00 39.99  ? 63   LEU F CB    1 
ATOM   485  C  CG    . LEU A 1 64  ? 96.046  34.691  176.005 1.00 40.98  ? 63   LEU F CG    1 
ATOM   486  C  CD1   . LEU A 1 64  ? 97.515  34.441  176.318 1.00 42.30  ? 63   LEU F CD1   1 
ATOM   487  C  CD2   . LEU A 1 64  ? 95.326  35.302  177.199 1.00 39.98  ? 63   LEU F CD2   1 
ATOM   488  N  N     . LYS A 1 65  ? 94.715  36.758  171.950 1.00 44.26  ? 64   LYS F N     1 
ATOM   489  C  CA    . LYS A 1 65  ? 94.533  37.855  171.007 1.00 39.98  ? 64   LYS F CA    1 
ATOM   490  C  C     . LYS A 1 65  ? 93.061  38.219  170.872 1.00 50.76  ? 64   LYS F C     1 
ATOM   491  O  O     . LYS A 1 65  ? 92.718  39.395  170.731 1.00 49.93  ? 64   LYS F O     1 
ATOM   492  C  CB    . LYS A 1 65  ? 95.120  37.487  169.647 1.00 53.65  ? 64   LYS F CB    1 
ATOM   493  N  N     . LEU A 1 66  ? 92.177  37.219  170.899 1.00 39.46  ? 65   LEU F N     1 
ATOM   494  C  CA    . LEU A 1 66  ? 90.751  37.493  170.854 1.00 36.19  ? 65   LEU F CA    1 
ATOM   495  C  C     . LEU A 1 66  ? 90.246  38.038  172.179 1.00 39.31  ? 65   LEU F C     1 
ATOM   496  O  O     . LEU A 1 66  ? 89.339  38.872  172.197 1.00 43.85  ? 65   LEU F O     1 
ATOM   497  C  CB    . LEU A 1 66  ? 89.977  36.226  170.473 1.00 37.06  ? 65   LEU F CB    1 
ATOM   498  C  CG    . LEU A 1 66  ? 90.093  35.713  169.036 1.00 39.32  ? 65   LEU F CG    1 
ATOM   499  C  CD1   . LEU A 1 66  ? 89.562  34.280  168.921 1.00 37.88  ? 65   LEU F CD1   1 
ATOM   500  C  CD2   . LEU A 1 66  ? 89.357  36.634  168.067 1.00 38.29  ? 65   LEU F CD2   1 
ATOM   501  N  N     . CYS A 1 67  ? 90.823  37.601  173.286 1.00 42.00  ? 66   CYS F N     1 
ATOM   502  C  CA    . CYS A 1 67  ? 90.305  37.902  174.621 1.00 36.97  ? 66   CYS F CA    1 
ATOM   503  C  C     . CYS A 1 67  ? 91.489  38.227  175.518 1.00 34.09  ? 66   CYS F C     1 
ATOM   504  O  O     . CYS A 1 67  ? 91.957  37.380  176.290 1.00 36.11  ? 66   CYS F O     1 
ATOM   505  C  CB    . CYS A 1 67  ? 89.490  36.713  175.159 1.00 36.95  ? 66   CYS F CB    1 
ATOM   506  S  SG    . CYS A 1 67  ? 88.816  36.935  176.827 1.00 44.16  ? 66   CYS F SG    1 
ATOM   507  N  N     . PRO A 1 68  ? 92.023  39.454  175.425 1.00 47.93  ? 67   PRO F N     1 
ATOM   508  C  CA    . PRO A 1 68  ? 93.267  39.775  176.152 1.00 46.14  ? 67   PRO F CA    1 
ATOM   509  C  C     . PRO A 1 68  ? 93.187  39.588  177.653 1.00 44.35  ? 67   PRO F C     1 
ATOM   510  O  O     . PRO A 1 68  ? 94.219  39.329  178.282 1.00 43.08  ? 67   PRO F O     1 
ATOM   511  C  CB    . PRO A 1 68  ? 93.514  41.248  175.786 1.00 43.98  ? 67   PRO F CB    1 
ATOM   512  C  CG    . PRO A 1 68  ? 92.885  41.397  174.456 1.00 52.29  ? 67   PRO F CG    1 
ATOM   513  C  CD    . PRO A 1 68  ? 91.657  40.520  174.477 1.00 49.31  ? 67   PRO F CD    1 
ATOM   514  N  N     . HIS A 1 69  ? 92.005  39.715  178.254 1.00 44.53  ? 68   HIS F N     1 
ATOM   515  C  CA    . HIS A 1 69  ? 91.852  39.529  179.691 1.00 42.59  ? 68   HIS F CA    1 
ATOM   516  C  C     . HIS A 1 69  ? 91.509  38.090  180.079 1.00 42.80  ? 68   HIS F C     1 
ATOM   517  O  O     . HIS A 1 69  ? 91.133  37.845  181.232 1.00 45.71  ? 68   HIS F O     1 
ATOM   518  C  CB    . HIS A 1 69  ? 90.791  40.491  180.228 1.00 47.01  ? 68   HIS F CB    1 
ATOM   519  C  CG    . HIS A 1 69  ? 91.133  41.934  180.029 1.00 48.43  ? 68   HIS F CG    1 
ATOM   520  N  ND1   . HIS A 1 69  ? 90.634  42.682  178.982 1.00 55.82  ? 68   HIS F ND1   1 
ATOM   521  C  CD2   . HIS A 1 69  ? 91.934  42.766  180.736 1.00 67.36  ? 68   HIS F CD2   1 
ATOM   522  C  CE1   . HIS A 1 69  ? 91.104  43.914  179.059 1.00 65.10  ? 68   HIS F CE1   1 
ATOM   523  N  NE2   . HIS A 1 69  ? 91.898  43.991  180.112 1.00 70.90  ? 68   HIS F NE2   1 
ATOM   524  N  N     . LEU A 1 70  ? 91.638  37.139  179.153 1.00 38.17  ? 69   LEU F N     1 
ATOM   525  C  CA    . LEU A 1 70  ? 91.351  35.744  179.455 1.00 36.17  ? 69   LEU F CA    1 
ATOM   526  C  C     . LEU A 1 70  ? 92.149  35.287  180.671 1.00 42.27  ? 69   LEU F C     1 
ATOM   527  O  O     . LEU A 1 70  ? 93.349  35.541  180.765 1.00 44.37  ? 69   LEU F O     1 
ATOM   528  C  CB    . LEU A 1 70  ? 91.702  34.866  178.251 1.00 36.46  ? 69   LEU F CB    1 
ATOM   529  C  CG    . LEU A 1 70  ? 91.401  33.375  178.371 1.00 37.24  ? 69   LEU F CG    1 
ATOM   530  C  CD1   . LEU A 1 70  ? 89.878  33.181  178.565 1.00 37.83  ? 69   LEU F CD1   1 
ATOM   531  C  CD2   . LEU A 1 70  ? 91.900  32.625  177.140 1.00 31.01  ? 69   LEU F CD2   1 
ATOM   532  N  N     . THR A 1 71  ? 91.473  34.637  181.611 1.00 38.21  ? 70   THR F N     1 
ATOM   533  C  CA    . THR A 1 71  ? 92.119  34.060  182.783 1.00 47.01  ? 70   THR F CA    1 
ATOM   534  C  C     . THR A 1 71  ? 92.363  32.579  182.526 1.00 47.88  ? 70   THR F C     1 
ATOM   535  O  O     . THR A 1 71  ? 91.416  31.809  182.325 1.00 41.91  ? 70   THR F O     1 
ATOM   536  C  CB    . THR A 1 71  ? 91.274  34.250  184.038 1.00 51.88  ? 70   THR F CB    1 
ATOM   537  O  OG1   . THR A 1 71  ? 91.231  35.641  184.380 1.00 47.84  ? 70   THR F OG1   1 
ATOM   538  C  CG2   . THR A 1 71  ? 91.862  33.449  185.198 1.00 45.79  ? 70   THR F CG2   1 
ATOM   539  N  N     . LEU A 1 72  ? 93.626  32.186  182.535 1.00 45.00  ? 71   LEU F N     1 
ATOM   540  C  CA    . LEU A 1 72  ? 94.038  30.868  182.093 1.00 41.24  ? 71   LEU F CA    1 
ATOM   541  C  C     . LEU A 1 72  ? 94.253  29.973  183.302 1.00 43.02  ? 71   LEU F C     1 
ATOM   542  O  O     . LEU A 1 72  ? 94.991  30.337  184.218 1.00 40.97  ? 71   LEU F O     1 
ATOM   543  C  CB    . LEU A 1 72  ? 95.312  30.975  181.263 1.00 43.24  ? 71   LEU F CB    1 
ATOM   544  C  CG    . LEU A 1 72  ? 95.518  29.928  180.177 1.00 53.16  ? 71   LEU F CG    1 
ATOM   545  C  CD1   . LEU A 1 72  ? 94.300  29.834  179.262 1.00 49.71  ? 71   LEU F CD1   1 
ATOM   546  C  CD2   . LEU A 1 72  ? 96.745  30.318  179.399 1.00 58.51  ? 71   LEU F CD2   1 
ATOM   547  N  N     . LEU A 1 73  ? 93.607  28.809  183.301 1.00 42.02  ? 72   LEU F N     1 
ATOM   548  C  CA    . LEU A 1 73  ? 93.651  27.904  184.434 1.00 41.17  ? 72   LEU F CA    1 
ATOM   549  C  C     . LEU A 1 73  ? 94.348  26.608  184.048 1.00 40.50  ? 72   LEU F C     1 
ATOM   550  O  O     . LEU A 1 73  ? 94.283  26.188  182.892 1.00 36.77  ? 72   LEU F O     1 
ATOM   551  C  CB    . LEU A 1 73  ? 92.241  27.586  184.944 1.00 40.12  ? 72   LEU F CB    1 
ATOM   552  C  CG    . LEU A 1 73  ? 91.596  28.521  185.980 1.00 47.75  ? 72   LEU F CG    1 
ATOM   553  C  CD1   . LEU A 1 73  ? 91.936  29.951  185.743 1.00 50.17  ? 72   LEU F CD1   1 
ATOM   554  C  CD2   . LEU A 1 73  ? 90.093  28.354  185.951 1.00 56.53  ? 72   LEU F CD2   1 
ATOM   555  N  N     . PRO A 1 74  ? 95.034  25.959  184.989 1.00 41.13  ? 73   PRO F N     1 
ATOM   556  C  CA    . PRO A 1 74  ? 95.764  24.732  184.644 1.00 31.25  ? 73   PRO F CA    1 
ATOM   557  C  C     . PRO A 1 74  ? 94.917  23.465  184.572 1.00 36.29  ? 73   PRO F C     1 
ATOM   558  O  O     . PRO A 1 74  ? 95.288  22.521  183.868 1.00 46.20  ? 73   PRO F O     1 
ATOM   559  C  CB    . PRO A 1 74  ? 96.804  24.624  185.772 1.00 39.68  ? 73   PRO F CB    1 
ATOM   560  C  CG    . PRO A 1 74  ? 96.132  25.245  186.940 1.00 42.37  ? 73   PRO F CG    1 
ATOM   561  C  CD    . PRO A 1 74  ? 95.396  26.447  186.333 1.00 42.27  ? 73   PRO F CD    1 
ATOM   562  N  N     . GLY A 1 75  ? 93.814  23.388  185.295 1.00 35.64  ? 74   GLY F N     1 
ATOM   563  C  CA    . GLY A 1 75  ? 93.080  22.138  185.235 1.00 44.14  ? 74   GLY F CA    1 
ATOM   564  C  C     . GLY A 1 75  ? 93.361  21.220  186.405 1.00 37.56  ? 74   GLY F C     1 
ATOM   565  O  O     . GLY A 1 75  ? 94.520  20.984  186.765 1.00 41.28  ? 74   GLY F O     1 
ATOM   566  N  N     . ARG A 1 76  ? 92.286  20.691  186.988 1.00 37.90  ? 75   ARG F N     1 
ATOM   567  C  CA    . ARG A 1 76  ? 92.307  19.860  188.190 1.00 32.80  ? 75   ARG F CA    1 
ATOM   568  C  C     . ARG A 1 76  ? 91.583  18.568  187.838 1.00 38.05  ? 75   ARG F C     1 
ATOM   569  O  O     . ARG A 1 76  ? 90.374  18.430  188.041 1.00 32.85  ? 75   ARG F O     1 
ATOM   570  C  CB    . ARG A 1 76  ? 91.655  20.592  189.366 1.00 29.19  ? 75   ARG F CB    1 
ATOM   571  C  CG    . ARG A 1 76  ? 92.355  21.916  189.692 1.00 32.72  ? 75   ARG F CG    1 
ATOM   572  C  CD    . ARG A 1 76  ? 91.419  22.952  190.328 1.00 43.52  ? 75   ARG F CD    1 
ATOM   573  N  NE    . ARG A 1 76  ? 90.708  22.402  191.472 1.00 45.28  ? 75   ARG F NE    1 
ATOM   574  C  CZ    . ARG A 1 76  ? 89.387  22.405  191.617 1.00 52.24  ? 75   ARG F CZ    1 
ATOM   575  N  NH1   . ARG A 1 76  ? 88.848  21.859  192.697 1.00 60.73  ? 75   ARG F NH1   1 
ATOM   576  N  NH2   . ARG A 1 76  ? 88.601  22.962  190.702 1.00 48.87  ? 75   ARG F NH2   1 
ATOM   577  N  N     . PHE A 1 77  ? 92.326  17.608  187.295 1.00 35.88  ? 76   PHE F N     1 
ATOM   578  C  CA    . PHE A 1 77  ? 91.646  16.485  186.666 1.00 38.37  ? 76   PHE F CA    1 
ATOM   579  C  C     . PHE A 1 77  ? 90.977  15.570  187.679 1.00 33.79  ? 76   PHE F C     1 
ATOM   580  O  O     . PHE A 1 77  ? 90.009  14.897  187.327 1.00 34.37  ? 76   PHE F O     1 
ATOM   581  C  CB    . PHE A 1 77  ? 92.614  15.733  185.752 1.00 35.45  ? 76   PHE F CB    1 
ATOM   582  C  CG    . PHE A 1 77  ? 92.857  16.463  184.447 1.00 44.68  ? 76   PHE F CG    1 
ATOM   583  C  CD1   . PHE A 1 77  ? 91.993  16.294  183.370 1.00 44.25  ? 76   PHE F CD1   1 
ATOM   584  C  CD2   . PHE A 1 77  ? 93.898  17.379  184.324 1.00 47.53  ? 76   PHE F CD2   1 
ATOM   585  C  CE1   . PHE A 1 77  ? 92.187  17.002  182.174 1.00 42.62  ? 76   PHE F CE1   1 
ATOM   586  C  CE2   . PHE A 1 77  ? 94.103  18.092  183.129 1.00 39.22  ? 76   PHE F CE2   1 
ATOM   587  C  CZ    . PHE A 1 77  ? 93.247  17.904  182.059 1.00 33.37  ? 76   PHE F CZ    1 
ATOM   588  N  N     . ASP A 1 78  ? 91.438  15.548  188.936 1.00 34.02  ? 77   ASP F N     1 
ATOM   589  C  CA    . ASP A 1 78  ? 90.735  14.759  189.947 1.00 35.94  ? 77   ASP F CA    1 
ATOM   590  C  C     . ASP A 1 78  ? 89.387  15.377  190.295 1.00 42.41  ? 77   ASP F C     1 
ATOM   591  O  O     . ASP A 1 78  ? 88.418  14.651  190.549 1.00 40.43  ? 77   ASP F O     1 
ATOM   592  C  CB    . ASP A 1 78  ? 91.595  14.593  191.204 1.00 43.82  ? 77   ASP F CB    1 
ATOM   593  C  CG    . ASP A 1 78  ? 92.626  13.466  191.070 1.00 57.10  ? 77   ASP F CG    1 
ATOM   594  O  OD1   . ASP A 1 78  ? 92.694  12.823  189.999 1.00 47.10  ? 77   ASP F OD1   1 
ATOM   595  O  OD2   . ASP A 1 78  ? 93.375  13.231  192.043 1.00 56.36  ? 77   ASP F OD2   1 
ATOM   596  N  N     . ALA A 1 79  ? 89.301  16.712  190.313 1.00 37.31  ? 78   ALA F N     1 
ATOM   597  C  CA    . ALA A 1 79  ? 88.012  17.364  190.535 1.00 35.95  ? 78   ALA F CA    1 
ATOM   598  C  C     . ALA A 1 79  ? 87.021  17.012  189.427 1.00 33.87  ? 78   ALA F C     1 
ATOM   599  O  O     . ALA A 1 79  ? 85.831  16.794  189.691 1.00 33.05  ? 78   ALA F O     1 
ATOM   600  C  CB    . ALA A 1 79  ? 88.195  18.883  190.617 1.00 38.14  ? 78   ALA F CB    1 
ATOM   601  N  N     . TYR A 1 80  ? 87.494  16.950  188.179 1.00 28.74  ? 79   TYR F N     1 
ATOM   602  C  CA    . TYR A 1 80  ? 86.607  16.610  187.072 1.00 30.06  ? 79   TYR F CA    1 
ATOM   603  C  C     . TYR A 1 80  ? 86.215  15.143  187.118 1.00 34.02  ? 79   TYR F C     1 
ATOM   604  O  O     . TYR A 1 80  ? 85.063  14.795  186.830 1.00 34.78  ? 79   TYR F O     1 
ATOM   605  C  CB    . TYR A 1 80  ? 87.268  16.911  185.736 1.00 31.06  ? 79   TYR F CB    1 
ATOM   606  C  CG    . TYR A 1 80  ? 87.942  18.253  185.631 1.00 35.09  ? 79   TYR F CG    1 
ATOM   607  C  CD1   . TYR A 1 80  ? 87.405  19.388  186.242 1.00 30.77  ? 79   TYR F CD1   1 
ATOM   608  C  CD2   . TYR A 1 80  ? 89.119  18.388  184.900 1.00 31.52  ? 79   TYR F CD2   1 
ATOM   609  C  CE1   . TYR A 1 80  ? 88.036  20.619  186.127 1.00 24.79  ? 79   TYR F CE1   1 
ATOM   610  C  CE2   . TYR A 1 80  ? 89.747  19.609  184.781 1.00 32.27  ? 79   TYR F CE2   1 
ATOM   611  C  CZ    . TYR A 1 80  ? 89.208  20.717  185.395 1.00 30.81  ? 79   TYR F CZ    1 
ATOM   612  O  OH    . TYR A 1 80  ? 89.865  21.933  185.269 1.00 36.79  ? 79   TYR F OH    1 
ATOM   613  N  N     . LYS A 1 81  ? 87.170  14.268  187.446 1.00 30.63  ? 80   LYS F N     1 
ATOM   614  C  CA    . LYS A 1 81  ? 86.856  12.848  187.568 1.00 37.72  ? 80   LYS F CA    1 
ATOM   615  C  C     . LYS A 1 81  ? 85.848  12.615  188.685 1.00 38.86  ? 80   LYS F C     1 
ATOM   616  O  O     . LYS A 1 81  ? 84.978  11.740  188.579 1.00 35.57  ? 80   LYS F O     1 
ATOM   617  C  CB    . LYS A 1 81  ? 88.137  12.035  187.822 1.00 37.28  ? 80   LYS F CB    1 
ATOM   618  C  CG    . LYS A 1 81  ? 87.876  10.548  188.038 1.00 43.06  ? 80   LYS F CG    1 
ATOM   619  C  CD    . LYS A 1 81  ? 89.158  9.723   188.069 1.00 57.68  ? 80   LYS F CD    1 
ATOM   620  C  CE    . LYS A 1 81  ? 89.974  9.980   189.329 1.00 61.28  ? 80   LYS F CE    1 
ATOM   621  N  NZ    . LYS A 1 81  ? 91.095  9.002   189.458 1.00 69.97  ? 80   LYS F NZ    1 
ATOM   622  N  N     . GLU A 1 82  ? 85.958  13.391  189.766 1.00 30.38  ? 81   GLU F N     1 
ATOM   623  C  CA    . GLU A 1 82  ? 85.009  13.277  190.863 1.00 38.59  ? 81   GLU F CA    1 
ATOM   624  C  C     . GLU A 1 82  ? 83.609  13.654  190.408 1.00 37.49  ? 81   GLU F C     1 
ATOM   625  O  O     . GLU A 1 82  ? 82.639  12.956  190.714 1.00 36.87  ? 81   GLU F O     1 
ATOM   626  C  CB    . GLU A 1 82  ? 85.446  14.156  192.033 1.00 49.52  ? 81   GLU F CB    1 
ATOM   627  C  CG    . GLU A 1 82  ? 84.553  14.038  193.263 1.00 63.35  ? 81   GLU F CG    1 
ATOM   628  C  CD    . GLU A 1 82  ? 84.930  15.027  194.357 1.00 82.36  ? 81   GLU F CD    1 
ATOM   629  O  OE1   . GLU A 1 82  ? 85.145  16.220  194.040 1.00 88.84  ? 81   GLU F OE1   1 
ATOM   630  O  OE2   . GLU A 1 82  ? 85.019  14.612  195.534 1.00 87.53  ? 81   GLU F OE2   1 
ATOM   631  N  N     . ALA A 1 83  ? 83.479  14.754  189.666 1.00 37.16  ? 82   ALA F N     1 
ATOM   632  C  CA    . ALA A 1 83  ? 82.165  15.108  189.146 1.00 37.56  ? 82   ALA F CA    1 
ATOM   633  C  C     . ALA A 1 83  ? 81.666  14.053  188.167 1.00 32.20  ? 82   ALA F C     1 
ATOM   634  O  O     . ALA A 1 83  ? 80.474  13.735  188.145 1.00 35.16  ? 82   ALA F O     1 
ATOM   635  C  CB    . ALA A 1 83  ? 82.208  16.489  188.488 1.00 37.36  ? 82   ALA F CB    1 
ATOM   636  N  N     . SER A 1 84  ? 82.566  13.494  187.356 1.00 29.87  ? 83   SER F N     1 
ATOM   637  C  CA    . SER A 1 84  ? 82.178  12.462  186.399 1.00 36.78  ? 83   SER F CA    1 
ATOM   638  C  C     . SER A 1 84  ? 81.628  11.234  187.110 1.00 34.79  ? 83   SER F C     1 
ATOM   639  O  O     . SER A 1 84  ? 80.550  10.737  186.766 1.00 33.49  ? 83   SER F O     1 
ATOM   640  C  CB    . SER A 1 84  ? 83.367  12.076  185.520 1.00 34.85  ? 83   SER F CB    1 
ATOM   641  O  OG    . SER A 1 84  ? 82.988  11.127  184.533 1.00 32.63  ? 83   SER F OG    1 
ATOM   642  N  N     . ASN A 1 85  ? 82.357  10.725  188.107 1.00 38.46  ? 84   ASN F N     1 
ATOM   643  C  CA    . ASN A 1 85  ? 81.869  9.560   188.849 1.00 40.46  ? 84   ASN F CA    1 
ATOM   644  C  C     . ASN A 1 85  ? 80.489  9.820   189.437 1.00 42.66  ? 84   ASN F C     1 
ATOM   645  O  O     . ASN A 1 85  ? 79.607  8.950   189.389 1.00 29.03  ? 84   ASN F O     1 
ATOM   646  C  CB    . ASN A 1 85  ? 82.853  9.187   189.957 1.00 35.62  ? 84   ASN F CB    1 
ATOM   647  C  CG    . ASN A 1 85  ? 84.171  8.647   189.412 1.00 42.09  ? 84   ASN F CG    1 
ATOM   648  O  OD1   . ASN A 1 85  ? 84.249  8.198   188.270 1.00 37.77  ? 84   ASN F OD1   1 
ATOM   649  N  ND2   . ASN A 1 85  ? 85.205  8.684   190.233 1.00 35.12  ? 84   ASN F ND2   1 
ATOM   650  N  N     . HIS A 1 86  ? 80.276  11.024  189.969 1.00 31.95  ? 85   HIS F N     1 
ATOM   651  C  CA    . HIS A 1 86  ? 78.998  11.363  190.585 1.00 36.64  ? 85   HIS F CA    1 
ATOM   652  C  C     . HIS A 1 86  ? 77.863  11.354  189.559 1.00 37.13  ? 85   HIS F C     1 
ATOM   653  O  O     . HIS A 1 86  ? 76.796  10.782  189.813 1.00 39.17  ? 85   HIS F O     1 
ATOM   654  C  CB    . HIS A 1 86  ? 79.117  12.726  191.276 1.00 36.86  ? 85   HIS F CB    1 
ATOM   655  C  CG    . HIS A 1 86  ? 78.003  13.034  192.231 1.00 45.27  ? 85   HIS F CG    1 
ATOM   656  N  ND1   . HIS A 1 86  ? 78.112  14.004  193.205 1.00 51.12  ? 85   HIS F ND1   1 
ATOM   657  C  CD2   . HIS A 1 86  ? 76.758  12.513  192.357 1.00 50.41  ? 85   HIS F CD2   1 
ATOM   658  C  CE1   . HIS A 1 86  ? 76.985  14.064  193.893 1.00 58.40  ? 85   HIS F CE1   1 
ATOM   659  N  NE2   . HIS A 1 86  ? 76.146  13.170  193.398 1.00 48.41  ? 85   HIS F NE2   1 
ATOM   660  N  N     . ILE A 1 87  ? 78.064  11.976  188.388 1.00 31.44  ? 86   ILE F N     1 
ATOM   661  C  CA    . ILE A 1 87  ? 76.952  12.013  187.432 1.00 35.88  ? 86   ILE F CA    1 
ATOM   662  C  C     . ILE A 1 87  ? 76.694  10.622  186.862 1.00 40.65  ? 86   ILE F C     1 
ATOM   663  O  O     . ILE A 1 87  ? 75.558  10.296  186.496 1.00 34.84  ? 86   ILE F O     1 
ATOM   664  C  CB    . ILE A 1 87  ? 77.159  13.050  186.300 1.00 34.38  ? 86   ILE F CB    1 
ATOM   665  C  CG1   . ILE A 1 87  ? 78.077  12.526  185.197 1.00 41.25  ? 86   ILE F CG1   1 
ATOM   666  C  CG2   . ILE A 1 87  ? 77.659  14.396  186.842 1.00 28.75  ? 86   ILE F CG2   1 
ATOM   667  C  CD1   . ILE A 1 87  ? 78.415  13.602  184.139 1.00 38.57  ? 86   ILE F CD1   1 
ATOM   668  N  N     . ARG A 1 88  ? 77.717  9.767   186.797 1.00 36.97  ? 87   ARG F N     1 
ATOM   669  C  CA    . ARG A 1 88  ? 77.479  8.403   186.338 1.00 34.77  ? 87   ARG F CA    1 
ATOM   670  C  C     . ARG A 1 88  ? 76.729  7.602   187.382 1.00 32.65  ? 87   ARG F C     1 
ATOM   671  O  O     . ARG A 1 88  ? 75.971  6.686   187.036 1.00 38.24  ? 87   ARG F O     1 
ATOM   672  C  CB    . ARG A 1 88  ? 78.795  7.712   185.979 1.00 26.98  ? 87   ARG F CB    1 
ATOM   673  C  CG    . ARG A 1 88  ? 79.518  8.360   184.811 1.00 32.10  ? 87   ARG F CG    1 
ATOM   674  C  CD    . ARG A 1 88  ? 80.859  7.672   184.564 1.00 30.36  ? 87   ARG F CD    1 
ATOM   675  N  NE    . ARG A 1 88  ? 81.565  8.332   183.468 1.00 29.71  ? 87   ARG F NE    1 
ATOM   676  C  CZ    . ARG A 1 88  ? 82.732  7.935   182.985 1.00 36.90  ? 87   ARG F CZ    1 
ATOM   677  N  NH1   . ARG A 1 88  ? 83.332  6.864   183.492 1.00 34.25  ? 87   ARG F NH1   1 
ATOM   678  N  NH2   . ARG A 1 88  ? 83.288  8.599   181.987 1.00 37.21  ? 87   ARG F NH2   1 
ATOM   679  N  N     . GLU A 1 89  ? 76.929  7.921   188.661 1.00 33.79  ? 88   GLU F N     1 
ATOM   680  C  CA    . GLU A 1 89  ? 76.119  7.299   189.695 1.00 35.15  ? 88   GLU F CA    1 
ATOM   681  C  C     . GLU A 1 89  ? 74.677  7.786   189.614 1.00 40.99  ? 88   GLU F C     1 
ATOM   682  O  O     . GLU A 1 89  ? 73.747  7.003   189.844 1.00 43.02  ? 88   GLU F O     1 
ATOM   683  C  CB    . GLU A 1 89  ? 76.740  7.568   191.073 1.00 40.71  ? 88   GLU F CB    1 
ATOM   684  C  CG    . GLU A 1 89  ? 75.994  6.925   192.245 1.00 60.41  ? 88   GLU F CG    1 
ATOM   685  C  CD    . GLU A 1 89  ? 74.885  7.811   192.794 1.00 64.52  ? 88   GLU F CD    1 
ATOM   686  O  OE1   . GLU A 1 89  ? 75.124  9.027   192.973 1.00 68.69  ? 88   GLU F OE1   1 
ATOM   687  O  OE2   . GLU A 1 89  ? 73.773  7.295   193.034 1.00 69.21  ? 88   GLU F OE2   1 
ATOM   688  N  N     . ILE A 1 90  ? 74.472  9.056   189.252 1.00 41.85  ? 89   ILE F N     1 
ATOM   689  C  CA    . ILE A 1 90  ? 73.117  9.570   189.039 1.00 41.18  ? 89   ILE F CA    1 
ATOM   690  C  C     . ILE A 1 90  ? 72.455  8.885   187.840 1.00 39.09  ? 89   ILE F C     1 
ATOM   691  O  O     . ILE A 1 90  ? 71.268  8.550   187.888 1.00 38.37  ? 89   ILE F O     1 
ATOM   692  C  CB    . ILE A 1 90  ? 73.155  11.104  188.892 1.00 40.67  ? 89   ILE F CB    1 
ATOM   693  C  CG1   . ILE A 1 90  ? 73.434  11.747  190.249 1.00 40.15  ? 89   ILE F CG1   1 
ATOM   694  C  CG2   . ILE A 1 90  ? 71.851  11.651  188.310 1.00 38.16  ? 89   ILE F CG2   1 
ATOM   695  C  CD1   . ILE A 1 90  ? 73.743  13.232  190.166 1.00 42.04  ? 89   ILE F CD1   1 
ATOM   696  N  N     . PHE A 1 91  ? 73.204  8.655   186.752 1.00 37.43  ? 90   PHE F N     1 
ATOM   697  C  CA    . PHE A 1 91  ? 72.658  7.883   185.629 1.00 41.15  ? 90   PHE F CA    1 
ATOM   698  C  C     . PHE A 1 91  ? 72.221  6.490   186.082 1.00 41.09  ? 90   PHE F C     1 
ATOM   699  O  O     . PHE A 1 91  ? 71.183  5.978   185.640 1.00 40.23  ? 90   PHE F O     1 
ATOM   700  C  CB    . PHE A 1 91  ? 73.683  7.744   184.489 1.00 39.45  ? 90   PHE F CB    1 
ATOM   701  C  CG    . PHE A 1 91  ? 74.217  9.059   183.936 1.00 35.90  ? 90   PHE F CG    1 
ATOM   702  C  CD1   . PHE A 1 91  ? 73.466  10.231  183.979 1.00 30.72  ? 90   PHE F CD1   1 
ATOM   703  C  CD2   . PHE A 1 91  ? 75.470  9.102   183.336 1.00 33.77  ? 90   PHE F CD2   1 
ATOM   704  C  CE1   . PHE A 1 91  ? 73.977  11.425  183.466 1.00 36.09  ? 90   PHE F CE1   1 
ATOM   705  C  CE2   . PHE A 1 91  ? 75.985  10.276  182.825 1.00 35.00  ? 90   PHE F CE2   1 
ATOM   706  C  CZ    . PHE A 1 91  ? 75.240  11.444  182.878 1.00 35.34  ? 90   PHE F CZ    1 
ATOM   707  N  N     . SER A 1 92  ? 73.006  5.851   186.956 1.00 35.42  ? 91   SER F N     1 
ATOM   708  C  CA    . SER A 1 92  ? 72.685  4.497   187.387 1.00 40.14  ? 91   SER F CA    1 
ATOM   709  C  C     . SER A 1 92  ? 71.376  4.437   188.163 1.00 42.98  ? 91   SER F C     1 
ATOM   710  O  O     . SER A 1 92  ? 70.746  3.375   188.207 1.00 39.64  ? 91   SER F O     1 
ATOM   711  C  CB    . SER A 1 92  ? 73.823  3.913   188.236 1.00 41.53  ? 91   SER F CB    1 
ATOM   712  O  OG    . SER A 1 92  ? 73.835  4.478   189.540 1.00 39.75  ? 91   SER F OG    1 
ATOM   713  N  N     . ARG A 1 93  ? 70.935  5.553   188.753 1.00 39.28  ? 92   ARG F N     1 
ATOM   714  C  CA    . ARG A 1 93  ? 69.640  5.552   189.426 1.00 48.76  ? 92   ARG F CA    1 
ATOM   715  C  C     . ARG A 1 93  ? 68.489  5.317   188.461 1.00 43.40  ? 92   ARG F C     1 
ATOM   716  O  O     . ARG A 1 93  ? 67.403  4.936   188.902 1.00 45.65  ? 92   ARG F O     1 
ATOM   717  C  CB    . ARG A 1 93  ? 69.416  6.873   190.175 1.00 45.98  ? 92   ARG F CB    1 
ATOM   718  C  CG    . ARG A 1 93  ? 70.412  7.116   191.290 1.00 49.01  ? 92   ARG F CG    1 
ATOM   719  C  CD    . ARG A 1 93  ? 70.247  8.496   191.910 1.00 50.57  ? 92   ARG F CD    1 
ATOM   720  N  NE    . ARG A 1 93  ? 71.462  8.904   192.615 1.00 46.53  ? 92   ARG F NE    1 
ATOM   721  C  CZ    . ARG A 1 93  ? 71.671  10.124  193.102 1.00 51.34  ? 92   ARG F CZ    1 
ATOM   722  N  NH1   . ARG A 1 93  ? 70.741  11.061  192.970 1.00 50.39  ? 92   ARG F NH1   1 
ATOM   723  N  NH2   . ARG A 1 93  ? 72.815  10.412  193.715 1.00 47.68  ? 92   ARG F NH2   1 
ATOM   724  N  N     . TYR A 1 94  ? 68.690  5.535   187.163 1.00 43.48  ? 93   TYR F N     1 
ATOM   725  C  CA    . TYR A 1 94  ? 67.608  5.432   186.191 1.00 48.46  ? 93   TYR F CA    1 
ATOM   726  C  C     . TYR A 1 94  ? 67.718  4.232   185.266 1.00 46.91  ? 93   TYR F C     1 
ATOM   727  O  O     . TYR A 1 94  ? 66.692  3.768   184.765 1.00 49.91  ? 93   TYR F O     1 
ATOM   728  C  CB    . TYR A 1 94  ? 67.533  6.707   185.341 1.00 46.14  ? 93   TYR F CB    1 
ATOM   729  C  CG    . TYR A 1 94  ? 67.083  7.901   186.138 1.00 49.08  ? 93   TYR F CG    1 
ATOM   730  C  CD1   . TYR A 1 94  ? 67.991  8.637   186.893 1.00 47.72  ? 93   TYR F CD1   1 
ATOM   731  C  CD2   . TYR A 1 94  ? 65.747  8.281   186.163 1.00 50.13  ? 93   TYR F CD2   1 
ATOM   732  C  CE1   . TYR A 1 94  ? 67.573  9.731   187.642 1.00 51.41  ? 93   TYR F CE1   1 
ATOM   733  C  CE2   . TYR A 1 94  ? 65.325  9.378   186.904 1.00 49.80  ? 93   TYR F CE2   1 
ATOM   734  C  CZ    . TYR A 1 94  ? 66.245  10.097  187.638 1.00 47.57  ? 93   TYR F CZ    1 
ATOM   735  O  OH    . TYR A 1 94  ? 65.830  11.180  188.379 1.00 59.15  ? 93   TYR F OH    1 
ATOM   736  N  N     . THR A 1 95  ? 68.925  3.727   185.027 1.00 47.18  ? 94   THR F N     1 
ATOM   737  C  CA    . THR A 1 95  ? 69.145  2.592   184.135 1.00 47.33  ? 94   THR F CA    1 
ATOM   738  C  C     . THR A 1 95  ? 70.587  2.134   184.285 1.00 47.49  ? 94   THR F C     1 
ATOM   739  O  O     . THR A 1 95  ? 71.457  2.914   184.672 1.00 48.86  ? 94   THR F O     1 
ATOM   740  C  CB    . THR A 1 95  ? 68.864  2.955   182.666 1.00 44.97  ? 94   THR F CB    1 
ATOM   741  O  OG1   . THR A 1 95  ? 69.153  1.825   181.833 1.00 48.51  ? 94   THR F OG1   1 
ATOM   742  C  CG2   . THR A 1 95  ? 69.728  4.119   182.233 1.00 45.61  ? 94   THR F CG2   1 
ATOM   743  N  N     . SER A 1 96  ? 70.829  0.863   183.974 1.00 46.58  ? 95   SER F N     1 
ATOM   744  C  CA    . SER A 1 96  ? 72.184  0.339   183.876 1.00 41.00  ? 95   SER F CA    1 
ATOM   745  C  C     . SER A 1 96  ? 72.713  0.395   182.452 1.00 46.69  ? 95   SER F C     1 
ATOM   746  O  O     . SER A 1 96  ? 73.877  0.051   182.217 1.00 44.15  ? 95   SER F O     1 
ATOM   747  C  CB    . SER A 1 96  ? 72.227  -1.100  184.388 1.00 53.78  ? 95   SER F CB    1 
ATOM   748  O  OG    . SER A 1 96  ? 71.425  -1.930  183.571 1.00 63.73  ? 95   SER F OG    1 
ATOM   749  N  N     . ARG A 1 97  ? 71.888  0.836   181.501 1.00 37.94  ? 96   ARG F N     1 
ATOM   750  C  CA    . ARG A 1 97  ? 72.288  0.914   180.097 1.00 44.22  ? 96   ARG F CA    1 
ATOM   751  C  C     . ARG A 1 97  ? 72.955  2.266   179.872 1.00 34.60  ? 96   ARG F C     1 
ATOM   752  O  O     . ARG A 1 97  ? 72.338  3.217   179.401 1.00 33.03  ? 96   ARG F O     1 
ATOM   753  C  CB    . ARG A 1 97  ? 71.081  0.731   179.185 1.00 43.18  ? 96   ARG F CB    1 
ATOM   754  C  CG    . ARG A 1 97  ? 70.188  -0.459  179.536 1.00 50.17  ? 96   ARG F CG    1 
ATOM   755  C  CD    . ARG A 1 97  ? 70.613  -1.694  178.791 1.00 41.41  ? 96   ARG F CD    1 
ATOM   756  N  NE    . ARG A 1 97  ? 70.454  -1.593  177.339 1.00 40.60  ? 96   ARG F NE    1 
ATOM   757  C  CZ    . ARG A 1 97  ? 71.467  -1.615  176.475 1.00 53.03  ? 96   ARG F CZ    1 
ATOM   758  N  NH1   . ARG A 1 97  ? 72.727  -1.714  176.915 1.00 59.81  ? 96   ARG F NH1   1 
ATOM   759  N  NH2   . ARG A 1 97  ? 71.223  -1.542  175.166 1.00 40.48  ? 96   ARG F NH2   1 
ATOM   760  N  N     . ILE A 1 98  ? 74.251  2.335   180.194 1.00 34.65  ? 97   ILE F N     1 
ATOM   761  C  CA    . ILE A 1 98  ? 75.014  3.589   180.223 1.00 32.14  ? 97   ILE F CA    1 
ATOM   762  C  C     . ILE A 1 98  ? 76.319  3.396   179.465 1.00 33.15  ? 97   ILE F C     1 
ATOM   763  O  O     . ILE A 1 98  ? 77.153  2.573   179.857 1.00 35.36  ? 97   ILE F O     1 
ATOM   764  C  CB    . ILE A 1 98  ? 75.332  4.042   181.661 1.00 34.50  ? 97   ILE F CB    1 
ATOM   765  C  CG1   . ILE A 1 98  ? 74.057  4.195   182.487 1.00 35.23  ? 97   ILE F CG1   1 
ATOM   766  C  CG2   . ILE A 1 98  ? 76.158  5.364   181.653 1.00 31.72  ? 97   ILE F CG2   1 
ATOM   767  C  CD1   . ILE A 1 98  ? 74.317  4.175   183.979 1.00 38.40  ? 97   ILE F CD1   1 
ATOM   768  N  N     . GLU A 1 99  ? 76.526  4.180   178.417 1.00 30.32  ? 98   GLU F N     1 
ATOM   769  C  CA    . GLU A 1 99  ? 77.784  4.133   177.685 1.00 31.85  ? 98   GLU F CA    1 
ATOM   770  C  C     . GLU A 1 99  ? 78.471  5.488   177.829 1.00 30.13  ? 98   GLU F C     1 
ATOM   771  O  O     . GLU A 1 99  ? 78.144  6.440   177.096 1.00 30.10  ? 98   GLU F O     1 
ATOM   772  C  CB    . GLU A 1 99  ? 77.563  3.775   176.217 1.00 31.60  ? 98   GLU F CB    1 
ATOM   773  C  CG    . GLU A 1 99  ? 78.858  3.763   175.414 1.00 31.37  ? 98   GLU F CG    1 
ATOM   774  C  CD    . GLU A 1 99  ? 78.617  3.326   173.992 1.00 47.40  ? 98   GLU F CD    1 
ATOM   775  O  OE1   . GLU A 1 99  ? 77.538  2.741   173.738 1.00 40.80  ? 98   GLU F OE1   1 
ATOM   776  O  OE2   . GLU A 1 99  ? 79.494  3.573   173.135 1.00 48.18  ? 98   GLU F OE2   1 
ATOM   777  N  N     . PRO A 1 100 ? 79.386  5.643   178.782 1.00 32.59  ? 99   PRO F N     1 
ATOM   778  C  CA    . PRO A 1 100 ? 80.088  6.926   178.901 1.00 35.01  ? 99   PRO F CA    1 
ATOM   779  C  C     . PRO A 1 100 ? 80.996  7.108   177.700 1.00 31.43  ? 99   PRO F C     1 
ATOM   780  O  O     . PRO A 1 100 ? 81.638  6.160   177.246 1.00 34.81  ? 99   PRO F O     1 
ATOM   781  C  CB    . PRO A 1 100 ? 80.888  6.788   180.202 1.00 39.70  ? 99   PRO F CB    1 
ATOM   782  C  CG    . PRO A 1 100 ? 80.361  5.518   180.874 1.00 46.60  ? 99   PRO F CG    1 
ATOM   783  C  CD    . PRO A 1 100 ? 79.847  4.657   179.777 1.00 31.39  ? 99   PRO F CD    1 
ATOM   784  N  N     . LEU A 1 101 ? 81.002  8.320   177.146 1.00 35.41  ? 100  LEU F N     1 
ATOM   785  C  CA    . LEU A 1 101 ? 81.858  8.623   176.008 1.00 38.70  ? 100  LEU F CA    1 
ATOM   786  C  C     . LEU A 1 101 ? 83.084  9.429   176.393 1.00 41.35  ? 100  LEU F C     1 
ATOM   787  O  O     . LEU A 1 101 ? 83.987  9.591   175.567 1.00 44.16  ? 100  LEU F O     1 
ATOM   788  C  CB    . LEU A 1 101 ? 81.076  9.388   174.949 1.00 35.11  ? 100  LEU F CB    1 
ATOM   789  C  CG    . LEU A 1 101 ? 79.816  8.649   174.521 1.00 40.21  ? 100  LEU F CG    1 
ATOM   790  C  CD1   . LEU A 1 101 ? 78.890  9.626   173.815 1.00 50.15  ? 100  LEU F CD1   1 
ATOM   791  C  CD2   . LEU A 1 101 ? 80.186  7.482   173.624 1.00 41.86  ? 100  LEU F CD2   1 
ATOM   792  N  N     . SER A 1 102 ? 83.116  9.934   177.617 1.00 36.93  ? 101  SER F N     1 
ATOM   793  C  CA    . SER A 1 102 ? 84.172  10.792  178.129 1.00 35.76  ? 101  SER F CA    1 
ATOM   794  C  C     . SER A 1 102 ? 83.786  11.091  179.567 1.00 30.40  ? 101  SER F C     1 
ATOM   795  O  O     . SER A 1 102 ? 82.758  10.583  180.036 1.00 31.63  ? 101  SER F O     1 
ATOM   796  C  CB    . SER A 1 102 ? 84.308  12.060  177.290 1.00 36.03  ? 101  SER F CB    1 
ATOM   797  O  OG    . SER A 1 102 ? 83.154  12.889  177.382 1.00 38.80  ? 101  SER F OG    1 
ATOM   798  N  N     . LEU A 1 103 ? 84.588  11.890  180.275 1.00 32.64  ? 102  LEU F N     1 
ATOM   799  C  CA    . LEU A 1 103 ? 84.226  12.300  181.632 1.00 27.50  ? 102  LEU F CA    1 
ATOM   800  C  C     . LEU A 1 103 ? 82.819  12.868  181.701 1.00 26.16  ? 102  LEU F C     1 
ATOM   801  O  O     . LEU A 1 103 ? 82.046  12.526  182.600 1.00 30.73  ? 102  LEU F O     1 
ATOM   802  C  CB    . LEU A 1 103 ? 85.210  13.346  182.146 1.00 28.31  ? 102  LEU F CB    1 
ATOM   803  C  CG    . LEU A 1 103 ? 86.602  12.836  182.517 1.00 28.66  ? 102  LEU F CG    1 
ATOM   804  C  CD1   . LEU A 1 103 ? 87.383  13.981  183.142 1.00 39.09  ? 102  LEU F CD1   1 
ATOM   805  C  CD2   . LEU A 1 103 ? 86.491  11.676  183.476 1.00 35.05  ? 102  LEU F CD2   1 
ATOM   806  N  N     . ASP A 1 104 ? 82.470  13.749  180.767 1.00 25.01  ? 103  ASP F N     1 
ATOM   807  C  CA    . ASP A 1 104 ? 81.314  14.620  180.953 1.00 29.57  ? 103  ASP F CA    1 
ATOM   808  C  C     . ASP A 1 104 ? 80.088  14.225  180.139 1.00 32.78  ? 103  ASP F C     1 
ATOM   809  O  O     . ASP A 1 104 ? 79.133  15.016  180.069 1.00 30.05  ? 103  ASP F O     1 
ATOM   810  C  CB    . ASP A 1 104 ? 81.696  16.071  180.637 1.00 27.68  ? 103  ASP F CB    1 
ATOM   811  C  CG    . ASP A 1 104 ? 81.467  16.451  179.174 1.00 30.24  ? 103  ASP F CG    1 
ATOM   812  O  OD1   . ASP A 1 104 ? 81.750  15.638  178.268 1.00 34.33  ? 103  ASP F OD1   1 
ATOM   813  O  OD2   . ASP A 1 104 ? 80.988  17.568  178.934 1.00 32.82  ? 103  ASP F OD2   1 
ATOM   814  N  N     . GLU A 1 105 ? 80.068  13.045  179.520 1.00 26.24  ? 104  GLU F N     1 
ATOM   815  C  CA    . GLU A 1 105 ? 78.913  12.721  178.694 1.00 25.17  ? 104  GLU F CA    1 
ATOM   816  C  C     . GLU A 1 105 ? 78.686  11.217  178.612 1.00 29.44  ? 104  GLU F C     1 
ATOM   817  O  O     . GLU A 1 105 ? 79.593  10.399  178.835 1.00 27.46  ? 104  GLU F O     1 
ATOM   818  C  CB    . GLU A 1 105 ? 79.040  13.330  177.293 1.00 30.42  ? 104  GLU F CB    1 
ATOM   819  C  CG    . GLU A 1 105 ? 79.986  12.638  176.352 1.00 48.11  ? 104  GLU F CG    1 
ATOM   820  C  CD    . GLU A 1 105 ? 80.062  13.341  174.996 1.00 58.29  ? 104  GLU F CD    1 
ATOM   821  O  OE1   . GLU A 1 105 ? 80.251  14.569  174.961 1.00 54.94  ? 104  GLU F OE1   1 
ATOM   822  O  OE2   . GLU A 1 105 ? 79.927  12.665  173.957 1.00 72.34  ? 104  GLU F OE2   1 
ATOM   823  N  N     . ALA A 1 106 ? 77.446  10.859  178.279 1.00 29.90  ? 105  ALA F N     1 
ATOM   824  C  CA    . ALA A 1 106 ? 77.071  9.454   178.242 1.00 29.40  ? 105  ALA F CA    1 
ATOM   825  C  C     . ALA A 1 106 ? 75.808  9.278   177.414 1.00 26.91  ? 105  ALA F C     1 
ATOM   826  O  O     . ALA A 1 106 ? 74.961  10.178  177.345 1.00 31.10  ? 105  ALA F O     1 
ATOM   827  C  CB    . ALA A 1 106 ? 76.841  8.899   179.653 1.00 28.39  ? 105  ALA F CB    1 
ATOM   828  N  N     . TYR A 1 107 ? 75.708  8.112   176.780 1.00 27.64  ? 106  TYR F N     1 
ATOM   829  C  CA    . TYR A 1 107 ? 74.453  7.614   176.237 1.00 28.43  ? 106  TYR F CA    1 
ATOM   830  C  C     . TYR A 1 107 ? 73.744  6.793   177.296 1.00 33.10  ? 106  TYR F C     1 
ATOM   831  O  O     . TYR A 1 107 ? 74.379  6.005   178.009 1.00 35.25  ? 106  TYR F O     1 
ATOM   832  C  CB    . TYR A 1 107 ? 74.682  6.735   175.008 1.00 27.46  ? 106  TYR F CB    1 
ATOM   833  C  CG    . TYR A 1 107 ? 75.105  7.461   173.759 1.00 27.01  ? 106  TYR F CG    1 
ATOM   834  C  CD1   . TYR A 1 107 ? 74.291  8.434   173.193 1.00 28.29  ? 106  TYR F CD1   1 
ATOM   835  C  CD2   . TYR A 1 107 ? 76.305  7.148   173.122 1.00 32.55  ? 106  TYR F CD2   1 
ATOM   836  C  CE1   . TYR A 1 107 ? 74.670  9.094   172.034 1.00 31.76  ? 106  TYR F CE1   1 
ATOM   837  C  CE2   . TYR A 1 107 ? 76.696  7.805   171.963 1.00 35.74  ? 106  TYR F CE2   1 
ATOM   838  C  CZ    . TYR A 1 107 ? 75.871  8.785   171.430 1.00 41.18  ? 106  TYR F CZ    1 
ATOM   839  O  OH    . TYR A 1 107 ? 76.243  9.452   170.285 1.00 40.15  ? 106  TYR F OH    1 
ATOM   840  N  N     . LEU A 1 108 ? 72.423  6.960   177.369 1.00 32.55  ? 107  LEU F N     1 
ATOM   841  C  CA    . LEU A 1 108 ? 71.539  6.132   178.176 1.00 35.31  ? 107  LEU F CA    1 
ATOM   842  C  C     . LEU A 1 108 ? 70.502  5.503   177.258 1.00 32.15  ? 107  LEU F C     1 
ATOM   843  O  O     . LEU A 1 108 ? 69.900  6.201   176.444 1.00 40.89  ? 107  LEU F O     1 
ATOM   844  C  CB    . LEU A 1 108 ? 70.833  6.966   179.251 1.00 33.78  ? 107  LEU F CB    1 
ATOM   845  C  CG    . LEU A 1 108 ? 71.504  7.233   180.602 1.00 46.23  ? 107  LEU F CG    1 
ATOM   846  C  CD1   . LEU A 1 108 ? 72.873  7.836   180.468 1.00 41.18  ? 107  LEU F CD1   1 
ATOM   847  C  CD2   . LEU A 1 108 ? 70.627  8.152   181.417 1.00 52.66  ? 107  LEU F CD2   1 
ATOM   848  N  N     . ASP A 1 109 ? 70.293  4.192   177.363 1.00 33.96  ? 108  ASP F N     1 
ATOM   849  C  CA    . ASP A 1 109 ? 69.165  3.561   176.683 1.00 35.02  ? 108  ASP F CA    1 
ATOM   850  C  C     . ASP A 1 109 ? 68.060  3.400   177.718 1.00 42.90  ? 108  ASP F C     1 
ATOM   851  O  O     . ASP A 1 109 ? 68.168  2.565   178.627 1.00 39.14  ? 108  ASP F O     1 
ATOM   852  C  CB    . ASP A 1 109 ? 69.548  2.220   176.052 1.00 38.42  ? 108  ASP F CB    1 
ATOM   853  C  CG    . ASP A 1 109 ? 68.436  1.652   175.148 1.00 43.16  ? 108  ASP F CG    1 
ATOM   854  O  OD1   . ASP A 1 109 ? 67.246  1.774   175.502 1.00 40.84  ? 108  ASP F OD1   1 
ATOM   855  O  OD2   . ASP A 1 109 ? 68.748  1.083   174.078 1.00 42.69  ? 108  ASP F OD2   1 
ATOM   856  N  N     . VAL A 1 110 ? 67.000  4.194   177.580 1.00 38.59  ? 109  VAL F N     1 
ATOM   857  C  CA    . VAL A 1 110 ? 65.903  4.160   178.538 1.00 43.28  ? 109  VAL F CA    1 
ATOM   858  C  C     . VAL A 1 110 ? 64.653  3.586   177.885 1.00 45.19  ? 109  VAL F C     1 
ATOM   859  O  O     . VAL A 1 110 ? 63.534  3.869   178.319 1.00 46.19  ? 109  VAL F O     1 
ATOM   860  C  CB    . VAL A 1 110 ? 65.623  5.558   179.120 1.00 44.46  ? 109  VAL F CB    1 
ATOM   861  C  CG1   . VAL A 1 110 ? 66.840  6.047   179.913 1.00 46.67  ? 109  VAL F CG1   1 
ATOM   862  C  CG2   . VAL A 1 110 ? 65.285  6.528   178.007 1.00 45.08  ? 109  VAL F CG2   1 
ATOM   863  N  N     . THR A 1 111 ? 64.831  2.769   176.846 1.00 49.39  ? 110  THR F N     1 
ATOM   864  C  CA    . THR A 1 111 ? 63.688  2.108   176.225 1.00 54.26  ? 110  THR F CA    1 
ATOM   865  C  C     . THR A 1 111 ? 62.901  1.294   177.242 1.00 52.77  ? 110  THR F C     1 
ATOM   866  O  O     . THR A 1 111 ? 61.676  1.423   177.342 1.00 55.86  ? 110  THR F O     1 
ATOM   867  C  CB    . THR A 1 111 ? 64.149  1.204   175.089 1.00 53.14  ? 110  THR F CB    1 
ATOM   868  O  OG1   . THR A 1 111 ? 64.908  1.971   174.147 1.00 52.63  ? 110  THR F OG1   1 
ATOM   869  C  CG2   . THR A 1 111 ? 62.931  0.567   174.409 1.00 52.83  ? 110  THR F CG2   1 
ATOM   870  N  N     . ASP A 1 112 ? 63.592  0.450   178.005 1.00 50.68  ? 111  ASP F N     1 
ATOM   871  C  CA    . ASP A 1 112 ? 62.961  -0.427  178.981 1.00 70.70  ? 111  ASP F CA    1 
ATOM   872  C  C     . ASP A 1 112 ? 62.845  0.215   180.353 1.00 65.54  ? 111  ASP F C     1 
ATOM   873  O  O     . ASP A 1 112 ? 62.590  -0.490  181.333 1.00 67.06  ? 111  ASP F O     1 
ATOM   874  C  CB    . ASP A 1 112 ? 63.737  -1.746  179.111 1.00 78.82  ? 111  ASP F CB    1 
ATOM   875  C  CG    . ASP A 1 112 ? 63.870  -2.483  177.796 1.00 81.25  ? 111  ASP F CG    1 
ATOM   876  O  OD1   . ASP A 1 112 ? 62.897  -2.483  177.013 1.00 87.52  ? 111  ASP F OD1   1 
ATOM   877  O  OD2   . ASP A 1 112 ? 64.952  -3.062  177.549 1.00 75.00  ? 111  ASP F OD2   1 
ATOM   878  N  N     . SER A 1 113 ? 63.035  1.523   180.451 1.00 54.23  ? 112  SER F N     1 
ATOM   879  C  CA    . SER A 1 113 ? 62.930  2.183   181.738 1.00 62.30  ? 112  SER F CA    1 
ATOM   880  C  C     . SER A 1 113 ? 61.473  2.405   182.118 1.00 74.97  ? 112  SER F C     1 
ATOM   881  O  O     . SER A 1 113 ? 60.605  2.606   181.263 1.00 78.25  ? 112  SER F O     1 
ATOM   882  C  CB    . SER A 1 113 ? 63.660  3.521   181.728 1.00 70.91  ? 112  SER F CB    1 
ATOM   883  O  OG    . SER A 1 113 ? 63.507  4.158   182.983 1.00 68.68  ? 112  SER F OG    1 
ATOM   884  N  N     . VAL A 1 114 ? 61.215  2.358   183.425 1.00 74.45  ? 113  VAL F N     1 
ATOM   885  C  CA    . VAL A 1 114 ? 59.915  2.677   184.000 1.00 78.48  ? 113  VAL F CA    1 
ATOM   886  C  C     . VAL A 1 114 ? 60.130  3.642   185.158 1.00 84.09  ? 113  VAL F C     1 
ATOM   887  O  O     . VAL A 1 114 ? 59.890  3.294   186.320 1.00 94.18  ? 113  VAL F O     1 
ATOM   888  C  CB    . VAL A 1 114 ? 59.182  1.407   184.473 1.00 84.04  ? 113  VAL F CB    1 
ATOM   889  C  CG1   . VAL A 1 114 ? 57.728  1.719   184.814 1.00 87.39  ? 113  VAL F CG1   1 
ATOM   890  C  CG2   . VAL A 1 114 ? 59.269  0.298   183.424 1.00 82.75  ? 113  VAL F CG2   1 
ATOM   891  N  N     . HIS A 1 115 ? 60.597  4.852   184.861 1.00 76.22  ? 114  HIS F N     1 
ATOM   892  C  CA    . HIS A 1 115 ? 60.902  5.818   185.912 1.00 70.22  ? 114  HIS F CA    1 
ATOM   893  C  C     . HIS A 1 115 ? 60.034  7.062   185.877 1.00 73.65  ? 114  HIS F C     1 
ATOM   894  O  O     . HIS A 1 115 ? 59.667  7.582   186.934 1.00 81.63  ? 114  HIS F O     1 
ATOM   895  C  CB    . HIS A 1 115 ? 62.374  6.233   185.841 1.00 57.76  ? 114  HIS F CB    1 
ATOM   896  C  CG    . HIS A 1 115 ? 63.287  5.329   186.607 1.00 72.24  ? 114  HIS F CG    1 
ATOM   897  N  ND1   . HIS A 1 115 ? 63.612  5.549   187.928 1.00 81.34  ? 114  HIS F ND1   1 
ATOM   898  C  CD2   . HIS A 1 115 ? 63.941  4.201   186.241 1.00 76.62  ? 114  HIS F CD2   1 
ATOM   899  C  CE1   . HIS A 1 115 ? 64.428  4.596   188.343 1.00 86.33  ? 114  HIS F CE1   1 
ATOM   900  N  NE2   . HIS A 1 115 ? 64.645  3.765   187.338 1.00 80.01  ? 114  HIS F NE2   1 
ATOM   901  N  N     . CYS A 1 116 ? 59.706  7.570   184.698 1.00 59.91  ? 115  CYS F N     1 
ATOM   902  C  CA    . CYS A 1 116 ? 58.836  8.734   184.580 1.00 61.71  ? 115  CYS F CA    1 
ATOM   903  C  C     . CYS A 1 116 ? 57.735  8.446   183.578 1.00 62.40  ? 115  CYS F C     1 
ATOM   904  O  O     . CYS A 1 116 ? 57.520  9.187   182.617 1.00 67.21  ? 115  CYS F O     1 
ATOM   905  C  CB    . CYS A 1 116 ? 59.627  9.977   184.186 1.00 65.76  ? 115  CYS F CB    1 
ATOM   906  S  SG    . CYS A 1 116 ? 60.982  10.390  185.312 1.00 68.10  ? 115  CYS F SG    1 
ATOM   907  N  N     . HIS A 1 117 ? 57.035  7.331   183.795 1.00 66.87  ? 116  HIS F N     1 
ATOM   908  C  CA    . HIS A 1 117 ? 55.978  6.857   182.903 1.00 71.45  ? 116  HIS F CA    1 
ATOM   909  C  C     . HIS A 1 117 ? 56.521  6.536   181.517 1.00 75.57  ? 116  HIS F C     1 
ATOM   910  O  O     . HIS A 1 117 ? 55.842  6.744   180.510 1.00 81.16  ? 116  HIS F O     1 
ATOM   911  C  CB    . HIS A 1 117 ? 54.829  7.865   182.809 1.00 74.38  ? 116  HIS F CB    1 
ATOM   912  C  CG    . HIS A 1 117 ? 54.384  8.389   184.139 1.00 84.63  ? 116  HIS F CG    1 
ATOM   913  N  ND1   . HIS A 1 117 ? 54.950  9.499   184.730 1.00 85.75  ? 116  HIS F ND1   1 
ATOM   914  C  CD2   . HIS A 1 117 ? 53.441  7.943   185.003 1.00 89.74  ? 116  HIS F CD2   1 
ATOM   915  C  CE1   . HIS A 1 117 ? 54.368  9.721   185.896 1.00 88.84  ? 116  HIS F CE1   1 
ATOM   916  N  NE2   . HIS A 1 117 ? 53.447  8.791   186.084 1.00 91.62  ? 116  HIS F NE2   1 
ATOM   917  N  N     . GLY A 1 118 ? 57.752  6.031   181.458 1.00 72.45  ? 117  GLY F N     1 
ATOM   918  C  CA    . GLY A 1 118 ? 58.405  5.799   180.188 1.00 63.18  ? 117  GLY F CA    1 
ATOM   919  C  C     . GLY A 1 118 ? 58.742  7.050   179.412 1.00 55.51  ? 117  GLY F C     1 
ATOM   920  O  O     . GLY A 1 118 ? 59.197  6.946   178.270 1.00 52.77  ? 117  GLY F O     1 
ATOM   921  N  N     . SER A 1 119 ? 58.532  8.233   179.984 1.00 54.91  ? 118  SER F N     1 
ATOM   922  C  CA    . SER A 1 119 ? 58.874  9.478   179.309 1.00 53.78  ? 118  SER F CA    1 
ATOM   923  C  C     . SER A 1 119 ? 60.384  9.685   179.370 1.00 52.23  ? 118  SER F C     1 
ATOM   924  O  O     . SER A 1 119 ? 60.946  9.948   180.440 1.00 49.09  ? 118  SER F O     1 
ATOM   925  C  CB    . SER A 1 119 ? 58.136  10.655  179.937 1.00 54.04  ? 118  SER F CB    1 
ATOM   926  O  OG    . SER A 1 119 ? 58.830  11.858  179.681 1.00 57.83  ? 118  SER F OG    1 
ATOM   927  N  N     . ALA A 1 120 ? 61.042  9.583   178.218 1.00 39.93  ? 119  ALA F N     1 
ATOM   928  C  CA    . ALA A 1 120 ? 62.463  9.888   178.168 1.00 43.79  ? 119  ALA F CA    1 
ATOM   929  C  C     . ALA A 1 120 ? 62.696  11.389  178.296 1.00 49.11  ? 119  ALA F C     1 
ATOM   930  O  O     . ALA A 1 120 ? 63.742  11.817  178.802 1.00 47.69  ? 119  ALA F O     1 
ATOM   931  C  CB    . ALA A 1 120 ? 63.061  9.339   176.872 1.00 40.38  ? 119  ALA F CB    1 
ATOM   932  N  N     . THR A 1 121 ? 61.719  12.195  177.863 1.00 50.11  ? 120  THR F N     1 
ATOM   933  C  CA    . THR A 1 121 ? 61.801  13.640  178.050 1.00 47.43  ? 120  THR F CA    1 
ATOM   934  C  C     . THR A 1 121 ? 61.918  13.990  179.525 1.00 50.63  ? 120  THR F C     1 
ATOM   935  O  O     . THR A 1 121 ? 62.761  14.812  179.912 1.00 42.70  ? 120  THR F O     1 
ATOM   936  C  CB    . THR A 1 121 ? 60.572  14.325  177.444 1.00 49.55  ? 120  THR F CB    1 
ATOM   937  O  OG1   . THR A 1 121 ? 60.526  14.087  176.030 1.00 47.79  ? 120  THR F OG1   1 
ATOM   938  C  CG2   . THR A 1 121 ? 60.605  15.837  177.708 1.00 46.49  ? 120  THR F CG2   1 
ATOM   939  N  N     . LEU A 1 122 ? 61.101  13.347  180.368 1.00 44.07  ? 121  LEU F N     1 
ATOM   940  C  CA    . LEU A 1 122 ? 61.090  13.650  181.795 1.00 50.20  ? 121  LEU F CA    1 
ATOM   941  C  C     . LEU A 1 122 ? 62.256  13.017  182.535 1.00 45.16  ? 121  LEU F C     1 
ATOM   942  O  O     . LEU A 1 122 ? 62.736  13.596  183.516 1.00 53.30  ? 121  LEU F O     1 
ATOM   943  C  CB    . LEU A 1 122 ? 59.778  13.190  182.433 1.00 57.03  ? 121  LEU F CB    1 
ATOM   944  C  CG    . LEU A 1 122 ? 58.543  14.034  182.126 1.00 51.53  ? 121  LEU F CG    1 
ATOM   945  C  CD1   . LEU A 1 122 ? 57.312  13.509  182.870 1.00 52.02  ? 121  LEU F CD1   1 
ATOM   946  C  CD2   . LEU A 1 122 ? 58.788  15.496  182.465 1.00 57.13  ? 121  LEU F CD2   1 
ATOM   947  N  N     . ILE A 1 123 ? 62.696  11.823  182.118 1.00 47.47  ? 122  ILE F N     1 
ATOM   948  C  CA    . ILE A 1 123 ? 63.900  11.236  182.703 1.00 42.04  ? 122  ILE F CA    1 
ATOM   949  C  C     . ILE A 1 123 ? 65.089  12.166  182.487 1.00 39.08  ? 122  ILE F C     1 
ATOM   950  O  O     . ILE A 1 123 ? 65.903  12.378  183.396 1.00 45.31  ? 122  ILE F O     1 
ATOM   951  C  CB    . ILE A 1 123 ? 64.162  9.827   182.124 1.00 41.90  ? 122  ILE F CB    1 
ATOM   952  C  CG1   . ILE A 1 123 ? 63.119  8.819   182.618 1.00 48.70  ? 122  ILE F CG1   1 
ATOM   953  C  CG2   . ILE A 1 123 ? 65.595  9.340   182.472 1.00 34.76  ? 122  ILE F CG2   1 
ATOM   954  C  CD1   . ILE A 1 123 ? 63.154  7.489   181.882 1.00 51.29  ? 122  ILE F CD1   1 
ATOM   955  N  N     . ALA A 1 124 ? 65.207  12.732  181.279 1.00 33.50  ? 123  ALA F N     1 
ATOM   956  C  CA    . ALA A 1 124 ? 66.310  13.642  180.974 1.00 39.63  ? 123  ALA F CA    1 
ATOM   957  C  C     . ALA A 1 124 ? 66.221  14.909  181.807 1.00 36.30  ? 123  ALA F C     1 
ATOM   958  O  O     . ALA A 1 124 ? 67.230  15.378  182.353 1.00 38.15  ? 123  ALA F O     1 
ATOM   959  C  CB    . ALA A 1 124 ? 66.320  13.991  179.487 1.00 38.83  ? 123  ALA F CB    1 
ATOM   960  N  N     . GLN A 1 125 ? 65.013  15.466  181.933 1.00 37.34  ? 124  GLN F N     1 
ATOM   961  C  CA    . GLN A 1 125 ? 64.822  16.630  182.791 1.00 42.03  ? 124  GLN F CA    1 
ATOM   962  C  C     . GLN A 1 125 ? 65.176  16.304  184.238 1.00 46.24  ? 124  GLN F C     1 
ATOM   963  O  O     . GLN A 1 125 ? 65.802  17.109  184.935 1.00 46.80  ? 124  GLN F O     1 
ATOM   964  C  CB    . GLN A 1 125 ? 63.375  17.119  182.684 1.00 39.75  ? 124  GLN F CB    1 
ATOM   965  C  CG    . GLN A 1 125 ? 63.050  18.352  183.509 1.00 62.07  ? 124  GLN F CG    1 
ATOM   966  C  CD    . GLN A 1 125 ? 63.094  19.632  182.690 1.00 75.11  ? 124  GLN F CD    1 
ATOM   967  O  OE1   . GLN A 1 125 ? 64.037  19.873  181.933 1.00 56.74  ? 124  GLN F OE1   1 
ATOM   968  N  NE2   . GLN A 1 125 ? 62.062  20.459  182.833 1.00 84.66  ? 124  GLN F NE2   1 
ATOM   969  N  N     . GLU A 1 126 ? 64.800  15.117  184.703 1.00 43.10  ? 125  GLU F N     1 
ATOM   970  C  CA    . GLU A 1 126 ? 65.029  14.766  186.099 1.00 46.73  ? 125  GLU F CA    1 
ATOM   971  C  C     . GLU A 1 126 ? 66.514  14.562  186.380 1.00 43.51  ? 125  GLU F C     1 
ATOM   972  O  O     . GLU A 1 126 ? 67.027  15.000  187.422 1.00 41.42  ? 125  GLU F O     1 
ATOM   973  C  CB    . GLU A 1 126 ? 64.232  13.514  186.436 1.00 48.42  ? 125  GLU F CB    1 
ATOM   974  C  CG    . GLU A 1 126 ? 63.765  13.442  187.857 1.00 66.82  ? 125  GLU F CG    1 
ATOM   975  C  CD    . GLU A 1 126 ? 62.946  12.204  188.103 1.00 68.24  ? 125  GLU F CD    1 
ATOM   976  O  OE1   . GLU A 1 126 ? 61.754  12.209  187.735 1.00 73.22  ? 125  GLU F OE1   1 
ATOM   977  O  OE2   . GLU A 1 126 ? 63.507  11.222  188.634 1.00 65.11  ? 125  GLU F OE2   1 
ATOM   978  N  N     . ILE A 1 127 ? 67.215  13.899  185.454 1.00 43.59  ? 126  ILE F N     1 
ATOM   979  C  CA    . ILE A 1 127 ? 68.664  13.747  185.554 1.00 42.26  ? 126  ILE F CA    1 
ATOM   980  C  C     . ILE A 1 127 ? 69.349  15.107  185.553 1.00 40.38  ? 126  ILE F C     1 
ATOM   981  O  O     . ILE A 1 127 ? 70.261  15.358  186.349 1.00 38.80  ? 126  ILE F O     1 
ATOM   982  C  CB    . ILE A 1 127 ? 69.184  12.853  184.411 1.00 35.43  ? 126  ILE F CB    1 
ATOM   983  C  CG1   . ILE A 1 127 ? 68.796  11.386  184.650 1.00 45.99  ? 126  ILE F CG1   1 
ATOM   984  C  CG2   . ILE A 1 127 ? 70.713  13.008  184.234 1.00 31.36  ? 126  ILE F CG2   1 
ATOM   985  C  CD1   . ILE A 1 127 ? 68.917  10.515  183.411 1.00 39.42  ? 126  ILE F CD1   1 
ATOM   986  N  N     . ARG A 1 128 ? 68.943  16.001  184.653 1.00 42.21  ? 127  ARG F N     1 
ATOM   987  C  CA    . ARG A 1 128 ? 69.586  17.311  184.627 1.00 40.25  ? 127  ARG F CA    1 
ATOM   988  C  C     . ARG A 1 128 ? 69.355  18.058  185.935 1.00 45.87  ? 127  ARG F C     1 
ATOM   989  O  O     . ARG A 1 128 ? 70.267  18.719  186.451 1.00 46.95  ? 127  ARG F O     1 
ATOM   990  C  CB    . ARG A 1 128 ? 69.096  18.129  183.436 1.00 39.13  ? 127  ARG F CB    1 
ATOM   991  C  CG    . ARG A 1 128 ? 69.634  17.651  182.090 1.00 34.78  ? 127  ARG F CG    1 
ATOM   992  C  CD    . ARG A 1 128 ? 69.365  18.676  180.999 1.00 44.78  ? 127  ARG F CD    1 
ATOM   993  N  NE    . ARG A 1 128 ? 67.976  19.106  180.974 1.00 60.28  ? 127  ARG F NE    1 
ATOM   994  C  CZ    . ARG A 1 128 ? 67.544  20.323  181.296 1.00 56.18  ? 127  ARG F CZ    1 
ATOM   995  N  NH1   . ARG A 1 128 ? 68.382  21.278  181.679 1.00 50.89  ? 127  ARG F NH1   1 
ATOM   996  N  NH2   . ARG A 1 128 ? 66.253  20.580  181.237 1.00 57.02  ? 127  ARG F NH2   1 
ATOM   997  N  N     . GLN A 1 129 ? 68.153  17.928  186.509 1.00 42.21  ? 128  GLN F N     1 
ATOM   998  C  CA    . GLN A 1 129 ? 67.846  18.629  187.754 1.00 45.85  ? 128  GLN F CA    1 
ATOM   999  C  C     . GLN A 1 129 ? 68.616  18.035  188.926 1.00 44.69  ? 128  GLN F C     1 
ATOM   1000 O  O     . GLN A 1 129 ? 69.133  18.773  189.777 1.00 43.96  ? 128  GLN F O     1 
ATOM   1001 C  CB    . GLN A 1 129 ? 66.342  18.587  188.025 1.00 49.79  ? 128  GLN F CB    1 
ATOM   1002 C  CG    . GLN A 1 129 ? 65.904  19.417  189.228 1.00 53.81  ? 128  GLN F CG    1 
ATOM   1003 C  CD    . GLN A 1 129 ? 66.126  20.907  189.020 1.00 57.50  ? 128  GLN F CD    1 
ATOM   1004 O  OE1   . GLN A 1 129 ? 65.696  21.474  188.017 1.00 64.63  ? 128  GLN F OE1   1 
ATOM   1005 N  NE2   . GLN A 1 129 ? 66.808  21.545  189.964 1.00 55.27  ? 128  GLN F NE2   1 
ATOM   1006 N  N     . THR A 1 130 ? 68.700  16.704  188.987 1.00 42.70  ? 129  THR F N     1 
ATOM   1007 C  CA    . THR A 1 130 ? 69.472  16.061  190.045 1.00 47.97  ? 129  THR F CA    1 
ATOM   1008 C  C     . THR A 1 130 ? 70.942  16.449  189.976 1.00 45.89  ? 129  THR F C     1 
ATOM   1009 O  O     . THR A 1 130 ? 71.562  16.752  191.004 1.00 46.40  ? 129  THR F O     1 
ATOM   1010 C  CB    . THR A 1 130 ? 69.322  14.549  189.956 1.00 44.14  ? 129  THR F CB    1 
ATOM   1011 O  OG1   . THR A 1 130 ? 67.930  14.213  190.014 1.00 51.56  ? 129  THR F OG1   1 
ATOM   1012 C  CG2   . THR A 1 130 ? 70.038  13.893  191.109 1.00 43.50  ? 129  THR F CG2   1 
ATOM   1013 N  N     . ILE A 1 131 ? 71.521  16.434  188.772 1.00 36.14  ? 130  ILE F N     1 
ATOM   1014 C  CA    . ILE A 1 131 ? 72.910  16.841  188.615 1.00 38.11  ? 130  ILE F CA    1 
ATOM   1015 C  C     . ILE A 1 131 ? 73.098  18.255  189.139 1.00 43.83  ? 130  ILE F C     1 
ATOM   1016 O  O     . ILE A 1 131 ? 74.058  18.543  189.861 1.00 42.60  ? 130  ILE F O     1 
ATOM   1017 C  CB    . ILE A 1 131 ? 73.344  16.728  187.142 1.00 37.52  ? 130  ILE F CB    1 
ATOM   1018 C  CG1   . ILE A 1 131 ? 73.417  15.268  186.697 1.00 31.27  ? 130  ILE F CG1   1 
ATOM   1019 C  CG2   . ILE A 1 131 ? 74.702  17.447  186.908 1.00 31.63  ? 130  ILE F CG2   1 
ATOM   1020 C  CD1   . ILE A 1 131 ? 73.663  15.148  185.198 1.00 37.57  ? 130  ILE F CD1   1 
ATOM   1021 N  N     . PHE A 1 132 ? 72.179  19.159  188.795 1.00 40.13  ? 131  PHE F N     1 
ATOM   1022 C  CA    . PHE A 1 132 ? 72.295  20.511  189.318 1.00 40.82  ? 131  PHE F CA    1 
ATOM   1023 C  C     . PHE A 1 132 ? 72.117  20.527  190.831 1.00 47.60  ? 131  PHE F C     1 
ATOM   1024 O  O     . PHE A 1 132 ? 72.871  21.203  191.540 1.00 50.46  ? 131  PHE F O     1 
ATOM   1025 C  CB    . PHE A 1 132 ? 71.285  21.441  188.646 1.00 42.43  ? 131  PHE F CB    1 
ATOM   1026 C  CG    . PHE A 1 132 ? 71.344  22.843  189.158 1.00 44.58  ? 131  PHE F CG    1 
ATOM   1027 C  CD1   . PHE A 1 132 ? 72.496  23.595  189.010 1.00 47.05  ? 131  PHE F CD1   1 
ATOM   1028 C  CD2   . PHE A 1 132 ? 70.261  23.405  189.810 1.00 54.68  ? 131  PHE F CD2   1 
ATOM   1029 C  CE1   . PHE A 1 132 ? 72.560  24.896  189.495 1.00 54.32  ? 131  PHE F CE1   1 
ATOM   1030 C  CE2   . PHE A 1 132 ? 70.315  24.704  190.294 1.00 57.69  ? 131  PHE F CE2   1 
ATOM   1031 C  CZ    . PHE A 1 132 ? 71.464  25.449  190.138 1.00 54.50  ? 131  PHE F CZ    1 
ATOM   1032 N  N     . ASN A 1 133 ? 71.146  19.772  191.349 1.00 44.08  ? 132  ASN F N     1 
ATOM   1033 C  CA    . ASN A 1 133 ? 70.895  19.802  192.787 1.00 45.83  ? 132  ASN F CA    1 
ATOM   1034 C  C     . ASN A 1 133 ? 72.078  19.256  193.576 1.00 51.72  ? 132  ASN F C     1 
ATOM   1035 O  O     . ASN A 1 133 ? 72.407  19.779  194.647 1.00 53.40  ? 132  ASN F O     1 
ATOM   1036 C  CB    . ASN A 1 133 ? 69.632  19.013  193.128 1.00 50.56  ? 132  ASN F CB    1 
ATOM   1037 C  CG    . ASN A 1 133 ? 68.370  19.710  192.681 1.00 51.38  ? 132  ASN F CG    1 
ATOM   1038 O  OD1   . ASN A 1 133 ? 68.376  20.904  192.389 1.00 54.66  ? 132  ASN F OD1   1 
ATOM   1039 N  ND2   . ASN A 1 133 ? 67.270  18.961  192.625 1.00 48.08  ? 132  ASN F ND2   1 
ATOM   1040 N  N     . GLU A 1 134 ? 72.732  18.210  193.070 1.00 46.38  ? 133  GLU F N     1 
ATOM   1041 C  CA    . GLU A 1 134 ? 73.760  17.537  193.852 1.00 41.56  ? 133  GLU F CA    1 
ATOM   1042 C  C     . GLU A 1 134 ? 75.178  17.978  193.510 1.00 46.35  ? 133  GLU F C     1 
ATOM   1043 O  O     . GLU A 1 134 ? 76.068  17.853  194.358 1.00 46.38  ? 133  GLU F O     1 
ATOM   1044 C  CB    . GLU A 1 134 ? 73.642  16.011  193.686 1.00 42.01  ? 133  GLU F CB    1 
ATOM   1045 C  CG    . GLU A 1 134 ? 72.313  15.412  194.185 1.00 50.30  ? 133  GLU F CG    1 
ATOM   1046 C  CD    . GLU A 1 134 ? 72.284  13.881  194.086 1.00 59.40  ? 133  GLU F CD    1 
ATOM   1047 O  OE1   . GLU A 1 134 ? 73.349  13.273  193.815 1.00 47.14  ? 133  GLU F OE1   1 
ATOM   1048 O  OE2   . GLU A 1 134 ? 71.197  13.284  194.268 1.00 54.08  ? 133  GLU F OE2   1 
ATOM   1049 N  N     . LEU A 1 135 ? 75.424  18.481  192.305 1.00 45.74  ? 134  LEU F N     1 
ATOM   1050 C  CA    . LEU A 1 135 ? 76.768  18.895  191.941 1.00 42.36  ? 134  LEU F CA    1 
ATOM   1051 C  C     . LEU A 1 135 ? 76.929  20.386  191.717 1.00 39.36  ? 134  LEU F C     1 
ATOM   1052 O  O     . LEU A 1 135 ? 78.066  20.834  191.534 1.00 42.04  ? 134  LEU F O     1 
ATOM   1053 C  CB    . LEU A 1 135 ? 77.241  18.170  190.674 1.00 45.79  ? 134  LEU F CB    1 
ATOM   1054 C  CG    . LEU A 1 135 ? 77.552  16.686  190.846 1.00 49.14  ? 134  LEU F CG    1 
ATOM   1055 C  CD1   . LEU A 1 135 ? 76.397  15.849  190.336 1.00 48.73  ? 134  LEU F CD1   1 
ATOM   1056 C  CD2   . LEU A 1 135 ? 78.819  16.375  190.102 1.00 48.15  ? 134  LEU F CD2   1 
ATOM   1057 N  N     . GLN A 1 136 ? 75.844  21.161  191.723 1.00 39.45  ? 135  GLN F N     1 
ATOM   1058 C  CA    . GLN A 1 136 ? 75.880  22.597  191.391 1.00 50.83  ? 135  GLN F CA    1 
ATOM   1059 C  C     . GLN A 1 136 ? 76.549  22.837  190.037 1.00 47.42  ? 135  GLN F C     1 
ATOM   1060 O  O     . GLN A 1 136 ? 77.291  23.805  189.844 1.00 43.02  ? 135  GLN F O     1 
ATOM   1061 C  CB    . GLN A 1 136 ? 76.574  23.431  192.480 1.00 57.02  ? 135  GLN F CB    1 
ATOM   1062 C  CG    . GLN A 1 136 ? 76.589  22.849  193.882 1.00 66.79  ? 135  GLN F CG    1 
ATOM   1063 C  CD    . GLN A 1 136 ? 75.219  22.430  194.361 1.00 84.84  ? 135  GLN F CD    1 
ATOM   1064 O  OE1   . GLN A 1 136 ? 74.231  23.140  194.162 1.00 91.64  ? 135  GLN F OE1   1 
ATOM   1065 N  NE2   . GLN A 1 136 ? 75.148  21.258  194.987 1.00 86.73  ? 135  GLN F NE2   1 
ATOM   1066 N  N     . LEU A 1 137 ? 76.307  21.925  189.099 1.00 39.69  ? 136  LEU F N     1 
ATOM   1067 C  CA    . LEU A 1 137 ? 76.776  22.028  187.725 1.00 30.57  ? 136  LEU F CA    1 
ATOM   1068 C  C     . LEU A 1 137 ? 75.575  21.789  186.819 1.00 39.59  ? 136  LEU F C     1 
ATOM   1069 O  O     . LEU A 1 137 ? 74.661  21.049  187.185 1.00 40.58  ? 136  LEU F O     1 
ATOM   1070 C  CB    . LEU A 1 137 ? 77.899  20.983  187.427 1.00 29.27  ? 136  LEU F CB    1 
ATOM   1071 C  CG    . LEU A 1 137 ? 79.165  21.018  188.295 1.00 39.11  ? 136  LEU F CG    1 
ATOM   1072 C  CD1   . LEU A 1 137 ? 80.038  19.783  188.088 1.00 30.98  ? 136  LEU F CD1   1 
ATOM   1073 C  CD2   . LEU A 1 137 ? 79.960  22.286  188.015 1.00 34.27  ? 136  LEU F CD2   1 
ATOM   1074 N  N     . THR A 1 138 ? 75.554  22.404  185.643 1.00 37.89  ? 137  THR F N     1 
ATOM   1075 C  CA    . THR A 1 138 ? 74.422  22.173  184.754 1.00 38.25  ? 137  THR F CA    1 
ATOM   1076 C  C     . THR A 1 138 ? 74.805  21.268  183.596 1.00 36.03  ? 137  THR F C     1 
ATOM   1077 O  O     . THR A 1 138 ? 75.965  21.179  183.191 1.00 32.12  ? 137  THR F O     1 
ATOM   1078 C  CB    . THR A 1 138 ? 73.809  23.467  184.186 1.00 37.87  ? 137  THR F CB    1 
ATOM   1079 O  OG1   . THR A 1 138 ? 74.727  24.130  183.298 1.00 40.05  ? 137  THR F OG1   1 
ATOM   1080 C  CG2   . THR A 1 138 ? 73.346  24.395  185.311 1.00 39.95  ? 137  THR F CG2   1 
ATOM   1081 N  N     . ALA A 1 139 ? 73.797  20.601  183.061 1.00 34.94  ? 138  ALA F N     1 
ATOM   1082 C  CA    . ALA A 1 139 ? 73.965  19.662  181.975 1.00 31.81  ? 138  ALA F CA    1 
ATOM   1083 C  C     . ALA A 1 139 ? 72.884  19.932  180.948 1.00 31.82  ? 138  ALA F C     1 
ATOM   1084 O  O     . ALA A 1 139 ? 71.812  20.436  181.272 1.00 33.67  ? 138  ALA F O     1 
ATOM   1085 C  CB    . ALA A 1 139 ? 73.881  18.209  182.478 1.00 32.69  ? 138  ALA F CB    1 
ATOM   1086 N  N     . SER A 1 140 ? 73.175  19.594  179.705 1.00 28.10  ? 139  SER F N     1 
ATOM   1087 C  CA    . SER A 1 140 ? 72.179  19.612  178.653 1.00 28.71  ? 139  SER F CA    1 
ATOM   1088 C  C     . SER A 1 140 ? 71.903  18.185  178.197 1.00 35.91  ? 139  SER F C     1 
ATOM   1089 O  O     . SER A 1 140 ? 72.626  17.254  178.547 1.00 29.28  ? 139  SER F O     1 
ATOM   1090 C  CB    . SER A 1 140 ? 72.645  20.491  177.489 1.00 33.17  ? 139  SER F CB    1 
ATOM   1091 O  OG    . SER A 1 140 ? 72.742  21.838  177.939 1.00 31.56  ? 139  SER F OG    1 
ATOM   1092 N  N     . ALA A 1 141 ? 70.821  17.993  177.448 1.00 33.02  ? 140  ALA F N     1 
ATOM   1093 C  CA    . ALA A 1 141 ? 70.504  16.623  177.072 1.00 35.04  ? 140  ALA F CA    1 
ATOM   1094 C  C     . ALA A 1 141 ? 69.820  16.603  175.719 1.00 34.67  ? 140  ALA F C     1 
ATOM   1095 O  O     . ALA A 1 141 ? 69.186  17.574  175.308 1.00 35.14  ? 140  ALA F O     1 
ATOM   1096 C  CB    . ALA A 1 141 ? 69.628  15.928  178.120 1.00 30.94  ? 140  ALA F CB    1 
ATOM   1097 N  N     . GLY A 1 142 ? 69.976  15.483  175.028 1.00 33.26  ? 141  GLY F N     1 
ATOM   1098 C  CA    . GLY A 1 142 ? 69.261  15.243  173.792 1.00 28.77  ? 141  GLY F CA    1 
ATOM   1099 C  C     . GLY A 1 142 ? 68.558  13.904  173.861 1.00 28.85  ? 141  GLY F C     1 
ATOM   1100 O  O     . GLY A 1 142 ? 69.054  12.953  174.459 1.00 30.78  ? 141  GLY F O     1 
ATOM   1101 N  N     . VAL A 1 143 ? 67.376  13.849  173.245 1.00 26.91  ? 142  VAL F N     1 
ATOM   1102 C  CA    . VAL A 1 143 ? 66.521  12.661  173.258 1.00 35.34  ? 142  VAL F CA    1 
ATOM   1103 C  C     . VAL A 1 143 ? 66.129  12.336  171.823 1.00 32.97  ? 142  VAL F C     1 
ATOM   1104 O  O     . VAL A 1 143 ? 65.591  13.201  171.121 1.00 36.99  ? 142  VAL F O     1 
ATOM   1105 C  CB    . VAL A 1 143 ? 65.259  12.877  174.116 1.00 33.29  ? 142  VAL F CB    1 
ATOM   1106 C  CG1   . VAL A 1 143 ? 64.390  11.607  174.139 1.00 36.85  ? 142  VAL F CG1   1 
ATOM   1107 C  CG2   . VAL A 1 143 ? 65.624  13.291  175.519 1.00 33.12  ? 142  VAL F CG2   1 
ATOM   1108 N  N     . ALA A 1 144 ? 66.348  11.088  171.406 1.00 33.15  ? 143  ALA F N     1 
ATOM   1109 C  CA    . ALA A 1 144 ? 66.120  10.681  170.022 1.00 32.75  ? 143  ALA F CA    1 
ATOM   1110 C  C     . ALA A 1 144 ? 65.988  9.159   169.971 1.00 39.04  ? 143  ALA F C     1 
ATOM   1111 O  O     . ALA A 1 144 ? 66.280  8.464   170.956 1.00 35.30  ? 143  ALA F O     1 
ATOM   1112 C  CB    . ALA A 1 144 ? 67.263  11.166  169.118 1.00 29.90  ? 143  ALA F CB    1 
ATOM   1113 N  N     . PRO A 1 145 ? 65.544  8.599   168.836 1.00 36.47  ? 144  PRO F N     1 
ATOM   1114 C  CA    . PRO A 1 145 ? 65.431  7.137   168.748 1.00 38.47  ? 144  PRO F CA    1 
ATOM   1115 C  C     . PRO A 1 145 ? 66.744  6.416   168.520 1.00 41.43  ? 144  PRO F C     1 
ATOM   1116 O  O     . PRO A 1 145 ? 66.758  5.182   168.628 1.00 38.39  ? 144  PRO F O     1 
ATOM   1117 C  CB    . PRO A 1 145 ? 64.490  6.909   167.547 1.00 38.38  ? 144  PRO F CB    1 
ATOM   1118 C  CG    . PRO A 1 145 ? 63.828  8.236   167.300 1.00 37.25  ? 144  PRO F CG    1 
ATOM   1119 C  CD    . PRO A 1 145 ? 64.842  9.264   167.722 1.00 42.46  ? 144  PRO F CD    1 
ATOM   1120 N  N     . VAL A 1 146 ? 67.828  7.121   168.182 1.00 33.24  ? 145  VAL F N     1 
ATOM   1121 C  CA    . VAL A 1 146 ? 69.118  6.497   167.899 1.00 32.47  ? 145  VAL F CA    1 
ATOM   1122 C  C     . VAL A 1 146 ? 70.228  7.367   168.476 1.00 33.46  ? 145  VAL F C     1 
ATOM   1123 O  O     . VAL A 1 146 ? 70.029  8.539   168.803 1.00 28.81  ? 145  VAL F O     1 
ATOM   1124 C  CB    . VAL A 1 146 ? 69.366  6.277   166.392 1.00 35.62  ? 145  VAL F CB    1 
ATOM   1125 C  CG1   . VAL A 1 146 ? 68.321  5.321   165.785 1.00 35.05  ? 145  VAL F CG1   1 
ATOM   1126 C  CG2   . VAL A 1 146 ? 69.401  7.645   165.659 1.00 34.74  ? 145  VAL F CG2   1 
ATOM   1127 N  N     . LYS A 1 147 ? 71.424  6.779   168.574 1.00 30.62  ? 146  LYS F N     1 
ATOM   1128 C  CA    . LYS A 1 147 ? 72.544  7.444   169.232 1.00 31.78  ? 146  LYS F CA    1 
ATOM   1129 C  C     . LYS A 1 147 ? 72.864  8.804   168.617 1.00 32.68  ? 146  LYS F C     1 
ATOM   1130 O  O     . LYS A 1 147 ? 72.925  9.814   169.328 1.00 29.12  ? 146  LYS F O     1 
ATOM   1131 C  CB    . LYS A 1 147 ? 73.778  6.553   169.175 1.00 30.67  ? 146  LYS F CB    1 
ATOM   1132 C  CG    . LYS A 1 147 ? 73.848  5.520   170.260 1.00 33.43  ? 146  LYS F CG    1 
ATOM   1133 C  CD    . LYS A 1 147 ? 75.166  4.781   170.045 1.00 35.64  ? 146  LYS F CD    1 
ATOM   1134 C  CE    . LYS A 1 147 ? 75.544  3.922   171.222 1.00 37.87  ? 146  LYS F CE    1 
ATOM   1135 N  NZ    . LYS A 1 147 ? 76.934  3.422   170.998 1.00 40.31  ? 146  LYS F NZ    1 
ATOM   1136 N  N     . PHE A 1 148 ? 73.106  8.856   167.301 1.00 30.90  ? 147  PHE F N     1 
ATOM   1137 C  CA    . PHE A 1 148 ? 73.719  10.067  166.754 1.00 29.96  ? 147  PHE F CA    1 
ATOM   1138 C  C     . PHE A 1 148 ? 72.754  11.245  166.789 1.00 35.13  ? 147  PHE F C     1 
ATOM   1139 O  O     . PHE A 1 148 ? 73.165  12.376  167.060 1.00 26.98  ? 147  PHE F O     1 
ATOM   1140 C  CB    . PHE A 1 148 ? 74.277  9.811   165.345 1.00 25.58  ? 147  PHE F CB    1 
ATOM   1141 C  CG    . PHE A 1 148 ? 73.299  9.985   164.228 1.00 35.29  ? 147  PHE F CG    1 
ATOM   1142 C  CD1   . PHE A 1 148 ? 72.414  8.971   163.887 1.00 29.55  ? 147  PHE F CD1   1 
ATOM   1143 C  CD2   . PHE A 1 148 ? 73.309  11.143  163.466 1.00 37.97  ? 147  PHE F CD2   1 
ATOM   1144 C  CE1   . PHE A 1 148 ? 71.540  9.126   162.841 1.00 32.06  ? 147  PHE F CE1   1 
ATOM   1145 C  CE2   . PHE A 1 148 ? 72.436  11.309  162.418 1.00 35.78  ? 147  PHE F CE2   1 
ATOM   1146 C  CZ    . PHE A 1 148 ? 71.546  10.296  162.100 1.00 33.50  ? 147  PHE F CZ    1 
ATOM   1147 N  N     . LEU A 1 149 ? 71.467  10.996  166.569 1.00 31.48  ? 148  LEU F N     1 
ATOM   1148 C  CA    . LEU A 1 149 ? 70.482  12.067  166.656 1.00 30.42  ? 148  LEU F CA    1 
ATOM   1149 C  C     . LEU A 1 149 ? 70.368  12.592  168.080 1.00 32.82  ? 148  LEU F C     1 
ATOM   1150 O  O     . LEU A 1 149 ? 70.207  13.799  168.289 1.00 34.26  ? 148  LEU F O     1 
ATOM   1151 C  CB    . LEU A 1 149 ? 69.131  11.563  166.135 1.00 29.18  ? 148  LEU F CB    1 
ATOM   1152 C  CG    . LEU A 1 149 ? 69.121  11.428  164.610 1.00 33.62  ? 148  LEU F CG    1 
ATOM   1153 C  CD1   . LEU A 1 149 ? 67.792  10.872  164.072 1.00 35.86  ? 148  LEU F CD1   1 
ATOM   1154 C  CD2   . LEU A 1 149 ? 69.453  12.792  163.954 1.00 28.61  ? 148  LEU F CD2   1 
ATOM   1155 N  N     . ALA A 1 150 ? 70.464  11.703  169.067 1.00 34.14  ? 149  ALA F N     1 
ATOM   1156 C  CA    . ALA A 1 150 ? 70.436  12.130  170.462 1.00 27.25  ? 149  ALA F CA    1 
ATOM   1157 C  C     . ALA A 1 150 ? 71.622  13.034  170.766 1.00 30.09  ? 149  ALA F C     1 
ATOM   1158 O  O     . ALA A 1 150 ? 71.489  14.050  171.461 1.00 28.85  ? 149  ALA F O     1 
ATOM   1159 C  CB    . ALA A 1 150 ? 70.439  10.899  171.379 1.00 27.20  ? 149  ALA F CB    1 
ATOM   1160 N  N     . LYS A 1 151 ? 72.791  12.680  170.235 1.00 26.91  ? 150  LYS F N     1 
ATOM   1161 C  CA    . LYS A 1 151 ? 73.992  13.456  170.491 1.00 31.43  ? 150  LYS F CA    1 
ATOM   1162 C  C     . LYS A 1 151 ? 73.911  14.824  169.823 1.00 35.01  ? 150  LYS F C     1 
ATOM   1163 O  O     . LYS A 1 151 ? 74.213  15.842  170.452 1.00 30.20  ? 150  LYS F O     1 
ATOM   1164 C  CB    . LYS A 1 151 ? 75.212  12.675  170.008 1.00 22.12  ? 150  LYS F CB    1 
ATOM   1165 C  CG    . LYS A 1 151 ? 76.456  13.523  169.984 1.00 31.94  ? 150  LYS F CG    1 
ATOM   1166 C  CD    . LYS A 1 151 ? 77.636  12.638  170.226 1.00 41.77  ? 150  LYS F CD    1 
ATOM   1167 C  CE    . LYS A 1 151 ? 78.803  13.517  170.556 1.00 47.83  ? 150  LYS F CE    1 
ATOM   1168 N  NZ    . LYS A 1 151 ? 79.448  13.034  171.802 1.00 51.50  ? 150  LYS F NZ    1 
ATOM   1169 N  N     . ILE A 1 152 ? 73.475  14.873  168.559 1.00 30.00  ? 151  ILE F N     1 
ATOM   1170 C  CA    . ILE A 1 152 ? 73.195  16.164  167.930 1.00 34.39  ? 151  ILE F CA    1 
ATOM   1171 C  C     . ILE A 1 152 ? 72.168  16.940  168.749 1.00 40.43  ? 151  ILE F C     1 
ATOM   1172 O  O     . ILE A 1 152 ? 72.320  18.147  168.984 1.00 36.17  ? 151  ILE F O     1 
ATOM   1173 C  CB    . ILE A 1 152 ? 72.737  15.958  166.469 1.00 30.78  ? 151  ILE F CB    1 
ATOM   1174 C  CG1   . ILE A 1 152 ? 73.878  15.338  165.642 1.00 32.03  ? 151  ILE F CG1   1 
ATOM   1175 C  CG2   . ILE A 1 152 ? 72.234  17.283  165.842 1.00 34.67  ? 151  ILE F CG2   1 
ATOM   1176 C  CD1   . ILE A 1 152 ? 73.478  14.850  164.260 1.00 30.95  ? 151  ILE F CD1   1 
ATOM   1177 N  N     . ALA A 1 153 ? 71.114  16.261  169.213 1.00 26.04  ? 152  ALA F N     1 
ATOM   1178 C  CA    . ALA A 1 153 ? 70.057  16.970  169.927 1.00 35.09  ? 152  ALA F CA    1 
ATOM   1179 C  C     . ALA A 1 153 ? 70.565  17.637  171.200 1.00 37.44  ? 152  ALA F C     1 
ATOM   1180 O  O     . ALA A 1 153 ? 70.059  18.704  171.578 1.00 32.87  ? 152  ALA F O     1 
ATOM   1181 C  CB    . ALA A 1 153 ? 68.905  16.017  170.263 1.00 33.80  ? 152  ALA F CB    1 
ATOM   1182 N  N     . SER A 1 154 ? 71.547  17.029  171.883 1.00 26.94  ? 153  SER F N     1 
ATOM   1183 C  CA    . SER A 1 154 ? 72.015  17.594  173.143 1.00 32.42  ? 153  SER F CA    1 
ATOM   1184 C  C     . SER A 1 154 ? 72.755  18.907  172.939 1.00 30.60  ? 153  SER F C     1 
ATOM   1185 O  O     . SER A 1 154 ? 72.853  19.702  173.881 1.00 35.22  ? 153  SER F O     1 
ATOM   1186 C  CB    . SER A 1 154 ? 72.888  16.580  173.892 1.00 36.74  ? 153  SER F CB    1 
ATOM   1187 O  OG    . SER A 1 154 ? 74.171  16.453  173.319 1.00 35.60  ? 153  SER F OG    1 
ATOM   1188 N  N     . ASP A 1 155 ? 73.218  19.188  171.722 1.00 32.90  ? 154  ASP F N     1 
ATOM   1189 C  CA    . ASP A 1 155 ? 73.839  20.473  171.441 1.00 39.52  ? 154  ASP F CA    1 
ATOM   1190 C  C     . ASP A 1 155 ? 72.844  21.588  171.162 1.00 43.65  ? 154  ASP F C     1 
ATOM   1191 O  O     . ASP A 1 155 ? 73.224  22.758  171.240 1.00 47.58  ? 154  ASP F O     1 
ATOM   1192 C  CB    . ASP A 1 155 ? 74.769  20.390  170.233 1.00 41.43  ? 154  ASP F CB    1 
ATOM   1193 C  CG    . ASP A 1 155 ? 76.119  19.841  170.576 1.00 46.45  ? 154  ASP F CG    1 
ATOM   1194 O  OD1   . ASP A 1 155 ? 76.465  19.794  171.776 1.00 58.07  ? 154  ASP F OD1   1 
ATOM   1195 O  OD2   . ASP A 1 155 ? 76.838  19.461  169.631 1.00 57.55  ? 154  ASP F OD2   1 
ATOM   1196 N  N     . MET A 1 156 ? 71.597  21.279  170.809 1.00 42.72  ? 155  MET F N     1 
ATOM   1197 C  CA    . MET A 1 156 ? 70.764  22.323  170.217 1.00 41.17  ? 155  MET F CA    1 
ATOM   1198 C  C     . MET A 1 156 ? 70.124  23.253  171.236 1.00 41.13  ? 155  MET F C     1 
ATOM   1199 O  O     . MET A 1 156 ? 69.723  24.367  170.877 1.00 43.27  ? 155  MET F O     1 
ATOM   1200 C  CB    . MET A 1 156 ? 69.713  21.681  169.326 1.00 45.18  ? 155  MET F CB    1 
ATOM   1201 C  CG    . MET A 1 156 ? 70.383  20.980  168.179 1.00 46.22  ? 155  MET F CG    1 
ATOM   1202 S  SD    . MET A 1 156 ? 69.185  20.041  167.276 1.00 58.66  ? 155  MET F SD    1 
ATOM   1203 C  CE    . MET A 1 156 ? 68.009  21.364  166.965 1.00 54.29  ? 155  MET F CE    1 
ATOM   1204 N  N     . ASN A 1 157 ? 70.082  22.873  172.500 1.00 40.49  ? 156  ASN F N     1 
ATOM   1205 C  CA    . ASN A 1 157 ? 69.478  23.729  173.506 1.00 37.83  ? 156  ASN F CA    1 
ATOM   1206 C  C     . ASN A 1 157 ? 70.406  23.931  174.697 1.00 39.82  ? 156  ASN F C     1 
ATOM   1207 O  O     . ASN A 1 157 ? 69.954  24.040  175.839 1.00 48.09  ? 156  ASN F O     1 
ATOM   1208 C  CB    . ASN A 1 157 ? 68.138  23.153  173.949 1.00 44.04  ? 156  ASN F CB    1 
ATOM   1209 C  CG    . ASN A 1 157 ? 67.026  24.152  173.856 1.00 50.35  ? 156  ASN F CG    1 
ATOM   1210 O  OD1   . ASN A 1 157 ? 67.130  25.150  173.135 1.00 54.32  ? 156  ASN F OD1   1 
ATOM   1211 N  ND2   . ASN A 1 157 ? 65.949  23.902  174.588 1.00 46.88  ? 156  ASN F ND2   1 
ATOM   1212 N  N     . LYS A 1 158 ? 71.719  23.980  174.461 1.00 35.62  ? 157  LYS F N     1 
ATOM   1213 C  CA    . LYS A 1 158 ? 72.662  24.223  175.547 1.00 36.11  ? 157  LYS F CA    1 
ATOM   1214 C  C     . LYS A 1 158 ? 72.909  25.734  175.680 1.00 38.35  ? 157  LYS F C     1 
ATOM   1215 O  O     . LYS A 1 158 ? 72.755  26.463  174.712 1.00 36.33  ? 157  LYS F O     1 
ATOM   1216 C  CB    . LYS A 1 158 ? 73.980  23.451  175.315 1.00 39.42  ? 157  LYS F CB    1 
ATOM   1217 C  CG    . LYS A 1 158 ? 74.830  23.906  174.146 1.00 47.14  ? 157  LYS F CG    1 
ATOM   1218 C  CD    . LYS A 1 158 ? 76.039  22.949  173.946 1.00 55.95  ? 157  LYS F CD    1 
ATOM   1219 C  CE    . LYS A 1 158 ? 76.996  23.451  172.853 1.00 63.58  ? 157  LYS F CE    1 
ATOM   1220 N  NZ    . LYS A 1 158 ? 78.156  22.534  172.601 1.00 61.12  ? 157  LYS F NZ    1 
ATOM   1221 N  N     . PRO A 1 159 ? 73.267  26.213  176.886 1.00 36.47  ? 158  PRO F N     1 
ATOM   1222 C  CA    . PRO A 1 159 ? 73.470  25.457  178.121 1.00 33.80  ? 158  PRO F CA    1 
ATOM   1223 C  C     . PRO A 1 159 ? 72.172  25.215  178.872 1.00 38.71  ? 158  PRO F C     1 
ATOM   1224 O  O     . PRO A 1 159 ? 71.186  25.931  178.658 1.00 37.26  ? 158  PRO F O     1 
ATOM   1225 C  CB    . PRO A 1 159 ? 74.391  26.369  178.927 1.00 31.61  ? 158  PRO F CB    1 
ATOM   1226 C  CG    . PRO A 1 159 ? 73.922  27.764  178.540 1.00 33.94  ? 158  PRO F CG    1 
ATOM   1227 C  CD    . PRO A 1 159 ? 73.489  27.661  177.089 1.00 32.71  ? 158  PRO F CD    1 
ATOM   1228 N  N     . ASN A 1 160 ? 72.179  24.201  179.736 1.00 32.81  ? 159  ASN F N     1 
ATOM   1229 C  CA    . ASN A 1 160 ? 71.100  23.957  180.686 1.00 35.27  ? 159  ASN F CA    1 
ATOM   1230 C  C     . ASN A 1 160 ? 69.747  23.840  179.980 1.00 40.84  ? 159  ASN F C     1 
ATOM   1231 O  O     . ASN A 1 160 ? 68.788  24.534  180.300 1.00 43.38  ? 159  ASN F O     1 
ATOM   1232 C  CB    . ASN A 1 160 ? 71.075  25.045  181.767 1.00 36.72  ? 159  ASN F CB    1 
ATOM   1233 C  CG    . ASN A 1 160 ? 70.237  24.647  182.987 1.00 42.04  ? 159  ASN F CG    1 
ATOM   1234 O  OD1   . ASN A 1 160 ? 69.814  23.501  183.119 1.00 44.99  ? 159  ASN F OD1   1 
ATOM   1235 N  ND2   . ASN A 1 160 ? 70.007  25.597  183.887 1.00 42.06  ? 159  ASN F ND2   1 
ATOM   1236 N  N     . GLY A 1 161 ? 69.675  22.938  179.008 1.00 35.21  ? 160  GLY F N     1 
ATOM   1237 C  CA    . GLY A 1 161 ? 68.446  22.727  178.265 1.00 37.55  ? 160  GLY F CA    1 
ATOM   1238 C  C     . GLY A 1 161 ? 68.508  21.404  177.535 1.00 40.82  ? 160  GLY F C     1 
ATOM   1239 O  O     . GLY A 1 161 ? 69.533  20.717  177.528 1.00 35.61  ? 160  GLY F O     1 
ATOM   1240 N  N     . GLN A 1 162 ? 67.394  21.035  176.911 1.00 40.87  ? 161  GLN F N     1 
ATOM   1241 C  CA    . GLN A 1 162 ? 67.341  19.754  176.218 1.00 39.42  ? 161  GLN F CA    1 
ATOM   1242 C  C     . GLN A 1 162 ? 66.509  19.893  174.954 1.00 43.53  ? 161  GLN F C     1 
ATOM   1243 O  O     . GLN A 1 162 ? 65.835  20.902  174.731 1.00 38.28  ? 161  GLN F O     1 
ATOM   1244 C  CB    . GLN A 1 162 ? 66.811  18.633  177.137 1.00 31.00  ? 161  GLN F CB    1 
ATOM   1245 C  CG    . GLN A 1 162 ? 65.428  18.902  177.779 1.00 39.10  ? 161  GLN F CG    1 
ATOM   1246 C  CD    . GLN A 1 162 ? 65.064  17.833  178.798 1.00 43.17  ? 161  GLN F CD    1 
ATOM   1247 O  OE1   . GLN A 1 162 ? 65.796  17.595  179.759 1.00 45.28  ? 161  GLN F OE1   1 
ATOM   1248 N  NE2   . GLN A 1 162 ? 63.943  17.164  178.574 1.00 46.03  ? 161  GLN F NE2   1 
ATOM   1249 N  N     . PHE A 1 163 ? 66.594  18.878  174.100 1.00 32.10  ? 162  PHE F N     1 
ATOM   1250 C  CA    . PHE A 1 163 ? 65.887  18.875  172.830 1.00 30.83  ? 162  PHE F CA    1 
ATOM   1251 C  C     . PHE A 1 163 ? 65.488  17.448  172.496 1.00 34.65  ? 162  PHE F C     1 
ATOM   1252 O  O     . PHE A 1 163 ? 66.301  16.528  172.625 1.00 35.50  ? 162  PHE F O     1 
ATOM   1253 C  CB    . PHE A 1 163 ? 66.756  19.452  171.711 1.00 32.77  ? 162  PHE F CB    1 
ATOM   1254 C  CG    . PHE A 1 163 ? 66.023  19.647  170.416 1.00 44.14  ? 162  PHE F CG    1 
ATOM   1255 C  CD1   . PHE A 1 163 ? 65.139  20.705  170.262 1.00 50.17  ? 162  PHE F CD1   1 
ATOM   1256 C  CD2   . PHE A 1 163 ? 66.240  18.801  169.343 1.00 42.87  ? 162  PHE F CD2   1 
ATOM   1257 C  CE1   . PHE A 1 163 ? 64.464  20.890  169.073 1.00 59.06  ? 162  PHE F CE1   1 
ATOM   1258 C  CE2   . PHE A 1 163 ? 65.561  18.984  168.147 1.00 45.84  ? 162  PHE F CE2   1 
ATOM   1259 C  CZ    . PHE A 1 163 ? 64.677  20.023  168.013 1.00 55.32  ? 162  PHE F CZ    1 
ATOM   1260 N  N     . VAL A 1 164 ? 64.253  17.266  172.039 1.00 30.30  ? 163  VAL F N     1 
ATOM   1261 C  CA    . VAL A 1 164 ? 63.695  15.941  171.797 1.00 38.16  ? 163  VAL F CA    1 
ATOM   1262 C  C     . VAL A 1 164 ? 63.375  15.803  170.318 1.00 41.05  ? 163  VAL F C     1 
ATOM   1263 O  O     . VAL A 1 164 ? 62.676  16.647  169.753 1.00 38.07  ? 163  VAL F O     1 
ATOM   1264 C  CB    . VAL A 1 164 ? 62.441  15.698  172.650 1.00 44.28  ? 163  VAL F CB    1 
ATOM   1265 C  CG1   . VAL A 1 164 ? 61.846  14.330  172.329 1.00 45.71  ? 163  VAL F CG1   1 
ATOM   1266 C  CG2   . VAL A 1 164 ? 62.784  15.818  174.128 1.00 42.04  ? 163  VAL F CG2   1 
ATOM   1267 N  N     . ILE A 1 165 ? 63.861  14.736  169.698 1.00 37.47  ? 164  ILE F N     1 
ATOM   1268 C  CA    . ILE A 1 165 ? 63.517  14.414  168.318 1.00 39.69  ? 164  ILE F CA    1 
ATOM   1269 C  C     . ILE A 1 165 ? 62.650  13.157  168.343 1.00 43.31  ? 164  ILE F C     1 
ATOM   1270 O  O     . ILE A 1 165 ? 63.145  12.069  168.659 1.00 33.63  ? 164  ILE F O     1 
ATOM   1271 C  CB    . ILE A 1 165 ? 64.768  14.207  167.456 1.00 33.55  ? 164  ILE F CB    1 
ATOM   1272 C  CG1   . ILE A 1 165 ? 65.624  15.476  167.432 1.00 36.44  ? 164  ILE F CG1   1 
ATOM   1273 C  CG2   . ILE A 1 165 ? 64.388  13.806  166.036 1.00 36.46  ? 164  ILE F CG2   1 
ATOM   1274 C  CD1   . ILE A 1 165 ? 66.994  15.268  166.776 1.00 30.72  ? 164  ILE F CD1   1 
ATOM   1275 N  N     . THR A 1 166 ? 61.349  13.279  168.024 1.00 36.33  ? 165  THR F N     1 
ATOM   1276 C  CA    . THR A 1 166 ? 60.529  12.088  167.921 1.00 39.21  ? 165  THR F CA    1 
ATOM   1277 C  C     . THR A 1 166 ? 60.724  11.416  166.569 1.00 40.26  ? 165  THR F C     1 
ATOM   1278 O  O     . THR A 1 166 ? 61.157  12.048  165.602 1.00 39.30  ? 165  THR F O     1 
ATOM   1279 C  CB    . THR A 1 166 ? 59.050  12.425  168.058 1.00 35.76  ? 165  THR F CB    1 
ATOM   1280 O  OG1   . THR A 1 166 ? 58.654  13.064  166.849 1.00 39.48  ? 165  THR F OG1   1 
ATOM   1281 C  CG2   . THR A 1 166 ? 58.781  13.390  169.230 1.00 42.36  ? 165  THR F CG2   1 
ATOM   1282 N  N     . PRO A 1 167 ? 60.355  10.134  166.461 1.00 51.88  ? 166  PRO F N     1 
ATOM   1283 C  CA    . PRO A 1 167 ? 60.365  9.486   165.144 1.00 36.06  ? 166  PRO F CA    1 
ATOM   1284 C  C     . PRO A 1 167 ? 59.608  10.264  164.065 1.00 35.47  ? 166  PRO F C     1 
ATOM   1285 O  O     . PRO A 1 167 ? 60.038  10.296  162.904 1.00 41.03  ? 166  PRO F O     1 
ATOM   1286 C  CB    . PRO A 1 167 ? 59.730  8.127   165.465 1.00 50.53  ? 166  PRO F CB    1 
ATOM   1287 C  CG    . PRO A 1 167 ? 60.200  7.815   166.865 1.00 47.02  ? 166  PRO F CG    1 
ATOM   1288 C  CD    . PRO A 1 167 ? 60.182  9.143   167.555 1.00 46.36  ? 166  PRO F CD    1 
ATOM   1289 N  N     . ALA A 1 168 ? 58.488  10.902  164.400 1.00 38.92  ? 167  ALA F N     1 
ATOM   1290 C  CA    . ALA A 1 168 ? 57.772  11.664  163.379 1.00 50.06  ? 167  ALA F CA    1 
ATOM   1291 C  C     . ALA A 1 168 ? 58.602  12.833  162.858 1.00 49.91  ? 167  ALA F C     1 
ATOM   1292 O  O     . ALA A 1 168 ? 58.488  13.185  161.682 1.00 48.34  ? 167  ALA F O     1 
ATOM   1293 C  CB    . ALA A 1 168 ? 56.433  12.163  163.917 1.00 47.93  ? 167  ALA F CB    1 
ATOM   1294 N  N     . GLU A 1 169 ? 59.463  13.423  163.696 1.00 45.88  ? 168  GLU F N     1 
ATOM   1295 C  CA    . GLU A 1 169 ? 60.222  14.616  163.310 1.00 40.45  ? 168  GLU F CA    1 
ATOM   1296 C  C     . GLU A 1 169 ? 61.534  14.317  162.576 1.00 43.47  ? 168  GLU F C     1 
ATOM   1297 O  O     . GLU A 1 169 ? 62.190  15.256  162.093 1.00 37.59  ? 168  GLU F O     1 
ATOM   1298 C  CB    . GLU A 1 169 ? 60.536  15.454  164.550 1.00 50.06  ? 168  GLU F CB    1 
ATOM   1299 C  CG    . GLU A 1 169 ? 59.329  15.758  165.403 1.00 55.29  ? 168  GLU F CG    1 
ATOM   1300 C  CD    . GLU A 1 169 ? 59.725  16.381  166.719 1.00 63.48  ? 168  GLU F CD    1 
ATOM   1301 O  OE1   . GLU A 1 169 ? 59.271  17.505  167.007 1.00 68.99  ? 168  GLU F OE1   1 
ATOM   1302 O  OE2   . GLU A 1 169 ? 60.506  15.752  167.460 1.00 62.05  ? 168  GLU F OE2   1 
ATOM   1303 N  N     . VAL A 1 170 ? 61.937  13.049  162.488 1.00 35.69  ? 169  VAL F N     1 
ATOM   1304 C  CA    . VAL A 1 170 ? 63.266  12.727  161.961 1.00 35.32  ? 169  VAL F CA    1 
ATOM   1305 C  C     . VAL A 1 170 ? 63.452  13.137  160.503 1.00 34.67  ? 169  VAL F C     1 
ATOM   1306 O  O     . VAL A 1 170 ? 64.496  13.725  160.182 1.00 34.92  ? 169  VAL F O     1 
ATOM   1307 C  CB    . VAL A 1 170 ? 63.579  11.235  162.198 1.00 37.53  ? 169  VAL F CB    1 
ATOM   1308 C  CG1   . VAL A 1 170 ? 64.751  10.804  161.332 1.00 31.99  ? 169  VAL F CG1   1 
ATOM   1309 C  CG2   . VAL A 1 170 ? 63.901  11.001  163.670 1.00 33.89  ? 169  VAL F CG2   1 
ATOM   1310 N  N     . PRO A 1 171 ? 62.517  12.877  159.582 1.00 36.16  ? 170  PRO F N     1 
ATOM   1311 C  CA    . PRO A 1 171 ? 62.767  13.277  158.182 1.00 38.19  ? 170  PRO F CA    1 
ATOM   1312 C  C     . PRO A 1 171 ? 62.974  14.776  157.978 1.00 40.46  ? 170  PRO F C     1 
ATOM   1313 O  O     . PRO A 1 171 ? 63.862  15.177  157.211 1.00 37.10  ? 170  PRO F O     1 
ATOM   1314 C  CB    . PRO A 1 171 ? 61.505  12.796  157.458 1.00 41.96  ? 170  PRO F CB    1 
ATOM   1315 C  CG    . PRO A 1 171 ? 61.057  11.634  158.270 1.00 46.79  ? 170  PRO F CG    1 
ATOM   1316 C  CD    . PRO A 1 171 ? 61.319  12.026  159.692 1.00 37.98  ? 170  PRO F CD    1 
ATOM   1317 N  N     . ALA A 1 172 ? 62.152  15.615  158.612 1.00 39.46  ? 171  ALA F N     1 
ATOM   1318 C  CA    . ALA A 1 172 ? 62.327  17.055  158.459 1.00 38.88  ? 171  ALA F CA    1 
ATOM   1319 C  C     . ALA A 1 172 ? 63.634  17.497  159.093 1.00 34.74  ? 171  ALA F C     1 
ATOM   1320 O  O     . ALA A 1 172 ? 64.344  18.341  158.545 1.00 42.68  ? 171  ALA F O     1 
ATOM   1321 C  CB    . ALA A 1 172 ? 61.140  17.810  159.064 1.00 41.23  ? 171  ALA F CB    1 
ATOM   1322 N  N     . PHE A 1 173 ? 63.992  16.893  160.228 1.00 35.07  ? 172  PHE F N     1 
ATOM   1323 C  CA    . PHE A 1 173 ? 65.256  17.213  160.868 1.00 39.24  ? 172  PHE F CA    1 
ATOM   1324 C  C     . PHE A 1 173 ? 66.431  16.900  159.950 1.00 41.87  ? 172  PHE F C     1 
ATOM   1325 O  O     . PHE A 1 173 ? 67.341  17.718  159.806 1.00 38.28  ? 172  PHE F O     1 
ATOM   1326 C  CB    . PHE A 1 173 ? 65.393  16.462  162.192 1.00 39.12  ? 172  PHE F CB    1 
ATOM   1327 C  CG    . PHE A 1 173 ? 66.571  16.919  163.003 1.00 31.77  ? 172  PHE F CG    1 
ATOM   1328 C  CD1   . PHE A 1 173 ? 66.505  18.116  163.713 1.00 44.02  ? 172  PHE F CD1   1 
ATOM   1329 C  CD2   . PHE A 1 173 ? 67.750  16.191  163.021 1.00 32.13  ? 172  PHE F CD2   1 
ATOM   1330 C  CE1   . PHE A 1 173 ? 67.591  18.574  164.446 1.00 46.56  ? 172  PHE F CE1   1 
ATOM   1331 C  CE2   . PHE A 1 173 ? 68.846  16.645  163.747 1.00 35.12  ? 172  PHE F CE2   1 
ATOM   1332 C  CZ    . PHE A 1 173 ? 68.758  17.851  164.460 1.00 35.43  ? 172  PHE F CZ    1 
ATOM   1333 N  N     . LEU A 1 174 ? 66.413  15.733  159.302 1.00 41.23  ? 173  LEU F N     1 
ATOM   1334 C  CA    . LEU A 1 174 ? 67.533  15.290  158.470 1.00 33.90  ? 173  LEU F CA    1 
ATOM   1335 C  C     . LEU A 1 174 ? 67.710  16.130  157.221 1.00 35.63  ? 173  LEU F C     1 
ATOM   1336 O  O     . LEU A 1 174 ? 68.839  16.287  156.741 1.00 37.04  ? 173  LEU F O     1 
ATOM   1337 C  CB    . LEU A 1 174 ? 67.309  13.851  158.029 1.00 38.57  ? 173  LEU F CB    1 
ATOM   1338 C  CG    . LEU A 1 174 ? 67.429  12.790  159.102 1.00 39.04  ? 173  LEU F CG    1 
ATOM   1339 C  CD1   . LEU A 1 174 ? 66.897  11.486  158.525 1.00 36.64  ? 173  LEU F CD1   1 
ATOM   1340 C  CD2   . LEU A 1 174 ? 68.889  12.682  159.544 1.00 39.73  ? 173  LEU F CD2   1 
ATOM   1341 N  N     . GLN A 1 175 ? 66.608  16.628  156.652 1.00 36.33  ? 174  GLN F N     1 
ATOM   1342 C  CA    . GLN A 1 175 ? 66.644  17.156  155.297 1.00 34.63  ? 174  GLN F CA    1 
ATOM   1343 C  C     . GLN A 1 175 ? 67.719  18.223  155.146 1.00 35.67  ? 174  GLN F C     1 
ATOM   1344 O  O     . GLN A 1 175 ? 68.487  18.203  154.178 1.00 41.73  ? 174  GLN F O     1 
ATOM   1345 C  CB    . GLN A 1 175 ? 65.264  17.707  154.920 1.00 43.03  ? 174  GLN F CB    1 
ATOM   1346 C  CG    . GLN A 1 175 ? 65.099  17.995  153.442 1.00 44.58  ? 174  GLN F CG    1 
ATOM   1347 C  CD    . GLN A 1 175 ? 65.231  16.744  152.591 1.00 50.05  ? 174  GLN F CD    1 
ATOM   1348 O  OE1   . GLN A 1 175 ? 65.791  16.783  151.495 1.00 57.39  ? 174  GLN F OE1   1 
ATOM   1349 N  NE2   . GLN A 1 175 ? 64.709  15.624  153.093 1.00 43.34  ? 174  GLN F NE2   1 
ATOM   1350 N  N     . THR A 1 176 ? 67.803  19.146  156.110 1.00 38.00  ? 175  THR F N     1 
ATOM   1351 C  CA    . THR A 1 176 ? 68.744  20.263  156.063 1.00 51.50  ? 175  THR F CA    1 
ATOM   1352 C  C     . THR A 1 176 ? 69.906  20.097  157.033 1.00 44.47  ? 175  THR F C     1 
ATOM   1353 O  O     . THR A 1 176 ? 70.709  21.025  157.182 1.00 34.67  ? 175  THR F O     1 
ATOM   1354 C  CB    . THR A 1 176 ? 68.042  21.606  156.350 1.00 48.77  ? 175  THR F CB    1 
ATOM   1355 O  OG1   . THR A 1 176 ? 67.591  21.636  157.713 1.00 55.75  ? 175  THR F OG1   1 
ATOM   1356 C  CG2   . THR A 1 176 ? 66.859  21.825  155.411 1.00 52.98  ? 175  THR F CG2   1 
ATOM   1357 N  N     . LEU A 1 177 ? 70.022  18.950  157.684 1.00 37.89  ? 176  LEU F N     1 
ATOM   1358 C  CA    . LEU A 1 177 ? 71.096  18.715  158.643 1.00 34.86  ? 176  LEU F CA    1 
ATOM   1359 C  C     . LEU A 1 177 ? 72.454  18.678  157.950 1.00 35.91  ? 176  LEU F C     1 
ATOM   1360 O  O     . LEU A 1 177 ? 72.704  17.763  157.155 1.00 36.07  ? 176  LEU F O     1 
ATOM   1361 C  CB    . LEU A 1 177 ? 70.836  17.404  159.377 1.00 41.17  ? 176  LEU F CB    1 
ATOM   1362 C  CG    . LEU A 1 177 ? 71.943  16.887  160.288 1.00 44.72  ? 176  LEU F CG    1 
ATOM   1363 C  CD1   . LEU A 1 177 ? 72.196  17.883  161.409 1.00 43.90  ? 176  LEU F CD1   1 
ATOM   1364 C  CD2   . LEU A 1 177 ? 71.566  15.503  160.823 1.00 44.26  ? 176  LEU F CD2   1 
ATOM   1365 N  N     . PRO A 1 178 ? 73.361  19.621  158.232 1.00 36.94  ? 177  PRO F N     1 
ATOM   1366 C  CA    . PRO A 1 178 ? 74.703  19.560  157.637 1.00 35.94  ? 177  PRO F CA    1 
ATOM   1367 C  C     . PRO A 1 178 ? 75.403  18.255  157.977 1.00 34.79  ? 177  PRO F C     1 
ATOM   1368 O  O     . PRO A 1 178 ? 75.311  17.756  159.100 1.00 42.18  ? 177  PRO F O     1 
ATOM   1369 C  CB    . PRO A 1 178 ? 75.429  20.757  158.269 1.00 39.41  ? 177  PRO F CB    1 
ATOM   1370 C  CG    . PRO A 1 178 ? 74.328  21.681  158.692 1.00 40.49  ? 177  PRO F CG    1 
ATOM   1371 C  CD    . PRO A 1 178 ? 73.218  20.776  159.135 1.00 40.12  ? 177  PRO F CD    1 
ATOM   1372 N  N     . LEU A 1 179 ? 76.109  17.700  156.986 1.00 33.78  ? 178  LEU F N     1 
ATOM   1373 C  CA    . LEU A 1 179 ? 76.863  16.472  157.209 1.00 36.16  ? 178  LEU F CA    1 
ATOM   1374 C  C     . LEU A 1 179 ? 77.896  16.646  158.311 1.00 35.05  ? 178  LEU F C     1 
ATOM   1375 O  O     . LEU A 1 179 ? 78.116  15.731  159.111 1.00 30.90  ? 178  LEU F O     1 
ATOM   1376 C  CB    . LEU A 1 179 ? 77.531  16.032  155.906 1.00 32.35  ? 178  LEU F CB    1 
ATOM   1377 C  CG    . LEU A 1 179 ? 76.466  15.709  154.850 1.00 31.44  ? 178  LEU F CG    1 
ATOM   1378 C  CD1   . LEU A 1 179 ? 77.105  15.479  153.491 1.00 34.54  ? 178  LEU F CD1   1 
ATOM   1379 C  CD2   . LEU A 1 179 ? 75.643  14.492  155.287 1.00 30.93  ? 178  LEU F CD2   1 
ATOM   1380 N  N     . ALA A 1 180 ? 78.528  17.827  158.383 1.00 37.33  ? 179  ALA F N     1 
ATOM   1381 C  CA    . ALA A 1 180 ? 79.554  18.063  159.396 1.00 43.87  ? 179  ALA F CA    1 
ATOM   1382 C  C     . ALA A 1 180 ? 79.014  17.909  160.810 1.00 42.95  ? 179  ALA F C     1 
ATOM   1383 O  O     . ALA A 1 180 ? 79.801  17.755  161.744 1.00 41.03  ? 179  ALA F O     1 
ATOM   1384 C  CB    . ALA A 1 180 ? 80.160  19.462  159.224 1.00 44.78  ? 179  ALA F CB    1 
ATOM   1385 N  N     . LYS A 1 181 ? 77.691  17.958  160.995 1.00 42.48  ? 180  LYS F N     1 
ATOM   1386 C  CA    . LYS A 1 181 ? 77.120  17.728  162.315 1.00 35.44  ? 180  LYS F CA    1 
ATOM   1387 C  C     . LYS A 1 181 ? 77.153  16.265  162.724 1.00 35.67  ? 180  LYS F C     1 
ATOM   1388 O  O     . LYS A 1 181 ? 77.025  15.967  163.917 1.00 39.02  ? 180  LYS F O     1 
ATOM   1389 C  CB    . LYS A 1 181 ? 75.683  18.246  162.362 1.00 49.37  ? 180  LYS F CB    1 
ATOM   1390 C  CG    . LYS A 1 181 ? 75.572  19.765  162.407 1.00 51.84  ? 180  LYS F CG    1 
ATOM   1391 C  CD    . LYS A 1 181 ? 75.652  20.284  163.842 1.00 61.86  ? 180  LYS F CD    1 
ATOM   1392 C  CE    . LYS A 1 181 ? 74.824  21.567  164.017 1.00 67.48  ? 180  LYS F CE    1 
ATOM   1393 N  NZ    . LYS A 1 181 ? 74.433  21.849  165.439 1.00 63.56  ? 180  LYS F NZ    1 
ATOM   1394 N  N     . ILE A 1 182 ? 77.341  15.352  161.780 1.00 33.90  ? 181  ILE F N     1 
ATOM   1395 C  CA    . ILE A 1 182 ? 77.362  13.926  162.126 1.00 34.44  ? 181  ILE F CA    1 
ATOM   1396 C  C     . ILE A 1 182 ? 78.663  13.601  162.847 1.00 39.54  ? 181  ILE F C     1 
ATOM   1397 O  O     . ILE A 1 182 ? 79.747  13.899  162.314 1.00 31.38  ? 181  ILE F O     1 
ATOM   1398 C  CB    . ILE A 1 182 ? 77.218  13.072  160.866 1.00 32.24  ? 181  ILE F CB    1 
ATOM   1399 C  CG1   . ILE A 1 182 ? 75.883  13.355  160.174 1.00 36.68  ? 181  ILE F CG1   1 
ATOM   1400 C  CG2   . ILE A 1 182 ? 77.328  11.616  161.209 1.00 37.36  ? 181  ILE F CG2   1 
ATOM   1401 C  CD1   . ILE A 1 182 ? 75.786  12.715  158.809 1.00 40.25  ? 181  ILE F CD1   1 
ATOM   1402 N  N     . PRO A 1 183 ? 78.617  12.971  164.023 1.00 43.12  ? 182  PRO F N     1 
ATOM   1403 C  CA    . PRO A 1 183 ? 79.861  12.543  164.680 1.00 42.11  ? 182  PRO F CA    1 
ATOM   1404 C  C     . PRO A 1 183 ? 80.646  11.608  163.770 1.00 35.32  ? 182  PRO F C     1 
ATOM   1405 O  O     . PRO A 1 183 ? 80.088  10.687  163.177 1.00 38.78  ? 182  PRO F O     1 
ATOM   1406 C  CB    . PRO A 1 183 ? 79.366  11.827  165.942 1.00 47.61  ? 182  PRO F CB    1 
ATOM   1407 C  CG    . PRO A 1 183 ? 77.985  12.373  166.173 1.00 44.42  ? 182  PRO F CG    1 
ATOM   1408 C  CD    . PRO A 1 183 ? 77.424  12.610  164.808 1.00 38.92  ? 182  PRO F CD    1 
ATOM   1409 N  N     . GLY A 1 184 ? 81.948  11.888  163.619 1.00 31.63  ? 183  GLY F N     1 
ATOM   1410 C  CA    . GLY A 1 184 ? 82.802  11.158  162.708 1.00 34.66  ? 183  GLY F CA    1 
ATOM   1411 C  C     . GLY A 1 184 ? 83.045  11.851  161.382 1.00 30.82  ? 183  GLY F C     1 
ATOM   1412 O  O     . GLY A 1 184 ? 83.981  11.483  160.669 1.00 38.67  ? 183  GLY F O     1 
ATOM   1413 N  N     . VAL A 1 185 ? 82.232  12.837  161.038 1.00 32.07  ? 184  VAL F N     1 
ATOM   1414 C  CA    . VAL A 1 185 ? 82.429  13.667  159.856 1.00 33.06  ? 184  VAL F CA    1 
ATOM   1415 C  C     . VAL A 1 185 ? 83.137  14.928  160.329 1.00 28.64  ? 184  VAL F C     1 
ATOM   1416 O  O     . VAL A 1 185 ? 82.509  15.827  160.884 1.00 38.63  ? 184  VAL F O     1 
ATOM   1417 C  CB    . VAL A 1 185 ? 81.103  13.996  159.165 1.00 34.42  ? 184  VAL F CB    1 
ATOM   1418 C  CG1   . VAL A 1 185 ? 81.345  14.882  157.950 1.00 33.50  ? 184  VAL F CG1   1 
ATOM   1419 C  CG2   . VAL A 1 185 ? 80.371  12.699  158.791 1.00 36.00  ? 184  VAL F CG2   1 
ATOM   1420 N  N     . GLY A 1 186 ? 84.450  14.991  160.118 1.00 30.88  ? 185  GLY F N     1 
ATOM   1421 C  CA    . GLY A 1 186 ? 85.253  16.130  160.507 1.00 30.42  ? 185  GLY F CA    1 
ATOM   1422 C  C     . GLY A 1 186 ? 85.590  17.022  159.332 1.00 32.57  ? 185  GLY F C     1 
ATOM   1423 O  O     . GLY A 1 186 ? 85.030  16.890  158.237 1.00 30.32  ? 185  GLY F O     1 
ATOM   1424 N  N     . LYS A 1 187 ? 86.539  17.939  159.563 1.00 34.18  ? 186  LYS F N     1 
ATOM   1425 C  CA    . LYS A 1 187 ? 86.856  18.966  158.572 1.00 41.03  ? 186  LYS F CA    1 
ATOM   1426 C  C     . LYS A 1 187 ? 87.264  18.357  157.235 1.00 37.71  ? 186  LYS F C     1 
ATOM   1427 O  O     . LYS A 1 187 ? 86.825  18.820  156.178 1.00 37.67  ? 186  LYS F O     1 
ATOM   1428 C  CB    . LYS A 1 187 ? 87.963  19.887  159.104 1.00 56.23  ? 186  LYS F CB    1 
ATOM   1429 C  CG    . LYS A 1 187 ? 89.128  20.117  158.137 1.00 69.54  ? 186  LYS F CG    1 
ATOM   1430 C  CD    . LYS A 1 187 ? 90.302  20.870  158.776 1.00 68.37  ? 186  LYS F CD    1 
ATOM   1431 C  CE    . LYS A 1 187 ? 91.512  20.862  157.850 1.00 69.21  ? 186  LYS F CE    1 
ATOM   1432 N  NZ    . LYS A 1 187 ? 92.371  22.086  157.999 1.00 80.54  ? 186  LYS F NZ    1 
ATOM   1433 N  N     . VAL A 1 188 ? 88.101  17.318  157.262 1.00 39.47  ? 187  VAL F N     1 
ATOM   1434 C  CA    . VAL A 1 188 ? 88.615  16.736  156.024 1.00 40.96  ? 187  VAL F CA    1 
ATOM   1435 C  C     . VAL A 1 188 ? 87.494  16.058  155.256 1.00 39.51  ? 187  VAL F C     1 
ATOM   1436 O  O     . VAL A 1 188 ? 87.331  16.270  154.050 1.00 38.28  ? 187  VAL F O     1 
ATOM   1437 C  CB    . VAL A 1 188 ? 89.769  15.760  156.320 1.00 41.68  ? 187  VAL F CB    1 
ATOM   1438 C  CG1   . VAL A 1 188 ? 90.086  14.930  155.090 1.00 49.10  ? 187  VAL F CG1   1 
ATOM   1439 C  CG2   . VAL A 1 188 ? 91.019  16.528  156.786 1.00 39.47  ? 187  VAL F CG2   1 
ATOM   1440 N  N     . SER A 1 189 ? 86.685  15.253  155.953 1.00 33.64  ? 188  SER F N     1 
ATOM   1441 C  CA    . SER A 1 189 ? 85.571  14.585  155.298 1.00 31.48  ? 188  SER F CA    1 
ATOM   1442 C  C     . SER A 1 189 ? 84.549  15.594  154.796 1.00 31.83  ? 188  SER F C     1 
ATOM   1443 O  O     . SER A 1 189 ? 83.983  15.421  153.714 1.00 38.90  ? 188  SER F O     1 
ATOM   1444 C  CB    . SER A 1 189 ? 84.919  13.579  156.251 1.00 30.61  ? 188  SER F CB    1 
ATOM   1445 O  OG    . SER A 1 189 ? 85.887  12.655  156.741 1.00 37.70  ? 188  SER F OG    1 
ATOM   1446 N  N     . ALA A 1 190 ? 84.277  16.641  155.572 1.00 31.51  ? 189  ALA F N     1 
ATOM   1447 C  CA    . ALA A 1 190 ? 83.235  17.584  155.166 1.00 43.59  ? 189  ALA F CA    1 
ATOM   1448 C  C     . ALA A 1 190 ? 83.641  18.352  153.924 1.00 43.05  ? 189  ALA F C     1 
ATOM   1449 O  O     . ALA A 1 190 ? 82.790  18.660  153.069 1.00 39.69  ? 189  ALA F O     1 
ATOM   1450 C  CB    . ALA A 1 190 ? 82.916  18.561  156.295 1.00 40.01  ? 189  ALA F CB    1 
ATOM   1451 N  N     . ALA A 1 191 ? 84.931  18.671  153.819 1.00 40.31  ? 190  ALA F N     1 
ATOM   1452 C  CA    . ALA A 1 191 ? 85.446  19.368  152.648 1.00 45.29  ? 190  ALA F CA    1 
ATOM   1453 C  C     . ALA A 1 191 ? 85.435  18.457  151.433 1.00 43.46  ? 190  ALA F C     1 
ATOM   1454 O  O     . ALA A 1 191 ? 85.124  18.896  150.322 1.00 42.58  ? 190  ALA F O     1 
ATOM   1455 C  CB    . ALA A 1 191 ? 86.858  19.882  152.931 1.00 47.39  ? 190  ALA F CB    1 
ATOM   1456 N  N     . LYS A 1 192 ? 85.765  17.180  151.620 1.00 41.30  ? 191  LYS F N     1 
ATOM   1457 C  CA    . LYS A 1 192 ? 85.645  16.231  150.520 1.00 39.44  ? 191  LYS F CA    1 
ATOM   1458 C  C     . LYS A 1 192 ? 84.198  16.101  150.073 1.00 47.97  ? 191  LYS F C     1 
ATOM   1459 O  O     . LYS A 1 192 ? 83.903  16.142  148.872 1.00 51.34  ? 191  LYS F O     1 
ATOM   1460 C  CB    . LYS A 1 192 ? 86.196  14.873  150.943 1.00 45.91  ? 191  LYS F CB    1 
ATOM   1461 C  CG    . LYS A 1 192 ? 86.409  13.911  149.807 1.00 59.89  ? 191  LYS F CG    1 
ATOM   1462 C  CD    . LYS A 1 192 ? 87.017  12.615  150.338 1.00 69.62  ? 191  LYS F CD    1 
ATOM   1463 C  CE    . LYS A 1 192 ? 88.167  12.894  151.308 1.00 77.15  ? 191  LYS F CE    1 
ATOM   1464 N  NZ    . LYS A 1 192 ? 88.617  11.658  152.019 1.00 84.80  ? 191  LYS F NZ    1 
ATOM   1465 N  N     . LEU A 1 193 ? 83.280  15.928  151.028 1.00 34.33  ? 192  LEU F N     1 
ATOM   1466 C  CA    . LEU A 1 193 ? 81.863  15.852  150.690 1.00 35.80  ? 192  LEU F CA    1 
ATOM   1467 C  C     . LEU A 1 193 ? 81.396  17.147  150.025 1.00 44.48  ? 192  LEU F C     1 
ATOM   1468 O  O     . LEU A 1 193 ? 80.690  17.118  149.009 1.00 44.30  ? 192  LEU F O     1 
ATOM   1469 C  CB    . LEU A 1 193 ? 81.050  15.544  151.950 1.00 33.27  ? 192  LEU F CB    1 
ATOM   1470 C  CG    . LEU A 1 193 ? 81.262  14.122  152.501 1.00 36.61  ? 192  LEU F CG    1 
ATOM   1471 C  CD1   . LEU A 1 193 ? 80.754  13.955  153.936 1.00 37.81  ? 192  LEU F CD1   1 
ATOM   1472 C  CD2   . LEU A 1 193 ? 80.584  13.106  151.590 1.00 42.63  ? 192  LEU F CD2   1 
ATOM   1473 N  N     . GLU A 1 194 ? 81.811  18.298  150.570 1.00 45.01  ? 193  GLU F N     1 
ATOM   1474 C  CA    . GLU A 1 194 ? 81.431  19.580  149.979 1.00 50.08  ? 193  GLU F CA    1 
ATOM   1475 C  C     . GLU A 1 194 ? 81.887  19.680  148.528 1.00 57.06  ? 193  GLU F C     1 
ATOM   1476 O  O     . GLU A 1 194 ? 81.171  20.224  147.680 1.00 55.46  ? 193  GLU F O     1 
ATOM   1477 C  CB    . GLU A 1 194 ? 82.009  20.736  150.805 1.00 53.64  ? 193  GLU F CB    1 
ATOM   1478 C  CG    . GLU A 1 194 ? 81.508  22.136  150.416 1.00 64.69  ? 193  GLU F CG    1 
ATOM   1479 C  CD    . GLU A 1 194 ? 80.143  22.468  151.015 1.00 81.80  ? 193  GLU F CD    1 
ATOM   1480 O  OE1   . GLU A 1 194 ? 79.807  21.921  152.091 1.00 86.30  ? 193  GLU F OE1   1 
ATOM   1481 O  OE2   . GLU A 1 194 ? 79.407  23.278  150.410 1.00 81.60  ? 193  GLU F OE2   1 
ATOM   1482 N  N     . ALA A 1 195 ? 83.070  19.152  148.217 1.00 55.47  ? 194  ALA F N     1 
ATOM   1483 C  CA    . ALA A 1 195 ? 83.571  19.242  146.851 1.00 60.86  ? 194  ALA F CA    1 
ATOM   1484 C  C     . ALA A 1 195 ? 82.865  18.283  145.904 1.00 60.62  ? 194  ALA F C     1 
ATOM   1485 O  O     . ALA A 1 195 ? 83.126  18.328  144.698 1.00 71.45  ? 194  ALA F O     1 
ATOM   1486 C  CB    . ALA A 1 195 ? 85.078  18.995  146.819 1.00 59.63  ? 194  ALA F CB    1 
ATOM   1487 N  N     . MET A 1 196 ? 82.001  17.413  146.416 1.00 48.35  ? 195  MET F N     1 
ATOM   1488 C  CA    . MET A 1 196 ? 81.089  16.630  145.599 1.00 53.67  ? 195  MET F CA    1 
ATOM   1489 C  C     . MET A 1 196 ? 79.696  17.238  145.563 1.00 55.49  ? 195  MET F C     1 
ATOM   1490 O  O     . MET A 1 196 ? 78.765  16.598  145.062 1.00 53.14  ? 195  MET F O     1 
ATOM   1491 C  CB    . MET A 1 196 ? 80.990  15.194  146.124 1.00 58.31  ? 195  MET F CB    1 
ATOM   1492 C  CG    . MET A 1 196 ? 82.266  14.394  146.091 1.00 63.06  ? 195  MET F CG    1 
ATOM   1493 S  SD    . MET A 1 196 ? 82.100  12.909  147.095 1.00 61.74  ? 195  MET F SD    1 
ATOM   1494 C  CE    . MET A 1 196 ? 80.522  12.304  146.526 1.00 59.23  ? 195  MET F CE    1 
ATOM   1495 N  N     . GLY A 1 197 ? 79.523  18.440  146.113 1.00 51.26  ? 196  GLY F N     1 
ATOM   1496 C  CA    . GLY A 1 197 ? 78.199  19.018  146.235 1.00 52.74  ? 196  GLY F CA    1 
ATOM   1497 C  C     . GLY A 1 197 ? 77.322  18.392  147.296 1.00 44.97  ? 196  GLY F C     1 
ATOM   1498 O  O     . GLY A 1 197 ? 76.092  18.479  147.202 1.00 49.75  ? 196  GLY F O     1 
ATOM   1499 N  N     . LEU A 1 198 ? 77.906  17.749  148.299 1.00 39.21  ? 197  LEU F N     1 
ATOM   1500 C  CA    . LEU A 1 198 ? 77.150  17.093  149.362 1.00 40.27  ? 197  LEU F CA    1 
ATOM   1501 C  C     . LEU A 1 198 ? 77.398  17.873  150.647 1.00 47.04  ? 197  LEU F C     1 
ATOM   1502 O  O     . LEU A 1 198 ? 78.489  17.803  151.221 1.00 42.87  ? 197  LEU F O     1 
ATOM   1503 C  CB    . LEU A 1 198 ? 77.553  15.621  149.514 1.00 35.89  ? 197  LEU F CB    1 
ATOM   1504 C  CG    . LEU A 1 198 ? 77.379  14.700  148.296 1.00 39.92  ? 197  LEU F CG    1 
ATOM   1505 C  CD1   . LEU A 1 198 ? 77.759  13.266  148.638 1.00 49.27  ? 197  LEU F CD1   1 
ATOM   1506 C  CD2   . LEU A 1 198 ? 75.958  14.741  147.741 1.00 40.65  ? 197  LEU F CD2   1 
ATOM   1507 N  N     . ARG A 1 199 ? 76.385  18.602  151.101 1.00 40.10  ? 198  ARG F N     1 
ATOM   1508 C  CA    . ARG A 1 199 ? 76.484  19.412  152.305 1.00 41.40  ? 198  ARG F CA    1 
ATOM   1509 C  C     . ARG A 1 199 ? 75.584  18.923  153.420 1.00 33.65  ? 198  ARG F C     1 
ATOM   1510 O  O     . ARG A 1 199 ? 75.982  18.978  154.585 1.00 33.25  ? 198  ARG F O     1 
ATOM   1511 C  CB    . ARG A 1 199 ? 76.137  20.888  151.994 1.00 36.94  ? 198  ARG F CB    1 
ATOM   1512 C  CG    . ARG A 1 199 ? 76.454  21.857  153.122 1.00 41.27  ? 198  ARG F CG    1 
ATOM   1513 C  CD    . ARG A 1 199 ? 76.095  23.314  152.755 1.00 48.30  ? 198  ARG F CD    1 
ATOM   1514 N  NE    . ARG A 1 199 ? 74.644  23.486  152.656 1.00 53.84  ? 198  ARG F NE    1 
ATOM   1515 C  CZ    . ARG A 1 199 ? 73.836  23.591  153.708 1.00 51.06  ? 198  ARG F CZ    1 
ATOM   1516 N  NH1   . ARG A 1 199 ? 74.343  23.561  154.938 1.00 49.01  ? 198  ARG F NH1   1 
ATOM   1517 N  NH2   . ARG A 1 199 ? 72.525  23.722  153.534 1.00 51.10  ? 198  ARG F NH2   1 
ATOM   1518 N  N     . THR A 1 200 ? 74.401  18.418  153.095 1.00 36.15  ? 199  THR F N     1 
ATOM   1519 C  CA    . THR A 1 200 ? 73.410  18.021  154.082 1.00 42.44  ? 199  THR F CA    1 
ATOM   1520 C  C     . THR A 1 200 ? 73.039  16.559  153.896 1.00 35.85  ? 199  THR F C     1 
ATOM   1521 O  O     . THR A 1 200 ? 73.353  15.939  152.878 1.00 35.91  ? 199  THR F O     1 
ATOM   1522 C  CB    . THR A 1 200 ? 72.139  18.868  153.973 1.00 34.07  ? 199  THR F CB    1 
ATOM   1523 O  OG1   . THR A 1 200 ? 71.412  18.463  152.810 1.00 41.53  ? 199  THR F OG1   1 
ATOM   1524 C  CG2   . THR A 1 200 ? 72.477  20.357  153.862 1.00 38.48  ? 199  THR F CG2   1 
ATOM   1525 N  N     . CYS A 1 201 ? 72.322  16.024  154.888 1.00 32.28  ? 200  CYS F N     1 
ATOM   1526 C  CA    . CYS A 1 201 ? 71.821  14.654  154.770 1.00 32.04  ? 200  CYS F CA    1 
ATOM   1527 C  C     . CYS A 1 201 ? 70.838  14.525  153.620 1.00 41.38  ? 200  CYS F C     1 
ATOM   1528 O  O     . CYS A 1 201 ? 70.804  13.487  152.951 1.00 41.44  ? 200  CYS F O     1 
ATOM   1529 C  CB    . CYS A 1 201 ? 71.174  14.212  156.079 1.00 31.35  ? 200  CYS F CB    1 
ATOM   1530 S  SG    . CYS A 1 201 ? 72.360  14.021  157.459 1.00 42.48  ? 200  CYS F SG    1 
ATOM   1531 N  N     . GLY A 1 202 ? 70.036  15.567  153.372 1.00 40.74  ? 201  GLY F N     1 
ATOM   1532 C  CA    . GLY A 1 202 ? 69.176  15.573  152.199 1.00 41.07  ? 201  GLY F CA    1 
ATOM   1533 C  C     . GLY A 1 202 ? 69.938  15.347  150.907 1.00 40.93  ? 201  GLY F C     1 
ATOM   1534 O  O     . GLY A 1 202 ? 69.504  14.574  150.049 1.00 47.96  ? 201  GLY F O     1 
ATOM   1535 N  N     . ASP A 1 203 ? 71.084  16.017  150.751 1.00 39.43  ? 202  ASP F N     1 
ATOM   1536 C  CA    . ASP A 1 203 ? 71.968  15.749  149.616 1.00 45.00  ? 202  ASP F CA    1 
ATOM   1537 C  C     . ASP A 1 203 ? 72.355  14.276  149.537 1.00 50.40  ? 202  ASP F C     1 
ATOM   1538 O  O     . ASP A 1 203 ? 72.324  13.672  148.459 1.00 48.09  ? 202  ASP F O     1 
ATOM   1539 C  CB    . ASP A 1 203 ? 73.235  16.596  149.716 1.00 42.42  ? 202  ASP F CB    1 
ATOM   1540 C  CG    . ASP A 1 203 ? 72.954  18.088  149.714 1.00 53.56  ? 202  ASP F CG    1 
ATOM   1541 O  OD1   . ASP A 1 203 ? 71.830  18.483  149.346 1.00 49.75  ? 202  ASP F OD1   1 
ATOM   1542 O  OD2   . ASP A 1 203 ? 73.867  18.860  150.078 1.00 47.90  ? 202  ASP F OD2   1 
ATOM   1543 N  N     . VAL A 1 204 ? 72.765  13.691  150.664 1.00 44.80  ? 203  VAL F N     1 
ATOM   1544 C  CA    . VAL A 1 204 ? 73.268  12.323  150.628 1.00 36.55  ? 203  VAL F CA    1 
ATOM   1545 C  C     . VAL A 1 204 ? 72.130  11.348  150.379 1.00 41.21  ? 203  VAL F C     1 
ATOM   1546 O  O     . VAL A 1 204 ? 72.335  10.278  149.797 1.00 47.82  ? 203  VAL F O     1 
ATOM   1547 C  CB    . VAL A 1 204 ? 74.035  12.007  151.924 1.00 32.89  ? 203  VAL F CB    1 
ATOM   1548 C  CG1   . VAL A 1 204 ? 74.406  10.511  152.007 1.00 39.19  ? 203  VAL F CG1   1 
ATOM   1549 C  CG2   . VAL A 1 204 ? 75.291  12.878  152.002 1.00 32.80  ? 203  VAL F CG2   1 
ATOM   1550 N  N     . GLN A 1 205 ? 70.912  11.704  150.788 1.00 47.52  ? 204  GLN F N     1 
ATOM   1551 C  CA    . GLN A 1 205 ? 69.758  10.865  150.490 1.00 45.22  ? 204  GLN F CA    1 
ATOM   1552 C  C     . GLN A 1 205 ? 69.559  10.679  148.996 1.00 47.46  ? 204  GLN F C     1 
ATOM   1553 O  O     . GLN A 1 205 ? 69.031  9.648   148.568 1.00 49.74  ? 204  GLN F O     1 
ATOM   1554 C  CB    . GLN A 1 205 ? 68.504  11.460  151.109 1.00 41.97  ? 204  GLN F CB    1 
ATOM   1555 C  CG    . GLN A 1 205 ? 68.480  11.297  152.601 1.00 47.81  ? 204  GLN F CG    1 
ATOM   1556 C  CD    . GLN A 1 205 ? 67.358  12.081  153.225 1.00 42.66  ? 204  GLN F CD    1 
ATOM   1557 O  OE1   . GLN A 1 205 ? 66.417  12.457  152.541 1.00 47.83  ? 204  GLN F OE1   1 
ATOM   1558 N  NE2   . GLN A 1 205 ? 67.447  12.324  154.529 1.00 34.50  ? 204  GLN F NE2   1 
ATOM   1559 N  N     . LYS A 1 206 ? 69.967  11.651  148.187 1.00 49.23  ? 205  LYS F N     1 
ATOM   1560 C  CA    . LYS A 1 206 ? 69.846  11.542  146.740 1.00 57.63  ? 205  LYS F CA    1 
ATOM   1561 C  C     . LYS A 1 206 ? 71.058  10.865  146.105 1.00 65.14  ? 205  LYS F C     1 
ATOM   1562 O  O     . LYS A 1 206 ? 71.269  11.005  144.893 1.00 65.50  ? 205  LYS F O     1 
ATOM   1563 C  CB    . LYS A 1 206 ? 69.619  12.928  146.125 1.00 53.40  ? 205  LYS F CB    1 
ATOM   1564 N  N     . CYS A 1 207 ? 71.848  10.137  146.897 1.00 59.76  ? 206  CYS F N     1 
ATOM   1565 C  CA    . CYS A 1 207 ? 73.063  9.474   146.448 1.00 60.49  ? 206  CYS F CA    1 
ATOM   1566 C  C     . CYS A 1 207 ? 72.881  7.965   146.440 1.00 51.58  ? 206  CYS F C     1 
ATOM   1567 O  O     . CYS A 1 207 ? 72.099  7.409   147.216 1.00 58.04  ? 206  CYS F O     1 
ATOM   1568 C  CB    . CYS A 1 207 ? 74.261  9.803   147.346 1.00 63.72  ? 206  CYS F CB    1 
ATOM   1569 S  SG    . CYS A 1 207 ? 75.013  11.396  147.057 1.00 71.92  ? 206  CYS F SG    1 
ATOM   1570 N  N     . ASP A 1 208 ? 73.652  7.311   145.576 1.00 48.77  ? 207  ASP F N     1 
ATOM   1571 C  CA    . ASP A 1 208 ? 73.653  5.862   145.466 1.00 49.07  ? 207  ASP F CA    1 
ATOM   1572 C  C     . ASP A 1 208 ? 74.656  5.279   146.451 1.00 44.06  ? 207  ASP F C     1 
ATOM   1573 O  O     . ASP A 1 208 ? 75.801  5.738   146.535 1.00 41.91  ? 207  ASP F O     1 
ATOM   1574 C  CB    . ASP A 1 208 ? 73.990  5.441   144.036 1.00 52.35  ? 207  ASP F CB    1 
ATOM   1575 C  CG    . ASP A 1 208 ? 74.274  3.966   143.914 1.00 71.22  ? 207  ASP F CG    1 
ATOM   1576 O  OD1   . ASP A 1 208 ? 73.485  3.146   144.431 1.00 73.01  ? 207  ASP F OD1   1 
ATOM   1577 O  OD2   . ASP A 1 208 ? 75.302  3.624   143.299 1.00 87.61  ? 207  ASP F OD2   1 
ATOM   1578 N  N     . LEU A 1 209 ? 74.220  4.260   147.194 1.00 47.76  ? 208  LEU F N     1 
ATOM   1579 C  CA    . LEU A 1 209 ? 75.096  3.621   148.170 1.00 36.77  ? 208  LEU F CA    1 
ATOM   1580 C  C     . LEU A 1 209 ? 76.353  3.059   147.513 1.00 42.42  ? 208  LEU F C     1 
ATOM   1581 O  O     . LEU A 1 209 ? 77.448  3.141   148.086 1.00 46.15  ? 208  LEU F O     1 
ATOM   1582 C  CB    . LEU A 1 209 ? 74.327  2.527   148.918 1.00 36.38  ? 208  LEU F CB    1 
ATOM   1583 C  CG    . LEU A 1 209 ? 75.150  1.598   149.816 1.00 45.39  ? 208  LEU F CG    1 
ATOM   1584 C  CD1   . LEU A 1 209 ? 75.776  2.379   150.963 1.00 34.18  ? 208  LEU F CD1   1 
ATOM   1585 C  CD2   . LEU A 1 209 ? 74.307  0.418   150.334 1.00 43.48  ? 208  LEU F CD2   1 
ATOM   1586 N  N     . VAL A 1 210 ? 76.225  2.487   146.311 1.00 46.83  ? 209  VAL F N     1 
ATOM   1587 C  CA    . VAL A 1 210 ? 77.393  1.890   145.664 1.00 48.92  ? 209  VAL F CA    1 
ATOM   1588 C  C     . VAL A 1 210 ? 78.437  2.960   145.389 1.00 51.39  ? 209  VAL F C     1 
ATOM   1589 O  O     . VAL A 1 210 ? 79.641  2.745   145.568 1.00 54.17  ? 209  VAL F O     1 
ATOM   1590 C  CB    . VAL A 1 210 ? 76.989  1.156   144.370 1.00 52.14  ? 209  VAL F CB    1 
ATOM   1591 C  CG1   . VAL A 1 210 ? 78.215  0.509   143.737 1.00 52.97  ? 209  VAL F CG1   1 
ATOM   1592 C  CG2   . VAL A 1 210 ? 75.897  0.110   144.638 1.00 43.47  ? 209  VAL F CG2   1 
ATOM   1593 N  N     . MET A 1 211 ? 77.983  4.133   144.962 1.00 57.58  ? 210  MET F N     1 
ATOM   1594 C  CA    . MET A 1 211 ? 78.877  5.258   144.732 1.00 63.44  ? 210  MET F CA    1 
ATOM   1595 C  C     . MET A 1 211 ? 79.647  5.611   146.000 1.00 54.80  ? 210  MET F C     1 
ATOM   1596 O  O     . MET A 1 211 ? 80.879  5.723   145.987 1.00 48.53  ? 210  MET F O     1 
ATOM   1597 C  CB    . MET A 1 211 ? 78.044  6.440   144.247 1.00 79.43  ? 210  MET F CB    1 
ATOM   1598 C  CG    . MET A 1 211 ? 78.659  7.293   143.169 1.00 101.09 ? 210  MET F CG    1 
ATOM   1599 S  SD    . MET A 1 211 ? 78.104  9.000   143.410 1.00 115.89 ? 210  MET F SD    1 
ATOM   1600 C  CE    . MET A 1 211 ? 76.341  8.771   143.685 1.00 105.39 ? 210  MET F CE    1 
ATOM   1601 N  N     . LEU A 1 212 ? 78.932  5.771   147.116 1.00 44.53  ? 211  LEU F N     1 
ATOM   1602 C  CA    . LEU A 1 212 ? 79.579  6.167   148.362 1.00 48.02  ? 211  LEU F CA    1 
ATOM   1603 C  C     . LEU A 1 212 ? 80.539  5.095   148.859 1.00 52.84  ? 211  LEU F C     1 
ATOM   1604 O  O     . LEU A 1 212 ? 81.594  5.413   149.420 1.00 57.78  ? 211  LEU F O     1 
ATOM   1605 C  CB    . LEU A 1 212 ? 78.523  6.479   149.418 1.00 47.02  ? 211  LEU F CB    1 
ATOM   1606 C  CG    . LEU A 1 212 ? 77.680  7.713   149.114 1.00 47.18  ? 211  LEU F CG    1 
ATOM   1607 C  CD1   . LEU A 1 212 ? 76.384  7.654   149.871 1.00 42.37  ? 211  LEU F CD1   1 
ATOM   1608 C  CD2   . LEU A 1 212 ? 78.451  8.955   149.481 1.00 48.18  ? 211  LEU F CD2   1 
ATOM   1609 N  N     . LEU A 1 213 ? 80.185  3.820   148.672 1.00 46.33  ? 212  LEU F N     1 
ATOM   1610 C  CA    . LEU A 1 213 ? 81.065  2.738   149.101 1.00 46.11  ? 212  LEU F CA    1 
ATOM   1611 C  C     . LEU A 1 213 ? 82.376  2.758   148.329 1.00 53.14  ? 212  LEU F C     1 
ATOM   1612 O  O     . LEU A 1 213 ? 83.441  2.479   148.892 1.00 55.44  ? 212  LEU F O     1 
ATOM   1613 C  CB    . LEU A 1 213 ? 80.356  1.394   148.935 1.00 39.89  ? 212  LEU F CB    1 
ATOM   1614 C  CG    . LEU A 1 213 ? 79.391  1.020   150.061 1.00 43.69  ? 212  LEU F CG    1 
ATOM   1615 C  CD1   . LEU A 1 213 ? 78.599  -0.208  149.712 1.00 39.94  ? 212  LEU F CD1   1 
ATOM   1616 C  CD2   . LEU A 1 213 ? 80.182  0.785   151.335 1.00 49.42  ? 212  LEU F CD2   1 
ATOM   1617 N  N     . LYS A 1 214 ? 82.325  3.092   147.039 1.00 58.72  ? 213  LYS F N     1 
ATOM   1618 C  CA    . LYS A 1 214 ? 83.558  3.189   146.266 1.00 63.25  ? 213  LYS F CA    1 
ATOM   1619 C  C     . LYS A 1 214 ? 84.432  4.334   146.763 1.00 63.92  ? 213  LYS F C     1 
ATOM   1620 O  O     . LYS A 1 214 ? 85.623  4.145   147.038 1.00 76.26  ? 213  LYS F O     1 
ATOM   1621 C  CB    . LYS A 1 214 ? 83.247  3.366   144.780 1.00 67.43  ? 213  LYS F CB    1 
ATOM   1622 C  CG    . LYS A 1 214 ? 82.773  2.107   144.078 1.00 69.60  ? 213  LYS F CG    1 
ATOM   1623 C  CD    . LYS A 1 214 ? 83.010  2.198   142.575 1.00 75.57  ? 213  LYS F CD    1 
ATOM   1624 C  CE    . LYS A 1 214 ? 84.498  2.095   142.227 1.00 79.34  ? 213  LYS F CE    1 
ATOM   1625 N  NZ    . LYS A 1 214 ? 85.060  0.713   142.359 1.00 77.05  ? 213  LYS F NZ    1 
ATOM   1626 N  N     . ARG A 1 215 ? 83.855  5.530   146.894 1.00 61.29  ? 214  ARG F N     1 
ATOM   1627 C  CA    . ARG A 1 215 ? 84.634  6.727   147.198 1.00 63.98  ? 214  ARG F CA    1 
ATOM   1628 C  C     . ARG A 1 215 ? 84.964  6.895   148.674 1.00 57.84  ? 214  ARG F C     1 
ATOM   1629 O  O     . ARG A 1 215 ? 85.765  7.774   149.002 1.00 50.40  ? 214  ARG F O     1 
ATOM   1630 C  CB    . ARG A 1 215 ? 83.899  7.985   146.734 1.00 66.98  ? 214  ARG F CB    1 
ATOM   1631 C  CG    . ARG A 1 215 ? 83.490  7.992   145.275 1.00 77.87  ? 214  ARG F CG    1 
ATOM   1632 C  CD    . ARG A 1 215 ? 82.781  9.292   144.937 1.00 90.22  ? 214  ARG F CD    1 
ATOM   1633 N  NE    . ARG A 1 215 ? 81.326  9.150   144.841 1.00 102.78 ? 214  ARG F NE    1 
ATOM   1634 C  CZ    . ARG A 1 215 ? 80.500  9.024   145.881 1.00 96.43  ? 214  ARG F CZ    1 
ATOM   1635 N  NH1   . ARG A 1 215 ? 80.973  9.012   147.120 1.00 109.11 ? 214  ARG F NH1   1 
ATOM   1636 N  NH2   . ARG A 1 215 ? 79.192  8.921   145.687 1.00 60.45  ? 214  ARG F NH2   1 
ATOM   1637 N  N     . PHE A 1 216 ? 84.373  6.100   149.565 1.00 51.73  ? 215  PHE F N     1 
ATOM   1638 C  CA    . PHE A 1 216 ? 84.632  6.275   150.990 1.00 46.32  ? 215  PHE F CA    1 
ATOM   1639 C  C     . PHE A 1 216 ? 84.808  4.985   151.766 1.00 44.52  ? 215  PHE F C     1 
ATOM   1640 O  O     . PHE A 1 216 ? 85.136  5.062   152.954 1.00 49.59  ? 215  PHE F O     1 
ATOM   1641 C  CB    . PHE A 1 216 ? 83.504  7.074   151.654 1.00 46.44  ? 215  PHE F CB    1 
ATOM   1642 C  CG    . PHE A 1 216 ? 83.454  8.515   151.249 1.00 55.09  ? 215  PHE F CG    1 
ATOM   1643 C  CD1   . PHE A 1 216 ? 84.353  9.426   151.777 1.00 62.06  ? 215  PHE F CD1   1 
ATOM   1644 C  CD2   . PHE A 1 216 ? 82.494  8.966   150.359 1.00 55.87  ? 215  PHE F CD2   1 
ATOM   1645 C  CE1   . PHE A 1 216 ? 84.306  10.757  151.412 1.00 59.38  ? 215  PHE F CE1   1 
ATOM   1646 C  CE2   . PHE A 1 216 ? 82.438  10.296  149.990 1.00 53.75  ? 215  PHE F CE2   1 
ATOM   1647 C  CZ    . PHE A 1 216 ? 83.346  11.195  150.520 1.00 60.77  ? 215  PHE F CZ    1 
ATOM   1648 N  N     . GLY A 1 217 ? 84.592  3.812   151.164 1.00 49.92  ? 216  GLY F N     1 
ATOM   1649 C  CA    . GLY A 1 217 ? 84.672  2.578   151.926 1.00 52.17  ? 216  GLY F CA    1 
ATOM   1650 C  C     . GLY A 1 217 ? 83.574  2.498   152.973 1.00 51.66  ? 216  GLY F C     1 
ATOM   1651 O  O     . GLY A 1 217 ? 82.464  3.014   152.792 1.00 55.38  ? 216  GLY F O     1 
ATOM   1652 N  N     . LYS A 1 218 ? 83.901  1.856   154.101 1.00 45.16  ? 217  LYS F N     1 
ATOM   1653 C  CA    . LYS A 1 218 ? 82.912  1.649   155.157 1.00 46.51  ? 217  LYS F CA    1 
ATOM   1654 C  C     . LYS A 1 218 ? 82.355  2.964   155.671 1.00 52.26  ? 217  LYS F C     1 
ATOM   1655 O  O     . LYS A 1 218 ? 81.237  3.004   156.192 1.00 49.24  ? 217  LYS F O     1 
ATOM   1656 C  CB    . LYS A 1 218 ? 83.520  0.855   156.314 1.00 52.78  ? 217  LYS F CB    1 
ATOM   1657 C  CG    . LYS A 1 218 ? 83.856  -0.589  155.967 1.00 64.43  ? 217  LYS F CG    1 
ATOM   1658 C  CD    . LYS A 1 218 ? 84.517  -1.303  157.143 1.00 69.55  ? 217  LYS F CD    1 
ATOM   1659 C  CE    . LYS A 1 218 ? 84.526  -2.807  156.941 1.00 70.16  ? 217  LYS F CE    1 
ATOM   1660 N  NZ    . LYS A 1 218 ? 85.096  -3.177  155.615 1.00 73.83  ? 217  LYS F NZ    1 
ATOM   1661 N  N     . PHE A 1 219 ? 83.121  4.046   155.537 1.00 52.79  ? 218  PHE F N     1 
ATOM   1662 C  CA    . PHE A 1 219 ? 82.633  5.361   155.932 1.00 43.05  ? 218  PHE F CA    1 
ATOM   1663 C  C     . PHE A 1 219 ? 81.464  5.803   155.061 1.00 32.22  ? 218  PHE F C     1 
ATOM   1664 O  O     . PHE A 1 219 ? 80.560  6.501   155.532 1.00 39.25  ? 218  PHE F O     1 
ATOM   1665 C  CB    . PHE A 1 219 ? 83.780  6.365   155.851 1.00 39.54  ? 218  PHE F CB    1 
ATOM   1666 C  CG    . PHE A 1 219 ? 83.400  7.759   156.232 1.00 45.38  ? 218  PHE F CG    1 
ATOM   1667 C  CD1   . PHE A 1 219 ? 83.096  8.072   157.545 1.00 49.51  ? 218  PHE F CD1   1 
ATOM   1668 C  CD2   . PHE A 1 219 ? 83.383  8.766   155.284 1.00 49.13  ? 218  PHE F CD2   1 
ATOM   1669 C  CE1   . PHE A 1 219 ? 82.764  9.363   157.899 1.00 48.53  ? 218  PHE F CE1   1 
ATOM   1670 C  CE2   . PHE A 1 219 ? 83.055  10.060  155.633 1.00 51.83  ? 218  PHE F CE2   1 
ATOM   1671 C  CZ    . PHE A 1 219 ? 82.740  10.357  156.940 1.00 52.66  ? 218  PHE F CZ    1 
ATOM   1672 N  N     . GLY A 1 220 ? 81.480  5.430   153.779 1.00 35.91  ? 219  GLY F N     1 
ATOM   1673 C  CA    . GLY A 1 220 ? 80.385  5.783   152.895 1.00 40.22  ? 219  GLY F CA    1 
ATOM   1674 C  C     . GLY A 1 220 ? 79.094  5.063   153.243 1.00 41.93  ? 219  GLY F C     1 
ATOM   1675 O  O     . GLY A 1 220 ? 78.005  5.621   153.076 1.00 36.88  ? 219  GLY F O     1 
ATOM   1676 N  N     . ARG A 1 221 ? 79.193  3.829   153.742 1.00 35.56  ? 220  ARG F N     1 
ATOM   1677 C  CA    . ARG A 1 221 ? 78.004  3.165   154.271 1.00 35.82  ? 220  ARG F CA    1 
ATOM   1678 C  C     . ARG A 1 221 ? 77.457  3.916   155.481 1.00 32.17  ? 220  ARG F C     1 
ATOM   1679 O  O     . ARG A 1 221 ? 76.245  4.128   155.596 1.00 31.80  ? 220  ARG F O     1 
ATOM   1680 C  CB    . ARG A 1 221 ? 78.311  1.709   154.645 1.00 31.69  ? 220  ARG F CB    1 
ATOM   1681 C  CG    . ARG A 1 221 ? 77.045  0.975   155.156 1.00 35.83  ? 220  ARG F CG    1 
ATOM   1682 C  CD    . ARG A 1 221 ? 77.308  -0.505  155.417 1.00 35.73  ? 220  ARG F CD    1 
ATOM   1683 N  NE    . ARG A 1 221 ? 77.452  -1.254  154.174 1.00 33.08  ? 220  ARG F NE    1 
ATOM   1684 C  CZ    . ARG A 1 221 ? 76.420  -1.627  153.419 1.00 33.73  ? 220  ARG F CZ    1 
ATOM   1685 N  NH1   . ARG A 1 221 ? 75.184  -1.301  153.778 1.00 37.76  ? 220  ARG F NH1   1 
ATOM   1686 N  NH2   . ARG A 1 221 ? 76.623  -2.314  152.306 1.00 39.52  ? 220  ARG F NH2   1 
ATOM   1687 N  N     . ILE A 1 222 ? 78.342  4.353   156.380 1.00 33.23  ? 221  ILE F N     1 
ATOM   1688 C  CA    . ILE A 1 222 ? 77.898  5.094   157.560 1.00 36.81  ? 221  ILE F CA    1 
ATOM   1689 C  C     . ILE A 1 222 ? 77.222  6.405   157.151 1.00 29.45  ? 221  ILE F C     1 
ATOM   1690 O  O     . ILE A 1 222 ? 76.147  6.746   157.648 1.00 36.25  ? 221  ILE F O     1 
ATOM   1691 C  CB    . ILE A 1 222 ? 79.080  5.336   158.517 1.00 35.90  ? 221  ILE F CB    1 
ATOM   1692 C  CG1   . ILE A 1 222 ? 79.414  4.049   159.269 1.00 43.21  ? 221  ILE F CG1   1 
ATOM   1693 C  CG2   . ILE A 1 222 ? 78.751  6.446   159.503 1.00 32.75  ? 221  ILE F CG2   1 
ATOM   1694 C  CD1   . ILE A 1 222 ? 80.587  4.201   160.216 1.00 57.52  ? 221  ILE F CD1   1 
ATOM   1695 N  N     . LEU A 1 223 ? 77.849  7.161   156.248 1.00 31.83  ? 222  LEU F N     1 
ATOM   1696 C  CA    . LEU A 1 223 ? 77.230  8.381   155.715 1.00 29.86  ? 222  LEU F CA    1 
ATOM   1697 C  C     . LEU A 1 223 ? 75.836  8.099   155.165 1.00 31.57  ? 222  LEU F C     1 
ATOM   1698 O  O     . LEU A 1 223 ? 74.869  8.819   155.453 1.00 30.90  ? 222  LEU F O     1 
ATOM   1699 C  CB    . LEU A 1 223 ? 78.110  8.948   154.608 1.00 33.30  ? 222  LEU F CB    1 
ATOM   1700 C  CG    . LEU A 1 223 ? 78.744  10.329  154.620 1.00 56.65  ? 222  LEU F CG    1 
ATOM   1701 C  CD1   . LEU A 1 223 ? 78.819  10.944  156.009 1.00 51.82  ? 222  LEU F CD1   1 
ATOM   1702 C  CD2   . LEU A 1 223 ? 80.114  10.118  154.033 1.00 47.83  ? 222  LEU F CD2   1 
ATOM   1703 N  N     . TRP A 1 224 ? 75.722  7.063   154.341 1.00 37.28  ? 223  TRP F N     1 
ATOM   1704 C  CA    . TRP A 1 224 ? 74.440  6.736   153.733 1.00 31.51  ? 223  TRP F CA    1 
ATOM   1705 C  C     . TRP A 1 224 ? 73.397  6.396   154.797 1.00 34.55  ? 223  TRP F C     1 
ATOM   1706 O  O     . TRP A 1 224 ? 72.256  6.870   154.743 1.00 33.02  ? 223  TRP F O     1 
ATOM   1707 C  CB    . TRP A 1 224 ? 74.643  5.579   152.759 1.00 39.78  ? 223  TRP F CB    1 
ATOM   1708 C  CG    . TRP A 1 224 ? 73.416  5.210   152.034 1.00 41.02  ? 223  TRP F CG    1 
ATOM   1709 C  CD1   . TRP A 1 224 ? 72.974  5.741   150.859 1.00 36.54  ? 223  TRP F CD1   1 
ATOM   1710 C  CD2   . TRP A 1 224 ? 72.449  4.230   152.424 1.00 41.08  ? 223  TRP F CD2   1 
ATOM   1711 N  NE1   . TRP A 1 224 ? 71.790  5.160   150.499 1.00 39.24  ? 223  TRP F NE1   1 
ATOM   1712 C  CE2   . TRP A 1 224 ? 71.448  4.218   151.433 1.00 40.09  ? 223  TRP F CE2   1 
ATOM   1713 C  CE3   . TRP A 1 224 ? 72.328  3.368   153.515 1.00 39.41  ? 223  TRP F CE3   1 
ATOM   1714 C  CZ2   . TRP A 1 224 ? 70.338  3.372   151.494 1.00 42.44  ? 223  TRP F CZ2   1 
ATOM   1715 C  CZ3   . TRP A 1 224 ? 71.220  2.526   153.580 1.00 44.18  ? 223  TRP F CZ3   1 
ATOM   1716 C  CH2   . TRP A 1 224 ? 70.238  2.536   152.572 1.00 42.51  ? 223  TRP F CH2   1 
ATOM   1717 N  N     . GLU A 1 225 ? 73.778  5.582   155.782 1.00 30.97  ? 224  GLU F N     1 
ATOM   1718 C  CA    . GLU A 1 225 ? 72.869  5.237   156.871 1.00 29.71  ? 224  GLU F CA    1 
ATOM   1719 C  C     . GLU A 1 225 ? 72.418  6.476   157.638 1.00 30.88  ? 224  GLU F C     1 
ATOM   1720 O  O     . GLU A 1 225 ? 71.220  6.767   157.728 1.00 32.45  ? 224  GLU F O     1 
ATOM   1721 C  CB    . GLU A 1 225 ? 73.548  4.246   157.817 1.00 30.72  ? 224  GLU F CB    1 
ATOM   1722 C  CG    . GLU A 1 225 ? 73.568  2.847   157.273 1.00 32.48  ? 224  GLU F CG    1 
ATOM   1723 C  CD    . GLU A 1 225 ? 74.332  1.883   158.172 1.00 48.96  ? 224  GLU F CD    1 
ATOM   1724 O  OE1   . GLU A 1 225 ? 74.688  2.268   159.308 1.00 60.24  ? 224  GLU F OE1   1 
ATOM   1725 O  OE2   . GLU A 1 225 ? 74.579  0.750   157.724 1.00 56.64  ? 224  GLU F OE2   1 
ATOM   1726 N  N     . ARG A 1 226 ? 73.374  7.214   158.212 1.00 33.45  ? 225  ARG F N     1 
ATOM   1727 C  CA    . ARG A 1 226 ? 73.031  8.352   159.062 1.00 32.73  ? 225  ARG F CA    1 
ATOM   1728 C  C     . ARG A 1 226 ? 72.161  9.357   158.323 1.00 35.10  ? 225  ARG F C     1 
ATOM   1729 O  O     . ARG A 1 226 ? 71.278  9.985   158.917 1.00 43.47  ? 225  ARG F O     1 
ATOM   1730 C  CB    . ARG A 1 226 ? 74.308  9.035   159.553 1.00 33.03  ? 225  ARG F CB    1 
ATOM   1731 C  CG    . ARG A 1 226 ? 75.291  8.101   160.238 1.00 35.39  ? 225  ARG F CG    1 
ATOM   1732 C  CD    . ARG A 1 226 ? 74.794  7.659   161.585 1.00 33.14  ? 225  ARG F CD    1 
ATOM   1733 N  NE    . ARG A 1 226 ? 75.734  6.733   162.217 1.00 38.92  ? 225  ARG F NE    1 
ATOM   1734 C  CZ    . ARG A 1 226 ? 75.711  5.412   162.049 1.00 46.11  ? 225  ARG F CZ    1 
ATOM   1735 N  NH1   . ARG A 1 226 ? 74.788  4.857   161.273 1.00 36.07  ? 225  ARG F NH1   1 
ATOM   1736 N  NH2   . ARG A 1 226 ? 76.608  4.642   162.663 1.00 41.36  ? 225  ARG F NH2   1 
ATOM   1737 N  N     . SER A 1 227 ? 72.392  9.518   157.023 1.00 32.50  ? 226  SER F N     1 
ATOM   1738 C  CA    . SER A 1 227 ? 71.588  10.464  156.263 1.00 40.27  ? 226  SER F CA    1 
ATOM   1739 C  C     . SER A 1 227 ? 70.128  10.060  156.202 1.00 48.75  ? 226  SER F C     1 
ATOM   1740 O  O     . SER A 1 227 ? 69.293  10.877  155.804 1.00 50.00  ? 226  SER F O     1 
ATOM   1741 C  CB    . SER A 1 227 ? 72.154  10.619  154.859 1.00 38.23  ? 226  SER F CB    1 
ATOM   1742 O  OG    . SER A 1 227 ? 73.402  11.281  154.952 1.00 46.49  ? 226  SER F OG    1 
ATOM   1743 N  N     . GLN A 1 228 ? 69.795  8.842   156.614 1.00 41.07  ? 227  GLN F N     1 
ATOM   1744 C  CA    . GLN A 1 228 ? 68.412  8.403   156.659 1.00 39.68  ? 227  GLN F CA    1 
ATOM   1745 C  C     . GLN A 1 228 ? 67.900  8.241   158.074 1.00 41.36  ? 227  GLN F C     1 
ATOM   1746 O  O     . GLN A 1 228 ? 66.787  7.740   158.257 1.00 40.94  ? 227  GLN F O     1 
ATOM   1747 C  CB    . GLN A 1 228 ? 68.252  7.088   155.918 1.00 43.76  ? 227  GLN F CB    1 
ATOM   1748 C  CG    . GLN A 1 228 ? 69.219  6.968   154.817 1.00 54.85  ? 227  GLN F CG    1 
ATOM   1749 C  CD    . GLN A 1 228 ? 68.644  6.301   153.616 1.00 63.07  ? 227  GLN F CD    1 
ATOM   1750 O  OE1   . GLN A 1 228 ? 69.364  5.651   152.881 1.00 76.71  ? 227  GLN F OE1   1 
ATOM   1751 N  NE2   . GLN A 1 228 ? 67.343  6.466   153.390 1.00 59.22  ? 227  GLN F NE2   1 
ATOM   1752 N  N     . GLY A 1 229 ? 68.666  8.672   159.073 1.00 39.15  ? 228  GLY F N     1 
ATOM   1753 C  CA    . GLY A 1 229 ? 68.297  8.404   160.442 1.00 39.15  ? 228  GLY F CA    1 
ATOM   1754 C  C     . GLY A 1 229 ? 68.633  7.005   160.917 1.00 36.70  ? 228  GLY F C     1 
ATOM   1755 O  O     . GLY A 1 229 ? 68.209  6.630   162.012 1.00 39.14  ? 228  GLY F O     1 
ATOM   1756 N  N     . ILE A 1 230 ? 69.373  6.225   160.129 1.00 36.40  ? 229  ILE F N     1 
ATOM   1757 C  CA    . ILE A 1 230 ? 69.675  4.838   160.480 1.00 28.77  ? 229  ILE F CA    1 
ATOM   1758 C  C     . ILE A 1 230 ? 70.928  4.818   161.338 1.00 30.47  ? 229  ILE F C     1 
ATOM   1759 O  O     . ILE A 1 230 ? 71.985  5.298   160.922 1.00 34.85  ? 229  ILE F O     1 
ATOM   1760 C  CB    . ILE A 1 230 ? 69.867  3.967   159.234 1.00 35.63  ? 229  ILE F CB    1 
ATOM   1761 C  CG1   . ILE A 1 230 ? 68.563  3.859   158.433 1.00 35.67  ? 229  ILE F CG1   1 
ATOM   1762 C  CG2   . ILE A 1 230 ? 70.346  2.551   159.645 1.00 33.69  ? 229  ILE F CG2   1 
ATOM   1763 C  CD1   . ILE A 1 230 ? 68.786  3.266   157.054 1.00 41.66  ? 229  ILE F CD1   1 
ATOM   1764 N  N     . ASP A 1 231 ? 70.808  4.257   162.537 1.00 27.11  ? 230  ASP F N     1 
ATOM   1765 C  CA    . ASP A 1 231 ? 71.934  4.160   163.464 1.00 30.62  ? 230  ASP F CA    1 
ATOM   1766 C  C     . ASP A 1 231 ? 71.580  3.045   164.445 1.00 22.48  ? 230  ASP F C     1 
ATOM   1767 O  O     . ASP A 1 231 ? 70.982  3.290   165.493 1.00 28.36  ? 230  ASP F O     1 
ATOM   1768 C  CB    . ASP A 1 231 ? 72.208  5.461   164.185 1.00 32.41  ? 230  ASP F CB    1 
ATOM   1769 C  CG    . ASP A 1 231 ? 73.392  5.367   165.140 1.00 45.24  ? 230  ASP F CG    1 
ATOM   1770 O  OD1   . ASP A 1 231 ? 74.039  4.295   165.210 1.00 36.96  ? 230  ASP F OD1   1 
ATOM   1771 O  OD2   . ASP A 1 231 ? 73.679  6.383   165.810 1.00 36.92  ? 230  ASP F OD2   1 
ATOM   1772 N  N     . GLU A 1 232 ? 71.984  1.827   164.092 1.00 32.34  ? 231  GLU F N     1 
ATOM   1773 C  CA    . GLU A 1 232 ? 71.626  0.656   164.873 1.00 30.48  ? 231  GLU F CA    1 
ATOM   1774 C  C     . GLU A 1 232 ? 72.571  0.405   166.035 1.00 43.79  ? 231  GLU F C     1 
ATOM   1775 O  O     . GLU A 1 232 ? 72.355  -0.557  166.782 1.00 38.01  ? 231  GLU F O     1 
ATOM   1776 C  CB    . GLU A 1 232 ? 71.596  -0.575  163.957 1.00 40.52  ? 231  GLU F CB    1 
ATOM   1777 C  CG    . GLU A 1 232 ? 70.612  -0.465  162.811 1.00 50.15  ? 231  GLU F CG    1 
ATOM   1778 C  CD    . GLU A 1 232 ? 69.205  -0.848  163.215 1.00 71.80  ? 231  GLU F CD    1 
ATOM   1779 O  OE1   . GLU A 1 232 ? 68.891  -0.810  164.426 1.00 76.56  ? 231  GLU F OE1   1 
ATOM   1780 O  OE2   . GLU A 1 232 ? 68.413  -1.201  162.316 1.00 81.99  ? 231  GLU F OE2   1 
ATOM   1781 N  N     . ARG A 1 233 ? 73.617  1.220   166.192 1.00 29.37  ? 232  ARG F N     1 
ATOM   1782 C  CA    . ARG A 1 233 ? 74.579  0.984   167.257 1.00 29.46  ? 232  ARG F CA    1 
ATOM   1783 C  C     . ARG A 1 233 ? 73.876  0.922   168.604 1.00 38.37  ? 232  ARG F C     1 
ATOM   1784 O  O     . ARG A 1 233 ? 73.107  1.810   168.966 1.00 34.20  ? 232  ARG F O     1 
ATOM   1785 C  CB    . ARG A 1 233 ? 75.659  2.068   167.253 1.00 30.27  ? 232  ARG F CB    1 
ATOM   1786 C  CG    . ARG A 1 233 ? 76.512  2.040   165.997 1.00 27.70  ? 232  ARG F CG    1 
ATOM   1787 C  CD    . ARG A 1 233 ? 77.446  3.254   165.943 1.00 40.43  ? 232  ARG F CD    1 
ATOM   1788 N  NE    . ARG A 1 233 ? 76.674  4.497   166.043 1.00 36.21  ? 232  ARG F NE    1 
ATOM   1789 C  CZ    . ARG A 1 233 ? 77.117  5.599   166.642 1.00 46.19  ? 232  ARG F CZ    1 
ATOM   1790 N  NH1   . ARG A 1 233 ? 78.329  5.626   167.189 1.00 36.94  ? 232  ARG F NH1   1 
ATOM   1791 N  NH2   . ARG A 1 233 ? 76.349  6.675   166.699 1.00 34.51  ? 232  ARG F NH2   1 
ATOM   1792 N  N     . ASP A 1 234 ? 74.110  -0.159  169.326 1.00 29.95  ? 233  ASP F N     1 
ATOM   1793 C  CA    . ASP A 1 234 ? 73.514  -0.343  170.639 1.00 24.29  ? 233  ASP F CA    1 
ATOM   1794 C  C     . ASP A 1 234 ? 74.309  0.430   171.685 1.00 30.94  ? 233  ASP F C     1 
ATOM   1795 O  O     . ASP A 1 234 ? 75.515  0.642   171.538 1.00 32.51  ? 233  ASP F O     1 
ATOM   1796 C  CB    . ASP A 1 234 ? 73.500  -1.838  170.985 1.00 39.41  ? 233  ASP F CB    1 
ATOM   1797 C  CG    . ASP A 1 234 ? 72.520  -2.182  172.080 1.00 60.48  ? 233  ASP F CG    1 
ATOM   1798 O  OD1   . ASP A 1 234 ? 71.473  -1.508  172.195 1.00 66.07  ? 233  ASP F OD1   1 
ATOM   1799 O  OD2   . ASP A 1 234 ? 72.799  -3.146  172.826 1.00 76.69  ? 233  ASP F OD2   1 
ATOM   1800 N  N     . VAL A 1 235 ? 73.619  0.862   172.738 1.00 28.00  ? 234  VAL F N     1 
ATOM   1801 C  CA    . VAL A 1 235 ? 74.287  1.432   173.905 1.00 31.36  ? 234  VAL F CA    1 
ATOM   1802 C  C     . VAL A 1 235 ? 75.062  0.311   174.586 1.00 50.89  ? 234  VAL F C     1 
ATOM   1803 O  O     . VAL A 1 235 ? 74.480  -0.695  175.015 1.00 42.71  ? 234  VAL F O     1 
ATOM   1804 C  CB    . VAL A 1 235 ? 73.274  2.073   174.864 1.00 31.15  ? 234  VAL F CB    1 
ATOM   1805 C  CG1   . VAL A 1 235 ? 73.903  2.376   176.200 1.00 29.07  ? 234  VAL F CG1   1 
ATOM   1806 C  CG2   . VAL A 1 235 ? 72.691  3.368   174.259 1.00 28.94  ? 234  VAL F CG2   1 
ATOM   1807 N  N     . ASN A 1 236 ? 76.379  0.470   174.684 1.00 36.24  ? 235  ASN F N     1 
ATOM   1808 C  CA    . ASN A 1 236 ? 77.181  -0.705  175.015 1.00 48.88  ? 235  ASN F CA    1 
ATOM   1809 C  C     . ASN A 1 236 ? 77.180  -1.002  176.512 1.00 50.70  ? 235  ASN F C     1 
ATOM   1810 O  O     . ASN A 1 236 ? 76.503  -1.937  176.956 1.00 81.36  ? 235  ASN F O     1 
ATOM   1811 C  CB    . ASN A 1 236 ? 78.608  -0.553  174.491 1.00 57.02  ? 235  ASN F CB    1 
ATOM   1812 C  CG    . ASN A 1 236 ? 79.394  -1.857  174.577 1.00 61.31  ? 235  ASN F CG    1 
ATOM   1813 O  OD1   . ASN A 1 236 ? 79.476  -2.466  175.641 1.00 44.83  ? 235  ASN F OD1   1 
ATOM   1814 N  ND2   . ASN A 1 236 ? 79.948  -2.300  173.454 1.00 61.62  ? 235  ASN F ND2   1 
ATOM   1815 N  N     . SER A 1 237 ? 77.962  -0.247  177.276 1.00 33.32  ? 236  SER F N     1 
ATOM   1816 C  CA    . SER A 1 237 ? 78.186  -0.309  178.740 1.00 34.28  ? 236  SER F CA    1 
ATOM   1817 C  C     . SER A 1 237 ? 79.326  -1.254  179.125 1.00 33.22  ? 236  SER F C     1 
ATOM   1818 O  O     . SER A 1 237 ? 79.687  -1.284  180.309 1.00 35.06  ? 236  SER F O     1 
ATOM   1819 C  CB    . SER A 1 237 ? 76.927  -0.662  179.561 1.00 44.82  ? 236  SER F CB    1 
ATOM   1820 O  OG    . SER A 1 237 ? 76.740  -2.052  179.788 1.00 45.14  ? 236  SER F OG    1 
ATOM   1821 N  N     . GLU A 1 238 ? 79.943  -1.962  178.172 1.00 35.74  ? 237  GLU F N     1 
ATOM   1822 C  CA    . GLU A 1 238 ? 81.007  -2.935  178.441 1.00 47.02  ? 237  GLU F CA    1 
ATOM   1823 C  C     . GLU A 1 238 ? 82.376  -2.504  177.915 1.00 43.74  ? 237  GLU F C     1 
ATOM   1824 O  O     . GLU A 1 238 ? 83.330  -3.291  177.972 1.00 34.78  ? 237  GLU F O     1 
ATOM   1825 C  CB    . GLU A 1 238 ? 80.656  -4.299  177.827 1.00 47.79  ? 237  GLU F CB    1 
ATOM   1826 C  CG    . GLU A 1 238 ? 79.344  -4.896  178.280 1.00 62.74  ? 237  GLU F CG    1 
ATOM   1827 C  CD    . GLU A 1 238 ? 79.310  -5.136  179.768 1.00 75.21  ? 237  GLU F CD    1 
ATOM   1828 O  OE1   . GLU A 1 238 ? 80.283  -5.712  180.304 1.00 84.61  ? 237  GLU F OE1   1 
ATOM   1829 O  OE2   . GLU A 1 238 ? 78.313  -4.737  180.404 1.00 78.02  ? 237  GLU F OE2   1 
ATOM   1830 N  N     . ARG A 1 239 ? 82.504  -1.286  177.400 1.00 37.37  ? 238  ARG F N     1 
ATOM   1831 C  CA    . ARG A 1 239 ? 83.757  -0.881  176.774 1.00 32.27  ? 238  ARG F CA    1 
ATOM   1832 C  C     . ARG A 1 239 ? 84.862  -0.708  177.804 1.00 30.84  ? 238  ARG F C     1 
ATOM   1833 O  O     . ARG A 1 239 ? 84.623  -0.270  178.933 1.00 35.56  ? 238  ARG F O     1 
ATOM   1834 C  CB    . ARG A 1 239 ? 83.556  0.418   175.997 1.00 42.48  ? 238  ARG F CB    1 
ATOM   1835 C  CG    . ARG A 1 239 ? 82.464  0.284   174.958 1.00 43.46  ? 238  ARG F CG    1 
ATOM   1836 C  CD    . ARG A 1 239 ? 82.182  1.590   174.273 1.00 51.35  ? 238  ARG F CD    1 
ATOM   1837 N  NE    . ARG A 1 239 ? 83.306  2.022   173.456 1.00 50.57  ? 238  ARG F NE    1 
ATOM   1838 C  CZ    . ARG A 1 239 ? 83.295  3.122   172.714 1.00 62.97  ? 238  ARG F CZ    1 
ATOM   1839 N  NH1   . ARG A 1 239 ? 82.213  3.894   172.693 1.00 61.32  ? 238  ARG F NH1   1 
ATOM   1840 N  NH2   . ARG A 1 239 ? 84.361  3.447   171.992 1.00 61.07  ? 238  ARG F NH2   1 
ATOM   1841 N  N     . LEU A 1 240 ? 86.091  -1.049  177.394 1.00 34.73  ? 239  LEU F N     1 
ATOM   1842 C  CA    . LEU A 1 240 ? 87.280  -0.954  178.229 1.00 32.36  ? 239  LEU F CA    1 
ATOM   1843 C  C     . LEU A 1 240 ? 88.389  -0.205  177.491 1.00 26.89  ? 239  LEU F C     1 
ATOM   1844 O  O     . LEU A 1 240 ? 88.505  -0.285  176.265 1.00 32.51  ? 239  LEU F O     1 
ATOM   1845 C  CB    . LEU A 1 240 ? 87.785  -2.338  178.619 1.00 42.71  ? 239  LEU F CB    1 
ATOM   1846 C  CG    . LEU A 1 240 ? 86.721  -3.224  179.271 1.00 43.90  ? 239  LEU F CG    1 
ATOM   1847 C  CD1   . LEU A 1 240 ? 87.198  -4.658  179.343 1.00 48.70  ? 239  LEU F CD1   1 
ATOM   1848 C  CD2   . LEU A 1 240 ? 86.386  -2.668  180.647 1.00 41.88  ? 239  LEU F CD2   1 
ATOM   1849 N  N     . ARG A 1 241 ? 89.201  0.504   178.261 1.00 27.62  ? 240  ARG F N     1 
ATOM   1850 C  CA    . ARG A 1 241 ? 90.349  1.240   177.739 1.00 36.20  ? 240  ARG F CA    1 
ATOM   1851 C  C     . ARG A 1 241 ? 91.398  0.292   177.158 1.00 34.93  ? 240  ARG F C     1 
ATOM   1852 O  O     . ARG A 1 241 ? 91.672  -0.764  177.726 1.00 31.11  ? 240  ARG F O     1 
ATOM   1853 C  CB    . ARG A 1 241 ? 90.961  2.066   178.857 1.00 36.68  ? 240  ARG F CB    1 
ATOM   1854 C  CG    . ARG A 1 241 ? 92.212  2.821   178.439 1.00 47.23  ? 240  ARG F CG    1 
ATOM   1855 C  CD    . ARG A 1 241 ? 92.607  3.891   179.441 1.00 63.82  ? 240  ARG F CD    1 
ATOM   1856 N  NE    . ARG A 1 241 ? 93.006  3.335   180.729 1.00 66.75  ? 240  ARG F NE    1 
ATOM   1857 C  CZ    . ARG A 1 241 ? 93.672  4.019   181.654 1.00 62.54  ? 240  ARG F CZ    1 
ATOM   1858 N  NH1   . ARG A 1 241 ? 94.019  5.277   181.424 1.00 73.06  ? 240  ARG F NH1   1 
ATOM   1859 N  NH2   . ARG A 1 241 ? 94.004  3.448   182.801 1.00 52.02  ? 240  ARG F NH2   1 
ATOM   1860 N  N     . LYS A 1 242 ? 91.991  0.674   176.015 1.00 30.27  ? 241  LYS F N     1 
ATOM   1861 C  CA    . LYS A 1 242 ? 92.927  -0.188  175.286 1.00 29.21  ? 241  LYS F CA    1 
ATOM   1862 C  C     . LYS A 1 242 ? 94.372  0.294   175.275 1.00 31.77  ? 241  LYS F C     1 
ATOM   1863 O  O     . LYS A 1 242 ? 95.248  -0.457  174.838 1.00 32.11  ? 241  LYS F O     1 
ATOM   1864 C  CB    . LYS A 1 242 ? 92.472  -0.346  173.826 1.00 26.79  ? 241  LYS F CB    1 
ATOM   1865 C  CG    . LYS A 1 242 ? 91.133  -1.047  173.728 1.00 35.76  ? 241  LYS F CG    1 
ATOM   1866 C  CD    . LYS A 1 242 ? 90.633  -1.201  172.306 1.00 43.63  ? 241  LYS F CD    1 
ATOM   1867 C  CE    . LYS A 1 242 ? 89.294  -1.948  172.302 1.00 45.43  ? 241  LYS F CE    1 
ATOM   1868 N  NZ    . LYS A 1 242 ? 88.683  -2.006  170.958 1.00 53.10  ? 241  LYS F NZ    1 
ATOM   1869 N  N     . SER A 1 243 ? 94.641  1.530   175.671 1.00 29.01  ? 242  SER F N     1 
ATOM   1870 C  CA    . SER A 1 243 ? 95.983  2.088   175.607 1.00 22.05  ? 242  SER F CA    1 
ATOM   1871 C  C     . SER A 1 243 ? 96.139  3.078   176.741 1.00 28.82  ? 242  SER F C     1 
ATOM   1872 O  O     . SER A 1 243 ? 95.155  3.539   177.336 1.00 27.01  ? 242  SER F O     1 
ATOM   1873 C  CB    . SER A 1 243 ? 96.269  2.784   174.261 1.00 27.03  ? 242  SER F CB    1 
ATOM   1874 O  OG    . SER A 1 243 ? 95.330  3.830   174.017 1.00 26.17  ? 242  SER F OG    1 
ATOM   1875 N  N     . VAL A 1 244 ? 97.396  3.377   177.040 1.00 28.31  ? 243  VAL F N     1 
ATOM   1876 C  CA    . VAL A 1 244 ? 97.781  4.413   177.983 1.00 34.77  ? 243  VAL F CA    1 
ATOM   1877 C  C     . VAL A 1 244 ? 98.945  5.165   177.356 1.00 35.39  ? 243  VAL F C     1 
ATOM   1878 O  O     . VAL A 1 244 ? 99.906  4.546   176.891 1.00 28.69  ? 243  VAL F O     1 
ATOM   1879 C  CB    . VAL A 1 244 ? 98.189  3.831   179.349 1.00 31.94  ? 243  VAL F CB    1 
ATOM   1880 C  CG1   . VAL A 1 244 ? 98.426  4.953   180.322 1.00 25.38  ? 243  VAL F CG1   1 
ATOM   1881 C  CG2   . VAL A 1 244 ? 97.136  2.851   179.867 1.00 27.25  ? 243  VAL F CG2   1 
ATOM   1882 N  N     . GLY A 1 245 ? 98.859  6.484   177.308 1.00 28.90  ? 244  GLY F N     1 
ATOM   1883 C  CA    . GLY A 1 245 ? 99.917  7.285   176.725 1.00 25.52  ? 244  GLY F CA    1 
ATOM   1884 C  C     . GLY A 1 245 ? 100.227 8.474   177.607 1.00 31.30  ? 244  GLY F C     1 
ATOM   1885 O  O     . GLY A 1 245 ? 99.361  8.990   178.312 1.00 29.73  ? 244  GLY F O     1 
ATOM   1886 N  N     . VAL A 1 246 ? 101.491 8.893   177.567 1.00 30.35  ? 245  VAL F N     1 
ATOM   1887 C  CA    . VAL A 1 246 ? 101.983 10.039  178.333 1.00 27.44  ? 245  VAL F CA    1 
ATOM   1888 C  C     . VAL A 1 246 ? 102.916 10.817  177.417 1.00 30.07  ? 245  VAL F C     1 
ATOM   1889 O  O     . VAL A 1 246 ? 103.964 10.298  177.006 1.00 26.16  ? 245  VAL F O     1 
ATOM   1890 C  CB    . VAL A 1 246 ? 102.707 9.620   179.623 1.00 33.54  ? 245  VAL F CB    1 
ATOM   1891 C  CG1   . VAL A 1 246 ? 103.178 10.835  180.388 1.00 40.51  ? 245  VAL F CG1   1 
ATOM   1892 C  CG2   . VAL A 1 246 ? 101.777 8.774   180.503 1.00 32.97  ? 245  VAL F CG2   1 
ATOM   1893 N  N     . GLU A 1 247 ? 102.552 12.058  177.098 1.00 28.01  ? 246  GLU F N     1 
ATOM   1894 C  CA    . GLU A 1 247 ? 103.381 12.856  176.211 1.00 25.34  ? 246  GLU F CA    1 
ATOM   1895 C  C     . GLU A 1 247 ? 103.433 14.290  176.710 1.00 33.55  ? 246  GLU F C     1 
ATOM   1896 O  O     . GLU A 1 247 ? 102.546 14.737  177.438 1.00 25.45  ? 246  GLU F O     1 
ATOM   1897 C  CB    . GLU A 1 247 ? 102.867 12.802  174.769 1.00 27.79  ? 246  GLU F CB    1 
ATOM   1898 C  CG    . GLU A 1 247 ? 101.506 13.402  174.541 1.00 37.68  ? 246  GLU F CG    1 
ATOM   1899 C  CD    . GLU A 1 247 ? 100.819 12.816  173.316 1.00 45.74  ? 246  GLU F CD    1 
ATOM   1900 O  OE1   . GLU A 1 247 ? 101.019 11.610  173.045 1.00 49.38  ? 246  GLU F OE1   1 
ATOM   1901 O  OE2   . GLU A 1 247 ? 100.075 13.549  172.629 1.00 44.05  ? 246  GLU F OE2   1 
ATOM   1902 N  N     . ARG A 1 248 ? 104.487 15.016  176.303 1.00 35.34  ? 247  ARG F N     1 
ATOM   1903 C  CA    . ARG A 1 248 ? 104.643 16.415  176.677 1.00 33.97  ? 247  ARG F CA    1 
ATOM   1904 C  C     . ARG A 1 248 ? 105.204 17.217  175.516 1.00 28.92  ? 247  ARG F C     1 
ATOM   1905 O  O     . ARG A 1 248 ? 106.121 16.781  174.821 1.00 32.99  ? 247  ARG F O     1 
ATOM   1906 C  CB    . ARG A 1 248 ? 105.549 16.602  177.914 1.00 40.85  ? 247  ARG F CB    1 
ATOM   1907 C  CG    . ARG A 1 248 ? 104.770 16.606  179.251 1.00 47.72  ? 247  ARG F CG    1 
ATOM   1908 C  CD    . ARG A 1 248 ? 103.394 17.321  179.125 1.00 54.50  ? 247  ARG F CD    1 
ATOM   1909 N  NE    . ARG A 1 248 ? 102.654 17.393  180.385 1.00 56.43  ? 247  ARG F NE    1 
ATOM   1910 C  CZ    . ARG A 1 248 ? 101.827 16.446  180.833 1.00 70.36  ? 247  ARG F CZ    1 
ATOM   1911 N  NH1   . ARG A 1 248 ? 101.624 15.334  180.126 1.00 62.88  ? 247  ARG F NH1   1 
ATOM   1912 N  NH2   . ARG A 1 248 ? 101.199 16.609  181.993 1.00 72.91  ? 247  ARG F NH2   1 
ATOM   1913 N  N     . THR A 1 249 ? 104.637 18.393  175.312 1.00 30.46  ? 248  THR F N     1 
ATOM   1914 C  CA    . THR A 1 249 ? 105.200 19.389  174.410 1.00 28.69  ? 248  THR F CA    1 
ATOM   1915 C  C     . THR A 1 249 ? 106.046 20.353  175.236 1.00 30.64  ? 248  THR F C     1 
ATOM   1916 O  O     . THR A 1 249 ? 105.575 20.893  176.243 1.00 36.27  ? 248  THR F O     1 
ATOM   1917 C  CB    . THR A 1 249 ? 104.070 20.099  173.659 1.00 35.63  ? 248  THR F CB    1 
ATOM   1918 O  OG1   . THR A 1 249 ? 103.442 19.157  172.782 1.00 33.23  ? 248  THR F OG1   1 
ATOM   1919 C  CG2   . THR A 1 249 ? 104.582 21.311  172.839 1.00 32.14  ? 248  THR F CG2   1 
ATOM   1920 N  N     . MET A 1 250 ? 107.299 20.528  174.837 1.00 33.36  ? 249  MET F N     1 
ATOM   1921 C  CA    . MET A 1 250 ? 108.204 21.457  175.508 1.00 38.37  ? 249  MET F CA    1 
ATOM   1922 C  C     . MET A 1 250 ? 107.950 22.907  175.102 1.00 44.30  ? 249  MET F C     1 
ATOM   1923 O  O     . MET A 1 250 ? 107.465 23.201  173.997 1.00 37.34  ? 249  MET F O     1 
ATOM   1924 C  CB    . MET A 1 250 ? 109.659 21.104  175.212 1.00 41.92  ? 249  MET F CB    1 
ATOM   1925 C  CG    . MET A 1 250 ? 110.190 19.987  176.083 1.00 50.16  ? 249  MET F CG    1 
ATOM   1926 S  SD    . MET A 1 250 ? 109.448 18.413  175.645 1.00 61.44  ? 249  MET F SD    1 
ATOM   1927 C  CE    . MET A 1 250 ? 109.952 18.308  173.935 1.00 48.63  ? 249  MET F CE    1 
ATOM   1928 N  N     . ALA A 1 251 ? 108.287 23.820  176.025 1.00 39.80  ? 250  ALA F N     1 
ATOM   1929 C  CA    . ALA A 1 251 ? 108.127 25.252  175.773 1.00 40.31  ? 250  ALA F CA    1 
ATOM   1930 C  C     . ALA A 1 251 ? 109.017 25.710  174.634 1.00 46.26  ? 250  ALA F C     1 
ATOM   1931 O  O     . ALA A 1 251 ? 108.639 26.592  173.858 1.00 48.43  ? 250  ALA F O     1 
ATOM   1932 C  CB    . ALA A 1 251 ? 108.439 26.053  177.038 1.00 43.28  ? 250  ALA F CB    1 
ATOM   1933 N  N     . GLU A 1 252 ? 110.215 25.146  174.540 1.00 47.27  ? 251  GLU F N     1 
ATOM   1934 C  CA    . GLU A 1 252 ? 111.118 25.359  173.422 1.00 47.18  ? 251  GLU F CA    1 
ATOM   1935 C  C     . GLU A 1 252 ? 111.432 24.009  172.801 1.00 42.55  ? 251  GLU F C     1 
ATOM   1936 O  O     . GLU A 1 252 ? 111.545 23.009  173.511 1.00 37.66  ? 251  GLU F O     1 
ATOM   1937 C  CB    . GLU A 1 252 ? 112.443 26.020  173.865 1.00 52.04  ? 251  GLU F CB    1 
ATOM   1938 C  CG    . GLU A 1 252 ? 112.293 27.222  174.778 1.00 65.89  ? 251  GLU F CG    1 
ATOM   1939 C  CD    . GLU A 1 252 ? 111.756 28.438  174.052 1.00 81.82  ? 251  GLU F CD    1 
ATOM   1940 O  OE1   . GLU A 1 252 ? 111.772 28.446  172.802 1.00 86.19  ? 251  GLU F OE1   1 
ATOM   1941 O  OE2   . GLU A 1 252 ? 111.316 29.386  174.733 1.00 93.62  ? 251  GLU F OE2   1 
ATOM   1942 N  N     . ASP A 1 253 ? 111.612 23.987  171.481 1.00 40.41  ? 252  ASP F N     1 
ATOM   1943 C  CA    . ASP A 1 253 ? 112.028 22.750  170.839 1.00 33.64  ? 252  ASP F CA    1 
ATOM   1944 C  C     . ASP A 1 253 ? 113.381 22.320  171.381 1.00 50.39  ? 252  ASP F C     1 
ATOM   1945 O  O     . ASP A 1 253 ? 114.222 23.148  171.742 1.00 44.70  ? 252  ASP F O     1 
ATOM   1946 C  CB    . ASP A 1 253 ? 112.145 22.916  169.326 1.00 34.06  ? 252  ASP F CB    1 
ATOM   1947 C  CG    . ASP A 1 253 ? 110.860 23.338  168.675 1.00 51.01  ? 252  ASP F CG    1 
ATOM   1948 O  OD1   . ASP A 1 253 ? 109.771 23.163  169.272 1.00 43.65  ? 252  ASP F OD1   1 
ATOM   1949 O  OD2   . ASP A 1 253 ? 110.956 23.832  167.537 1.00 55.01  ? 252  ASP F OD2   1 
ATOM   1950 N  N     . ILE A 1 254 ? 113.595 21.015  171.417 1.00 46.23  ? 253  ILE F N     1 
ATOM   1951 C  CA    . ILE A 1 254 ? 114.877 20.458  171.819 1.00 44.94  ? 253  ILE F CA    1 
ATOM   1952 C  C     . ILE A 1 254 ? 115.615 20.003  170.575 1.00 45.78  ? 253  ILE F C     1 
ATOM   1953 O  O     . ILE A 1 254 ? 115.009 19.612  169.571 1.00 35.84  ? 253  ILE F O     1 
ATOM   1954 C  CB    . ILE A 1 254 ? 114.723 19.296  172.817 1.00 42.75  ? 253  ILE F CB    1 
ATOM   1955 C  CG1   . ILE A 1 254 ? 113.982 18.136  172.157 1.00 44.55  ? 253  ILE F CG1   1 
ATOM   1956 C  CG2   . ILE A 1 254 ? 114.047 19.784  174.105 1.00 44.97  ? 253  ILE F CG2   1 
ATOM   1957 C  CD1   . ILE A 1 254 ? 113.985 16.873  173.002 1.00 41.68  ? 253  ILE F CD1   1 
ATOM   1958 N  N     . HIS A 1 255 ? 116.946 20.062  170.641 1.00 47.87  ? 254  HIS F N     1 
ATOM   1959 C  CA    . HIS A 1 255 ? 117.772 19.732  169.498 1.00 48.28  ? 254  HIS F CA    1 
ATOM   1960 C  C     . HIS A 1 255 ? 118.830 18.694  169.810 1.00 49.19  ? 254  HIS F C     1 
ATOM   1961 O  O     . HIS A 1 255 ? 119.596 18.334  168.909 1.00 41.62  ? 254  HIS F O     1 
ATOM   1962 C  CB    . HIS A 1 255 ? 118.442 20.996  168.940 1.00 47.96  ? 254  HIS F CB    1 
ATOM   1963 C  CG    . HIS A 1 255 ? 117.473 21.969  168.346 1.00 48.82  ? 254  HIS F CG    1 
ATOM   1964 N  ND1   . HIS A 1 255 ? 116.794 22.902  169.103 1.00 51.12  ? 254  HIS F ND1   1 
ATOM   1965 C  CD2   . HIS A 1 255 ? 117.041 22.131  167.074 1.00 53.76  ? 254  HIS F CD2   1 
ATOM   1966 C  CE1   . HIS A 1 255 ? 115.997 23.607  168.320 1.00 48.42  ? 254  HIS F CE1   1 
ATOM   1967 N  NE2   . HIS A 1 255 ? 116.126 23.157  167.084 1.00 57.98  ? 254  HIS F NE2   1 
ATOM   1968 N  N     . HIS A 1 256 ? 118.893 18.197  171.045 1.00 42.34  ? 255  HIS F N     1 
ATOM   1969 C  CA    . HIS A 1 256 ? 119.969 17.317  171.475 1.00 42.69  ? 255  HIS F CA    1 
ATOM   1970 C  C     . HIS A 1 256 ? 119.386 16.074  172.121 1.00 38.40  ? 255  HIS F C     1 
ATOM   1971 O  O     . HIS A 1 256 ? 118.410 16.156  172.878 1.00 42.55  ? 255  HIS F O     1 
ATOM   1972 C  CB    . HIS A 1 256 ? 120.911 18.024  172.455 1.00 47.19  ? 255  HIS F CB    1 
ATOM   1973 C  CG    . HIS A 1 256 ? 121.530 19.261  171.893 1.00 44.47  ? 255  HIS F CG    1 
ATOM   1974 N  ND1   . HIS A 1 256 ? 122.443 19.231  170.861 1.00 44.05  ? 255  HIS F ND1   1 
ATOM   1975 C  CD2   . HIS A 1 256 ? 121.343 20.567  172.194 1.00 51.42  ? 255  HIS F CD2   1 
ATOM   1976 C  CE1   . HIS A 1 256 ? 122.800 20.467  170.557 1.00 45.70  ? 255  HIS F CE1   1 
ATOM   1977 N  NE2   . HIS A 1 256 ? 122.156 21.296  171.357 1.00 51.35  ? 255  HIS F NE2   1 
ATOM   1978 N  N     . TRP A 1 257 ? 119.998 14.924  171.827 1.00 39.09  ? 256  TRP F N     1 
ATOM   1979 C  CA    . TRP A 1 257 ? 119.505 13.673  172.395 1.00 42.58  ? 256  TRP F CA    1 
ATOM   1980 C  C     . TRP A 1 257 ? 119.492 13.715  173.919 1.00 35.82  ? 256  TRP F C     1 
ATOM   1981 O  O     . TRP A 1 257 ? 118.590 13.169  174.547 1.00 34.26  ? 256  TRP F O     1 
ATOM   1982 C  CB    . TRP A 1 257 ? 120.348 12.490  171.916 1.00 37.33  ? 256  TRP F CB    1 
ATOM   1983 C  CG    . TRP A 1 257 ? 120.085 11.283  172.777 1.00 36.95  ? 256  TRP F CG    1 
ATOM   1984 C  CD1   . TRP A 1 257 ? 120.947 10.697  173.656 1.00 37.22  ? 256  TRP F CD1   1 
ATOM   1985 C  CD2   . TRP A 1 257 ? 118.846 10.571  172.890 1.00 34.49  ? 256  TRP F CD2   1 
ATOM   1986 N  NE1   . TRP A 1 257 ? 120.338 9.632   174.277 1.00 40.06  ? 256  TRP F NE1   1 
ATOM   1987 C  CE2   . TRP A 1 257 ? 119.044 9.537   173.828 1.00 38.91  ? 256  TRP F CE2   1 
ATOM   1988 C  CE3   . TRP A 1 257 ? 117.602 10.678  172.252 1.00 38.80  ? 256  TRP F CE3   1 
ATOM   1989 C  CZ2   . TRP A 1 257 ? 118.044 8.624   174.157 1.00 39.12  ? 256  TRP F CZ2   1 
ATOM   1990 C  CZ3   . TRP A 1 257 ? 116.603 9.771   172.586 1.00 41.13  ? 256  TRP F CZ3   1 
ATOM   1991 C  CH2   . TRP A 1 257 ? 116.828 8.764   173.536 1.00 36.03  ? 256  TRP F CH2   1 
ATOM   1992 N  N     . SER A 1 258 ? 120.507 14.326  174.538 1.00 44.97  ? 257  SER F N     1 
ATOM   1993 C  CA    . SER A 1 258 ? 120.516 14.422  175.997 1.00 43.34  ? 257  SER F CA    1 
ATOM   1994 C  C     . SER A 1 258 ? 119.230 15.057  176.511 1.00 40.53  ? 257  SER F C     1 
ATOM   1995 O  O     . SER A 1 258 ? 118.677 14.624  177.536 1.00 36.48  ? 257  SER F O     1 
ATOM   1996 C  CB    . SER A 1 258 ? 121.729 15.228  176.460 1.00 46.06  ? 257  SER F CB    1 
ATOM   1997 O  OG    . SER A 1 258 ? 121.646 16.560  175.974 1.00 43.16  ? 257  SER F OG    1 
ATOM   1998 N  N     . GLU A 1 259 ? 118.726 16.078  175.802 1.00 35.20  ? 258  GLU F N     1 
ATOM   1999 C  CA    . GLU A 1 259 ? 117.467 16.698  176.206 1.00 34.56  ? 258  GLU F CA    1 
ATOM   2000 C  C     . GLU A 1 259 ? 116.297 15.738  176.041 1.00 42.00  ? 258  GLU F C     1 
ATOM   2001 O  O     . GLU A 1 259 ? 115.377 15.721  176.871 1.00 38.55  ? 258  GLU F O     1 
ATOM   2002 C  CB    . GLU A 1 259 ? 117.211 17.966  175.393 1.00 37.46  ? 258  GLU F CB    1 
ATOM   2003 C  CG    . GLU A 1 259 ? 118.347 18.958  175.442 1.00 43.44  ? 258  GLU F CG    1 
ATOM   2004 C  CD    . GLU A 1 259 ? 118.081 20.136  174.546 1.00 58.81  ? 258  GLU F CD    1 
ATOM   2005 O  OE1   . GLU A 1 259 ? 117.817 21.235  175.074 1.00 77.63  ? 258  GLU F OE1   1 
ATOM   2006 O  OE2   . GLU A 1 259 ? 118.103 19.952  173.312 1.00 53.57  ? 258  GLU F OE2   1 
ATOM   2007 N  N     . CYS A 1 260 ? 116.297 14.952  174.966 1.00 33.98  ? 259  CYS F N     1 
ATOM   2008 C  CA    . CYS A 1 260 ? 115.194 14.024  174.747 1.00 30.29  ? 259  CYS F CA    1 
ATOM   2009 C  C     . CYS A 1 260 ? 115.145 12.974  175.847 1.00 32.71  ? 259  CYS F C     1 
ATOM   2010 O  O     . CYS A 1 260 ? 114.079 12.681  176.405 1.00 31.50  ? 259  CYS F O     1 
ATOM   2011 C  CB    . CYS A 1 260 ? 115.336 13.366  173.367 1.00 31.08  ? 259  CYS F CB    1 
ATOM   2012 S  SG    . CYS A 1 260 ? 113.905 12.327  172.884 1.00 36.41  ? 259  CYS F SG    1 
ATOM   2013 N  N     . GLU A 1 261 ? 116.304 12.392  176.166 1.00 31.53  ? 260  GLU F N     1 
ATOM   2014 C  CA    . GLU A 1 261 ? 116.387 11.364  177.198 1.00 30.94  ? 260  GLU F CA    1 
ATOM   2015 C  C     . GLU A 1 261 ? 115.985 11.900  178.565 1.00 33.69  ? 260  GLU F C     1 
ATOM   2016 O  O     . GLU A 1 261 ? 115.369 11.177  179.359 1.00 35.87  ? 260  GLU F O     1 
ATOM   2017 C  CB    . GLU A 1 261 ? 117.814 10.812  177.242 1.00 38.52  ? 260  GLU F CB    1 
ATOM   2018 C  CG    . GLU A 1 261 ? 117.962 9.394   177.799 1.00 46.94  ? 260  GLU F CG    1 
ATOM   2019 C  CD    . GLU A 1 261 ? 117.906 9.322   179.313 1.00 67.29  ? 260  GLU F CD    1 
ATOM   2020 O  OE1   . GLU A 1 261 ? 117.237 8.410   179.834 1.00 74.90  ? 260  GLU F OE1   1 
ATOM   2021 O  OE2   . GLU A 1 261 ? 118.529 10.168  179.986 1.00 77.40  ? 260  GLU F OE2   1 
ATOM   2022 N  N     . ALA A 1 262 ? 116.318 13.164  178.856 1.00 40.88  ? 261  ALA F N     1 
ATOM   2023 C  CA    . ALA A 1 262 ? 115.913 13.771  180.121 1.00 41.36  ? 261  ALA F CA    1 
ATOM   2024 C  C     . ALA A 1 262 ? 114.398 13.866  180.223 1.00 38.63  ? 261  ALA F C     1 
ATOM   2025 O  O     . ALA A 1 262 ? 113.821 13.593  181.286 1.00 37.16  ? 261  ALA F O     1 
ATOM   2026 C  CB    . ALA A 1 262 ? 116.549 15.156  180.266 1.00 44.25  ? 261  ALA F CB    1 
ATOM   2027 N  N     . ILE A 1 263 ? 113.741 14.253  179.121 1.00 32.39  ? 262  ILE F N     1 
ATOM   2028 C  CA    . ILE A 1 263 ? 112.279 14.308  179.070 1.00 34.43  ? 262  ILE F CA    1 
ATOM   2029 C  C     . ILE A 1 263 ? 111.684 12.934  179.356 1.00 32.63  ? 262  ILE F C     1 
ATOM   2030 O  O     . ILE A 1 263 ? 110.745 12.789  180.155 1.00 34.45  ? 262  ILE F O     1 
ATOM   2031 C  CB    . ILE A 1 263 ? 111.808 14.828  177.695 1.00 28.72  ? 262  ILE F CB    1 
ATOM   2032 C  CG1   . ILE A 1 263 ? 112.283 16.261  177.412 1.00 38.51  ? 262  ILE F CG1   1 
ATOM   2033 C  CG2   . ILE A 1 263 ? 110.317 14.672  177.573 1.00 29.97  ? 262  ILE F CG2   1 
ATOM   2034 C  CD1   . ILE A 1 263 ? 111.824 17.252  178.421 1.00 52.67  ? 262  ILE F CD1   1 
ATOM   2035 N  N     . ILE A 1 264 ? 112.199 11.907  178.671 1.00 28.17  ? 263  ILE F N     1 
ATOM   2036 C  CA    . ILE A 1 264 ? 111.728 10.540  178.896 1.00 25.74  ? 263  ILE F CA    1 
ATOM   2037 C  C     . ILE A 1 264 ? 111.874 10.136  180.361 1.00 26.99  ? 263  ILE F C     1 
ATOM   2038 O  O     . ILE A 1 264 ? 110.996 9.477   180.925 1.00 27.74  ? 263  ILE F O     1 
ATOM   2039 C  CB    . ILE A 1 264 ? 112.484 9.569   177.974 1.00 29.31  ? 263  ILE F CB    1 
ATOM   2040 C  CG1   . ILE A 1 264 ? 112.157 9.884   176.526 1.00 32.65  ? 263  ILE F CG1   1 
ATOM   2041 C  CG2   . ILE A 1 264 ? 112.089 8.153   178.273 1.00 33.60  ? 263  ILE F CG2   1 
ATOM   2042 C  CD1   . ILE A 1 264 ? 112.883 9.014   175.573 1.00 35.81  ? 263  ILE F CD1   1 
ATOM   2043 N  N     . GLU A 1 265 ? 113.015 10.465  180.984 1.00 33.56  ? 264  GLU F N     1 
ATOM   2044 C  CA    . GLU A 1 265 ? 113.184 10.165  182.403 1.00 37.17  ? 264  GLU F CA    1 
ATOM   2045 C  C     . GLU A 1 265 ? 112.073 10.775  183.253 1.00 32.00  ? 264  GLU F C     1 
ATOM   2046 O  O     . GLU A 1 265 ? 111.695 10.199  184.279 1.00 34.37  ? 264  GLU F O     1 
ATOM   2047 C  CB    . GLU A 1 265 ? 114.549 10.653  182.891 1.00 36.25  ? 264  GLU F CB    1 
ATOM   2048 C  CG    . GLU A 1 265 ? 115.732 9.878   182.320 1.00 42.23  ? 264  GLU F CG    1 
ATOM   2049 C  CD    . GLU A 1 265 ? 115.872 8.474   182.909 1.00 48.23  ? 264  GLU F CD    1 
ATOM   2050 O  OE1   . GLU A 1 265 ? 115.083 8.105   183.804 1.00 49.34  ? 264  GLU F OE1   1 
ATOM   2051 O  OE2   . GLU A 1 265 ? 116.785 7.740   182.477 1.00 48.80  ? 264  GLU F OE2   1 
ATOM   2052 N  N     . ARG A 1 266 ? 111.531 11.930  182.850 1.00 33.13  ? 265  ARG F N     1 
ATOM   2053 C  CA    . ARG A 1 266 ? 110.427 12.509  183.606 1.00 36.61  ? 265  ARG F CA    1 
ATOM   2054 C  C     . ARG A 1 266 ? 109.084 11.882  183.237 1.00 38.82  ? 265  ARG F C     1 
ATOM   2055 O  O     . ARG A 1 266 ? 108.213 11.736  184.110 1.00 38.89  ? 265  ARG F O     1 
ATOM   2056 C  CB    . ARG A 1 266 ? 110.416 14.028  183.409 1.00 41.46  ? 265  ARG F CB    1 
ATOM   2057 C  CG    . ARG A 1 266 ? 111.754 14.676  183.798 1.00 47.76  ? 265  ARG F CG    1 
ATOM   2058 C  CD    . ARG A 1 266 ? 111.667 16.211  183.857 1.00 62.68  ? 265  ARG F CD    1 
ATOM   2059 N  NE    . ARG A 1 266 ? 111.952 16.855  182.578 1.00 73.80  ? 265  ARG F NE    1 
ATOM   2060 C  CZ    . ARG A 1 266 ? 112.436 18.090  182.460 1.00 81.17  ? 265  ARG F CZ    1 
ATOM   2061 N  NH1   . ARG A 1 266 ? 112.701 18.806  183.544 1.00 81.22  ? 265  ARG F NH1   1 
ATOM   2062 N  NH2   . ARG A 1 266 ? 112.674 18.605  181.262 1.00 81.08  ? 265  ARG F NH2   1 
ATOM   2063 N  N     . LEU A 1 267 ? 108.913 11.468  181.974 1.00 30.80  ? 266  LEU F N     1 
ATOM   2064 C  CA    . LEU A 1 267 ? 107.636 10.899  181.542 1.00 27.31  ? 266  LEU F CA    1 
ATOM   2065 C  C     . LEU A 1 267 ? 107.443 9.490   182.076 1.00 30.51  ? 266  LEU F C     1 
ATOM   2066 O  O     . LEU A 1 267 ? 106.316 9.094   182.402 1.00 32.09  ? 266  LEU F O     1 
ATOM   2067 C  CB    . LEU A 1 267 ? 107.541 10.861  180.015 1.00 26.35  ? 266  LEU F CB    1 
ATOM   2068 C  CG    . LEU A 1 267 ? 107.479 12.149  179.208 1.00 33.15  ? 266  LEU F CG    1 
ATOM   2069 C  CD1   . LEU A 1 267 ? 107.706 11.817  177.729 1.00 30.22  ? 266  LEU F CD1   1 
ATOM   2070 C  CD2   . LEU A 1 267 ? 106.143 12.811  179.406 1.00 33.77  ? 266  LEU F CD2   1 
ATOM   2071 N  N     . TYR A 1 268 ? 108.515 8.706   182.126 1.00 29.70  ? 267  TYR F N     1 
ATOM   2072 C  CA    . TYR A 1 268 ? 108.359 7.284   182.425 1.00 29.41  ? 267  TYR F CA    1 
ATOM   2073 C  C     . TYR A 1 268 ? 107.670 7.007   183.758 1.00 26.63  ? 267  TYR F C     1 
ATOM   2074 O  O     . TYR A 1 268 ? 106.710 6.218   183.779 1.00 30.52  ? 267  TYR F O     1 
ATOM   2075 C  CB    . TYR A 1 268 ? 109.717 6.577   182.379 1.00 31.49  ? 267  TYR F CB    1 
ATOM   2076 C  CG    . TYR A 1 268 ? 109.543 5.134   182.743 1.00 31.98  ? 267  TYR F CG    1 
ATOM   2077 C  CD1   . TYR A 1 268 ? 109.099 4.224   181.801 1.00 30.03  ? 267  TYR F CD1   1 
ATOM   2078 C  CD2   . TYR A 1 268 ? 109.776 4.686   184.041 1.00 30.04  ? 267  TYR F CD2   1 
ATOM   2079 C  CE1   . TYR A 1 268 ? 108.906 2.908   182.131 1.00 25.11  ? 267  TYR F CE1   1 
ATOM   2080 C  CE2   . TYR A 1 268 ? 109.567 3.364   184.383 1.00 32.49  ? 267  TYR F CE2   1 
ATOM   2081 C  CZ    . TYR A 1 268 ? 109.145 2.476   183.414 1.00 29.30  ? 267  TYR F CZ    1 
ATOM   2082 O  OH    . TYR A 1 268 ? 108.965 1.150   183.730 1.00 35.10  ? 267  TYR F OH    1 
ATOM   2083 N  N     . PRO A 1 269 ? 108.084 7.586   184.888 1.00 36.45  ? 268  PRO F N     1 
ATOM   2084 C  CA    . PRO A 1 269 ? 107.383 7.255   186.139 1.00 39.83  ? 268  PRO F CA    1 
ATOM   2085 C  C     . PRO A 1 269 ? 105.907 7.659   186.121 1.00 35.28  ? 268  PRO F C     1 
ATOM   2086 O  O     . PRO A 1 269 ? 105.093 7.013   186.797 1.00 34.06  ? 268  PRO F O     1 
ATOM   2087 C  CB    . PRO A 1 269 ? 108.193 8.005   187.208 1.00 43.71  ? 268  PRO F CB    1 
ATOM   2088 C  CG    . PRO A 1 269 ? 108.879 9.092   186.489 1.00 41.35  ? 268  PRO F CG    1 
ATOM   2089 C  CD    . PRO A 1 269 ? 109.150 8.582   185.100 1.00 35.98  ? 268  PRO F CD    1 
ATOM   2090 N  N     . GLU A 1 270 ? 105.520 8.669   185.337 1.00 33.22  ? 269  GLU F N     1 
ATOM   2091 C  CA    . GLU A 1 270 ? 104.094 8.977   185.205 1.00 35.00  ? 269  GLU F CA    1 
ATOM   2092 C  C     . GLU A 1 270 ? 103.361 7.881   184.442 1.00 30.39  ? 269  GLU F C     1 
ATOM   2093 O  O     . GLU A 1 270 ? 102.254 7.483   184.824 1.00 27.62  ? 269  GLU F O     1 
ATOM   2094 C  CB    . GLU A 1 270 ? 103.889 10.324  184.509 1.00 35.19  ? 269  GLU F CB    1 
ATOM   2095 C  CG    . GLU A 1 270 ? 104.426 11.499  185.293 1.00 39.19  ? 269  GLU F CG    1 
ATOM   2096 C  CD    . GLU A 1 270 ? 103.700 11.673  186.610 1.00 56.79  ? 269  GLU F CD    1 
ATOM   2097 O  OE1   . GLU A 1 270 ? 102.597 12.255  186.597 1.00 61.55  ? 269  GLU F OE1   1 
ATOM   2098 O  OE2   . GLU A 1 270 ? 104.221 11.205  187.649 1.00 58.92  ? 269  GLU F OE2   1 
ATOM   2099 N  N     . LEU A 1 271 ? 103.967 7.370   183.369 1.00 29.41  ? 270  LEU F N     1 
ATOM   2100 C  CA    . LEU A 1 271 ? 103.360 6.257   182.649 1.00 29.38  ? 270  LEU F CA    1 
ATOM   2101 C  C     . LEU A 1 271 ? 103.242 5.021   183.540 1.00 30.17  ? 270  LEU F C     1 
ATOM   2102 O  O     . LEU A 1 271 ? 102.195 4.357   183.566 1.00 27.32  ? 270  LEU F O     1 
ATOM   2103 C  CB    . LEU A 1 271 ? 104.168 5.961   181.385 1.00 27.21  ? 270  LEU F CB    1 
ATOM   2104 C  CG    . LEU A 1 271 ? 103.713 4.741   180.591 1.00 27.97  ? 270  LEU F CG    1 
ATOM   2105 C  CD1   . LEU A 1 271 ? 102.281 4.874   180.133 1.00 30.99  ? 270  LEU F CD1   1 
ATOM   2106 C  CD2   . LEU A 1 271 ? 104.640 4.468   179.404 1.00 30.97  ? 270  LEU F CD2   1 
ATOM   2107 N  N     . GLU A 1 272 ? 104.292 4.716   184.308 1.00 27.76  ? 271  GLU F N     1 
ATOM   2108 C  CA    . GLU A 1 272 ? 104.244 3.569   185.212 1.00 31.75  ? 271  GLU F CA    1 
ATOM   2109 C  C     . GLU A 1 272 ? 103.126 3.700   186.246 1.00 33.20  ? 271  GLU F C     1 
ATOM   2110 O  O     . GLU A 1 272 ? 102.417 2.727   186.528 1.00 29.24  ? 271  GLU F O     1 
ATOM   2111 C  CB    . GLU A 1 272 ? 105.598 3.406   185.897 1.00 33.25  ? 271  GLU F CB    1 
ATOM   2112 C  CG    . GLU A 1 272 ? 105.637 2.395   187.000 1.00 46.31  ? 271  GLU F CG    1 
ATOM   2113 C  CD    . GLU A 1 272 ? 106.998 2.350   187.645 1.00 65.04  ? 271  GLU F CD    1 
ATOM   2114 O  OE1   . GLU A 1 272 ? 107.463 3.407   188.129 1.00 79.94  ? 271  GLU F OE1   1 
ATOM   2115 O  OE2   . GLU A 1 272 ? 107.614 1.268   187.643 1.00 64.72  ? 271  GLU F OE2   1 
ATOM   2116 N  N     . ARG A 1 273 ? 102.952 4.891   186.818 1.00 27.85  ? 272  ARG F N     1 
ATOM   2117 C  CA    . ARG A 1 273 ? 101.929 5.087   187.839 1.00 32.49  ? 272  ARG F CA    1 
ATOM   2118 C  C     . ARG A 1 273 ? 100.532 4.910   187.264 1.00 34.04  ? 272  ARG F C     1 
ATOM   2119 O  O     . ARG A 1 273 ? 99.649  4.349   187.918 1.00 33.13  ? 272  ARG F O     1 
ATOM   2120 C  CB    . ARG A 1 273 ? 102.079 6.484   188.458 1.00 40.17  ? 272  ARG F CB    1 
ATOM   2121 C  CG    . ARG A 1 273 ? 100.877 6.967   189.264 1.00 36.62  ? 272  ARG F CG    1 
ATOM   2122 C  CD    . ARG A 1 273 ? 101.029 8.440   189.655 1.00 38.87  ? 272  ARG F CD    1 
ATOM   2123 N  NE    . ARG A 1 273 ? 99.816  8.947   190.290 1.00 41.28  ? 272  ARG F NE    1 
ATOM   2124 C  CZ    . ARG A 1 273 ? 98.847  9.598   189.649 1.00 40.75  ? 272  ARG F CZ    1 
ATOM   2125 N  NH1   . ARG A 1 273 ? 98.962  9.837   188.351 1.00 33.79  ? 272  ARG F NH1   1 
ATOM   2126 N  NH2   . ARG A 1 273 ? 97.764  10.017  190.306 1.00 43.71  ? 272  ARG F NH2   1 
ATOM   2127 N  N     . ARG A 1 274 ? 100.308 5.386   186.048 1.00 26.48  ? 273  ARG F N     1 
ATOM   2128 C  CA    . ARG A 1 274 ? 98.985  5.261   185.460 1.00 29.29  ? 273  ARG F CA    1 
ATOM   2129 C  C     . ARG A 1 274 ? 98.710  3.839   184.999 1.00 31.18  ? 273  ARG F C     1 
ATOM   2130 O  O     . ARG A 1 274 ? 97.606  3.325   185.200 1.00 27.63  ? 273  ARG F O     1 
ATOM   2131 C  CB    . ARG A 1 274 ? 98.843  6.268   184.328 1.00 28.66  ? 273  ARG F CB    1 
ATOM   2132 C  CG    . ARG A 1 274 ? 98.613  7.659   184.921 1.00 34.81  ? 273  ARG F CG    1 
ATOM   2133 C  CD    . ARG A 1 274 ? 98.831  8.728   183.928 1.00 39.19  ? 273  ARG F CD    1 
ATOM   2134 N  NE    . ARG A 1 274 ? 98.163  8.392   182.686 1.00 42.79  ? 273  ARG F NE    1 
ATOM   2135 C  CZ    . ARG A 1 274 ? 98.195  9.167   181.611 1.00 47.52  ? 273  ARG F CZ    1 
ATOM   2136 N  NH1   . ARG A 1 274 ? 98.868  10.320  181.655 1.00 30.64  ? 273  ARG F NH1   1 
ATOM   2137 N  NH2   . ARG A 1 274 ? 97.575  8.780   180.500 1.00 32.87  ? 273  ARG F NH2   1 
ATOM   2138 N  N     . LEU A 1 275 ? 99.708  3.168   184.426 1.00 34.57  ? 274  LEU F N     1 
ATOM   2139 C  CA    . LEU A 1 275 ? 99.527  1.766   184.066 1.00 27.23  ? 274  LEU F CA    1 
ATOM   2140 C  C     . LEU A 1 275 ? 99.232  0.933   185.304 1.00 28.01  ? 274  LEU F C     1 
ATOM   2141 O  O     . LEU A 1 275 ? 98.300  0.121   185.317 1.00 34.55  ? 274  LEU F O     1 
ATOM   2142 C  CB    . LEU A 1 275 ? 100.772 1.238   183.354 1.00 28.29  ? 274  LEU F CB    1 
ATOM   2143 C  CG    . LEU A 1 275 ? 100.677 -0.259  183.035 1.00 31.10  ? 274  LEU F CG    1 
ATOM   2144 C  CD1   . LEU A 1 275 ? 99.496  -0.515  182.131 1.00 30.02  ? 274  LEU F CD1   1 
ATOM   2145 C  CD2   . LEU A 1 275 ? 101.961 -0.712  182.381 1.00 30.70  ? 274  LEU F CD2   1 
ATOM   2146 N  N     . ALA A 1 276 ? 100.001 1.155   186.372 1.00 39.21  ? 275  ALA F N     1 
ATOM   2147 C  CA    . ALA A 1 276 ? 99.851  0.356   187.587 1.00 40.38  ? 275  ALA F CA    1 
ATOM   2148 C  C     . ALA A 1 276 ? 98.460  0.487   188.198 1.00 47.82  ? 275  ALA F C     1 
ATOM   2149 O  O     . ALA A 1 276 ? 97.987  -0.450  188.847 1.00 43.87  ? 275  ALA F O     1 
ATOM   2150 C  CB    . ALA A 1 276 ? 100.917 0.749   188.610 1.00 34.91  ? 275  ALA F CB    1 
ATOM   2151 N  N     . LYS A 1 277 ? 97.787  1.630   188.009 1.00 44.03  ? 276  LYS F N     1 
ATOM   2152 C  CA    . LYS A 1 277 ? 96.425  1.758   188.524 1.00 43.40  ? 276  LYS F CA    1 
ATOM   2153 C  C     . LYS A 1 277 ? 95.489  0.724   187.913 1.00 45.28  ? 276  LYS F C     1 
ATOM   2154 O  O     . LYS A 1 277 ? 94.556  0.267   188.578 1.00 45.00  ? 276  LYS F O     1 
ATOM   2155 C  CB    . LYS A 1 277 ? 95.873  3.157   188.258 1.00 37.02  ? 276  LYS F CB    1 
ATOM   2156 C  CG    . LYS A 1 277 ? 96.561  4.259   189.037 1.00 39.84  ? 276  LYS F CG    1 
ATOM   2157 C  CD    . LYS A 1 277 ? 95.770  5.545   188.899 1.00 43.59  ? 276  LYS F CD    1 
ATOM   2158 C  CE    . LYS A 1 277 ? 96.360  6.661   189.720 1.00 50.06  ? 276  LYS F CE    1 
ATOM   2159 N  NZ    . LYS A 1 277 ? 95.489  7.865   189.595 1.00 46.24  ? 276  LYS F NZ    1 
ATOM   2160 N  N     . VAL A 1 278 ? 95.718  0.352   186.655 1.00 33.91  ? 277  VAL F N     1 
ATOM   2161 C  CA    . VAL A 1 278 ? 94.850  -0.577  185.952 1.00 41.31  ? 277  VAL F CA    1 
ATOM   2162 C  C     . VAL A 1 278 ? 95.483  -1.961  185.777 1.00 44.74  ? 277  VAL F C     1 
ATOM   2163 O  O     . VAL A 1 278 ? 94.754  -2.954  185.663 1.00 42.82  ? 277  VAL F O     1 
ATOM   2164 C  CB    . VAL A 1 278 ? 94.454  0.036   184.590 1.00 46.35  ? 277  VAL F CB    1 
ATOM   2165 C  CG1   . VAL A 1 278 ? 93.897  -1.007  183.622 1.00 57.04  ? 277  VAL F CG1   1 
ATOM   2166 C  CG2   . VAL A 1 278 ? 93.430  1.119   184.821 1.00 53.72  ? 277  VAL F CG2   1 
ATOM   2167 N  N     . LYS A 1 279 ? 96.811  -2.062  185.791 1.00 50.63  ? 278  LYS F N     1 
ATOM   2168 C  CA    . LYS A 1 279 ? 97.506  -3.348  185.699 1.00 40.38  ? 278  LYS F CA    1 
ATOM   2169 C  C     . LYS A 1 279 ? 98.708  -3.289  186.630 1.00 38.49  ? 278  LYS F C     1 
ATOM   2170 O  O     . LYS A 1 279 ? 99.799  -2.852  186.238 1.00 39.08  ? 278  LYS F O     1 
ATOM   2171 C  CB    . LYS A 1 279 ? 97.923  -3.661  184.258 1.00 38.49  ? 278  LYS F CB    1 
ATOM   2172 C  CG    . LYS A 1 279 ? 97.210  -4.912  183.681 1.00 52.78  ? 278  LYS F CG    1 
ATOM   2173 C  CD    . LYS A 1 279 ? 98.136  -6.096  183.508 1.00 59.92  ? 278  LYS F CD    1 
ATOM   2174 C  CE    . LYS A 1 279 ? 97.373  -7.412  183.438 1.00 60.70  ? 278  LYS F CE    1 
ATOM   2175 N  NZ    . LYS A 1 279 ? 96.082  -7.208  182.709 1.00 67.06  ? 278  LYS F NZ    1 
ATOM   2176 N  N     . PRO A 1 280 ? 98.528  -3.672  187.895 1.00 46.03  ? 279  PRO F N     1 
ATOM   2177 C  CA    . PRO A 1 280 ? 99.612  -3.497  188.880 1.00 42.96  ? 279  PRO F CA    1 
ATOM   2178 C  C     . PRO A 1 280 ? 100.894 -4.249  188.556 1.00 41.89  ? 279  PRO F C     1 
ATOM   2179 O  O     . PRO A 1 280 ? 101.977 -3.793  188.947 1.00 41.99  ? 279  PRO F O     1 
ATOM   2180 C  CB    . PRO A 1 280 ? 98.973  -4.008  190.179 1.00 48.86  ? 279  PRO F CB    1 
ATOM   2181 C  CG    . PRO A 1 280 ? 97.530  -3.711  190.001 1.00 46.56  ? 279  PRO F CG    1 
ATOM   2182 C  CD    . PRO A 1 280 ? 97.237  -3.960  188.542 1.00 43.55  ? 279  PRO F CD    1 
ATOM   2183 N  N     . ASP A 1 281 ? 100.813 -5.390  187.874 1.00 35.43  ? 280  ASP F N     1 
ATOM   2184 C  CA    . ASP A 1 281 ? 102.005 -6.143  187.507 1.00 44.84  ? 280  ASP F CA    1 
ATOM   2185 C  C     . ASP A 1 281 ? 102.690 -5.599  186.255 1.00 39.02  ? 280  ASP F C     1 
ATOM   2186 O  O     . ASP A 1 281 ? 103.696 -6.178  185.828 1.00 35.10  ? 280  ASP F O     1 
ATOM   2187 C  CB    . ASP A 1 281 ? 101.657 -7.629  187.316 1.00 55.86  ? 280  ASP F CB    1 
ATOM   2188 C  CG    . ASP A 1 281 ? 100.593 -7.859  186.245 1.00 59.49  ? 280  ASP F CG    1 
ATOM   2189 O  OD1   . ASP A 1 281 ? 100.233 -6.901  185.532 1.00 46.75  ? 280  ASP F OD1   1 
ATOM   2190 O  OD2   . ASP A 1 281 ? 100.109 -9.006  186.122 1.00 53.96  ? 280  ASP F OD2   1 
ATOM   2191 N  N     . LEU A 1 282 ? 102.144 -4.533  185.656 1.00 36.94  ? 281  LEU F N     1 
ATOM   2192 C  CA    . LEU A 1 282 ? 102.702 -3.794  184.515 1.00 30.83  ? 281  LEU F CA    1 
ATOM   2193 C  C     . LEU A 1 282 ? 102.775 -4.614  183.233 1.00 33.05  ? 281  LEU F C     1 
ATOM   2194 O  O     . LEU A 1 282 ? 103.509 -4.245  182.302 1.00 31.54  ? 281  LEU F O     1 
ATOM   2195 C  CB    . LEU A 1 282 ? 104.090 -3.227  184.833 1.00 33.05  ? 281  LEU F CB    1 
ATOM   2196 C  CG    . LEU A 1 282 ? 104.177 -2.342  186.073 1.00 36.32  ? 281  LEU F CG    1 
ATOM   2197 C  CD1   . LEU A 1 282 ? 105.607 -1.811  186.247 1.00 39.93  ? 281  LEU F CD1   1 
ATOM   2198 C  CD2   . LEU A 1 282 ? 103.161 -1.193  185.977 1.00 43.30  ? 281  LEU F CD2   1 
ATOM   2199 N  N     . LEU A 1 283 ? 102.040 -5.717  183.150 1.00 37.96  ? 282  LEU F N     1 
ATOM   2200 C  CA    . LEU A 1 283 ? 102.077 -6.552  181.958 1.00 34.82  ? 282  LEU F CA    1 
ATOM   2201 C  C     . LEU A 1 283 ? 101.253 -5.909  180.858 1.00 32.35  ? 282  LEU F C     1 
ATOM   2202 O  O     . LEU A 1 283 ? 100.135 -5.446  181.098 1.00 38.84  ? 282  LEU F O     1 
ATOM   2203 C  CB    . LEU A 1 283 ? 101.556 -7.959  182.269 1.00 36.57  ? 282  LEU F CB    1 
ATOM   2204 C  CG    . LEU A 1 283 ? 102.439 -8.773  183.214 1.00 43.29  ? 282  LEU F CG    1 
ATOM   2205 C  CD1   . LEU A 1 283 ? 101.932 -10.229 183.350 1.00 42.95  ? 282  LEU F CD1   1 
ATOM   2206 C  CD2   . LEU A 1 283 ? 103.903 -8.753  182.754 1.00 40.98  ? 282  LEU F CD2   1 
ATOM   2207 N  N     . ILE A 1 284 ? 101.798 -5.884  179.644 1.00 32.35  ? 283  ILE F N     1 
ATOM   2208 C  CA    . ILE A 1 284 ? 101.219 -5.124  178.543 1.00 32.77  ? 283  ILE F CA    1 
ATOM   2209 C  C     . ILE A 1 284 ? 101.396 -5.914  177.261 1.00 30.60  ? 283  ILE F C     1 
ATOM   2210 O  O     . ILE A 1 284 ? 102.075 -6.938  177.227 1.00 36.80  ? 283  ILE F O     1 
ATOM   2211 C  CB    . ILE A 1 284 ? 101.870 -3.731  178.408 1.00 36.45  ? 283  ILE F CB    1 
ATOM   2212 C  CG1   . ILE A 1 284 ? 103.392 -3.888  178.249 1.00 29.10  ? 283  ILE F CG1   1 
ATOM   2213 C  CG2   . ILE A 1 284 ? 101.514 -2.885  179.622 1.00 36.33  ? 283  ILE F CG2   1 
ATOM   2214 C  CD1   . ILE A 1 284 ? 104.185 -2.589  177.957 1.00 29.15  ? 283  ILE F CD1   1 
ATOM   2215 N  N     . ALA A 1 285 ? 100.796 -5.416  176.184 1.00 32.95  ? 284  ALA F N     1 
ATOM   2216 C  CA    . ALA A 1 285 ? 100.978 -6.074  174.897 1.00 35.48  ? 284  ALA F CA    1 
ATOM   2217 C  C     . ALA A 1 285 ? 102.028 -5.399  174.034 1.00 37.57  ? 284  ALA F C     1 
ATOM   2218 O  O     . ALA A 1 285 ? 102.769 -6.083  173.324 1.00 39.39  ? 284  ALA F O     1 
ATOM   2219 C  CB    . ALA A 1 285 ? 99.648  -6.148  174.143 1.00 33.12  ? 284  ALA F CB    1 
ATOM   2220 N  N     . ARG A 1 286 ? 102.113 -4.068  174.074 1.00 34.01  ? 285  ARG F N     1 
ATOM   2221 C  CA    . ARG A 1 286 ? 103.075 -3.322  173.278 1.00 24.64  ? 285  ARG F CA    1 
ATOM   2222 C  C     . ARG A 1 286 ? 103.470 -2.068  174.044 1.00 29.34  ? 285  ARG F C     1 
ATOM   2223 O  O     . ARG A 1 286 ? 102.719 -1.576  174.883 1.00 33.05  ? 285  ARG F O     1 
ATOM   2224 C  CB    . ARG A 1 286 ? 102.493 -2.944  171.906 1.00 31.57  ? 285  ARG F CB    1 
ATOM   2225 C  CG    . ARG A 1 286 ? 101.661 -4.051  171.250 1.00 33.55  ? 285  ARG F CG    1 
ATOM   2226 C  CD    . ARG A 1 286 ? 100.840 -3.572  170.079 1.00 37.68  ? 285  ARG F CD    1 
ATOM   2227 N  NE    . ARG A 1 286 ? 101.649 -2.864  169.088 1.00 47.18  ? 285  ARG F NE    1 
ATOM   2228 C  CZ    . ARG A 1 286 ? 102.303 -3.441  168.081 1.00 63.08  ? 285  ARG F CZ    1 
ATOM   2229 N  NH1   . ARG A 1 286 ? 102.269 -4.757  167.922 1.00 70.99  ? 285  ARG F NH1   1 
ATOM   2230 N  NH2   . ARG A 1 286 ? 102.999 -2.700  167.228 1.00 64.65  ? 285  ARG F NH2   1 
ATOM   2231 N  N     . GLN A 1 287 ? 104.648 -1.538  173.735 1.00 28.32  ? 286  GLN F N     1 
ATOM   2232 C  CA    . GLN A 1 287 ? 105.020 -0.216  174.222 1.00 29.46  ? 286  GLN F CA    1 
ATOM   2233 C  C     . GLN A 1 287 ? 105.775 0.511   173.115 1.00 33.46  ? 286  GLN F C     1 
ATOM   2234 O  O     . GLN A 1 287 ? 106.330 -0.106  172.199 1.00 31.77  ? 286  GLN F O     1 
ATOM   2235 C  CB    . GLN A 1 287 ? 105.840 -0.286  175.528 1.00 31.45  ? 286  GLN F CB    1 
ATOM   2236 C  CG    . GLN A 1 287 ? 107.185 -1.039  175.476 1.00 30.93  ? 286  GLN F CG    1 
ATOM   2237 C  CD    . GLN A 1 287 ? 108.018 -0.780  176.734 1.00 31.34  ? 286  GLN F CD    1 
ATOM   2238 O  OE1   . GLN A 1 287 ? 107.477 -0.531  177.810 1.00 29.82  ? 286  GLN F OE1   1 
ATOM   2239 N  NE2   . GLN A 1 287 ? 109.322 -0.833  176.601 1.00 29.32  ? 286  GLN F NE2   1 
ATOM   2240 N  N     . GLY A 1 288 ? 105.769 1.839   173.190 1.00 33.46  ? 287  GLY F N     1 
ATOM   2241 C  CA    . GLY A 1 288 ? 106.360 2.600   172.107 1.00 24.36  ? 287  GLY F CA    1 
ATOM   2242 C  C     . GLY A 1 288 ? 106.533 4.059   172.468 1.00 32.44  ? 287  GLY F C     1 
ATOM   2243 O  O     . GLY A 1 288 ? 106.271 4.494   173.595 1.00 24.06  ? 287  GLY F O     1 
ATOM   2244 N  N     . VAL A 1 289 ? 107.020 4.813   171.488 1.00 28.60  ? 288  VAL F N     1 
ATOM   2245 C  CA    . VAL A 1 289 ? 107.367 6.203   171.715 1.00 28.71  ? 288  VAL F CA    1 
ATOM   2246 C  C     . VAL A 1 289 ? 106.805 7.024   170.567 1.00 30.97  ? 288  VAL F C     1 
ATOM   2247 O  O     . VAL A 1 289 ? 106.425 6.501   169.515 1.00 26.31  ? 288  VAL F O     1 
ATOM   2248 C  CB    . VAL A 1 289 ? 108.892 6.410   171.850 1.00 26.88  ? 288  VAL F CB    1 
ATOM   2249 C  CG1   . VAL A 1 289 ? 109.491 5.437   172.923 1.00 26.02  ? 288  VAL F CG1   1 
ATOM   2250 C  CG2   . VAL A 1 289 ? 109.550 6.224   170.516 1.00 27.83  ? 288  VAL F CG2   1 
ATOM   2251 N  N     . LYS A 1 290 ? 106.753 8.329   170.794 1.00 32.70  ? 289  LYS F N     1 
ATOM   2252 C  CA    . LYS A 1 290 ? 106.235 9.279   169.824 1.00 25.33  ? 289  LYS F CA    1 
ATOM   2253 C  C     . LYS A 1 290 ? 107.186 10.459  169.801 1.00 27.27  ? 289  LYS F C     1 
ATOM   2254 O  O     . LYS A 1 290 ? 107.598 10.939  170.860 1.00 30.07  ? 289  LYS F O     1 
ATOM   2255 C  CB    . LYS A 1 290 ? 104.801 9.715   170.205 1.00 22.41  ? 289  LYS F CB    1 
ATOM   2256 C  CG    . LYS A 1 290 ? 104.205 10.851  169.335 1.00 33.65  ? 289  LYS F CG    1 
ATOM   2257 C  CD    . LYS A 1 290 ? 102.685 10.742  169.280 1.00 48.08  ? 289  LYS F CD    1 
ATOM   2258 C  CE    . LYS A 1 290 ? 101.999 11.769  170.146 1.00 50.12  ? 289  LYS F CE    1 
ATOM   2259 N  NZ    . LYS A 1 290 ? 100.567 11.380  170.435 1.00 52.01  ? 289  LYS F NZ    1 
ATOM   2260 N  N     . LEU A 1 291 ? 107.540 10.919  168.608 1.00 28.75  ? 290  LEU F N     1 
ATOM   2261 C  CA    . LEU A 1 291 ? 108.234 12.189  168.461 1.00 35.45  ? 290  LEU F CA    1 
ATOM   2262 C  C     . LEU A 1 291 ? 107.412 13.087  167.568 1.00 32.12  ? 290  LEU F C     1 
ATOM   2263 O  O     . LEU A 1 291 ? 106.880 12.638  166.545 1.00 29.20  ? 290  LEU F O     1 
ATOM   2264 C  CB    . LEU A 1 291 ? 109.634 12.023  167.863 1.00 30.85  ? 290  LEU F CB    1 
ATOM   2265 C  CG    . LEU A 1 291 ? 110.591 11.121  168.646 1.00 27.55  ? 290  LEU F CG    1 
ATOM   2266 C  CD1   . LEU A 1 291 ? 111.907 11.224  167.919 1.00 31.32  ? 290  LEU F CD1   1 
ATOM   2267 C  CD2   . LEU A 1 291 ? 110.735 11.577  170.081 1.00 32.88  ? 290  LEU F CD2   1 
ATOM   2268 N  N     . LYS A 1 292 ? 107.312 14.358  167.940 1.00 29.96  ? 291  LYS F N     1 
ATOM   2269 C  CA    . LYS A 1 292 ? 106.717 15.347  167.042 1.00 30.43  ? 291  LYS F CA    1 
ATOM   2270 C  C     . LYS A 1 292 ? 107.699 16.480  166.793 1.00 34.87  ? 291  LYS F C     1 
ATOM   2271 O  O     . LYS A 1 292 ? 108.269 17.047  167.739 1.00 37.84  ? 291  LYS F O     1 
ATOM   2272 C  CB    . LYS A 1 292 ? 105.417 15.909  167.584 1.00 25.53  ? 291  LYS F CB    1 
ATOM   2273 C  CG    . LYS A 1 292 ? 104.686 16.770  166.575 1.00 32.08  ? 291  LYS F CG    1 
ATOM   2274 C  CD    . LYS A 1 292 ? 103.590 17.569  167.222 1.00 39.38  ? 291  LYS F CD    1 
ATOM   2275 C  CE    . LYS A 1 292 ? 102.334 16.756  167.419 1.00 49.91  ? 291  LYS F CE    1 
ATOM   2276 N  NZ    . LYS A 1 292 ? 101.465 17.507  168.348 1.00 38.92  ? 291  LYS F NZ    1 
ATOM   2277 N  N     . PHE A 1 293 ? 107.871 16.818  165.524 1.00 38.22  ? 292  PHE F N     1 
ATOM   2278 C  CA    . PHE A 1 293 ? 108.918 17.727  165.095 1.00 36.46  ? 292  PHE F CA    1 
ATOM   2279 C  C     . PHE A 1 293 ? 108.402 19.161  164.991 1.00 39.72  ? 292  PHE F C     1 
ATOM   2280 O  O     . PHE A 1 293 ? 107.201 19.430  165.083 1.00 39.74  ? 292  PHE F O     1 
ATOM   2281 C  CB    . PHE A 1 293 ? 109.491 17.232  163.773 1.00 34.48  ? 292  PHE F CB    1 
ATOM   2282 C  CG    . PHE A 1 293 ? 109.986 15.818  163.851 1.00 37.88  ? 292  PHE F CG    1 
ATOM   2283 C  CD1   . PHE A 1 293 ? 111.117 15.515  164.601 1.00 38.92  ? 292  PHE F CD1   1 
ATOM   2284 C  CD2   . PHE A 1 293 ? 109.315 14.791  163.206 1.00 40.34  ? 292  PHE F CD2   1 
ATOM   2285 C  CE1   . PHE A 1 293 ? 111.568 14.210  164.692 1.00 49.66  ? 292  PHE F CE1   1 
ATOM   2286 C  CE2   . PHE A 1 293 ? 109.769 13.490  163.285 1.00 37.39  ? 292  PHE F CE2   1 
ATOM   2287 C  CZ    . PHE A 1 293 ? 110.887 13.197  164.033 1.00 40.48  ? 292  PHE F CZ    1 
ATOM   2288 N  N     . ASP A 1 294 ? 109.344 20.092  164.796 1.00 42.94  ? 293  ASP F N     1 
ATOM   2289 C  CA    . ASP A 1 294 ? 109.004 21.511  164.763 1.00 48.84  ? 293  ASP F CA    1 
ATOM   2290 C  C     . ASP A 1 294 ? 108.104 21.875  163.585 1.00 51.07  ? 293  ASP F C     1 
ATOM   2291 O  O     . ASP A 1 294 ? 107.410 22.900  163.649 1.00 43.10  ? 293  ASP F O     1 
ATOM   2292 C  CB    . ASP A 1 294 ? 110.284 22.376  164.762 1.00 46.96  ? 293  ASP F CB    1 
ATOM   2293 C  CG    . ASP A 1 294 ? 111.328 21.952  163.704 1.00 56.97  ? 293  ASP F CG    1 
ATOM   2294 O  OD1   . ASP A 1 294 ? 110.980 21.275  162.708 1.00 47.40  ? 293  ASP F OD1   1 
ATOM   2295 O  OD2   . ASP A 1 294 ? 112.519 22.335  163.867 1.00 57.11  ? 293  ASP F OD2   1 
ATOM   2296 N  N     . ASP A 1 295 ? 108.092 21.069  162.515 1.00 38.38  ? 294  ASP F N     1 
ATOM   2297 C  CA    . ASP A 1 295 ? 107.168 21.277  161.404 1.00 35.17  ? 294  ASP F CA    1 
ATOM   2298 C  C     . ASP A 1 295 ? 105.846 20.535  161.575 1.00 36.13  ? 294  ASP F C     1 
ATOM   2299 O  O     . ASP A 1 295 ? 105.014 20.566  160.662 1.00 42.17  ? 294  ASP F O     1 
ATOM   2300 C  CB    . ASP A 1 295 ? 107.802 20.859  160.075 1.00 41.01  ? 294  ASP F CB    1 
ATOM   2301 C  CG    . ASP A 1 295 ? 108.271 19.412  160.063 1.00 39.71  ? 294  ASP F CG    1 
ATOM   2302 O  OD1   . ASP A 1 295 ? 107.842 18.614  160.902 1.00 38.16  ? 294  ASP F OD1   1 
ATOM   2303 O  OD2   . ASP A 1 295 ? 109.077 19.062  159.185 1.00 61.42  ? 294  ASP F OD2   1 
ATOM   2304 N  N     . PHE A 1 296 ? 105.647 19.856  162.699 1.00 41.03  ? 295  PHE F N     1 
ATOM   2305 C  CA    . PHE A 1 296 ? 104.409 19.203  163.124 1.00 41.48  ? 295  PHE F CA    1 
ATOM   2306 C  C     . PHE A 1 296 ? 104.171 17.823  162.522 1.00 41.02  ? 295  PHE F C     1 
ATOM   2307 O  O     . PHE A 1 296 ? 103.141 17.227  162.827 1.00 45.75  ? 295  PHE F O     1 
ATOM   2308 C  CB    . PHE A 1 296 ? 103.159 20.067  162.876 1.00 38.89  ? 295  PHE F CB    1 
ATOM   2309 C  CG    . PHE A 1 296 ? 102.703 20.766  164.103 1.00 41.89  ? 295  PHE F CG    1 
ATOM   2310 C  CD1   . PHE A 1 296 ? 103.480 21.776  164.642 1.00 59.24  ? 295  PHE F CD1   1 
ATOM   2311 C  CD2   . PHE A 1 296 ? 101.549 20.386  164.756 1.00 54.20  ? 295  PHE F CD2   1 
ATOM   2312 C  CE1   . PHE A 1 296 ? 103.102 22.402  165.805 1.00 73.55  ? 295  PHE F CE1   1 
ATOM   2313 C  CE2   . PHE A 1 296 ? 101.154 21.020  165.919 1.00 63.75  ? 295  PHE F CE2   1 
ATOM   2314 C  CZ    . PHE A 1 296 ? 101.929 22.032  166.441 1.00 63.58  ? 295  PHE F CZ    1 
ATOM   2315 N  N     . GLN A 1 297 ? 105.069 17.290  161.700 1.00 42.69  ? 296  GLN F N     1 
ATOM   2316 C  CA    . GLN A 1 297 ? 105.004 15.872  161.376 1.00 36.40  ? 296  GLN F CA    1 
ATOM   2317 C  C     . GLN A 1 297 ? 105.327 15.070  162.632 1.00 39.86  ? 296  GLN F C     1 
ATOM   2318 O  O     . GLN A 1 297 ? 106.142 15.486  163.459 1.00 39.36  ? 296  GLN F O     1 
ATOM   2319 C  CB    . GLN A 1 297 ? 105.992 15.531  160.255 1.00 42.16  ? 296  GLN F CB    1 
ATOM   2320 C  CG    . GLN A 1 297 ? 105.950 14.090  159.712 1.00 42.02  ? 296  GLN F CG    1 
ATOM   2321 C  CD    . GLN A 1 297 ? 107.121 13.810  158.754 1.00 56.60  ? 296  GLN F CD    1 
ATOM   2322 O  OE1   . GLN A 1 297 ? 108.228 14.330  158.948 1.00 59.27  ? 296  GLN F OE1   1 
ATOM   2323 N  NE2   . GLN A 1 297 ? 106.875 13.012  157.711 1.00 44.92  ? 296  GLN F NE2   1 
ATOM   2324 N  N     . GLN A 1 298 ? 104.674 13.931  162.794 1.00 38.79  ? 297  GLN F N     1 
ATOM   2325 C  CA    . GLN A 1 298 ? 104.943 13.088  163.948 1.00 39.32  ? 297  GLN F CA    1 
ATOM   2326 C  C     . GLN A 1 298 ? 105.098 11.636  163.520 1.00 38.58  ? 297  GLN F C     1 
ATOM   2327 O  O     . GLN A 1 298 ? 104.527 11.200  162.517 1.00 41.73  ? 297  GLN F O     1 
ATOM   2328 C  CB    . GLN A 1 298 ? 103.843 13.210  165.012 1.00 45.29  ? 297  GLN F CB    1 
ATOM   2329 C  CG    . GLN A 1 298 ? 102.552 12.479  164.712 1.00 58.07  ? 297  GLN F CG    1 
ATOM   2330 C  CD    . GLN A 1 298 ? 101.634 12.416  165.936 1.00 58.13  ? 297  GLN F CD    1 
ATOM   2331 O  OE1   . GLN A 1 298 ? 101.416 13.418  166.614 1.00 63.03  ? 297  GLN F OE1   1 
ATOM   2332 N  NE2   . GLN A 1 298 ? 101.111 11.235  166.225 1.00 43.88  ? 297  GLN F NE2   1 
ATOM   2333 N  N     . THR A 1 299 ? 105.873 10.887  164.308 1.00 33.21  ? 298  THR F N     1 
ATOM   2334 C  CA    . THR A 1 299 ? 106.097 9.473   164.066 1.00 26.73  ? 298  THR F CA    1 
ATOM   2335 C  C     . THR A 1 299 ? 105.959 8.728   165.387 1.00 28.26  ? 298  THR F C     1 
ATOM   2336 O  O     . THR A 1 299 ? 106.300 9.243   166.461 1.00 33.61  ? 298  THR F O     1 
ATOM   2337 C  CB    . THR A 1 299 ? 107.496 9.217   163.432 1.00 40.17  ? 298  THR F CB    1 
ATOM   2338 O  OG1   . THR A 1 299 ? 107.683 7.819   163.161 1.00 41.50  ? 298  THR F OG1   1 
ATOM   2339 C  CG2   . THR A 1 299 ? 108.617 9.712   164.347 1.00 47.02  ? 298  THR F CG2   1 
ATOM   2340 N  N     . THR A 1 300 ? 105.439 7.519   165.294 1.00 29.16  ? 299  THR F N     1 
ATOM   2341 C  CA    . THR A 1 300 ? 105.321 6.613   166.425 1.00 31.76  ? 299  THR F CA    1 
ATOM   2342 C  C     . THR A 1 300 ? 106.055 5.327   166.069 1.00 43.59  ? 299  THR F C     1 
ATOM   2343 O  O     . THR A 1 300 ? 105.987 4.872   164.926 1.00 37.00  ? 299  THR F O     1 
ATOM   2344 C  CB    . THR A 1 300 ? 103.847 6.309   166.747 1.00 38.37  ? 299  THR F CB    1 
ATOM   2345 O  OG1   . THR A 1 300 ? 103.221 5.689   165.608 1.00 31.05  ? 299  THR F OG1   1 
ATOM   2346 C  CG2   . THR A 1 300 ? 103.080 7.603   167.120 1.00 31.04  ? 299  THR F CG2   1 
ATOM   2347 N  N     . GLN A 1 301 ? 106.777 4.743   167.024 1.00 31.56  ? 300  GLN F N     1 
ATOM   2348 C  CA    . GLN A 1 301 ? 107.208 3.364   166.810 1.00 29.30  ? 300  GLN F CA    1 
ATOM   2349 C  C     . GLN A 1 301 ? 107.057 2.580   168.095 1.00 27.91  ? 300  GLN F C     1 
ATOM   2350 O  O     . GLN A 1 301 ? 107.524 2.981   169.170 1.00 31.49  ? 300  GLN F O     1 
ATOM   2351 C  CB    . GLN A 1 301 ? 108.625 3.225   166.240 1.00 38.45  ? 300  GLN F CB    1 
ATOM   2352 C  CG    . GLN A 1 301 ? 109.770 3.772   166.978 1.00 55.35  ? 300  GLN F CG    1 
ATOM   2353 C  CD    . GLN A 1 301 ? 111.087 3.490   166.224 1.00 70.80  ? 300  GLN F CD    1 
ATOM   2354 O  OE1   . GLN A 1 301 ? 111.817 4.411   165.854 1.00 73.66  ? 300  GLN F OE1   1 
ATOM   2355 N  NE2   . GLN A 1 301 ? 111.376 2.212   165.988 1.00 66.51  ? 300  GLN F NE2   1 
ATOM   2356 N  N     . GLU A 1 302 ? 106.359 1.476   167.949 1.00 27.50  ? 301  GLU F N     1 
ATOM   2357 C  CA    . GLU A 1 302 ? 105.857 0.646   169.022 1.00 35.45  ? 301  GLU F CA    1 
ATOM   2358 C  C     . GLU A 1 302 ? 106.047 -0.791  168.584 1.00 36.08  ? 301  GLU F C     1 
ATOM   2359 O  O     . GLU A 1 302 ? 106.093 -1.087  167.385 1.00 35.76  ? 301  GLU F O     1 
ATOM   2360 C  CB    . GLU A 1 302 ? 104.368 0.925   169.288 1.00 34.50  ? 301  GLU F CB    1 
ATOM   2361 C  CG    . GLU A 1 302 ? 104.065 2.416   169.426 1.00 53.91  ? 301  GLU F CG    1 
ATOM   2362 C  CD    . GLU A 1 302 ? 102.624 2.789   169.114 1.00 68.24  ? 301  GLU F CD    1 
ATOM   2363 O  OE1   . GLU A 1 302 ? 101.806 1.883   168.842 1.00 72.32  ? 301  GLU F OE1   1 
ATOM   2364 O  OE2   . GLU A 1 302 ? 102.321 4.002   169.141 1.00 62.22  ? 301  GLU F OE2   1 
ATOM   2365 N  N     . HIS A 1 303 ? 106.116 -1.685  169.558 1.00 30.91  ? 302  HIS F N     1 
ATOM   2366 C  CA    . HIS A 1 303 ? 106.366 -3.077  169.244 1.00 35.06  ? 302  HIS F CA    1 
ATOM   2367 C  C     . HIS A 1 303 ? 105.857 -3.935  170.389 1.00 37.15  ? 302  HIS F C     1 
ATOM   2368 O  O     . HIS A 1 303 ? 105.734 -3.477  171.537 1.00 28.55  ? 302  HIS F O     1 
ATOM   2369 C  CB    . HIS A 1 303 ? 107.864 -3.321  169.016 1.00 31.27  ? 302  HIS F CB    1 
ATOM   2370 C  CG    . HIS A 1 303 ? 108.711 -2.800  170.134 1.00 35.75  ? 302  HIS F CG    1 
ATOM   2371 N  ND1   . HIS A 1 303 ? 109.458 -1.646  170.030 1.00 38.58  ? 302  HIS F ND1   1 
ATOM   2372 C  CD2   . HIS A 1 303 ? 108.879 -3.243  171.403 1.00 39.76  ? 302  HIS F CD2   1 
ATOM   2373 C  CE1   . HIS A 1 303 ? 110.088 -1.426  171.171 1.00 43.94  ? 302  HIS F CE1   1 
ATOM   2374 N  NE2   . HIS A 1 303 ? 109.756 -2.382  172.022 1.00 41.58  ? 302  HIS F NE2   1 
ATOM   2375 N  N     . VAL A 1 304 ? 105.568 -5.189  170.056 1.00 37.30  ? 303  VAL F N     1 
ATOM   2376 C  CA    . VAL A 1 304 ? 105.303 -6.236  171.033 1.00 40.69  ? 303  VAL F CA    1 
ATOM   2377 C  C     . VAL A 1 304 ? 106.332 -6.167  172.153 1.00 31.61  ? 303  VAL F C     1 
ATOM   2378 O  O     . VAL A 1 304 ? 107.541 -6.112  171.896 1.00 31.20  ? 303  VAL F O     1 
ATOM   2379 C  CB    . VAL A 1 304 ? 105.301 -7.608  170.340 1.00 39.73  ? 303  VAL F CB    1 
ATOM   2380 C  CG1   . VAL A 1 304 ? 105.323 -8.713  171.358 1.00 43.74  ? 303  VAL F CG1   1 
ATOM   2381 C  CG2   . VAL A 1 304 ? 104.063 -7.699  169.431 1.00 42.34  ? 303  VAL F CG2   1 
ATOM   2382 N  N     . TRP A 1 305 ? 105.855 -6.125  173.400 1.00 31.71  ? 304  TRP F N     1 
ATOM   2383 C  CA    . TRP A 1 305 ? 106.739 -6.076  174.556 1.00 34.62  ? 304  TRP F CA    1 
ATOM   2384 C  C     . TRP A 1 305 ? 105.912 -6.531  175.741 1.00 31.17  ? 304  TRP F C     1 
ATOM   2385 O  O     . TRP A 1 305 ? 104.739 -6.147  175.843 1.00 35.65  ? 304  TRP F O     1 
ATOM   2386 C  CB    . TRP A 1 305 ? 107.304 -4.669  174.800 1.00 35.90  ? 304  TRP F CB    1 
ATOM   2387 C  CG    . TRP A 1 305 ? 108.468 -4.644  175.778 1.00 32.17  ? 304  TRP F CG    1 
ATOM   2388 C  CD1   . TRP A 1 305 ? 108.397 -4.414  177.121 1.00 32.74  ? 304  TRP F CD1   1 
ATOM   2389 C  CD2   . TRP A 1 305 ? 109.850 -4.855  175.479 1.00 30.56  ? 304  TRP F CD2   1 
ATOM   2390 N  NE1   . TRP A 1 305 ? 109.653 -4.468  177.683 1.00 32.95  ? 304  TRP F NE1   1 
ATOM   2391 C  CE2   . TRP A 1 305 ? 110.564 -4.738  176.696 1.00 39.33  ? 304  TRP F CE2   1 
ATOM   2392 C  CE3   . TRP A 1 305 ? 110.562 -5.122  174.304 1.00 31.74  ? 304  TRP F CE3   1 
ATOM   2393 C  CZ2   . TRP A 1 305 ? 111.951 -4.891  176.767 1.00 32.78  ? 304  TRP F CZ2   1 
ATOM   2394 C  CZ3   . TRP A 1 305 ? 111.944 -5.278  174.384 1.00 38.19  ? 304  TRP F CZ3   1 
ATOM   2395 C  CH2   . TRP A 1 305 ? 112.619 -5.155  175.601 1.00 34.59  ? 304  TRP F CH2   1 
ATOM   2396 N  N     . PRO A 1 306 ? 106.452 -7.340  176.619 1.00 30.96  ? 305  PRO F N     1 
ATOM   2397 C  CA    . PRO A 1 306 ? 105.609 -7.993  177.623 1.00 32.74  ? 305  PRO F CA    1 
ATOM   2398 C  C     . PRO A 1 306 ? 105.364 -7.182  178.886 1.00 31.65  ? 305  PRO F C     1 
ATOM   2399 O  O     . PRO A 1 306 ? 104.397 -7.471  179.588 1.00 31.18  ? 305  PRO F O     1 
ATOM   2400 C  CB    . PRO A 1 306 ? 106.411 -9.261  177.938 1.00 37.09  ? 305  PRO F CB    1 
ATOM   2401 C  CG    . PRO A 1 306 ? 107.819 -8.791  177.829 1.00 41.05  ? 305  PRO F CG    1 
ATOM   2402 C  CD    . PRO A 1 306 ? 107.818 -7.887  176.620 1.00 32.71  ? 305  PRO F CD    1 
ATOM   2403 N  N     . ARG A 1 307 ? 106.206 -6.196  179.212 1.00 35.89  ? 306  ARG F N     1 
ATOM   2404 C  CA    . ARG A 1 307 ? 106.103 -5.523  180.508 1.00 34.62  ? 306  ARG F CA    1 
ATOM   2405 C  C     . ARG A 1 307 ? 106.793 -4.172  180.426 1.00 35.62  ? 306  ARG F C     1 
ATOM   2406 O  O     . ARG A 1 307 ? 107.914 -4.078  179.912 1.00 37.67  ? 306  ARG F O     1 
ATOM   2407 C  CB    . ARG A 1 307 ? 106.737 -6.361  181.623 1.00 31.31  ? 306  ARG F CB    1 
ATOM   2408 C  CG    . ARG A 1 307 ? 106.681 -5.746  183.035 1.00 42.61  ? 306  ARG F CG    1 
ATOM   2409 C  CD    . ARG A 1 307 ? 107.401 -6.684  184.048 1.00 46.13  ? 306  ARG F CD    1 
ATOM   2410 N  NE    . ARG A 1 307 ? 107.208 -6.255  185.432 1.00 56.33  ? 306  ARG F NE    1 
ATOM   2411 C  CZ    . ARG A 1 307 ? 107.966 -5.359  186.061 1.00 65.32  ? 306  ARG F CZ    1 
ATOM   2412 N  NH1   . ARG A 1 307 ? 108.986 -4.785  185.434 1.00 68.18  ? 306  ARG F NH1   1 
ATOM   2413 N  NH2   . ARG A 1 307 ? 107.701 -5.034  187.324 1.00 56.51  ? 306  ARG F NH2   1 
ATOM   2414 N  N     . LEU A 1 308 ? 106.122 -3.145  180.937 1.00 33.29  ? 307  LEU F N     1 
ATOM   2415 C  CA    . LEU A 1 308 ? 106.621 -1.783  180.858 1.00 30.21  ? 307  LEU F CA    1 
ATOM   2416 C  C     . LEU A 1 308 ? 108.099 -1.727  181.222 1.00 30.97  ? 307  LEU F C     1 
ATOM   2417 O  O     . LEU A 1 308 ? 108.527 -2.290  182.237 1.00 37.41  ? 307  LEU F O     1 
ATOM   2418 C  CB    . LEU A 1 308 ? 105.789 -0.897  181.787 1.00 32.23  ? 307  LEU F CB    1 
ATOM   2419 C  CG    . LEU A 1 308 ? 106.151 0.584   181.672 1.00 32.48  ? 307  LEU F CG    1 
ATOM   2420 C  CD1   . LEU A 1 308 ? 105.713 1.134   180.334 1.00 29.90  ? 307  LEU F CD1   1 
ATOM   2421 C  CD2   . LEU A 1 308 ? 105.566 1.372   182.836 1.00 28.41  ? 307  LEU F CD2   1 
ATOM   2422 N  N     . ASN A 1 309 ? 108.902 -1.125  180.345 1.00 28.14  ? 308  ASN F N     1 
ATOM   2423 C  CA    . ASN A 1 309 ? 110.348 -1.151  180.531 1.00 28.38  ? 308  ASN F CA    1 
ATOM   2424 C  C     . ASN A 1 309 ? 110.956 0.162   180.060 1.00 30.01  ? 308  ASN F C     1 
ATOM   2425 O  O     . ASN A 1 309 ? 110.860 0.501   178.881 1.00 27.05  ? 308  ASN F O     1 
ATOM   2426 C  CB    . ASN A 1 309 ? 110.961 -2.342  179.791 1.00 33.16  ? 308  ASN F CB    1 
ATOM   2427 C  CG    . ASN A 1 309 ? 112.472 -2.405  179.920 1.00 29.82  ? 308  ASN F CG    1 
ATOM   2428 O  OD1   . ASN A 1 309 ? 113.187 -1.679  179.219 1.00 35.91  ? 308  ASN F OD1   1 
ATOM   2429 N  ND2   . ASN A 1 309 ? 112.974 -3.304  180.778 1.00 31.43  ? 308  ASN F ND2   1 
ATOM   2430 N  N     . LYS A 1 310 ? 111.597 0.889   180.981 1.00 28.15  ? 309  LYS F N     1 
ATOM   2431 C  CA    . LYS A 1 310 ? 112.086 2.235   180.677 1.00 31.31  ? 309  LYS F CA    1 
ATOM   2432 C  C     . LYS A 1 310 ? 113.235 2.204   179.678 1.00 28.31  ? 309  LYS F C     1 
ATOM   2433 O  O     . LYS A 1 310 ? 113.250 2.995   178.735 1.00 31.48  ? 309  LYS F O     1 
ATOM   2434 C  CB    . LYS A 1 310 ? 112.541 2.950   181.955 1.00 31.03  ? 309  LYS F CB    1 
ATOM   2435 C  CG    . LYS A 1 310 ? 112.877 4.422   181.737 1.00 29.21  ? 309  LYS F CG    1 
ATOM   2436 C  CD    . LYS A 1 310 ? 114.082 4.867   182.552 1.00 49.67  ? 309  LYS F CD    1 
ATOM   2437 C  CE    . LYS A 1 310 ? 113.783 4.921   184.020 1.00 54.18  ? 309  LYS F CE    1 
ATOM   2438 N  NZ    . LYS A 1 310 ? 115.000 5.344   184.745 1.00 43.20  ? 309  LYS F NZ    1 
ATOM   2439 N  N     . ALA A 1 311 ? 114.198 1.295   179.861 1.00 29.60  ? 310  ALA F N     1 
ATOM   2440 C  CA    . ALA A 1 311 ? 115.384 1.298   179.006 1.00 39.44  ? 310  ALA F CA    1 
ATOM   2441 C  C     . ALA A 1 311 ? 115.028 0.990   177.556 1.00 38.24  ? 310  ALA F C     1 
ATOM   2442 O  O     . ALA A 1 311 ? 115.583 1.598   176.625 1.00 30.73  ? 310  ALA F O     1 
ATOM   2443 C  CB    . ALA A 1 311 ? 116.420 0.304   179.534 1.00 32.29  ? 310  ALA F CB    1 
ATOM   2444 N  N     . ASP A 1 312 ? 114.088 0.065   177.340 1.00 30.78  ? 311  ASP F N     1 
ATOM   2445 C  CA    . ASP A 1 312 ? 113.664 -0.210  175.972 1.00 36.11  ? 311  ASP F CA    1 
ATOM   2446 C  C     . ASP A 1 312 ? 112.962 1.002   175.352 1.00 31.63  ? 311  ASP F C     1 
ATOM   2447 O  O     . ASP A 1 312 ? 113.101 1.253   174.149 1.00 28.58  ? 311  ASP F O     1 
ATOM   2448 C  CB    . ASP A 1 312 ? 112.766 -1.456  175.935 1.00 29.27  ? 311  ASP F CB    1 
ATOM   2449 C  CG    . ASP A 1 312 ? 112.135 -1.672  174.575 1.00 28.93  ? 311  ASP F CG    1 
ATOM   2450 O  OD1   . ASP A 1 312 ? 112.860 -2.061  173.651 1.00 34.28  ? 311  ASP F OD1   1 
ATOM   2451 O  OD2   . ASP A 1 312 ? 110.918 -1.439  174.418 1.00 32.35  ? 311  ASP F OD2   1 
ATOM   2452 N  N     . LEU A 1 313 ? 112.223 1.783   176.146 1.00 27.38  ? 312  LEU F N     1 
ATOM   2453 C  CA    . LEU A 1 313 ? 111.608 2.983   175.580 1.00 28.12  ? 312  LEU F CA    1 
ATOM   2454 C  C     . LEU A 1 313 ? 112.669 4.022   175.234 1.00 28.68  ? 312  LEU F C     1 
ATOM   2455 O  O     . LEU A 1 313 ? 112.612 4.637   174.165 1.00 33.56  ? 312  LEU F O     1 
ATOM   2456 C  CB    . LEU A 1 313 ? 110.546 3.556   176.532 1.00 26.05  ? 312  LEU F CB    1 
ATOM   2457 C  CG    . LEU A 1 313 ? 109.278 2.728   176.803 1.00 35.22  ? 312  LEU F CG    1 
ATOM   2458 C  CD1   . LEU A 1 313 ? 108.432 3.297   177.957 1.00 26.38  ? 312  LEU F CD1   1 
ATOM   2459 C  CD2   . LEU A 1 313 ? 108.421 2.602   175.561 1.00 32.36  ? 312  LEU F CD2   1 
ATOM   2460 N  N     . ILE A 1 314 ? 113.687 4.184   176.091 1.00 28.07  ? 313  ILE F N     1 
ATOM   2461 C  CA    . ILE A 1 314 ? 114.795 5.083   175.754 1.00 29.77  ? 313  ILE F CA    1 
ATOM   2462 C  C     . ILE A 1 314 ? 115.502 4.617   174.481 1.00 30.08  ? 313  ILE F C     1 
ATOM   2463 O  O     . ILE A 1 314 ? 115.775 5.412   173.565 1.00 30.45  ? 313  ILE F O     1 
ATOM   2464 C  CB    . ILE A 1 314 ? 115.772 5.185   176.941 1.00 30.02  ? 313  ILE F CB    1 
ATOM   2465 C  CG1   . ILE A 1 314 ? 115.126 5.952   178.100 1.00 29.73  ? 313  ILE F CG1   1 
ATOM   2466 C  CG2   . ILE A 1 314 ? 117.103 5.824   176.521 1.00 31.49  ? 313  ILE F CG2   1 
ATOM   2467 C  CD1   . ILE A 1 314 ? 115.820 5.705   179.417 1.00 35.55  ? 313  ILE F CD1   1 
ATOM   2468 N  N     . ALA A 1 315 ? 115.821 3.322   174.410 1.00 37.50  ? 314  ALA F N     1 
ATOM   2469 C  CA    . ALA A 1 315 ? 116.489 2.784   173.230 1.00 38.90  ? 314  ALA F CA    1 
ATOM   2470 C  C     . ALA A 1 315 ? 115.665 3.033   171.980 1.00 32.85  ? 314  ALA F C     1 
ATOM   2471 O  O     . ALA A 1 315 ? 116.203 3.427   170.936 1.00 41.37  ? 314  ALA F O     1 
ATOM   2472 C  CB    . ALA A 1 315 ? 116.743 1.287   173.401 1.00 37.92  ? 314  ALA F CB    1 
ATOM   2473 N  N     . THR A 1 316 ? 114.352 2.808   172.068 1.00 29.81  ? 315  THR F N     1 
ATOM   2474 C  CA    . THR A 1 316 ? 113.486 3.011   170.910 1.00 29.27  ? 315  THR F CA    1 
ATOM   2475 C  C     . THR A 1 316 ? 113.431 4.483   170.522 1.00 37.45  ? 315  THR F C     1 
ATOM   2476 O  O     . THR A 1 316 ? 113.555 4.827   169.342 1.00 33.44  ? 315  THR F O     1 
ATOM   2477 C  CB    . THR A 1 316 ? 112.091 2.472   171.210 1.00 36.57  ? 315  THR F CB    1 
ATOM   2478 O  OG1   . THR A 1 316 ? 112.193 1.067   171.478 1.00 41.47  ? 315  THR F OG1   1 
ATOM   2479 C  CG2   . THR A 1 316 ? 111.151 2.686   170.013 1.00 31.52  ? 315  THR F CG2   1 
ATOM   2480 N  N     . ALA A 1 317 ? 113.307 5.372   171.508 1.00 29.90  ? 316  ALA F N     1 
ATOM   2481 C  CA    . ALA A 1 317 ? 113.350 6.804   171.208 1.00 34.72  ? 316  ALA F CA    1 
ATOM   2482 C  C     . ALA A 1 317 ? 114.682 7.213   170.570 1.00 30.07  ? 316  ALA F C     1 
ATOM   2483 O  O     . ALA A 1 317 ? 114.715 8.088   169.693 1.00 38.03  ? 316  ALA F O     1 
ATOM   2484 C  CB    . ALA A 1 317 ? 113.078 7.602   172.488 1.00 29.60  ? 316  ALA F CB    1 
ATOM   2485 N  N     . ARG A 1 318 ? 115.789 6.576   170.973 1.00 31.72  ? 317  ARG F N     1 
ATOM   2486 C  CA    . ARG A 1 318 ? 117.093 6.897   170.394 1.00 42.08  ? 317  ARG F CA    1 
ATOM   2487 C  C     . ARG A 1 318 ? 117.163 6.492   168.923 1.00 36.94  ? 317  ARG F C     1 
ATOM   2488 O  O     . ARG A 1 318 ? 117.632 7.268   168.080 1.00 35.48  ? 317  ARG F O     1 
ATOM   2489 C  CB    . ARG A 1 318 ? 118.203 6.211   171.192 1.00 34.02  ? 317  ARG F CB    1 
ATOM   2490 C  CG    . ARG A 1 318 ? 119.631 6.464   170.658 1.00 36.11  ? 317  ARG F CG    1 
ATOM   2491 C  CD    . ARG A 1 318 ? 120.051 7.895   170.940 1.00 57.58  ? 317  ARG F CD    1 
ATOM   2492 N  NE    . ARG A 1 318 ? 121.470 7.999   171.278 1.00 78.17  ? 317  ARG F NE    1 
ATOM   2493 C  CZ    . ARG A 1 318 ? 122.384 8.593   170.517 1.00 75.51  ? 317  ARG F CZ    1 
ATOM   2494 N  NH1   . ARG A 1 318 ? 122.038 9.152   169.365 1.00 76.91  ? 317  ARG F NH1   1 
ATOM   2495 N  NH2   . ARG A 1 318 ? 123.645 8.637   170.914 1.00 70.89  ? 317  ARG F NH2   1 
ATOM   2496 N  N     . LYS A 1 319 ? 116.671 5.296   168.600 1.00 33.36  ? 318  LYS F N     1 
ATOM   2497 C  CA    . LYS A 1 319 ? 116.573 4.858   167.210 1.00 35.94  ? 318  LYS F CA    1 
ATOM   2498 C  C     . LYS A 1 319 ? 115.717 5.818   166.388 1.00 42.52  ? 318  LYS F C     1 
ATOM   2499 O  O     . LYS A 1 319 ? 116.116 6.238   165.292 1.00 39.29  ? 318  LYS F O     1 
ATOM   2500 C  CB    . LYS A 1 319 ? 115.995 3.445   167.176 1.00 42.62  ? 318  LYS F CB    1 
ATOM   2501 C  CG    . LYS A 1 319 ? 116.002 2.755   165.828 1.00 63.06  ? 318  LYS F CG    1 
ATOM   2502 C  CD    . LYS A 1 319 ? 115.669 1.274   166.000 1.00 65.56  ? 318  LYS F CD    1 
ATOM   2503 C  CE    . LYS A 1 319 ? 116.530 0.654   167.105 1.00 64.94  ? 318  LYS F CE    1 
ATOM   2504 N  NZ    . LYS A 1 319 ? 116.174 -0.772  167.396 1.00 70.87  ? 318  LYS F NZ    1 
ATOM   2505 N  N     . THR A 1 320 ? 114.530 6.180   166.910 1.00 39.58  ? 319  THR F N     1 
ATOM   2506 C  CA    . THR A 1 320 ? 113.651 7.110   166.200 1.00 38.28  ? 319  THR F CA    1 
ATOM   2507 C  C     . THR A 1 320 ? 114.326 8.469   166.039 1.00 35.95  ? 319  THR F C     1 
ATOM   2508 O  O     . THR A 1 320 ? 114.247 9.093   164.971 1.00 40.08  ? 319  THR F O     1 
ATOM   2509 C  CB    . THR A 1 320 ? 112.309 7.275   166.942 1.00 36.20  ? 319  THR F CB    1 
ATOM   2510 O  OG1   . THR A 1 320 ? 111.832 6.017   167.437 1.00 35.59  ? 319  THR F OG1   1 
ATOM   2511 C  CG2   . THR A 1 320 ? 111.253 7.839   166.027 1.00 32.90  ? 319  THR F CG2   1 
ATOM   2512 N  N     . TRP A 1 321 ? 114.959 8.954   167.106 1.00 32.22  ? 320  TRP F N     1 
ATOM   2513 C  CA    . TRP A 1 321 ? 115.690 10.215  167.058 1.00 34.84  ? 320  TRP F CA    1 
ATOM   2514 C  C     . TRP A 1 321 ? 116.765 10.177  165.986 1.00 40.64  ? 320  TRP F C     1 
ATOM   2515 O  O     . TRP A 1 321 ? 116.796 11.024  165.082 1.00 39.52  ? 320  TRP F O     1 
ATOM   2516 C  CB    . TRP A 1 321 ? 116.307 10.501  168.427 1.00 36.92  ? 320  TRP F CB    1 
ATOM   2517 C  CG    . TRP A 1 321 ? 117.107 11.767  168.531 1.00 34.65  ? 320  TRP F CG    1 
ATOM   2518 C  CD1   . TRP A 1 321 ? 118.426 11.937  168.222 1.00 36.32  ? 320  TRP F CD1   1 
ATOM   2519 C  CD2   . TRP A 1 321 ? 116.644 13.022  169.030 1.00 37.89  ? 320  TRP F CD2   1 
ATOM   2520 N  NE1   . TRP A 1 321 ? 118.806 13.228  168.487 1.00 37.06  ? 320  TRP F NE1   1 
ATOM   2521 C  CE2   . TRP A 1 321 ? 117.730 13.915  168.985 1.00 39.17  ? 320  TRP F CE2   1 
ATOM   2522 C  CE3   . TRP A 1 321 ? 115.406 13.481  169.505 1.00 33.69  ? 320  TRP F CE3   1 
ATOM   2523 C  CZ2   . TRP A 1 321 ? 117.620 15.247  169.384 1.00 40.26  ? 320  TRP F CZ2   1 
ATOM   2524 C  CZ3   . TRP A 1 321 ? 115.303 14.805  169.917 1.00 39.58  ? 320  TRP F CZ3   1 
ATOM   2525 C  CH2   . TRP A 1 321 ? 116.402 15.670  169.850 1.00 38.57  ? 320  TRP F CH2   1 
ATOM   2526 N  N     . ASP A 1 322 ? 117.664 9.198   166.076 1.00 40.56  ? 321  ASP F N     1 
ATOM   2527 C  CA    . ASP A 1 322 ? 118.742 9.099   165.098 1.00 42.57  ? 321  ASP F CA    1 
ATOM   2528 C  C     . ASP A 1 322 ? 118.193 8.980   163.682 1.00 41.79  ? 321  ASP F C     1 
ATOM   2529 O  O     . ASP A 1 322 ? 118.696 9.627   162.761 1.00 43.64  ? 321  ASP F O     1 
ATOM   2530 C  CB    . ASP A 1 322 ? 119.651 7.904   165.412 1.00 39.16  ? 321  ASP F CB    1 
ATOM   2531 C  CG    . ASP A 1 322 ? 120.480 8.121   166.652 1.00 47.43  ? 321  ASP F CG    1 
ATOM   2532 O  OD1   . ASP A 1 322 ? 120.658 9.293   167.034 1.00 49.56  ? 321  ASP F OD1   1 
ATOM   2533 O  OD2   . ASP A 1 322 ? 120.944 7.122   167.248 1.00 45.02  ? 321  ASP F OD2   1 
ATOM   2534 N  N     . GLU A 1 323 ? 117.141 8.187   163.491 1.00 43.90  ? 322  GLU F N     1 
ATOM   2535 C  CA    . GLU A 1 323 ? 116.803 7.771   162.131 1.00 53.09  ? 322  GLU F CA    1 
ATOM   2536 C  C     . GLU A 1 323 ? 115.873 8.730   161.399 1.00 50.29  ? 322  GLU F C     1 
ATOM   2537 O  O     . GLU A 1 323 ? 116.042 8.953   160.197 1.00 51.15  ? 322  GLU F O     1 
ATOM   2538 C  CB    . GLU A 1 323 ? 116.192 6.367   162.148 1.00 49.81  ? 322  GLU F CB    1 
ATOM   2539 C  CG    . GLU A 1 323 ? 117.234 5.291   162.459 1.00 63.20  ? 322  GLU F CG    1 
ATOM   2540 C  CD    . GLU A 1 323 ? 116.650 3.900   162.555 1.00 72.57  ? 322  GLU F CD    1 
ATOM   2541 O  OE1   . GLU A 1 323 ? 115.425 3.756   162.366 1.00 75.88  ? 322  GLU F OE1   1 
ATOM   2542 O  OE2   . GLU A 1 323 ? 117.422 2.952   162.821 1.00 69.98  ? 322  GLU F OE2   1 
ATOM   2543 N  N     . ARG A 1 324 ? 114.894 9.307   162.067 1.00 37.02  ? 323  ARG F N     1 
ATOM   2544 C  CA    . ARG A 1 324 ? 113.814 9.942   161.333 1.00 39.13  ? 323  ARG F CA    1 
ATOM   2545 C  C     . ARG A 1 324 ? 113.592 11.366  161.812 1.00 49.51  ? 323  ARG F C     1 
ATOM   2546 O  O     . ARG A 1 324 ? 112.464 11.851  161.868 1.00 78.46  ? 323  ARG F O     1 
ATOM   2547 C  CB    . ARG A 1 324 ? 112.544 9.091   161.442 1.00 46.02  ? 323  ARG F CB    1 
ATOM   2548 C  CG    . ARG A 1 324 ? 111.804 8.944   160.119 1.00 54.85  ? 323  ARG F CG    1 
ATOM   2549 C  CD    . ARG A 1 324 ? 110.547 8.106   160.285 1.00 59.39  ? 323  ARG F CD    1 
ATOM   2550 N  NE    . ARG A 1 324 ? 109.486 8.521   159.374 1.00 65.74  ? 323  ARG F NE    1 
ATOM   2551 C  CZ    . ARG A 1 324 ? 108.775 9.639   159.506 1.00 75.85  ? 323  ARG F CZ    1 
ATOM   2552 N  NH1   . ARG A 1 324 ? 109.005 10.470  160.513 1.00 83.22  ? 323  ARG F NH1   1 
ATOM   2553 N  NH2   . ARG A 1 324 ? 107.832 9.935   158.621 1.00 83.51  ? 323  ARG F NH2   1 
ATOM   2554 N  N     . ARG A 1 325 ? 114.671 12.056  162.146 1.00 55.66  ? 324  ARG F N     1 
ATOM   2555 C  CA    . ARG A 1 325 ? 114.595 13.398  162.702 1.00 56.59  ? 324  ARG F CA    1 
ATOM   2556 C  C     . ARG A 1 325 ? 115.227 14.481  161.833 1.00 54.82  ? 324  ARG F C     1 
ATOM   2557 O  O     . ARG A 1 325 ? 114.742 15.619  161.842 1.00 50.84  ? 324  ARG F O     1 
ATOM   2558 C  CB    . ARG A 1 325 ? 115.259 13.418  164.067 1.00 42.59  ? 324  ARG F CB    1 
ATOM   2559 C  CG    . ARG A 1 325 ? 115.290 14.769  164.704 1.00 49.13  ? 324  ARG F CG    1 
ATOM   2560 C  CD    . ARG A 1 325 ? 115.949 14.690  166.055 1.00 57.67  ? 324  ARG F CD    1 
ATOM   2561 N  NE    . ARG A 1 325 ? 117.069 15.621  166.156 1.00 58.94  ? 324  ARG F NE    1 
ATOM   2562 C  CZ    . ARG A 1 325 ? 118.311 15.341  165.784 1.00 60.46  ? 324  ARG F CZ    1 
ATOM   2563 N  NH1   . ARG A 1 325 ? 118.612 14.142  165.274 1.00 56.88  ? 324  ARG F NH1   1 
ATOM   2564 N  NH2   . ARG A 1 325 ? 119.255 16.267  165.922 1.00 62.73  ? 324  ARG F NH2   1 
ATOM   2565 N  N     . GLY A 1 326 ? 116.305 14.172  161.117 1.00 52.86  ? 325  GLY F N     1 
ATOM   2566 C  CA    . GLY A 1 326 ? 116.864 15.067  160.119 1.00 53.50  ? 325  GLY F CA    1 
ATOM   2567 C  C     . GLY A 1 326 ? 117.147 16.489  160.572 1.00 53.97  ? 325  GLY F C     1 
ATOM   2568 O  O     . GLY A 1 326 ? 116.778 17.450  159.891 1.00 56.35  ? 325  GLY F O     1 
ATOM   2569 N  N     . GLY A 1 327 ? 117.814 16.635  161.707 1.00 45.43  ? 326  GLY F N     1 
ATOM   2570 C  CA    . GLY A 1 327 ? 118.177 17.945  162.211 1.00 56.47  ? 326  GLY F CA    1 
ATOM   2571 C  C     . GLY A 1 327 ? 117.046 18.891  162.571 1.00 55.28  ? 326  GLY F C     1 
ATOM   2572 O  O     . GLY A 1 327 ? 117.305 20.070  162.836 1.00 52.49  ? 326  GLY F O     1 
ATOM   2573 N  N     . ARG A 1 328 ? 115.800 18.413  162.601 1.00 56.70  ? 327  ARG F N     1 
ATOM   2574 C  CA    . ARG A 1 328 ? 114.699 19.277  163.003 1.00 42.79  ? 327  ARG F CA    1 
ATOM   2575 C  C     . ARG A 1 328 ? 114.635 19.398  164.520 1.00 45.14  ? 327  ARG F C     1 
ATOM   2576 O  O     . ARG A 1 328 ? 115.097 18.528  165.261 1.00 43.60  ? 327  ARG F O     1 
ATOM   2577 C  CB    . ARG A 1 328 ? 113.362 18.752  162.495 1.00 43.55  ? 327  ARG F CB    1 
ATOM   2578 C  CG    . ARG A 1 328 ? 113.107 18.956  161.025 1.00 51.46  ? 327  ARG F CG    1 
ATOM   2579 C  CD    . ARG A 1 328 ? 111.830 18.235  160.642 1.00 50.51  ? 327  ARG F CD    1 
ATOM   2580 N  NE    . ARG A 1 328 ? 112.014 16.785  160.718 1.00 57.50  ? 327  ARG F NE    1 
ATOM   2581 C  CZ    . ARG A 1 328 ? 111.054 15.890  160.506 1.00 48.50  ? 327  ARG F CZ    1 
ATOM   2582 N  NH1   . ARG A 1 328 ? 109.811 16.284  160.217 1.00 44.19  ? 327  ARG F NH1   1 
ATOM   2583 N  NH2   . ARG A 1 328 ? 111.337 14.597  160.595 1.00 37.77  ? 327  ARG F NH2   1 
ATOM   2584 N  N     . GLY A 1 329 ? 114.051 20.499  164.983 1.00 45.42  ? 328  GLY F N     1 
ATOM   2585 C  CA    . GLY A 1 329 ? 113.673 20.580  166.381 1.00 42.36  ? 328  GLY F CA    1 
ATOM   2586 C  C     . GLY A 1 329 ? 112.568 19.593  166.714 1.00 35.80  ? 328  GLY F C     1 
ATOM   2587 O  O     . GLY A 1 329 ? 111.745 19.226  165.876 1.00 38.59  ? 328  GLY F O     1 
ATOM   2588 N  N     . VAL A 1 330 ? 112.551 19.154  167.964 1.00 35.20  ? 329  VAL F N     1 
ATOM   2589 C  CA    . VAL A 1 330 ? 111.497 18.281  168.460 1.00 30.78  ? 329  VAL F CA    1 
ATOM   2590 C  C     . VAL A 1 330 ? 110.669 19.080  169.454 1.00 37.81  ? 329  VAL F C     1 
ATOM   2591 O  O     . VAL A 1 330 ? 111.202 19.597  170.448 1.00 32.35  ? 329  VAL F O     1 
ATOM   2592 C  CB    . VAL A 1 330 ? 112.076 17.013  169.104 1.00 30.33  ? 329  VAL F CB    1 
ATOM   2593 C  CG1   . VAL A 1 330 ? 111.008 16.300  169.917 1.00 28.57  ? 329  VAL F CG1   1 
ATOM   2594 C  CG2   . VAL A 1 330 ? 112.650 16.099  168.024 1.00 39.08  ? 329  VAL F CG2   1 
ATOM   2595 N  N     . ARG A 1 331 ? 109.363 19.174  169.197 1.00 34.78  ? 330  ARG F N     1 
ATOM   2596 C  CA    . ARG A 1 331 ? 108.484 19.862  170.126 1.00 39.19  ? 330  ARG F CA    1 
ATOM   2597 C  C     . ARG A 1 331 ? 107.808 18.917  171.110 1.00 33.89  ? 330  ARG F C     1 
ATOM   2598 O  O     . ARG A 1 331 ? 107.399 19.371  172.187 1.00 36.20  ? 330  ARG F O     1 
ATOM   2599 C  CB    . ARG A 1 331 ? 107.421 20.678  169.366 1.00 33.46  ? 330  ARG F CB    1 
ATOM   2600 C  CG    . ARG A 1 331 ? 106.526 19.861  168.464 1.00 37.13  ? 330  ARG F CG    1 
ATOM   2601 C  CD    . ARG A 1 331 ? 105.489 20.714  167.747 1.00 34.46  ? 330  ARG F CD    1 
ATOM   2602 N  NE    . ARG A 1 331 ? 104.515 21.340  168.641 1.00 36.50  ? 330  ARG F NE    1 
ATOM   2603 C  CZ    . ARG A 1 331 ? 104.449 22.650  168.891 1.00 42.26  ? 330  ARG F CZ    1 
ATOM   2604 N  NH1   . ARG A 1 331 ? 103.509 23.126  169.696 1.00 38.27  ? 330  ARG F NH1   1 
ATOM   2605 N  NH2   . ARG A 1 331 ? 105.312 23.493  168.337 1.00 41.49  ? 330  ARG F NH2   1 
ATOM   2606 N  N     . LEU A 1 332 ? 107.719 17.618  170.803 1.00 30.14  ? 331  LEU F N     1 
ATOM   2607 C  CA    . LEU A 1 332 ? 106.995 16.698  171.682 1.00 30.02  ? 331  LEU F CA    1 
ATOM   2608 C  C     . LEU A 1 332 ? 107.680 15.344  171.771 1.00 30.36  ? 331  LEU F C     1 
ATOM   2609 O  O     . LEU A 1 332 ? 108.113 14.791  170.760 1.00 29.34  ? 331  LEU F O     1 
ATOM   2610 C  CB    . LEU A 1 332 ? 105.560 16.471  171.202 1.00 30.04  ? 331  LEU F CB    1 
ATOM   2611 C  CG    . LEU A 1 332 ? 104.682 15.393  171.869 1.00 33.85  ? 331  LEU F CG    1 
ATOM   2612 C  CD1   . LEU A 1 332 ? 103.217 15.806  171.724 1.00 33.42  ? 331  LEU F CD1   1 
ATOM   2613 C  CD2   . LEU A 1 332 ? 104.900 13.976  171.284 1.00 26.71  ? 331  LEU F CD2   1 
ATOM   2614 N  N     . VAL A 1 333 ? 107.693 14.784  172.980 1.00 26.32  ? 332  VAL F N     1 
ATOM   2615 C  CA    . VAL A 1 333 ? 108.108 13.410  173.210 1.00 31.44  ? 332  VAL F CA    1 
ATOM   2616 C  C     . VAL A 1 333 ? 106.976 12.725  173.955 1.00 29.06  ? 332  VAL F C     1 
ATOM   2617 O  O     . VAL A 1 333 ? 106.411 13.296  174.897 1.00 30.34  ? 332  VAL F O     1 
ATOM   2618 C  CB    . VAL A 1 333 ? 109.422 13.310  174.020 1.00 30.01  ? 332  VAL F CB    1 
ATOM   2619 C  CG1   . VAL A 1 333 ? 109.849 11.832  174.166 1.00 27.59  ? 332  VAL F CG1   1 
ATOM   2620 C  CG2   . VAL A 1 333 ? 110.560 14.144  173.380 1.00 30.31  ? 332  VAL F CG2   1 
ATOM   2621 N  N     . GLY A 1 334 ? 106.640 11.515  173.542 1.00 24.29  ? 333  GLY F N     1 
ATOM   2622 C  CA    . GLY A 1 334 ? 105.626 10.750  174.247 1.00 21.69  ? 333  GLY F CA    1 
ATOM   2623 C  C     . GLY A 1 334 ? 106.013 9.296   174.394 1.00 26.54  ? 333  GLY F C     1 
ATOM   2624 O  O     . GLY A 1 334 ? 106.819 8.763   173.629 1.00 27.23  ? 333  GLY F O     1 
ATOM   2625 N  N     . LEU A 1 335 ? 105.436 8.663   175.415 1.00 26.36  ? 334  LEU F N     1 
ATOM   2626 C  CA    . LEU A 1 335 ? 105.537 7.230   175.650 1.00 25.22  ? 334  LEU F CA    1 
ATOM   2627 C  C     . LEU A 1 335 ? 104.158 6.604   175.494 1.00 31.41  ? 334  LEU F C     1 
ATOM   2628 O  O     . LEU A 1 335 ? 103.131 7.248   175.745 1.00 28.07  ? 334  LEU F O     1 
ATOM   2629 C  CB    . LEU A 1 335 ? 106.091 6.921   177.054 1.00 26.39  ? 334  LEU F CB    1 
ATOM   2630 C  CG    . LEU A 1 335 ? 107.432 7.578   177.414 1.00 25.91  ? 334  LEU F CG    1 
ATOM   2631 C  CD1   . LEU A 1 335 ? 107.868 7.177   178.825 1.00 30.25  ? 334  LEU F CD1   1 
ATOM   2632 C  CD2   . LEU A 1 335 ? 108.535 7.246   176.406 1.00 24.51  ? 334  LEU F CD2   1 
ATOM   2633 N  N     . HIS A 1 336 ? 104.130 5.337   175.083 1.00 31.41  ? 335  HIS F N     1 
ATOM   2634 C  CA    . HIS A 1 336 ? 102.849 4.706   174.787 1.00 26.65  ? 335  HIS F CA    1 
ATOM   2635 C  C     . HIS A 1 336 ? 102.866 3.245   175.202 1.00 33.26  ? 335  HIS F C     1 
ATOM   2636 O  O     . HIS A 1 336 ? 103.891 2.581   175.125 1.00 26.94  ? 335  HIS F O     1 
ATOM   2637 C  CB    . HIS A 1 336 ? 102.522 4.817   173.297 1.00 24.55  ? 335  HIS F CB    1 
ATOM   2638 C  CG    . HIS A 1 336 ? 101.102 4.487   172.968 1.00 28.38  ? 335  HIS F CG    1 
ATOM   2639 N  ND1   . HIS A 1 336 ? 100.721 3.256   172.485 1.00 36.48  ? 335  HIS F ND1   1 
ATOM   2640 C  CD2   . HIS A 1 336 ? 99.969  5.231   173.044 1.00 35.15  ? 335  HIS F CD2   1 
ATOM   2641 C  CE1   . HIS A 1 336 ? 99.413  3.247   172.287 1.00 38.24  ? 335  HIS F CE1   1 
ATOM   2642 N  NE2   . HIS A 1 336 ? 98.934  4.437   172.609 1.00 30.14  ? 335  HIS F NE2   1 
ATOM   2643 N  N     . VAL A 1 337 ? 101.712 2.748   175.634 1.00 27.99  ? 336  VAL F N     1 
ATOM   2644 C  CA    . VAL A 1 337 ? 101.541 1.338   175.935 1.00 34.38  ? 336  VAL F CA    1 
ATOM   2645 C  C     . VAL A 1 337 ? 100.229 0.871   175.317 1.00 33.82  ? 336  VAL F C     1 
ATOM   2646 O  O     . VAL A 1 337 ? 99.224  1.585   175.363 1.00 29.13  ? 336  VAL F O     1 
ATOM   2647 C  CB    . VAL A 1 337 ? 101.573 1.126   177.464 1.00 41.01  ? 336  VAL F CB    1 
ATOM   2648 C  CG1   . VAL A 1 337 ? 100.692 0.003   177.886 1.00 52.71  ? 336  VAL F CG1   1 
ATOM   2649 C  CG2   . VAL A 1 337 ? 103.019 0.967   177.927 1.00 28.04  ? 336  VAL F CG2   1 
ATOM   2650 N  N     . THR A 1 338 ? 100.231 -0.333  174.748 1.00 26.98  ? 337  THR F N     1 
ATOM   2651 C  CA    . THR A 1 338 ? 98.999  -1.005  174.341 1.00 27.18  ? 337  THR F CA    1 
ATOM   2652 C  C     . THR A 1 338 ? 98.680  -2.099  175.354 1.00 33.87  ? 337  THR F C     1 
ATOM   2653 O  O     . THR A 1 338 ? 99.527  -2.950  175.654 1.00 30.76  ? 337  THR F O     1 
ATOM   2654 C  CB    . THR A 1 338 ? 99.113  -1.616  172.947 1.00 32.00  ? 337  THR F CB    1 
ATOM   2655 O  OG1   . THR A 1 338 ? 99.550  -0.625  172.017 1.00 35.80  ? 337  THR F OG1   1 
ATOM   2656 C  CG2   . THR A 1 338 ? 97.779  -2.199  172.489 1.00 27.58  ? 337  THR F CG2   1 
ATOM   2657 N  N     . LEU A 1 339 ? 97.465  -2.069  175.887 1.00 29.29  ? 338  LEU F N     1 
ATOM   2658 C  CA    . LEU A 1 339 ? 97.085  -2.993  176.943 1.00 29.59  ? 338  LEU F CA    1 
ATOM   2659 C  C     . LEU A 1 339 ? 96.736  -4.357  176.364 1.00 32.52  ? 338  LEU F C     1 
ATOM   2660 O  O     . LEU A 1 339 ? 96.248  -4.465  175.239 1.00 38.30  ? 338  LEU F O     1 
ATOM   2661 C  CB    . LEU A 1 339 ? 95.885  -2.450  177.734 1.00 27.60  ? 338  LEU F CB    1 
ATOM   2662 C  CG    . LEU A 1 339 ? 96.112  -1.136  178.479 1.00 29.65  ? 338  LEU F CG    1 
ATOM   2663 C  CD1   . LEU A 1 339 ? 94.844  -0.695  179.200 1.00 37.52  ? 338  LEU F CD1   1 
ATOM   2664 C  CD2   . LEU A 1 339 ? 97.299  -1.242  179.448 1.00 28.33  ? 338  LEU F CD2   1 
ATOM   2665 N  N     . LEU A 1 340 ? 96.995  -5.402  177.150 1.00 33.92  ? 339  LEU F N     1 
ATOM   2666 C  CA    . LEU A 1 340 ? 96.562  -6.747  176.788 1.00 42.82  ? 339  LEU F CA    1 
ATOM   2667 C  C     . LEU A 1 340 ? 95.049  -6.796  176.589 1.00 46.95  ? 339  LEU F C     1 
ATOM   2668 O  O     . LEU A 1 340 ? 94.292  -6.068  177.233 1.00 46.11  ? 339  LEU F O     1 
ATOM   2669 C  CB    . LEU A 1 340 ? 96.970  -7.747  177.872 1.00 40.37  ? 339  LEU F CB    1 
ATOM   2670 C  CG    . LEU A 1 340 ? 98.458  -8.010  178.111 1.00 40.15  ? 339  LEU F CG    1 
ATOM   2671 C  CD1   . LEU A 1 340 ? 98.645  -8.736  179.438 1.00 47.60  ? 339  LEU F CD1   1 
ATOM   2672 C  CD2   . LEU A 1 340 ? 99.051  -8.832  176.973 1.00 42.37  ? 339  LEU F CD2   1 
ATOM   2673 N  N     . ASP A 1 341 ? 94.605  -7.718  175.733 1.00 48.02  ? 340  ASP F N     1 
ATOM   2674 C  CA    . ASP A 1 341 ? 93.206  -7.796  175.313 1.00 50.51  ? 340  ASP F CA    1 
ATOM   2675 C  C     . ASP A 1 341 ? 92.178  -8.247  176.356 1.00 66.44  ? 340  ASP F C     1 
ATOM   2676 O  O     . ASP A 1 341 ? 91.001  -8.374  175.996 1.00 80.07  ? 340  ASP F O     1 
ATOM   2677 C  CB    . ASP A 1 341 ? 93.085  -8.729  174.105 1.00 52.75  ? 340  ASP F CB    1 
ATOM   2678 C  CG    . ASP A 1 341 ? 93.567  -8.083  172.818 1.00 70.73  ? 340  ASP F CG    1 
ATOM   2679 O  OD1   . ASP A 1 341 ? 94.148  -6.978  172.882 1.00 81.51  ? 340  ASP F OD1   1 
ATOM   2680 O  OD2   . ASP A 1 341 ? 93.371  -8.681  171.736 1.00 77.38  ? 340  ASP F OD2   1 
ATOM   2681 N  N     . PRO A 1 342 ? 92.539  -8.537  177.628 1.00 67.93  ? 341  PRO F N     1 
ATOM   2682 C  CA    . PRO A 1 342 ? 91.390  -8.700  178.534 1.00 73.11  ? 341  PRO F CA    1 
ATOM   2683 C  C     . PRO A 1 342 ? 90.506  -7.465  178.657 1.00 72.71  ? 341  PRO F C     1 
ATOM   2684 O  O     . PRO A 1 342 ? 89.294  -7.633  178.512 1.00 72.65  ? 341  PRO F O     1 
ATOM   2685 C  CB    . PRO A 1 342 ? 92.042  -9.017  179.894 1.00 75.23  ? 341  PRO F CB    1 
ATOM   2686 C  CG    . PRO A 1 342 ? 93.541  -9.052  179.645 1.00 76.13  ? 341  PRO F CG    1 
ATOM   2687 C  CD    . PRO A 1 342 ? 93.716  -9.231  178.173 1.00 73.10  ? 341  PRO F CD    1 
ATOM   2688 N  N     . GLY B 1 1   ? 119.486 6.580   94.333  1.00 88.90  ? 0    GLY A N     1 
ATOM   2689 C  CA    . GLY B 1 1   ? 118.890 5.545   95.160  1.00 92.24  ? 0    GLY A CA    1 
ATOM   2690 C  C     . GLY B 1 1   ? 118.940 5.796   96.662  1.00 97.12  ? 0    GLY A C     1 
ATOM   2691 O  O     . GLY B 1 1   ? 119.122 4.856   97.440  1.00 103.92 ? 0    GLY A O     1 
ATOM   2692 N  N     . SER B 1 2   ? 118.775 7.055   97.075  1.00 92.65  ? 1    SER A N     1 
ATOM   2693 C  CA    . SER B 1 2   ? 118.755 7.439   98.483  1.00 81.25  ? 1    SER A CA    1 
ATOM   2694 C  C     . SER B 1 2   ? 117.350 7.902   98.882  1.00 80.11  ? 1    SER A C     1 
ATOM   2695 O  O     . SER B 1 2   ? 116.404 7.868   98.086  1.00 85.10  ? 1    SER A O     1 
ATOM   2696 C  CB    . SER B 1 2   ? 119.807 8.517   98.767  1.00 79.42  ? 1    SER A CB    1 
ATOM   2697 O  OG    . SER B 1 2   ? 119.551 9.717   98.056  1.00 80.60  ? 1    SER A OG    1 
ATOM   2698 N  N     . ARG B 1 3   ? 117.217 8.344   100.133 1.00 55.32  ? 2    ARG A N     1 
ATOM   2699 C  CA    . ARG B 1 3   ? 115.907 8.589   100.720 1.00 43.46  ? 2    ARG A CA    1 
ATOM   2700 C  C     . ARG B 1 3   ? 115.432 10.025  100.499 1.00 51.31  ? 2    ARG A C     1 
ATOM   2701 O  O     . ARG B 1 3   ? 116.222 10.942  100.254 1.00 47.41  ? 2    ARG A O     1 
ATOM   2702 C  CB    . ARG B 1 3   ? 115.928 8.286   102.221 1.00 47.02  ? 2    ARG A CB    1 
ATOM   2703 C  CG    . ARG B 1 3   ? 115.679 6.822   102.552 1.00 62.08  ? 2    ARG A CG    1 
ATOM   2704 C  CD    . ARG B 1 3   ? 115.710 6.608   104.044 1.00 57.64  ? 2    ARG A CD    1 
ATOM   2705 N  NE    . ARG B 1 3   ? 116.975 7.068   104.606 1.00 55.94  ? 2    ARG A NE    1 
ATOM   2706 C  CZ    . ARG B 1 3   ? 117.133 7.492   105.858 1.00 49.01  ? 2    ARG A CZ    1 
ATOM   2707 N  NH1   . ARG B 1 3   ? 116.105 7.519   106.698 1.00 44.16  ? 2    ARG A NH1   1 
ATOM   2708 N  NH2   . ARG B 1 3   ? 118.328 7.884   106.270 1.00 41.40  ? 2    ARG A NH2   1 
ATOM   2709 N  N     . LYS B 1 4   ? 114.115 10.215  100.610 1.00 40.87  ? 3    LYS A N     1 
ATOM   2710 C  CA    . LYS B 1 4   ? 113.511 11.547  100.618 1.00 37.87  ? 3    LYS A CA    1 
ATOM   2711 C  C     . LYS B 1 4   ? 112.729 11.743  101.915 1.00 39.66  ? 3    LYS A C     1 
ATOM   2712 O  O     . LYS B 1 4   ? 111.662 11.147  102.099 1.00 37.49  ? 3    LYS A O     1 
ATOM   2713 C  CB    . LYS B 1 4   ? 112.623 11.748  99.395  1.00 50.63  ? 3    LYS A CB    1 
ATOM   2714 C  CG    . LYS B 1 4   ? 113.444 12.088  98.164  1.00 56.56  ? 3    LYS A CG    1 
ATOM   2715 C  CD    . LYS B 1 4   ? 113.103 11.201  96.996  1.00 72.89  ? 3    LYS A CD    1 
ATOM   2716 C  CE    . LYS B 1 4   ? 111.833 11.664  96.323  1.00 75.85  ? 3    LYS A CE    1 
ATOM   2717 N  NZ    . LYS B 1 4   ? 111.574 10.947  95.037  1.00 70.98  ? 3    LYS A NZ    1 
ATOM   2718 N  N     . ILE B 1 5   ? 113.252 12.592  102.801 1.00 37.15  ? 4    ILE A N     1 
ATOM   2719 C  CA    . ILE B 1 5   ? 112.670 12.841  104.118 1.00 35.24  ? 4    ILE A CA    1 
ATOM   2720 C  C     . ILE B 1 5   ? 112.138 14.270  104.161 1.00 38.98  ? 4    ILE A C     1 
ATOM   2721 O  O     . ILE B 1 5   ? 112.832 15.222  103.765 1.00 37.87  ? 4    ILE A O     1 
ATOM   2722 C  CB    . ILE B 1 5   ? 113.693 12.607  105.246 1.00 40.28  ? 4    ILE A CB    1 
ATOM   2723 C  CG1   . ILE B 1 5   ? 114.341 11.217  105.138 1.00 35.43  ? 4    ILE A CG1   1 
ATOM   2724 C  CG2   . ILE B 1 5   ? 113.044 12.800  106.630 1.00 36.55  ? 4    ILE A CG2   1 
ATOM   2725 C  CD1   . ILE B 1 5   ? 113.349 10.028  105.036 1.00 35.44  ? 4    ILE A CD1   1 
ATOM   2726 N  N     . ILE B 1 6   ? 110.912 14.423  104.649 1.00 39.13  ? 5    ILE A N     1 
ATOM   2727 C  CA    . ILE B 1 6   ? 110.318 15.731  104.902 1.00 34.88  ? 5    ILE A CA    1 
ATOM   2728 C  C     . ILE B 1 6   ? 110.091 15.863  106.398 1.00 36.25  ? 5    ILE A C     1 
ATOM   2729 O  O     . ILE B 1 6   ? 109.588 14.929  107.039 1.00 37.39  ? 5    ILE A O     1 
ATOM   2730 C  CB    . ILE B 1 6   ? 108.994 15.915  104.146 1.00 36.24  ? 5    ILE A CB    1 
ATOM   2731 C  CG1   . ILE B 1 6   ? 109.211 15.777  102.639 1.00 49.70  ? 5    ILE A CG1   1 
ATOM   2732 C  CG2   . ILE B 1 6   ? 108.373 17.261  104.484 1.00 34.58  ? 5    ILE A CG2   1 
ATOM   2733 C  CD1   . ILE B 1 6   ? 107.924 15.874  101.830 1.00 46.74  ? 5    ILE A CD1   1 
ATOM   2734 N  N     . HIS B 1 7   ? 110.480 17.007  106.953 1.00 34.31  ? 6    HIS A N     1 
ATOM   2735 C  CA    . HIS B 1 7   ? 110.128 17.410  108.311 1.00 30.94  ? 6    HIS A CA    1 
ATOM   2736 C  C     . HIS B 1 7   ? 109.169 18.586  108.201 1.00 35.05  ? 6    HIS A C     1 
ATOM   2737 O  O     . HIS B 1 7   ? 109.492 19.585  107.551 1.00 32.55  ? 6    HIS A O     1 
ATOM   2738 C  CB    . HIS B 1 7   ? 111.368 17.804  109.115 1.00 38.91  ? 6    HIS A CB    1 
ATOM   2739 C  CG    . HIS B 1 7   ? 111.061 18.228  110.516 1.00 38.52  ? 6    HIS A CG    1 
ATOM   2740 N  ND1   . HIS B 1 7   ? 110.801 17.325  111.529 1.00 36.68  ? 6    HIS A ND1   1 
ATOM   2741 C  CD2   . HIS B 1 7   ? 110.945 19.459  111.067 1.00 32.65  ? 6    HIS A CD2   1 
ATOM   2742 C  CE1   . HIS B 1 7   ? 110.556 17.987  112.648 1.00 28.30  ? 6    HIS A CE1   1 
ATOM   2743 N  NE2   . HIS B 1 7   ? 110.633 19.281  112.393 1.00 40.52  ? 6    HIS A NE2   1 
ATOM   2744 N  N     . VAL B 1 8   ? 107.983 18.451  108.788 1.00 34.12  ? 7    VAL A N     1 
ATOM   2745 C  CA    . VAL B 1 8   ? 106.953 19.486  108.753 1.00 32.91  ? 7    VAL A CA    1 
ATOM   2746 C  C     . VAL B 1 8   ? 106.798 20.013  110.168 1.00 38.74  ? 7    VAL A C     1 
ATOM   2747 O  O     . VAL B 1 8   ? 106.649 19.228  111.108 1.00 39.03  ? 7    VAL A O     1 
ATOM   2748 C  CB    . VAL B 1 8   ? 105.610 18.956  108.230 1.00 40.45  ? 7    VAL A CB    1 
ATOM   2749 C  CG1   . VAL B 1 8   ? 104.570 20.079  108.217 1.00 34.25  ? 7    VAL A CG1   1 
ATOM   2750 C  CG2   . VAL B 1 8   ? 105.773 18.348  106.841 1.00 39.96  ? 7    VAL A CG2   1 
ATOM   2751 N  N     . ASP B 1 9   ? 106.825 21.334  110.319 1.00 38.01  ? 8    ASP A N     1 
ATOM   2752 C  CA    . ASP B 1 9   ? 106.844 21.966  111.637 1.00 36.86  ? 8    ASP A CA    1 
ATOM   2753 C  C     . ASP B 1 9   ? 105.887 23.150  111.613 1.00 37.73  ? 8    ASP A C     1 
ATOM   2754 O  O     . ASP B 1 9   ? 106.041 24.039  110.777 1.00 33.32  ? 8    ASP A O     1 
ATOM   2755 C  CB    . ASP B 1 9   ? 108.268 22.421  111.985 1.00 45.87  ? 8    ASP A CB    1 
ATOM   2756 C  CG    . ASP B 1 9   ? 108.390 22.976  113.403 1.00 55.50  ? 8    ASP A CG    1 
ATOM   2757 O  OD1   . ASP B 1 9   ? 107.938 24.108  113.657 1.00 57.97  ? 8    ASP A OD1   1 
ATOM   2758 O  OD2   . ASP B 1 9   ? 108.970 22.287  114.258 1.00 65.94  ? 8    ASP A OD2   1 
ATOM   2759 N  N     . MET B 1 10  ? 104.895 23.170  112.501 1.00 36.67  ? 9    MET A N     1 
ATOM   2760 C  CA    . MET B 1 10  ? 103.969 24.297  112.505 1.00 37.09  ? 9    MET A CA    1 
ATOM   2761 C  C     . MET B 1 10  ? 104.670 25.560  113.012 1.00 31.35  ? 9    MET A C     1 
ATOM   2762 O  O     . MET B 1 10  ? 105.524 25.505  113.891 1.00 33.48  ? 9    MET A O     1 
ATOM   2763 C  CB    . MET B 1 10  ? 102.750 23.999  113.378 1.00 37.66  ? 9    MET A CB    1 
ATOM   2764 C  CG    . MET B 1 10  ? 101.962 22.766  112.977 1.00 39.30  ? 9    MET A CG    1 
ATOM   2765 S  SD    . MET B 1 10  ? 101.259 22.974  111.339 1.00 41.57  ? 9    MET A SD    1 
ATOM   2766 C  CE    . MET B 1 10  ? 100.163 24.358  111.642 1.00 47.41  ? 9    MET A CE    1 
ATOM   2767 N  N     . ASP B 1 11  ? 104.289 26.713  112.457 1.00 36.61  ? 10   ASP A N     1 
ATOM   2768 C  CA    . ASP B 1 11  ? 104.861 27.987  112.892 1.00 31.66  ? 10   ASP A CA    1 
ATOM   2769 C  C     . ASP B 1 11  ? 104.147 28.499  114.144 1.00 30.43  ? 10   ASP A C     1 
ATOM   2770 O  O     . ASP B 1 11  ? 102.914 28.570  114.170 1.00 31.68  ? 10   ASP A O     1 
ATOM   2771 C  CB    . ASP B 1 11  ? 104.768 29.044  111.782 1.00 30.59  ? 10   ASP A CB    1 
ATOM   2772 C  CG    . ASP B 1 11  ? 105.398 28.590  110.473 1.00 38.77  ? 10   ASP A CG    1 
ATOM   2773 O  OD1   . ASP B 1 11  ? 106.543 28.101  110.502 1.00 34.75  ? 10   ASP A OD1   1 
ATOM   2774 O  OD2   . ASP B 1 11  ? 104.749 28.729  109.408 1.00 35.20  ? 10   ASP A OD2   1 
ATOM   2775 N  N     . CYS B 1 12  ? 104.931 28.853  115.168 1.00 37.41  ? 11   CYS A N     1 
ATOM   2776 C  CA    . CYS B 1 12  ? 104.466 29.422  116.446 1.00 35.73  ? 11   CYS A CA    1 
ATOM   2777 C  C     . CYS B 1 12  ? 103.185 28.755  116.940 1.00 32.00  ? 11   CYS A C     1 
ATOM   2778 O  O     . CYS B 1 12  ? 102.186 29.408  117.241 1.00 36.36  ? 11   CYS A O     1 
ATOM   2779 C  CB    . CYS B 1 12  ? 104.267 30.929  116.328 1.00 44.58  ? 11   CYS A CB    1 
ATOM   2780 S  SG    . CYS B 1 12  ? 105.763 31.816  115.913 1.00 49.12  ? 11   CYS A SG    1 
ATOM   2781 N  N     . PHE B 1 13  ? 103.258 27.428  117.063 1.00 38.40  ? 12   PHE A N     1 
ATOM   2782 C  CA    . PHE B 1 13  ? 102.062 26.589  117.008 1.00 35.66  ? 12   PHE A CA    1 
ATOM   2783 C  C     . PHE B 1 13  ? 100.957 27.080  117.941 1.00 33.87  ? 12   PHE A C     1 
ATOM   2784 O  O     . PHE B 1 13  ? 99.871  27.441  117.479 1.00 38.72  ? 12   PHE A O     1 
ATOM   2785 C  CB    . PHE B 1 13  ? 102.424 25.133  117.306 1.00 33.48  ? 12   PHE A CB    1 
ATOM   2786 C  CG    . PHE B 1 13  ? 101.258 24.203  117.218 1.00 38.31  ? 12   PHE A CG    1 
ATOM   2787 C  CD1   . PHE B 1 13  ? 100.355 24.304  116.165 1.00 38.64  ? 12   PHE A CD1   1 
ATOM   2788 C  CD2   . PHE B 1 13  ? 101.063 23.220  118.180 1.00 43.48  ? 12   PHE A CD2   1 
ATOM   2789 C  CE1   . PHE B 1 13  ? 99.266  23.446  116.077 1.00 47.62  ? 12   PHE A CE1   1 
ATOM   2790 C  CE2   . PHE B 1 13  ? 99.983  22.349  118.096 1.00 47.00  ? 12   PHE A CE2   1 
ATOM   2791 C  CZ    . PHE B 1 13  ? 99.085  22.462  117.042 1.00 49.67  ? 12   PHE A CZ    1 
ATOM   2792 N  N     . PHE B 1 14  ? 101.210 27.097  119.257 1.00 37.68  ? 13   PHE A N     1 
ATOM   2793 C  CA    . PHE B 1 14  ? 100.157 27.485  120.198 1.00 41.59  ? 13   PHE A CA    1 
ATOM   2794 C  C     . PHE B 1 14  ? 99.681  28.900  119.924 1.00 36.68  ? 13   PHE A C     1 
ATOM   2795 O  O     . PHE B 1 14  ? 98.479  29.174  119.952 1.00 39.17  ? 13   PHE A O     1 
ATOM   2796 C  CB    . PHE B 1 14  ? 100.625 27.394  121.657 1.00 32.67  ? 13   PHE A CB    1 
ATOM   2797 C  CG    . PHE B 1 14  ? 100.849 25.992  122.165 1.00 36.99  ? 13   PHE A CG    1 
ATOM   2798 C  CD1   . PHE B 1 14  ? 100.722 24.894  121.335 1.00 33.13  ? 13   PHE A CD1   1 
ATOM   2799 C  CD2   . PHE B 1 14  ? 101.173 25.783  123.496 1.00 36.93  ? 13   PHE A CD2   1 
ATOM   2800 C  CE1   . PHE B 1 14  ? 100.944 23.624  121.810 1.00 31.22  ? 13   PHE A CE1   1 
ATOM   2801 C  CE2   . PHE B 1 14  ? 101.383 24.516  123.990 1.00 35.90  ? 13   PHE A CE2   1 
ATOM   2802 C  CZ    . PHE B 1 14  ? 101.268 23.433  123.146 1.00 37.81  ? 13   PHE A CZ    1 
ATOM   2803 N  N     . ALA B 1 15  ? 100.614 29.822  119.677 1.00 42.43  ? 14   ALA A N     1 
ATOM   2804 C  CA    . ALA B 1 15  ? 100.228 31.210  119.436 1.00 45.79  ? 14   ALA A CA    1 
ATOM   2805 C  C     . ALA B 1 15  ? 99.509  31.374  118.102 1.00 50.36  ? 14   ALA A C     1 
ATOM   2806 O  O     . ALA B 1 15  ? 98.631  32.234  117.976 1.00 47.48  ? 14   ALA A O     1 
ATOM   2807 C  CB    . ALA B 1 15  ? 101.457 32.117  119.493 1.00 47.22  ? 14   ALA A CB    1 
ATOM   2808 N  N     . ALA B 1 16  ? 99.869  30.569  117.097 1.00 51.56  ? 15   ALA A N     1 
ATOM   2809 C  CA    . ALA B 1 16  ? 99.175  30.640  115.816 1.00 43.05  ? 15   ALA A CA    1 
ATOM   2810 C  C     . ALA B 1 16  ? 97.721  30.210  115.960 1.00 37.01  ? 15   ALA A C     1 
ATOM   2811 O  O     . ALA B 1 16  ? 96.827  30.824  115.368 1.00 46.30  ? 15   ALA A O     1 
ATOM   2812 C  CB    . ALA B 1 16  ? 99.899  29.784  114.771 1.00 39.26  ? 15   ALA A CB    1 
ATOM   2813 N  N     . VAL B 1 17  ? 97.464  29.154  116.738 1.00 42.06  ? 16   VAL A N     1 
ATOM   2814 C  CA    . VAL B 1 17  ? 96.086  28.720  116.962 1.00 47.17  ? 16   VAL A CA    1 
ATOM   2815 C  C     . VAL B 1 17  ? 95.299  29.822  117.653 1.00 57.62  ? 16   VAL A C     1 
ATOM   2816 O  O     . VAL B 1 17  ? 94.165  30.135  117.272 1.00 57.65  ? 16   VAL A O     1 
ATOM   2817 C  CB    . VAL B 1 17  ? 96.049  27.413  117.774 1.00 42.29  ? 16   VAL A CB    1 
ATOM   2818 C  CG1   . VAL B 1 17  ? 94.596  27.051  118.141 1.00 44.74  ? 16   VAL A CG1   1 
ATOM   2819 C  CG2   . VAL B 1 17  ? 96.724  26.277  116.999 1.00 38.54  ? 16   VAL A CG2   1 
ATOM   2820 N  N     . GLU B 1 18  ? 95.897  30.433  118.680 1.00 52.07  ? 17   GLU A N     1 
ATOM   2821 C  CA    . GLU B 1 18  ? 95.221  31.516  119.390 1.00 52.19  ? 17   GLU A CA    1 
ATOM   2822 C  C     . GLU B 1 18  ? 94.925  32.690  118.463 1.00 49.40  ? 17   GLU A C     1 
ATOM   2823 O  O     . GLU B 1 18  ? 93.819  33.241  118.486 1.00 52.19  ? 17   GLU A O     1 
ATOM   2824 C  CB    . GLU B 1 18  ? 96.062  31.964  120.582 1.00 54.05  ? 17   GLU A CB    1 
ATOM   2825 C  CG    . GLU B 1 18  ? 96.326  30.854  121.592 1.00 62.26  ? 17   GLU A CG    1 
ATOM   2826 C  CD    . GLU B 1 18  ? 95.072  30.426  122.346 1.00 69.85  ? 17   GLU A CD    1 
ATOM   2827 O  OE1   . GLU B 1 18  ? 94.078  31.183  122.335 1.00 70.41  ? 17   GLU A OE1   1 
ATOM   2828 O  OE2   . GLU B 1 18  ? 95.083  29.329  122.949 1.00 68.55  ? 17   GLU A OE2   1 
ATOM   2829 N  N     . MET B 1 19  ? 95.891  33.080  117.631 1.00 39.09  ? 18   MET A N     1 
ATOM   2830 C  CA    . MET B 1 19  ? 95.664  34.213  116.736 1.00 51.84  ? 18   MET A CA    1 
ATOM   2831 C  C     . MET B 1 19  ? 94.568  33.917  115.718 1.00 57.49  ? 18   MET A C     1 
ATOM   2832 O  O     . MET B 1 19  ? 93.809  34.817  115.336 1.00 49.48  ? 18   MET A O     1 
ATOM   2833 C  CB    . MET B 1 19  ? 96.950  34.581  116.014 1.00 52.62  ? 18   MET A CB    1 
ATOM   2834 C  CG    . MET B 1 19  ? 97.960  35.308  116.852 1.00 48.21  ? 18   MET A CG    1 
ATOM   2835 S  SD    . MET B 1 19  ? 99.487  35.285  115.912 1.00 60.47  ? 18   MET A SD    1 
ATOM   2836 C  CE    . MET B 1 19  ? 100.047 36.921  116.131 1.00 64.99  ? 18   MET A CE    1 
ATOM   2837 N  N     . ARG B 1 20  ? 94.478  32.667  115.257 1.00 58.87  ? 19   ARG A N     1 
ATOM   2838 C  CA    . ARG B 1 20  ? 93.433  32.300  114.305 1.00 63.01  ? 19   ARG A CA    1 
ATOM   2839 C  C     . ARG B 1 20  ? 92.051  32.444  114.927 1.00 62.31  ? 19   ARG A C     1 
ATOM   2840 O  O     . ARG B 1 20  ? 91.141  33.028  114.326 1.00 65.57  ? 19   ARG A O     1 
ATOM   2841 C  CB    . ARG B 1 20  ? 93.647  30.868  113.822 1.00 62.49  ? 19   ARG A CB    1 
ATOM   2842 C  CG    . ARG B 1 20  ? 92.495  30.304  113.016 1.00 50.79  ? 19   ARG A CG    1 
ATOM   2843 C  CD    . ARG B 1 20  ? 92.610  28.789  112.939 1.00 60.04  ? 19   ARG A CD    1 
ATOM   2844 N  NE    . ARG B 1 20  ? 92.254  28.143  114.200 1.00 52.22  ? 19   ARG A NE    1 
ATOM   2845 C  CZ    . ARG B 1 20  ? 92.375  26.838  114.433 1.00 52.90  ? 19   ARG A CZ    1 
ATOM   2846 N  NH1   . ARG B 1 20  ? 92.864  26.036  113.491 1.00 43.38  ? 19   ARG A NH1   1 
ATOM   2847 N  NH2   . ARG B 1 20  ? 92.017  26.334  115.613 1.00 47.91  ? 19   ARG A NH2   1 
ATOM   2848 N  N     . ASP B 1 21  ? 91.881  31.920  116.142 1.00 52.18  ? 20   ASP A N     1 
ATOM   2849 C  CA    . ASP B 1 21  ? 90.583  31.927  116.801 1.00 61.06  ? 20   ASP A CA    1 
ATOM   2850 C  C     . ASP B 1 21  ? 90.225  33.287  117.382 1.00 64.30  ? 20   ASP A C     1 
ATOM   2851 O  O     . ASP B 1 21  ? 89.045  33.541  117.649 1.00 73.79  ? 20   ASP A O     1 
ATOM   2852 C  CB    . ASP B 1 21  ? 90.561  30.853  117.891 1.00 54.24  ? 20   ASP A CB    1 
ATOM   2853 C  CG    . ASP B 1 21  ? 90.865  29.474  117.341 1.00 65.37  ? 20   ASP A CG    1 
ATOM   2854 O  OD1   . ASP B 1 21  ? 90.761  29.302  116.103 1.00 70.23  ? 20   ASP A OD1   1 
ATOM   2855 O  OD2   . ASP B 1 21  ? 91.204  28.567  118.137 1.00 64.30  ? 20   ASP A OD2   1 
ATOM   2856 N  N     . ASN B 1 22  ? 91.209  34.161  117.581 1.00 60.19  ? 21   ASN A N     1 
ATOM   2857 C  CA    . ASN B 1 22  ? 90.964  35.530  118.033 1.00 62.06  ? 21   ASN A CA    1 
ATOM   2858 C  C     . ASN B 1 22  ? 91.834  36.462  117.203 1.00 67.72  ? 21   ASN A C     1 
ATOM   2859 O  O     . ASN B 1 22  ? 92.994  36.723  117.546 1.00 65.54  ? 21   ASN A O     1 
ATOM   2860 C  CB    . ASN B 1 22  ? 91.258  35.685  119.524 1.00 58.41  ? 21   ASN A CB    1 
ATOM   2861 C  CG    . ASN B 1 22  ? 90.836  37.035  120.065 1.00 67.84  ? 21   ASN A CG    1 
ATOM   2862 O  OD1   . ASN B 1 22  ? 90.646  37.995  119.313 1.00 72.19  ? 21   ASN A OD1   1 
ATOM   2863 N  ND2   . ASN B 1 22  ? 90.685  37.116  121.379 1.00 72.81  ? 21   ASN A ND2   1 
ATOM   2864 N  N     . PRO B 1 23  ? 91.303  36.987  116.096 1.00 65.23  ? 22   PRO A N     1 
ATOM   2865 C  CA    . PRO B 1 23  ? 92.131  37.838  115.223 1.00 67.56  ? 22   PRO A CA    1 
ATOM   2866 C  C     . PRO B 1 23  ? 92.603  39.131  115.877 1.00 69.09  ? 22   PRO A C     1 
ATOM   2867 O  O     . PRO B 1 23  ? 93.552  39.744  115.374 1.00 64.54  ? 22   PRO A O     1 
ATOM   2868 C  CB    . PRO B 1 23  ? 91.214  38.114  114.019 1.00 69.50  ? 22   PRO A CB    1 
ATOM   2869 C  CG    . PRO B 1 23  ? 89.829  37.788  114.485 1.00 73.47  ? 22   PRO A CG    1 
ATOM   2870 C  CD    . PRO B 1 23  ? 89.977  36.712  115.518 1.00 68.87  ? 22   PRO A CD    1 
ATOM   2871 N  N     . ALA B 1 24  ? 91.991  39.568  116.981 1.00 73.60  ? 23   ALA A N     1 
ATOM   2872 C  CA    . ALA B 1 24  ? 92.469  40.773  117.652 1.00 69.54  ? 23   ALA A CA    1 
ATOM   2873 C  C     . ALA B 1 24  ? 93.881  40.619  118.213 1.00 75.36  ? 23   ALA A C     1 
ATOM   2874 O  O     . ALA B 1 24  ? 94.482  41.623  118.613 1.00 71.29  ? 23   ALA A O     1 
ATOM   2875 C  CB    . ALA B 1 24  ? 91.509  41.168  118.775 1.00 60.19  ? 23   ALA A CB    1 
ATOM   2876 N  N     . LEU B 1 25  ? 94.425  39.400  118.243 1.00 64.42  ? 24   LEU A N     1 
ATOM   2877 C  CA    . LEU B 1 25  ? 95.759  39.140  118.765 1.00 64.78  ? 24   LEU A CA    1 
ATOM   2878 C  C     . LEU B 1 25  ? 96.823  39.046  117.672 1.00 67.11  ? 24   LEU A C     1 
ATOM   2879 O  O     . LEU B 1 25  ? 97.968  38.686  117.967 1.00 65.84  ? 24   LEU A O     1 
ATOM   2880 C  CB    . LEU B 1 25  ? 95.751  37.850  119.590 1.00 56.77  ? 24   LEU A CB    1 
ATOM   2881 C  CG    . LEU B 1 25  ? 94.777  37.794  120.770 1.00 56.65  ? 24   LEU A CG    1 
ATOM   2882 C  CD1   . LEU B 1 25  ? 94.771  36.420  121.386 1.00 58.52  ? 24   LEU A CD1   1 
ATOM   2883 C  CD2   . LEU B 1 25  ? 95.123  38.838  121.821 1.00 51.80  ? 24   LEU A CD2   1 
ATOM   2884 N  N     . ARG B 1 26  ? 96.477  39.373  116.426 1.00 54.67  ? 25   ARG A N     1 
ATOM   2885 C  CA    . ARG B 1 26  ? 97.380  39.116  115.303 1.00 61.13  ? 25   ARG A CA    1 
ATOM   2886 C  C     . ARG B 1 26  ? 98.610  40.021  115.335 1.00 62.69  ? 25   ARG A C     1 
ATOM   2887 O  O     . ARG B 1 26  ? 99.724  39.573  115.036 1.00 54.07  ? 25   ARG A O     1 
ATOM   2888 C  CB    . ARG B 1 26  ? 96.624  39.284  113.979 1.00 68.49  ? 25   ARG A CB    1 
ATOM   2889 C  CG    . ARG B 1 26  ? 97.451  39.045  112.709 1.00 65.22  ? 25   ARG A CG    1 
ATOM   2890 C  CD    . ARG B 1 26  ? 97.843  37.583  112.542 1.00 71.96  ? 25   ARG A CD    1 
ATOM   2891 N  NE    . ARG B 1 26  ? 96.701  36.673  112.640 1.00 79.70  ? 25   ARG A NE    1 
ATOM   2892 C  CZ    . ARG B 1 26  ? 96.745  35.383  112.315 1.00 73.29  ? 25   ARG A CZ    1 
ATOM   2893 N  NH1   . ARG B 1 26  ? 97.872  34.853  111.859 1.00 62.64  ? 25   ARG A NH1   1 
ATOM   2894 N  NH2   . ARG B 1 26  ? 95.662  34.625  112.438 1.00 73.20  ? 25   ARG A NH2   1 
ATOM   2895 N  N     . ASP B 1 27  ? 98.439  41.295  115.685 1.00 62.68  ? 26   ASP A N     1 
ATOM   2896 C  CA    . ASP B 1 27  ? 99.506  42.278  115.534 1.00 62.31  ? 26   ASP A CA    1 
ATOM   2897 C  C     . ASP B 1 27  ? 100.033 42.796  116.864 1.00 62.36  ? 26   ASP A C     1 
ATOM   2898 O  O     . ASP B 1 27  ? 100.792 43.771  116.883 1.00 59.27  ? 26   ASP A O     1 
ATOM   2899 C  CB    . ASP B 1 27  ? 99.021  43.443  114.665 1.00 70.24  ? 26   ASP A CB    1 
ATOM   2900 C  CG    . ASP B 1 27  ? 98.719  43.010  113.242 1.00 77.85  ? 26   ASP A CG    1 
ATOM   2901 O  OD1   . ASP B 1 27  ? 99.500  42.199  112.694 1.00 72.42  ? 26   ASP A OD1   1 
ATOM   2902 O  OD2   . ASP B 1 27  ? 97.701  43.466  112.676 1.00 90.96  ? 26   ASP A OD2   1 
ATOM   2903 N  N     . ILE B 1 28  ? 99.664  42.161  117.971 1.00 60.27  ? 27   ILE A N     1 
ATOM   2904 C  CA    . ILE B 1 28  ? 100.126 42.579  119.289 1.00 60.48  ? 27   ILE A CA    1 
ATOM   2905 C  C     . ILE B 1 28  ? 100.986 41.457  119.867 1.00 55.14  ? 27   ILE A C     1 
ATOM   2906 O  O     . ILE B 1 28  ? 100.812 40.292  119.487 1.00 49.37  ? 27   ILE A O     1 
ATOM   2907 C  CB    . ILE B 1 28  ? 98.937  42.932  120.198 1.00 51.24  ? 27   ILE A CB    1 
ATOM   2908 C  CG1   . ILE B 1 28  ? 97.971  41.750  120.288 1.00 55.72  ? 27   ILE A CG1   1 
ATOM   2909 C  CG2   . ILE B 1 28  ? 98.227  44.186  119.679 1.00 50.83  ? 27   ILE A CG2   1 
ATOM   2910 C  CD1   . ILE B 1 28  ? 96.834  41.969  121.241 1.00 55.94  ? 27   ILE A CD1   1 
ATOM   2911 N  N     . PRO B 1 29  ? 101.927 41.749  120.767 1.00 48.12  ? 28   PRO A N     1 
ATOM   2912 C  CA    . PRO B 1 29  ? 102.770 40.678  121.327 1.00 43.70  ? 28   PRO A CA    1 
ATOM   2913 C  C     . PRO B 1 29  ? 101.974 39.824  122.304 1.00 40.90  ? 28   PRO A C     1 
ATOM   2914 O  O     . PRO B 1 29  ? 101.416 40.332  123.285 1.00 42.90  ? 28   PRO A O     1 
ATOM   2915 C  CB    . PRO B 1 29  ? 103.903 41.442  122.032 1.00 44.65  ? 28   PRO A CB    1 
ATOM   2916 C  CG    . PRO B 1 29  ? 103.511 42.915  122.014 1.00 46.78  ? 28   PRO A CG    1 
ATOM   2917 C  CD    . PRO B 1 29  ? 102.126 43.033  121.465 1.00 46.79  ? 28   PRO A CD    1 
ATOM   2918 N  N     . ILE B 1 30  ? 101.910 38.518  122.024 1.00 43.59  ? 29   ILE A N     1 
ATOM   2919 C  CA    . ILE B 1 30  ? 101.224 37.564  122.885 1.00 37.90  ? 29   ILE A CA    1 
ATOM   2920 C  C     . ILE B 1 30  ? 102.153 36.393  123.171 1.00 42.05  ? 29   ILE A C     1 
ATOM   2921 O  O     . ILE B 1 30  ? 103.092 36.108  122.425 1.00 41.08  ? 29   ILE A O     1 
ATOM   2922 C  CB    . ILE B 1 30  ? 99.908  37.033  122.276 1.00 44.44  ? 29   ILE A CB    1 
ATOM   2923 C  CG1   . ILE B 1 30  ? 100.212 35.982  121.197 1.00 35.81  ? 29   ILE A CG1   1 
ATOM   2924 C  CG2   . ILE B 1 30  ? 99.060  38.183  121.717 1.00 40.88  ? 29   ILE A CG2   1 
ATOM   2925 C  CD1   . ILE B 1 30  ? 98.975  35.342  120.577 1.00 38.46  ? 29   ILE A CD1   1 
ATOM   2926 N  N     . ALA B 1 31  ? 101.855 35.699  124.264 1.00 36.23  ? 30   ALA A N     1 
ATOM   2927 C  CA    . ALA B 1 31  ? 102.560 34.488  124.638 1.00 37.49  ? 30   ALA A CA    1 
ATOM   2928 C  C     . ALA B 1 31  ? 101.598 33.585  125.392 1.00 39.87  ? 30   ALA A C     1 
ATOM   2929 O  O     . ALA B 1 31  ? 100.690 34.053  126.081 1.00 40.72  ? 30   ALA A O     1 
ATOM   2930 C  CB    . ALA B 1 31  ? 103.792 34.792  125.499 1.00 38.39  ? 30   ALA A CB    1 
ATOM   2931 N  N     . ILE B 1 32  ? 101.787 32.286  125.228 1.00 34.11  ? 31   ILE A N     1 
ATOM   2932 C  CA    . ILE B 1 32  ? 101.116 31.296  126.060 1.00 35.04  ? 31   ILE A CA    1 
ATOM   2933 C  C     . ILE B 1 32  ? 102.101 30.926  127.159 1.00 40.53  ? 31   ILE A C     1 
ATOM   2934 O  O     . ILE B 1 32  ? 103.241 30.540  126.870 1.00 33.72  ? 31   ILE A O     1 
ATOM   2935 C  CB    . ILE B 1 32  ? 100.693 30.059  125.247 1.00 36.15  ? 31   ILE A CB    1 
ATOM   2936 C  CG1   . ILE B 1 32  ? 99.576  30.380  124.244 1.00 47.57  ? 31   ILE A CG1   1 
ATOM   2937 C  CG2   . ILE B 1 32  ? 100.184 28.977  126.164 1.00 35.43  ? 31   ILE A CG2   1 
ATOM   2938 C  CD1   . ILE B 1 32  ? 100.005 31.105  122.998 1.00 40.52  ? 31   ILE A CD1   1 
ATOM   2939 N  N     . GLY B 1 33  ? 101.684 31.067  128.412 1.00 41.19  ? 32   GLY A N     1 
ATOM   2940 C  CA    . GLY B 1 33  ? 102.552 30.706  129.524 1.00 39.50  ? 32   GLY A CA    1 
ATOM   2941 C  C     . GLY B 1 33  ? 101.866 30.971  130.846 1.00 40.57  ? 32   GLY A C     1 
ATOM   2942 O  O     . GLY B 1 33  ? 100.804 31.593  130.909 1.00 41.54  ? 32   GLY A O     1 
ATOM   2943 N  N     . GLY B 1 34  ? 102.488 30.471  131.911 1.00 36.75  ? 33   GLY A N     1 
ATOM   2944 C  CA    . GLY B 1 34  ? 101.958 30.696  133.244 1.00 37.46  ? 33   GLY A CA    1 
ATOM   2945 C  C     . GLY B 1 34  ? 102.318 32.066  133.794 1.00 36.03  ? 33   GLY A C     1 
ATOM   2946 O  O     . GLY B 1 34  ? 103.376 32.629  133.511 1.00 40.34  ? 33   GLY A O     1 
ATOM   2947 N  N     . SER B 1 35  ? 101.418 32.607  134.609 1.00 40.46  ? 34   SER A N     1 
ATOM   2948 C  CA    . SER B 1 35  ? 101.604 33.952  135.128 1.00 40.96  ? 34   SER A CA    1 
ATOM   2949 C  C     . SER B 1 35  ? 102.837 34.034  136.025 1.00 50.17  ? 34   SER A C     1 
ATOM   2950 O  O     . SER B 1 35  ? 103.422 33.030  136.446 1.00 43.90  ? 34   SER A O     1 
ATOM   2951 C  CB    . SER B 1 35  ? 100.392 34.385  135.935 1.00 43.06  ? 34   SER A CB    1 
ATOM   2952 O  OG    . SER B 1 35  ? 100.343 33.607  137.116 1.00 38.75  ? 34   SER A OG    1 
ATOM   2953 N  N     . ARG B 1 36  ? 103.212 35.270  136.343 1.00 39.60  ? 35   ARG A N     1 
ATOM   2954 C  CA    . ARG B 1 36  ? 104.320 35.480  137.263 1.00 46.20  ? 35   ARG A CA    1 
ATOM   2955 C  C     . ARG B 1 36  ? 103.975 34.970  138.659 1.00 43.60  ? 35   ARG A C     1 
ATOM   2956 O  O     . ARG B 1 36  ? 104.787 34.280  139.286 1.00 48.23  ? 35   ARG A O     1 
ATOM   2957 C  CB    . ARG B 1 36  ? 104.693 36.962  137.282 1.00 48.60  ? 35   ARG A CB    1 
ATOM   2958 C  CG    . ARG B 1 36  ? 105.984 37.265  137.991 1.00 59.36  ? 35   ARG A CG    1 
ATOM   2959 C  CD    . ARG B 1 36  ? 106.523 38.625  137.570 1.00 70.18  ? 35   ARG A CD    1 
ATOM   2960 N  NE    . ARG B 1 36  ? 107.708 38.990  138.339 1.00 81.39  ? 35   ARG A NE    1 
ATOM   2961 C  CZ    . ARG B 1 36  ? 107.809 40.082  139.090 1.00 84.60  ? 35   ARG A CZ    1 
ATOM   2962 N  NH1   . ARG B 1 36  ? 106.800 40.944  139.163 1.00 77.40  ? 35   ARG A NH1   1 
ATOM   2963 N  NH2   . ARG B 1 36  ? 108.929 40.318  139.757 1.00 92.37  ? 35   ARG A NH2   1 
ATOM   2964 N  N     . GLU B 1 37  ? 102.758 35.270  139.146 1.00 54.56  ? 36   GLU A N     1 
ATOM   2965 C  CA    . GLU B 1 37  ? 102.324 34.817  140.472 1.00 55.99  ? 36   GLU A CA    1 
ATOM   2966 C  C     . GLU B 1 37  ? 102.430 33.307  140.613 1.00 49.88  ? 36   GLU A C     1 
ATOM   2967 O  O     . GLU B 1 37  ? 102.654 32.802  141.719 1.00 50.19  ? 36   GLU A O     1 
ATOM   2968 C  CB    . GLU B 1 37  ? 100.872 35.246  140.762 1.00 61.39  ? 36   GLU A CB    1 
ATOM   2969 C  CG    . GLU B 1 37  ? 99.862  34.895  139.633 1.00 74.76  ? 36   GLU A CG    1 
ATOM   2970 C  CD    . GLU B 1 37  ? 98.445  34.474  140.079 1.00 68.99  ? 36   GLU A CD    1 
ATOM   2971 O  OE1   . GLU B 1 37  ? 98.272  33.896  141.175 1.00 70.20  ? 36   GLU A OE1   1 
ATOM   2972 O  OE2   . GLU B 1 37  ? 97.497  34.702  139.298 1.00 54.33  ? 36   GLU A OE2   1 
ATOM   2973 N  N     . ARG B 1 38  ? 102.244 32.574  139.520 1.00 44.70  ? 37   ARG A N     1 
ATOM   2974 C  CA    . ARG B 1 38  ? 102.271 31.120  139.540 1.00 42.81  ? 37   ARG A CA    1 
ATOM   2975 C  C     . ARG B 1 38  ? 103.646 30.567  139.208 1.00 38.14  ? 37   ARG A C     1 
ATOM   2976 O  O     . ARG B 1 38  ? 103.775 29.362  138.968 1.00 41.17  ? 37   ARG A O     1 
ATOM   2977 C  CB    . ARG B 1 38  ? 101.205 30.569  138.587 1.00 45.05  ? 37   ARG A CB    1 
ATOM   2978 C  CG    . ARG B 1 38  ? 99.798  30.885  139.085 1.00 52.17  ? 37   ARG A CG    1 
ATOM   2979 C  CD    . ARG B 1 38  ? 98.698  30.095  138.386 1.00 69.08  ? 37   ARG A CD    1 
ATOM   2980 N  NE    . ARG B 1 38  ? 99.089  28.734  138.023 1.00 79.98  ? 37   ARG A NE    1 
ATOM   2981 C  CZ    . ARG B 1 38  ? 99.317  27.748  138.888 1.00 73.31  ? 37   ARG A CZ    1 
ATOM   2982 N  NH1   . ARG B 1 38  ? 99.220  27.959  140.194 1.00 75.32  ? 37   ARG A NH1   1 
ATOM   2983 N  NH2   . ARG B 1 38  ? 99.667  26.550  138.437 1.00 68.28  ? 37   ARG A NH2   1 
ATOM   2984 N  N     . ARG B 1 39  ? 104.671 31.426  139.221 1.00 31.35  ? 38   ARG A N     1 
ATOM   2985 C  CA    . ARG B 1 39  ? 106.061 31.055  138.949 1.00 33.23  ? 38   ARG A CA    1 
ATOM   2986 C  C     . ARG B 1 39  ? 106.198 30.351  137.596 1.00 44.20  ? 38   ARG A C     1 
ATOM   2987 O  O     . ARG B 1 39  ? 106.939 29.381  137.447 1.00 38.66  ? 38   ARG A O     1 
ATOM   2988 C  CB    . ARG B 1 39  ? 106.628 30.215  140.100 1.00 34.77  ? 38   ARG A CB    1 
ATOM   2989 C  CG    . ARG B 1 39  ? 106.428 30.937  141.442 1.00 35.76  ? 38   ARG A CG    1 
ATOM   2990 C  CD    . ARG B 1 39  ? 107.432 30.566  142.521 1.00 37.20  ? 38   ARG A CD    1 
ATOM   2991 N  NE    . ARG B 1 39  ? 107.091 29.297  143.138 1.00 36.30  ? 38   ARG A NE    1 
ATOM   2992 C  CZ    . ARG B 1 39  ? 107.633 28.840  144.260 1.00 40.90  ? 38   ARG A CZ    1 
ATOM   2993 N  NH1   . ARG B 1 39  ? 108.550 29.553  144.902 1.00 46.38  ? 38   ARG A NH1   1 
ATOM   2994 N  NH2   . ARG B 1 39  ? 107.243 27.676  144.744 1.00 34.84  ? 38   ARG A NH2   1 
ATOM   2995 N  N     . GLY B 1 40  ? 105.512 30.899  136.582 1.00 36.89  ? 39   GLY A N     1 
ATOM   2996 C  CA    . GLY B 1 40  ? 105.422 30.263  135.285 1.00 35.02  ? 39   GLY A CA    1 
ATOM   2997 C  C     . GLY B 1 40  ? 106.544 30.618  134.320 1.00 29.11  ? 39   GLY A C     1 
ATOM   2998 O  O     . GLY B 1 40  ? 107.430 31.430  134.588 1.00 29.58  ? 39   GLY A O     1 
ATOM   2999 N  N     . VAL B 1 41  ? 106.523 29.936  133.174 1.00 27.52  ? 40   VAL A N     1 
ATOM   3000 C  CA    . VAL B 1 41  ? 107.395 30.259  132.049 1.00 33.77  ? 40   VAL A CA    1 
ATOM   3001 C  C     . VAL B 1 41  ? 106.546 30.413  130.797 1.00 27.91  ? 40   VAL A C     1 
ATOM   3002 O  O     . VAL B 1 41  ? 105.361 30.066  130.772 1.00 33.86  ? 40   VAL A O     1 
ATOM   3003 C  CB    . VAL B 1 41  ? 108.477 29.193  131.791 1.00 39.27  ? 40   VAL A CB    1 
ATOM   3004 C  CG1   . VAL B 1 41  ? 109.349 28.975  133.021 1.00 38.87  ? 40   VAL A CG1   1 
ATOM   3005 C  CG2   . VAL B 1 41  ? 107.813 27.915  131.321 1.00 29.52  ? 40   VAL A CG2   1 
ATOM   3006 N  N     . ILE B 1 42  ? 107.197 30.905  129.741 1.00 29.27  ? 41   ILE A N     1 
ATOM   3007 C  CA    . ILE B 1 42  ? 106.597 31.031  128.415 1.00 28.74  ? 41   ILE A CA    1 
ATOM   3008 C  C     . ILE B 1 42  ? 106.657 29.684  127.710 1.00 29.73  ? 41   ILE A C     1 
ATOM   3009 O  O     . ILE B 1 42  ? 107.735 29.094  127.577 1.00 32.15  ? 41   ILE A O     1 
ATOM   3010 C  CB    . ILE B 1 42  ? 107.331 32.099  127.580 1.00 34.62  ? 41   ILE A CB    1 
ATOM   3011 C  CG1   . ILE B 1 42  ? 107.357 33.452  128.299 1.00 28.07  ? 41   ILE A CG1   1 
ATOM   3012 C  CG2   . ILE B 1 42  ? 106.722 32.206  126.156 1.00 28.92  ? 41   ILE A CG2   1 
ATOM   3013 C  CD1   . ILE B 1 42  ? 105.993 33.967  128.682 1.00 36.78  ? 41   ILE A CD1   1 
ATOM   3014 N  N     . SER B 1 43  ? 105.501 29.205  127.229 1.00 29.92  ? 42   SER A N     1 
ATOM   3015 C  CA    . SER B 1 43  ? 105.489 28.050  126.333 1.00 31.55  ? 42   SER A CA    1 
ATOM   3016 C  C     . SER B 1 43  ? 105.886 28.452  124.917 1.00 35.02  ? 42   SER A C     1 
ATOM   3017 O  O     . SER B 1 43  ? 106.714 27.788  124.280 1.00 29.46  ? 42   SER A O     1 
ATOM   3018 C  CB    . SER B 1 43  ? 104.110 27.392  126.329 1.00 34.40  ? 42   SER A CB    1 
ATOM   3019 O  OG    . SER B 1 43  ? 103.995 26.429  127.366 1.00 40.03  ? 42   SER A OG    1 
ATOM   3020 N  N     . THR B 1 44  ? 105.305 29.531  124.407 1.00 37.52  ? 43   THR A N     1 
ATOM   3021 C  CA    . THR B 1 44  ? 105.704 30.047  123.106 1.00 35.45  ? 43   THR A CA    1 
ATOM   3022 C  C     . THR B 1 44  ? 105.149 31.457  122.956 1.00 32.46  ? 43   THR A C     1 
ATOM   3023 O  O     . THR B 1 44  ? 104.331 31.912  123.754 1.00 31.46  ? 43   THR A O     1 
ATOM   3024 C  CB    . THR B 1 44  ? 105.216 29.138  121.972 1.00 34.77  ? 43   THR A CB    1 
ATOM   3025 O  OG1   . THR B 1 44  ? 105.828 29.533  120.738 1.00 36.23  ? 43   THR A OG1   1 
ATOM   3026 C  CG2   . THR B 1 44  ? 103.701 29.231  121.840 1.00 31.90  ? 43   THR A CG2   1 
ATOM   3027 N  N     . ALA B 1 45  ? 105.585 32.133  121.898 1.00 34.08  ? 44   ALA A N     1 
ATOM   3028 C  CA    . ALA B 1 45  ? 105.197 33.512  121.675 1.00 38.20  ? 44   ALA A CA    1 
ATOM   3029 C  C     . ALA B 1 45  ? 105.115 33.754  120.180 1.00 38.37  ? 44   ALA A C     1 
ATOM   3030 O  O     . ALA B 1 45  ? 105.731 33.036  119.386 1.00 40.92  ? 44   ALA A O     1 
ATOM   3031 C  CB    . ALA B 1 45  ? 106.185 34.481  122.344 1.00 41.43  ? 44   ALA A CB    1 
ATOM   3032 N  N     . ASN B 1 46  ? 104.331 34.765  119.798 1.00 35.19  ? 45   ASN A N     1 
ATOM   3033 C  CA    . ASN B 1 46  ? 104.201 35.107  118.390 1.00 36.87  ? 45   ASN A CA    1 
ATOM   3034 C  C     . ASN B 1 46  ? 105.371 35.997  117.974 1.00 36.21  ? 45   ASN A C     1 
ATOM   3035 O  O     . ASN B 1 46  ? 106.229 36.350  118.784 1.00 38.72  ? 45   ASN A O     1 
ATOM   3036 C  CB    . ASN B 1 46  ? 102.843 35.760  118.116 1.00 41.51  ? 45   ASN A CB    1 
ATOM   3037 C  CG    . ASN B 1 46  ? 102.704 37.152  118.739 1.00 39.81  ? 45   ASN A CG    1 
ATOM   3038 O  OD1   . ASN B 1 46  ? 103.516 37.576  119.556 1.00 43.14  ? 45   ASN A OD1   1 
ATOM   3039 N  ND2   . ASN B 1 46  ? 101.651 37.852  118.361 1.00 36.96  ? 45   ASN A ND2   1 
ATOM   3040 N  N     . TYR B 1 47  ? 105.413 36.375  116.699 1.00 41.12  ? 46   TYR A N     1 
ATOM   3041 C  CA    . TYR B 1 47  ? 106.561 37.132  116.217 1.00 37.78  ? 46   TYR A CA    1 
ATOM   3042 C  C     . TYR B 1 47  ? 106.626 38.552  116.776 1.00 34.55  ? 46   TYR A C     1 
ATOM   3043 O  O     . TYR B 1 47  ? 107.734 39.053  117.004 1.00 41.44  ? 46   TYR A O     1 
ATOM   3044 C  CB    . TYR B 1 47  ? 106.582 37.152  114.686 1.00 44.45  ? 46   TYR A CB    1 
ATOM   3045 C  CG    . TYR B 1 47  ? 107.245 35.905  114.153 1.00 43.14  ? 46   TYR A CG    1 
ATOM   3046 C  CD1   . TYR B 1 47  ? 108.628 35.791  114.135 1.00 43.17  ? 46   TYR A CD1   1 
ATOM   3047 C  CD2   . TYR B 1 47  ? 106.492 34.828  113.721 1.00 47.15  ? 46   TYR A CD2   1 
ATOM   3048 C  CE1   . TYR B 1 47  ? 109.248 34.641  113.678 1.00 45.78  ? 46   TYR A CE1   1 
ATOM   3049 C  CE2   . TYR B 1 47  ? 107.099 33.669  113.259 1.00 47.48  ? 46   TYR A CE2   1 
ATOM   3050 C  CZ    . TYR B 1 47  ? 108.477 33.583  113.242 1.00 49.24  ? 46   TYR A CZ    1 
ATOM   3051 O  OH    . TYR B 1 47  ? 109.078 32.439  112.779 1.00 40.85  ? 46   TYR A OH    1 
ATOM   3052 N  N     . PRO B 1 48  ? 105.503 39.263  116.974 1.00 43.01  ? 47   PRO A N     1 
ATOM   3053 C  CA    . PRO B 1 48  ? 105.619 40.565  117.653 1.00 44.64  ? 47   PRO A CA    1 
ATOM   3054 C  C     . PRO B 1 48  ? 106.235 40.461  119.040 1.00 52.93  ? 47   PRO A C     1 
ATOM   3055 O  O     . PRO B 1 48  ? 106.973 41.368  119.447 1.00 43.71  ? 47   PRO A O     1 
ATOM   3056 C  CB    . PRO B 1 48  ? 104.172 41.070  117.690 1.00 40.76  ? 47   PRO A CB    1 
ATOM   3057 C  CG    . PRO B 1 48  ? 103.582 40.520  116.448 1.00 44.91  ? 47   PRO A CG    1 
ATOM   3058 C  CD    . PRO B 1 48  ? 104.187 39.129  116.314 1.00 47.72  ? 47   PRO A CD    1 
ATOM   3059 N  N     . ALA B 1 49  ? 105.978 39.371  119.772 1.00 48.85  ? 48   ALA A N     1 
ATOM   3060 C  CA    . ALA B 1 49  ? 106.615 39.201  121.074 1.00 38.62  ? 48   ALA A CA    1 
ATOM   3061 C  C     . ALA B 1 49  ? 108.079 38.796  120.931 1.00 39.81  ? 48   ALA A C     1 
ATOM   3062 O  O     . ALA B 1 49  ? 108.932 39.252  121.703 1.00 37.64  ? 48   ALA A O     1 
ATOM   3063 C  CB    . ALA B 1 49  ? 105.851 38.171  121.912 1.00 37.47  ? 48   ALA A CB    1 
ATOM   3064 N  N     . ARG B 1 50  ? 108.392 37.958  119.938 1.00 37.90  ? 49   ARG A N     1 
ATOM   3065 C  CA    . ARG B 1 50  ? 109.770 37.514  119.740 1.00 38.66  ? 49   ARG A CA    1 
ATOM   3066 C  C     . ARG B 1 50  ? 110.711 38.672  119.413 1.00 36.92  ? 49   ARG A C     1 
ATOM   3067 O  O     . ARG B 1 50  ? 111.904 38.600  119.723 1.00 39.63  ? 49   ARG A O     1 
ATOM   3068 C  CB    . ARG B 1 50  ? 109.825 36.455  118.637 1.00 33.97  ? 49   ARG A CB    1 
ATOM   3069 C  CG    . ARG B 1 50  ? 109.136 35.175  119.044 1.00 35.37  ? 49   ARG A CG    1 
ATOM   3070 C  CD    . ARG B 1 50  ? 109.249 34.056  118.017 1.00 39.30  ? 49   ARG A CD    1 
ATOM   3071 N  NE    . ARG B 1 50  ? 108.460 32.909  118.444 1.00 38.88  ? 49   ARG A NE    1 
ATOM   3072 C  CZ    . ARG B 1 50  ? 108.591 31.680  117.959 1.00 61.26  ? 49   ARG A CZ    1 
ATOM   3073 N  NH1   . ARG B 1 50  ? 109.490 31.422  117.011 1.00 67.82  ? 49   ARG A NH1   1 
ATOM   3074 N  NH2   . ARG B 1 50  ? 107.814 30.708  118.423 1.00 51.22  ? 49   ARG A NH2   1 
ATOM   3075 N  N     . LYS B 1 51  ? 110.215 39.751  118.818 1.00 38.97  ? 50   LYS A N     1 
ATOM   3076 C  CA    . LYS B 1 51  ? 111.158 40.813  118.470 1.00 43.92  ? 50   LYS A CA    1 
ATOM   3077 C  C     . LYS B 1 51  ? 111.651 41.561  119.704 1.00 40.97  ? 50   LYS A C     1 
ATOM   3078 O  O     . LYS B 1 51  ? 112.739 42.146  119.666 1.00 44.52  ? 50   LYS A O     1 
ATOM   3079 C  CB    . LYS B 1 51  ? 110.547 41.770  117.451 1.00 48.08  ? 50   LYS A CB    1 
ATOM   3080 C  CG    . LYS B 1 51  ? 109.808 42.937  118.008 1.00 61.26  ? 50   LYS A CG    1 
ATOM   3081 C  CD    . LYS B 1 51  ? 109.785 44.067  116.991 1.00 59.69  ? 50   LYS A CD    1 
ATOM   3082 C  CE    . LYS B 1 51  ? 108.745 45.099  117.366 1.00 63.63  ? 50   LYS A CE    1 
ATOM   3083 N  NZ    . LYS B 1 51  ? 107.382 44.530  117.258 1.00 67.11  ? 50   LYS A NZ    1 
ATOM   3084 N  N     . PHE B 1 52  ? 110.894 41.519  120.801 1.00 43.73  ? 51   PHE A N     1 
ATOM   3085 C  CA    . PHE B 1 52  ? 111.338 42.028  122.095 1.00 48.54  ? 51   PHE A CA    1 
ATOM   3086 C  C     . PHE B 1 52  ? 112.255 41.054  122.829 1.00 50.00  ? 51   PHE A C     1 
ATOM   3087 O  O     . PHE B 1 52  ? 112.725 41.378  123.926 1.00 45.86  ? 51   PHE A O     1 
ATOM   3088 C  CB    . PHE B 1 52  ? 110.129 42.348  122.982 1.00 38.52  ? 51   PHE A CB    1 
ATOM   3089 C  CG    . PHE B 1 52  ? 109.280 43.482  122.477 1.00 45.90  ? 51   PHE A CG    1 
ATOM   3090 C  CD1   . PHE B 1 52  ? 109.560 44.788  122.840 1.00 41.86  ? 51   PHE A CD1   1 
ATOM   3091 C  CD2   . PHE B 1 52  ? 108.189 43.242  121.652 1.00 44.57  ? 51   PHE A CD2   1 
ATOM   3092 C  CE1   . PHE B 1 52  ? 108.779 45.838  122.378 1.00 51.24  ? 51   PHE A CE1   1 
ATOM   3093 C  CE2   . PHE B 1 52  ? 107.403 44.285  121.196 1.00 43.98  ? 51   PHE A CE2   1 
ATOM   3094 C  CZ    . PHE B 1 52  ? 107.703 45.585  121.554 1.00 48.21  ? 51   PHE A CZ    1 
ATOM   3095 N  N     . GLY B 1 53  ? 112.503 39.871  122.265 1.00 45.78  ? 52   GLY A N     1 
ATOM   3096 C  CA    . GLY B 1 53  ? 113.359 38.883  122.880 1.00 40.47  ? 52   GLY A CA    1 
ATOM   3097 C  C     . GLY B 1 53  ? 112.630 37.797  123.634 1.00 42.68  ? 52   GLY A C     1 
ATOM   3098 O  O     . GLY B 1 53  ? 113.289 36.968  124.270 1.00 43.13  ? 52   GLY A O     1 
ATOM   3099 N  N     . VAL B 1 54  ? 111.295 37.782  123.599 1.00 41.01  ? 53   VAL A N     1 
ATOM   3100 C  CA    . VAL B 1 54  ? 110.539 36.748  124.292 1.00 37.56  ? 53   VAL A CA    1 
ATOM   3101 C  C     . VAL B 1 54  ? 110.761 35.414  123.592 1.00 43.89  ? 53   VAL A C     1 
ATOM   3102 O  O     . VAL B 1 54  ? 110.642 35.315  122.365 1.00 42.28  ? 53   VAL A O     1 
ATOM   3103 C  CB    . VAL B 1 54  ? 109.042 37.089  124.356 1.00 36.87  ? 53   VAL A CB    1 
ATOM   3104 C  CG1   . VAL B 1 54  ? 108.254 35.917  124.995 1.00 36.06  ? 53   VAL A CG1   1 
ATOM   3105 C  CG2   . VAL B 1 54  ? 108.797 38.394  125.120 1.00 36.91  ? 53   VAL A CG2   1 
ATOM   3106 N  N     . ARG B 1 55  ? 111.073 34.381  124.375 1.00 37.29  ? 54   ARG A N     1 
ATOM   3107 C  CA    . ARG B 1 55  ? 111.396 33.052  123.861 1.00 36.25  ? 54   ARG A CA    1 
ATOM   3108 C  C     . ARG B 1 55  ? 110.695 31.987  124.693 1.00 35.58  ? 54   ARG A C     1 
ATOM   3109 O  O     . ARG B 1 55  ? 110.383 32.205  125.866 1.00 33.74  ? 54   ARG A O     1 
ATOM   3110 C  CB    . ARG B 1 55  ? 112.909 32.778  123.911 1.00 40.11  ? 54   ARG A CB    1 
ATOM   3111 C  CG    . ARG B 1 55  ? 113.776 33.762  123.167 1.00 39.68  ? 54   ARG A CG    1 
ATOM   3112 C  CD    . ARG B 1 55  ? 113.664 33.543  121.667 1.00 50.58  ? 54   ARG A CD    1 
ATOM   3113 N  NE    . ARG B 1 55  ? 114.511 34.465  120.917 1.00 56.59  ? 54   ARG A NE    1 
ATOM   3114 C  CZ    . ARG B 1 55  ? 114.095 35.619  120.404 1.00 61.45  ? 54   ARG A CZ    1 
ATOM   3115 N  NH1   . ARG B 1 55  ? 112.834 36.014  120.557 1.00 45.45  ? 54   ARG A NH1   1 
ATOM   3116 N  NH2   . ARG B 1 55  ? 114.948 36.378  119.733 1.00 74.69  ? 54   ARG A NH2   1 
ATOM   3117 N  N     . SER B 1 56  ? 110.490 30.813  124.084 1.00 32.66  ? 55   SER A N     1 
ATOM   3118 C  CA    . SER B 1 56  ? 110.078 29.635  124.830 1.00 35.40  ? 55   SER A CA    1 
ATOM   3119 C  C     . SER B 1 56  ? 111.021 29.375  125.994 1.00 36.07  ? 55   SER A C     1 
ATOM   3120 O  O     . SER B 1 56  ? 112.233 29.593  125.900 1.00 39.88  ? 55   SER A O     1 
ATOM   3121 C  CB    . SER B 1 56  ? 110.044 28.416  123.916 1.00 34.62  ? 55   SER A CB    1 
ATOM   3122 O  OG    . SER B 1 56  ? 108.976 28.509  123.000 1.00 36.88  ? 55   SER A OG    1 
ATOM   3123 N  N     . ALA B 1 57  ? 110.445 28.918  127.101 1.00 34.07  ? 56   ALA A N     1 
ATOM   3124 C  CA    . ALA B 1 57  ? 111.130 28.529  128.327 1.00 40.64  ? 56   ALA A CA    1 
ATOM   3125 C  C     . ALA B 1 57  ? 111.636 29.734  129.110 1.00 37.07  ? 56   ALA A C     1 
ATOM   3126 O  O     . ALA B 1 57  ? 112.153 29.559  130.215 1.00 36.09  ? 56   ALA A O     1 
ATOM   3127 C  CB    . ALA B 1 57  ? 112.292 27.549  128.066 1.00 30.07  ? 56   ALA A CB    1 
ATOM   3128 N  N     . MET B 1 58  ? 111.475 30.947  128.602 1.00 34.84  ? 57   MET A N     1 
ATOM   3129 C  CA    . MET B 1 58  ? 111.861 32.119  129.376 1.00 32.33  ? 57   MET A CA    1 
ATOM   3130 C  C     . MET B 1 58  ? 110.917 32.292  130.561 1.00 34.69  ? 57   MET A C     1 
ATOM   3131 O  O     . MET B 1 58  ? 109.693 32.152  130.403 1.00 32.56  ? 57   MET A O     1 
ATOM   3132 C  CB    . MET B 1 58  ? 111.844 33.377  128.514 1.00 27.62  ? 57   MET A CB    1 
ATOM   3133 C  CG    . MET B 1 58  ? 112.380 34.614  129.207 1.00 34.06  ? 57   MET A CG    1 
ATOM   3134 S  SD    . MET B 1 58  ? 112.381 36.002  128.043 1.00 42.55  ? 57   MET A SD    1 
ATOM   3135 C  CE    . MET B 1 58  ? 110.777 35.726  127.370 1.00 52.58  ? 57   MET A CE    1 
ATOM   3136 N  N     . PRO B 1 59  ? 111.438 32.580  131.752 1.00 29.39  ? 58   PRO A N     1 
ATOM   3137 C  CA    . PRO B 1 59  ? 110.564 32.874  132.889 1.00 30.36  ? 58   PRO A CA    1 
ATOM   3138 C  C     . PRO B 1 59  ? 109.649 34.041  132.579 1.00 36.15  ? 58   PRO A C     1 
ATOM   3139 O  O     . PRO B 1 59  ? 110.076 35.044  132.008 1.00 36.31  ? 58   PRO A O     1 
ATOM   3140 C  CB    . PRO B 1 59  ? 111.554 33.211  134.012 1.00 39.99  ? 58   PRO A CB    1 
ATOM   3141 C  CG    . PRO B 1 59  ? 112.766 32.404  133.657 1.00 38.27  ? 58   PRO A CG    1 
ATOM   3142 C  CD    . PRO B 1 59  ? 112.853 32.476  132.157 1.00 37.17  ? 58   PRO A CD    1 
ATOM   3143 N  N     . THR B 1 60  ? 108.377 33.901  132.969 1.00 28.84  ? 59   THR A N     1 
ATOM   3144 C  CA    . THR B 1 60  ? 107.381 34.897  132.579 1.00 37.94  ? 59   THR A CA    1 
ATOM   3145 C  C     . THR B 1 60  ? 107.708 36.276  133.145 1.00 46.54  ? 59   THR A C     1 
ATOM   3146 O  O     . THR B 1 60  ? 107.401 37.292  132.511 1.00 42.92  ? 59   THR A O     1 
ATOM   3147 C  CB    . THR B 1 60  ? 105.991 34.453  133.020 1.00 39.87  ? 59   THR A CB    1 
ATOM   3148 O  OG1   . THR B 1 60  ? 105.700 33.186  132.423 1.00 36.38  ? 59   THR A OG1   1 
ATOM   3149 C  CG2   . THR B 1 60  ? 104.933 35.465  132.575 1.00 39.71  ? 59   THR A CG2   1 
ATOM   3150 N  N     . GLY B 1 61  ? 108.343 36.333  134.318 1.00 45.86  ? 60   GLY A N     1 
ATOM   3151 C  CA    . GLY B 1 61  ? 108.792 37.614  134.845 1.00 45.66  ? 60   GLY A CA    1 
ATOM   3152 C  C     . GLY B 1 61  ? 109.809 38.301  133.951 1.00 47.80  ? 60   GLY A C     1 
ATOM   3153 O  O     . GLY B 1 61  ? 109.787 39.528  133.792 1.00 43.68  ? 60   GLY A O     1 
ATOM   3154 N  N     . MET B 1 62  ? 110.720 37.527  133.358 1.00 42.55  ? 61   MET A N     1 
ATOM   3155 C  CA    . MET B 1 62  ? 111.666 38.121  132.421 1.00 51.20  ? 61   MET A CA    1 
ATOM   3156 C  C     . MET B 1 62  ? 110.980 38.496  131.114 1.00 47.71  ? 61   MET A C     1 
ATOM   3157 O  O     . MET B 1 62  ? 111.311 39.519  130.503 1.00 42.98  ? 61   MET A O     1 
ATOM   3158 C  CB    . MET B 1 62  ? 112.829 37.163  132.171 1.00 48.60  ? 61   MET A CB    1 
ATOM   3159 C  CG    . MET B 1 62  ? 113.687 37.528  130.971 1.00 63.15  ? 61   MET A CG    1 
ATOM   3160 S  SD    . MET B 1 62  ? 115.289 36.698  130.981 1.00 74.35  ? 61   MET A SD    1 
ATOM   3161 C  CE    . MET B 1 62  ? 116.323 38.069  131.510 1.00 87.22  ? 61   MET A CE    1 
ATOM   3162 N  N     . ALA B 1 63  ? 110.017 37.683  130.673 1.00 36.49  ? 62   ALA A N     1 
ATOM   3163 C  CA    . ALA B 1 63  ? 109.245 38.024  129.478 1.00 37.58  ? 62   ALA A CA    1 
ATOM   3164 C  C     . ALA B 1 63  ? 108.534 39.363  129.631 1.00 40.90  ? 62   ALA A C     1 
ATOM   3165 O  O     . ALA B 1 63  ? 108.474 40.157  128.684 1.00 42.45  ? 62   ALA A O     1 
ATOM   3166 C  CB    . ALA B 1 63  ? 108.221 36.924  129.179 1.00 34.68  ? 62   ALA A CB    1 
ATOM   3167 N  N     . LEU B 1 64  ? 107.971 39.623  130.808 1.00 47.05  ? 63   LEU A N     1 
ATOM   3168 C  CA    . LEU B 1 64  ? 107.248 40.870  131.023 1.00 49.94  ? 63   LEU A CA    1 
ATOM   3169 C  C     . LEU B 1 64  ? 108.186 42.063  131.147 1.00 48.23  ? 63   LEU A C     1 
ATOM   3170 O  O     . LEU B 1 64  ? 107.803 43.178  130.783 1.00 51.07  ? 63   LEU A O     1 
ATOM   3171 C  CB    . LEU B 1 64  ? 106.360 40.749  132.258 1.00 49.46  ? 63   LEU A CB    1 
ATOM   3172 C  CG    . LEU B 1 64  ? 105.131 39.889  131.979 1.00 52.08  ? 63   LEU A CG    1 
ATOM   3173 C  CD1   . LEU B 1 64  ? 104.488 39.451  133.285 1.00 50.17  ? 63   LEU A CD1   1 
ATOM   3174 C  CD2   . LEU B 1 64  ? 104.146 40.669  131.103 1.00 59.35  ? 63   LEU A CD2   1 
ATOM   3175 N  N     . LYS B 1 65  ? 109.412 41.849  131.634 1.00 48.66  ? 64   LYS A N     1 
ATOM   3176 C  CA    . LYS B 1 65  ? 110.389 42.930  131.665 1.00 53.60  ? 64   LYS A CA    1 
ATOM   3177 C  C     . LYS B 1 65  ? 110.918 43.245  130.273 1.00 56.45  ? 64   LYS A C     1 
ATOM   3178 O  O     . LYS B 1 65  ? 111.246 44.401  129.991 1.00 47.97  ? 64   LYS A O     1 
ATOM   3179 C  CB    . LYS B 1 65  ? 111.542 42.582  132.606 1.00 58.48  ? 64   LYS A CB    1 
ATOM   3180 N  N     . LEU B 1 66  ? 111.003 42.246  129.387 1.00 44.06  ? 65   LEU A N     1 
ATOM   3181 C  CA    . LEU B 1 66  ? 111.437 42.530  128.021 1.00 49.04  ? 65   LEU A CA    1 
ATOM   3182 C  C     . LEU B 1 66  ? 110.321 43.133  127.174 1.00 45.09  ? 65   LEU A C     1 
ATOM   3183 O  O     . LEU B 1 66  ? 110.604 43.862  126.218 1.00 47.06  ? 65   LEU A O     1 
ATOM   3184 C  CB    . LEU B 1 66  ? 111.954 41.258  127.345 1.00 50.67  ? 65   LEU A CB    1 
ATOM   3185 C  CG    . LEU B 1 66  ? 113.140 40.555  127.999 1.00 52.48  ? 65   LEU A CG    1 
ATOM   3186 C  CD1   . LEU B 1 66  ? 113.569 39.336  127.188 1.00 43.96  ? 65   LEU A CD1   1 
ATOM   3187 C  CD2   . LEU B 1 66  ? 114.296 41.531  128.182 1.00 44.98  ? 65   LEU A CD2   1 
ATOM   3188 N  N     . CYS B 1 67  ? 109.066 42.835  127.505 1.00 43.94  ? 66   CYS A N     1 
ATOM   3189 C  CA    . CYS B 1 67  ? 107.917 43.190  126.667 1.00 47.59  ? 66   CYS A CA    1 
ATOM   3190 C  C     . CYS B 1 67  ? 106.744 43.484  127.588 1.00 49.15  ? 66   CYS A C     1 
ATOM   3191 O  O     . CYS B 1 67  ? 105.863 42.641  127.798 1.00 39.35  ? 66   CYS A O     1 
ATOM   3192 C  CB    . CYS B 1 67  ? 107.582 42.064  125.682 1.00 50.53  ? 66   CYS A CB    1 
ATOM   3193 S  SG    . CYS B 1 67  ? 106.121 42.333  124.632 1.00 48.52  ? 66   CYS A SG    1 
ATOM   3194 N  N     . PRO B 1 68  ? 106.714 44.677  128.190 1.00 55.00  ? 67   PRO A N     1 
ATOM   3195 C  CA    . PRO B 1 68  ? 105.698 44.952  129.222 1.00 46.84  ? 67   PRO A CA    1 
ATOM   3196 C  C     . PRO B 1 68  ? 104.268 44.968  128.701 1.00 45.48  ? 67   PRO A C     1 
ATOM   3197 O  O     . PRO B 1 68  ? 103.338 44.810  129.503 1.00 47.76  ? 67   PRO A O     1 
ATOM   3198 C  CB    . PRO B 1 68  ? 106.116 46.324  129.774 1.00 50.58  ? 67   PRO A CB    1 
ATOM   3199 C  CG    . PRO B 1 68  ? 106.997 46.911  128.738 1.00 53.11  ? 67   PRO A CG    1 
ATOM   3200 C  CD    . PRO B 1 68  ? 107.697 45.765  128.075 1.00 53.62  ? 67   PRO A CD    1 
ATOM   3201 N  N     . HIS B 1 69  ? 104.054 45.130  127.399 1.00 42.43  ? 68   HIS A N     1 
ATOM   3202 C  CA    . HIS B 1 69  ? 102.718 45.083  126.818 1.00 51.07  ? 68   HIS A CA    1 
ATOM   3203 C  C     . HIS B 1 69  ? 102.283 43.661  126.473 1.00 53.58  ? 68   HIS A C     1 
ATOM   3204 O  O     . HIS B 1 69  ? 101.292 43.479  125.754 1.00 53.68  ? 68   HIS A O     1 
ATOM   3205 C  CB    . HIS B 1 69  ? 102.658 45.965  125.566 1.00 67.07  ? 68   HIS A CB    1 
ATOM   3206 C  CG    . HIS B 1 69  ? 102.816 47.429  125.845 1.00 77.73  ? 68   HIS A CG    1 
ATOM   3207 N  ND1   . HIS B 1 69  ? 101.741 48.278  125.997 1.00 85.94  ? 68   HIS A ND1   1 
ATOM   3208 C  CD2   . HIS B 1 69  ? 103.923 48.197  125.988 1.00 80.25  ? 68   HIS A CD2   1 
ATOM   3209 C  CE1   . HIS B 1 69  ? 102.178 49.504  126.226 1.00 85.54  ? 68   HIS A CE1   1 
ATOM   3210 N  NE2   . HIS B 1 69  ? 103.499 49.482  126.229 1.00 84.13  ? 68   HIS A NE2   1 
ATOM   3211 N  N     . LEU B 1 70  ? 102.996 42.660  126.979 1.00 42.28  ? 69   LEU A N     1 
ATOM   3212 C  CA    . LEU B 1 70  ? 102.748 41.276  126.597 1.00 44.39  ? 69   LEU A CA    1 
ATOM   3213 C  C     . LEU B 1 70  ? 101.375 40.817  127.073 1.00 41.77  ? 69   LEU A C     1 
ATOM   3214 O  O     . LEU B 1 70  ? 101.017 40.992  128.241 1.00 44.95  ? 69   LEU A O     1 
ATOM   3215 C  CB    . LEU B 1 70  ? 103.841 40.380  127.187 1.00 46.30  ? 69   LEU A CB    1 
ATOM   3216 C  CG    . LEU B 1 70  ? 103.886 38.911  126.772 1.00 40.61  ? 69   LEU A CG    1 
ATOM   3217 C  CD1   . LEU B 1 70  ? 104.193 38.814  125.282 1.00 34.83  ? 69   LEU A CD1   1 
ATOM   3218 C  CD2   . LEU B 1 70  ? 104.921 38.174  127.600 1.00 40.48  ? 69   LEU A CD2   1 
ATOM   3219 N  N     . THR B 1 71  ? 100.602 40.238  126.157 1.00 39.34  ? 70   THR A N     1 
ATOM   3220 C  CA    . THR B 1 71  ? 99.338  39.597  126.497 1.00 48.26  ? 70   THR A CA    1 
ATOM   3221 C  C     . THR B 1 71  ? 99.587  38.116  126.757 1.00 52.07  ? 70   THR A C     1 
ATOM   3222 O  O     . THR B 1 71  ? 100.084 37.399  125.881 1.00 51.43  ? 70   THR A O     1 
ATOM   3223 C  CB    . THR B 1 71  ? 98.316  39.771  125.381 1.00 43.51  ? 70   THR A CB    1 
ATOM   3224 O  OG1   . THR B 1 71  ? 98.046  41.165  125.200 1.00 55.62  ? 70   THR A OG1   1 
ATOM   3225 C  CG2   . THR B 1 71  ? 97.032  39.039  125.735 1.00 50.29  ? 70   THR A CG2   1 
ATOM   3226 N  N     . LEU B 1 72  ? 99.238  37.660  127.952 1.00 47.20  ? 71   LEU A N     1 
ATOM   3227 C  CA    . LEU B 1 72  ? 99.577  36.321  128.406 1.00 45.17  ? 71   LEU A CA    1 
ATOM   3228 C  C     . LEU B 1 72  ? 98.341  35.433  128.333 1.00 48.26  ? 71   LEU A C     1 
ATOM   3229 O  O     . LEU B 1 72  ? 97.296  35.771  128.895 1.00 47.88  ? 71   LEU A O     1 
ATOM   3230 C  CB    . LEU B 1 72  ? 100.123 36.375  129.831 1.00 46.28  ? 71   LEU A CB    1 
ATOM   3231 C  CG    . LEU B 1 72  ? 100.883 35.184  130.396 1.00 50.95  ? 71   LEU A CG    1 
ATOM   3232 C  CD1   . LEU B 1 72  ? 102.077 34.813  129.516 1.00 42.51  ? 71   LEU A CD1   1 
ATOM   3233 C  CD2   . LEU B 1 72  ? 101.339 35.549  131.795 1.00 52.03  ? 71   LEU A CD2   1 
ATOM   3234 N  N     . LEU B 1 73  ? 98.467  34.294  127.645 1.00 45.68  ? 72   LEU A N     1 
ATOM   3235 C  CA    . LEU B 1 73  ? 97.349  33.376  127.464 1.00 53.43  ? 72   LEU A CA    1 
ATOM   3236 C  C     . LEU B 1 73  ? 97.581  32.076  128.230 1.00 49.23  ? 72   LEU A C     1 
ATOM   3237 O  O     . LEU B 1 73  ? 98.721  31.606  128.313 1.00 46.64  ? 72   LEU A O     1 
ATOM   3238 C  CB    . LEU B 1 73  ? 97.140  33.065  125.976 1.00 50.25  ? 72   LEU A CB    1 
ATOM   3239 C  CG    . LEU B 1 73  ? 96.316  34.071  125.159 1.00 58.92  ? 72   LEU A CG    1 
ATOM   3240 C  CD1   . LEU B 1 73  ? 96.904  35.474  125.179 1.00 57.18  ? 72   LEU A CD1   1 
ATOM   3241 C  CD2   . LEU B 1 73  ? 96.171  33.595  123.730 1.00 60.99  ? 72   LEU A CD2   1 
ATOM   3242 N  N     . PRO B 1 74  ? 96.532  31.478  128.809 1.00 49.67  ? 73   PRO A N     1 
ATOM   3243 C  CA    . PRO B 1 74  ? 96.727  30.236  129.578 1.00 42.63  ? 73   PRO A CA    1 
ATOM   3244 C  C     . PRO B 1 74  ? 96.919  29.006  128.712 1.00 46.06  ? 73   PRO A C     1 
ATOM   3245 O  O     . PRO B 1 74  ? 97.460  28.006  129.199 1.00 51.32  ? 73   PRO A O     1 
ATOM   3246 C  CB    . PRO B 1 74  ? 95.438  30.129  130.401 1.00 44.23  ? 73   PRO A CB    1 
ATOM   3247 C  CG    . PRO B 1 74  ? 94.399  30.777  129.505 1.00 48.24  ? 73   PRO A CG    1 
ATOM   3248 C  CD    . PRO B 1 74  ? 95.122  31.917  128.812 1.00 55.73  ? 73   PRO A CD    1 
ATOM   3249 N  N     . GLY B 1 75  ? 96.485  29.032  127.456 1.00 41.57  ? 74   GLY A N     1 
ATOM   3250 C  CA    . GLY B 1 75  ? 96.647  27.875  126.599 1.00 55.25  ? 74   GLY A CA    1 
ATOM   3251 C  C     . GLY B 1 75  ? 95.412  26.999  126.574 1.00 57.55  ? 74   GLY A C     1 
ATOM   3252 O  O     . GLY B 1 75  ? 94.812  26.723  127.616 1.00 50.69  ? 74   GLY A O     1 
ATOM   3253 N  N     . ARG B 1 76  ? 95.022  26.555  125.386 1.00 51.27  ? 75   ARG A N     1 
ATOM   3254 C  CA    . ARG B 1 76  ? 93.805  25.774  125.192 1.00 53.68  ? 75   ARG A CA    1 
ATOM   3255 C  C     . ARG B 1 76  ? 94.227  24.438  124.592 1.00 53.05  ? 75   ARG A C     1 
ATOM   3256 O  O     . ARG B 1 76  ? 94.264  24.283  123.369 1.00 52.34  ? 75   ARG A O     1 
ATOM   3257 C  CB    . ARG B 1 76  ? 92.832  26.534  124.305 1.00 48.80  ? 75   ARG A CB    1 
ATOM   3258 C  CG    . ARG B 1 76  ? 92.367  27.851  124.928 1.00 51.85  ? 75   ARG A CG    1 
ATOM   3259 C  CD    . ARG B 1 76  ? 91.846  28.819  123.888 1.00 51.99  ? 75   ARG A CD    1 
ATOM   3260 N  NE    . ARG B 1 76  ? 90.983  28.148  122.924 1.00 62.53  ? 75   ARG A NE    1 
ATOM   3261 C  CZ    . ARG B 1 76  ? 91.134  28.212  121.607 1.00 65.66  ? 75   ARG A CZ    1 
ATOM   3262 N  NH1   . ARG B 1 76  ? 92.110  28.938  121.084 1.00 68.78  ? 75   ARG A NH1   1 
ATOM   3263 N  NH2   . ARG B 1 76  ? 90.298  27.561  120.809 1.00 67.54  ? 75   ARG A NH2   1 
ATOM   3264 N  N     . PHE B 1 77  ? 94.543  23.473  125.460 1.00 53.05  ? 76   PHE A N     1 
ATOM   3265 C  CA    . PHE B 1 77  ? 95.158  22.237  124.986 1.00 51.38  ? 76   PHE A CA    1 
ATOM   3266 C  C     . PHE B 1 77  ? 94.271  21.508  123.982 1.00 51.71  ? 76   PHE A C     1 
ATOM   3267 O  O     . PHE B 1 77  ? 94.766  20.976  122.982 1.00 51.36  ? 76   PHE A O     1 
ATOM   3268 C  CB    . PHE B 1 77  ? 95.489  21.311  126.152 1.00 64.16  ? 76   PHE A CB    1 
ATOM   3269 C  CG    . PHE B 1 77  ? 95.899  19.931  125.710 1.00 78.29  ? 76   PHE A CG    1 
ATOM   3270 C  CD1   . PHE B 1 77  ? 97.186  19.691  125.253 1.00 78.97  ? 76   PHE A CD1   1 
ATOM   3271 C  CD2   . PHE B 1 77  ? 94.986  18.881  125.713 1.00 81.10  ? 76   PHE A CD2   1 
ATOM   3272 C  CE1   . PHE B 1 77  ? 97.562  18.428  124.826 1.00 77.35  ? 76   PHE A CE1   1 
ATOM   3273 C  CE2   . PHE B 1 77  ? 95.355  17.616  125.286 1.00 77.08  ? 76   PHE A CE2   1 
ATOM   3274 C  CZ    . PHE B 1 77  ? 96.643  17.390  124.844 1.00 74.72  ? 76   PHE A CZ    1 
ATOM   3275 N  N     . ASP B 1 78  ? 92.962  21.455  124.231 1.00 49.01  ? 77   ASP A N     1 
ATOM   3276 C  CA    . ASP B 1 78  ? 92.109  20.708  123.315 1.00 53.54  ? 77   ASP A CA    1 
ATOM   3277 C  C     . ASP B 1 78  ? 92.030  21.379  121.950 1.00 54.89  ? 77   ASP A C     1 
ATOM   3278 O  O     . ASP B 1 78  ? 91.782  20.706  120.943 1.00 57.36  ? 77   ASP A O     1 
ATOM   3279 C  CB    . ASP B 1 78  ? 90.721  20.512  123.920 1.00 55.67  ? 77   ASP A CB    1 
ATOM   3280 C  CG    . ASP B 1 78  ? 90.707  19.432  124.988 1.00 73.33  ? 77   ASP A CG    1 
ATOM   3281 O  OD1   . ASP B 1 78  ? 91.444  18.434  124.837 1.00 75.86  ? 77   ASP A OD1   1 
ATOM   3282 O  OD2   . ASP B 1 78  ? 89.973  19.584  125.982 1.00 83.06  ? 77   ASP A OD2   1 
ATOM   3283 N  N     . ALA B 1 79  ? 92.251  22.691  121.885 1.00 52.72  ? 78   ALA A N     1 
ATOM   3284 C  CA    . ALA B 1 79  ? 92.393  23.330  120.580 1.00 52.83  ? 78   ALA A CA    1 
ATOM   3285 C  C     . ALA B 1 79  ? 93.660  22.857  119.875 1.00 49.14  ? 78   ALA A C     1 
ATOM   3286 O  O     . ALA B 1 79  ? 93.642  22.592  118.666 1.00 52.95  ? 78   ALA A O     1 
ATOM   3287 C  CB    . ALA B 1 79  ? 92.386  24.853  120.725 1.00 47.44  ? 78   ALA A CB    1 
ATOM   3288 N  N     . TYR B 1 80  ? 94.763  22.703  120.620 1.00 43.26  ? 79   TYR A N     1 
ATOM   3289 C  CA    . TYR B 1 80  ? 96.027  22.331  119.989 1.00 42.78  ? 79   TYR A CA    1 
ATOM   3290 C  C     . TYR B 1 80  ? 96.021  20.868  119.553 1.00 46.40  ? 79   TYR A C     1 
ATOM   3291 O  O     . TYR B 1 80  ? 96.574  20.524  118.499 1.00 40.52  ? 79   TYR A O     1 
ATOM   3292 C  CB    . TYR B 1 80  ? 97.196  22.602  120.937 1.00 47.00  ? 79   TYR A CB    1 
ATOM   3293 C  CG    . TYR B 1 80  ? 97.183  23.973  121.584 1.00 42.80  ? 79   TYR A CG    1 
ATOM   3294 C  CD1   . TYR B 1 80  ? 96.692  25.092  120.912 1.00 45.15  ? 79   TYR A CD1   1 
ATOM   3295 C  CD2   . TYR B 1 80  ? 97.647  24.141  122.879 1.00 50.31  ? 79   TYR A CD2   1 
ATOM   3296 C  CE1   . TYR B 1 80  ? 96.679  26.338  121.520 1.00 39.88  ? 79   TYR A CE1   1 
ATOM   3297 C  CE2   . TYR B 1 80  ? 97.642  25.373  123.489 1.00 44.22  ? 79   TYR A CE2   1 
ATOM   3298 C  CZ    . TYR B 1 80  ? 97.158  26.466  122.817 1.00 46.78  ? 79   TYR A CZ    1 
ATOM   3299 O  OH    . TYR B 1 80  ? 97.168  27.686  123.458 1.00 43.87  ? 79   TYR A OH    1 
ATOM   3300 N  N     . LYS B 1 81  ? 95.403  19.990  120.352 1.00 43.20  ? 80   LYS A N     1 
ATOM   3301 C  CA    . LYS B 1 81  ? 95.301  18.588  119.959 1.00 49.49  ? 80   LYS A CA    1 
ATOM   3302 C  C     . LYS B 1 81  ? 94.419  18.428  118.727 1.00 49.47  ? 80   LYS A C     1 
ATOM   3303 O  O     . LYS B 1 81  ? 94.703  17.598  117.853 1.00 47.19  ? 80   LYS A O     1 
ATOM   3304 C  CB    . LYS B 1 81  ? 94.759  17.754  121.122 1.00 51.13  ? 80   LYS A CB    1 
ATOM   3305 C  CG    . LYS B 1 81  ? 94.753  16.256  120.865 1.00 54.18  ? 80   LYS A CG    1 
ATOM   3306 C  CD    . LYS B 1 81  ? 96.172  15.704  120.759 1.00 60.19  ? 80   LYS A CD    1 
ATOM   3307 C  CE    . LYS B 1 81  ? 96.187  14.184  120.556 1.00 58.61  ? 80   LYS A CE    1 
ATOM   3308 N  NZ    . LYS B 1 81  ? 97.584  13.651  120.648 1.00 57.90  ? 80   LYS A NZ    1 
ATOM   3309 N  N     . GLU B 1 82  ? 93.353  19.226  118.636 1.00 52.64  ? 81   GLU A N     1 
ATOM   3310 C  CA    . GLU B 1 82  ? 92.482  19.181  117.466 1.00 58.71  ? 81   GLU A CA    1 
ATOM   3311 C  C     . GLU B 1 82  ? 93.261  19.482  116.188 1.00 45.83  ? 81   GLU A C     1 
ATOM   3312 O  O     . GLU B 1 82  ? 93.205  18.717  115.217 1.00 43.98  ? 81   GLU A O     1 
ATOM   3313 C  CB    . GLU B 1 82  ? 91.326  20.166  117.650 1.00 56.83  ? 81   GLU A CB    1 
ATOM   3314 C  CG    . GLU B 1 82  ? 90.555  20.448  116.389 1.00 71.58  ? 81   GLU A CG    1 
ATOM   3315 C  CD    . GLU B 1 82  ? 90.019  19.184  115.752 1.00 81.74  ? 81   GLU A CD    1 
ATOM   3316 O  OE1   . GLU B 1 82  ? 89.277  18.442  116.434 1.00 84.74  ? 81   GLU A OE1   1 
ATOM   3317 O  OE2   . GLU B 1 82  ? 90.354  18.930  114.574 1.00 85.69  ? 81   GLU A OE2   1 
ATOM   3318 N  N     . ALA B 1 83  ? 94.008  20.591  116.177 1.00 44.84  ? 82   ALA A N     1 
ATOM   3319 C  CA    . ALA B 1 83  ? 94.829  20.931  115.016 1.00 45.03  ? 82   ALA A CA    1 
ATOM   3320 C  C     . ALA B 1 83  ? 95.877  19.858  114.732 1.00 42.99  ? 82   ALA A C     1 
ATOM   3321 O  O     . ALA B 1 83  ? 96.154  19.540  113.570 1.00 46.64  ? 82   ALA A O     1 
ATOM   3322 C  CB    . ALA B 1 83  ? 95.503  22.287  115.235 1.00 42.26  ? 82   ALA A CB    1 
ATOM   3323 N  N     . SER B 1 84  ? 96.477  19.296  115.785 1.00 42.50  ? 83   SER A N     1 
ATOM   3324 C  CA    . SER B 1 84  ? 97.513  18.282  115.604 1.00 46.53  ? 83   SER A CA    1 
ATOM   3325 C  C     . SER B 1 84  ? 96.957  17.005  114.976 1.00 49.07  ? 83   SER A C     1 
ATOM   3326 O  O     . SER B 1 84  ? 97.594  16.416  114.090 1.00 38.91  ? 83   SER A O     1 
ATOM   3327 C  CB    . SER B 1 84  ? 98.170  17.971  116.942 1.00 37.31  ? 83   SER A CB    1 
ATOM   3328 O  OG    . SER B 1 84  ? 99.126  16.931  116.794 1.00 45.12  ? 83   SER A OG    1 
ATOM   3329 N  N     . ASN B 1 85  ? 95.782  16.547  115.432 1.00 42.42  ? 84   ASN A N     1 
ATOM   3330 C  CA    . ASN B 1 85  ? 95.164  15.381  114.803 1.00 47.38  ? 84   ASN A CA    1 
ATOM   3331 C  C     . ASN B 1 85  ? 94.865  15.659  113.342 1.00 46.07  ? 84   ASN A C     1 
ATOM   3332 O  O     . ASN B 1 85  ? 95.033  14.784  112.484 1.00 48.54  ? 84   ASN A O     1 
ATOM   3333 C  CB    . ASN B 1 85  ? 93.873  14.986  115.521 1.00 48.61  ? 84   ASN A CB    1 
ATOM   3334 C  CG    . ASN B 1 85  ? 94.109  14.467  116.925 1.00 55.34  ? 84   ASN A CG    1 
ATOM   3335 O  OD1   . ASN B 1 85  ? 95.197  13.980  117.261 1.00 53.68  ? 84   ASN A OD1   1 
ATOM   3336 N  ND2   . ASN B 1 85  ? 93.073  14.554  117.755 1.00 52.68  ? 84   ASN A ND2   1 
ATOM   3337 N  N     . HIS B 1 86  ? 94.431  16.884  113.042 1.00 46.11  ? 85   HIS A N     1 
ATOM   3338 C  CA    . HIS B 1 86  ? 94.102  17.249  111.670 1.00 52.28  ? 85   HIS A CA    1 
ATOM   3339 C  C     . HIS B 1 86  ? 95.344  17.222  110.777 1.00 51.06  ? 85   HIS A C     1 
ATOM   3340 O  O     . HIS B 1 86  ? 95.314  16.651  109.679 1.00 49.11  ? 85   HIS A O     1 
ATOM   3341 C  CB    . HIS B 1 86  ? 93.431  18.628  111.657 1.00 55.77  ? 85   HIS A CB    1 
ATOM   3342 C  CG    . HIS B 1 86  ? 92.696  18.940  110.387 1.00 64.25  ? 85   HIS A CG    1 
ATOM   3343 N  ND1   . HIS B 1 86  ? 91.673  19.863  110.329 1.00 59.68  ? 85   HIS A ND1   1 
ATOM   3344 C  CD2   . HIS B 1 86  ? 92.844  18.466  109.127 1.00 65.15  ? 85   HIS A CD2   1 
ATOM   3345 C  CE1   . HIS B 1 86  ? 91.220  19.940  109.091 1.00 64.98  ? 85   HIS A CE1   1 
ATOM   3346 N  NE2   . HIS B 1 86  ? 91.913  19.102  108.342 1.00 66.74  ? 85   HIS A NE2   1 
ATOM   3347 N  N     . ILE B 1 87  ? 96.454  17.824  111.231 1.00 46.50  ? 86   ILE A N     1 
ATOM   3348 C  CA    . ILE B 1 87  ? 97.637  17.846  110.369 1.00 39.99  ? 86   ILE A CA    1 
ATOM   3349 C  C     . ILE B 1 87  ? 98.179  16.435  110.168 1.00 39.81  ? 86   ILE A C     1 
ATOM   3350 O  O     . ILE B 1 87  ? 98.653  16.100  109.078 1.00 40.62  ? 86   ILE A O     1 
ATOM   3351 C  CB    . ILE B 1 87  ? 98.741  18.795  110.900 1.00 52.38  ? 86   ILE A CB    1 
ATOM   3352 C  CG1   . ILE B 1 87  ? 99.395  18.267  112.176 1.00 55.81  ? 86   ILE A CG1   1 
ATOM   3353 C  CG2   . ILE B 1 87  ? 98.221  20.222  111.110 1.00 41.77  ? 86   ILE A CG2   1 
ATOM   3354 C  CD1   . ILE B 1 87  ? 100.645 19.051  112.575 1.00 53.29  ? 86   ILE A CD1   1 
ATOM   3355 N  N     . ARG B 1 88  ? 98.103  15.580  111.193 1.00 39.60  ? 87   ARG A N     1 
ATOM   3356 C  CA    . ARG B 1 88  ? 98.577  14.211  111.024 1.00 48.01  ? 87   ARG A CA    1 
ATOM   3357 C  C     . ARG B 1 88  ? 97.695  13.431  110.054 1.00 55.03  ? 87   ARG A C     1 
ATOM   3358 O  O     . ARG B 1 88  ? 98.195  12.558  109.336 1.00 46.96  ? 87   ARG A O     1 
ATOM   3359 C  CB    . ARG B 1 88  ? 98.664  13.504  112.380 1.00 44.42  ? 87   ARG A CB    1 
ATOM   3360 C  CG    . ARG B 1 88  ? 100.040 13.682  113.050 1.00 45.07  ? 87   ARG A CG    1 
ATOM   3361 C  CD    . ARG B 1 88  ? 99.991  14.103  114.518 1.00 55.92  ? 87   ARG A CD    1 
ATOM   3362 N  NE    . ARG B 1 88  ? 100.096 12.972  115.428 1.00 67.77  ? 87   ARG A NE    1 
ATOM   3363 C  CZ    . ARG B 1 88  ? 100.684 13.001  116.622 1.00 65.95  ? 87   ARG A CZ    1 
ATOM   3364 N  NH1   . ARG B 1 88  ? 100.701 11.902  117.364 1.00 60.61  ? 87   ARG A NH1   1 
ATOM   3365 N  NH2   . ARG B 1 88  ? 101.270 14.105  117.074 1.00 63.63  ? 87   ARG A NH2   1 
ATOM   3366 N  N     . GLU B 1 89  ? 96.392  13.733  110.009 1.00 50.60  ? 88   GLU A N     1 
ATOM   3367 C  CA    . GLU B 1 89  ? 95.529  13.094  109.018 1.00 46.22  ? 88   GLU A CA    1 
ATOM   3368 C  C     . GLU B 1 89  ? 95.877  13.561  107.609 1.00 47.73  ? 88   GLU A C     1 
ATOM   3369 O  O     . GLU B 1 89  ? 95.818  12.777  106.655 1.00 50.44  ? 88   GLU A O     1 
ATOM   3370 C  CB    . GLU B 1 89  ? 94.057  13.371  109.336 1.00 49.14  ? 88   GLU A CB    1 
ATOM   3371 C  CG    . GLU B 1 89  ? 93.076  12.750  108.343 1.00 59.13  ? 88   GLU A CG    1 
ATOM   3372 C  CD    . GLU B 1 89  ? 92.863  13.605  107.106 1.00 65.23  ? 88   GLU A CD    1 
ATOM   3373 O  OE1   . GLU B 1 89  ? 92.962  14.845  107.217 1.00 64.26  ? 88   GLU A OE1   1 
ATOM   3374 O  OE2   . GLU B 1 89  ? 92.617  13.036  106.021 1.00 71.65  ? 88   GLU A OE2   1 
ATOM   3375 N  N     . ILE B 1 90  ? 96.232  14.839  107.463 1.00 45.84  ? 89   ILE A N     1 
ATOM   3376 C  CA    . ILE B 1 90  ? 96.712  15.349  106.182 1.00 50.27  ? 89   ILE A CA    1 
ATOM   3377 C  C     . ILE B 1 90  ? 97.986  14.623  105.759 1.00 48.52  ? 89   ILE A C     1 
ATOM   3378 O  O     . ILE B 1 90  ? 98.126  14.204  104.601 1.00 47.28  ? 89   ILE A O     1 
ATOM   3379 C  CB    . ILE B 1 90  ? 96.915  16.874  106.279 1.00 53.23  ? 89   ILE A CB    1 
ATOM   3380 C  CG1   . ILE B 1 90  ? 95.548  17.576  106.316 1.00 52.65  ? 89   ILE A CG1   1 
ATOM   3381 C  CG2   . ILE B 1 90  ? 97.813  17.400  105.149 1.00 42.19  ? 89   ILE A CG2   1 
ATOM   3382 C  CD1   . ILE B 1 90  ? 95.622  19.067  106.592 1.00 50.95  ? 89   ILE A CD1   1 
ATOM   3383 N  N     . PHE B 1 91  ? 98.933  14.458  106.691 1.00 41.09  ? 90   PHE A N     1 
ATOM   3384 C  CA    . PHE B 1 91  ? 100.158 13.724  106.379 1.00 47.71  ? 90   PHE A CA    1 
ATOM   3385 C  C     . PHE B 1 91  ? 99.844  12.340  105.821 1.00 49.99  ? 90   PHE A C     1 
ATOM   3386 O  O     . PHE B 1 91  ? 100.518 11.862  104.899 1.00 47.28  ? 90   PHE A O     1 
ATOM   3387 C  CB    . PHE B 1 91  ? 101.026 13.594  107.627 1.00 39.14  ? 90   PHE A CB    1 
ATOM   3388 C  CG    . PHE B 1 91  ? 101.504 14.911  108.192 1.00 39.66  ? 90   PHE A CG    1 
ATOM   3389 C  CD1   . PHE B 1 91  ? 101.620 16.030  107.389 1.00 37.34  ? 90   PHE A CD1   1 
ATOM   3390 C  CD2   . PHE B 1 91  ? 101.846 15.013  109.535 1.00 45.05  ? 90   PHE A CD2   1 
ATOM   3391 C  CE1   . PHE B 1 91  ? 102.057 17.226  107.901 1.00 38.71  ? 90   PHE A CE1   1 
ATOM   3392 C  CE2   . PHE B 1 91  ? 102.292 16.217  110.068 1.00 41.75  ? 90   PHE A CE2   1 
ATOM   3393 C  CZ    . PHE B 1 91  ? 102.398 17.329  109.250 1.00 43.06  ? 90   PHE A CZ    1 
ATOM   3394 N  N     . SER B 1 92  ? 98.809  11.693  106.366 1.00 44.06  ? 91   SER A N     1 
ATOM   3395 C  CA    . SER B 1 92  ? 98.462  10.324  106.015 1.00 48.96  ? 91   SER A CA    1 
ATOM   3396 C  C     . SER B 1 92  ? 97.867  10.212  104.626 1.00 52.24  ? 91   SER A C     1 
ATOM   3397 O  O     . SER B 1 92  ? 97.784  9.100   104.094 1.00 47.92  ? 91   SER A O     1 
ATOM   3398 C  CB    . SER B 1 92  ? 97.474  9.763   107.035 1.00 50.63  ? 91   SER A CB    1 
ATOM   3399 O  OG    . SER B 1 92  ? 96.156  10.210  106.750 1.00 50.05  ? 91   SER A OG    1 
ATOM   3400 N  N     . ARG B 1 93  ? 97.430  11.323  104.031 1.00 46.32  ? 92   ARG A N     1 
ATOM   3401 C  CA    . ARG B 1 93  ? 96.996  11.254  102.644 1.00 54.82  ? 92   ARG A CA    1 
ATOM   3402 C  C     . ARG B 1 93  ? 98.169  11.041  101.703 1.00 52.72  ? 92   ARG A C     1 
ATOM   3403 O  O     . ARG B 1 93  ? 97.964  10.612  100.563 1.00 53.55  ? 92   ARG A O     1 
ATOM   3404 C  CB    . ARG B 1 93  ? 96.253  12.531  102.245 1.00 59.77  ? 92   ARG A CB    1 
ATOM   3405 C  CG    . ARG B 1 93  ? 95.147  12.938  103.194 1.00 57.98  ? 92   ARG A CG    1 
ATOM   3406 C  CD    . ARG B 1 93  ? 94.671  14.348  102.894 1.00 57.90  ? 92   ARG A CD    1 
ATOM   3407 N  NE    . ARG B 1 93  ? 93.714  14.824  103.889 1.00 59.48  ? 92   ARG A NE    1 
ATOM   3408 C  CZ    . ARG B 1 93  ? 93.145  16.025  103.863 1.00 52.93  ? 92   ARG A CZ    1 
ATOM   3409 N  NH1   . ARG B 1 93  ? 93.436  16.868  102.892 1.00 48.11  ? 92   ARG A NH1   1 
ATOM   3410 N  NH2   . ARG B 1 93  ? 92.285  16.381  104.807 1.00 59.34  ? 92   ARG A NH2   1 
ATOM   3411 N  N     . TYR B 1 94  ? 99.389  11.331  102.154 1.00 45.63  ? 93   TYR A N     1 
ATOM   3412 C  CA    . TYR B 1 94  ? 100.565 11.321  101.292 1.00 54.11  ? 93   TYR A CA    1 
ATOM   3413 C  C     . TYR B 1 94  ? 101.447 10.107  101.506 1.00 54.56  ? 93   TYR A C     1 
ATOM   3414 O  O     . TYR B 1 94  ? 101.991 9.565   100.538 1.00 54.31  ? 93   TYR A O     1 
ATOM   3415 C  CB    . TYR B 1 94  ? 101.387 12.600  101.500 1.00 54.19  ? 93   TYR A CB    1 
ATOM   3416 C  CG    . TYR B 1 94  ? 100.706 13.791  100.888 1.00 54.82  ? 93   TYR A CG    1 
ATOM   3417 C  CD1   . TYR B 1 94  ? 99.768  14.522  101.606 1.00 51.62  ? 93   TYR A CD1   1 
ATOM   3418 C  CD2   . TYR B 1 94  ? 100.960 14.157  99.574  1.00 56.12  ? 93   TYR A CD2   1 
ATOM   3419 C  CE1   . TYR B 1 94  ? 99.123  15.599  101.033 1.00 51.11  ? 93   TYR A CE1   1 
ATOM   3420 C  CE2   . TYR B 1 94  ? 100.324 15.236  98.998  1.00 52.43  ? 93   TYR A CE2   1 
ATOM   3421 C  CZ    . TYR B 1 94  ? 99.404  15.946  99.729  1.00 49.45  ? 93   TYR A CZ    1 
ATOM   3422 O  OH    . TYR B 1 94  ? 98.769  17.018  99.157  1.00 59.13  ? 93   TYR A OH    1 
ATOM   3423 N  N     . THR B 1 95  ? 101.596 9.667   102.752 1.00 50.24  ? 94   THR A N     1 
ATOM   3424 C  CA    . THR B 1 95  ? 102.299 8.426   103.031 1.00 55.04  ? 94   THR A CA    1 
ATOM   3425 C  C     . THR B 1 95  ? 101.827 7.893   104.374 1.00 58.12  ? 94   THR A C     1 
ATOM   3426 O  O     . THR B 1 95  ? 101.249 8.620   105.185 1.00 53.80  ? 94   THR A O     1 
ATOM   3427 C  CB    . THR B 1 95  ? 103.819 8.625   103.025 1.00 47.33  ? 94   THR A CB    1 
ATOM   3428 O  OG1   . THR B 1 95  ? 104.466 7.383   103.326 1.00 50.80  ? 94   THR A OG1   1 
ATOM   3429 C  CG2   . THR B 1 95  ? 104.234 9.682   104.048 1.00 42.59  ? 94   THR A CG2   1 
ATOM   3430 N  N     . SER B 1 96  ? 102.066 6.604   104.591 1.00 59.25  ? 95   SER A N     1 
ATOM   3431 C  CA    . SER B 1 96  ? 101.889 6.018   105.912 1.00 54.87  ? 95   SER A CA    1 
ATOM   3432 C  C     . SER B 1 96  ? 103.160 6.067   106.748 1.00 49.32  ? 95   SER A C     1 
ATOM   3433 O  O     . SER B 1 96  ? 103.113 5.737   107.938 1.00 52.48  ? 95   SER A O     1 
ATOM   3434 C  CB    . SER B 1 96  ? 101.417 4.566   105.790 1.00 54.50  ? 95   SER A CB    1 
ATOM   3435 O  OG    . SER B 1 96  ? 102.442 3.762   105.229 1.00 53.81  ? 95   SER A OG    1 
ATOM   3436 N  N     . ARG B 1 97  ? 104.290 6.474   106.161 1.00 45.13  ? 96   ARG A N     1 
ATOM   3437 C  CA    . ARG B 1 97  ? 105.569 6.535   106.876 1.00 42.56  ? 96   ARG A CA    1 
ATOM   3438 C  C     . ARG B 1 97  ? 105.683 7.896   107.565 1.00 42.60  ? 96   ARG A C     1 
ATOM   3439 O  O     . ARG B 1 97  ? 106.292 8.848   107.065 1.00 43.06  ? 96   ARG A O     1 
ATOM   3440 C  CB    . ARG B 1 97  ? 106.723 6.266   105.916 1.00 47.27  ? 96   ARG A CB    1 
ATOM   3441 C  CG    . ARG B 1 97  ? 106.442 5.081   104.978 1.00 49.92  ? 96   ARG A CG    1 
ATOM   3442 C  CD    . ARG B 1 97  ? 107.545 4.025   105.021 1.00 54.70  ? 96   ARG A CD    1 
ATOM   3443 N  NE    . ARG B 1 97  ? 108.376 4.141   106.213 1.00 52.50  ? 96   ARG A NE    1 
ATOM   3444 C  CZ    . ARG B 1 97  ? 109.702 4.050   106.206 1.00 61.97  ? 96   ARG A CZ    1 
ATOM   3445 N  NH1   . ARG B 1 97  ? 110.346 3.841   105.061 1.00 63.14  ? 96   ARG A NH1   1 
ATOM   3446 N  NH2   . ARG B 1 97  ? 110.388 4.175   107.339 1.00 52.10  ? 96   ARG A NH2   1 
ATOM   3447 N  N     . ILE B 1 98  ? 105.079 7.974   108.750 1.00 41.75  ? 97   ILE A N     1 
ATOM   3448 C  CA    . ILE B 1 98  ? 104.950 9.206   109.517 1.00 42.01  ? 97   ILE A CA    1 
ATOM   3449 C  C     . ILE B 1 98  ? 105.455 8.947   110.926 1.00 48.63  ? 97   ILE A C     1 
ATOM   3450 O  O     . ILE B 1 98  ? 104.998 8.012   111.591 1.00 48.90  ? 97   ILE A O     1 
ATOM   3451 C  CB    . ILE B 1 98  ? 103.493 9.696   109.580 1.00 43.58  ? 97   ILE A CB    1 
ATOM   3452 C  CG1   . ILE B 1 98  ? 102.920 9.868   108.177 1.00 39.84  ? 97   ILE A CG1   1 
ATOM   3453 C  CG2   . ILE B 1 98  ? 103.408 10.989  110.403 1.00 38.40  ? 97   ILE A CG2   1 
ATOM   3454 C  CD1   . ILE B 1 98  ? 101.417 9.769   108.137 1.00 47.00  ? 97   ILE A CD1   1 
ATOM   3455 N  N     . GLU B 1 99  ? 106.382 9.783   111.387 1.00 41.49  ? 98   GLU A N     1 
ATOM   3456 C  CA    . GLU B 1 99  ? 106.880 9.734   112.757 1.00 42.04  ? 98   GLU A CA    1 
ATOM   3457 C  C     . GLU B 1 99  ? 106.605 11.083  113.409 1.00 40.07  ? 98   GLU A C     1 
ATOM   3458 O  O     . GLU B 1 99  ? 107.429 12.009  113.312 1.00 39.35  ? 98   GLU A O     1 
ATOM   3459 C  CB    . GLU B 1 99  ? 108.367 9.380   112.792 1.00 39.10  ? 98   GLU A CB    1 
ATOM   3460 C  CG    . GLU B 1 99  ? 108.971 9.477   114.190 1.00 41.06  ? 98   GLU A CG    1 
ATOM   3461 C  CD    . GLU B 1 99  ? 110.383 8.955   114.256 1.00 55.87  ? 98   GLU A CD    1 
ATOM   3462 O  OE1   . GLU B 1 99  ? 110.871 8.403   113.240 1.00 48.62  ? 98   GLU A OE1   1 
ATOM   3463 O  OE2   . GLU B 1 99  ? 111.000 9.089   115.333 1.00 53.56  ? 98   GLU A OE2   1 
ATOM   3464 N  N     . PRO B 1 100 ? 105.462 11.243  114.084 1.00 43.79  ? 99   PRO A N     1 
ATOM   3465 C  CA    . PRO B 1 100 ? 105.232 12.477  114.850 1.00 44.00  ? 99   PRO A CA    1 
ATOM   3466 C  C     . PRO B 1 100 ? 106.270 12.613  115.955 1.00 45.41  ? 99   PRO A C     1 
ATOM   3467 O  O     . PRO B 1 100 ? 106.624 11.639  116.623 1.00 38.32  ? 99   PRO A O     1 
ATOM   3468 C  CB    . PRO B 1 100 ? 103.820 12.294  115.424 1.00 45.46  ? 99   PRO A CB    1 
ATOM   3469 C  CG    . PRO B 1 100 ? 103.209 11.146  114.644 1.00 47.52  ? 99   PRO A CG    1 
ATOM   3470 C  CD    . PRO B 1 100 ? 104.360 10.272  114.244 1.00 42.40  ? 99   PRO A CD    1 
ATOM   3471 N  N     . LEU B 1 101 ? 106.789 13.827  116.119 1.00 43.54  ? 100  LEU A N     1 
ATOM   3472 C  CA    . LEU B 1 101 ? 107.764 14.119  117.165 1.00 48.69  ? 100  LEU A CA    1 
ATOM   3473 C  C     . LEU B 1 101 ? 107.176 14.921  118.314 1.00 44.94  ? 100  LEU A C     1 
ATOM   3474 O  O     . LEU B 1 101 ? 107.791 14.993  119.383 1.00 41.87  ? 100  LEU A O     1 
ATOM   3475 C  CB    . LEU B 1 101 ? 108.959 14.887  116.581 1.00 46.20  ? 100  LEU A CB    1 
ATOM   3476 C  CG    . LEU B 1 101 ? 109.752 14.163  115.495 1.00 49.26  ? 100  LEU A CG    1 
ATOM   3477 C  CD1   . LEU B 1 101 ? 110.914 15.014  115.028 1.00 44.67  ? 100  LEU A CD1   1 
ATOM   3478 C  CD2   . LEU B 1 101 ? 110.237 12.819  115.998 1.00 50.82  ? 100  LEU A CD2   1 
ATOM   3479 N  N     . SER B 1 102 ? 106.011 15.512  118.113 1.00 35.76  ? 101  SER A N     1 
ATOM   3480 C  CA    . SER B 1 102 ? 105.305 16.349  119.072 1.00 37.60  ? 101  SER A CA    1 
ATOM   3481 C  C     . SER B 1 102 ? 103.948 16.606  118.441 1.00 35.97  ? 101  SER A C     1 
ATOM   3482 O  O     . SER B 1 102 ? 103.669 16.129  117.337 1.00 40.22  ? 101  SER A O     1 
ATOM   3483 C  CB    . SER B 1 102 ? 106.044 17.663  119.343 1.00 40.42  ? 101  SER A CB    1 
ATOM   3484 O  OG    . SER B 1 102 ? 106.070 18.469  118.171 1.00 38.75  ? 101  SER A OG    1 
ATOM   3485 N  N     . LEU B 1 103 ? 103.126 17.406  119.112 1.00 35.14  ? 102  LEU A N     1 
ATOM   3486 C  CA    . LEU B 1 103 ? 101.854 17.795  118.508 1.00 42.21  ? 102  LEU A CA    1 
ATOM   3487 C  C     . LEU B 1 103 ? 102.052 18.402  117.123 1.00 41.79  ? 102  LEU A C     1 
ATOM   3488 O  O     . LEU B 1 103 ? 101.281 18.123  116.198 1.00 42.52  ? 102  LEU A O     1 
ATOM   3489 C  CB    . LEU B 1 103 ? 101.119 18.789  119.406 1.00 35.47  ? 102  LEU A CB    1 
ATOM   3490 C  CG    . LEU B 1 103 ? 100.394 18.269  120.643 1.00 43.90  ? 102  LEU A CG    1 
ATOM   3491 C  CD1   . LEU B 1 103 ? 99.350  19.288  121.049 1.00 42.43  ? 102  LEU A CD1   1 
ATOM   3492 C  CD2   . LEU B 1 103 ? 99.762  16.905  120.386 1.00 53.19  ? 102  LEU A CD2   1 
ATOM   3493 N  N     . ASP B 1 104 ? 103.097 19.214  116.951 1.00 36.33  ? 103  ASP A N     1 
ATOM   3494 C  CA    . ASP B 1 104 ? 103.164 20.126  115.818 1.00 41.52  ? 103  ASP A CA    1 
ATOM   3495 C  C     . ASP B 1 104 ? 104.224 19.756  114.789 1.00 39.05  ? 103  ASP A C     1 
ATOM   3496 O  O     . ASP B 1 104 ? 104.462 20.535  113.859 1.00 40.07  ? 103  ASP A O     1 
ATOM   3497 C  CB    . ASP B 1 104 ? 103.379 21.563  116.321 1.00 39.76  ? 103  ASP A CB    1 
ATOM   3498 C  CG    . ASP B 1 104 ? 104.860 21.980  116.392 1.00 34.18  ? 103  ASP A CG    1 
ATOM   3499 O  OD1   . ASP B 1 104 ? 105.729 21.195  116.820 1.00 37.22  ? 103  ASP A OD1   1 
ATOM   3500 O  OD2   . ASP B 1 104 ? 105.156 23.124  116.014 1.00 35.21  ? 103  ASP A OD2   1 
ATOM   3501 N  N     . GLU B 1 105 ? 104.867 18.599  114.906 1.00 36.74  ? 104  GLU A N     1 
ATOM   3502 C  CA    . GLU B 1 105 ? 105.846 18.272  113.881 1.00 37.75  ? 104  GLU A CA    1 
ATOM   3503 C  C     . GLU B 1 105 ? 105.926 16.766  113.678 1.00 38.34  ? 104  GLU A C     1 
ATOM   3504 O  O     . GLU B 1 105 ? 105.582 15.979  114.565 1.00 35.13  ? 104  GLU A O     1 
ATOM   3505 C  CB    . GLU B 1 105 ? 107.231 18.848  114.205 1.00 46.81  ? 104  GLU A CB    1 
ATOM   3506 C  CG    . GLU B 1 105 ? 107.769 18.496  115.552 1.00 54.97  ? 104  GLU A CG    1 
ATOM   3507 C  CD    . GLU B 1 105 ? 109.095 19.192  115.849 1.00 60.95  ? 104  GLU A CD    1 
ATOM   3508 O  OE1   . GLU B 1 105 ? 110.156 18.608  115.540 1.00 60.11  ? 104  GLU A OE1   1 
ATOM   3509 O  OE2   . GLU B 1 105 ? 109.075 20.322  116.382 1.00 69.10  ? 104  GLU A OE2   1 
ATOM   3510 N  N     . ALA B 1 106 ? 106.394 16.389  112.490 1.00 33.89  ? 105  ALA A N     1 
ATOM   3511 C  CA    . ALA B 1 106 ? 106.490 15.004  112.060 1.00 39.13  ? 105  ALA A CA    1 
ATOM   3512 C  C     . ALA B 1 106 ? 107.580 14.876  111.007 1.00 39.06  ? 105  ALA A C     1 
ATOM   3513 O  O     . ALA B 1 106 ? 107.806 15.799  110.224 1.00 35.37  ? 105  ALA A O     1 
ATOM   3514 C  CB    . ALA B 1 106 ? 105.161 14.521  111.487 1.00 33.57  ? 105  ALA A CB    1 
ATOM   3515 N  N     . TYR B 1 107 ? 108.270 13.736  111.009 1.00 39.79  ? 106  TYR A N     1 
ATOM   3516 C  CA    . TYR B 1 107 ? 109.036 13.308  109.845 1.00 32.40  ? 106  TYR A CA    1 
ATOM   3517 C  C     . TYR B 1 107 ? 108.140 12.497  108.934 1.00 33.91  ? 106  TYR A C     1 
ATOM   3518 O  O     . TYR B 1 107 ? 107.347 11.677  109.406 1.00 38.55  ? 106  TYR A O     1 
ATOM   3519 C  CB    . TYR B 1 107 ? 110.232 12.434  110.226 1.00 37.52  ? 106  TYR A CB    1 
ATOM   3520 C  CG    . TYR B 1 107 ? 111.396 13.129  110.884 1.00 40.01  ? 106  TYR A CG    1 
ATOM   3521 C  CD1   . TYR B 1 107 ? 112.097 14.122  110.223 1.00 38.28  ? 106  TYR A CD1   1 
ATOM   3522 C  CD2   . TYR B 1 107 ? 111.830 12.742  112.155 1.00 33.99  ? 106  TYR A CD2   1 
ATOM   3523 C  CE1   . TYR B 1 107 ? 113.179 14.742  110.825 1.00 42.67  ? 106  TYR A CE1   1 
ATOM   3524 C  CE2   . TYR B 1 107 ? 112.914 13.355  112.758 1.00 37.80  ? 106  TYR A CE2   1 
ATOM   3525 C  CZ    . TYR B 1 107 ? 113.580 14.350  112.090 1.00 40.75  ? 106  TYR A CZ    1 
ATOM   3526 O  OH    . TYR B 1 107 ? 114.647 14.966  112.685 1.00 48.01  ? 106  TYR A OH    1 
ATOM   3527 N  N     . LEU B 1 108 ? 108.301 12.694  107.627 1.00 34.28  ? 107  LEU A N     1 
ATOM   3528 C  CA    . LEU B 1 108 ? 107.678 11.862  106.603 1.00 37.37  ? 107  LEU A CA    1 
ATOM   3529 C  C     . LEU B 1 108 ? 108.752 11.259  105.706 1.00 44.83  ? 107  LEU A C     1 
ATOM   3530 O  O     . LEU B 1 108 ? 109.702 11.945  105.318 1.00 35.64  ? 107  LEU A O     1 
ATOM   3531 C  CB    . LEU B 1 108 ? 106.705 12.663  105.726 1.00 42.02  ? 107  LEU A CB    1 
ATOM   3532 C  CG    . LEU B 1 108 ? 105.268 12.866  106.187 1.00 50.07  ? 107  LEU A CG    1 
ATOM   3533 C  CD1   . LEU B 1 108 ? 105.212 13.393  107.604 1.00 54.88  ? 107  LEU A CD1   1 
ATOM   3534 C  CD2   . LEU B 1 108 ? 104.592 13.833  105.238 1.00 57.25  ? 107  LEU A CD2   1 
ATOM   3535 N  N     . ASP B 1 109 ? 108.601 9.980   105.366 1.00 37.98  ? 108  ASP A N     1 
ATOM   3536 C  CA    . ASP B 1 109 ? 109.467 9.331   104.387 1.00 38.08  ? 108  ASP A CA    1 
ATOM   3537 C  C     . ASP B 1 109 ? 108.671 9.180   103.097 1.00 48.72  ? 108  ASP A C     1 
ATOM   3538 O  O     . ASP B 1 109 ? 107.779 8.327   103.012 1.00 44.99  ? 108  ASP A O     1 
ATOM   3539 C  CB    . ASP B 1 109 ? 109.960 7.972   104.893 1.00 46.54  ? 108  ASP A CB    1 
ATOM   3540 C  CG    . ASP B 1 109 ? 111.010 7.346   103.976 1.00 47.86  ? 108  ASP A CG    1 
ATOM   3541 O  OD1   . ASP B 1 109 ? 110.903 7.491   102.748 1.00 46.82  ? 108  ASP A OD1   1 
ATOM   3542 O  OD2   . ASP B 1 109 ? 111.961 6.723   104.486 1.00 56.48  ? 108  ASP A OD2   1 
ATOM   3543 N  N     . VAL B 1 110 ? 108.992 10.003  102.095 1.00 43.09  ? 109  VAL A N     1 
ATOM   3544 C  CA    . VAL B 1 110 ? 108.288 9.936   100.818 1.00 48.57  ? 109  VAL A CA    1 
ATOM   3545 C  C     . VAL B 1 110 ? 109.198 9.376   99.726  1.00 54.39  ? 109  VAL A C     1 
ATOM   3546 O  O     . VAL B 1 110 ? 109.010 9.676   98.542  1.00 53.53  ? 109  VAL A O     1 
ATOM   3547 C  CB    . VAL B 1 110 ? 107.720 11.314  100.416 1.00 40.69  ? 109  VAL A CB    1 
ATOM   3548 C  CG1   . VAL B 1 110 ? 106.702 11.786  101.434 1.00 46.12  ? 109  VAL A CG1   1 
ATOM   3549 C  CG2   . VAL B 1 110 ? 108.827 12.350  100.262 1.00 39.91  ? 109  VAL A CG2   1 
ATOM   3550 N  N     . THR B 1 111 ? 110.172 8.539   100.107 1.00 43.94  ? 110  THR A N     1 
ATOM   3551 C  CA    . THR B 1 111 ? 111.067 7.934   99.116  1.00 52.73  ? 110  THR A CA    1 
ATOM   3552 C  C     . THR B 1 111 ? 110.287 7.264   97.988  1.00 53.27  ? 110  THR A C     1 
ATOM   3553 O  O     . THR B 1 111 ? 110.608 7.432   96.804  1.00 62.11  ? 110  THR A O     1 
ATOM   3554 C  CB    . THR B 1 111 ? 111.992 6.904   99.777  1.00 51.28  ? 110  THR A CB    1 
ATOM   3555 O  OG1   . THR B 1 111 ? 112.826 7.539   100.748 1.00 49.70  ? 110  THR A OG1   1 
ATOM   3556 C  CG2   . THR B 1 111 ? 112.875 6.202   98.723  1.00 45.44  ? 110  THR A CG2   1 
ATOM   3557 N  N     . ASP B 1 112 ? 109.250 6.507   98.335  1.00 50.09  ? 111  ASP A N     1 
ATOM   3558 C  CA    . ASP B 1 112 ? 108.506 5.720   97.347  1.00 79.62  ? 111  ASP A CA    1 
ATOM   3559 C  C     . ASP B 1 112 ? 107.153 6.336   97.004  1.00 82.20  ? 111  ASP A C     1 
ATOM   3560 O  O     . ASP B 1 112 ? 106.164 5.616   96.840  1.00 77.13  ? 111  ASP A O     1 
ATOM   3561 C  CB    . ASP B 1 112 ? 108.323 4.286   97.842  1.00 84.83  ? 111  ASP A CB    1 
ATOM   3562 C  CG    . ASP B 1 112 ? 109.598 3.463   97.747  1.00 90.21  ? 111  ASP A CG    1 
ATOM   3563 O  OD1   . ASP B 1 112 ? 110.364 3.655   96.774  1.00 89.85  ? 111  ASP A OD1   1 
ATOM   3564 O  OD2   . ASP B 1 112 ? 109.827 2.624   98.648  1.00 88.18  ? 111  ASP A OD2   1 
ATOM   3565 N  N     . SER B 1 113 ? 107.069 7.655   96.863  1.00 78.43  ? 112  SER A N     1 
ATOM   3566 C  CA    . SER B 1 113 ? 105.778 8.312   96.716  1.00 76.47  ? 112  SER A CA    1 
ATOM   3567 C  C     . SER B 1 113 ? 105.366 8.426   95.253  1.00 66.23  ? 112  SER A C     1 
ATOM   3568 O  O     . SER B 1 113 ? 106.156 8.852   94.403  1.00 62.49  ? 112  SER A O     1 
ATOM   3569 C  CB    . SER B 1 113 ? 105.795 9.699   97.352  1.00 78.27  ? 112  SER A CB    1 
ATOM   3570 O  OG    . SER B 1 113 ? 104.539 10.330  97.171  1.00 75.84  ? 112  SER A OG    1 
ATOM   3571 N  N     . VAL B 1 114 ? 104.106 8.082   94.983  1.00 61.44  ? 113  VAL A N     1 
ATOM   3572 C  CA    . VAL B 1 114 ? 103.501 8.215   93.662  1.00 74.31  ? 113  VAL A CA    1 
ATOM   3573 C  C     . VAL B 1 114 ? 102.662 9.487   93.608  1.00 73.78  ? 113  VAL A C     1 
ATOM   3574 O  O     . VAL B 1 114 ? 101.707 9.572   92.829  1.00 76.94  ? 113  VAL A O     1 
ATOM   3575 C  CB    . VAL B 1 114 ? 102.623 6.991   93.316  1.00 74.60  ? 113  VAL A CB    1 
ATOM   3576 C  CG1   . VAL B 1 114 ? 103.463 5.733   93.116  1.00 67.90  ? 113  VAL A CG1   1 
ATOM   3577 C  CG2   . VAL B 1 114 ? 101.564 6.767   94.395  1.00 76.44  ? 113  VAL A CG2   1 
ATOM   3578 N  N     . HIS B 1 115 ? 102.996 10.484  94.425  1.00 62.03  ? 114  HIS A N     1 
ATOM   3579 C  CA    . HIS B 1 115 ? 102.056 11.584  94.626  1.00 73.23  ? 114  HIS A CA    1 
ATOM   3580 C  C     . HIS B 1 115 ? 102.335 12.813  93.769  1.00 76.48  ? 114  HIS A C     1 
ATOM   3581 O  O     . HIS B 1 115 ? 101.417 13.326  93.121  1.00 82.67  ? 114  HIS A O     1 
ATOM   3582 C  CB    . HIS B 1 115 ? 101.998 11.971  96.105  1.00 68.93  ? 114  HIS A CB    1 
ATOM   3583 C  CG    . HIS B 1 115 ? 100.825 11.377  96.818  1.00 77.36  ? 114  HIS A CG    1 
ATOM   3584 N  ND1   . HIS B 1 115 ? 99.578  11.965  96.813  1.00 78.84  ? 114  HIS A ND1   1 
ATOM   3585 C  CD2   . HIS B 1 115 ? 100.697 10.229  97.526  1.00 78.20  ? 114  HIS A CD2   1 
ATOM   3586 C  CE1   . HIS B 1 115 ? 98.737  11.215  97.501  1.00 79.15  ? 114  HIS A CE1   1 
ATOM   3587 N  NE2   . HIS B 1 115 ? 99.391  10.156  97.945  1.00 82.58  ? 114  HIS A NE2   1 
ATOM   3588 N  N     . CYS B 1 116 ? 103.562 13.319  93.753  1.00 61.62  ? 115  CYS A N     1 
ATOM   3589 C  CA    . CYS B 1 116 ? 103.817 14.461  92.878  1.00 63.18  ? 115  CYS A CA    1 
ATOM   3590 C  C     . CYS B 1 116 ? 104.925 14.118  91.895  1.00 54.44  ? 115  CYS A C     1 
ATOM   3591 O  O     . CYS B 1 116 ? 105.956 14.799  91.840  1.00 52.70  ? 115  CYS A O     1 
ATOM   3592 C  CB    . CYS B 1 116 ? 104.177 15.702  93.697  1.00 66.71  ? 115  CYS A CB    1 
ATOM   3593 S  SG    . CYS B 1 116 ? 102.805 16.353  94.679  1.00 59.75  ? 115  CYS A SG    1 
ATOM   3594 N  N     . HIS B 1 117 ? 104.724 13.039  91.141  1.00 53.84  ? 116  HIS A N     1 
ATOM   3595 C  CA    . HIS B 1 117 ? 105.783 12.422  90.344  1.00 58.63  ? 116  HIS A CA    1 
ATOM   3596 C  C     . HIS B 1 117 ? 107.007 12.121  91.203  1.00 59.05  ? 116  HIS A C     1 
ATOM   3597 O  O     . HIS B 1 117 ? 108.140 12.106  90.715  1.00 57.55  ? 116  HIS A O     1 
ATOM   3598 C  CB    . HIS B 1 117 ? 106.143 13.292  89.138  1.00 67.25  ? 116  HIS A CB    1 
ATOM   3599 C  CG    . HIS B 1 117 ? 104.957 13.668  88.306  1.00 76.55  ? 116  HIS A CG    1 
ATOM   3600 N  ND1   . HIS B 1 117 ? 104.150 14.745  88.606  1.00 76.96  ? 116  HIS A ND1   1 
ATOM   3601 C  CD2   . HIS B 1 117 ? 104.421 13.091  87.204  1.00 82.39  ? 116  HIS A CD2   1 
ATOM   3602 C  CE1   . HIS B 1 117 ? 103.179 14.825  87.715  1.00 74.30  ? 116  HIS A CE1   1 
ATOM   3603 N  NE2   . HIS B 1 117 ? 103.319 13.832  86.855  1.00 78.02  ? 116  HIS A NE2   1 
ATOM   3604 N  N     . GLY B 1 118 ? 106.774 11.868  92.493  1.00 52.07  ? 117  GLY A N     1 
ATOM   3605 C  CA    . GLY B 1 118 ? 107.857 11.588  93.407  1.00 59.08  ? 117  GLY A CA    1 
ATOM   3606 C  C     . GLY B 1 118 ? 108.667 12.798  93.797  1.00 65.28  ? 117  GLY A C     1 
ATOM   3607 O  O     . GLY B 1 118 ? 109.780 12.647  94.304  1.00 61.19  ? 117  GLY A O     1 
ATOM   3608 N  N     . SER B 1 119 ? 108.150 14.002  93.566  1.00 60.20  ? 118  SER A N     1 
ATOM   3609 C  CA    . SER B 1 119 ? 108.859 15.216  93.947  1.00 48.80  ? 118  SER A CA    1 
ATOM   3610 C  C     . SER B 1 119 ? 108.620 15.480  95.428  1.00 50.10  ? 118  SER A C     1 
ATOM   3611 O  O     . SER B 1 119 ? 107.502 15.806  95.838  1.00 43.08  ? 118  SER A O     1 
ATOM   3612 C  CB    . SER B 1 119 ? 108.400 16.398  93.100  1.00 50.89  ? 118  SER A CB    1 
ATOM   3613 O  OG    . SER B 1 119 ? 108.856 17.614  93.664  1.00 50.01  ? 118  SER A OG    1 
ATOM   3614 N  N     . ALA B 1 120 ? 109.668 15.334  96.237  1.00 43.22  ? 119  ALA A N     1 
ATOM   3615 C  CA    . ALA B 1 120 ? 109.529 15.650  97.650  1.00 43.16  ? 119  ALA A CA    1 
ATOM   3616 C  C     . ALA B 1 120 ? 109.336 17.148  97.866  1.00 38.88  ? 119  ALA A C     1 
ATOM   3617 O  O     . ALA B 1 120 ? 108.680 17.554  98.834  1.00 38.06  ? 119  ALA A O     1 
ATOM   3618 C  CB    . ALA B 1 120 ? 110.742 15.126  98.423  1.00 47.08  ? 119  ALA A CB    1 
ATOM   3619 N  N     . THR B 1 121 ? 109.880 17.980  96.974  1.00 42.98  ? 120  THR A N     1 
ATOM   3620 C  CA    . THR B 1 121 ? 109.629 19.421  97.041  1.00 48.34  ? 120  THR A CA    1 
ATOM   3621 C  C     . THR B 1 121 ? 108.150 19.731  96.833  1.00 43.40  ? 120  THR A C     1 
ATOM   3622 O  O     . THR B 1 121 ? 107.539 20.477  97.610  1.00 44.28  ? 120  THR A O     1 
ATOM   3623 C  CB    . THR B 1 121 ? 110.473 20.169  95.998  1.00 47.57  ? 120  THR A CB    1 
ATOM   3624 O  OG1   . THR B 1 121 ? 111.867 19.974  96.262  1.00 48.11  ? 120  THR A OG1   1 
ATOM   3625 C  CG2   . THR B 1 121 ? 110.167 21.675  96.039  1.00 46.46  ? 120  THR A CG2   1 
ATOM   3626 N  N     . LEU B 1 122 ? 107.555 19.176  95.782  1.00 44.45  ? 121  LEU A N     1 
ATOM   3627 C  CA    . LEU B 1 122 ? 106.151 19.465  95.517  1.00 51.08  ? 121  LEU A CA    1 
ATOM   3628 C  C     . LEU B 1 122 ? 105.241 18.828  96.560  1.00 45.51  ? 121  LEU A C     1 
ATOM   3629 O  O     . LEU B 1 122 ? 104.217 19.417  96.921  1.00 43.68  ? 121  LEU A O     1 
ATOM   3630 C  CB    . LEU B 1 122 ? 105.778 19.007  94.110  1.00 49.93  ? 121  LEU A CB    1 
ATOM   3631 C  CG    . LEU B 1 122 ? 106.515 19.698  92.956  1.00 55.10  ? 121  LEU A CG    1 
ATOM   3632 C  CD1   . LEU B 1 122 ? 106.212 18.993  91.662  1.00 52.35  ? 121  LEU A CD1   1 
ATOM   3633 C  CD2   . LEU B 1 122 ? 106.141 21.177  92.847  1.00 51.84  ? 121  LEU A CD2   1 
ATOM   3634 N  N     . ILE B 1 123 ? 105.604 17.646  97.074  1.00 45.19  ? 122  ILE A N     1 
ATOM   3635 C  CA    . ILE B 1 123 ? 104.818 17.035  98.147  1.00 41.82  ? 122  ILE A CA    1 
ATOM   3636 C  C     . ILE B 1 123 ? 104.818 17.926  99.381  1.00 42.96  ? 122  ILE A C     1 
ATOM   3637 O  O     . ILE B 1 123 ? 103.773 18.138  100.008 1.00 39.68  ? 122  ILE A O     1 
ATOM   3638 C  CB    . ILE B 1 123 ? 105.341 15.626  98.484  1.00 41.19  ? 122  ILE A CB    1 
ATOM   3639 C  CG1   . ILE B 1 123 ? 104.972 14.644  97.374  1.00 43.15  ? 122  ILE A CG1   1 
ATOM   3640 C  CG2   . ILE B 1 123 ? 104.782 15.165  99.839  1.00 40.57  ? 122  ILE A CG2   1 
ATOM   3641 C  CD1   . ILE B 1 123 ? 105.790 13.380  97.399  1.00 51.71  ? 122  ILE A CD1   1 
ATOM   3642 N  N     . ALA B 1 124 ? 105.996 18.442  99.765  1.00 40.49  ? 123  ALA A N     1 
ATOM   3643 C  CA    . ALA B 1 124 ? 106.070 19.299  100.949 1.00 49.33  ? 123  ALA A CA    1 
ATOM   3644 C  C     . ALA B 1 124 ? 105.270 20.577  100.741 1.00 44.27  ? 123  ALA A C     1 
ATOM   3645 O  O     . ALA B 1 124 ? 104.597 21.058  101.661 1.00 36.74  ? 123  ALA A O     1 
ATOM   3646 C  CB    . ALA B 1 124 ? 107.530 19.634  101.290 1.00 36.42  ? 123  ALA A CB    1 
ATOM   3647 N  N     . GLN B 1 125 ? 105.329 21.133  99.530  1.00 42.60  ? 124  GLN A N     1 
ATOM   3648 C  CA    . GLN B 1 125 ? 104.564 22.330  99.208  1.00 49.50  ? 124  GLN A CA    1 
ATOM   3649 C  C     . GLN B 1 125 ? 103.063 22.063  99.248  1.00 50.35  ? 124  GLN A C     1 
ATOM   3650 O  O     . GLN B 1 125 ? 102.286 22.925  99.674  1.00 42.94  ? 124  GLN A O     1 
ATOM   3651 C  CB    . GLN B 1 125 ? 104.990 22.852  97.831  1.00 47.01  ? 124  GLN A CB    1 
ATOM   3652 C  CG    . GLN B 1 125 ? 104.520 24.251  97.521  1.00 65.39  ? 124  GLN A CG    1 
ATOM   3653 C  CD    . GLN B 1 125 ? 104.978 25.251  98.566  1.00 78.39  ? 124  GLN A CD    1 
ATOM   3654 O  OE1   . GLN B 1 125 ? 104.168 25.773  99.337  1.00 89.75  ? 124  GLN A OE1   1 
ATOM   3655 N  NE2   . GLN B 1 125 ? 106.283 25.519  98.600  1.00 72.60  ? 124  GLN A NE2   1 
ATOM   3656 N  N     . GLU B 1 126 ? 102.634 20.875  98.819  1.00 50.12  ? 125  GLU A N     1 
ATOM   3657 C  CA    . GLU B 1 126 ? 101.207 20.581  98.858  1.00 46.68  ? 125  GLU A CA    1 
ATOM   3658 C  C     . GLU B 1 126 ? 100.728 20.365  100.287 1.00 44.19  ? 125  GLU A C     1 
ATOM   3659 O  O     . GLU B 1 126 ? 99.602  20.742  100.624 1.00 43.99  ? 125  GLU A O     1 
ATOM   3660 C  CB    . GLU B 1 126 ? 100.892 19.361  97.992  1.00 44.80  ? 125  GLU A CB    1 
ATOM   3661 C  CG    . GLU B 1 126 ? 99.760  19.598  97.030  1.00 56.60  ? 125  GLU A CG    1 
ATOM   3662 C  CD    . GLU B 1 126 ? 99.769  18.614  95.882  1.00 66.31  ? 125  GLU A CD    1 
ATOM   3663 O  OE1   . GLU B 1 126 ? 100.347 18.938  94.825  1.00 74.09  ? 125  GLU A OE1   1 
ATOM   3664 O  OE2   . GLU B 1 126 ? 99.214  17.512  96.046  1.00 62.74  ? 125  GLU A OE2   1 
ATOM   3665 N  N     . ILE B 1 127 ? 101.569 19.780  101.138 1.00 39.81  ? 126  ILE A N     1 
ATOM   3666 C  CA    . ILE B 1 127 ? 101.171 19.554  102.522 1.00 42.67  ? 126  ILE A CA    1 
ATOM   3667 C  C     . ILE B 1 127 ? 101.009 20.883  103.251 1.00 46.88  ? 126  ILE A C     1 
ATOM   3668 O  O     . ILE B 1 127 ? 100.014 21.106  103.949 1.00 45.58  ? 126  ILE A O     1 
ATOM   3669 C  CB    . ILE B 1 127 ? 102.181 18.632  103.226 1.00 41.19  ? 126  ILE A CB    1 
ATOM   3670 C  CG1   . ILE B 1 127 ? 102.032 17.195  102.710 1.00 42.86  ? 126  ILE A CG1   1 
ATOM   3671 C  CG2   . ILE B 1 127 ? 101.995 18.693  104.727 1.00 37.32  ? 126  ILE A CG2   1 
ATOM   3672 C  CD1   . ILE B 1 127 ? 103.235 16.324  102.992 1.00 38.56  ? 126  ILE A CD1   1 
ATOM   3673 N  N     . ARG B 1 128 ? 101.976 21.792  103.087 1.00 45.94  ? 127  ARG A N     1 
ATOM   3674 C  CA    . ARG B 1 128 ? 101.861 23.114  103.698 1.00 40.15  ? 127  ARG A CA    1 
ATOM   3675 C  C     . ARG B 1 128 ? 100.600 23.832  103.222 1.00 38.06  ? 127  ARG A C     1 
ATOM   3676 O  O     . ARG B 1 128 ? 99.857  24.408  104.026 1.00 45.52  ? 127  ARG A O     1 
ATOM   3677 C  CB    . ARG B 1 128 ? 103.108 23.950  103.388 1.00 43.95  ? 127  ARG A CB    1 
ATOM   3678 C  CG    . ARG B 1 128 ? 104.413 23.378  103.965 1.00 39.73  ? 127  ARG A CG    1 
ATOM   3679 C  CD    . ARG B 1 128 ? 105.524 24.429  104.070 1.00 39.49  ? 127  ARG A CD    1 
ATOM   3680 N  NE    . ARG B 1 128 ? 105.821 25.096  102.804 1.00 54.71  ? 127  ARG A NE    1 
ATOM   3681 C  CZ    . ARG B 1 128 ? 105.491 26.351  102.520 1.00 49.69  ? 127  ARG A CZ    1 
ATOM   3682 N  NH1   . ARG B 1 128 ? 104.857 27.092  103.414 1.00 46.86  ? 127  ARG A NH1   1 
ATOM   3683 N  NH2   . ARG B 1 128 ? 105.806 26.870  101.346 1.00 46.01  ? 127  ARG A NH2   1 
ATOM   3684 N  N     . GLN B 1 129 ? 100.340 23.801  101.913 1.00 39.21  ? 128  GLN A N     1 
ATOM   3685 C  CA    . GLN B 1 129 ? 99.167  24.477  101.364 1.00 40.55  ? 128  GLN A CA    1 
ATOM   3686 C  C     . GLN B 1 129 ? 97.870  23.847  101.859 1.00 46.21  ? 128  GLN A C     1 
ATOM   3687 O  O     . GLN B 1 129 ? 96.906  24.558  102.181 1.00 42.13  ? 128  GLN A O     1 
ATOM   3688 C  CB    . GLN B 1 129 ? 99.219  24.446  99.835  1.00 47.31  ? 128  GLN A CB    1 
ATOM   3689 C  CG    . GLN B 1 129 ? 98.102  25.239  99.150  1.00 52.47  ? 128  GLN A CG    1 
ATOM   3690 C  CD    . GLN B 1 129 ? 98.156  26.726  99.467  1.00 55.04  ? 128  GLN A CD    1 
ATOM   3691 O  OE1   . GLN B 1 129 ? 97.171  27.315  99.916  1.00 67.67  ? 128  GLN A OE1   1 
ATOM   3692 N  NE2   . GLN B 1 129 ? 99.312  27.338  99.235  1.00 42.43  ? 128  GLN A NE2   1 
ATOM   3693 N  N     . THR B 1 130 ? 97.812  22.514  101.892 1.00 43.26  ? 129  THR A N     1 
ATOM   3694 C  CA    . THR B 1 130 ? 96.637  21.839  102.435 1.00 48.75  ? 129  THR A CA    1 
ATOM   3695 C  C     . THR B 1 130 ? 96.432  22.186  103.908 1.00 52.38  ? 129  THR A C     1 
ATOM   3696 O  O     . THR B 1 130 ? 95.295  22.333  104.366 1.00 46.93  ? 129  THR A O     1 
ATOM   3697 C  CB    . THR B 1 130 ? 96.773  20.324  102.256 1.00 47.64  ? 129  THR A CB    1 
ATOM   3698 O  OG1   . THR B 1 130 ? 96.969  20.021  100.868 1.00 52.28  ? 129  THR A OG1   1 
ATOM   3699 C  CG2   . THR B 1 130 ? 95.528  19.608  102.770 1.00 47.22  ? 129  THR A CG2   1 
ATOM   3700 N  N     . ILE B 1 131 ? 97.520  22.316  104.669 1.00 50.78  ? 130  ILE A N     1 
ATOM   3701 C  CA    . ILE B 1 131 ? 97.393  22.673  106.080 1.00 46.69  ? 130  ILE A CA    1 
ATOM   3702 C  C     . ILE B 1 131 ? 96.844  24.093  106.224 1.00 48.25  ? 130  ILE A C     1 
ATOM   3703 O  O     . ILE B 1 131 ? 96.003  24.355  107.089 1.00 46.30  ? 130  ILE A O     1 
ATOM   3704 C  CB    . ILE B 1 131 ? 98.745  22.494  106.801 1.00 37.92  ? 130  ILE A CB    1 
ATOM   3705 C  CG1   . ILE B 1 131 ? 99.045  21.010  107.036 1.00 43.66  ? 130  ILE A CG1   1 
ATOM   3706 C  CG2   . ILE B 1 131 ? 98.780  23.261  108.115 1.00 37.12  ? 130  ILE A CG2   1 
ATOM   3707 C  CD1   . ILE B 1 131 ? 100.440 20.753  107.580 1.00 46.27  ? 130  ILE A CD1   1 
ATOM   3708 N  N     . PHE B 1 132 ? 97.278  25.021  105.362 1.00 45.78  ? 131  PHE A N     1 
ATOM   3709 C  CA    . PHE B 1 132 ? 96.780  26.398  105.443 1.00 45.77  ? 131  PHE A CA    1 
ATOM   3710 C  C     . PHE B 1 132 ? 95.305  26.481  105.060 1.00 47.05  ? 131  PHE A C     1 
ATOM   3711 O  O     . PHE B 1 132 ? 94.500  27.065  105.794 1.00 50.13  ? 131  PHE A O     1 
ATOM   3712 C  CB    . PHE B 1 132 ? 97.619  27.332  104.567 1.00 52.14  ? 131  PHE A CB    1 
ATOM   3713 C  CG    . PHE B 1 132 ? 97.172  28.773  104.618 1.00 52.96  ? 131  PHE A CG    1 
ATOM   3714 C  CD1   . PHE B 1 132 ? 97.310  29.516  105.783 1.00 49.00  ? 131  PHE A CD1   1 
ATOM   3715 C  CD2   . PHE B 1 132 ? 96.615  29.385  103.501 1.00 51.87  ? 131  PHE A CD2   1 
ATOM   3716 C  CE1   . PHE B 1 132 ? 96.903  30.847  105.834 1.00 50.60  ? 131  PHE A CE1   1 
ATOM   3717 C  CE2   . PHE B 1 132 ? 96.205  30.706  103.546 1.00 51.69  ? 131  PHE A CE2   1 
ATOM   3718 C  CZ    . PHE B 1 132 ? 96.351  31.439  104.716 1.00 52.82  ? 131  PHE A CZ    1 
ATOM   3719 N  N     . ASN B 1 133 ? 94.923  25.921  103.911 1.00 48.92  ? 132  ASN A N     1 
ATOM   3720 C  CA    . ASN B 1 133 ? 93.510  25.609  103.738 1.00 46.43  ? 132  ASN A CA    1 
ATOM   3721 C  C     . ASN B 1 133 ? 93.092  24.656  104.870 1.00 60.25  ? 132  ASN A C     1 
ATOM   3722 O  O     . ASN B 1 133 ? 93.928  24.118  105.590 1.00 79.29  ? 132  ASN A O     1 
ATOM   3723 C  CB    . ASN B 1 133 ? 93.251  24.988  102.364 1.00 50.39  ? 132  ASN A CB    1 
ATOM   3724 C  CG    . ASN B 1 133 ? 93.981  25.711  101.228 1.00 57.96  ? 132  ASN A CG    1 
ATOM   3725 O  OD1   . ASN B 1 133 ? 94.380  26.869  101.351 1.00 61.44  ? 132  ASN A OD1   1 
ATOM   3726 N  ND2   . ASN B 1 133 ? 94.142  25.018  100.104 1.00 53.83  ? 132  ASN A ND2   1 
ATOM   3727 N  N     . GLU B 1 134 ? 91.789  24.477  105.064 1.00 60.89  ? 133  GLU A N     1 
ATOM   3728 C  CA    . GLU B 1 134 ? 91.313  23.532  106.084 1.00 63.24  ? 133  GLU A CA    1 
ATOM   3729 C  C     . GLU B 1 134 ? 91.602  23.956  107.528 1.00 59.11  ? 133  GLU A C     1 
ATOM   3730 O  O     . GLU B 1 134 ? 90.733  23.805  108.390 1.00 58.46  ? 133  GLU A O     1 
ATOM   3731 C  CB    . GLU B 1 134 ? 91.902  22.121  105.877 1.00 55.93  ? 133  GLU A CB    1 
ATOM   3732 C  CG    . GLU B 1 134 ? 91.700  21.518  104.492 1.00 57.73  ? 133  GLU A CG    1 
ATOM   3733 C  CD    . GLU B 1 134 ? 91.985  20.023  104.454 1.00 64.24  ? 133  GLU A CD    1 
ATOM   3734 O  OE1   . GLU B 1 134 ? 92.056  19.389  105.530 1.00 60.64  ? 133  GLU A OE1   1 
ATOM   3735 O  OE2   . GLU B 1 134 ? 92.125  19.474  103.341 1.00 59.43  ? 133  GLU A OE2   1 
ATOM   3736 N  N     . LEU B 1 135 ? 92.814  24.453  107.825 1.00 59.75  ? 134  LEU A N     1 
ATOM   3737 C  CA    . LEU B 1 135 ? 93.188  24.779  109.199 1.00 53.46  ? 134  LEU A CA    1 
ATOM   3738 C  C     . LEU B 1 135 ? 93.543  26.237  109.448 1.00 49.02  ? 134  LEU A C     1 
ATOM   3739 O  O     . LEU B 1 135 ? 93.607  26.635  110.617 1.00 45.60  ? 134  LEU A O     1 
ATOM   3740 C  CB    . LEU B 1 135 ? 94.373  23.911  109.660 1.00 55.97  ? 134  LEU A CB    1 
ATOM   3741 C  CG    . LEU B 1 135 ? 93.982  22.456  109.904 1.00 66.80  ? 134  LEU A CG    1 
ATOM   3742 C  CD1   . LEU B 1 135 ? 95.151  21.520  109.701 1.00 61.18  ? 134  LEU A CD1   1 
ATOM   3743 C  CD2   . LEU B 1 135 ? 93.429  22.337  111.305 1.00 84.54  ? 134  LEU A CD2   1 
ATOM   3744 N  N     . GLN B 1 136 ? 93.795  27.038  108.407 1.00 46.84  ? 135  GLN A N     1 
ATOM   3745 C  CA    . GLN B 1 136 ? 94.122  28.460  108.566 1.00 55.51  ? 135  GLN A CA    1 
ATOM   3746 C  C     . GLN B 1 136 ? 95.393  28.674  109.392 1.00 59.21  ? 135  GLN A C     1 
ATOM   3747 O  O     . GLN B 1 136 ? 95.528  29.677  110.097 1.00 52.82  ? 135  GLN A O     1 
ATOM   3748 C  CB    . GLN B 1 136 ? 92.955  29.238  109.186 1.00 64.53  ? 135  GLN A CB    1 
ATOM   3749 C  CG    . GLN B 1 136 ? 91.722  29.354  108.312 1.00 72.98  ? 135  GLN A CG    1 
ATOM   3750 C  CD    . GLN B 1 136 ? 91.015  30.689  108.503 1.00 85.19  ? 135  GLN A CD    1 
ATOM   3751 O  OE1   . GLN B 1 136 ? 91.448  31.529  109.301 1.00 88.85  ? 135  GLN A OE1   1 
ATOM   3752 N  NE2   . GLN B 1 136 ? 89.928  30.895  107.768 1.00 84.66  ? 135  GLN A NE2   1 
ATOM   3753 N  N     . LEU B 1 137 ? 96.334  27.736  109.320 1.00 50.41  ? 136  LEU A N     1 
ATOM   3754 C  CA    . LEU B 1 137 ? 97.611  27.848  110.010 1.00 52.52  ? 136  LEU A CA    1 
ATOM   3755 C  C     . LEU B 1 137 ? 98.732  27.554  109.026 1.00 50.85  ? 136  LEU A C     1 
ATOM   3756 O  O     . LEU B 1 137 ? 98.571  26.749  108.105 1.00 48.44  ? 136  LEU A O     1 
ATOM   3757 C  CB    . LEU B 1 137 ? 97.700  26.881  111.195 1.00 46.29  ? 136  LEU A CB    1 
ATOM   3758 C  CG    . LEU B 1 137 ? 96.625  27.000  112.271 1.00 46.80  ? 136  LEU A CG    1 
ATOM   3759 C  CD1   . LEU B 1 137 ? 96.676  25.791  113.189 1.00 44.65  ? 136  LEU A CD1   1 
ATOM   3760 C  CD2   . LEU B 1 137 ? 96.779  28.306  113.052 1.00 43.95  ? 136  LEU A CD2   1 
ATOM   3761 N  N     . THR B 1 138 ? 99.874  28.201  109.225 1.00 39.02  ? 137  THR A N     1 
ATOM   3762 C  CA    . THR B 1 138 ? 100.997 27.995  108.327 1.00 41.07  ? 137  THR A CA    1 
ATOM   3763 C  C     . THR B 1 138 ? 101.992 27.022  108.944 1.00 42.59  ? 137  THR A C     1 
ATOM   3764 O  O     . THR B 1 138 ? 102.155 26.952  110.164 1.00 38.29  ? 137  THR A O     1 
ATOM   3765 C  CB    . THR B 1 138 ? 101.700 29.313  107.974 1.00 46.29  ? 137  THR A CB    1 
ATOM   3766 O  OG1   . THR B 1 138 ? 102.250 29.911  109.154 1.00 41.45  ? 137  THR A OG1   1 
ATOM   3767 C  CG2   . THR B 1 138 ? 100.722 30.284  107.289 1.00 35.58  ? 137  THR A CG2   1 
ATOM   3768 N  N     . ALA B 1 139 ? 102.638 26.256  108.075 1.00 40.41  ? 138  ALA A N     1 
ATOM   3769 C  CA    . ALA B 1 139 ? 103.708 25.361  108.459 1.00 39.16  ? 138  ALA A CA    1 
ATOM   3770 C  C     . ALA B 1 139 ? 104.937 25.662  107.619 1.00 35.94  ? 138  ALA A C     1 
ATOM   3771 O  O     . ALA B 1 139 ? 104.854 26.240  106.532 1.00 41.28  ? 138  ALA A O     1 
ATOM   3772 C  CB    . ALA B 1 139 ? 103.301 23.893  108.287 1.00 34.41  ? 138  ALA A CB    1 
ATOM   3773 N  N     . SER B 1 140 ? 106.085 25.270  108.149 1.00 34.89  ? 139  SER A N     1 
ATOM   3774 C  CA    . SER B 1 140 ? 107.337 25.288  107.416 1.00 33.70  ? 139  SER A CA    1 
ATOM   3775 C  C     . SER B 1 140 ? 107.810 23.849  107.267 1.00 35.37  ? 139  SER A C     1 
ATOM   3776 O  O     . SER B 1 140 ? 107.398 22.965  108.021 1.00 36.27  ? 139  SER A O     1 
ATOM   3777 C  CB    . SER B 1 140 ? 108.380 26.154  108.135 1.00 40.89  ? 139  SER A CB    1 
ATOM   3778 O  OG    . SER B 1 140 ? 107.880 27.476  108.286 1.00 38.55  ? 139  SER A OG    1 
ATOM   3779 N  N     . ALA B 1 141 ? 108.656 23.604  106.272 1.00 35.32  ? 140  ALA A N     1 
ATOM   3780 C  CA    . ALA B 1 141 ? 109.056 22.230  106.000 1.00 33.70  ? 140  ALA A CA    1 
ATOM   3781 C  C     . ALA B 1 141 ? 110.488 22.188  105.485 1.00 38.17  ? 140  ALA A C     1 
ATOM   3782 O  O     . ALA B 1 141 ? 110.975 23.132  104.864 1.00 32.45  ? 140  ALA A O     1 
ATOM   3783 C  CB    . ALA B 1 141 ? 108.103 21.562  105.000 1.00 32.12  ? 140  ALA A CB    1 
ATOM   3784 N  N     . GLY B 1 142 ? 111.158 21.080  105.770 1.00 38.12  ? 141  GLY A N     1 
ATOM   3785 C  CA    . GLY B 1 142 ? 112.488 20.832  105.264 1.00 32.14  ? 141  GLY A CA    1 
ATOM   3786 C  C     . GLY B 1 142 ? 112.487 19.514  104.517 1.00 44.42  ? 141  GLY A C     1 
ATOM   3787 O  O     . GLY B 1 142 ? 111.732 18.595  104.845 1.00 36.81  ? 141  GLY A O     1 
ATOM   3788 N  N     . VAL B 1 143 ? 113.319 19.438  103.488 1.00 33.86  ? 142  VAL A N     1 
ATOM   3789 C  CA    . VAL B 1 143 ? 113.414 18.260  102.638 1.00 32.67  ? 142  VAL A CA    1 
ATOM   3790 C  C     . VAL B 1 143 ? 114.885 17.938  102.470 1.00 36.92  ? 142  VAL A C     1 
ATOM   3791 O  O     . VAL B 1 143 ? 115.662 18.809  102.069 1.00 37.81  ? 142  VAL A O     1 
ATOM   3792 C  CB    . VAL B 1 143 ? 112.765 18.504  101.262 1.00 42.01  ? 142  VAL A CB    1 
ATOM   3793 C  CG1   . VAL B 1 143 ? 112.849 17.244  100.407 1.00 40.42  ? 142  VAL A CG1   1 
ATOM   3794 C  CG2   . VAL B 1 143 ? 111.324 18.984  101.415 1.00 34.09  ? 142  VAL A CG2   1 
ATOM   3795 N  N     . ALA B 1 144 ? 115.265 16.697  102.746 1.00 34.88  ? 143  ALA A N     1 
ATOM   3796 C  CA    . ALA B 1 144 ? 116.674 16.329  102.760 1.00 38.92  ? 143  ALA A CA    1 
ATOM   3797 C  C     . ALA B 1 144 ? 116.781 14.810  102.631 1.00 40.43  ? 143  ALA A C     1 
ATOM   3798 O  O     . ALA B 1 144 ? 115.771 14.096  102.722 1.00 37.93  ? 143  ALA A O     1 
ATOM   3799 C  CB    . ALA B 1 144 ? 117.354 16.836  104.042 1.00 31.36  ? 143  ALA A CB    1 
ATOM   3800 N  N     . PRO B 1 145 ? 117.988 14.279  102.386 1.00 43.49  ? 144  PRO A N     1 
ATOM   3801 C  CA    . PRO B 1 145 ? 118.122 12.812  102.269 1.00 43.38  ? 144  PRO A CA    1 
ATOM   3802 C  C     . PRO B 1 145 ? 118.068 12.063  103.596 1.00 38.27  ? 144  PRO A C     1 
ATOM   3803 O  O     . PRO B 1 145 ? 117.860 10.843  103.572 1.00 41.28  ? 144  PRO A O     1 
ATOM   3804 C  CB    . PRO B 1 145 ? 119.491 12.620  101.589 1.00 41.49  ? 144  PRO A CB    1 
ATOM   3805 C  CG    . PRO B 1 145 ? 119.876 13.998  101.058 1.00 43.60  ? 144  PRO A CG    1 
ATOM   3806 C  CD    . PRO B 1 145 ? 119.211 14.985  101.960 1.00 39.21  ? 144  PRO A CD    1 
ATOM   3807 N  N     . VAL B 1 146 ? 118.239 12.739  104.740 1.00 32.80  ? 145  VAL A N     1 
ATOM   3808 C  CA    . VAL B 1 146 ? 118.263 12.114  106.064 1.00 32.23  ? 145  VAL A CA    1 
ATOM   3809 C  C     . VAL B 1 146 ? 117.470 12.985  107.036 1.00 38.48  ? 145  VAL A C     1 
ATOM   3810 O  O     . VAL B 1 146 ? 117.134 14.132  106.742 1.00 32.40  ? 145  VAL A O     1 
ATOM   3811 C  CB    . VAL B 1 146 ? 119.701 11.908  106.594 1.00 36.69  ? 145  VAL A CB    1 
ATOM   3812 C  CG1   . VAL B 1 146 ? 120.548 11.080  105.602 1.00 40.80  ? 145  VAL A CG1   1 
ATOM   3813 C  CG2   . VAL B 1 146 ? 120.349 13.241  106.841 1.00 30.94  ? 145  VAL A CG2   1 
ATOM   3814 N  N     . LYS B 1 147 ? 117.196 12.425  108.222 1.00 30.82  ? 146  LYS A N     1 
ATOM   3815 C  CA    . LYS B 1 147 ? 116.370 13.107  109.222 1.00 31.24  ? 146  LYS A CA    1 
ATOM   3816 C  C     . LYS B 1 147 ? 116.945 14.450  109.663 1.00 30.57  ? 146  LYS A C     1 
ATOM   3817 O  O     . LYS B 1 147 ? 116.262 15.475  109.596 1.00 32.65  ? 146  LYS A O     1 
ATOM   3818 C  CB    . LYS B 1 147 ? 116.189 12.218  110.450 1.00 29.99  ? 146  LYS A CB    1 
ATOM   3819 C  CG    . LYS B 1 147 ? 115.101 11.195  110.282 1.00 35.52  ? 146  LYS A CG    1 
ATOM   3820 C  CD    . LYS B 1 147 ? 114.935 10.439  111.597 1.00 34.01  ? 146  LYS A CD    1 
ATOM   3821 C  CE    . LYS B 1 147 ? 113.711 9.560   111.559 1.00 38.35  ? 146  LYS A CE    1 
ATOM   3822 N  NZ    . LYS B 1 147 ? 113.558 8.848   112.860 1.00 43.21  ? 146  LYS A NZ    1 
ATOM   3823 N  N     . PHE B 1 148 ? 118.161 14.457  110.227 1.00 34.31  ? 147  PHE A N     1 
ATOM   3824 C  CA    . PHE B 1 148 ? 118.606 15.677  110.906 1.00 33.17  ? 147  PHE A CA    1 
ATOM   3825 C  C     . PHE B 1 148 ? 118.741 16.848  109.932 1.00 33.02  ? 147  PHE A C     1 
ATOM   3826 O  O     . PHE B 1 148 ? 118.552 18.012  110.318 1.00 30.29  ? 147  PHE A O     1 
ATOM   3827 C  CB    . PHE B 1 148 ? 119.914 15.430  111.676 1.00 33.35  ? 147  PHE A CB    1 
ATOM   3828 C  CG    . PHE B 1 148 ? 121.177 15.583  110.855 1.00 37.56  ? 147  PHE A CG    1 
ATOM   3829 C  CD1   . PHE B 1 148 ? 121.608 14.566  110.016 1.00 40.79  ? 147  PHE A CD1   1 
ATOM   3830 C  CD2   . PHE B 1 148 ? 121.952 16.734  110.955 1.00 41.29  ? 147  PHE A CD2   1 
ATOM   3831 C  CE1   . PHE B 1 148 ? 122.781 14.705  109.271 1.00 40.48  ? 147  PHE A CE1   1 
ATOM   3832 C  CE2   . PHE B 1 148 ? 123.130 16.884  110.216 1.00 34.37  ? 147  PHE A CE2   1 
ATOM   3833 C  CZ    . PHE B 1 148 ? 123.543 15.869  109.379 1.00 36.12  ? 147  PHE A CZ    1 
ATOM   3834 N  N     . LEU B 1 149 ? 119.055 16.578  108.671 1.00 32.35  ? 148  LEU A N     1 
ATOM   3835 C  CA    . LEU B 1 149 ? 119.117 17.687  107.717 1.00 31.96  ? 148  LEU A CA    1 
ATOM   3836 C  C     . LEU B 1 149 ? 117.731 18.202  107.346 1.00 31.00  ? 148  LEU A C     1 
ATOM   3837 O  O     . LEU B 1 149 ? 117.566 19.399  107.104 1.00 33.13  ? 148  LEU A O     1 
ATOM   3838 C  CB    . LEU B 1 149 ? 119.886 17.271  106.460 1.00 30.67  ? 148  LEU A CB    1 
ATOM   3839 C  CG    . LEU B 1 149 ? 121.395 17.110  106.665 1.00 35.91  ? 148  LEU A CG    1 
ATOM   3840 C  CD1   . LEU B 1 149 ? 122.067 16.580  105.394 1.00 34.49  ? 148  LEU A CD1   1 
ATOM   3841 C  CD2   . LEU B 1 149 ? 122.037 18.421  107.102 1.00 35.49  ? 148  LEU A CD2   1 
ATOM   3842 N  N     . ALA B 1 150 ? 116.724 17.335  107.301 1.00 34.49  ? 149  ALA A N     1 
ATOM   3843 C  CA    . ALA B 1 150 ? 115.374 17.812  107.012 1.00 30.67  ? 149  ALA A CA    1 
ATOM   3844 C  C     . ALA B 1 150 ? 114.859 18.693  108.140 1.00 32.99  ? 149  ALA A C     1 
ATOM   3845 O  O     . ALA B 1 150 ? 114.153 19.681  107.895 1.00 34.49  ? 149  ALA A O     1 
ATOM   3846 C  CB    . ALA B 1 150 ? 114.431 16.629  106.781 1.00 30.11  ? 149  ALA A CB    1 
ATOM   3847 N  N     . LYS B 1 151 ? 115.206 18.346  109.381 1.00 33.05  ? 150  LYS A N     1 
ATOM   3848 C  CA    . LYS B 1 151 ? 114.835 19.161  110.533 1.00 30.45  ? 150  LYS A CA    1 
ATOM   3849 C  C     . LYS B 1 151 ? 115.501 20.537  110.476 1.00 29.65  ? 150  LYS A C     1 
ATOM   3850 O  O     . LYS B 1 151 ? 114.829 21.568  110.587 1.00 32.43  ? 150  LYS A O     1 
ATOM   3851 C  CB    . LYS B 1 151 ? 115.207 18.401  111.811 1.00 32.27  ? 150  LYS A CB    1 
ATOM   3852 C  CG    . LYS B 1 151 ? 115.101 19.174  113.107 1.00 41.93  ? 150  LYS A CG    1 
ATOM   3853 C  CD    . LYS B 1 151 ? 113.690 19.632  113.408 1.00 55.29  ? 150  LYS A CD    1 
ATOM   3854 C  CE    . LYS B 1 151 ? 113.619 20.222  114.815 1.00 65.47  ? 150  LYS A CE    1 
ATOM   3855 N  NZ    . LYS B 1 151 ? 112.359 20.978  115.047 1.00 67.89  ? 150  LYS A NZ    1 
ATOM   3856 N  N     . ILE B 1 152 ? 116.826 20.571  110.300 1.00 31.36  ? 151  ILE A N     1 
ATOM   3857 C  CA    . ILE B 1 152 ? 117.531 21.843  110.109 1.00 34.28  ? 151  ILE A CA    1 
ATOM   3858 C  C     . ILE B 1 152 ? 116.904 22.643  108.974 1.00 36.04  ? 151  ILE A C     1 
ATOM   3859 O  O     . ILE B 1 152 ? 116.676 23.856  109.095 1.00 33.95  ? 151  ILE A O     1 
ATOM   3860 C  CB    . ILE B 1 152 ? 119.030 21.589  109.852 1.00 37.84  ? 151  ILE A CB    1 
ATOM   3861 C  CG1   . ILE B 1 152 ? 119.704 21.035  111.106 1.00 31.80  ? 151  ILE A CG1   1 
ATOM   3862 C  CG2   . ILE B 1 152 ? 119.737 22.872  109.377 1.00 35.85  ? 151  ILE A CG2   1 
ATOM   3863 C  CD1   . ILE B 1 152 ? 121.027 20.350  110.826 1.00 37.45  ? 151  ILE A CD1   1 
ATOM   3864 N  N     . ALA B 1 153 ? 116.610 21.977  107.854 1.00 34.39  ? 152  ALA A N     1 
ATOM   3865 C  CA    . ALA B 1 153 ? 116.070 22.679  106.694 1.00 29.09  ? 152  ALA A CA    1 
ATOM   3866 C  C     . ALA B 1 153 ? 114.697 23.279  106.984 1.00 37.11  ? 152  ALA A C     1 
ATOM   3867 O  O     . ALA B 1 153 ? 114.364 24.334  106.435 1.00 34.58  ? 152  ALA A O     1 
ATOM   3868 C  CB    . ALA B 1 153 ? 115.996 21.734  105.485 1.00 29.05  ? 152  ALA A CB    1 
ATOM   3869 N  N     . SER B 1 154 ? 113.887 22.644  107.842 1.00 27.91  ? 153  SER A N     1 
ATOM   3870 C  CA    . SER B 1 154 ? 112.568 23.216  108.105 1.00 39.05  ? 153  SER A CA    1 
ATOM   3871 C  C     . SER B 1 154 ? 112.645 24.556  108.827 1.00 41.54  ? 153  SER A C     1 
ATOM   3872 O  O     . SER B 1 154 ? 111.662 25.304  108.823 1.00 32.85  ? 153  SER A O     1 
ATOM   3873 C  CB    . SER B 1 154 ? 111.702 22.258  108.921 1.00 37.88  ? 153  SER A CB    1 
ATOM   3874 O  OG    . SER B 1 154 ? 112.243 22.046  110.214 1.00 39.58  ? 153  SER A OG    1 
ATOM   3875 N  N     . ASP B 1 155 ? 113.773 24.873  109.458 1.00 36.61  ? 154  ASP A N     1 
ATOM   3876 C  CA    . ASP B 1 155 ? 113.902 26.147  110.150 1.00 44.18  ? 154  ASP A CA    1 
ATOM   3877 C  C     . ASP B 1 155 ? 114.419 27.267  109.257 1.00 41.03  ? 154  ASP A C     1 
ATOM   3878 O  O     . ASP B 1 155 ? 114.345 28.435  109.653 1.00 45.80  ? 154  ASP A O     1 
ATOM   3879 C  CB    . ASP B 1 155 ? 114.831 26.009  111.363 1.00 44.35  ? 154  ASP A CB    1 
ATOM   3880 C  CG    . ASP B 1 155 ? 114.145 25.379  112.566 1.00 58.28  ? 154  ASP A CG    1 
ATOM   3881 O  OD1   . ASP B 1 155 ? 113.019 25.796  112.923 1.00 56.48  ? 154  ASP A OD1   1 
ATOM   3882 O  OD2   . ASP B 1 155 ? 114.743 24.455  113.159 1.00 71.13  ? 154  ASP A OD2   1 
ATOM   3883 N  N     . MET B 1 156 ? 114.925 26.959  108.062 1.00 37.72  ? 155  MET A N     1 
ATOM   3884 C  CA    . MET B 1 156 ? 115.706 27.966  107.345 1.00 39.65  ? 155  MET A CA    1 
ATOM   3885 C  C     . MET B 1 156 ? 114.853 28.978  106.591 1.00 42.65  ? 155  MET A C     1 
ATOM   3886 O  O     . MET B 1 156 ? 115.287 30.119  106.407 1.00 45.19  ? 155  MET A O     1 
ATOM   3887 C  CB    . MET B 1 156 ? 116.676 27.280  106.398 1.00 44.79  ? 155  MET A CB    1 
ATOM   3888 C  CG    . MET B 1 156 ? 117.750 26.550  107.156 1.00 49.91  ? 155  MET A CG    1 
ATOM   3889 S  SD    . MET B 1 156 ? 118.912 25.784  106.049 1.00 57.21  ? 155  MET A SD    1 
ATOM   3890 C  CE    . MET B 1 156 ? 119.410 27.217  105.089 1.00 53.89  ? 155  MET A CE    1 
ATOM   3891 N  N     . ASN B 1 157 ? 113.664 28.597  106.132 1.00 42.34  ? 156  ASN A N     1 
ATOM   3892 C  CA    . ASN B 1 157 ? 112.737 29.541  105.527 1.00 37.69  ? 156  ASN A CA    1 
ATOM   3893 C  C     . ASN B 1 157 ? 111.474 29.691  106.362 1.00 37.86  ? 156  ASN A C     1 
ATOM   3894 O  O     . ASN B 1 157 ? 110.393 29.919  105.826 1.00 48.04  ? 156  ASN A O     1 
ATOM   3895 C  CB    . ASN B 1 157 ? 112.382 29.128  104.101 1.00 37.70  ? 156  ASN A CB    1 
ATOM   3896 C  CG    . ASN B 1 157 ? 113.341 29.688  103.083 1.00 47.09  ? 156  ASN A CG    1 
ATOM   3897 O  OD1   . ASN B 1 157 ? 113.944 30.739  103.297 1.00 47.52  ? 156  ASN A OD1   1 
ATOM   3898 N  ND2   . ASN B 1 157 ? 113.482 28.995  101.960 1.00 54.45  ? 156  ASN A ND2   1 
ATOM   3899 N  N     . LYS B 1 158 ? 111.600 29.569  107.673 1.00 31.49  ? 157  LYS A N     1 
ATOM   3900 C  CA    . LYS B 1 158 ? 110.467 29.713  108.570 1.00 36.36  ? 157  LYS A CA    1 
ATOM   3901 C  C     . LYS B 1 158 ? 110.280 31.196  108.900 1.00 33.90  ? 157  LYS A C     1 
ATOM   3902 O  O     . LYS B 1 158 ? 111.262 31.922  109.064 1.00 43.15  ? 157  LYS A O     1 
ATOM   3903 C  CB    . LYS B 1 158 ? 110.714 28.878  109.831 1.00 33.73  ? 157  LYS A CB    1 
ATOM   3904 C  CG    . LYS B 1 158 ? 109.640 28.926  110.896 1.00 50.16  ? 157  LYS A CG    1 
ATOM   3905 C  CD    . LYS B 1 158 ? 110.051 28.097  112.137 1.00 52.02  ? 157  LYS A CD    1 
ATOM   3906 C  CE    . LYS B 1 158 ? 109.627 26.626  112.026 1.00 48.77  ? 157  LYS A CE    1 
ATOM   3907 N  NZ    . LYS B 1 158 ? 108.141 26.426  112.141 1.00 36.81  ? 157  LYS A NZ    1 
ATOM   3908 N  N     . PRO B 1 159 ? 109.026 31.663  109.004 1.00 29.61  ? 158  PRO A N     1 
ATOM   3909 C  CA    . PRO B 1 159 ? 107.733 30.986  108.883 1.00 34.78  ? 158  PRO A CA    1 
ATOM   3910 C  C     . PRO B 1 159 ? 107.238 30.850  107.450 1.00 40.08  ? 158  PRO A C     1 
ATOM   3911 O  O     . PRO B 1 159 ? 107.701 31.565  106.553 1.00 40.37  ? 158  PRO A O     1 
ATOM   3912 C  CB    . PRO B 1 159 ? 106.799 31.901  109.668 1.00 36.90  ? 158  PRO A CB    1 
ATOM   3913 C  CG    . PRO B 1 159 ? 107.351 33.266  109.370 1.00 33.68  ? 158  PRO A CG    1 
ATOM   3914 C  CD    . PRO B 1 159 ? 108.855 33.082  109.393 1.00 33.57  ? 158  PRO A CD    1 
ATOM   3915 N  N     . ASN B 1 160 ? 106.300 29.924  107.264 1.00 39.61  ? 159  ASN A N     1 
ATOM   3916 C  CA    . ASN B 1 160 ? 105.555 29.768  106.020 1.00 35.86  ? 159  ASN A CA    1 
ATOM   3917 C  C     . ASN B 1 160 ? 106.481 29.633  104.810 1.00 42.71  ? 159  ASN A C     1 
ATOM   3918 O  O     . ASN B 1 160 ? 106.331 30.315  103.799 1.00 38.16  ? 159  ASN A O     1 
ATOM   3919 C  CB    . ASN B 1 160 ? 104.575 30.923  105.837 1.00 37.04  ? 159  ASN A CB    1 
ATOM   3920 C  CG    . ASN B 1 160 ? 103.563 30.649  104.756 1.00 44.27  ? 159  ASN A CG    1 
ATOM   3921 O  OD1   . ASN B 1 160 ? 103.441 29.517  104.286 1.00 44.12  ? 159  ASN A OD1   1 
ATOM   3922 N  ND2   . ASN B 1 160 ? 102.826 31.680  104.352 1.00 40.60  ? 159  ASN A ND2   1 
ATOM   3923 N  N     . GLY B 1 161 ? 107.451 28.735  104.918 1.00 41.42  ? 160  GLY A N     1 
ATOM   3924 C  CA    . GLY B 1 161 ? 108.342 28.500  103.800 1.00 39.18  ? 160  GLY A CA    1 
ATOM   3925 C  C     . GLY B 1 161 ? 108.968 27.130  103.929 1.00 46.14  ? 160  GLY A C     1 
ATOM   3926 O  O     . GLY B 1 161 ? 108.727 26.400  104.892 1.00 36.28  ? 160  GLY A O     1 
ATOM   3927 N  N     . GLN B 1 162 ? 109.780 26.775  102.945 1.00 38.72  ? 161  GLN A N     1 
ATOM   3928 C  CA    . GLN B 1 162 ? 110.446 25.485  103.007 1.00 40.79  ? 161  GLN A CA    1 
ATOM   3929 C  C     . GLN B 1 162 ? 111.829 25.617  102.393 1.00 41.10  ? 161  GLN A C     1 
ATOM   3930 O  O     . GLN B 1 162 ? 112.168 26.628  101.772 1.00 42.80  ? 161  GLN A O     1 
ATOM   3931 C  CB    . GLN B 1 162 ? 109.608 24.386  102.323 1.00 35.69  ? 161  GLN A CB    1 
ATOM   3932 C  CG    . GLN B 1 162 ? 109.210 24.690  100.863 1.00 46.28  ? 161  GLN A CG    1 
ATOM   3933 C  CD    . GLN B 1 162 ? 108.356 23.583  100.238 1.00 41.62  ? 161  GLN A CD    1 
ATOM   3934 O  OE1   . GLN B 1 162 ? 107.211 23.367  100.630 1.00 43.55  ? 161  GLN A OE1   1 
ATOM   3935 N  NE2   . GLN B 1 162 ? 108.922 22.873  99.275  1.00 42.32  ? 161  GLN A NE2   1 
ATOM   3936 N  N     . PHE B 1 163 ? 112.636 24.584  102.592 1.00 35.62  ? 162  PHE A N     1 
ATOM   3937 C  CA    . PHE B 1 163 ? 114.004 24.578  102.104 1.00 40.55  ? 162  PHE A CA    1 
ATOM   3938 C  C     . PHE B 1 163 ? 114.395 23.139  101.815 1.00 45.11  ? 162  PHE A C     1 
ATOM   3939 O  O     . PHE B 1 163 ? 114.079 22.234  102.594 1.00 38.65  ? 162  PHE A O     1 
ATOM   3940 C  CB    . PHE B 1 163 ? 114.963 25.210  103.122 1.00 43.41  ? 162  PHE A CB    1 
ATOM   3941 C  CG    . PHE B 1 163 ? 116.350 25.433  102.586 1.00 46.24  ? 162  PHE A CG    1 
ATOM   3942 C  CD1   . PHE B 1 163 ? 116.654 26.594  101.894 1.00 38.80  ? 162  PHE A CD1   1 
ATOM   3943 C  CD2   . PHE B 1 163 ? 117.344 24.483  102.769 1.00 47.06  ? 162  PHE A CD2   1 
ATOM   3944 C  CE1   . PHE B 1 163 ? 117.932 26.811  101.395 1.00 45.79  ? 162  PHE A CE1   1 
ATOM   3945 C  CE2   . PHE B 1 163 ? 118.619 24.687  102.265 1.00 51.31  ? 162  PHE A CE2   1 
ATOM   3946 C  CZ    . PHE B 1 163 ? 118.912 25.856  101.574 1.00 51.57  ? 162  PHE A CZ    1 
ATOM   3947 N  N     . VAL B 1 164 ? 115.091 22.941  100.700 1.00 32.75  ? 163  VAL A N     1 
ATOM   3948 C  CA    . VAL B 1 164 ? 115.404 21.618  100.164 1.00 42.25  ? 163  VAL A CA    1 
ATOM   3949 C  C     . VAL B 1 164 ? 116.920 21.476  100.099 1.00 45.85  ? 163  VAL A C     1 
ATOM   3950 O  O     . VAL B 1 164 ? 117.613 22.388  99.636  1.00 38.69  ? 163  VAL A O     1 
ATOM   3951 C  CB    . VAL B 1 164 ? 114.772 21.413  98.770  1.00 43.07  ? 163  VAL A CB    1 
ATOM   3952 C  CG1   . VAL B 1 164 ? 115.163 20.058  98.170  1.00 43.16  ? 163  VAL A CG1   1 
ATOM   3953 C  CG2   . VAL B 1 164 ? 113.261 21.531  98.845  1.00 38.43  ? 163  VAL A CG2   1 
ATOM   3954 N  N     . ILE B 1 165 ? 117.433 20.343  100.573 1.00 33.33  ? 164  ILE A N     1 
ATOM   3955 C  CA    . ILE B 1 165 ? 118.857 20.024  100.485 1.00 41.90  ? 164  ILE A CA    1 
ATOM   3956 C  C     . ILE B 1 165 ? 118.992 18.750  99.658  1.00 43.39  ? 164  ILE A C     1 
ATOM   3957 O  O     . ILE B 1 165 ? 118.607 17.660  100.105 1.00 40.44  ? 164  ILE A O     1 
ATOM   3958 C  CB    . ILE B 1 165 ? 119.507 19.848  101.865 1.00 41.40  ? 164  ILE A CB    1 
ATOM   3959 C  CG1   . ILE B 1 165 ? 119.469 21.149  102.662 1.00 38.55  ? 164  ILE A CG1   1 
ATOM   3960 C  CG2   . ILE B 1 165 ? 120.951 19.359  101.707 1.00 34.12  ? 164  ILE A CG2   1 
ATOM   3961 C  CD1   . ILE B 1 165 ? 119.743 20.931  104.149 1.00 34.93  ? 164  ILE A CD1   1 
ATOM   3962 N  N     . THR B 1 166 ? 119.526 18.882  98.457  1.00 47.45  ? 165  THR A N     1 
ATOM   3963 C  CA    . THR B 1 166 ? 119.770 17.723  97.621  1.00 45.23  ? 165  THR A CA    1 
ATOM   3964 C  C     . THR B 1 166 ? 121.036 17.014  98.077  1.00 42.92  ? 165  THR A C     1 
ATOM   3965 O  O     . THR B 1 166 ? 121.905 17.620  98.710  1.00 40.67  ? 165  THR A O     1 
ATOM   3966 C  CB    . THR B 1 166 ? 119.927 18.142  96.164  1.00 43.09  ? 165  THR A CB    1 
ATOM   3967 O  OG1   . THR B 1 166 ? 121.144 18.886  96.038  1.00 43.07  ? 165  THR A OG1   1 
ATOM   3968 C  CG2   . THR B 1 166 ? 118.759 19.019  95.737  1.00 46.35  ? 165  THR A CG2   1 
ATOM   3969 N  N     . PRO B 1 167 ? 121.169 15.727  97.769  1.00 48.17  ? 166  PRO A N     1 
ATOM   3970 C  CA    . PRO B 1 167 ? 122.443 15.046  98.055  1.00 53.65  ? 166  PRO A CA    1 
ATOM   3971 C  C     . PRO B 1 167 ? 123.668 15.786  97.527  1.00 47.26  ? 166  PRO A C     1 
ATOM   3972 O  O     . PRO B 1 167 ? 124.703 15.807  98.204  1.00 44.35  ? 166  PRO A O     1 
ATOM   3973 C  CB    . PRO B 1 167 ? 122.247 13.679  97.386  1.00 50.65  ? 166  PRO A CB    1 
ATOM   3974 C  CG    . PRO B 1 167 ? 120.765 13.425  97.560  1.00 52.74  ? 166  PRO A CG    1 
ATOM   3975 C  CD    . PRO B 1 167 ? 120.095 14.779  97.416  1.00 44.98  ? 166  PRO A CD    1 
ATOM   3976 N  N     . ALA B 1 168 ? 123.572 16.414  96.349  1.00 37.58  ? 167  ALA A N     1 
ATOM   3977 C  CA    . ALA B 1 168 ? 124.713 17.146  95.800  1.00 44.29  ? 167  ALA A CA    1 
ATOM   3978 C  C     . ALA B 1 168 ? 125.111 18.336  96.667  1.00 47.81  ? 167  ALA A C     1 
ATOM   3979 O  O     . ALA B 1 168 ? 126.285 18.725  96.683  1.00 47.36  ? 167  ALA A O     1 
ATOM   3980 C  CB    . ALA B 1 168 ? 124.403 17.627  94.379  1.00 41.75  ? 167  ALA A CB    1 
ATOM   3981 N  N     . GLU B 1 169 ? 124.157 18.936  97.378  1.00 46.95  ? 168  GLU A N     1 
ATOM   3982 C  CA    . GLU B 1 169 ? 124.438 20.122  98.174  1.00 44.50  ? 168  GLU A CA    1 
ATOM   3983 C  C     . GLU B 1 169 ? 124.909 19.802  99.591  1.00 40.06  ? 168  GLU A C     1 
ATOM   3984 O  O     . GLU B 1 169 ? 125.421 20.696  100.270 1.00 39.70  ? 168  GLU A O     1 
ATOM   3985 C  CB    . GLU B 1 169 ? 123.192 21.025  98.224  1.00 50.35  ? 168  GLU A CB    1 
ATOM   3986 C  CG    . GLU B 1 169 ? 122.807 21.617  96.854  1.00 49.52  ? 168  GLU A CG    1 
ATOM   3987 C  CD    . GLU B 1 169 ? 121.360 22.107  96.777  1.00 48.25  ? 168  GLU A CD    1 
ATOM   3988 O  OE1   . GLU B 1 169 ? 120.572 21.819  97.691  1.00 41.55  ? 168  GLU A OE1   1 
ATOM   3989 O  OE2   . GLU B 1 169 ? 121.001 22.774  95.784  1.00 62.64  ? 168  GLU A OE2   1 
ATOM   3990 N  N     . VAL B 1 170 ? 124.765 18.557  100.049 1.00 37.35  ? 169  VAL A N     1 
ATOM   3991 C  CA    . VAL B 1 170 ? 125.099 18.243  101.440 1.00 45.49  ? 169  VAL A CA    1 
ATOM   3992 C  C     . VAL B 1 170 ? 126.533 18.610  101.804 1.00 41.21  ? 169  VAL A C     1 
ATOM   3993 O  O     . VAL B 1 170 ? 126.736 19.220  102.866 1.00 40.06  ? 169  VAL A O     1 
ATOM   3994 C  CB    . VAL B 1 170 ? 124.763 16.760  101.742 1.00 35.99  ? 169  VAL A CB    1 
ATOM   3995 C  CG1   . VAL B 1 170 ? 125.283 16.378  103.109 1.00 37.13  ? 169  VAL A CG1   1 
ATOM   3996 C  CG2   . VAL B 1 170 ? 123.259 16.560  101.726 1.00 37.51  ? 169  VAL A CG2   1 
ATOM   3997 N  N     . PRO B 1 171 ? 127.557 18.302  101.000 1.00 41.55  ? 170  PRO A N     1 
ATOM   3998 C  CA    . PRO B 1 171 ? 128.922 18.680  101.419 1.00 44.92  ? 170  PRO A CA    1 
ATOM   3999 C  C     . PRO B 1 171 ? 129.104 20.174  101.652 1.00 48.11  ? 170  PRO A C     1 
ATOM   4000 O  O     . PRO B 1 171 ? 129.656 20.563  102.690 1.00 45.44  ? 170  PRO A O     1 
ATOM   4001 C  CB    . PRO B 1 171 ? 129.788 18.167  100.263 1.00 47.79  ? 170  PRO A CB    1 
ATOM   4002 C  CG    . PRO B 1 171 ? 129.021 17.037  99.709  1.00 44.94  ? 170  PRO A CG    1 
ATOM   4003 C  CD    . PRO B 1 171 ? 127.585 17.451  99.796  1.00 42.82  ? 170  PRO A CD    1 
ATOM   4004 N  N     . ALA B 1 172 ? 128.663 21.023  100.714 1.00 40.54  ? 171  ALA A N     1 
ATOM   4005 C  CA    . ALA B 1 172 ? 128.742 22.469  100.929 1.00 49.06  ? 171  ALA A CA    1 
ATOM   4006 C  C     . ALA B 1 172 ? 127.938 22.888  102.148 1.00 48.88  ? 171  ALA A C     1 
ATOM   4007 O  O     . ALA B 1 172 ? 128.367 23.755  102.918 1.00 53.16  ? 171  ALA A O     1 
ATOM   4008 C  CB    . ALA B 1 172 ? 128.244 23.234  99.702  1.00 42.09  ? 171  ALA A CB    1 
ATOM   4009 N  N     . PHE B 1 173 ? 126.760 22.290  102.331 1.00 36.81  ? 172  PHE A N     1 
ATOM   4010 C  CA    . PHE B 1 173 ? 125.903 22.687  103.435 1.00 41.08  ? 172  PHE A CA    1 
ATOM   4011 C  C     . PHE B 1 173 ? 126.562 22.371  104.769 1.00 40.96  ? 172  PHE A C     1 
ATOM   4012 O  O     . PHE B 1 173 ? 126.447 23.145  105.724 1.00 43.70  ? 172  PHE A O     1 
ATOM   4013 C  CB    . PHE B 1 173 ? 124.547 21.992  103.312 1.00 34.78  ? 172  PHE A CB    1 
ATOM   4014 C  CG    . PHE B 1 173 ? 123.557 22.429  104.334 1.00 35.58  ? 172  PHE A CG    1 
ATOM   4015 C  CD1   . PHE B 1 173 ? 122.747 23.523  104.103 1.00 48.42  ? 172  PHE A CD1   1 
ATOM   4016 C  CD2   . PHE B 1 173 ? 123.434 21.753  105.535 1.00 38.68  ? 172  PHE A CD2   1 
ATOM   4017 C  CE1   . PHE B 1 173 ? 121.831 23.934  105.049 1.00 39.23  ? 172  PHE A CE1   1 
ATOM   4018 C  CE2   . PHE B 1 173 ? 122.521 22.164  106.482 1.00 41.33  ? 172  PHE A CE2   1 
ATOM   4019 C  CZ    . PHE B 1 173 ? 121.719 23.259  106.232 1.00 40.00  ? 172  PHE A CZ    1 
ATOM   4020 N  N     . LEU B 1 174 ? 127.281 21.246  104.842 1.00 41.76  ? 173  LEU A N     1 
ATOM   4021 C  CA    . LEU B 1 174 ? 127.891 20.817  106.097 1.00 42.54  ? 173  LEU A CA    1 
ATOM   4022 C  C     . LEU B 1 174 ? 129.087 21.676  106.494 1.00 47.87  ? 173  LEU A C     1 
ATOM   4023 O  O     . LEU B 1 174 ? 129.315 21.889  107.689 1.00 37.33  ? 173  LEU A O     1 
ATOM   4024 C  CB    . LEU B 1 174 ? 128.327 19.359  105.990 1.00 39.95  ? 173  LEU A CB    1 
ATOM   4025 C  CG    . LEU B 1 174 ? 127.224 18.305  105.903 1.00 34.86  ? 173  LEU A CG    1 
ATOM   4026 C  CD1   . LEU B 1 174 ? 127.856 16.997  105.479 1.00 35.56  ? 173  LEU A CD1   1 
ATOM   4027 C  CD2   . LEU B 1 174 ? 126.505 18.168  107.228 1.00 39.99  ? 173  LEU A CD2   1 
ATOM   4028 N  N     . GLN B 1 175 ? 129.847 22.186  105.520 1.00 43.16  ? 174  GLN A N     1 
ATOM   4029 C  CA    . GLN B 1 175 ? 131.184 22.705  105.807 1.00 47.75  ? 174  GLN A CA    1 
ATOM   4030 C  C     . GLN B 1 175 ? 131.168 23.766  106.901 1.00 46.82  ? 174  GLN A C     1 
ATOM   4031 O  O     . GLN B 1 175 ? 132.034 23.764  107.783 1.00 41.46  ? 174  GLN A O     1 
ATOM   4032 C  CB    . GLN B 1 175 ? 131.819 23.270  104.534 1.00 42.97  ? 174  GLN A CB    1 
ATOM   4033 C  CG    . GLN B 1 175 ? 133.307 23.539  104.686 1.00 45.20  ? 174  GLN A CG    1 
ATOM   4034 C  CD    . GLN B 1 175 ? 134.097 22.270  104.978 1.00 56.21  ? 174  GLN A CD    1 
ATOM   4035 O  OE1   . GLN B 1 175 ? 133.750 21.185  104.502 1.00 54.87  ? 174  GLN A OE1   1 
ATOM   4036 N  NE2   . GLN B 1 175 ? 135.164 22.403  105.761 1.00 57.77  ? 174  GLN A NE2   1 
ATOM   4037 N  N     . THR B 1 176 ? 130.190 24.676  106.867 1.00 39.92  ? 175  THR A N     1 
ATOM   4038 C  CA    . THR B 1 176 ? 130.095 25.757  107.838 1.00 49.41  ? 175  THR A CA    1 
ATOM   4039 C  C     . THR B 1 176 ? 128.901 25.613  108.773 1.00 41.97  ? 175  THR A C     1 
ATOM   4040 O  O     . THR B 1 176 ? 128.613 26.541  109.531 1.00 43.89  ? 175  THR A O     1 
ATOM   4041 C  CB    . THR B 1 176 ? 130.035 27.112  107.119 1.00 51.84  ? 175  THR A CB    1 
ATOM   4042 O  OG1   . THR B 1 176 ? 129.044 27.064  106.083 1.00 67.97  ? 175  THR A OG1   1 
ATOM   4043 C  CG2   . THR B 1 176 ? 131.388 27.450  106.504 1.00 52.29  ? 175  THR A CG2   1 
ATOM   4044 N  N     . LEU B 1 177 ? 128.200 24.490  108.739 1.00 42.51  ? 176  LEU A N     1 
ATOM   4045 C  CA    . LEU B 1 177 ? 127.054 24.312  109.617 1.00 37.10  ? 176  LEU A CA    1 
ATOM   4046 C  C     . LEU B 1 177 ? 127.511 24.314  111.077 1.00 40.75  ? 176  LEU A C     1 
ATOM   4047 O  O     . LEU B 1 177 ? 128.375 23.507  111.455 1.00 36.29  ? 176  LEU A O     1 
ATOM   4048 C  CB    . LEU B 1 177 ? 126.320 23.013  109.276 1.00 39.38  ? 176  LEU A CB    1 
ATOM   4049 C  CG    . LEU B 1 177 ? 125.113 22.591  110.121 1.00 36.67  ? 176  LEU A CG    1 
ATOM   4050 C  CD1   . LEU B 1 177 ? 123.950 23.530  109.920 1.00 40.08  ? 176  LEU A CD1   1 
ATOM   4051 C  CD2   . LEU B 1 177 ? 124.700 21.155  109.806 1.00 39.76  ? 176  LEU A CD2   1 
ATOM   4052 N  N     . PRO B 1 178 ? 127.000 25.213  111.911 1.00 37.99  ? 177  PRO A N     1 
ATOM   4053 C  CA    . PRO B 1 178 ? 127.375 25.188  113.332 1.00 32.78  ? 177  PRO A CA    1 
ATOM   4054 C  C     . PRO B 1 178 ? 126.925 23.883  113.968 1.00 38.65  ? 177  PRO A C     1 
ATOM   4055 O  O     . PRO B 1 178 ? 125.801 23.428  113.740 1.00 35.39  ? 177  PRO A O     1 
ATOM   4056 C  CB    . PRO B 1 178 ? 126.629 26.393  113.918 1.00 38.44  ? 177  PRO A CB    1 
ATOM   4057 C  CG    . PRO B 1 178 ? 126.367 27.297  112.728 1.00 42.35  ? 177  PRO A CG    1 
ATOM   4058 C  CD    . PRO B 1 178 ? 126.155 26.368  111.563 1.00 40.68  ? 177  PRO A CD    1 
ATOM   4059 N  N     . LEU B 1 179 ? 127.822 23.263  114.742 1.00 36.21  ? 178  LEU A N     1 
ATOM   4060 C  CA    . LEU B 1 179 ? 127.456 22.040  115.455 1.00 39.90  ? 178  LEU A CA    1 
ATOM   4061 C  C     . LEU B 1 179 ? 126.211 22.235  116.298 1.00 42.70  ? 178  LEU A C     1 
ATOM   4062 O  O     . LEU B 1 179 ? 125.408 21.307  116.445 1.00 34.24  ? 178  LEU A O     1 
ATOM   4063 C  CB    . LEU B 1 179 ? 128.595 21.574  116.356 1.00 33.38  ? 178  LEU A CB    1 
ATOM   4064 C  CG    . LEU B 1 179 ? 129.798 21.063  115.574 1.00 40.08  ? 178  LEU A CG    1 
ATOM   4065 C  CD1   . LEU B 1 179 ? 130.934 20.848  116.544 1.00 37.29  ? 178  LEU A CD1   1 
ATOM   4066 C  CD2   . LEU B 1 179 ? 129.430 19.770  114.837 1.00 37.89  ? 178  LEU A CD2   1 
ATOM   4067 N  N     . ALA B 1 180 ? 126.047 23.434  116.865 1.00 37.63  ? 179  ALA A N     1 
ATOM   4068 C  CA    . ALA B 1 180 ? 124.878 23.773  117.666 1.00 39.12  ? 179  ALA A CA    1 
ATOM   4069 C  C     . ALA B 1 180 ? 123.571 23.614  116.902 1.00 32.71  ? 179  ALA A C     1 
ATOM   4070 O  O     . ALA B 1 180 ? 122.521 23.478  117.532 1.00 36.67  ? 179  ALA A O     1 
ATOM   4071 C  CB    . ALA B 1 180 ? 125.009 25.211  118.178 1.00 41.71  ? 179  ALA A CB    1 
ATOM   4072 N  N     . LYS B 1 181 ? 123.600 23.626  115.568 1.00 30.67  ? 180  LYS A N     1 
ATOM   4073 C  CA    . LYS B 1 181 ? 122.371 23.433  114.805 1.00 35.54  ? 180  LYS A CA    1 
ATOM   4074 C  C     . LYS B 1 181 ? 121.952 21.976  114.712 1.00 42.65  ? 180  LYS A C     1 
ATOM   4075 O  O     . LYS B 1 181 ? 120.818 21.705  114.302 1.00 45.04  ? 180  LYS A O     1 
ATOM   4076 C  CB    . LYS B 1 181 ? 122.519 23.998  113.387 1.00 39.98  ? 180  LYS A CB    1 
ATOM   4077 C  CG    . LYS B 1 181 ? 122.625 25.493  113.319 1.00 45.53  ? 180  LYS A CG    1 
ATOM   4078 C  CD    . LYS B 1 181 ? 121.363 26.158  113.859 1.00 47.58  ? 180  LYS A CD    1 
ATOM   4079 C  CE    . LYS B 1 181 ? 121.399 27.667  113.632 1.00 58.48  ? 180  LYS A CE    1 
ATOM   4080 N  NZ    . LYS B 1 181 ? 121.793 28.025  112.234 1.00 65.43  ? 180  LYS A NZ    1 
ATOM   4081 N  N     . ILE B 1 182 ? 122.826 21.043  115.082 1.00 38.08  ? 181  ILE A N     1 
ATOM   4082 C  CA    . ILE B 1 182 ? 122.522 19.616  115.031 1.00 43.06  ? 181  ILE A CA    1 
ATOM   4083 C  C     . ILE B 1 182 ? 121.563 19.268  116.163 1.00 41.55  ? 181  ILE A C     1 
ATOM   4084 O  O     . ILE B 1 182 ? 121.867 19.547  117.330 1.00 35.84  ? 181  ILE A O     1 
ATOM   4085 C  CB    . ILE B 1 182 ? 123.806 18.776  115.116 1.00 36.75  ? 181  ILE A CB    1 
ATOM   4086 C  CG1   . ILE B 1 182 ? 124.726 19.101  113.939 1.00 36.45  ? 181  ILE A CG1   1 
ATOM   4087 C  CG2   . ILE B 1 182 ? 123.476 17.272  115.202 1.00 34.40  ? 181  ILE A CG2   1 
ATOM   4088 C  CD1   . ILE B 1 182 ? 126.050 18.384  113.998 1.00 39.33  ? 181  ILE A CD1   1 
ATOM   4089 N  N     . PRO B 1 183 ? 120.409 18.667  115.869 1.00 43.25  ? 182  PRO A N     1 
ATOM   4090 C  CA    . PRO B 1 183 ? 119.488 18.265  116.940 1.00 36.88  ? 182  PRO A CA    1 
ATOM   4091 C  C     . PRO B 1 183 ? 120.178 17.331  117.919 1.00 40.69  ? 182  PRO A C     1 
ATOM   4092 O  O     . PRO B 1 183 ? 120.837 16.364  117.525 1.00 42.56  ? 182  PRO A O     1 
ATOM   4093 C  CB    . PRO B 1 183 ? 118.353 17.558  116.186 1.00 43.02  ? 182  PRO A CB    1 
ATOM   4094 C  CG    . PRO B 1 183 ? 118.403 18.173  114.790 1.00 40.85  ? 182  PRO A CG    1 
ATOM   4095 C  CD    . PRO B 1 183 ? 119.866 18.378  114.527 1.00 40.73  ? 182  PRO A CD    1 
ATOM   4096 N  N     . GLY B 1 184 ? 120.014 17.626  119.204 1.00 34.06  ? 183  GLY A N     1 
ATOM   4097 C  CA    . GLY B 1 184 ? 120.691 16.904  120.264 1.00 31.00  ? 183  GLY A CA    1 
ATOM   4098 C  C     . GLY B 1 184 ? 121.977 17.551  120.730 1.00 39.52  ? 183  GLY A C     1 
ATOM   4099 O  O     . GLY B 1 184 ? 122.537 17.114  121.746 1.00 36.66  ? 183  GLY A O     1 
ATOM   4100 N  N     . VAL B 1 185 ? 122.467 18.559  120.015 1.00 31.29  ? 184  VAL A N     1 
ATOM   4101 C  CA    . VAL B 1 185 ? 123.635 19.325  120.438 1.00 41.04  ? 184  VAL A CA    1 
ATOM   4102 C  C     . VAL B 1 185 ? 123.086 20.586  121.100 1.00 36.76  ? 184  VAL A C     1 
ATOM   4103 O  O     . VAL B 1 185 ? 122.745 21.567  120.438 1.00 44.03  ? 184  VAL A O     1 
ATOM   4104 C  CB    . VAL B 1 185 ? 124.571 19.640  119.270 1.00 38.72  ? 184  VAL A CB    1 
ATOM   4105 C  CG1   . VAL B 1 185 ? 125.740 20.477  119.748 1.00 31.75  ? 184  VAL A CG1   1 
ATOM   4106 C  CG2   . VAL B 1 185 ? 125.071 18.350  118.638 1.00 39.34  ? 184  VAL A CG2   1 
ATOM   4107 N  N     . GLY B 1 186 ? 122.982 20.550  122.421 1.00 35.61  ? 185  GLY A N     1 
ATOM   4108 C  CA    . GLY B 1 186 ? 122.466 21.657  123.193 1.00 30.23  ? 185  GLY A CA    1 
ATOM   4109 C  C     . GLY B 1 186 ? 123.564 22.558  123.722 1.00 35.84  ? 185  GLY A C     1 
ATOM   4110 O  O     . GLY B 1 186 ? 124.712 22.522  123.271 1.00 32.47  ? 185  GLY A O     1 
ATOM   4111 N  N     . LYS B 1 187 ? 123.198 23.357  124.727 1.00 30.62  ? 186  LYS A N     1 
ATOM   4112 C  CA    . LYS B 1 187 ? 124.092 24.395  125.227 1.00 46.05  ? 186  LYS A CA    1 
ATOM   4113 C  C     . LYS B 1 187 ? 125.347 23.798  125.855 1.00 47.23  ? 186  LYS A C     1 
ATOM   4114 O  O     . LYS B 1 187 ? 126.457 24.285  125.613 1.00 40.38  ? 186  LYS A O     1 
ATOM   4115 C  CB    . LYS B 1 187 ? 123.348 25.272  126.238 1.00 51.22  ? 186  LYS A CB    1 
ATOM   4116 C  CG    . LYS B 1 187 ? 124.092 26.532  126.637 1.00 67.44  ? 186  LYS A CG    1 
ATOM   4117 C  CD    . LYS B 1 187 ? 123.379 27.253  127.774 1.00 76.43  ? 186  LYS A CD    1 
ATOM   4118 C  CE    . LYS B 1 187 ? 121.920 27.505  127.436 1.00 74.13  ? 186  LYS A CE    1 
ATOM   4119 N  NZ    . LYS B 1 187 ? 121.779 28.345  126.217 1.00 66.01  ? 186  LYS A NZ    1 
ATOM   4120 N  N     . VAL B 1 188 ? 125.192 22.737  126.656 1.00 40.60  ? 187  VAL A N     1 
ATOM   4121 C  CA    . VAL B 1 188 ? 126.341 22.135  127.333 1.00 45.73  ? 187  VAL A CA    1 
ATOM   4122 C  C     . VAL B 1 188 ? 127.278 21.474  126.322 1.00 43.15  ? 187  VAL A C     1 
ATOM   4123 O  O     . VAL B 1 188 ? 128.501 21.650  126.376 1.00 36.88  ? 187  VAL A O     1 
ATOM   4124 C  CB    . VAL B 1 188 ? 125.872 21.136  128.410 1.00 43.18  ? 187  VAL A CB    1 
ATOM   4125 C  CG1   . VAL B 1 188 ? 127.061 20.418  129.033 1.00 40.27  ? 187  VAL A CG1   1 
ATOM   4126 C  CG2   . VAL B 1 188 ? 125.054 21.845  129.496 1.00 45.00  ? 187  VAL A CG2   1 
ATOM   4127 N  N     . SER B 1 189 ? 126.729 20.702  125.385 1.00 37.04  ? 188  SER A N     1 
ATOM   4128 C  CA    . SER B 1 189 ? 127.592 20.037  124.411 1.00 41.03  ? 188  SER A CA    1 
ATOM   4129 C  C     . SER B 1 189 ? 128.262 21.041  123.483 1.00 37.25  ? 188  SER A C     1 
ATOM   4130 O  O     . SER B 1 189 ? 129.447 20.892  123.161 1.00 40.08  ? 188  SER A O     1 
ATOM   4131 C  CB    . SER B 1 189 ? 126.801 19.008  123.598 1.00 39.70  ? 188  SER A CB    1 
ATOM   4132 O  OG    . SER B 1 189 ? 126.287 17.994  124.447 1.00 44.83  ? 188  SER A OG    1 
ATOM   4133 N  N     . ALA B 1 190 ? 127.518 22.054  123.021 1.00 37.01  ? 189  ALA A N     1 
ATOM   4134 C  CA    . ALA B 1 190 ? 128.104 23.070  122.145 1.00 40.69  ? 189  ALA A CA    1 
ATOM   4135 C  C     . ALA B 1 190 ? 129.269 23.786  122.819 1.00 48.35  ? 189  ALA A C     1 
ATOM   4136 O  O     . ALA B 1 190 ? 130.276 24.099  122.172 1.00 37.13  ? 189  ALA A O     1 
ATOM   4137 C  CB    . ALA B 1 190 ? 127.046 24.091  121.724 1.00 37.85  ? 189  ALA A CB    1 
ATOM   4138 N  N     . ALA B 1 191 ? 129.141 24.083  124.113 1.00 41.12  ? 190  ALA A N     1 
ATOM   4139 C  CA    . ALA B 1 191 ? 130.231 24.771  124.798 1.00 42.12  ? 190  ALA A CA    1 
ATOM   4140 C  C     . ALA B 1 191 ? 131.402 23.829  125.056 1.00 43.45  ? 190  ALA A C     1 
ATOM   4141 O  O     . ALA B 1 191 ? 132.564 24.249  125.006 1.00 45.59  ? 190  ALA A O     1 
ATOM   4142 C  CB    . ALA B 1 191 ? 129.729 25.396  126.101 1.00 38.60  ? 190  ALA A CB    1 
ATOM   4143 N  N     . LYS B 1 192 ? 131.122 22.548  125.313 1.00 35.79  ? 191  LYS A N     1 
ATOM   4144 C  CA    . LYS B 1 192 ? 132.200 21.573  125.435 1.00 41.62  ? 191  LYS A CA    1 
ATOM   4145 C  C     . LYS B 1 192 ? 132.984 21.460  124.134 1.00 43.70  ? 191  LYS A C     1 
ATOM   4146 O  O     . LYS B 1 192 ? 134.217 21.351  124.143 1.00 47.22  ? 191  LYS A O     1 
ATOM   4147 C  CB    . LYS B 1 192 ? 131.625 20.216  125.843 1.00 44.79  ? 191  LYS A CB    1 
ATOM   4148 C  CG    . LYS B 1 192 ? 132.658 19.124  126.079 1.00 52.67  ? 191  LYS A CG    1 
ATOM   4149 C  CD    . LYS B 1 192 ? 132.093 18.039  126.992 1.00 57.29  ? 191  LYS A CD    1 
ATOM   4150 C  CE    . LYS B 1 192 ? 133.158 17.024  127.407 1.00 71.53  ? 191  LYS A CE    1 
ATOM   4151 N  NZ    . LYS B 1 192 ? 133.644 16.186  126.273 1.00 77.85  ? 191  LYS A NZ    1 
ATOM   4152 N  N     . LEU B 1 193 ? 132.282 21.499  123.003 1.00 36.41  ? 192  LEU A N     1 
ATOM   4153 C  CA    . LEU B 1 193 ? 132.936 21.445  121.701 1.00 38.11  ? 192  LEU A CA    1 
ATOM   4154 C  C     . LEU B 1 193 ? 133.718 22.722  121.423 1.00 38.18  ? 192  LEU A C     1 
ATOM   4155 O  O     . LEU B 1 193 ? 134.876 22.669  120.996 1.00 45.10  ? 192  LEU A O     1 
ATOM   4156 C  CB    . LEU B 1 193 ? 131.886 21.206  120.617 1.00 35.86  ? 192  LEU A CB    1 
ATOM   4157 C  CG    . LEU B 1 193 ? 131.249 19.822  120.700 1.00 41.09  ? 192  LEU A CG    1 
ATOM   4158 C  CD1   . LEU B 1 193 ? 129.911 19.777  119.953 1.00 38.83  ? 192  LEU A CD1   1 
ATOM   4159 C  CD2   . LEU B 1 193 ? 132.236 18.794  120.151 1.00 39.56  ? 192  LEU A CD2   1 
ATOM   4160 N  N     . GLU B 1 194 ? 133.092 23.883  121.659 1.00 46.81  ? 193  GLU A N     1 
ATOM   4161 C  CA    . GLU B 1 194 ? 133.763 25.164  121.452 1.00 49.42  ? 193  GLU A CA    1 
ATOM   4162 C  C     . GLU B 1 194 ? 135.029 25.263  122.288 1.00 55.26  ? 193  GLU A C     1 
ATOM   4163 O  O     . GLU B 1 194 ? 136.048 25.791  121.827 1.00 59.70  ? 193  GLU A O     1 
ATOM   4164 C  CB    . GLU B 1 194 ? 132.814 26.314  121.801 1.00 55.07  ? 193  GLU A CB    1 
ATOM   4165 C  CG    . GLU B 1 194 ? 133.388 27.698  121.560 1.00 70.13  ? 193  GLU A CG    1 
ATOM   4166 C  CD    . GLU B 1 194 ? 133.186 28.165  120.130 1.00 89.32  ? 193  GLU A CD    1 
ATOM   4167 O  OE1   . GLU B 1 194 ? 132.364 27.549  119.418 1.00 95.71  ? 193  GLU A OE1   1 
ATOM   4168 O  OE2   . GLU B 1 194 ? 133.841 29.147  119.720 1.00 96.61  ? 193  GLU A OE2   1 
ATOM   4169 N  N     . ALA B 1 195 ? 134.981 24.752  123.522 1.00 56.75  ? 194  ALA A N     1 
ATOM   4170 C  CA    . ALA B 1 195 ? 136.148 24.793  124.399 1.00 59.76  ? 194  ALA A CA    1 
ATOM   4171 C  C     . ALA B 1 195 ? 137.327 24.044  123.798 1.00 57.29  ? 194  ALA A C     1 
ATOM   4172 O  O     . ALA B 1 195 ? 138.480 24.368  124.098 1.00 58.15  ? 194  ALA A O     1 
ATOM   4173 C  CB    . ALA B 1 195 ? 135.799 24.222  125.776 1.00 45.93  ? 194  ALA A CB    1 
ATOM   4174 N  N     . MET B 1 196 ? 137.068 23.054  122.940 1.00 43.91  ? 195  MET A N     1 
ATOM   4175 C  CA    . MET B 1 196 ? 138.139 22.319  122.280 1.00 54.64  ? 195  MET A CA    1 
ATOM   4176 C  C     . MET B 1 196 ? 138.249 22.678  120.799 1.00 52.02  ? 195  MET A C     1 
ATOM   4177 O  O     . MET B 1 196 ? 138.736 21.882  119.994 1.00 51.41  ? 195  MET A O     1 
ATOM   4178 C  CB    . MET B 1 196 ? 137.964 20.814  122.474 1.00 53.81  ? 195  MET A CB    1 
ATOM   4179 C  CG    . MET B 1 196 ? 136.784 20.181  121.788 1.00 58.39  ? 195  MET A CG    1 
ATOM   4180 S  SD    . MET B 1 196 ? 136.686 18.416  122.196 1.00 59.29  ? 195  MET A SD    1 
ATOM   4181 C  CE    . MET B 1 196 ? 135.958 18.511  123.822 1.00 56.58  ? 195  MET A CE    1 
ATOM   4182 N  N     . GLY B 1 197 ? 137.804 23.882  120.434 1.00 53.72  ? 196  GLY A N     1 
ATOM   4183 C  CA    . GLY B 1 197 ? 138.017 24.420  119.102 1.00 59.51  ? 196  GLY A CA    1 
ATOM   4184 C  C     . GLY B 1 197 ? 137.116 23.892  118.005 1.00 63.71  ? 196  GLY A C     1 
ATOM   4185 O  O     . GLY B 1 197 ? 137.404 24.131  116.828 1.00 70.29  ? 196  GLY A O     1 
ATOM   4186 N  N     . LEU B 1 198 ? 136.034 23.190  118.340 1.00 59.15  ? 197  LEU A N     1 
ATOM   4187 C  CA    . LEU B 1 198 ? 135.107 22.647  117.349 1.00 46.39  ? 197  LEU A CA    1 
ATOM   4188 C  C     . LEU B 1 198 ? 133.849 23.507  117.338 1.00 41.52  ? 197  LEU A C     1 
ATOM   4189 O  O     . LEU B 1 198 ? 133.098 23.531  118.321 1.00 38.67  ? 197  LEU A O     1 
ATOM   4190 C  CB    . LEU B 1 198 ? 134.761 21.196  117.663 1.00 42.24  ? 197  LEU A CB    1 
ATOM   4191 C  CG    . LEU B 1 198 ? 135.960 20.268  117.833 1.00 45.54  ? 197  LEU A CG    1 
ATOM   4192 C  CD1   . LEU B 1 198 ? 135.510 18.900  118.305 1.00 42.68  ? 197  LEU A CD1   1 
ATOM   4193 C  CD2   . LEU B 1 198 ? 136.719 20.175  116.519 1.00 46.41  ? 197  LEU A CD2   1 
ATOM   4194 N  N     . ARG B 1 199 ? 133.629 24.223  116.237 1.00 37.03  ? 198  ARG A N     1 
ATOM   4195 C  CA    . ARG B 1 199 ? 132.421 25.020  116.073 1.00 45.60  ? 198  ARG A CA    1 
ATOM   4196 C  C     . ARG B 1 199 ? 131.505 24.528  114.963 1.00 35.44  ? 198  ARG A C     1 
ATOM   4197 O  O     . ARG B 1 199 ? 130.292 24.643  115.097 1.00 35.97  ? 198  ARG A O     1 
ATOM   4198 C  CB    . ARG B 1 199 ? 132.770 26.494  115.802 1.00 41.94  ? 198  ARG A CB    1 
ATOM   4199 C  CG    . ARG B 1 199 ? 131.590 27.449  116.037 1.00 42.20  ? 198  ARG A CG    1 
ATOM   4200 C  CD    . ARG B 1 199 ? 131.922 28.910  115.706 1.00 48.90  ? 198  ARG A CD    1 
ATOM   4201 N  NE    . ARG B 1 199 ? 132.176 29.105  114.278 1.00 52.32  ? 198  ARG A NE    1 
ATOM   4202 C  CZ    . ARG B 1 199 ? 131.233 29.349  113.370 1.00 46.51  ? 198  ARG A CZ    1 
ATOM   4203 N  NH1   . ARG B 1 199 ? 129.962 29.437  113.735 1.00 44.23  ? 198  ARG A NH1   1 
ATOM   4204 N  NH2   . ARG B 1 199 ? 131.562 29.512  112.094 1.00 36.34  ? 198  ARG A NH2   1 
ATOM   4205 N  N     . THR B 1 200 ? 132.042 23.996  113.875 1.00 38.42  ? 199  THR A N     1 
ATOM   4206 C  CA    . THR B 1 200 ? 131.234 23.620  112.722 1.00 49.16  ? 199  THR A CA    1 
ATOM   4207 C  C     . THR B 1 200 ? 131.400 22.141  112.410 1.00 39.14  ? 199  THR A C     1 
ATOM   4208 O  O     . THR B 1 200 ? 132.308 21.475  112.914 1.00 37.19  ? 199  THR A O     1 
ATOM   4209 C  CB    . THR B 1 200 ? 131.632 24.428  111.486 1.00 50.77  ? 199  THR A CB    1 
ATOM   4210 O  OG1   . THR B 1 200 ? 133.036 24.251  111.276 1.00 41.38  ? 199  THR A OG1   1 
ATOM   4211 C  CG2   . THR B 1 200 ? 131.312 25.912  111.664 1.00 46.10  ? 199  THR A CG2   1 
ATOM   4212 N  N     . CYS B 1 201 ? 130.544 21.642  111.512 1.00 39.66  ? 200  CYS A N     1 
ATOM   4213 C  CA    . CYS B 1 201 ? 130.705 20.268  111.031 1.00 42.86  ? 200  CYS A CA    1 
ATOM   4214 C  C     . CYS B 1 201 ? 132.022 20.091  110.288 1.00 49.43  ? 200  CYS A C     1 
ATOM   4215 O  O     . CYS B 1 201 ? 132.646 19.025  110.363 1.00 43.75  ? 200  CYS A O     1 
ATOM   4216 C  CB    . CYS B 1 201 ? 129.533 19.872  110.133 1.00 37.85  ? 200  CYS A CB    1 
ATOM   4217 S  SG    . CYS B 1 201 ? 127.966 19.710  111.029 1.00 43.72  ? 200  CYS A SG    1 
ATOM   4218 N  N     . GLY B 1 202 ? 132.451 21.114  109.544 1.00 49.73  ? 201  GLY A N     1 
ATOM   4219 C  CA    . GLY B 1 202 ? 133.744 21.039  108.881 1.00 48.40  ? 201  GLY A CA    1 
ATOM   4220 C  C     . GLY B 1 202 ? 134.885 20.842  109.862 1.00 56.11  ? 201  GLY A C     1 
ATOM   4221 O  O     . GLY B 1 202 ? 135.835 20.103  109.584 1.00 48.83  ? 201  GLY A O     1 
ATOM   4222 N  N     . ASP B 1 203 ? 134.802 21.497  111.029 1.00 48.28  ? 202  ASP A N     1 
ATOM   4223 C  CA    . ASP B 1 203 ? 135.775 21.253  112.090 1.00 52.91  ? 202  ASP A CA    1 
ATOM   4224 C  C     . ASP B 1 203 ? 135.809 19.777  112.484 1.00 47.04  ? 202  ASP A C     1 
ATOM   4225 O  O     . ASP B 1 203 ? 136.887 19.200  112.660 1.00 50.96  ? 202  ASP A O     1 
ATOM   4226 C  CB    . ASP B 1 203 ? 135.461 22.118  113.318 1.00 40.13  ? 202  ASP A CB    1 
ATOM   4227 C  CG    . ASP B 1 203 ? 135.562 23.617  113.041 1.00 55.17  ? 202  ASP A CG    1 
ATOM   4228 O  OD1   . ASP B 1 203 ? 136.269 24.024  112.090 1.00 49.01  ? 202  ASP A OD1   1 
ATOM   4229 O  OD2   . ASP B 1 203 ? 134.933 24.395  113.794 1.00 56.18  ? 202  ASP A OD2   1 
ATOM   4230 N  N     . VAL B 1 204 ? 134.638 19.146  112.615 1.00 50.13  ? 203  VAL A N     1 
ATOM   4231 C  CA    . VAL B 1 204 ? 134.585 17.782  113.148 1.00 47.81  ? 203  VAL A CA    1 
ATOM   4232 C  C     . VAL B 1 204 ? 134.987 16.745  112.103 1.00 50.42  ? 203  VAL A C     1 
ATOM   4233 O  O     . VAL B 1 204 ? 135.513 15.681  112.454 1.00 56.65  ? 203  VAL A O     1 
ATOM   4234 C  CB    . VAL B 1 204 ? 133.186 17.486  113.721 1.00 46.79  ? 203  VAL A CB    1 
ATOM   4235 C  CG1   . VAL B 1 204 ? 133.068 16.032  114.171 1.00 46.14  ? 203  VAL A CG1   1 
ATOM   4236 C  CG2   . VAL B 1 204 ? 132.892 18.403  114.894 1.00 44.44  ? 203  VAL A CG2   1 
ATOM   4237 N  N     . GLN B 1 205 ? 134.758 17.014  110.817 1.00 44.33  ? 204  GLN A N     1 
ATOM   4238 C  CA    . GLN B 1 205 ? 135.212 16.078  109.792 1.00 49.51  ? 204  GLN A CA    1 
ATOM   4239 C  C     . GLN B 1 205 ? 136.726 15.906  109.813 1.00 53.29  ? 204  GLN A C     1 
ATOM   4240 O  O     . GLN B 1 205 ? 137.232 14.893  109.319 1.00 58.04  ? 204  GLN A O     1 
ATOM   4241 C  CB    . GLN B 1 205 ? 134.770 16.544  108.398 1.00 48.52  ? 204  GLN A CB    1 
ATOM   4242 C  CG    . GLN B 1 205 ? 133.267 16.731  108.203 1.00 48.33  ? 204  GLN A CG    1 
ATOM   4243 C  CD    . GLN B 1 205 ? 132.940 17.404  106.875 1.00 48.29  ? 204  GLN A CD    1 
ATOM   4244 O  OE1   . GLN B 1 205 ? 133.838 17.736  106.103 1.00 44.58  ? 204  GLN A OE1   1 
ATOM   4245 N  NE2   . GLN B 1 205 ? 131.653 17.603  106.603 1.00 47.87  ? 204  GLN A NE2   1 
ATOM   4246 N  N     . LYS B 1 206 ? 137.453 16.866  110.379 1.00 50.05  ? 205  LYS A N     1 
ATOM   4247 C  CA    . LYS B 1 206 ? 138.908 16.861  110.390 1.00 59.53  ? 205  LYS A CA    1 
ATOM   4248 C  C     . LYS B 1 206 ? 139.510 16.179  111.616 1.00 61.29  ? 205  LYS A C     1 
ATOM   4249 O  O     . LYS B 1 206 ? 140.736 16.057  111.694 1.00 65.44  ? 205  LYS A O     1 
ATOM   4250 C  CB    . LYS B 1 206 ? 139.431 18.302  110.310 1.00 59.55  ? 205  LYS A CB    1 
ATOM   4251 N  N     . CYS B 1 207 ? 138.701 15.736  112.572 1.00 59.18  ? 206  CYS A N     1 
ATOM   4252 C  CA    . CYS B 1 207 ? 139.234 15.207  113.819 1.00 67.69  ? 206  CYS A CA    1 
ATOM   4253 C  C     . CYS B 1 207 ? 139.082 13.692  113.899 1.00 65.86  ? 206  CYS A C     1 
ATOM   4254 O  O     . CYS B 1 207 ? 138.293 13.073  113.179 1.00 61.58  ? 206  CYS A O     1 
ATOM   4255 C  CB    . CYS B 1 207 ? 138.566 15.871  115.031 1.00 82.72  ? 206  CYS A CB    1 
ATOM   4256 S  SG    . CYS B 1 207 ? 136.833 15.475  115.244 1.00 98.28  ? 206  CYS A SG    1 
ATOM   4257 N  N     . ASP B 1 208 ? 139.861 13.111  114.810 1.00 67.89  ? 207  ASP A N     1 
ATOM   4258 C  CA    . ASP B 1 208 ? 139.945 11.666  114.977 1.00 66.57  ? 207  ASP A CA    1 
ATOM   4259 C  C     . ASP B 1 208 ? 138.681 11.118  115.639 1.00 52.81  ? 207  ASP A C     1 
ATOM   4260 O  O     . ASP B 1 208 ? 138.245 11.617  116.677 1.00 45.83  ? 207  ASP A O     1 
ATOM   4261 C  CB    . ASP B 1 208 ? 141.187 11.341  115.815 1.00 70.49  ? 207  ASP A CB    1 
ATOM   4262 C  CG    . ASP B 1 208 ? 141.178 9.933   116.374 1.00 81.38  ? 207  ASP A CG    1 
ATOM   4263 O  OD1   . ASP B 1 208 ? 140.835 8.987   115.633 1.00 83.41  ? 207  ASP A OD1   1 
ATOM   4264 O  OD2   . ASP B 1 208 ? 141.532 9.778   117.564 1.00 81.46  ? 207  ASP A OD2   1 
ATOM   4265 N  N     . LEU B 1 209 ? 138.091 10.083  115.037 1.00 47.76  ? 208  LEU A N     1 
ATOM   4266 C  CA    . LEU B 1 209 ? 136.905 9.465   115.628 1.00 44.27  ? 208  LEU A CA    1 
ATOM   4267 C  C     . LEU B 1 209 ? 137.205 8.894   117.010 1.00 43.55  ? 208  LEU A C     1 
ATOM   4268 O  O     . LEU B 1 209 ? 136.360 8.959   117.915 1.00 42.80  ? 208  LEU A O     1 
ATOM   4269 C  CB    . LEU B 1 209 ? 136.365 8.371   114.699 1.00 44.98  ? 208  LEU A CB    1 
ATOM   4270 C  CG    . LEU B 1 209 ? 135.276 7.460   115.272 1.00 45.06  ? 208  LEU A CG    1 
ATOM   4271 C  CD1   . LEU B 1 209 ? 134.045 8.260   115.664 1.00 40.97  ? 208  LEU A CD1   1 
ATOM   4272 C  CD2   . LEU B 1 209 ? 134.926 6.336   114.290 1.00 45.25  ? 208  LEU A CD2   1 
ATOM   4273 N  N     . VAL B 1 210 ? 138.409 8.345   117.198 1.00 48.46  ? 209  VAL A N     1 
ATOM   4274 C  CA    . VAL B 1 210 ? 138.770 7.770   118.493 1.00 51.89  ? 209  VAL A CA    1 
ATOM   4275 C  C     . VAL B 1 210 ? 138.708 8.828   119.588 1.00 45.27  ? 209  VAL A C     1 
ATOM   4276 O  O     . VAL B 1 210 ? 138.225 8.565   120.696 1.00 47.03  ? 209  VAL A O     1 
ATOM   4277 C  CB    . VAL B 1 210 ? 140.158 7.107   118.426 1.00 55.60  ? 209  VAL A CB    1 
ATOM   4278 C  CG1   . VAL B 1 210 ? 140.559 6.591   119.801 1.00 54.25  ? 209  VAL A CG1   1 
ATOM   4279 C  CG2   . VAL B 1 210 ? 140.167 5.976   117.399 1.00 59.20  ? 209  VAL A CG2   1 
ATOM   4280 N  N     . MET B 1 211 ? 139.178 10.046  119.297 1.00 54.51  ? 210  MET A N     1 
ATOM   4281 C  CA    . MET B 1 211 ? 139.107 11.106  120.301 1.00 56.27  ? 210  MET A CA    1 
ATOM   4282 C  C     . MET B 1 211 ? 137.663 11.421  120.671 1.00 58.56  ? 210  MET A C     1 
ATOM   4283 O  O     . MET B 1 211 ? 137.349 11.607  121.854 1.00 53.03  ? 210  MET A O     1 
ATOM   4284 C  CB    . MET B 1 211 ? 139.805 12.369  119.805 1.00 71.12  ? 210  MET A CB    1 
ATOM   4285 C  CG    . MET B 1 211 ? 139.427 13.600  120.623 1.00 81.81  ? 210  MET A CG    1 
ATOM   4286 S  SD    . MET B 1 211 ? 139.578 15.155  119.732 1.00 91.12  ? 210  MET A SD    1 
ATOM   4287 C  CE    . MET B 1 211 ? 141.009 15.866  120.553 1.00 95.10  ? 210  MET A CE    1 
ATOM   4288 N  N     . LEU B 1 212 ? 136.765 11.475  119.675 1.00 49.72  ? 211  LEU A N     1 
ATOM   4289 C  CA    . LEU B 1 212 ? 135.376 11.837  119.959 1.00 47.57  ? 211  LEU A CA    1 
ATOM   4290 C  C     . LEU B 1 212 ? 134.673 10.755  120.771 1.00 43.65  ? 211  LEU A C     1 
ATOM   4291 O  O     . LEU B 1 212 ? 133.907 11.064  121.692 1.00 42.48  ? 211  LEU A O     1 
ATOM   4292 C  CB    . LEU B 1 212 ? 134.618 12.120  118.660 1.00 45.42  ? 211  LEU A CB    1 
ATOM   4293 C  CG    . LEU B 1 212 ? 135.124 13.267  117.788 1.00 52.22  ? 211  LEU A CG    1 
ATOM   4294 C  CD1   . LEU B 1 212 ? 134.310 13.352  116.501 1.00 53.41  ? 211  LEU A CD1   1 
ATOM   4295 C  CD2   . LEU B 1 212 ? 135.089 14.596  118.528 1.00 58.33  ? 211  LEU A CD2   1 
ATOM   4296 N  N     . LEU B 1 213 ? 134.926 9.482   120.458 1.00 42.38  ? 212  LEU A N     1 
ATOM   4297 C  CA    . LEU B 1 213 ? 134.427 8.411   121.317 1.00 46.30  ? 212  LEU A CA    1 
ATOM   4298 C  C     . LEU B 1 213 ? 134.989 8.543   122.726 1.00 52.47  ? 212  LEU A C     1 
ATOM   4299 O  O     . LEU B 1 213 ? 134.275 8.320   123.711 1.00 54.33  ? 212  LEU A O     1 
ATOM   4300 C  CB    . LEU B 1 213 ? 134.785 7.043   120.732 1.00 52.12  ? 212  LEU A CB    1 
ATOM   4301 C  CG    . LEU B 1 213 ? 134.334 6.681   119.317 1.00 52.27  ? 212  LEU A CG    1 
ATOM   4302 C  CD1   . LEU B 1 213 ? 134.771 5.252   118.969 1.00 47.76  ? 212  LEU A CD1   1 
ATOM   4303 C  CD2   . LEU B 1 213 ? 132.833 6.836   119.162 1.00 55.14  ? 212  LEU A CD2   1 
ATOM   4304 N  N     . LYS B 1 214 ? 136.267 8.918   122.838 1.00 50.82  ? 213  LYS A N     1 
ATOM   4305 C  CA    . LYS B 1 214 ? 136.890 9.110   124.147 1.00 61.47  ? 213  LYS A CA    1 
ATOM   4306 C  C     . LYS B 1 214 ? 136.229 10.248  124.916 1.00 64.21  ? 213  LYS A C     1 
ATOM   4307 O  O     . LYS B 1 214 ? 135.836 10.087  126.078 1.00 62.87  ? 213  LYS A O     1 
ATOM   4308 C  CB    . LYS B 1 214 ? 138.387 9.389   123.983 1.00 64.67  ? 213  LYS A CB    1 
ATOM   4309 C  CG    . LYS B 1 214 ? 139.265 8.157   123.909 1.00 75.15  ? 213  LYS A CG    1 
ATOM   4310 C  CD    . LYS B 1 214 ? 139.216 7.381   125.218 1.00 82.50  ? 213  LYS A CD    1 
ATOM   4311 C  CE    . LYS B 1 214 ? 139.646 8.246   126.399 1.00 80.67  ? 213  LYS A CE    1 
ATOM   4312 N  NZ    . LYS B 1 214 ? 139.314 7.615   127.711 1.00 78.17  ? 213  LYS A NZ    1 
ATOM   4313 N  N     . ARG B 1 215 ? 136.111 11.416  124.286 1.00 57.55  ? 214  ARG A N     1 
ATOM   4314 C  CA    . ARG B 1 215 ? 135.596 12.587  124.982 1.00 56.78  ? 214  ARG A CA    1 
ATOM   4315 C  C     . ARG B 1 215 ? 134.078 12.600  125.108 1.00 56.70  ? 214  ARG A C     1 
ATOM   4316 O  O     . ARG B 1 215 ? 133.561 13.283  125.998 1.00 63.44  ? 214  ARG A O     1 
ATOM   4317 C  CB    . ARG B 1 215 ? 136.063 13.867  124.283 1.00 56.17  ? 214  ARG A CB    1 
ATOM   4318 C  CG    . ARG B 1 215 ? 137.446 14.357  124.721 1.00 64.85  ? 214  ARG A CG    1 
ATOM   4319 C  CD    . ARG B 1 215 ? 137.410 15.013  126.109 1.00 72.34  ? 214  ARG A CD    1 
ATOM   4320 N  NE    . ARG B 1 215 ? 136.842 16.363  126.078 1.00 81.43  ? 214  ARG A NE    1 
ATOM   4321 C  CZ    . ARG B 1 215 ? 136.770 17.176  127.132 1.00 89.48  ? 214  ARG A CZ    1 
ATOM   4322 N  NH1   . ARG B 1 215 ? 137.229 16.778  128.313 1.00 100.34 ? 214  ARG A NH1   1 
ATOM   4323 N  NH2   . ARG B 1 215 ? 136.239 18.389  127.011 1.00 79.81  ? 214  ARG A NH2   1 
ATOM   4324 N  N     . PHE B 1 216 ? 133.344 11.860  124.268 1.00 50.37  ? 215  PHE A N     1 
ATOM   4325 C  CA    . PHE B 1 216 ? 131.890 12.002  124.242 1.00 45.58  ? 215  PHE A CA    1 
ATOM   4326 C  C     . PHE B 1 216 ? 131.091 10.704  124.280 1.00 49.08  ? 215  PHE A C     1 
ATOM   4327 O  O     . PHE B 1 216 ? 129.859 10.776  124.336 1.00 44.14  ? 215  PHE A O     1 
ATOM   4328 C  CB    . PHE B 1 216 ? 131.457 12.798  123.001 1.00 46.71  ? 215  PHE A CB    1 
ATOM   4329 C  CG    . PHE B 1 216 ? 131.949 14.214  122.988 1.00 53.86  ? 215  PHE A CG    1 
ATOM   4330 C  CD1   . PHE B 1 216 ? 131.260 15.205  123.671 1.00 54.41  ? 215  PHE A CD1   1 
ATOM   4331 C  CD2   . PHE B 1 216 ? 133.098 14.556  122.293 1.00 51.88  ? 215  PHE A CD2   1 
ATOM   4332 C  CE1   . PHE B 1 216 ? 131.708 16.510  123.657 1.00 53.62  ? 215  PHE A CE1   1 
ATOM   4333 C  CE2   . PHE B 1 216 ? 133.549 15.859  122.272 1.00 58.45  ? 215  PHE A CE2   1 
ATOM   4334 C  CZ    . PHE B 1 216 ? 132.856 16.838  122.959 1.00 58.10  ? 215  PHE A CZ    1 
ATOM   4335 N  N     . GLY B 1 217 ? 131.727 9.534   124.254 1.00 61.71  ? 216  GLY A N     1 
ATOM   4336 C  CA    . GLY B 1 217 ? 130.950 8.299   124.284 1.00 61.63  ? 216  GLY A CA    1 
ATOM   4337 C  C     . GLY B 1 217 ? 130.153 8.113   123.005 1.00 57.38  ? 216  GLY A C     1 
ATOM   4338 O  O     . GLY B 1 217 ? 130.611 8.446   121.907 1.00 54.30  ? 216  GLY A O     1 
ATOM   4339 N  N     . LYS B 1 218 ? 128.933 7.582   123.142 1.00 54.80  ? 217  LYS A N     1 
ATOM   4340 C  CA    . LYS B 1 218 ? 128.099 7.365   121.961 1.00 52.37  ? 217  LYS A CA    1 
ATOM   4341 C  C     . LYS B 1 218 ? 127.779 8.674   121.252 1.00 54.54  ? 217  LYS A C     1 
ATOM   4342 O  O     . LYS B 1 218 ? 127.647 8.700   120.020 1.00 49.29  ? 217  LYS A O     1 
ATOM   4343 C  CB    . LYS B 1 218 ? 126.808 6.635   122.346 1.00 56.89  ? 217  LYS A CB    1 
ATOM   4344 C  CG    . LYS B 1 218 ? 125.893 6.278   121.169 1.00 62.71  ? 217  LYS A CG    1 
ATOM   4345 C  CD    . LYS B 1 218 ? 126.673 5.683   119.973 1.00 76.26  ? 217  LYS A CD    1 
ATOM   4346 C  CE    . LYS B 1 218 ? 127.270 4.295   120.276 1.00 66.86  ? 217  LYS A CE    1 
ATOM   4347 N  NZ    . LYS B 1 218 ? 128.419 3.946   119.389 1.00 53.97  ? 217  LYS A NZ    1 
ATOM   4348 N  N     . PHE B 1 219 ? 127.645 9.764   122.009 1.00 47.27  ? 218  PHE A N     1 
ATOM   4349 C  CA    . PHE B 1 219 ? 127.390 11.066  121.401 1.00 46.82  ? 218  PHE A CA    1 
ATOM   4350 C  C     . PHE B 1 219 ? 128.485 11.419  120.402 1.00 38.57  ? 218  PHE A C     1 
ATOM   4351 O  O     . PHE B 1 219 ? 128.222 12.048  119.371 1.00 39.81  ? 218  PHE A O     1 
ATOM   4352 C  CB    . PHE B 1 219 ? 127.283 12.124  122.507 1.00 46.43  ? 218  PHE A CB    1 
ATOM   4353 C  CG    . PHE B 1 219 ? 126.978 13.527  122.012 1.00 57.13  ? 218  PHE A CG    1 
ATOM   4354 C  CD1   . PHE B 1 219 ? 125.673 13.931  121.781 1.00 60.19  ? 218  PHE A CD1   1 
ATOM   4355 C  CD2   . PHE B 1 219 ? 127.996 14.451  121.827 1.00 56.97  ? 218  PHE A CD2   1 
ATOM   4356 C  CE1   . PHE B 1 219 ? 125.391 15.218  121.352 1.00 56.24  ? 218  PHE A CE1   1 
ATOM   4357 C  CE2   . PHE B 1 219 ? 127.719 15.748  121.396 1.00 56.23  ? 218  PHE A CE2   1 
ATOM   4358 C  CZ    . PHE B 1 219 ? 126.418 16.129  121.159 1.00 52.28  ? 218  PHE A CZ    1 
ATOM   4359 N  N     . GLY B 1 220 ? 129.722 11.005  120.689 1.00 44.19  ? 219  GLY A N     1 
ATOM   4360 C  CA    . GLY B 1 220 ? 130.833 11.343  119.822 1.00 38.80  ? 219  GLY A CA    1 
ATOM   4361 C  C     . GLY B 1 220 ? 130.778 10.640  118.486 1.00 42.62  ? 219  GLY A C     1 
ATOM   4362 O  O     . GLY B 1 220 ? 131.273 11.170  117.486 1.00 37.92  ? 219  GLY A O     1 
ATOM   4363 N  N     . ARG B 1 221 ? 130.185 9.445   118.443 1.00 37.66  ? 220  ARG A N     1 
ATOM   4364 C  CA    . ARG B 1 221 ? 130.006 8.785   117.158 1.00 44.97  ? 220  ARG A CA    1 
ATOM   4365 C  C     . ARG B 1 221 ? 128.909 9.464   116.355 1.00 41.59  ? 220  ARG A C     1 
ATOM   4366 O  O     . ARG B 1 221 ? 129.063 9.685   115.152 1.00 41.67  ? 220  ARG A O     1 
ATOM   4367 C  CB    . ARG B 1 221 ? 129.693 7.296   117.337 1.00 40.12  ? 220  ARG A CB    1 
ATOM   4368 C  CG    . ARG B 1 221 ? 129.345 6.631   116.013 1.00 40.15  ? 220  ARG A CG    1 
ATOM   4369 C  CD    . ARG B 1 221 ? 129.109 5.150   116.151 1.00 42.48  ? 220  ARG A CD    1 
ATOM   4370 N  NE    . ARG B 1 221 ? 130.284 4.469   116.676 1.00 41.17  ? 220  ARG A NE    1 
ATOM   4371 C  CZ    . ARG B 1 221 ? 131.349 4.152   115.948 1.00 40.89  ? 220  ARG A CZ    1 
ATOM   4372 N  NH1   . ARG B 1 221 ? 131.391 4.472   114.670 1.00 40.70  ? 220  ARG A NH1   1 
ATOM   4373 N  NH2   . ARG B 1 221 ? 132.377 3.523   116.507 1.00 43.48  ? 220  ARG A NH2   1 
ATOM   4374 N  N     . ILE B 1 222 ? 127.794 9.796   117.002 1.00 46.49  ? 221  ILE A N     1 
ATOM   4375 C  CA    . ILE B 1 222 ? 126.726 10.516  116.315 1.00 41.60  ? 221  ILE A CA    1 
ATOM   4376 C  C     . ILE B 1 222 ? 127.238 11.854  115.795 1.00 35.19  ? 221  ILE A C     1 
ATOM   4377 O  O     . ILE B 1 222 ? 126.940 12.249  114.664 1.00 38.96  ? 221  ILE A O     1 
ATOM   4378 C  CB    . ILE B 1 222 ? 125.521 10.678  117.263 1.00 49.46  ? 221  ILE A CB    1 
ATOM   4379 C  CG1   . ILE B 1 222 ? 124.837 9.323   117.489 1.00 43.62  ? 221  ILE A CG1   1 
ATOM   4380 C  CG2   . ILE B 1 222 ? 124.529 11.696  116.742 1.00 43.06  ? 221  ILE A CG2   1 
ATOM   4381 C  CD1   . ILE B 1 222 ? 123.982 9.329   118.753 1.00 46.34  ? 221  ILE A CD1   1 
ATOM   4382 N  N     . LEU B 1 223 ? 128.050 12.554  116.591 1.00 35.60  ? 222  LEU A N     1 
ATOM   4383 C  CA    . LEU B 1 223 ? 128.647 13.804  116.124 1.00 41.76  ? 222  LEU A CA    1 
ATOM   4384 C  C     . LEU B 1 223 ? 129.518 13.578  114.889 1.00 44.02  ? 222  LEU A C     1 
ATOM   4385 O  O     . LEU B 1 223 ? 129.480 14.362  113.929 1.00 38.91  ? 222  LEU A O     1 
ATOM   4386 C  CB    . LEU B 1 223 ? 129.473 14.416  117.252 1.00 50.80  ? 222  LEU A CB    1 
ATOM   4387 C  CG    . LEU B 1 223 ? 129.677 15.917  117.358 1.00 56.74  ? 222  LEU A CG    1 
ATOM   4388 C  CD1   . LEU B 1 223 ? 128.342 16.645  117.351 1.00 52.97  ? 222  LEU A CD1   1 
ATOM   4389 C  CD2   . LEU B 1 223 ? 130.425 16.177  118.652 1.00 60.01  ? 222  LEU A CD2   1 
ATOM   4390 N  N     . TRP B 1 224 ? 130.319 12.513  114.899 1.00 37.03  ? 223  TRP A N     1 
ATOM   4391 C  CA    . TRP B 1 224 ? 131.193 12.228  113.766 1.00 38.15  ? 223  TRP A CA    1 
ATOM   4392 C  C     . TRP B 1 224 ? 130.390 11.910  112.507 1.00 44.79  ? 223  TRP A C     1 
ATOM   4393 O  O     . TRP B 1 224 ? 130.753 12.341  111.403 1.00 40.73  ? 223  TRP A O     1 
ATOM   4394 C  CB    . TRP B 1 224 ? 132.135 11.080  114.135 1.00 38.53  ? 223  TRP A CB    1 
ATOM   4395 C  CG    . TRP B 1 224 ? 133.119 10.748  113.078 1.00 44.59  ? 223  TRP A CG    1 
ATOM   4396 C  CD1   . TRP B 1 224 ? 134.359 11.293  112.909 1.00 41.11  ? 223  TRP A CD1   1 
ATOM   4397 C  CD2   . TRP B 1 224 ? 132.959 9.776   112.042 1.00 41.99  ? 223  TRP A CD2   1 
ATOM   4398 N  NE1   . TRP B 1 224 ? 134.977 10.727  111.821 1.00 44.49  ? 223  TRP A NE1   1 
ATOM   4399 C  CE2   . TRP B 1 224 ? 134.138 9.793   111.269 1.00 46.93  ? 223  TRP A CE2   1 
ATOM   4400 C  CE3   . TRP B 1 224 ? 131.927 8.898   111.686 1.00 39.18  ? 223  TRP A CE3   1 
ATOM   4401 C  CZ2   . TRP B 1 224 ? 134.315 8.970   110.165 1.00 48.41  ? 223  TRP A CZ2   1 
ATOM   4402 C  CZ3   . TRP B 1 224 ? 132.102 8.083   110.583 1.00 46.54  ? 223  TRP A CZ3   1 
ATOM   4403 C  CH2   . TRP B 1 224 ? 133.289 8.120   109.838 1.00 53.10  ? 223  TRP A CH2   1 
ATOM   4404 N  N     . GLU B 1 225 ? 129.287 11.171  112.651 1.00 39.12  ? 224  GLU A N     1 
ATOM   4405 C  CA    . GLU B 1 225 ? 128.485 10.794  111.489 1.00 44.78  ? 224  GLU A CA    1 
ATOM   4406 C  C     . GLU B 1 225 ? 127.761 11.998  110.905 1.00 48.88  ? 224  GLU A C     1 
ATOM   4407 O  O     . GLU B 1 225 ? 127.883 12.303  109.709 1.00 44.78  ? 224  GLU A O     1 
ATOM   4408 C  CB    . GLU B 1 225 ? 127.473 9.715   111.870 1.00 44.11  ? 224  GLU A CB    1 
ATOM   4409 C  CG    . GLU B 1 225 ? 128.070 8.390   112.296 1.00 46.88  ? 224  GLU A CG    1 
ATOM   4410 C  CD    . GLU B 1 225 ? 127.003 7.405   112.726 1.00 56.00  ? 224  GLU A CD    1 
ATOM   4411 O  OE1   . GLU B 1 225 ? 125.811 7.777   112.720 1.00 58.96  ? 224  GLU A OE1   1 
ATOM   4412 O  OE2   . GLU B 1 225 ? 127.352 6.259   113.065 1.00 72.81  ? 224  GLU A OE2   1 
ATOM   4413 N  N     . ARG B 1 226 ? 126.976 12.688  111.732 1.00 34.50  ? 225  ARG A N     1 
ATOM   4414 C  CA    . ARG B 1 226 ? 126.188 13.784  111.186 1.00 44.92  ? 225  ARG A CA    1 
ATOM   4415 C  C     . ARG B 1 226 ? 127.076 14.872  110.595 1.00 42.96  ? 225  ARG A C     1 
ATOM   4416 O  O     . ARG B 1 226 ? 126.679 15.533  109.627 1.00 43.65  ? 225  ARG A O     1 
ATOM   4417 C  CB    . ARG B 1 226 ? 125.253 14.331  112.258 1.00 47.72  ? 225  ARG A CB    1 
ATOM   4418 C  CG    . ARG B 1 226 ? 123.965 13.519  112.321 1.00 50.85  ? 225  ARG A CG    1 
ATOM   4419 C  CD    . ARG B 1 226 ? 123.583 13.186  113.724 1.00 50.85  ? 225  ARG A CD    1 
ATOM   4420 N  NE    . ARG B 1 226 ? 122.516 12.189  113.809 1.00 54.58  ? 225  ARG A NE    1 
ATOM   4421 C  CZ    . ARG B 1 226 ? 122.664 10.889  113.544 1.00 62.15  ? 225  ARG A CZ    1 
ATOM   4422 N  NH1   . ARG B 1 226 ? 123.834 10.408  113.132 1.00 57.85  ? 225  ARG A NH1   1 
ATOM   4423 N  NH2   . ARG B 1 226 ? 121.630 10.063  113.672 1.00 55.28  ? 225  ARG A NH2   1 
ATOM   4424 N  N     . SER B 1 227 ? 128.297 15.036  111.113 1.00 37.41  ? 226  SER A N     1 
ATOM   4425 C  CA    . SER B 1 227 ? 129.213 16.010  110.526 1.00 54.86  ? 226  SER A CA    1 
ATOM   4426 C  C     . SER B 1 227 ? 129.548 15.682  109.077 1.00 54.61  ? 226  SER A C     1 
ATOM   4427 O  O     . SER B 1 227 ? 130.041 16.553  108.351 1.00 56.62  ? 226  SER A O     1 
ATOM   4428 C  CB    . SER B 1 227 ? 130.494 16.101  111.353 1.00 49.14  ? 226  SER A CB    1 
ATOM   4429 O  OG    . SER B 1 227 ? 130.247 16.816  112.544 1.00 57.64  ? 226  SER A OG    1 
ATOM   4430 N  N     . GLN B 1 228 ? 129.290 14.446  108.649 1.00 48.90  ? 227  GLN A N     1 
ATOM   4431 C  CA    . GLN B 1 228 ? 129.432 14.019  107.265 1.00 53.64  ? 227  GLN A CA    1 
ATOM   4432 C  C     . GLN B 1 228 ? 128.093 13.736  106.605 1.00 51.43  ? 227  GLN A C     1 
ATOM   4433 O  O     . GLN B 1 228 ? 128.050 13.080  105.562 1.00 55.08  ? 227  GLN A O     1 
ATOM   4434 C  CB    . GLN B 1 228 ? 130.293 12.768  107.194 1.00 52.47  ? 227  GLN A CB    1 
ATOM   4435 C  CG    . GLN B 1 228 ? 131.543 12.877  107.981 1.00 59.68  ? 227  GLN A CG    1 
ATOM   4436 C  CD    . GLN B 1 228 ? 132.220 11.561  108.057 1.00 56.01  ? 227  GLN A CD    1 
ATOM   4437 O  OE1   . GLN B 1 228 ? 132.944 11.176  107.145 1.00 54.65  ? 227  GLN A OE1   1 
ATOM   4438 N  NE2   . GLN B 1 228 ? 131.960 10.830  109.126 1.00 50.49  ? 227  GLN A NE2   1 
ATOM   4439 N  N     . GLY B 1 229 ? 126.998 14.187  107.204 1.00 46.07  ? 228  GLY A N     1 
ATOM   4440 C  CA    . GLY B 1 229 ? 125.711 13.919  106.608 1.00 39.34  ? 228  GLY A CA    1 
ATOM   4441 C  C     . GLY B 1 229 ? 125.255 12.488  106.706 1.00 37.74  ? 228  GLY A C     1 
ATOM   4442 O  O     . GLY B 1 229 ? 124.333 12.097  105.986 1.00 43.33  ? 228  GLY A O     1 
ATOM   4443 N  N     . ILE B 1 230 ? 125.874 11.684  107.559 1.00 40.81  ? 229  ILE A N     1 
ATOM   4444 C  CA    . ILE B 1 230 ? 125.417 10.320  107.791 1.00 45.05  ? 229  ILE A CA    1 
ATOM   4445 C  C     . ILE B 1 230 ? 124.382 10.344  108.903 1.00 42.62  ? 229  ILE A C     1 
ATOM   4446 O  O     . ILE B 1 230 ? 124.617 10.918  109.977 1.00 35.56  ? 229  ILE A O     1 
ATOM   4447 C  CB    . ILE B 1 230 ? 126.590 9.389   108.140 1.00 49.06  ? 229  ILE A CB    1 
ATOM   4448 C  CG1   . ILE B 1 230 ? 127.581 9.323   106.975 1.00 47.30  ? 229  ILE A CG1   1 
ATOM   4449 C  CG2   . ILE B 1 230 ? 126.073 7.991   108.479 1.00 41.37  ? 229  ILE A CG2   1 
ATOM   4450 C  CD1   . ILE B 1 230 ? 128.919 8.739   107.349 1.00 48.97  ? 229  ILE A CD1   1 
ATOM   4451 N  N     . ASP B 1 231 ? 123.222 9.745   108.627 1.00 31.88  ? 230  ASP A N     1 
ATOM   4452 C  CA    . ASP B 1 231 ? 122.129 9.674   109.597 1.00 35.20  ? 230  ASP A CA    1 
ATOM   4453 C  C     . ASP B 1 231 ? 121.198 8.564   109.099 1.00 43.43  ? 230  ASP A C     1 
ATOM   4454 O  O     . ASP B 1 231 ? 120.223 8.829   108.395 1.00 39.72  ? 230  ASP A O     1 
ATOM   4455 C  CB    . ASP B 1 231 ? 121.400 10.997  109.753 1.00 34.03  ? 230  ASP A CB    1 
ATOM   4456 C  CG    . ASP B 1 231 ? 120.216 10.910  110.720 1.00 41.60  ? 230  ASP A CG    1 
ATOM   4457 O  OD1   . ASP B 1 231 ? 119.977 9.825   111.299 1.00 41.31  ? 230  ASP A OD1   1 
ATOM   4458 O  OD2   . ASP B 1 231 ? 119.521 11.930  110.917 1.00 36.90  ? 230  ASP A OD2   1 
ATOM   4459 N  N     . GLU B 1 232 ? 121.507 7.330   109.499 1.00 46.21  ? 231  GLU A N     1 
ATOM   4460 C  CA    . GLU B 1 232 ? 120.801 6.151   109.014 1.00 45.08  ? 231  GLU A CA    1 
ATOM   4461 C  C     . GLU B 1 232 ? 119.469 5.922   109.706 1.00 48.29  ? 231  GLU A C     1 
ATOM   4462 O  O     . GLU B 1 232 ? 118.769 4.972   109.346 1.00 49.42  ? 231  GLU A O     1 
ATOM   4463 C  CB    . GLU B 1 232 ? 121.685 4.914   109.175 1.00 44.74  ? 231  GLU A CB    1 
ATOM   4464 C  CG    . GLU B 1 232 ? 122.779 4.827   108.138 1.00 56.73  ? 231  GLU A CG    1 
ATOM   4465 C  CD    . GLU B 1 232 ? 122.254 4.331   106.803 1.00 74.33  ? 231  GLU A CD    1 
ATOM   4466 O  OE1   . GLU B 1 232 ? 121.780 3.170   106.740 1.00 71.02  ? 231  GLU A OE1   1 
ATOM   4467 O  OE2   . GLU B 1 232 ? 122.300 5.107   105.824 1.00 82.16  ? 231  GLU A OE2   1 
ATOM   4468 N  N     . ARG B 1 233 ? 119.111 6.754   110.684 1.00 44.92  ? 232  ARG A N     1 
ATOM   4469 C  CA    . ARG B 1 233 ? 117.857 6.587   111.407 1.00 48.23  ? 232  ARG A CA    1 
ATOM   4470 C  C     . ARG B 1 233 ? 116.684 6.511   110.443 1.00 43.96  ? 232  ARG A C     1 
ATOM   4471 O  O     . ARG B 1 233 ? 116.481 7.408   109.622 1.00 41.70  ? 232  ARG A O     1 
ATOM   4472 C  CB    . ARG B 1 233 ? 117.657 7.742   112.398 1.00 43.19  ? 232  ARG A CB    1 
ATOM   4473 C  CG    . ARG B 1 233 ? 118.660 7.767   113.530 1.00 43.49  ? 232  ARG A CG    1 
ATOM   4474 C  CD    . ARG B 1 233 ? 118.400 8.957   114.452 1.00 47.41  ? 232  ARG A CD    1 
ATOM   4475 N  NE    . ARG B 1 233 ? 118.567 10.224  113.745 1.00 35.32  ? 232  ARG A NE    1 
ATOM   4476 C  CZ    . ARG B 1 233 ? 117.961 11.363  114.079 1.00 43.51  ? 232  ARG A CZ    1 
ATOM   4477 N  NH1   . ARG B 1 233 ? 117.122 11.408  115.106 1.00 38.80  ? 232  ARG A NH1   1 
ATOM   4478 N  NH2   . ARG B 1 233 ? 118.182 12.458  113.368 1.00 43.85  ? 232  ARG A NH2   1 
ATOM   4479 N  N     . ASP B 1 234 ? 115.929 5.420   110.534 1.00 47.57  ? 233  ASP A N     1 
ATOM   4480 C  CA    . ASP B 1 234 ? 114.747 5.223   109.709 1.00 39.81  ? 233  ASP A CA    1 
ATOM   4481 C  C     . ASP B 1 234 ? 113.561 5.930   110.348 1.00 39.25  ? 233  ASP A C     1 
ATOM   4482 O  O     . ASP B 1 234 ? 113.438 5.972   111.577 1.00 39.34  ? 233  ASP A O     1 
ATOM   4483 C  CB    . ASP B 1 234 ? 114.461 3.721   109.567 1.00 47.78  ? 233  ASP A CB    1 
ATOM   4484 C  CG    . ASP B 1 234 ? 113.598 3.373   108.345 1.00 61.77  ? 233  ASP A CG    1 
ATOM   4485 O  OD1   . ASP B 1 234 ? 113.631 4.106   107.333 1.00 58.70  ? 233  ASP A OD1   1 
ATOM   4486 O  OD2   . ASP B 1 234 ? 112.902 2.332   108.395 1.00 65.03  ? 233  ASP A OD2   1 
ATOM   4487 N  N     . VAL B 1 235 ? 112.694 6.505   109.511 1.00 30.75  ? 234  VAL A N     1 
ATOM   4488 C  CA    . VAL B 1 235 ? 111.428 7.036   110.000 1.00 29.61  ? 234  VAL A CA    1 
ATOM   4489 C  C     . VAL B 1 235 ? 110.608 5.887   110.564 1.00 42.95  ? 234  VAL A C     1 
ATOM   4490 O  O     . VAL B 1 235 ? 110.441 4.852   109.907 1.00 39.42  ? 234  VAL A O     1 
ATOM   4491 C  CB    . VAL B 1 235 ? 110.675 7.756   108.873 1.00 31.91  ? 234  VAL A CB    1 
ATOM   4492 C  CG1   . VAL B 1 235 ? 109.275 8.156   109.328 1.00 33.60  ? 234  VAL A CG1   1 
ATOM   4493 C  CG2   . VAL B 1 235 ? 111.469 8.974   108.401 1.00 34.16  ? 234  VAL A CG2   1 
ATOM   4494 N  N     . ASN B 1 236 ? 110.094 6.060   111.785 1.00 38.38  ? 235  ASN A N     1 
ATOM   4495 C  CA    . ASN B 1 236 ? 109.415 4.987   112.524 1.00 40.51  ? 235  ASN A CA    1 
ATOM   4496 C  C     . ASN B 1 236 ? 107.990 5.417   112.841 1.00 36.79  ? 235  ASN A C     1 
ATOM   4497 O  O     . ASN B 1 236 ? 107.771 6.305   113.675 1.00 41.86  ? 235  ASN A O     1 
ATOM   4498 C  CB    . ASN B 1 236 ? 110.175 4.642   113.811 1.00 48.51  ? 235  ASN A CB    1 
ATOM   4499 C  CG    . ASN B 1 236 ? 109.597 3.417   114.548 1.00 51.61  ? 235  ASN A CG    1 
ATOM   4500 O  OD1   . ASN B 1 236 ? 108.464 2.986   114.310 1.00 46.35  ? 235  ASN A OD1   1 
ATOM   4501 N  ND2   . ASN B 1 236 ? 110.389 2.865   115.454 1.00 55.36  ? 235  ASN A ND2   1 
ATOM   4502 N  N     . SER B 1 237 ? 107.016 4.772   112.207 1.00 31.51  ? 236  SER A N     1 
ATOM   4503 C  CA    . SER B 1 237 ? 105.618 5.065   112.483 1.00 33.52  ? 236  SER A CA    1 
ATOM   4504 C  C     . SER B 1 237 ? 105.071 4.282   113.676 1.00 40.08  ? 236  SER A C     1 
ATOM   4505 O  O     . SER B 1 237 ? 103.890 4.438   114.003 1.00 41.22  ? 236  SER A O     1 
ATOM   4506 C  CB    . SER B 1 237 ? 104.762 4.773   111.244 1.00 43.87  ? 236  SER A CB    1 
ATOM   4507 O  OG    . SER B 1 237 ? 104.904 3.415   110.850 1.00 43.19  ? 236  SER A OG    1 
ATOM   4508 N  N     . GLU B 1 238 ? 105.898 3.468   114.344 1.00 41.78  ? 237  GLU A N     1 
ATOM   4509 C  CA    . GLU B 1 238 ? 105.424 2.523   115.354 1.00 49.44  ? 237  GLU A CA    1 
ATOM   4510 C  C     . GLU B 1 238 ? 105.835 2.900   116.775 1.00 51.71  ? 237  GLU A C     1 
ATOM   4511 O  O     . GLU B 1 238 ? 105.732 2.065   117.679 1.00 37.06  ? 237  GLU A O     1 
ATOM   4512 C  CB    . GLU B 1 238 ? 105.929 1.112   115.048 1.00 45.26  ? 237  GLU A CB    1 
ATOM   4513 C  CG    . GLU B 1 238 ? 105.287 0.440   113.860 1.00 67.58  ? 237  GLU A CG    1 
ATOM   4514 C  CD    . GLU B 1 238 ? 105.540 -1.058  113.855 1.00 81.55  ? 237  GLU A CD    1 
ATOM   4515 O  OE1   . GLU B 1 238 ? 106.682 -1.476  114.143 1.00 85.95  ? 237  GLU A OE1   1 
ATOM   4516 O  OE2   . GLU B 1 238 ? 104.589 -1.820  113.587 1.00 87.86  ? 237  GLU A OE2   1 
ATOM   4517 N  N     . ARG B 1 239 ? 106.295 4.130   116.995 1.00 49.92  ? 238  ARG A N     1 
ATOM   4518 C  CA    . ARG B 1 239 ? 106.760 4.520   118.321 1.00 46.64  ? 238  ARG A CA    1 
ATOM   4519 C  C     . ARG B 1 239 ? 105.591 4.691   119.284 1.00 38.51  ? 238  ARG A C     1 
ATOM   4520 O  O     . ARG B 1 239 ? 104.544 5.241   118.929 1.00 32.87  ? 238  ARG A O     1 
ATOM   4521 C  CB    . ARG B 1 239 ? 107.564 5.817   118.244 1.00 43.32  ? 238  ARG A CB    1 
ATOM   4522 C  CG    . ARG B 1 239 ? 108.820 5.696   117.408 1.00 44.71  ? 238  ARG A CG    1 
ATOM   4523 C  CD    . ARG B 1 239 ? 109.605 7.003   117.422 1.00 57.00  ? 238  ARG A CD    1 
ATOM   4524 N  NE    . ARG B 1 239 ? 110.063 7.345   118.767 1.00 50.25  ? 238  ARG A NE    1 
ATOM   4525 C  CZ    . ARG B 1 239 ? 110.745 8.445   119.066 1.00 59.80  ? 238  ARG A CZ    1 
ATOM   4526 N  NH1   . ARG B 1 239 ? 111.048 9.317   118.111 1.00 54.22  ? 238  ARG A NH1   1 
ATOM   4527 N  NH2   . ARG B 1 239 ? 111.124 8.674   120.318 1.00 50.79  ? 238  ARG A NH2   1 
ATOM   4528 N  N     . LEU B 1 240 ? 105.778 4.217   120.516 1.00 39.33  ? 239  LEU A N     1 
ATOM   4529 C  CA    . LEU B 1 240 ? 104.773 4.341   121.561 1.00 44.04  ? 239  LEU A CA    1 
ATOM   4530 C  C     . LEU B 1 240 ? 105.377 5.027   122.786 1.00 38.64  ? 239  LEU A C     1 
ATOM   4531 O  O     . LEU B 1 240 ? 106.553 4.835   123.112 1.00 36.52  ? 239  LEU A O     1 
ATOM   4532 C  CB    . LEU B 1 240 ? 104.197 2.966   121.949 1.00 49.15  ? 239  LEU A CB    1 
ATOM   4533 C  CG    . LEU B 1 240 ? 103.323 2.257   120.899 1.00 50.42  ? 239  LEU A CG    1 
ATOM   4534 C  CD1   . LEU B 1 240 ? 102.922 0.862   121.361 1.00 48.13  ? 239  LEU A CD1   1 
ATOM   4535 C  CD2   . LEU B 1 240 ? 102.089 3.090   120.559 1.00 55.14  ? 239  LEU A CD2   1 
ATOM   4536 N  N     . ARG B 1 241 ? 104.559 5.842   123.448 1.00 35.80  ? 240  ARG A N     1 
ATOM   4537 C  CA    . ARG B 1 241 ? 104.962 6.485   124.693 1.00 34.42  ? 240  ARG A CA    1 
ATOM   4538 C  C     . ARG B 1 241 ? 105.401 5.444   125.728 1.00 38.57  ? 240  ARG A C     1 
ATOM   4539 O  O     . ARG B 1 241 ? 104.792 4.381   125.854 1.00 38.76  ? 240  ARG A O     1 
ATOM   4540 C  CB    . ARG B 1 241 ? 103.795 7.318   125.209 1.00 48.17  ? 240  ARG A CB    1 
ATOM   4541 C  CG    . ARG B 1 241 ? 103.676 7.392   126.698 1.00 64.28  ? 240  ARG A CG    1 
ATOM   4542 C  CD    . ARG B 1 241 ? 102.221 7.238   127.118 1.00 77.86  ? 240  ARG A CD    1 
ATOM   4543 N  NE    . ARG B 1 241 ? 101.346 8.257   126.539 1.00 78.11  ? 240  ARG A NE    1 
ATOM   4544 C  CZ    . ARG B 1 241 ? 101.254 9.507   126.990 1.00 77.20  ? 240  ARG A CZ    1 
ATOM   4545 N  NH1   . ARG B 1 241 ? 101.999 9.903   128.018 1.00 69.59  ? 240  ARG A NH1   1 
ATOM   4546 N  NH2   . ARG B 1 241 ? 100.427 10.367  126.409 1.00 73.01  ? 240  ARG A NH2   1 
ATOM   4547 N  N     . LYS B 1 242 ? 106.470 5.749   126.473 1.00 60.31  ? 241  LYS A N     1 
ATOM   4548 C  CA    . LYS B 1 242 ? 107.001 4.835   127.483 1.00 47.13  ? 241  LYS A CA    1 
ATOM   4549 C  C     . LYS B 1 242 ? 106.743 5.263   128.923 1.00 44.23  ? 241  LYS A C     1 
ATOM   4550 O  O     . LYS B 1 242 ? 106.972 4.464   129.837 1.00 37.44  ? 241  LYS A O     1 
ATOM   4551 C  CB    . LYS B 1 242 ? 108.516 4.651   127.301 1.00 46.72  ? 241  LYS A CB    1 
ATOM   4552 C  CG    . LYS B 1 242 ? 108.908 3.974   125.997 1.00 47.56  ? 241  LYS A CG    1 
ATOM   4553 C  CD    . LYS B 1 242 ? 110.397 4.128   125.734 1.00 51.71  ? 241  LYS A CD    1 
ATOM   4554 C  CE    . LYS B 1 242 ? 110.761 3.582   124.365 1.00 51.45  ? 241  LYS A CE    1 
ATOM   4555 N  NZ    . LYS B 1 242 ? 112.212 3.742   124.047 1.00 58.66  ? 241  LYS A NZ    1 
ATOM   4556 N  N     . SER B 1 243 ? 106.316 6.497   129.163 1.00 46.87  ? 242  SER A N     1 
ATOM   4557 C  CA    . SER B 1 243 ? 106.119 6.954   130.530 1.00 40.85  ? 242  SER A CA    1 
ATOM   4558 C  C     . SER B 1 243 ? 104.943 7.915   130.568 1.00 34.82  ? 242  SER A C     1 
ATOM   4559 O  O     . SER B 1 243 ? 104.511 8.443   129.538 1.00 35.83  ? 242  SER A O     1 
ATOM   4560 C  CB    . SER B 1 243 ? 107.391 7.613   131.096 1.00 43.03  ? 242  SER A CB    1 
ATOM   4561 O  OG    . SER B 1 243 ? 107.891 8.619   130.237 1.00 49.70  ? 242  SER A OG    1 
ATOM   4562 N  N     . VAL B 1 244 ? 104.414 8.115   131.774 1.00 37.37  ? 243  VAL A N     1 
ATOM   4563 C  CA    . VAL B 1 244 ? 103.316 9.044   132.030 1.00 40.49  ? 243  VAL A CA    1 
ATOM   4564 C  C     . VAL B 1 244 ? 103.567 9.677   133.385 1.00 36.03  ? 243  VAL A C     1 
ATOM   4565 O  O     . VAL B 1 244 ? 103.787 8.973   134.379 1.00 34.74  ? 243  VAL A O     1 
ATOM   4566 C  CB    . VAL B 1 244 ? 101.922 8.372   132.030 1.00 45.67  ? 243  VAL A CB    1 
ATOM   4567 C  CG1   . VAL B 1 244 ? 100.838 9.424   132.249 1.00 44.54  ? 243  VAL A CG1   1 
ATOM   4568 C  CG2   . VAL B 1 244 ? 101.662 7.609   130.757 1.00 50.70  ? 243  VAL A CG2   1 
ATOM   4569 N  N     . GLY B 1 245 ? 103.531 11.003  133.430 1.00 33.64  ? 244  GLY A N     1 
ATOM   4570 C  CA    . GLY B 1 245 ? 103.758 11.712  134.664 1.00 30.11  ? 244  GLY A CA    1 
ATOM   4571 C  C     . GLY B 1 245 ? 102.774 12.852  134.804 1.00 32.09  ? 244  GLY A C     1 
ATOM   4572 O  O     . GLY B 1 245 ? 102.200 13.335  133.826 1.00 33.43  ? 244  GLY A O     1 
ATOM   4573 N  N     . VAL B 1 246 ? 102.584 13.272  136.052 1.00 34.26  ? 245  VAL A N     1 
ATOM   4574 C  CA    . VAL B 1 246 ? 101.827 14.476  136.374 1.00 29.93  ? 245  VAL A CA    1 
ATOM   4575 C  C     . VAL B 1 246 ? 102.607 15.218  137.446 1.00 27.98  ? 245  VAL A C     1 
ATOM   4576 O  O     . VAL B 1 246 ? 103.063 14.603  138.417 1.00 33.21  ? 245  VAL A O     1 
ATOM   4577 C  CB    . VAL B 1 246 ? 100.397 14.144  136.854 1.00 39.30  ? 245  VAL A CB    1 
ATOM   4578 C  CG1   . VAL B 1 246 ? 99.626  15.412  137.186 1.00 44.42  ? 245  VAL A CG1   1 
ATOM   4579 C  CG2   . VAL B 1 246 ? 99.651  13.340  135.790 1.00 37.43  ? 245  VAL A CG2   1 
ATOM   4580 N  N     . GLU B 1 247 ? 102.803 16.523  137.267 1.00 28.94  ? 246  GLU A N     1 
ATOM   4581 C  CA    . GLU B 1 247 ? 103.509 17.284  138.300 1.00 29.91  ? 246  GLU A CA    1 
ATOM   4582 C  C     . GLU B 1 247 ? 102.950 18.699  138.388 1.00 28.36  ? 246  GLU A C     1 
ATOM   4583 O  O     . GLU B 1 247 ? 102.380 19.226  137.424 1.00 32.79  ? 246  GLU A O     1 
ATOM   4584 C  CB    . GLU B 1 247 ? 105.027 17.325  138.037 1.00 26.75  ? 246  GLU A CB    1 
ATOM   4585 C  CG    . GLU B 1 247 ? 105.410 17.893  136.689 1.00 31.75  ? 246  GLU A CG    1 
ATOM   4586 C  CD    . GLU B 1 247 ? 106.774 17.413  136.200 1.00 41.02  ? 246  GLU A CD    1 
ATOM   4587 O  OE1   . GLU B 1 247 ? 107.064 16.195  136.312 1.00 39.20  ? 246  GLU A OE1   1 
ATOM   4588 O  OE2   . GLU B 1 247 ? 107.559 18.255  135.697 1.00 36.03  ? 246  GLU A OE2   1 
ATOM   4589 N  N     . ARG B 1 248 ? 103.143 19.319  139.554 1.00 26.30  ? 247  ARG A N     1 
ATOM   4590 C  CA    . ARG B 1 248 ? 102.673 20.679  139.788 1.00 28.81  ? 247  ARG A CA    1 
ATOM   4591 C  C     . ARG B 1 248 ? 103.726 21.494  140.531 1.00 27.34  ? 247  ARG A C     1 
ATOM   4592 O  O     . ARG B 1 248 ? 104.243 21.051  141.563 1.00 27.38  ? 247  ARG A O     1 
ATOM   4593 C  CB    . ARG B 1 248 ? 101.369 20.670  140.590 1.00 40.11  ? 247  ARG A CB    1 
ATOM   4594 C  CG    . ARG B 1 248 ? 100.949 22.021  141.146 1.00 51.06  ? 247  ARG A CG    1 
ATOM   4595 C  CD    . ARG B 1 248 ? 99.715  22.556  140.426 1.00 70.74  ? 247  ARG A CD    1 
ATOM   4596 N  NE    . ARG B 1 248 ? 99.298  23.850  140.961 1.00 83.13  ? 247  ARG A NE    1 
ATOM   4597 C  CZ    . ARG B 1 248 ? 98.087  24.375  140.799 1.00 87.41  ? 247  ARG A CZ    1 
ATOM   4598 N  NH1   . ARG B 1 248 ? 97.158  23.712  140.120 1.00 90.85  ? 247  ARG A NH1   1 
ATOM   4599 N  NH2   . ARG B 1 248 ? 97.800  25.560  141.326 1.00 83.06  ? 247  ARG A NH2   1 
ATOM   4600 N  N     . THR B 1 249 ? 104.014 22.695  140.028 1.00 25.35  ? 248  THR A N     1 
ATOM   4601 C  CA    . THR B 1 249 ? 104.817 23.664  140.768 1.00 26.68  ? 248  THR A CA    1 
ATOM   4602 C  C     . THR B 1 249 ? 103.886 24.596  141.530 1.00 31.27  ? 248  THR A C     1 
ATOM   4603 O  O     . THR B 1 249 ? 102.989 25.188  140.930 1.00 31.29  ? 248  THR A O     1 
ATOM   4604 C  CB    . THR B 1 249 ? 105.716 24.468  139.831 1.00 27.49  ? 248  THR A CB    1 
ATOM   4605 O  OG1   . THR B 1 249 ? 106.725 23.616  139.284 1.00 28.65  ? 248  THR A OG1   1 
ATOM   4606 C  CG2   . THR B 1 249 ? 106.379 25.625  140.563 1.00 29.00  ? 248  THR A CG2   1 
ATOM   4607 N  N     . MET B 1 250 ? 104.088 24.716  142.846 1.00 26.93  ? 249  MET A N     1 
ATOM   4608 C  CA    . MET B 1 250 ? 103.211 25.562  143.651 1.00 36.06  ? 249  MET A CA    1 
ATOM   4609 C  C     . MET B 1 250 ? 103.702 27.012  143.656 1.00 32.76  ? 249  MET A C     1 
ATOM   4610 O  O     . MET B 1 250 ? 104.886 27.300  143.455 1.00 34.16  ? 249  MET A O     1 
ATOM   4611 C  CB    . MET B 1 250 ? 103.106 25.045  145.092 1.00 36.51  ? 249  MET A CB    1 
ATOM   4612 C  CG    . MET B 1 250 ? 102.251 23.804  145.271 1.00 49.06  ? 249  MET A CG    1 
ATOM   4613 S  SD    . MET B 1 250 ? 103.157 22.352  144.735 1.00 58.19  ? 249  MET A SD    1 
ATOM   4614 C  CE    . MET B 1 250 ? 104.548 22.390  145.850 1.00 53.11  ? 249  MET A CE    1 
ATOM   4615 N  N     . ALA B 1 251 ? 102.771 27.935  143.914 1.00 33.64  ? 250  ALA A N     1 
ATOM   4616 C  CA    . ALA B 1 251 ? 103.134 29.350  143.945 1.00 36.67  ? 250  ALA A CA    1 
ATOM   4617 C  C     . ALA B 1 251 ? 104.009 29.697  145.145 1.00 38.73  ? 250  ALA A C     1 
ATOM   4618 O  O     . ALA B 1 251 ? 104.782 30.663  145.086 1.00 36.48  ? 250  ALA A O     1 
ATOM   4619 C  CB    . ALA B 1 251 ? 101.865 30.216  143.921 1.00 36.61  ? 250  ALA A CB    1 
ATOM   4620 N  N     . GLU B 1 252 ? 103.922 28.929  146.226 1.00 33.53  ? 251  GLU A N     1 
ATOM   4621 C  CA    . GLU B 1 252 ? 104.786 29.113  147.383 1.00 31.56  ? 251  GLU A CA    1 
ATOM   4622 C  C     . GLU B 1 252 ? 105.381 27.762  147.737 1.00 31.27  ? 251  GLU A C     1 
ATOM   4623 O  O     . GLU B 1 252 ? 104.705 26.742  147.597 1.00 34.79  ? 251  GLU A O     1 
ATOM   4624 C  CB    . GLU B 1 252 ? 104.014 29.677  148.595 1.00 36.53  ? 251  GLU A CB    1 
ATOM   4625 C  CG    . GLU B 1 252 ? 102.881 30.641  148.259 1.00 66.55  ? 251  GLU A CG    1 
ATOM   4626 C  CD    . GLU B 1 252 ? 103.369 32.038  147.904 1.00 80.84  ? 251  GLU A CD    1 
ATOM   4627 O  OE1   . GLU B 1 252 ? 104.527 32.374  148.242 1.00 84.47  ? 251  GLU A OE1   1 
ATOM   4628 O  OE2   . GLU B 1 252 ? 102.589 32.800  147.288 1.00 79.76  ? 251  GLU A OE2   1 
ATOM   4629 N  N     . ASP B 1 253 ? 106.649 27.743  148.151 1.00 33.89  ? 252  ASP A N     1 
ATOM   4630 C  CA    . ASP B 1 253 ? 107.265 26.480  148.553 1.00 32.48  ? 252  ASP A CA    1 
ATOM   4631 C  C     . ASP B 1 253 ? 106.515 25.903  149.750 1.00 31.92  ? 252  ASP A C     1 
ATOM   4632 O  O     . ASP B 1 253 ? 106.013 26.638  150.600 1.00 30.29  ? 252  ASP A O     1 
ATOM   4633 C  CB    . ASP B 1 253 ? 108.740 26.661  148.950 1.00 29.40  ? 252  ASP A CB    1 
ATOM   4634 C  CG    . ASP B 1 253 ? 109.596 27.263  147.857 1.00 33.11  ? 252  ASP A CG    1 
ATOM   4635 O  OD1   . ASP B 1 253 ? 109.210 27.234  146.673 1.00 29.27  ? 252  ASP A OD1   1 
ATOM   4636 O  OD2   . ASP B 1 253 ? 110.692 27.747  148.197 1.00 39.72  ? 252  ASP A OD2   1 
ATOM   4637 N  N     . ILE B 1 254 ? 106.453 24.577  149.833 1.00 29.96  ? 253  ILE A N     1 
ATOM   4638 C  CA    . ILE B 1 254 ? 105.819 23.941  150.982 1.00 29.29  ? 253  ILE A CA    1 
ATOM   4639 C  C     . ILE B 1 254 ? 106.886 23.451  151.946 1.00 25.31  ? 253  ILE A C     1 
ATOM   4640 O  O     . ILE B 1 254 ? 108.015 23.127  151.555 1.00 28.76  ? 253  ILE A O     1 
ATOM   4641 C  CB    . ILE B 1 254 ? 104.876 22.802  150.536 1.00 28.58  ? 253  ILE A CB    1 
ATOM   4642 C  CG1   . ILE B 1 254 ? 105.637 21.731  149.746 1.00 23.43  ? 253  ILE A CG1   1 
ATOM   4643 C  CG2   . ILE B 1 254 ? 103.772 23.394  149.685 1.00 29.16  ? 253  ILE A CG2   1 
ATOM   4644 C  CD1   . ILE B 1 254 ? 104.810 20.450  149.517 1.00 27.48  ? 253  ILE A CD1   1 
ATOM   4645 N  N     . HIS B 1 255 ? 106.527 23.396  153.234 1.00 24.10  ? 254  HIS A N     1 
ATOM   4646 C  CA    . HIS B 1 255 ? 107.479 23.022  154.265 1.00 28.05  ? 254  HIS A CA    1 
ATOM   4647 C  C     . HIS B 1 255 ? 106.976 21.941  155.209 1.00 25.72  ? 254  HIS A C     1 
ATOM   4648 O  O     . HIS B 1 255 ? 107.702 21.571  156.140 1.00 32.39  ? 254  HIS A O     1 
ATOM   4649 C  CB    . HIS B 1 255 ? 107.886 24.261  155.087 1.00 31.58  ? 254  HIS A CB    1 
ATOM   4650 C  CG    . HIS B 1 255 ? 108.604 25.295  154.280 1.00 38.44  ? 254  HIS A CG    1 
ATOM   4651 N  ND1   . HIS B 1 255 ? 107.941 26.269  153.559 1.00 38.90  ? 254  HIS A ND1   1 
ATOM   4652 C  CD2   . HIS B 1 255 ? 109.925 25.481  154.042 1.00 34.43  ? 254  HIS A CD2   1 
ATOM   4653 C  CE1   . HIS B 1 255 ? 108.825 27.022  152.930 1.00 36.85  ? 254  HIS A CE1   1 
ATOM   4654 N  NE2   . HIS B 1 255 ? 110.035 26.566  153.204 1.00 36.77  ? 254  HIS A NE2   1 
ATOM   4655 N  N     . HIS B 1 256 ? 105.769 21.420  155.004 1.00 28.81  ? 255  HIS A N     1 
ATOM   4656 C  CA    . HIS B 1 256 ? 105.189 20.456  155.926 1.00 26.99  ? 255  HIS A CA    1 
ATOM   4657 C  C     . HIS B 1 256 ? 104.782 19.228  155.131 1.00 32.27  ? 255  HIS A C     1 
ATOM   4658 O  O     . HIS B 1 256 ? 104.284 19.352  154.013 1.00 30.64  ? 255  HIS A O     1 
ATOM   4659 C  CB    . HIS B 1 256 ? 103.993 21.050  156.669 1.00 29.10  ? 255  HIS A CB    1 
ATOM   4660 C  CG    . HIS B 1 256 ? 104.312 22.335  157.371 1.00 45.36  ? 255  HIS A CG    1 
ATOM   4661 N  ND1   . HIS B 1 256 ? 104.539 22.404  158.728 1.00 48.99  ? 255  HIS A ND1   1 
ATOM   4662 C  CD2   . HIS B 1 256 ? 104.454 23.598  156.902 1.00 45.92  ? 255  HIS A CD2   1 
ATOM   4663 C  CE1   . HIS B 1 256 ? 104.801 23.652  159.069 1.00 41.06  ? 255  HIS A CE1   1 
ATOM   4664 N  NE2   . HIS B 1 256 ? 104.755 24.398  157.979 1.00 44.93  ? 255  HIS A NE2   1 
ATOM   4665 N  N     . TRP B 1 257 ? 105.049 18.047  155.698 1.00 29.01  ? 256  TRP A N     1 
ATOM   4666 C  CA    . TRP B 1 257 ? 104.690 16.796  155.038 1.00 31.57  ? 256  TRP A CA    1 
ATOM   4667 C  C     . TRP B 1 257 ? 103.205 16.758  154.678 1.00 26.56  ? 256  TRP A C     1 
ATOM   4668 O  O     . TRP B 1 257 ? 102.836 16.308  153.592 1.00 28.87  ? 256  TRP A O     1 
ATOM   4669 C  CB    . TRP B 1 257 ? 105.049 15.600  155.933 1.00 26.08  ? 256  TRP A CB    1 
ATOM   4670 C  CG    . TRP B 1 257 ? 104.299 14.351  155.525 1.00 26.69  ? 256  TRP A CG    1 
ATOM   4671 C  CD1   . TRP B 1 257 ? 103.364 13.695  156.246 1.00 27.85  ? 256  TRP A CD1   1 
ATOM   4672 C  CD2   . TRP B 1 257 ? 104.405 13.664  154.275 1.00 27.06  ? 256  TRP A CD2   1 
ATOM   4673 N  NE1   . TRP B 1 257 ? 102.886 12.616  155.536 1.00 33.31  ? 256  TRP A NE1   1 
ATOM   4674 C  CE2   . TRP B 1 257 ? 103.505 12.582  154.315 1.00 30.64  ? 256  TRP A CE2   1 
ATOM   4675 C  CE3   . TRP B 1 257 ? 105.180 13.856  153.132 1.00 25.39  ? 256  TRP A CE3   1 
ATOM   4676 C  CZ2   . TRP B 1 257 ? 103.363 11.684  153.257 1.00 30.64  ? 256  TRP A CZ2   1 
ATOM   4677 C  CZ3   . TRP B 1 257 ? 105.035 12.971  152.070 1.00 32.35  ? 256  TRP A CZ3   1 
ATOM   4678 C  CH2   . TRP B 1 257 ? 104.130 11.895  152.144 1.00 30.85  ? 256  TRP A CH2   1 
ATOM   4679 N  N     . SER B 1 258 ? 102.341 17.239  155.569 1.00 27.55  ? 257  SER A N     1 
ATOM   4680 C  CA    . SER B 1 258 ? 100.901 17.201  155.288 1.00 32.20  ? 257  SER A CA    1 
ATOM   4681 C  C     . SER B 1 258 ? 100.548 17.948  153.998 1.00 28.39  ? 257  SER A C     1 
ATOM   4682 O  O     . SER B 1 258 ? 99.596  17.575  153.303 1.00 31.26  ? 257  SER A O     1 
ATOM   4683 C  CB    . SER B 1 258 ? 100.136 17.781  156.474 1.00 31.51  ? 257  SER A CB    1 
ATOM   4684 O  OG    . SER B 1 258 ? 100.608 19.075  156.756 1.00 34.66  ? 257  SER A OG    1 
ATOM   4685 N  N     . GLU B 1 259 ? 101.321 18.985  153.650 1.00 29.44  ? 258  GLU A N     1 
ATOM   4686 C  CA    . GLU B 1 259 ? 101.082 19.714  152.407 1.00 35.62  ? 258  GLU A CA    1 
ATOM   4687 C  C     . GLU B 1 259 ? 101.502 18.889  151.201 1.00 34.17  ? 258  GLU A C     1 
ATOM   4688 O  O     . GLU B 1 259 ? 100.843 18.919  150.156 1.00 28.73  ? 258  GLU A O     1 
ATOM   4689 C  CB    . GLU B 1 259 ? 101.839 21.046  152.419 1.00 37.57  ? 258  GLU A CB    1 
ATOM   4690 C  CG    . GLU B 1 259 ? 101.371 22.034  153.482 1.00 43.16  ? 258  GLU A CG    1 
ATOM   4691 C  CD    . GLU B 1 259 ? 102.265 23.265  153.568 1.00 53.46  ? 258  GLU A CD    1 
ATOM   4692 O  OE1   . GLU B 1 259 ? 103.514 23.120  153.571 1.00 42.23  ? 258  GLU A OE1   1 
ATOM   4693 O  OE2   . GLU B 1 259 ? 101.711 24.380  153.629 1.00 63.20  ? 258  GLU A OE2   1 
ATOM   4694 N  N     . CYS B 1 260 ? 102.612 18.162  151.324 1.00 29.72  ? 259  CYS A N     1 
ATOM   4695 C  CA    . CYS B 1 260 ? 103.045 17.260  150.260 1.00 31.00  ? 259  CYS A CA    1 
ATOM   4696 C  C     . CYS B 1 260 ? 101.996 16.194  150.005 1.00 29.62  ? 259  CYS A C     1 
ATOM   4697 O  O     . CYS B 1 260 ? 101.600 15.954  148.860 1.00 29.18  ? 259  CYS A O     1 
ATOM   4698 C  CB    . CYS B 1 260 ? 104.379 16.608  150.643 1.00 29.44  ? 259  CYS A CB    1 
ATOM   4699 S  SG    . CYS B 1 260 ? 105.090 15.583  149.328 1.00 31.84  ? 259  CYS A SG    1 
ATOM   4700 N  N     . GLU B 1 261 ? 101.531 15.546  151.080 1.00 27.00  ? 260  GLU A N     1 
ATOM   4701 C  CA    . GLU B 1 261 ? 100.538 14.492  150.941 1.00 29.28  ? 260  GLU A CA    1 
ATOM   4702 C  C     . GLU B 1 261 ? 99.261  15.032  150.334 1.00 32.85  ? 260  GLU A C     1 
ATOM   4703 O  O     . GLU B 1 261 ? 98.635  14.369  149.497 1.00 33.20  ? 260  GLU A O     1 
ATOM   4704 C  CB    . GLU B 1 261 ? 100.247 13.864  152.296 1.00 33.96  ? 260  GLU A CB    1 
ATOM   4705 C  CG    . GLU B 1 261 ? 99.284  12.695  152.230 1.00 54.66  ? 260  GLU A CG    1 
ATOM   4706 C  CD    . GLU B 1 261 ? 99.395  11.814  153.451 1.00 73.02  ? 260  GLU A CD    1 
ATOM   4707 O  OE1   . GLU B 1 261 ? 99.738  12.340  154.531 1.00 70.30  ? 260  GLU A OE1   1 
ATOM   4708 O  OE2   . GLU B 1 261 ? 99.157  10.596  153.332 1.00 88.82  ? 260  GLU A OE2   1 
ATOM   4709 N  N     . ALA B 1 262 ? 98.857  16.237  150.738 1.00 29.31  ? 261  ALA A N     1 
ATOM   4710 C  CA    . ALA B 1 262 ? 97.627  16.800  150.188 1.00 34.87  ? 261  ALA A CA    1 
ATOM   4711 C  C     . ALA B 1 262 ? 97.769  17.037  148.690 1.00 36.07  ? 261  ALA A C     1 
ATOM   4712 O  O     . ALA B 1 262 ? 96.812  16.852  147.933 1.00 35.18  ? 261  ALA A O     1 
ATOM   4713 C  CB    . ALA B 1 262 ? 97.268  18.096  150.915 1.00 37.01  ? 261  ALA A CB    1 
ATOM   4714 N  N     . ILE B 1 263 ? 98.966  17.428  148.238 1.00 29.33  ? 262  ILE A N     1 
ATOM   4715 C  CA    . ILE B 1 263 ? 99.176  17.669  146.810 1.00 28.37  ? 262  ILE A CA    1 
ATOM   4716 C  C     . ILE B 1 263 ? 99.150  16.356  146.040 1.00 34.82  ? 262  ILE A C     1 
ATOM   4717 O  O     . ILE B 1 263 ? 98.551  16.268  144.961 1.00 36.25  ? 262  ILE A O     1 
ATOM   4718 C  CB    . ILE B 1 263 ? 100.481 18.457  146.592 1.00 34.00  ? 262  ILE A CB    1 
ATOM   4719 C  CG1   . ILE B 1 263 ? 100.241 19.926  146.945 1.00 35.70  ? 262  ILE A CG1   1 
ATOM   4720 C  CG2   . ILE B 1 263 ? 100.971 18.317  145.155 1.00 27.63  ? 262  ILE A CG2   1 
ATOM   4721 C  CD1   . ILE B 1 263 ? 101.477 20.652  147.396 1.00 36.05  ? 262  ILE A CD1   1 
ATOM   4722 N  N     . ILE B 1 264 ? 99.745  15.302  146.605 1.00 29.97  ? 263  ILE A N     1 
ATOM   4723 C  CA    . ILE B 1 264 ? 99.694  13.985  145.976 1.00 29.59  ? 263  ILE A CA    1 
ATOM   4724 C  C     . ILE B 1 264 ? 98.252  13.528  145.799 1.00 38.72  ? 263  ILE A C     1 
ATOM   4725 O  O     . ILE B 1 264 ? 97.902  12.940  144.770 1.00 33.65  ? 263  ILE A O     1 
ATOM   4726 C  CB    . ILE B 1 264 ? 100.499 12.967  146.802 1.00 29.71  ? 263  ILE A CB    1 
ATOM   4727 C  CG1   . ILE B 1 264 ? 101.990 13.257  146.699 1.00 31.75  ? 263  ILE A CG1   1 
ATOM   4728 C  CG2   . ILE B 1 264 ? 100.209 11.535  146.371 1.00 29.12  ? 263  ILE A CG2   1 
ATOM   4729 C  CD1   . ILE B 1 264 ? 102.786 12.494  147.716 1.00 38.02  ? 263  ILE A CD1   1 
ATOM   4730 N  N     . GLU B 1 265 ? 97.401  13.760  146.811 1.00 43.71  ? 264  GLU A N     1 
ATOM   4731 C  CA    . GLU B 1 265 ? 95.999  13.355  146.701 1.00 42.47  ? 264  GLU A CA    1 
ATOM   4732 C  C     . GLU B 1 265 ? 95.318  14.056  145.540 1.00 45.55  ? 264  GLU A C     1 
ATOM   4733 O  O     . GLU B 1 265 ? 94.409  13.493  144.926 1.00 45.83  ? 264  GLU A O     1 
ATOM   4734 C  CB    . GLU B 1 265 ? 95.232  13.651  147.994 1.00 43.04  ? 264  GLU A CB    1 
ATOM   4735 C  CG    . GLU B 1 265 ? 95.603  12.791  149.193 1.00 43.14  ? 264  GLU A CG    1 
ATOM   4736 C  CD    . GLU B 1 265 ? 95.165  11.347  149.045 1.00 61.73  ? 264  GLU A CD    1 
ATOM   4737 O  OE1   . GLU B 1 265 ? 94.211  11.064  148.283 1.00 63.16  ? 264  GLU A OE1   1 
ATOM   4738 O  OE2   . GLU B 1 265 ? 95.784  10.490  149.703 1.00 70.00  ? 264  GLU A OE2   1 
ATOM   4739 N  N     . ARG B 1 266 ? 95.743  15.281  145.225 1.00 40.22  ? 265  ARG A N     1 
ATOM   4740 C  CA    . ARG B 1 266 ? 95.180  16.000  144.089 1.00 42.41  ? 265  ARG A CA    1 
ATOM   4741 C  C     . ARG B 1 266 ? 95.770  15.529  142.766 1.00 43.37  ? 265  ARG A C     1 
ATOM   4742 O  O     . ARG B 1 266 ? 95.060  15.502  141.752 1.00 45.19  ? 265  ARG A O     1 
ATOM   4743 C  CB    . ARG B 1 266 ? 95.399  17.507  144.257 1.00 48.54  ? 265  ARG A CB    1 
ATOM   4744 C  CG    . ARG B 1 266 ? 94.563  18.144  145.370 1.00 58.40  ? 265  ARG A CG    1 
ATOM   4745 C  CD    . ARG B 1 266 ? 94.679  19.660  145.343 1.00 69.54  ? 265  ARG A CD    1 
ATOM   4746 N  NE    . ARG B 1 266 ? 94.801  20.151  143.972 1.00 83.85  ? 265  ARG A NE    1 
ATOM   4747 C  CZ    . ARG B 1 266 ? 95.028  21.419  143.637 1.00 87.02  ? 265  ARG A CZ    1 
ATOM   4748 N  NH1   . ARG B 1 266 ? 95.155  22.349  144.575 1.00 84.54  ? 265  ARG A NH1   1 
ATOM   4749 N  NH2   . ARG B 1 266 ? 95.131  21.758  142.357 1.00 86.11  ? 265  ARG A NH2   1 
ATOM   4750 N  N     . LEU B 1 267 ? 97.056  15.162  142.754 1.00 34.31  ? 266  LEU A N     1 
ATOM   4751 C  CA    . LEU B 1 267 ? 97.698  14.684  141.531 1.00 34.08  ? 266  LEU A CA    1 
ATOM   4752 C  C     . LEU B 1 267 ? 97.255  13.268  141.149 1.00 38.50  ? 266  LEU A C     1 
ATOM   4753 O  O     . LEU B 1 267 ? 97.150  12.953  139.956 1.00 35.59  ? 266  LEU A O     1 
ATOM   4754 C  CB    . LEU B 1 267 ? 99.216  14.731  141.698 1.00 30.51  ? 266  LEU A CB    1 
ATOM   4755 C  CG    . LEU B 1 267 ? 99.882  16.105  141.891 1.00 41.36  ? 266  LEU A CG    1 
ATOM   4756 C  CD1   . LEU B 1 267 ? 101.393 15.965  142.116 1.00 37.95  ? 266  LEU A CD1   1 
ATOM   4757 C  CD2   . LEU B 1 267 ? 99.618  17.038  140.718 1.00 38.31  ? 266  LEU A CD2   1 
ATOM   4758 N  N     . TYR B 1 268 ? 97.015  12.395  142.122 1.00 32.62  ? 267  TYR A N     1 
ATOM   4759 C  CA    . TYR B 1 268 ? 96.786  10.994  141.774 1.00 41.40  ? 267  TYR A CA    1 
ATOM   4760 C  C     . TYR B 1 268 ? 95.595  10.793  140.842 1.00 47.88  ? 267  TYR A C     1 
ATOM   4761 O  O     . TYR B 1 268 ? 95.725  9.995   139.896 1.00 49.51  ? 267  TYR A O     1 
ATOM   4762 C  CB    . TYR B 1 268 ? 96.638  10.131  143.035 1.00 33.92  ? 267  TYR A CB    1 
ATOM   4763 C  CG    . TYR B 1 268 ? 96.466  8.657   142.714 1.00 41.00  ? 267  TYR A CG    1 
ATOM   4764 C  CD1   . TYR B 1 268 ? 97.572  7.857   142.454 1.00 43.97  ? 267  TYR A CD1   1 
ATOM   4765 C  CD2   . TYR B 1 268 ? 95.203  8.073   142.635 1.00 43.07  ? 267  TYR A CD2   1 
ATOM   4766 C  CE1   . TYR B 1 268 ? 97.440  6.517   142.144 1.00 36.14  ? 267  TYR A CE1   1 
ATOM   4767 C  CE2   . TYR B 1 268 ? 95.055  6.709   142.325 1.00 42.53  ? 267  TYR A CE2   1 
ATOM   4768 C  CZ    . TYR B 1 268 ? 96.188  5.944   142.080 1.00 44.37  ? 267  TYR A CZ    1 
ATOM   4769 O  OH    . TYR B 1 268 ? 96.095  4.607   141.776 1.00 48.54  ? 267  TYR A OH    1 
ATOM   4770 N  N     . PRO B 1 269 ? 94.448  11.467  141.011 1.00 48.55  ? 268  PRO A N     1 
ATOM   4771 C  CA    . PRO B 1 269 ? 93.337  11.203  140.078 1.00 62.32  ? 268  PRO A CA    1 
ATOM   4772 C  C     . PRO B 1 269 ? 93.706  11.468  138.633 1.00 55.76  ? 268  PRO A C     1 
ATOM   4773 O  O     . PRO B 1 269 ? 93.312  10.697  137.749 1.00 49.76  ? 268  PRO A O     1 
ATOM   4774 C  CB    . PRO B 1 269 ? 92.226  12.141  140.576 1.00 56.98  ? 268  PRO A CB    1 
ATOM   4775 C  CG    . PRO B 1 269 ? 92.517  12.317  142.016 1.00 57.24  ? 268  PRO A CG    1 
ATOM   4776 C  CD    . PRO B 1 269 ? 94.024  12.373  142.094 1.00 40.36  ? 268  PRO A CD    1 
ATOM   4777 N  N     . GLU B 1 270 ? 94.493  12.517  138.373 1.00 53.68  ? 269  GLU A N     1 
ATOM   4778 C  CA    . GLU B 1 270 ? 94.854  12.854  136.998 1.00 47.84  ? 269  GLU A CA    1 
ATOM   4779 C  C     . GLU B 1 270 ? 95.806  11.820  136.400 1.00 41.52  ? 269  GLU A C     1 
ATOM   4780 O  O     . GLU B 1 270 ? 95.659  11.436  135.234 1.00 44.97  ? 269  GLU A O     1 
ATOM   4781 C  CB    . GLU B 1 270 ? 95.464  14.260  136.948 1.00 46.48  ? 269  GLU A CB    1 
ATOM   4782 C  CG    . GLU B 1 270 ? 95.126  15.043  135.679 1.00 66.32  ? 269  GLU A CG    1 
ATOM   4783 C  CD    . GLU B 1 270 ? 93.622  15.253  135.499 1.00 86.54  ? 269  GLU A CD    1 
ATOM   4784 O  OE1   . GLU B 1 270 ? 92.868  15.135  136.493 1.00 95.16  ? 269  GLU A OE1   1 
ATOM   4785 O  OE2   . GLU B 1 270 ? 93.192  15.539  134.360 1.00 96.46  ? 269  GLU A OE2   1 
ATOM   4786 N  N     . LEU B 1 271 ? 96.787  11.358  137.179 1.00 35.21  ? 270  LEU A N     1 
ATOM   4787 C  CA    . LEU B 1 271 ? 97.659  10.284  136.709 1.00 44.10  ? 270  LEU A CA    1 
ATOM   4788 C  C     . LEU B 1 271 ? 96.856  9.025   136.377 1.00 45.65  ? 270  LEU A C     1 
ATOM   4789 O  O     . LEU B 1 271 ? 97.087  8.383   135.342 1.00 43.58  ? 270  LEU A O     1 
ATOM   4790 C  CB    . LEU B 1 271 ? 98.729  9.981   137.761 1.00 33.56  ? 270  LEU A CB    1 
ATOM   4791 C  CG    . LEU B 1 271 ? 99.753  8.920   137.350 1.00 42.63  ? 270  LEU A CG    1 
ATOM   4792 C  CD1   . LEU B 1 271 ? 100.478 9.343   136.074 1.00 42.19  ? 270  LEU A CD1   1 
ATOM   4793 C  CD2   . LEU B 1 271 ? 100.749 8.605   138.465 1.00 33.17  ? 270  LEU A CD2   1 
ATOM   4794 N  N     . GLU B 1 272 ? 95.901  8.660   137.234 1.00 45.77  ? 271  GLU A N     1 
ATOM   4795 C  CA    . GLU B 1 272 ? 95.080  7.477   136.961 1.00 48.41  ? 271  GLU A CA    1 
ATOM   4796 C  C     . GLU B 1 272 ? 94.295  7.644   135.665 1.00 47.83  ? 271  GLU A C     1 
ATOM   4797 O  O     . GLU B 1 272 ? 94.258  6.736   134.824 1.00 54.15  ? 271  GLU A O     1 
ATOM   4798 C  CB    . GLU B 1 272 ? 94.141  7.200   138.137 1.00 52.40  ? 271  GLU A CB    1 
ATOM   4799 C  CG    . GLU B 1 272 ? 93.116  6.094   137.860 1.00 55.47  ? 271  GLU A CG    1 
ATOM   4800 C  CD    . GLU B 1 272 ? 92.662  5.366   139.118 1.00 73.23  ? 271  GLU A CD    1 
ATOM   4801 O  OE1   . GLU B 1 272 ? 92.262  6.020   140.103 1.00 65.67  ? 271  GLU A OE1   1 
ATOM   4802 O  OE2   . GLU B 1 272 ? 92.706  4.120   139.123 1.00 91.64  ? 271  GLU A OE2   1 
ATOM   4803 N  N     . ARG B 1 273 ? 93.666  8.807   135.485 1.00 48.14  ? 272  ARG A N     1 
ATOM   4804 C  CA    . ARG B 1 273 ? 92.940  9.099   134.251 1.00 58.55  ? 272  ARG A CA    1 
ATOM   4805 C  C     . ARG B 1 273 ? 93.825  8.929   133.020 1.00 58.66  ? 272  ARG A C     1 
ATOM   4806 O  O     . ARG B 1 273 ? 93.446  8.262   132.051 1.00 44.46  ? 272  ARG A O     1 
ATOM   4807 C  CB    . ARG B 1 273 ? 92.390  10.525  134.304 1.00 65.47  ? 272  ARG A CB    1 
ATOM   4808 C  CG    . ARG B 1 273 ? 90.892  10.625  134.125 1.00 73.51  ? 272  ARG A CG    1 
ATOM   4809 C  CD    . ARG B 1 273 ? 90.427  12.077  134.088 1.00 72.55  ? 272  ARG A CD    1 
ATOM   4810 N  NE    . ARG B 1 273 ? 90.912  12.862  135.223 1.00 76.33  ? 272  ARG A NE    1 
ATOM   4811 C  CZ    . ARG B 1 273 ? 90.446  12.766  136.467 1.00 75.05  ? 272  ARG A CZ    1 
ATOM   4812 N  NH1   . ARG B 1 273 ? 89.483  11.899  136.758 1.00 79.20  ? 272  ARG A NH1   1 
ATOM   4813 N  NH2   . ARG B 1 273 ? 90.951  13.536  137.427 1.00 70.19  ? 272  ARG A NH2   1 
ATOM   4814 N  N     . ARG B 1 274 ? 95.008  9.545   133.034 1.00 46.97  ? 273  ARG A N     1 
ATOM   4815 C  CA    . ARG B 1 274 ? 95.851  9.539   131.844 1.00 47.70  ? 273  ARG A CA    1 
ATOM   4816 C  C     . ARG B 1 274 ? 96.407  8.154   131.565 1.00 45.29  ? 273  ARG A C     1 
ATOM   4817 O  O     . ARG B 1 274 ? 96.504  7.742   130.402 1.00 49.22  ? 273  ARG A O     1 
ATOM   4818 C  CB    . ARG B 1 274 ? 96.992  10.543  132.000 1.00 43.19  ? 273  ARG A CB    1 
ATOM   4819 C  CG    . ARG B 1 274 ? 96.530  11.948  132.242 1.00 49.07  ? 273  ARG A CG    1 
ATOM   4820 C  CD    . ARG B 1 274 ? 97.731  12.864  132.271 1.00 51.30  ? 273  ARG A CD    1 
ATOM   4821 N  NE    . ARG B 1 274 ? 97.399  14.209  132.712 1.00 56.79  ? 273  ARG A NE    1 
ATOM   4822 C  CZ    . ARG B 1 274 ? 98.248  15.226  132.619 1.00 55.62  ? 273  ARG A CZ    1 
ATOM   4823 N  NH1   . ARG B 1 274 ? 99.449  15.017  132.099 1.00 48.38  ? 273  ARG A NH1   1 
ATOM   4824 N  NH2   . ARG B 1 274 ? 97.895  16.436  133.028 1.00 50.24  ? 273  ARG A NH2   1 
ATOM   4825 N  N     . LEU B 1 275 ? 96.788  7.425   132.619 1.00 42.19  ? 274  LEU A N     1 
ATOM   4826 C  CA    . LEU B 1 275 ? 97.270  6.060   132.439 1.00 47.57  ? 274  LEU A CA    1 
ATOM   4827 C  C     . LEU B 1 275 ? 96.158  5.147   131.934 1.00 54.74  ? 274  LEU A C     1 
ATOM   4828 O  O     . LEU B 1 275 ? 96.408  4.240   131.127 1.00 52.03  ? 274  LEU A O     1 
ATOM   4829 C  CB    . LEU B 1 275 ? 97.843  5.523   133.750 1.00 45.92  ? 274  LEU A CB    1 
ATOM   4830 C  CG    . LEU B 1 275 ? 98.215  4.041   133.665 1.00 48.21  ? 274  LEU A CG    1 
ATOM   4831 C  CD1   . LEU B 1 275 ? 99.322  3.849   132.641 1.00 40.86  ? 274  LEU A CD1   1 
ATOM   4832 C  CD2   . LEU B 1 275 ? 98.598  3.467   135.034 1.00 46.67  ? 274  LEU A CD2   1 
ATOM   4833 N  N     . ALA B 1 276 ? 94.924  5.367   132.398 1.00 58.51  ? 275  ALA A N     1 
ATOM   4834 C  CA    . ALA B 1 276 ? 93.825  4.488   131.999 1.00 64.28  ? 275  ALA A CA    1 
ATOM   4835 C  C     . ALA B 1 276 ? 93.581  4.555   130.498 1.00 69.76  ? 275  ALA A C     1 
ATOM   4836 O  O     . ALA B 1 276 ? 93.254  3.542   129.864 1.00 67.45  ? 275  ALA A O     1 
ATOM   4837 C  CB    . ALA B 1 276 ? 92.552  4.854   132.761 1.00 60.56  ? 275  ALA A CB    1 
ATOM   4838 N  N     . LYS B 1 277 ? 93.750  5.740   129.910 1.00 66.61  ? 276  LYS A N     1 
ATOM   4839 C  CA    . LYS B 1 277 ? 93.481  5.913   128.489 1.00 63.95  ? 276  LYS A CA    1 
ATOM   4840 C  C     . LYS B 1 277 ? 94.436  5.104   127.628 1.00 68.40  ? 276  LYS A C     1 
ATOM   4841 O  O     . LYS B 1 277 ? 94.089  4.759   126.494 1.00 64.41  ? 276  LYS A O     1 
ATOM   4842 C  CB    . LYS B 1 277 ? 93.556  7.398   128.117 1.00 56.92  ? 276  LYS A CB    1 
ATOM   4843 C  CG    . LYS B 1 277 ? 92.264  8.196   128.384 1.00 74.31  ? 276  LYS A CG    1 
ATOM   4844 C  CD    . LYS B 1 277 ? 91.418  7.595   129.513 1.00 84.29  ? 276  LYS A CD    1 
ATOM   4845 C  CE    . LYS B 1 277 ? 90.821  8.650   130.433 1.00 78.86  ? 276  LYS A CE    1 
ATOM   4846 N  NZ    . LYS B 1 277 ? 90.483  8.062   131.767 1.00 70.01  ? 276  LYS A NZ    1 
ATOM   4847 N  N     . VAL B 1 278 ? 95.618  4.779   128.143 1.00 58.39  ? 277  VAL A N     1 
ATOM   4848 C  CA    . VAL B 1 278 ? 96.598  4.019   127.383 1.00 63.25  ? 277  VAL A CA    1 
ATOM   4849 C  C     . VAL B 1 278 ? 96.815  2.612   127.939 1.00 69.68  ? 277  VAL A C     1 
ATOM   4850 O  O     . VAL B 1 278 ? 97.313  1.744   127.207 1.00 68.37  ? 277  VAL A O     1 
ATOM   4851 C  CB    . VAL B 1 278 ? 97.932  4.792   127.287 1.00 68.25  ? 277  VAL A CB    1 
ATOM   4852 C  CG1   . VAL B 1 278 ? 98.583  4.943   128.662 1.00 58.74  ? 277  VAL A CG1   1 
ATOM   4853 C  CG2   . VAL B 1 278 ? 98.870  4.165   126.255 1.00 68.95  ? 277  VAL A CG2   1 
ATOM   4854 N  N     . LYS B 1 279 ? 96.429  2.345   129.190 1.00 63.70  ? 278  LYS A N     1 
ATOM   4855 C  CA    . LYS B 1 279 ? 96.378  0.982   129.718 1.00 61.66  ? 278  LYS A CA    1 
ATOM   4856 C  C     . LYS B 1 279 ? 95.227  0.898   130.712 1.00 61.04  ? 278  LYS A C     1 
ATOM   4857 O  O     . LYS B 1 279 ? 95.380  1.257   131.889 1.00 61.31  ? 278  LYS A O     1 
ATOM   4858 C  CB    . LYS B 1 279 ? 97.694  0.561   130.368 1.00 68.13  ? 278  LYS A CB    1 
ATOM   4859 C  CG    . LYS B 1 279 ? 98.599  -0.258  129.451 1.00 79.89  ? 278  LYS A CG    1 
ATOM   4860 C  CD    . LYS B 1 279 ? 99.135  -1.504  130.149 1.00 79.40  ? 278  LYS A CD    1 
ATOM   4861 C  CE    . LYS B 1 279 ? 98.322  -2.741  129.795 1.00 80.34  ? 278  LYS A CE    1 
ATOM   4862 N  NZ    . LYS B 1 279 ? 98.782  -3.948  130.537 1.00 82.34  ? 278  LYS A NZ    1 
ATOM   4863 N  N     . PRO B 1 280 ? 94.058  0.418   130.280 1.00 65.67  ? 279  PRO A N     1 
ATOM   4864 C  CA    . PRO B 1 280 ? 92.886  0.399   131.178 1.00 64.67  ? 279  PRO A CA    1 
ATOM   4865 C  C     . PRO B 1 280 ? 93.087  -0.380  132.474 1.00 62.96  ? 279  PRO A C     1 
ATOM   4866 O  O     . PRO B 1 280 ? 92.474  -0.031  133.493 1.00 57.30  ? 279  PRO A O     1 
ATOM   4867 C  CB    . PRO B 1 280 ? 91.795  -0.241  130.306 1.00 58.41  ? 279  PRO A CB    1 
ATOM   4868 C  CG    . PRO B 1 280 ? 92.214  0.046   128.903 1.00 67.76  ? 279  PRO A CG    1 
ATOM   4869 C  CD    . PRO B 1 280 ? 93.717  0.019   128.903 1.00 66.27  ? 279  PRO A CD    1 
ATOM   4870 N  N     . ASP B 1 281 ? 93.911  -1.428  132.474 1.00 59.18  ? 280  ASP A N     1 
ATOM   4871 C  CA    . ASP B 1 281 ? 94.103  -2.253  133.660 1.00 66.68  ? 280  ASP A CA    1 
ATOM   4872 C  C     . ASP B 1 281 ? 95.233  -1.751  134.559 1.00 62.73  ? 280  ASP A C     1 
ATOM   4873 O  O     . ASP B 1 281 ? 95.558  -2.414  135.549 1.00 60.66  ? 280  ASP A O     1 
ATOM   4874 C  CB    . ASP B 1 281 ? 94.348  -3.712  133.253 1.00 73.74  ? 280  ASP A CB    1 
ATOM   4875 C  CG    . ASP B 1 281 ? 95.448  -3.848  132.220 1.00 93.21  ? 280  ASP A CG    1 
ATOM   4876 O  OD1   . ASP B 1 281 ? 95.737  -2.845  131.530 1.00 98.36  ? 280  ASP A OD1   1 
ATOM   4877 O  OD2   . ASP B 1 281 ? 96.021  -4.953  132.094 1.00 95.17  ? 280  ASP A OD2   1 
ATOM   4878 N  N     . LEU B 1 282 ? 95.835  -0.602  134.228 1.00 48.12  ? 281  LEU A N     1 
ATOM   4879 C  CA    . LEU B 1 282 ? 96.783  0.117   135.079 1.00 51.78  ? 281  LEU A CA    1 
ATOM   4880 C  C     . LEU B 1 282 ? 98.026  -0.697  135.414 1.00 50.27  ? 281  LEU A C     1 
ATOM   4881 O  O     . LEU B 1 282 ? 98.701  -0.414  136.404 1.00 49.65  ? 281  LEU A O     1 
ATOM   4882 C  CB    . LEU B 1 282 ? 96.114  0.600   136.371 1.00 49.57  ? 281  LEU A CB    1 
ATOM   4883 C  CG    . LEU B 1 282 ? 94.814  1.395   136.203 1.00 52.87  ? 281  LEU A CG    1 
ATOM   4884 C  CD1   . LEU B 1 282 ? 94.242  1.738   137.556 1.00 51.37  ? 281  LEU A CD1   1 
ATOM   4885 C  CD2   . LEU B 1 282 ? 95.011  2.656   135.369 1.00 48.49  ? 281  LEU A CD2   1 
ATOM   4886 N  N     . LEU B 1 283 ? 98.354  -1.703  134.611 1.00 51.98  ? 282  LEU A N     1 
ATOM   4887 C  CA    . LEU B 1 283 ? 99.557  -2.491  134.849 1.00 57.52  ? 282  LEU A CA    1 
ATOM   4888 C  C     . LEU B 1 283 ? 100.769 -1.758  134.283 1.00 50.05  ? 282  LEU A C     1 
ATOM   4889 O  O     . LEU B 1 283 ? 100.738 -1.264  133.149 1.00 45.24  ? 282  LEU A O     1 
ATOM   4890 C  CB    . LEU B 1 283 ? 99.420  -3.882  134.226 1.00 55.00  ? 282  LEU A CB    1 
ATOM   4891 C  CG    . LEU B 1 283 ? 98.381  -4.781  134.898 1.00 61.48  ? 282  LEU A CG    1 
ATOM   4892 C  CD1   . LEU B 1 283 ? 98.295  -6.154  134.219 1.00 70.79  ? 282  LEU A CD1   1 
ATOM   4893 C  CD2   . LEU B 1 283 ? 98.681  -4.938  136.381 1.00 60.39  ? 282  LEU A CD2   1 
ATOM   4894 N  N     . ILE B 1 284 ? 101.831 -1.674  135.080 1.00 44.80  ? 283  ILE A N     1 
ATOM   4895 C  CA    . ILE B 1 284 ? 102.988 -0.840  134.774 1.00 44.23  ? 283  ILE A CA    1 
ATOM   4896 C  C     . ILE B 1 284 ? 104.257 -1.615  135.112 1.00 48.49  ? 283  ILE A C     1 
ATOM   4897 O  O     . ILE B 1 284 ? 104.209 -2.743  135.611 1.00 47.68  ? 283  ILE A O     1 
ATOM   4898 C  CB    . ILE B 1 284 ? 102.945 0.505   135.531 1.00 47.04  ? 283  ILE A CB    1 
ATOM   4899 C  CG1   . ILE B 1 284 ? 102.881 0.254   137.040 1.00 44.69  ? 283  ILE A CG1   1 
ATOM   4900 C  CG2   . ILE B 1 284 ? 101.735 1.325   135.090 1.00 39.72  ? 283  ILE A CG2   1 
ATOM   4901 C  CD1   . ILE B 1 284 ? 102.805 1.512   137.884 1.00 41.93  ? 283  ILE A CD1   1 
ATOM   4902 N  N     . ALA B 1 285 ? 105.405 -1.008  134.809 1.00 43.85  ? 284  ALA A N     1 
ATOM   4903 C  CA    . ALA B 1 285 ? 106.713 -1.539  135.182 1.00 43.86  ? 284  ALA A CA    1 
ATOM   4904 C  C     . ALA B 1 285 ? 107.248 -0.901  136.456 1.00 43.02  ? 284  ALA A C     1 
ATOM   4905 O  O     . ALA B 1 285 ? 107.720 -1.607  137.352 1.00 44.31  ? 284  ALA A O     1 
ATOM   4906 C  CB    . ALA B 1 285 ? 107.726 -1.328  134.049 1.00 40.37  ? 284  ALA A CB    1 
ATOM   4907 N  N     . ARG B 1 286 ? 107.201 0.431   136.540 1.00 45.28  ? 285  ARG A N     1 
ATOM   4908 C  CA    . ARG B 1 286 ? 107.709 1.173   137.683 1.00 45.40  ? 285  ARG A CA    1 
ATOM   4909 C  C     . ARG B 1 286 ? 106.761 2.321   137.996 1.00 51.72  ? 285  ARG A C     1 
ATOM   4910 O  O     . ARG B 1 286 ? 105.975 2.753   137.149 1.00 43.13  ? 285  ARG A O     1 
ATOM   4911 C  CB    . ARG B 1 286 ? 109.117 1.730   137.430 1.00 45.31  ? 285  ARG A CB    1 
ATOM   4912 C  CG    . ARG B 1 286 ? 109.821 1.157   136.208 1.00 53.52  ? 285  ARG A CG    1 
ATOM   4913 C  CD    . ARG B 1 286 ? 111.302 1.506   136.199 1.00 57.46  ? 285  ARG A CD    1 
ATOM   4914 N  NE    . ARG B 1 286 ? 112.001 0.624   137.123 1.00 73.55  ? 285  ARG A NE    1 
ATOM   4915 C  CZ    . ARG B 1 286 ? 112.621 1.014   138.228 1.00 66.85  ? 285  ARG A CZ    1 
ATOM   4916 N  NH1   . ARG B 1 286 ? 112.683 2.293   138.564 1.00 56.92  ? 285  ARG A NH1   1 
ATOM   4917 N  NH2   . ARG B 1 286 ? 113.195 0.109   138.993 1.00 70.76  ? 285  ARG A NH2   1 
ATOM   4918 N  N     . GLN B 1 287 ? 106.840 2.817   139.231 1.00 41.09  ? 286  GLN A N     1 
ATOM   4919 C  CA    . GLN B 1 287 ? 106.156 4.056   139.570 1.00 37.24  ? 286  GLN A CA    1 
ATOM   4920 C  C     . GLN B 1 287 ? 106.944 4.755   140.658 1.00 44.96  ? 286  GLN A C     1 
ATOM   4921 O  O     . GLN B 1 287 ? 107.723 4.123   141.383 1.00 34.66  ? 286  GLN A O     1 
ATOM   4922 C  CB    . GLN B 1 287 ? 104.701 3.825   140.012 1.00 38.80  ? 286  GLN A CB    1 
ATOM   4923 C  CG    . GLN B 1 287 ? 104.525 3.098   141.345 1.00 38.15  ? 286  GLN A CG    1 
ATOM   4924 C  CD    . GLN B 1 287 ? 103.102 3.195   141.877 1.00 35.29  ? 286  GLN A CD    1 
ATOM   4925 O  OE1   . GLN B 1 287 ? 102.168 3.461   141.131 1.00 35.40  ? 286  GLN A OE1   1 
ATOM   4926 N  NE2   . GLN B 1 287 ? 102.942 3.002   143.181 1.00 36.49  ? 286  GLN A NE2   1 
ATOM   4927 N  N     . GLY B 1 288 ? 106.758 6.065   140.754 1.00 42.31  ? 287  GLY A N     1 
ATOM   4928 C  CA    . GLY B 1 288 ? 107.478 6.816   141.758 1.00 35.91  ? 287  GLY A CA    1 
ATOM   4929 C  C     . GLY B 1 288 ? 107.090 8.274   141.760 1.00 33.79  ? 287  GLY A C     1 
ATOM   4930 O  O     . GLY B 1 288 ? 106.094 8.677   141.154 1.00 31.01  ? 287  GLY A O     1 
ATOM   4931 N  N     . VAL B 1 289 ? 107.914 9.065   142.439 1.00 29.12  ? 288  VAL A N     1 
ATOM   4932 C  CA    . VAL B 1 289 ? 107.584 10.441  142.770 1.00 28.60  ? 288  VAL A CA    1 
ATOM   4933 C  C     . VAL B 1 289 ? 108.766 11.334  142.420 1.00 27.96  ? 288  VAL A C     1 
ATOM   4934 O  O     . VAL B 1 289 ? 109.892 10.877  142.196 1.00 30.08  ? 288  VAL A O     1 
ATOM   4935 C  CB    . VAL B 1 289 ? 107.220 10.603  144.264 1.00 28.20  ? 288  VAL A CB    1 
ATOM   4936 C  CG1   . VAL B 1 289 ? 106.098 9.660   144.648 1.00 27.03  ? 288  VAL A CG1   1 
ATOM   4937 C  CG2   . VAL B 1 289 ? 108.418 10.337  145.117 1.00 26.76  ? 288  VAL A CG2   1 
ATOM   4938 N  N     . LYS B 1 290 ? 108.489 12.626  142.376 1.00 29.05  ? 289  LYS A N     1 
ATOM   4939 C  CA    . LYS B 1 290 ? 109.512 13.634  142.157 1.00 26.72  ? 289  LYS A CA    1 
ATOM   4940 C  C     . LYS B 1 290 ? 109.274 14.783  143.121 1.00 25.43  ? 289  LYS A C     1 
ATOM   4941 O  O     . LYS B 1 290 ? 108.128 15.170  143.365 1.00 27.52  ? 289  LYS A O     1 
ATOM   4942 C  CB    . LYS B 1 290 ? 109.478 14.127  140.701 1.00 27.78  ? 289  LYS A CB    1 
ATOM   4943 C  CG    . LYS B 1 290 ? 110.276 15.390  140.465 1.00 36.35  ? 289  LYS A CG    1 
ATOM   4944 C  CD    . LYS B 1 290 ? 110.675 15.539  139.016 1.00 36.44  ? 289  LYS A CD    1 
ATOM   4945 C  CE    . LYS B 1 290 ? 109.659 16.296  138.210 1.00 46.89  ? 289  LYS A CE    1 
ATOM   4946 N  NZ    . LYS B 1 290 ? 110.094 16.444  136.769 1.00 41.71  ? 289  LYS A NZ    1 
ATOM   4947 N  N     . LEU B 1 291 ? 110.360 15.294  143.692 1.00 25.96  ? 290  LEU A N     1 
ATOM   4948 C  CA    . LEU B 1 291 ? 110.367 16.522  144.472 1.00 22.77  ? 290  LEU A CA    1 
ATOM   4949 C  C     . LEU B 1 291 ? 111.399 17.462  143.871 1.00 29.52  ? 290  LEU A C     1 
ATOM   4950 O  O     . LEU B 1 291 ? 112.529 17.042  143.592 1.00 25.83  ? 290  LEU A O     1 
ATOM   4951 C  CB    . LEU B 1 291 ? 110.719 16.250  145.938 1.00 25.02  ? 290  LEU A CB    1 
ATOM   4952 C  CG    . LEU B 1 291 ? 109.782 15.332  146.720 1.00 27.86  ? 290  LEU A CG    1 
ATOM   4953 C  CD1   . LEU B 1 291 ? 110.317 15.151  148.141 1.00 26.00  ? 290  LEU A CD1   1 
ATOM   4954 C  CD2   . LEU B 1 291 ? 108.333 15.887  146.741 1.00 22.26  ? 290  LEU A CD2   1 
ATOM   4955 N  N     . LYS B 1 292 ? 111.026 18.729  143.688 1.00 23.27  ? 291  LYS A N     1 
ATOM   4956 C  CA    . LYS B 1 292 ? 111.984 19.772  143.325 1.00 23.75  ? 291  LYS A CA    1 
ATOM   4957 C  C     . LYS B 1 292 ? 112.039 20.796  144.451 1.00 28.32  ? 291  LYS A C     1 
ATOM   4958 O  O     . LYS B 1 292 ? 110.990 21.228  144.947 1.00 26.02  ? 291  LYS A O     1 
ATOM   4959 C  CB    . LYS B 1 292 ? 111.592 20.447  142.012 1.00 22.92  ? 291  LYS A CB    1 
ATOM   4960 C  CG    . LYS B 1 292 ? 112.659 21.403  141.447 1.00 26.80  ? 291  LYS A CG    1 
ATOM   4961 C  CD    . LYS B 1 292 ? 112.088 22.176  140.233 1.00 34.45  ? 291  LYS A CD    1 
ATOM   4962 C  CE    . LYS B 1 292 ? 112.579 21.635  138.902 1.00 44.76  ? 291  LYS A CE    1 
ATOM   4963 N  NZ    . LYS B 1 292 ? 114.052 21.771  138.762 1.00 36.66  ? 291  LYS A NZ    1 
ATOM   4964 N  N     . PHE B 1 293 ? 113.253 21.200  144.840 1.00 24.70  ? 292  PHE A N     1 
ATOM   4965 C  CA    . PHE B 1 293 ? 113.446 21.994  146.046 1.00 26.19  ? 292  PHE A CA    1 
ATOM   4966 C  C     . PHE B 1 293 ? 113.671 23.463  145.702 1.00 30.27  ? 292  PHE A C     1 
ATOM   4967 O  O     . PHE B 1 293 ? 113.782 23.844  144.534 1.00 27.61  ? 292  PHE A O     1 
ATOM   4968 C  CB    . PHE B 1 293 ? 114.610 21.431  146.862 1.00 29.02  ? 292  PHE A CB    1 
ATOM   4969 C  CG    . PHE B 1 293 ? 114.509 19.960  147.080 1.00 27.88  ? 292  PHE A CG    1 
ATOM   4970 C  CD1   . PHE B 1 293 ? 113.580 19.449  147.984 1.00 28.38  ? 292  PHE A CD1   1 
ATOM   4971 C  CD2   . PHE B 1 293 ? 115.293 19.077  146.354 1.00 26.60  ? 292  PHE A CD2   1 
ATOM   4972 C  CE1   . PHE B 1 293 ? 113.447 18.062  148.159 1.00 31.80  ? 292  PHE A CE1   1 
ATOM   4973 C  CE2   . PHE B 1 293 ? 115.181 17.700  146.541 1.00 23.62  ? 292  PHE A CE2   1 
ATOM   4974 C  CZ    . PHE B 1 293 ? 114.257 17.199  147.446 1.00 32.72  ? 292  PHE A CZ    1 
ATOM   4975 N  N     . ASP B 1 294 ? 113.741 24.289  146.759 1.00 30.28  ? 293  ASP A N     1 
ATOM   4976 C  CA    . ASP B 1 294 ? 113.802 25.738  146.582 1.00 31.96  ? 293  ASP A CA    1 
ATOM   4977 C  C     . ASP B 1 294 ? 115.079 26.178  145.883 1.00 33.33  ? 293  ASP A C     1 
ATOM   4978 O  O     . ASP B 1 294 ? 115.104 27.245  145.263 1.00 33.84  ? 293  ASP A O     1 
ATOM   4979 C  CB    . ASP B 1 294 ? 113.653 26.449  147.940 1.00 27.27  ? 293  ASP A CB    1 
ATOM   4980 C  CG    . ASP B 1 294 ? 114.609 25.923  149.007 1.00 32.34  ? 293  ASP A CG    1 
ATOM   4981 O  OD1   . ASP B 1 294 ? 115.791 25.632  148.694 1.00 30.83  ? 293  ASP A OD1   1 
ATOM   4982 O  OD2   . ASP B 1 294 ? 114.166 25.821  150.177 1.00 36.33  ? 293  ASP A OD2   1 
ATOM   4983 N  N     . ASP B 1 295 ? 116.136 25.378  145.943 1.00 24.71  ? 294  ASP A N     1 
ATOM   4984 C  CA    . ASP B 1 295 ? 117.355 25.689  145.208 1.00 24.19  ? 294  ASP A CA    1 
ATOM   4985 C  C     . ASP B 1 295 ? 117.338 25.141  143.788 1.00 34.72  ? 294  ASP A C     1 
ATOM   4986 O  O     . ASP B 1 295 ? 118.393 25.060  143.149 1.00 28.86  ? 294  ASP A O     1 
ATOM   4987 C  CB    . ASP B 1 295 ? 118.576 25.148  145.946 1.00 29.55  ? 294  ASP A CB    1 
ATOM   4988 C  CG    . ASP B 1 295 ? 118.464 23.654  146.272 1.00 38.52  ? 294  ASP A CG    1 
ATOM   4989 O  OD1   . ASP B 1 295 ? 117.661 22.912  145.641 1.00 32.82  ? 294  ASP A OD1   1 
ATOM   4990 O  OD2   . ASP B 1 295 ? 119.193 23.225  147.187 1.00 34.42  ? 294  ASP A OD2   1 
ATOM   4991 N  N     . PHE B 1 296 ? 116.168 24.735  143.298 1.00 28.63  ? 295  PHE A N     1 
ATOM   4992 C  CA    . PHE B 1 296 ? 115.941 24.190  141.967 1.00 33.66  ? 295  PHE A CA    1 
ATOM   4993 C  C     . PHE B 1 296 ? 116.562 22.809  141.785 1.00 27.86  ? 295  PHE A C     1 
ATOM   4994 O  O     . PHE B 1 296 ? 116.396 22.217  140.720 1.00 30.25  ? 295  PHE A O     1 
ATOM   4995 C  CB    . PHE B 1 296 ? 116.425 25.143  140.864 1.00 33.56  ? 295  PHE A CB    1 
ATOM   4996 C  CG    . PHE B 1 296 ? 115.443 25.310  139.745 1.00 30.02  ? 295  PHE A CG    1 
ATOM   4997 C  CD1   . PHE B 1 296 ? 114.233 25.950  139.954 1.00 28.77  ? 295  PHE A CD1   1 
ATOM   4998 C  CD2   . PHE B 1 296 ? 115.723 24.804  138.488 1.00 47.65  ? 295  PHE A CD2   1 
ATOM   4999 C  CE1   . PHE B 1 296 ? 113.332 26.094  138.931 1.00 35.84  ? 295  PHE A CE1   1 
ATOM   5000 C  CE2   . PHE B 1 296 ? 114.819 24.941  137.455 1.00 47.14  ? 295  PHE A CE2   1 
ATOM   5001 C  CZ    . PHE B 1 296 ? 113.622 25.585  137.676 1.00 43.69  ? 295  PHE A CZ    1 
ATOM   5002 N  N     . GLN B 1 297 ? 117.224 22.250  142.793 1.00 27.83  ? 296  GLN A N     1 
ATOM   5003 C  CA    . GLN B 1 297 ? 117.618 20.847  142.692 1.00 27.10  ? 296  GLN A CA    1 
ATOM   5004 C  C     . GLN B 1 297 ? 116.383 19.959  142.741 1.00 31.44  ? 296  GLN A C     1 
ATOM   5005 O  O     . GLN B 1 297 ? 115.356 20.310  143.331 1.00 30.74  ? 296  GLN A O     1 
ATOM   5006 C  CB    . GLN B 1 297 ? 118.578 20.461  143.815 1.00 35.46  ? 296  GLN A CB    1 
ATOM   5007 C  CG    . GLN B 1 297 ? 119.923 21.177  143.740 1.00 49.04  ? 296  GLN A CG    1 
ATOM   5008 C  CD    . GLN B 1 297 ? 121.054 20.278  144.148 1.00 68.04  ? 296  GLN A CD    1 
ATOM   5009 O  OE1   . GLN B 1 297 ? 121.124 19.827  145.296 1.00 84.55  ? 296  GLN A OE1   1 
ATOM   5010 N  NE2   . GLN B 1 297 ? 121.936 19.979  143.204 1.00 62.79  ? 296  GLN A NE2   1 
ATOM   5011 N  N     . GLN B 1 298 ? 116.472 18.796  142.114 1.00 24.90  ? 297  GLN A N     1 
ATOM   5012 C  CA    . GLN B 1 298 ? 115.331 17.890  142.170 1.00 26.11  ? 297  GLN A CA    1 
ATOM   5013 C  C     . GLN B 1 298 ? 115.792 16.448  142.334 1.00 30.34  ? 297  GLN A C     1 
ATOM   5014 O  O     . GLN B 1 298 ? 116.948 16.100  142.067 1.00 31.36  ? 297  GLN A O     1 
ATOM   5015 C  CB    . GLN B 1 298 ? 114.453 18.030  140.935 1.00 26.89  ? 297  GLN A CB    1 
ATOM   5016 C  CG    . GLN B 1 298 ? 115.048 17.468  139.677 1.00 37.12  ? 297  GLN A CG    1 
ATOM   5017 C  CD    . GLN B 1 298 ? 114.080 17.592  138.520 1.00 46.04  ? 297  GLN A CD    1 
ATOM   5018 O  OE1   . GLN B 1 298 ? 113.351 18.576  138.420 1.00 47.54  ? 297  GLN A OE1   1 
ATOM   5019 N  NE2   . GLN B 1 298 ? 114.052 16.591  137.653 1.00 42.12  ? 297  GLN A NE2   1 
ATOM   5020 N  N     . THR B 1 299 ? 114.862 15.611  142.790 1.00 28.35  ? 298  THR A N     1 
ATOM   5021 C  CA    . THR B 1 299 ? 115.150 14.203  143.011 1.00 27.30  ? 298  THR A CA    1 
ATOM   5022 C  C     . THR B 1 299 ? 113.940 13.380  142.596 1.00 36.73  ? 298  THR A C     1 
ATOM   5023 O  O     . THR B 1 299 ? 112.797 13.852  142.644 1.00 28.19  ? 298  THR A O     1 
ATOM   5024 C  CB    . THR B 1 299 ? 115.546 13.927  144.471 1.00 28.52  ? 298  THR A CB    1 
ATOM   5025 O  OG1   . THR B 1 299 ? 116.000 12.569  144.595 1.00 34.53  ? 298  THR A OG1   1 
ATOM   5026 C  CG2   . THR B 1 299 ? 114.369 14.150  145.436 1.00 34.11  ? 298  THR A CG2   1 
ATOM   5027 N  N     . THR B 1 300 ? 114.210 12.158  142.139 1.00 27.18  ? 299  THR A N     1 
ATOM   5028 C  CA    . THR B 1 300 ? 113.161 11.220  141.773 1.00 23.87  ? 299  THR A CA    1 
ATOM   5029 C  C     . THR B 1 300 ? 113.410 9.911   142.513 1.00 25.08  ? 299  THR A C     1 
ATOM   5030 O  O     . THR B 1 300 ? 114.554 9.477   142.677 1.00 32.88  ? 299  THR A O     1 
ATOM   5031 C  CB    . THR B 1 300 ? 113.109 10.975  140.250 1.00 34.81  ? 299  THR A CB    1 
ATOM   5032 O  OG1   . THR B 1 300 ? 114.372 10.479  139.806 1.00 34.75  ? 299  THR A OG1   1 
ATOM   5033 C  CG2   . THR B 1 300 ? 112.793 12.267  139.484 1.00 31.04  ? 299  THR A CG2   1 
ATOM   5034 N  N     . GLN B 1 301 ? 112.343 9.292   142.979 1.00 29.20  ? 300  GLN A N     1 
ATOM   5035 C  CA    . GLN B 1 301 ? 112.435 8.008   143.663 1.00 29.30  ? 300  GLN A CA    1 
ATOM   5036 C  C     . GLN B 1 301 ? 111.350 7.132   143.064 1.00 29.29  ? 300  GLN A C     1 
ATOM   5037 O  O     . GLN B 1 301 ? 110.161 7.399   143.256 1.00 30.13  ? 300  GLN A O     1 
ATOM   5038 C  CB    . GLN B 1 301 ? 112.268 8.145   145.190 1.00 29.10  ? 300  GLN A CB    1 
ATOM   5039 C  CG    . GLN B 1 301 ? 112.466 6.800   145.913 1.00 37.30  ? 300  GLN A CG    1 
ATOM   5040 C  CD    . GLN B 1 301 ? 112.453 6.882   147.442 1.00 40.79  ? 300  GLN A CD    1 
ATOM   5041 O  OE1   . GLN B 1 301 ? 112.866 7.869   148.032 1.00 38.65  ? 300  GLN A OE1   1 
ATOM   5042 N  NE2   . GLN B 1 301 ? 111.976 5.826   148.077 1.00 52.14  ? 300  GLN A NE2   1 
ATOM   5043 N  N     . GLU B 1 302 ? 111.752 6.125   142.294 1.00 32.58  ? 301  GLU A N     1 
ATOM   5044 C  CA    . GLU B 1 302 ? 110.803 5.203   141.713 1.00 34.84  ? 301  GLU A CA    1 
ATOM   5045 C  C     . GLU B 1 302 ? 111.327 3.782   141.882 1.00 36.20  ? 301  GLU A C     1 
ATOM   5046 O  O     . GLU B 1 302 ? 112.510 3.552   142.141 1.00 35.52  ? 301  GLU A O     1 
ATOM   5047 C  CB    . GLU B 1 302 ? 110.514 5.529   140.232 1.00 46.39  ? 301  GLU A CB    1 
ATOM   5048 C  CG    . GLU B 1 302 ? 111.662 5.391   139.273 1.00 66.93  ? 301  GLU A CG    1 
ATOM   5049 C  CD    . GLU B 1 302 ? 111.188 5.382   137.822 1.00 83.87  ? 301  GLU A CD    1 
ATOM   5050 O  OE1   . GLU B 1 302 ? 109.956 5.455   137.580 1.00 81.73  ? 301  GLU A OE1   1 
ATOM   5051 O  OE2   . GLU B 1 302 ? 112.048 5.290   136.922 1.00 93.06  ? 301  GLU A OE2   1 
ATOM   5052 N  N     . HIS B 1 303 ? 110.421 2.831   141.759 1.00 32.96  ? 302  HIS A N     1 
ATOM   5053 C  CA    . HIS B 1 303 ? 110.790 1.438   141.967 1.00 42.94  ? 302  HIS A CA    1 
ATOM   5054 C  C     . HIS B 1 303 ? 109.896 0.539   141.124 1.00 46.19  ? 302  HIS A C     1 
ATOM   5055 O  O     . HIS B 1 303 ? 108.790 0.924   140.726 1.00 37.65  ? 302  HIS A O     1 
ATOM   5056 C  CB    . HIS B 1 303 ? 110.698 1.062   143.447 1.00 36.52  ? 302  HIS A CB    1 
ATOM   5057 C  CG    . HIS B 1 303 ? 109.384 1.416   144.076 1.00 52.69  ? 302  HIS A CG    1 
ATOM   5058 N  ND1   . HIS B 1 303 ? 108.206 0.778   143.752 1.00 55.59  ? 302  HIS A ND1   1 
ATOM   5059 C  CD2   . HIS B 1 303 ? 109.059 2.356   144.994 1.00 53.31  ? 302  HIS A CD2   1 
ATOM   5060 C  CE1   . HIS B 1 303 ? 107.216 1.302   144.450 1.00 49.44  ? 302  HIS A CE1   1 
ATOM   5061 N  NE2   . HIS B 1 303 ? 107.707 2.261   145.213 1.00 57.74  ? 302  HIS A NE2   1 
ATOM   5062 N  N     . VAL B 1 304 ? 110.411 -0.666  140.844 1.00 44.94  ? 303  VAL A N     1 
ATOM   5063 C  CA    . VAL B 1 304 ? 109.618 -1.721  140.229 1.00 47.31  ? 303  VAL A CA    1 
ATOM   5064 C  C     . VAL B 1 304 ? 108.283 -1.824  140.943 1.00 46.59  ? 303  VAL A C     1 
ATOM   5065 O  O     . VAL B 1 304 ? 108.227 -1.872  142.175 1.00 39.06  ? 303  VAL A O     1 
ATOM   5066 C  CB    . VAL B 1 304 ? 110.388 -3.056  140.286 1.00 51.32  ? 303  VAL A CB    1 
ATOM   5067 C  CG1   . VAL B 1 304 ? 109.433 -4.245  140.166 1.00 48.83  ? 303  VAL A CG1   1 
ATOM   5068 C  CG2   . VAL B 1 304 ? 111.453 -3.092  139.207 1.00 50.39  ? 303  VAL A CG2   1 
ATOM   5069 N  N     . TRP B 1 305 ? 107.201 -1.857  140.173 1.00 44.44  ? 304  TRP A N     1 
ATOM   5070 C  CA    . TRP B 1 305 ? 105.887 -1.949  140.795 1.00 43.84  ? 304  TRP A CA    1 
ATOM   5071 C  C     . TRP B 1 305 ? 104.886 -2.423  139.748 1.00 46.60  ? 304  TRP A C     1 
ATOM   5072 O  O     . TRP B 1 305 ? 104.897 -1.918  138.617 1.00 53.86  ? 304  TRP A O     1 
ATOM   5073 C  CB    . TRP B 1 305 ? 105.482 -0.601  141.397 1.00 44.53  ? 304  TRP A CB    1 
ATOM   5074 C  CG    . TRP B 1 305 ? 104.343 -0.702  142.342 1.00 45.65  ? 304  TRP A CG    1 
ATOM   5075 C  CD1   . TRP B 1 305 ? 103.044 -0.399  142.086 1.00 44.06  ? 304  TRP A CD1   1 
ATOM   5076 C  CD2   . TRP B 1 305 ? 104.391 -1.157  143.697 1.00 50.54  ? 304  TRP A CD2   1 
ATOM   5077 N  NE1   . TRP B 1 305 ? 102.270 -0.637  143.197 1.00 46.19  ? 304  TRP A NE1   1 
ATOM   5078 C  CE2   . TRP B 1 305 ? 103.076 -1.103  144.202 1.00 50.36  ? 304  TRP A CE2   1 
ATOM   5079 C  CE3   . TRP B 1 305 ? 105.418 -1.603  144.535 1.00 49.40  ? 304  TRP A CE3   1 
ATOM   5080 C  CZ2   . TRP B 1 305 ? 102.762 -1.471  145.505 1.00 47.18  ? 304  TRP A CZ2   1 
ATOM   5081 C  CZ3   . TRP B 1 305 ? 105.102 -1.966  145.833 1.00 45.37  ? 304  TRP A CZ3   1 
ATOM   5082 C  CH2   . TRP B 1 305 ? 103.787 -1.903  146.302 1.00 50.88  ? 304  TRP A CH2   1 
ATOM   5083 N  N     . PRO B 1 306 ? 104.020 -3.396  140.072 1.00 47.61  ? 305  PRO A N     1 
ATOM   5084 C  CA    . PRO B 1 306 ? 103.219 -4.042  139.018 1.00 49.03  ? 305  PRO A CA    1 
ATOM   5085 C  C     . PRO B 1 306 ? 102.006 -3.250  138.555 1.00 53.18  ? 305  PRO A C     1 
ATOM   5086 O  O     . PRO B 1 306 ? 101.540 -3.488  137.432 1.00 50.37  ? 305  PRO A O     1 
ATOM   5087 C  CB    . PRO B 1 306 ? 102.787 -5.363  139.668 1.00 50.36  ? 305  PRO A CB    1 
ATOM   5088 C  CG    . PRO B 1 306 ? 102.737 -5.055  141.119 1.00 45.16  ? 305  PRO A CG    1 
ATOM   5089 C  CD    . PRO B 1 306 ? 103.866 -4.078  141.374 1.00 42.02  ? 305  PRO A CD    1 
ATOM   5090 N  N     . ARG B 1 307 ? 101.476 -2.332  139.362 1.00 43.33  ? 306  ARG A N     1 
ATOM   5091 C  CA    . ARG B 1 307 ? 100.256 -1.637  138.971 1.00 48.60  ? 306  ARG A CA    1 
ATOM   5092 C  C     . ARG B 1 307 ? 100.155 -0.327  139.744 1.00 47.46  ? 306  ARG A C     1 
ATOM   5093 O  O     . ARG B 1 307 ? 100.547 -0.258  140.908 1.00 45.70  ? 306  ARG A O     1 
ATOM   5094 C  CB    . ARG B 1 307 ? 99.023  -2.518  139.211 1.00 56.75  ? 306  ARG A CB    1 
ATOM   5095 C  CG    . ARG B 1 307 ? 97.806  -1.753  139.679 1.00 70.76  ? 306  ARG A CG    1 
ATOM   5096 C  CD    . ARG B 1 307 ? 96.513  -2.550  139.592 1.00 75.67  ? 306  ARG A CD    1 
ATOM   5097 N  NE    . ARG B 1 307 ? 95.390  -1.661  139.875 1.00 82.33  ? 306  ARG A NE    1 
ATOM   5098 C  CZ    . ARG B 1 307 ? 94.110  -2.004  139.807 1.00 83.14  ? 306  ARG A CZ    1 
ATOM   5099 N  NH1   . ARG B 1 307 ? 93.767  -3.238  139.466 1.00 90.44  ? 306  ARG A NH1   1 
ATOM   5100 N  NH2   . ARG B 1 307 ? 93.172  -1.106  140.084 1.00 76.94  ? 306  ARG A NH2   1 
ATOM   5101 N  N     . LEU B 1 308 ? 99.620  0.707   139.086 1.00 50.49  ? 307  LEU A N     1 
ATOM   5102 C  CA    . LEU B 1 308 ? 99.476  2.022   139.708 1.00 46.13  ? 307  LEU A CA    1 
ATOM   5103 C  C     . LEU B 1 308 ? 98.789  1.911   141.061 1.00 42.25  ? 307  LEU A C     1 
ATOM   5104 O  O     . LEU B 1 308 ? 97.764  1.240   141.192 1.00 40.36  ? 307  LEU A O     1 
ATOM   5105 C  CB    . LEU B 1 308 ? 98.674  2.951   138.796 1.00 45.00  ? 307  LEU A CB    1 
ATOM   5106 C  CG    . LEU B 1 308 ? 98.398  4.336   139.379 1.00 42.85  ? 307  LEU A CG    1 
ATOM   5107 C  CD1   . LEU B 1 308 ? 99.690  5.120   139.438 1.00 41.43  ? 307  LEU A CD1   1 
ATOM   5108 C  CD2   . LEU B 1 308 ? 97.327  5.086   138.584 1.00 43.44  ? 307  LEU A CD2   1 
ATOM   5109 N  N     . ASN B 1 309 ? 99.353  2.588   142.068 1.00 37.15  ? 308  ASN A N     1 
ATOM   5110 C  CA    . ASN B 1 309 ? 98.925  2.396   143.456 1.00 38.87  ? 308  ASN A CA    1 
ATOM   5111 C  C     . ASN B 1 309 ? 99.164  3.669   144.263 1.00 39.21  ? 308  ASN A C     1 
ATOM   5112 O  O     . ASN B 1 309 ? 100.317 4.041   144.510 1.00 38.83  ? 308  ASN A O     1 
ATOM   5113 C  CB    . ASN B 1 309 ? 99.666  1.216   144.075 1.00 43.13  ? 308  ASN A CB    1 
ATOM   5114 C  CG    . ASN B 1 309 ? 99.054  0.769   145.383 1.00 56.50  ? 308  ASN A CG    1 
ATOM   5115 O  OD1   . ASN B 1 309 ? 99.442  1.239   146.450 1.00 48.71  ? 308  ASN A OD1   1 
ATOM   5116 N  ND2   . ASN B 1 309 ? 98.079  -0.142  145.307 1.00 48.26  ? 308  ASN A ND2   1 
ATOM   5117 N  N     . LYS B 1 310 ? 98.080  4.315   144.702 1.00 43.37  ? 309  LYS A N     1 
ATOM   5118 C  CA    . LYS B 1 310 ? 98.203  5.583   145.420 1.00 41.46  ? 309  LYS A CA    1 
ATOM   5119 C  C     . LYS B 1 310 ? 98.933  5.415   146.749 1.00 39.27  ? 309  LYS A C     1 
ATOM   5120 O  O     . LYS B 1 310 ? 99.829  6.204   147.079 1.00 37.61  ? 309  LYS A O     1 
ATOM   5121 C  CB    . LYS B 1 310 ? 96.823  6.196   145.659 1.00 46.10  ? 309  LYS A CB    1 
ATOM   5122 C  CG    . LYS B 1 310 ? 96.894  7.694   145.916 1.00 45.43  ? 309  LYS A CG    1 
ATOM   5123 C  CD    . LYS B 1 310 ? 96.108  8.123   147.116 1.00 52.36  ? 309  LYS A CD    1 
ATOM   5124 C  CE    . LYS B 1 310 ? 94.659  7.727   147.004 1.00 54.94  ? 309  LYS A CE    1 
ATOM   5125 N  NZ    . LYS B 1 310 ? 93.880  8.477   148.009 1.00 59.10  ? 309  LYS A NZ    1 
ATOM   5126 N  N     . ALA B 1 311 ? 98.553  4.402   147.533 1.00 35.43  ? 310  ALA A N     1 
ATOM   5127 C  CA    . ALA B 1 311 ? 99.159  4.197   148.846 1.00 36.09  ? 310  ALA A CA    1 
ATOM   5128 C  C     . ALA B 1 311 ? 100.666 4.032   148.738 1.00 33.86  ? 310  ALA A C     1 
ATOM   5129 O  O     . ALA B 1 311 ? 101.409 4.513   149.593 1.00 35.16  ? 310  ALA A O     1 
ATOM   5130 C  CB    . ALA B 1 311 ? 98.540  2.973   149.533 1.00 40.56  ? 310  ALA A CB    1 
ATOM   5131 N  N     . ASP B 1 312 ? 101.139 3.372   147.677 1.00 34.96  ? 311  ASP A N     1 
ATOM   5132 C  CA    . ASP B 1 312 ? 102.573 3.154   147.529 1.00 40.57  ? 311  ASP A CA    1 
ATOM   5133 C  C     . ASP B 1 312 ? 103.292 4.442   147.119 1.00 39.45  ? 311  ASP A C     1 
ATOM   5134 O  O     . ASP B 1 312 ? 104.405 4.713   147.582 1.00 33.53  ? 311  ASP A O     1 
ATOM   5135 C  CB    . ASP B 1 312 ? 102.804 2.028   146.523 1.00 36.45  ? 311  ASP A CB    1 
ATOM   5136 C  CG    . ASP B 1 312 ? 104.246 1.924   146.072 1.00 52.14  ? 311  ASP A CG    1 
ATOM   5137 O  OD1   . ASP B 1 312 ? 105.095 1.462   146.873 1.00 52.32  ? 311  ASP A OD1   1 
ATOM   5138 O  OD2   . ASP B 1 312 ? 104.521 2.289   144.907 1.00 50.46  ? 311  ASP A OD2   1 
ATOM   5139 N  N     . LEU B 1 313 ? 102.671 5.246   146.258 1.00 31.25  ? 312  LEU A N     1 
ATOM   5140 C  CA    . LEU B 1 313 ? 103.219 6.566   145.937 1.00 30.59  ? 312  LEU A CA    1 
ATOM   5141 C  C     . LEU B 1 313 ? 103.377 7.422   147.188 1.00 31.12  ? 312  LEU A C     1 
ATOM   5142 O  O     . LEU B 1 313 ? 104.437 8.027   147.408 1.00 29.44  ? 312  LEU A O     1 
ATOM   5143 C  CB    . LEU B 1 313 ? 102.325 7.273   144.923 1.00 30.02  ? 312  LEU A CB    1 
ATOM   5144 C  CG    . LEU B 1 313 ? 102.342 6.616   143.539 1.00 40.65  ? 312  LEU A CG    1 
ATOM   5145 C  CD1   . LEU B 1 313 ? 101.209 7.152   142.673 1.00 31.40  ? 312  LEU A CD1   1 
ATOM   5146 C  CD2   . LEU B 1 313 ? 103.703 6.818   142.875 1.00 32.31  ? 312  LEU A CD2   1 
ATOM   5147 N  N     . ILE B 1 314 ? 102.331 7.492   148.014 1.00 33.45  ? 313  ILE A N     1 
ATOM   5148 C  CA    . ILE B 1 314 ? 102.402 8.288   149.240 1.00 36.09  ? 313  ILE A CA    1 
ATOM   5149 C  C     . ILE B 1 314 ? 103.495 7.760   150.161 1.00 37.91  ? 313  ILE A C     1 
ATOM   5150 O  O     . ILE B 1 314 ? 104.310 8.535   150.684 1.00 32.41  ? 313  ILE A O     1 
ATOM   5151 C  CB    . ILE B 1 314 ? 101.031 8.323   149.936 1.00 36.56  ? 313  ILE A CB    1 
ATOM   5152 C  CG1   . ILE B 1 314 ? 100.048 9.189   149.138 1.00 35.11  ? 313  ILE A CG1   1 
ATOM   5153 C  CG2   . ILE B 1 314 ? 101.146 8.792   151.413 1.00 31.01  ? 313  ILE A CG2   1 
ATOM   5154 C  CD1   . ILE B 1 314 ? 98.618  9.124   149.698 1.00 36.04  ? 313  ILE A CD1   1 
ATOM   5155 N  N     . ALA B 1 315 ? 103.556 6.435   150.347 1.00 34.39  ? 314  ALA A N     1 
ATOM   5156 C  CA    . ALA B 1 315 ? 104.634 5.849   151.145 1.00 36.67  ? 314  ALA A CA    1 
ATOM   5157 C  C     . ALA B 1 315 ? 106.005 6.178   150.561 1.00 41.44  ? 314  ALA A C     1 
ATOM   5158 O  O     . ALA B 1 315 ? 106.949 6.483   151.302 1.00 32.99  ? 314  ALA A O     1 
ATOM   5159 C  CB    . ALA B 1 315 ? 104.447 4.331   151.261 1.00 38.43  ? 314  ALA A CB    1 
ATOM   5160 N  N     . THR B 1 316 ? 106.137 6.129   149.235 1.00 30.83  ? 315  THR A N     1 
ATOM   5161 C  CA    . THR B 1 316 ? 107.417 6.452   148.617 1.00 32.15  ? 315  THR A CA    1 
ATOM   5162 C  C     . THR B 1 316 ? 107.743 7.930   148.789 1.00 32.73  ? 315  THR A C     1 
ATOM   5163 O  O     . THR B 1 316 ? 108.873 8.297   149.128 1.00 32.61  ? 315  THR A O     1 
ATOM   5164 C  CB    . THR B 1 316 ? 107.388 6.070   147.133 1.00 36.27  ? 315  THR A CB    1 
ATOM   5165 O  OG1   . THR B 1 316 ? 107.207 4.658   147.022 1.00 44.27  ? 315  THR A OG1   1 
ATOM   5166 C  CG2   . THR B 1 316 ? 108.704 6.455   146.441 1.00 27.16  ? 315  THR A CG2   1 
ATOM   5167 N  N     . ALA B 1 317 ? 106.751 8.792   148.588 1.00 30.18  ? 316  ALA A N     1 
ATOM   5168 C  CA    . ALA B 1 317 ? 106.963 10.221  148.786 1.00 30.82  ? 316  ALA A CA    1 
ATOM   5169 C  C     . ALA B 1 317 ? 107.362 10.541  150.221 1.00 29.39  ? 316  ALA A C     1 
ATOM   5170 O  O     . ALA B 1 317 ? 108.168 11.447  150.447 1.00 24.66  ? 316  ALA A O     1 
ATOM   5171 C  CB    . ALA B 1 317 ? 105.705 10.993  148.408 1.00 25.42  ? 316  ALA A CB    1 
ATOM   5172 N  N     . ARG B 1 318 ? 106.810 9.818   151.210 1.00 27.41  ? 317  ARG A N     1 
ATOM   5173 C  CA    . ARG B 1 318 ? 107.187 10.116  152.594 1.00 30.97  ? 317  ARG A CA    1 
ATOM   5174 C  C     . ARG B 1 318 ? 108.675 9.884   152.802 1.00 38.87  ? 317  ARG A C     1 
ATOM   5175 O  O     . ARG B 1 318 ? 109.360 10.680  153.466 1.00 27.36  ? 317  ARG A O     1 
ATOM   5176 C  CB    . ARG B 1 318 ? 106.378 9.274   153.595 1.00 27.05  ? 317  ARG A CB    1 
ATOM   5177 C  CG    . ARG B 1 318 ? 106.664 9.698   155.076 1.00 27.20  ? 317  ARG A CG    1 
ATOM   5178 C  CD    . ARG B 1 318 ? 105.886 8.880   156.139 1.00 38.66  ? 317  ARG A CD    1 
ATOM   5179 N  NE    . ARG B 1 318 ? 104.453 9.169   156.106 1.00 42.84  ? 317  ARG A NE    1 
ATOM   5180 C  CZ    . ARG B 1 318 ? 103.556 8.394   155.502 1.00 43.32  ? 317  ARG A CZ    1 
ATOM   5181 N  NH1   . ARG B 1 318 ? 103.945 7.280   154.897 1.00 38.50  ? 317  ARG A NH1   1 
ATOM   5182 N  NH2   . ARG B 1 318 ? 102.275 8.729   155.498 1.00 31.72  ? 317  ARG A NH2   1 
ATOM   5183 N  N     . LYS B 1 319 ? 109.190 8.804   152.211 1.00 31.25  ? 318  LYS A N     1 
ATOM   5184 C  CA    . LYS B 1 319 ? 110.610 8.488   152.281 1.00 32.45  ? 318  LYS A CA    1 
ATOM   5185 C  C     . LYS B 1 319 ? 111.451 9.538   151.579 1.00 27.89  ? 318  LYS A C     1 
ATOM   5186 O  O     . LYS B 1 319 ? 112.480 9.967   152.117 1.00 31.93  ? 318  LYS A O     1 
ATOM   5187 C  CB    . LYS B 1 319 ? 110.859 7.106   151.675 1.00 38.19  ? 318  LYS A CB    1 
ATOM   5188 C  CG    . LYS B 1 319 ? 110.510 5.974   152.614 1.00 48.40  ? 318  LYS A CG    1 
ATOM   5189 C  CD    . LYS B 1 319 ? 110.542 4.628   151.917 1.00 58.62  ? 318  LYS A CD    1 
ATOM   5190 C  CE    . LYS B 1 319 ? 110.035 3.529   152.850 1.00 66.43  ? 318  LYS A CE    1 
ATOM   5191 N  NZ    . LYS B 1 319 ? 109.766 2.257   152.123 1.00 75.69  ? 318  LYS A NZ    1 
ATOM   5192 N  N     . THR B 1 320 ? 111.031 9.964   150.374 1.00 25.87  ? 319  THR A N     1 
ATOM   5193 C  CA    . THR B 1 320 ? 111.748 11.014  149.663 1.00 26.23  ? 319  THR A CA    1 
ATOM   5194 C  C     . THR B 1 320 ? 111.761 12.313  150.468 1.00 30.18  ? 319  THR A C     1 
ATOM   5195 O  O     . THR B 1 320 ? 112.815 12.953  150.629 1.00 28.67  ? 319  THR A O     1 
ATOM   5196 C  CB    . THR B 1 320 ? 111.119 11.243  148.277 1.00 28.86  ? 319  THR A CB    1 
ATOM   5197 O  OG1   . THR B 1 320 ? 110.835 9.985   147.657 1.00 33.04  ? 319  THR A OG1   1 
ATOM   5198 C  CG2   . THR B 1 320 ? 112.100 11.986  147.388 1.00 33.21  ? 319  THR A CG2   1 
ATOM   5199 N  N     . TRP B 1 321 ? 110.589 12.718  150.972 1.00 25.95  ? 320  TRP A N     1 
ATOM   5200 C  CA    . TRP B 1 321 ? 110.491 13.902  151.829 1.00 23.78  ? 320  TRP A CA    1 
ATOM   5201 C  C     . TRP B 1 321 ? 111.406 13.789  153.050 1.00 25.60  ? 320  TRP A C     1 
ATOM   5202 O  O     . TRP B 1 321 ? 112.144 14.727  153.369 1.00 32.71  ? 320  TRP A O     1 
ATOM   5203 C  CB    . TRP B 1 321 ? 109.030 14.101  152.246 1.00 26.48  ? 320  TRP A CB    1 
ATOM   5204 C  CG    . TRP B 1 321 ? 108.772 15.304  153.096 1.00 24.56  ? 320  TRP A CG    1 
ATOM   5205 C  CD1   . TRP B 1 321 ? 108.864 15.382  154.455 1.00 23.68  ? 320  TRP A CD1   1 
ATOM   5206 C  CD2   . TRP B 1 321 ? 108.363 16.606  152.645 1.00 22.97  ? 320  TRP A CD2   1 
ATOM   5207 N  NE1   . TRP B 1 321 ? 108.550 16.645  154.881 1.00 24.73  ? 320  TRP A NE1   1 
ATOM   5208 C  CE2   . TRP B 1 321 ? 108.235 17.420  153.795 1.00 27.60  ? 320  TRP A CE2   1 
ATOM   5209 C  CE3   . TRP B 1 321 ? 108.107 17.165  151.383 1.00 22.84  ? 320  TRP A CE3   1 
ATOM   5210 C  CZ2   . TRP B 1 321 ? 107.851 18.763  153.730 1.00 26.28  ? 320  TRP A CZ2   1 
ATOM   5211 C  CZ3   . TRP B 1 321 ? 107.732 18.513  151.318 1.00 23.56  ? 320  TRP A CZ3   1 
ATOM   5212 C  CH2   . TRP B 1 321 ? 107.601 19.289  152.494 1.00 22.94  ? 320  TRP A CH2   1 
ATOM   5213 N  N     . ASP B 1 322 ? 111.383 12.645  153.734 1.00 32.32  ? 321  ASP A N     1 
ATOM   5214 C  CA    . ASP B 1 322 ? 112.117 12.477  154.988 1.00 28.64  ? 321  ASP A CA    1 
ATOM   5215 C  C     . ASP B 1 322 ? 113.626 12.350  154.782 1.00 36.57  ? 321  ASP A C     1 
ATOM   5216 O  O     . ASP B 1 322 ? 114.400 12.817  155.625 1.00 33.89  ? 321  ASP A O     1 
ATOM   5217 C  CB    . ASP B 1 322 ? 111.616 11.233  155.735 1.00 25.45  ? 321  ASP A CB    1 
ATOM   5218 C  CG    . ASP B 1 322 ? 110.224 11.425  156.332 1.00 27.95  ? 321  ASP A CG    1 
ATOM   5219 O  OD1   . ASP B 1 322 ? 109.759 12.583  156.458 1.00 33.05  ? 321  ASP A OD1   1 
ATOM   5220 O  OD2   . ASP B 1 322 ? 109.604 10.412  156.689 1.00 35.62  ? 321  ASP A OD2   1 
ATOM   5221 N  N     . GLU B 1 323 ? 114.062 11.715  153.694 1.00 29.93  ? 322  GLU A N     1 
ATOM   5222 C  CA    . GLU B 1 323 ? 115.470 11.368  153.534 1.00 27.35  ? 322  GLU A CA    1 
ATOM   5223 C  C     . GLU B 1 323 ? 116.226 12.291  152.589 1.00 29.00  ? 322  GLU A C     1 
ATOM   5224 O  O     . GLU B 1 323 ? 117.447 12.423  152.718 1.00 35.75  ? 322  GLU A O     1 
ATOM   5225 C  CB    . GLU B 1 323 ? 115.604 9.920   153.038 1.00 32.03  ? 322  GLU A CB    1 
ATOM   5226 C  CG    . GLU B 1 323 ? 114.929 8.902   153.971 1.00 37.53  ? 322  GLU A CG    1 
ATOM   5227 C  CD    . GLU B 1 323 ? 114.714 7.525   153.353 1.00 46.82  ? 322  GLU A CD    1 
ATOM   5228 O  OE1   . GLU B 1 323 ? 115.172 7.262   152.205 1.00 37.72  ? 322  GLU A OE1   1 
ATOM   5229 O  OE2   . GLU B 1 323 ? 114.057 6.703   154.028 1.00 51.44  ? 322  GLU A OE2   1 
ATOM   5230 N  N     . ARG B 1 324 ? 115.553 12.945  151.646 1.00 29.96  ? 323  ARG A N     1 
ATOM   5231 C  CA    . ARG B 1 324 ? 116.263 13.692  150.615 1.00 28.99  ? 323  ARG A CA    1 
ATOM   5232 C  C     . ARG B 1 324 ? 116.011 15.186  150.647 1.00 25.89  ? 323  ARG A C     1 
ATOM   5233 O  O     . ARG B 1 324 ? 116.744 15.929  149.989 1.00 28.70  ? 323  ARG A O     1 
ATOM   5234 C  CB    . ARG B 1 324 ? 115.895 13.157  149.223 1.00 30.58  ? 323  ARG A CB    1 
ATOM   5235 C  CG    . ARG B 1 324 ? 116.270 11.700  149.053 1.00 31.59  ? 323  ARG A CG    1 
ATOM   5236 C  CD    . ARG B 1 324 ? 116.059 11.244  147.640 1.00 31.55  ? 323  ARG A CD    1 
ATOM   5237 N  NE    . ARG B 1 324 ? 116.027 9.793   147.587 1.00 38.40  ? 323  ARG A NE    1 
ATOM   5238 C  CZ    . ARG B 1 324 ? 115.904 9.086   146.469 1.00 36.08  ? 323  ARG A CZ    1 
ATOM   5239 N  NH1   . ARG B 1 324 ? 115.811 9.706   145.302 1.00 32.95  ? 323  ARG A NH1   1 
ATOM   5240 N  NH2   . ARG B 1 324 ? 115.857 7.763   146.523 1.00 36.45  ? 323  ARG A NH2   1 
ATOM   5241 N  N     . ARG B 1 325 ? 114.991 15.643  151.372 1.00 26.23  ? 324  ARG A N     1 
ATOM   5242 C  CA    . ARG B 1 325 ? 114.660 17.063  151.357 1.00 30.14  ? 324  ARG A CA    1 
ATOM   5243 C  C     . ARG B 1 325 ? 115.741 17.890  152.042 1.00 30.87  ? 324  ARG A C     1 
ATOM   5244 O  O     . ARG B 1 325 ? 115.981 19.043  151.654 1.00 29.13  ? 324  ARG A O     1 
ATOM   5245 C  CB    . ARG B 1 325 ? 113.306 17.282  152.033 1.00 33.91  ? 324  ARG A CB    1 
ATOM   5246 C  CG    . ARG B 1 325 ? 112.745 18.681  151.915 1.00 33.37  ? 324  ARG A CG    1 
ATOM   5247 C  CD    . ARG B 1 325 ? 111.325 18.752  152.487 1.00 26.86  ? 324  ARG A CD    1 
ATOM   5248 N  NE    . ARG B 1 325 ? 111.272 18.324  153.882 1.00 29.76  ? 324  ARG A NE    1 
ATOM   5249 C  CZ    . ARG B 1 325 ? 111.286 19.145  154.919 1.00 38.93  ? 324  ARG A CZ    1 
ATOM   5250 N  NH1   . ARG B 1 325 ? 111.372 20.463  154.729 1.00 32.39  ? 324  ARG A NH1   1 
ATOM   5251 N  NH2   . ARG B 1 325 ? 111.228 18.640  156.144 1.00 42.51  ? 324  ARG A NH2   1 
ATOM   5252 N  N     . GLY B 1 326 ? 116.379 17.331  153.071 1.00 30.65  ? 325  GLY A N     1 
ATOM   5253 C  CA    . GLY B 1 326 ? 117.440 18.047  153.761 1.00 38.85  ? 325  GLY A CA    1 
ATOM   5254 C  C     . GLY B 1 326 ? 117.014 19.374  154.344 1.00 35.85  ? 325  GLY A C     1 
ATOM   5255 O  O     . GLY B 1 326 ? 117.809 20.315  154.367 1.00 39.04  ? 325  GLY A O     1 
ATOM   5256 N  N     . GLY B 1 327 ? 115.778 19.484  154.811 1.00 33.27  ? 326  GLY A N     1 
ATOM   5257 C  CA    . GLY B 1 327 ? 115.322 20.726  155.403 1.00 33.53  ? 326  GLY A CA    1 
ATOM   5258 C  C     . GLY B 1 327 ? 114.894 21.791  154.419 1.00 37.58  ? 326  GLY A C     1 
ATOM   5259 O  O     . GLY B 1 327 ? 114.402 22.845  154.844 1.00 43.86  ? 326  GLY A O     1 
ATOM   5260 N  N     . ARG B 1 328 ? 115.036 21.552  153.119 1.00 32.73  ? 327  ARG A N     1 
ATOM   5261 C  CA    . ARG B 1 328 ? 114.701 22.584  152.151 1.00 24.88  ? 327  ARG A CA    1 
ATOM   5262 C  C     . ARG B 1 328 ? 113.188 22.677  151.942 1.00 33.94  ? 327  ARG A C     1 
ATOM   5263 O  O     . ARG B 1 328 ? 112.433 21.742  152.225 1.00 28.67  ? 327  ARG A O     1 
ATOM   5264 C  CB    . ARG B 1 328 ? 115.384 22.300  150.821 1.00 28.35  ? 327  ARG A CB    1 
ATOM   5265 C  CG    . ARG B 1 328 ? 116.890 22.333  150.933 1.00 30.29  ? 327  ARG A CG    1 
ATOM   5266 C  CD    . ARG B 1 328 ? 117.532 21.858  149.651 1.00 29.88  ? 327  ARG A CD    1 
ATOM   5267 N  NE    . ARG B 1 328 ? 117.448 20.412  149.534 1.00 26.91  ? 327  ARG A NE    1 
ATOM   5268 C  CZ    . ARG B 1 328 ? 118.029 19.702  148.573 1.00 30.05  ? 327  ARG A CZ    1 
ATOM   5269 N  NH1   . ARG B 1 328 ? 118.726 20.304  147.619 1.00 31.29  ? 327  ARG A NH1   1 
ATOM   5270 N  NH2   . ARG B 1 328 ? 117.901 18.382  148.560 1.00 24.71  ? 327  ARG A NH2   1 
ATOM   5271 N  N     . GLY B 1 329 ? 112.757 23.826  151.415 1.00 27.28  ? 328  GLY A N     1 
ATOM   5272 C  CA    . GLY B 1 329 ? 111.398 23.952  150.934 1.00 31.18  ? 328  GLY A CA    1 
ATOM   5273 C  C     . GLY B 1 329 ? 111.223 23.238  149.608 1.00 28.27  ? 328  GLY A C     1 
ATOM   5274 O  O     . GLY B 1 329 ? 112.173 23.042  148.847 1.00 28.97  ? 328  GLY A O     1 
ATOM   5275 N  N     . VAL B 1 330 ? 109.987 22.843  149.314 1.00 21.53  ? 329  VAL A N     1 
ATOM   5276 C  CA    . VAL B 1 330 ? 109.691 22.110  148.086 1.00 21.38  ? 329  VAL A CA    1 
ATOM   5277 C  C     . VAL B 1 330 ? 108.814 22.973  147.184 1.00 21.75  ? 329  VAL A C     1 
ATOM   5278 O  O     . VAL B 1 330 ? 107.729 23.414  147.591 1.00 24.53  ? 329  VAL A O     1 
ATOM   5279 C  CB    . VAL B 1 330 ? 109.025 20.765  148.403 1.00 25.15  ? 329  VAL A CB    1 
ATOM   5280 C  CG1   . VAL B 1 330 ? 108.432 20.151  147.134 1.00 22.88  ? 329  VAL A CG1   1 
ATOM   5281 C  CG2   . VAL B 1 330 ? 110.045 19.830  149.068 1.00 24.68  ? 329  VAL A CG2   1 
ATOM   5282 N  N     . ARG B 1 331 ? 109.269 23.208  145.947 1.00 23.65  ? 330  ARG A N     1 
ATOM   5283 C  CA    . ARG B 1 331 ? 108.454 23.966  145.006 1.00 22.10  ? 330  ARG A CA    1 
ATOM   5284 C  C     . ARG B 1 331 ? 107.620 23.096  144.085 1.00 25.81  ? 330  ARG A C     1 
ATOM   5285 O  O     . ARG B 1 331 ? 106.640 23.590  143.520 1.00 31.23  ? 330  ARG A O     1 
ATOM   5286 C  CB    . ARG B 1 331 ? 109.319 24.890  144.138 1.00 23.18  ? 330  ARG A CB    1 
ATOM   5287 C  CG    . ARG B 1 331 ? 110.314 24.158  143.255 1.00 22.15  ? 330  ARG A CG    1 
ATOM   5288 C  CD    . ARG B 1 331 ? 111.204 25.161  142.522 1.00 25.99  ? 330  ARG A CD    1 
ATOM   5289 N  NE    . ARG B 1 331 ? 110.549 25.740  141.347 1.00 23.29  ? 330  ARG A NE    1 
ATOM   5290 C  CZ    . ARG B 1 331 ? 110.267 27.034  141.211 1.00 31.15  ? 330  ARG A CZ    1 
ATOM   5291 N  NH1   . ARG B 1 331 ? 110.573 27.889  142.180 1.00 26.62  ? 330  ARG A NH1   1 
ATOM   5292 N  NH2   . ARG B 1 331 ? 109.715 27.485  140.096 1.00 26.14  ? 330  ARG A NH2   1 
ATOM   5293 N  N     . LEU B 1 332 ? 107.966 21.823  143.917 1.00 26.85  ? 331  LEU A N     1 
ATOM   5294 C  CA    . LEU B 1 332 ? 107.219 20.960  143.010 1.00 24.28  ? 331  LEU A CA    1 
ATOM   5295 C  C     . LEU B 1 332 ? 107.077 19.563  143.607 1.00 22.50  ? 331  LEU A C     1 
ATOM   5296 O  O     . LEU B 1 332 ? 108.007 19.057  144.244 1.00 27.51  ? 331  LEU A O     1 
ATOM   5297 C  CB    . LEU B 1 332 ? 107.922 20.910  141.635 1.00 23.26  ? 331  LEU A CB    1 
ATOM   5298 C  CG    . LEU B 1 332 ? 107.404 19.917  140.571 1.00 29.70  ? 331  LEU A CG    1 
ATOM   5299 C  CD1   . LEU B 1 332 ? 107.720 20.390  139.158 1.00 27.91  ? 331  LEU A CD1   1 
ATOM   5300 C  CD2   . LEU B 1 332 ? 107.990 18.498  140.794 1.00 22.95  ? 331  LEU A CD2   1 
ATOM   5301 N  N     . VAL B 1 333 ? 105.921 18.933  143.357 1.00 23.32  ? 332  VAL A N     1 
ATOM   5302 C  CA    . VAL B 1 333 ? 105.688 17.517  143.627 1.00 26.34  ? 332  VAL A CA    1 
ATOM   5303 C  C     . VAL B 1 333 ? 105.182 16.884  142.335 1.00 28.46  ? 332  VAL A C     1 
ATOM   5304 O  O     . VAL B 1 333 ? 104.371 17.489  141.624 1.00 26.82  ? 332  VAL A O     1 
ATOM   5305 C  CB    . VAL B 1 333 ? 104.667 17.295  144.768 1.00 25.51  ? 332  VAL A CB    1 
ATOM   5306 C  CG1   . VAL B 1 333 ? 104.376 15.778  144.971 1.00 24.43  ? 332  VAL A CG1   1 
ATOM   5307 C  CG2   . VAL B 1 333 ? 105.120 17.964  146.070 1.00 23.79  ? 332  VAL A CG2   1 
ATOM   5308 N  N     . GLY B 1 334 ? 105.660 15.683  142.028 1.00 24.16  ? 333  GLY A N     1 
ATOM   5309 C  CA    . GLY B 1 334 ? 105.235 14.988  140.823 1.00 27.00  ? 333  GLY A CA    1 
ATOM   5310 C  C     . GLY B 1 334 ? 105.053 13.502  141.070 1.00 28.05  ? 333  GLY A C     1 
ATOM   5311 O  O     . GLY B 1 334 ? 105.654 12.923  141.979 1.00 26.14  ? 333  GLY A O     1 
ATOM   5312 N  N     . LEU B 1 335 ? 104.210 12.886  140.242 1.00 26.65  ? 334  LEU A N     1 
ATOM   5313 C  CA    . LEU B 1 335 ? 104.021 11.439  140.234 1.00 27.35  ? 334  LEU A CA    1 
ATOM   5314 C  C     . LEU B 1 335 ? 104.424 10.908  138.865 1.00 27.90  ? 334  LEU A C     1 
ATOM   5315 O  O     . LEU B 1 335 ? 104.326 11.613  137.857 1.00 33.72  ? 334  LEU A O     1 
ATOM   5316 C  CB    . LEU B 1 335 ? 102.559 11.044  140.555 1.00 28.47  ? 334  LEU A CB    1 
ATOM   5317 C  CG    . LEU B 1 335 ? 101.920 11.618  141.834 1.00 29.26  ? 334  LEU A CG    1 
ATOM   5318 C  CD1   . LEU B 1 335 ? 100.429 11.221  141.977 1.00 31.23  ? 334  LEU A CD1   1 
ATOM   5319 C  CD2   . LEU B 1 335 ? 102.691 11.204  143.088 1.00 27.61  ? 334  LEU A CD2   1 
ATOM   5320 N  N     . HIS B 1 336 ? 104.895 9.664   138.826 1.00 33.91  ? 335  HIS A N     1 
ATOM   5321 C  CA    . HIS B 1 336 ? 105.452 9.159   137.581 1.00 28.95  ? 335  HIS A CA    1 
ATOM   5322 C  C     . HIS B 1 336 ? 105.240 7.656   137.494 1.00 33.63  ? 335  HIS A C     1 
ATOM   5323 O  O     . HIS B 1 336 ? 105.223 6.950   138.506 1.00 31.20  ? 335  HIS A O     1 
ATOM   5324 C  CB    . HIS B 1 336 ? 106.946 9.505   137.473 1.00 32.49  ? 335  HIS A CB    1 
ATOM   5325 C  CG    . HIS B 1 336 ? 107.558 9.186   136.143 1.00 38.16  ? 335  HIS A CG    1 
ATOM   5326 N  ND1   . HIS B 1 336 ? 108.192 7.988   135.883 1.00 37.77  ? 335  HIS A ND1   1 
ATOM   5327 C  CD2   . HIS B 1 336 ? 107.660 9.921   135.008 1.00 37.45  ? 335  HIS A CD2   1 
ATOM   5328 C  CE1   . HIS B 1 336 ? 108.651 7.994   134.644 1.00 48.37  ? 335  HIS A CE1   1 
ATOM   5329 N  NE2   . HIS B 1 336 ? 108.339 9.154   134.090 1.00 47.19  ? 335  HIS A NE2   1 
ATOM   5330 N  N     . VAL B 1 337 ? 105.108 7.186   136.258 1.00 31.26  ? 336  VAL A N     1 
ATOM   5331 C  CA    . VAL B 1 337 ? 104.842 5.803   135.924 1.00 37.87  ? 336  VAL A CA    1 
ATOM   5332 C  C     . VAL B 1 337 ? 105.679 5.442   134.705 1.00 39.14  ? 336  VAL A C     1 
ATOM   5333 O  O     . VAL B 1 337 ? 105.796 6.236   133.764 1.00 35.49  ? 336  VAL A O     1 
ATOM   5334 C  CB    . VAL B 1 337 ? 103.330 5.620   135.668 1.00 43.30  ? 336  VAL A CB    1 
ATOM   5335 C  CG1   . VAL B 1 337 ? 103.062 4.633   134.563 1.00 50.06  ? 336  VAL A CG1   1 
ATOM   5336 C  CG2   . VAL B 1 337 ? 102.634 5.254   136.974 1.00 34.85  ? 336  VAL A CG2   1 
ATOM   5337 N  N     . THR B 1 338 ? 106.285 4.258   134.731 1.00 40.49  ? 337  THR A N     1 
ATOM   5338 C  CA    . THR B 1 338 ? 106.954 3.685   133.569 1.00 41.74  ? 337  THR A CA    1 
ATOM   5339 C  C     . THR B 1 338 ? 106.116 2.532   133.040 1.00 50.85  ? 337  THR A C     1 
ATOM   5340 O  O     . THR B 1 338 ? 105.764 1.624   133.803 1.00 47.72  ? 337  THR A O     1 
ATOM   5341 C  CB    . THR B 1 338 ? 108.353 3.186   133.932 1.00 49.99  ? 337  THR A CB    1 
ATOM   5342 O  OG1   . THR B 1 338 ? 109.118 4.252   134.513 1.00 42.16  ? 337  THR A OG1   1 
ATOM   5343 C  CG2   . THR B 1 338 ? 109.075 2.645   132.701 1.00 45.44  ? 337  THR A CG2   1 
ATOM   5344 N  N     . LEU B 1 339 ? 105.806 2.552   131.741 1.00 38.29  ? 338  LEU A N     1 
ATOM   5345 C  CA    . LEU B 1 339 ? 104.960 1.494   131.194 1.00 44.92  ? 338  LEU A CA    1 
ATOM   5346 C  C     . LEU B 1 339 ? 105.764 0.217   130.928 1.00 41.66  ? 338  LEU A C     1 
ATOM   5347 O  O     . LEU B 1 339 ? 107.000 0.215   130.914 1.00 41.14  ? 338  LEU A O     1 
ATOM   5348 C  CB    . LEU B 1 339 ? 104.274 1.953   129.901 1.00 46.45  ? 338  LEU A CB    1 
ATOM   5349 C  CG    . LEU B 1 339 ? 103.526 3.286   130.009 1.00 49.29  ? 338  LEU A CG    1 
ATOM   5350 C  CD1   . LEU B 1 339 ? 102.895 3.685   128.670 1.00 50.92  ? 338  LEU A CD1   1 
ATOM   5351 C  CD2   . LEU B 1 339 ? 102.481 3.202   131.107 1.00 45.02  ? 338  LEU A CD2   1 
ATOM   5352 N  N     . LEU B 1 340 ? 105.035 -0.885  130.740 1.00 44.47  ? 339  LEU A N     1 
ATOM   5353 C  CA    . LEU B 1 340 ? 105.612 -2.148  130.292 1.00 51.78  ? 339  LEU A CA    1 
ATOM   5354 C  C     . LEU B 1 340 ? 106.060 -2.032  128.834 1.00 46.32  ? 339  LEU A C     1 
ATOM   5355 O  O     . LEU B 1 340 ? 105.624 -1.144  128.106 1.00 54.70  ? 339  LEU A O     1 
ATOM   5356 C  CB    . LEU B 1 340 ? 104.589 -3.275  130.455 1.00 49.67  ? 339  LEU A CB    1 
ATOM   5357 C  CG    . LEU B 1 340 ? 103.994 -3.444  131.859 1.00 50.67  ? 339  LEU A CG    1 
ATOM   5358 C  CD1   . LEU B 1 340 ? 102.675 -4.200  131.815 1.00 55.91  ? 339  LEU A CD1   1 
ATOM   5359 C  CD2   . LEU B 1 340 ? 104.986 -4.161  132.760 1.00 48.88  ? 339  LEU A CD2   1 
ATOM   5360 N  N     . ASP B 1 341 ? 106.906 -2.982  128.385 1.00 69.83  ? 340  ASP A N     1 
ATOM   5361 C  CA    . ASP B 1 341 ? 107.575 -2.808  127.094 1.00 79.46  ? 340  ASP A CA    1 
ATOM   5362 C  C     . ASP B 1 341 ? 106.659 -3.047  125.892 1.00 86.03  ? 340  ASP A C     1 
ATOM   5363 O  O     . ASP B 1 341 ? 106.561 -2.157  125.029 1.00 83.17  ? 340  ASP A O     1 
ATOM   5364 C  CB    . ASP B 1 341 ? 108.835 -3.676  127.037 1.00 80.34  ? 340  ASP A CB    1 
ATOM   5365 C  CG    . ASP B 1 341 ? 109.628 -3.623  128.321 1.00 83.74  ? 340  ASP A CG    1 
ATOM   5366 O  OD1   . ASP B 1 341 ? 109.124 -3.044  129.308 1.00 82.78  ? 340  ASP A OD1   1 
ATOM   5367 O  OD2   . ASP B 1 341 ? 110.752 -4.168  128.342 1.00 85.88  ? 340  ASP A OD2   1 
ATOM   5368 N  N     . PRO B 1 342 ? 106.011 -4.219  125.731 1.00 99.36  ? 341  PRO A N     1 
ATOM   5369 C  CA    . PRO B 1 342 ? 105.156 -4.262  124.534 1.00 100.51 ? 341  PRO A CA    1 
ATOM   5370 C  C     . PRO B 1 342 ? 103.681 -3.981  124.828 1.00 99.51  ? 341  PRO A C     1 
ATOM   5371 O  O     . PRO B 1 342 ? 102.815 -4.612  124.213 1.00 90.26  ? 341  PRO A O     1 
ATOM   5372 C  CB    . PRO B 1 342 ? 105.332 -5.705  124.024 1.00 96.89  ? 341  PRO A CB    1 
ATOM   5373 C  CG    . PRO B 1 342 ? 106.357 -6.357  124.945 1.00 99.33  ? 341  PRO A CG    1 
ATOM   5374 C  CD    . PRO B 1 342 ? 106.277 -5.579  126.223 1.00 106.91 ? 341  PRO A CD    1 
ATOM   5375 O  "O5'" . DT  C 2 1   ? 98.011  37.222  167.528 1.00 67.12  ? 837  DT  G "O5'" 1 
ATOM   5376 C  "C5'" . DT  C 2 1   ? 97.375  36.161  166.821 1.00 63.23  ? 837  DT  G "C5'" 1 
ATOM   5377 C  "C4'" . DT  C 2 1   ? 97.683  34.825  167.478 1.00 67.96  ? 837  DT  G "C4'" 1 
ATOM   5378 O  "O4'" . DT  C 2 1   ? 96.826  33.791  166.926 1.00 59.86  ? 837  DT  G "O4'" 1 
ATOM   5379 C  "C3'" . DT  C 2 1   ? 99.120  34.334  167.292 1.00 68.20  ? 837  DT  G "C3'" 1 
ATOM   5380 O  "O3'" . DT  C 2 1   ? 99.591  33.794  168.501 1.00 64.46  ? 837  DT  G "O3'" 1 
ATOM   5381 C  "C2'" . DT  C 2 1   ? 98.990  33.264  166.209 1.00 65.26  ? 837  DT  G "C2'" 1 
ATOM   5382 C  "C1'" . DT  C 2 1   ? 97.615  32.699  166.512 1.00 65.57  ? 837  DT  G "C1'" 1 
ATOM   5383 N  N1    . DT  C 2 1   ? 96.957  32.063  165.341 1.00 74.24  ? 837  DT  G N1    1 
ATOM   5384 C  C2    . DT  C 2 1   ? 96.444  30.796  165.480 1.00 75.51  ? 837  DT  G C2    1 
ATOM   5385 O  O2    . DT  C 2 1   ? 96.508  30.170  166.516 1.00 74.94  ? 837  DT  G O2    1 
ATOM   5386 N  N3    . DT  C 2 1   ? 95.851  30.287  164.354 1.00 79.46  ? 837  DT  G N3    1 
ATOM   5387 C  C4    . DT  C 2 1   ? 95.722  30.912  163.124 1.00 85.48  ? 837  DT  G C4    1 
ATOM   5388 O  O4    . DT  C 2 1   ? 95.173  30.371  162.168 1.00 88.05  ? 837  DT  G O4    1 
ATOM   5389 C  C5    . DT  C 2 1   ? 96.283  32.247  163.045 1.00 81.96  ? 837  DT  G C5    1 
ATOM   5390 C  C7    . DT  C 2 1   ? 96.203  33.027  161.764 1.00 81.34  ? 837  DT  G C7    1 
ATOM   5391 C  C6    . DT  C 2 1   ? 96.867  32.752  164.147 1.00 73.89  ? 837  DT  G C6    1 
ATOM   5392 P  P     . DC  C 2 2   ? 101.123 33.342  168.641 1.00 60.90  ? 838  DC  G P     1 
ATOM   5393 O  OP1   . DC  C 2 2   ? 101.416 33.323  170.090 1.00 62.74  ? 838  DC  G OP1   1 
ATOM   5394 O  OP2   . DC  C 2 2   ? 101.969 34.124  167.710 1.00 50.78  ? 838  DC  G OP2   1 
ATOM   5395 O  "O5'" . DC  C 2 2   ? 101.126 31.845  168.095 1.00 59.26  ? 838  DC  G "O5'" 1 
ATOM   5396 C  "C5'" . DC  C 2 2   ? 100.463 30.827  168.824 1.00 58.84  ? 838  DC  G "C5'" 1 
ATOM   5397 C  "C4'" . DC  C 2 2   ? 100.649 29.489  168.145 1.00 57.07  ? 838  DC  G "C4'" 1 
ATOM   5398 O  "O4'" . DC  C 2 2   ? 99.881  29.466  166.921 1.00 54.50  ? 838  DC  G "O4'" 1 
ATOM   5399 C  "C3'" . DC  C 2 2   ? 102.087 29.153  167.732 1.00 58.92  ? 838  DC  G "C3'" 1 
ATOM   5400 O  "O3'" . DC  C 2 2   ? 102.312 27.766  167.957 1.00 39.98  ? 838  DC  G "O3'" 1 
ATOM   5401 C  "C2'" . DC  C 2 2   ? 102.080 29.470  166.230 1.00 51.66  ? 838  DC  G "C2'" 1 
ATOM   5402 C  "C1'" . DC  C 2 2   ? 100.691 28.959  165.892 1.00 57.24  ? 838  DC  G "C1'" 1 
ATOM   5403 N  N1    . DC  C 2 2   ? 100.123 29.405  164.570 1.00 76.79  ? 838  DC  G N1    1 
ATOM   5404 C  C2    . DC  C 2 2   ? 99.165  28.594  163.917 1.00 74.46  ? 838  DC  G C2    1 
ATOM   5405 O  O2    . DC  C 2 2   ? 98.818  27.521  164.437 1.00 59.70  ? 838  DC  G O2    1 
ATOM   5406 N  N3    . DC  C 2 2   ? 98.649  29.010  162.730 1.00 76.51  ? 838  DC  G N3    1 
ATOM   5407 C  C4    . DC  C 2 2   ? 99.047  30.170  162.199 1.00 75.40  ? 838  DC  G C4    1 
ATOM   5408 N  N4    . DC  C 2 2   ? 98.512  30.537  161.026 1.00 72.21  ? 838  DC  G N4    1 
ATOM   5409 C  C5    . DC  C 2 2   ? 100.013 31.007  162.848 1.00 73.85  ? 838  DC  G C5    1 
ATOM   5410 C  C6    . DC  C 2 2   ? 100.516 30.593  164.020 1.00 76.78  ? 838  DC  G C6    1 
ATOM   5411 P  P     . DT  C 2 3   ? 102.891 27.221  169.361 1.00 42.27  ? 839  DT  G P     1 
ATOM   5412 O  OP1   . DT  C 2 3   ? 103.126 28.307  170.339 1.00 49.21  ? 839  DT  G OP1   1 
ATOM   5413 O  OP2   . DT  C 2 3   ? 103.989 26.313  168.971 1.00 41.26  ? 839  DT  G OP2   1 
ATOM   5414 O  "O5'" . DT  C 2 3   ? 101.681 26.411  169.943 1.00 48.82  ? 839  DT  G "O5'" 1 
ATOM   5415 C  "C5'" . DT  C 2 3   ? 101.385 25.257  169.381 1.00 51.21  ? 839  DT  G "C5'" 1 
ATOM   5416 C  "C4'" . DT  C 2 3   ? 99.917  25.125  169.113 1.00 37.86  ? 839  DT  G "C4'" 1 
ATOM   5417 O  "O4'" . DT  C 2 3   ? 99.547  25.949  167.979 1.00 37.43  ? 839  DT  G "O4'" 1 
ATOM   5418 C  "C3'" . DT  C 2 3   ? 99.589  23.717  168.723 1.00 38.34  ? 839  DT  G "C3'" 1 
ATOM   5419 O  "O3'" . DT  C 2 3   ? 99.196  23.035  169.869 1.00 36.57  ? 839  DT  G "O3'" 1 
ATOM   5420 C  "C2'" . DT  C 2 3   ? 98.465  23.885  167.722 1.00 37.05  ? 839  DT  G "C2'" 1 
ATOM   5421 C  "C1'" . DT  C 2 3   ? 98.923  25.144  166.999 1.00 36.56  ? 839  DT  G "C1'" 1 
ATOM   5422 N  N1    . DT  C 2 3   ? 99.903  24.903  165.903 1.00 44.32  ? 839  DT  G N1    1 
ATOM   5423 C  C2    . DT  C 2 3   ? 99.507  24.208  164.788 1.00 51.35  ? 839  DT  G C2    1 
ATOM   5424 O  O2    . DT  C 2 3   ? 98.392  23.753  164.648 1.00 50.73  ? 839  DT  G O2    1 
ATOM   5425 N  N3    . DT  C 2 3   ? 100.476 24.062  163.830 1.00 57.16  ? 839  DT  G N3    1 
ATOM   5426 C  C4    . DT  C 2 3   ? 101.774 24.535  163.870 1.00 61.31  ? 839  DT  G C4    1 
ATOM   5427 O  O4    . DT  C 2 3   ? 102.567 24.348  162.953 1.00 54.48  ? 839  DT  G O4    1 
ATOM   5428 C  C5    . DT  C 2 3   ? 102.129 25.265  165.066 1.00 61.83  ? 839  DT  G C5    1 
ATOM   5429 C  C7    . DT  C 2 3   ? 103.518 25.824  165.228 1.00 55.67  ? 839  DT  G C7    1 
ATOM   5430 C  C6    . DT  C 2 3   ? 101.188 25.416  166.010 1.00 53.80  ? 839  DT  G C6    1 
ATOM   5431 P  P     . DA  C 2 4   ? 99.679  21.534  170.098 1.00 37.04  ? 840  DA  G P     1 
ATOM   5432 O  OP1   . DA  C 2 4   ? 101.168 21.499  170.077 1.00 33.97  ? 840  DA  G OP1   1 
ATOM   5433 O  OP2   . DA  C 2 4   ? 98.944  20.689  169.135 1.00 37.40  ? 840  DA  G OP2   1 
ATOM   5434 O  "O5'" . DA  C 2 4   ? 99.137  21.243  171.550 1.00 34.63  ? 840  DA  G "O5'" 1 
ATOM   5435 C  "C5'" . DA  C 2 4   ? 99.599  22.005  172.622 1.00 36.45  ? 840  DA  G "C5'" 1 
ATOM   5436 C  "C4'" . DA  C 2 4   ? 99.378  21.265  173.913 1.00 35.24  ? 840  DA  G "C4'" 1 
ATOM   5437 O  "O4'" . DA  C 2 4   ? 97.960  21.145  174.188 1.00 34.48  ? 840  DA  G "O4'" 1 
ATOM   5438 C  "C3'" . DA  C 2 4   ? 99.935  19.859  173.943 1.00 28.29  ? 840  DA  G "C3'" 1 
ATOM   5439 O  "O3'" . DA  C 2 4   ? 100.439 19.623  175.234 1.00 31.03  ? 840  DA  G "O3'" 1 
ATOM   5440 C  "C2'" . DA  C 2 4   ? 98.722  18.960  173.619 1.00 24.89  ? 840  DA  G "C2'" 1 
ATOM   5441 C  "C1'" . DA  C 2 4   ? 97.536  19.790  174.101 1.00 33.59  ? 840  DA  G "C1'" 1 
ATOM   5442 N  N9    . DA  C 2 4   ? 96.388  19.763  173.201 1.00 36.13  ? 840  DA  G N9    1 
ATOM   5443 C  C8    . DA  C 2 4   ? 96.396  19.849  171.841 1.00 36.85  ? 840  DA  G C8    1 
ATOM   5444 N  N7    . DA  C 2 4   ? 95.195  19.826  171.307 1.00 31.62  ? 840  DA  G N7    1 
ATOM   5445 C  C5    . DA  C 2 4   ? 94.353  19.740  172.396 1.00 26.89  ? 840  DA  G C5    1 
ATOM   5446 C  C6    . DA  C 2 4   ? 92.945  19.699  172.512 1.00 24.03  ? 840  DA  G C6    1 
ATOM   5447 N  N6    . DA  C 2 4   ? 92.104  19.730  171.460 1.00 22.77  ? 840  DA  G N6    1 
ATOM   5448 N  N1    . DA  C 2 4   ? 92.435  19.616  173.752 1.00 25.30  ? 840  DA  G N1    1 
ATOM   5449 C  C2    . DA  C 2 4   ? 93.263  19.591  174.794 1.00 31.92  ? 840  DA  G C2    1 
ATOM   5450 N  N3    . DA  C 2 4   ? 94.592  19.630  174.809 1.00 31.44  ? 840  DA  G N3    1 
ATOM   5451 C  C4    . DA  C 2 4   ? 95.074  19.713  173.566 1.00 27.48  ? 840  DA  G C4    1 
ATOM   5452 P  P     . DG  C 2 5   ? 101.209 18.267  175.581 1.00 29.85  ? 841  DG  G P     1 
ATOM   5453 O  OP1   . DG  C 2 5   ? 102.077 18.642  176.723 1.00 34.12  ? 841  DG  G OP1   1 
ATOM   5454 O  OP2   . DG  C 2 5   ? 101.753 17.678  174.344 1.00 27.53  ? 841  DG  G OP2   1 
ATOM   5455 O  "O5'" . DG  C 2 5   ? 100.048 17.319  176.080 1.00 30.30  ? 841  DG  G "O5'" 1 
ATOM   5456 C  "C5'" . DG  C 2 5   ? 99.400  17.558  177.285 1.00 30.69  ? 841  DG  G "C5'" 1 
ATOM   5457 C  "C4'" . DG  C 2 5   ? 98.356  16.504  177.470 1.00 27.03  ? 841  DG  G "C4'" 1 
ATOM   5458 O  "O4'" . DG  C 2 5   ? 97.259  16.741  176.546 1.00 30.58  ? 841  DG  G "O4'" 1 
ATOM   5459 C  "C3'" . DG  C 2 5   ? 98.864  15.081  177.177 1.00 23.19  ? 841  DG  G "C3'" 1 
ATOM   5460 O  "O3'" . DG  C 2 5   ? 98.373  14.231  178.195 1.00 27.52  ? 841  DG  G "O3'" 1 
ATOM   5461 C  "C2'" . DG  C 2 5   ? 98.241  14.747  175.821 1.00 28.16  ? 841  DG  G "C2'" 1 
ATOM   5462 C  "C1'" . DG  C 2 5   ? 96.931  15.525  175.917 1.00 24.00  ? 841  DG  G "C1'" 1 
ATOM   5463 N  N9    . DG  C 2 5   ? 96.300  15.796  174.643 1.00 26.80  ? 841  DG  G N9    1 
ATOM   5464 C  C8    . DG  C 2 5   ? 96.899  15.980  173.413 1.00 27.39  ? 841  DG  G C8    1 
ATOM   5465 N  N7    . DG  C 2 5   ? 96.035  16.219  172.452 1.00 24.38  ? 841  DG  G N7    1 
ATOM   5466 C  C5    . DG  C 2 5   ? 94.793  16.175  173.096 1.00 26.73  ? 841  DG  G C5    1 
ATOM   5467 C  C6    . DG  C 2 5   ? 93.473  16.341  172.587 1.00 26.96  ? 841  DG  G C6    1 
ATOM   5468 O  O6    . DG  C 2 5   ? 93.113  16.571  171.424 1.00 26.08  ? 841  DG  G O6    1 
ATOM   5469 N  N1    . DG  C 2 5   ? 92.516  16.210  173.595 1.00 25.89  ? 841  DG  G N1    1 
ATOM   5470 C  C2    . DG  C 2 5   ? 92.791  15.979  174.908 1.00 30.79  ? 841  DG  G C2    1 
ATOM   5471 N  N2    . DG  C 2 5   ? 91.743  15.901  175.729 1.00 26.79  ? 841  DG  G N2    1 
ATOM   5472 N  N3    . DG  C 2 5   ? 94.006  15.822  175.391 1.00 32.94  ? 841  DG  G N3    1 
ATOM   5473 C  C4    . DG  C 2 5   ? 94.950  15.928  174.436 1.00 30.74  ? 841  DG  G C4    1 
ATOM   5474 P  P     . DG  C 2 6   ? 98.841  12.700  178.329 1.00 28.48  ? 842  DG  G P     1 
ATOM   5475 O  OP1   . DG  C 2 6   ? 99.220  12.573  179.734 1.00 29.74  ? 842  DG  G OP1   1 
ATOM   5476 O  OP2   . DG  C 2 6   ? 99.722  12.278  177.257 1.00 31.74  ? 842  DG  G OP2   1 
ATOM   5477 O  "O5'" . DG  C 2 6   ? 97.474  11.903  178.138 1.00 27.83  ? 842  DG  G "O5'" 1 
ATOM   5478 C  "C5'" . DG  C 2 6   ? 96.548  11.914  179.175 1.00 29.21  ? 842  DG  G "C5'" 1 
ATOM   5479 C  "C4'" . DG  C 2 6   ? 95.151  11.640  178.671 1.00 33.06  ? 842  DG  G "C4'" 1 
ATOM   5480 O  "O4'" . DG  C 2 6   ? 94.771  12.652  177.720 1.00 37.31  ? 842  DG  G "O4'" 1 
ATOM   5481 C  "C3'" . DG  C 2 6   ? 94.970  10.341  177.905 1.00 31.31  ? 842  DG  G "C3'" 1 
ATOM   5482 O  "O3'" . DG  C 2 6   ? 94.770  9.281   178.810 1.00 29.61  ? 842  DG  G "O3'" 1 
ATOM   5483 C  "C2'" . DG  C 2 6   ? 93.666  10.621  177.171 1.00 37.33  ? 842  DG  G "C2'" 1 
ATOM   5484 C  "C1'" . DG  C 2 6   ? 93.775  12.110  176.872 1.00 32.79  ? 842  DG  G "C1'" 1 
ATOM   5485 N  N9    . DG  C 2 6   ? 94.084  12.388  175.471 1.00 33.77  ? 842  DG  G N9    1 
ATOM   5486 C  C8    . DG  C 2 6   ? 95.308  12.573  174.874 1.00 28.65  ? 842  DG  G C8    1 
ATOM   5487 N  N7    . DG  C 2 6   ? 95.217  12.796  173.585 1.00 28.06  ? 842  DG  G N7    1 
ATOM   5488 C  C5    . DG  C 2 6   ? 93.856  12.737  173.330 1.00 25.10  ? 842  DG  G C5    1 
ATOM   5489 C  C6    . DG  C 2 6   ? 93.120  12.914  172.122 1.00 29.91  ? 842  DG  G C6    1 
ATOM   5490 O  O6    . DG  C 2 6   ? 93.543  13.170  170.980 1.00 29.62  ? 842  DG  G O6    1 
ATOM   5491 N  N1    . DG  C 2 6   ? 91.754  12.759  172.330 1.00 26.35  ? 842  DG  G N1    1 
ATOM   5492 C  C2    . DG  C 2 6   ? 91.160  12.508  173.536 1.00 26.79  ? 842  DG  G C2    1 
ATOM   5493 N  N2    . DG  C 2 6   ? 89.815  12.411  173.544 1.00 27.59  ? 842  DG  G N2    1 
ATOM   5494 N  N3    . DG  C 2 6   ? 91.824  12.354  174.657 1.00 31.63  ? 842  DG  G N3    1 
ATOM   5495 C  C4    . DG  C 2 6   ? 93.158  12.496  174.482 1.00 33.01  ? 842  DG  G C4    1 
ATOM   5496 P  P     . DG  C 2 7   ? 95.063  7.760   178.387 1.00 29.87  ? 843  DG  G P     1 
ATOM   5497 O  OP1   . DG  C 2 7   ? 94.937  7.014   179.641 1.00 30.90  ? 843  DG  G OP1   1 
ATOM   5498 O  OP2   . DG  C 2 7   ? 96.300  7.647   177.601 1.00 27.05  ? 843  DG  G OP2   1 
ATOM   5499 O  "O5'" . DG  C 2 7   ? 93.782  7.333   177.543 1.00 34.52  ? 843  DG  G "O5'" 1 
ATOM   5500 C  "C5'" . DG  C 2 7   ? 93.893  6.750   176.273 1.00 32.25  ? 843  DG  G "C5'" 1 
ATOM   5501 C  "C4'" . DG  C 2 7   ? 92.661  7.128   175.487 1.00 31.05  ? 843  DG  G "C4'" 1 
ATOM   5502 O  "O4'" . DG  C 2 7   ? 92.838  8.439   174.935 1.00 33.23  ? 843  DG  G "O4'" 1 
ATOM   5503 C  "C3'" . DG  C 2 7   ? 92.328  6.250   174.307 1.00 22.83  ? 843  DG  G "C3'" 1 
ATOM   5504 O  "O3'" . DG  C 2 7   ? 91.604  5.144   174.778 1.00 25.02  ? 843  DG  G "O3'" 1 
ATOM   5505 C  "C2'" . DG  C 2 7   ? 91.425  7.188   173.485 1.00 24.31  ? 843  DG  G "C2'" 1 
ATOM   5506 C  "C1'" . DG  C 2 7   ? 92.046  8.571   173.770 1.00 22.01  ? 843  DG  G "C1'" 1 
ATOM   5507 N  N9    . DG  C 2 7   ? 92.885  9.083   172.679 1.00 29.16  ? 843  DG  G N9    1 
ATOM   5508 C  C8    . DG  C 2 7   ? 94.245  9.276   172.677 1.00 31.14  ? 843  DG  G C8    1 
ATOM   5509 N  N7    . DG  C 2 7   ? 94.701  9.744   171.549 1.00 30.77  ? 843  DG  G N7    1 
ATOM   5510 C  C5    . DG  C 2 7   ? 93.565  9.864   170.756 1.00 29.04  ? 843  DG  G C5    1 
ATOM   5511 C  C6    . DG  C 2 7   ? 93.422  10.333  169.432 1.00 25.97  ? 843  DG  G C6    1 
ATOM   5512 O  O6    . DG  C 2 7   ? 94.299  10.736  168.673 1.00 30.02  ? 843  DG  G O6    1 
ATOM   5513 N  N1    . DG  C 2 7   ? 92.084  10.304  169.011 1.00 24.22  ? 843  DG  G N1    1 
ATOM   5514 C  C2    . DG  C 2 7   ? 91.037  9.849   169.785 1.00 25.08  ? 843  DG  G C2    1 
ATOM   5515 N  N2    . DG  C 2 7   ? 89.811  9.875   169.235 1.00 23.64  ? 843  DG  G N2    1 
ATOM   5516 N  N3    . DG  C 2 7   ? 91.175  9.430   171.029 1.00 23.88  ? 843  DG  G N3    1 
ATOM   5517 C  C4    . DG  C 2 7   ? 92.452  9.461   171.439 1.00 27.01  ? 843  DG  G C4    1 
ATOM   5518 P  P     . DT  C 2 8   ? 91.463  3.810   173.886 1.00 28.31  ? 844  DT  G P     1 
ATOM   5519 O  OP1   . DT  C 2 8   ? 90.782  2.828   174.755 1.00 29.45  ? 844  DT  G OP1   1 
ATOM   5520 O  OP2   . DT  C 2 8   ? 92.813  3.530   173.317 1.00 30.00  ? 844  DT  G OP2   1 
ATOM   5521 O  "O5'" . DT  C 2 8   ? 90.459  4.216   172.722 1.00 28.48  ? 844  DT  G "O5'" 1 
ATOM   5522 C  "C5'" . DT  C 2 8   ? 89.121  4.633   173.028 1.00 30.24  ? 844  DT  G "C5'" 1 
ATOM   5523 C  "C4'" . DT  C 2 8   ? 88.299  4.738   171.760 1.00 29.40  ? 844  DT  G "C4'" 1 
ATOM   5524 O  "O4'" . DT  C 2 8   ? 88.774  5.855   170.953 1.00 32.50  ? 844  DT  G "O4'" 1 
ATOM   5525 C  "C3'" . DT  C 2 8   ? 88.369  3.487   170.881 1.00 37.71  ? 844  DT  G "C3'" 1 
ATOM   5526 O  "O3'" . DT  C 2 8   ? 87.074  3.042   170.490 1.00 46.62  ? 844  DT  G "O3'" 1 
ATOM   5527 C  "C2'" . DT  C 2 8   ? 89.193  3.906   169.679 1.00 38.11  ? 844  DT  G "C2'" 1 
ATOM   5528 C  "C1'" . DT  C 2 8   ? 89.053  5.419   169.640 1.00 38.19  ? 844  DT  G "C1'" 1 
ATOM   5529 N  N1    . DT  C 2 8   ? 90.296  6.019   169.207 1.00 31.82  ? 844  DT  G N1    1 
ATOM   5530 C  C2    . DT  C 2 8   ? 90.345  6.651   167.999 1.00 33.38  ? 844  DT  G C2    1 
ATOM   5531 O  O2    . DT  C 2 8   ? 89.368  6.807   167.285 1.00 27.24  ? 844  DT  G O2    1 
ATOM   5532 N  N3    . DT  C 2 8   ? 91.578  7.134   167.667 1.00 25.79  ? 844  DT  G N3    1 
ATOM   5533 C  C4    . DT  C 2 8   ? 92.753  7.022   168.392 1.00 23.76  ? 844  DT  G C4    1 
ATOM   5534 O  O4    . DT  C 2 8   ? 93.812  7.516   168.006 1.00 23.65  ? 844  DT  G O4    1 
ATOM   5535 C  C5    . DT  C 2 8   ? 92.636  6.312   169.641 1.00 28.58  ? 844  DT  G C5    1 
ATOM   5536 C  C7    . DT  C 2 8   ? 93.836  6.123   170.521 1.00 29.05  ? 844  DT  G C7    1 
ATOM   5537 C  C6    . DT  C 2 8   ? 91.432  5.837   169.975 1.00 29.28  ? 844  DT  G C6    1 
ATOM   5538 P  P     . DC  C 2 9   ? 86.938  1.628   169.732 1.00 50.75  ? 845  DC  G P     1 
ATOM   5539 O  OP1   . DC  C 2 9   ? 85.550  1.172   169.886 1.00 54.77  ? 845  DC  G OP1   1 
ATOM   5540 O  OP2   . DC  C 2 9   ? 88.093  0.803   170.153 1.00 51.62  ? 845  DC  G OP2   1 
ATOM   5541 O  "O5'" . DC  C 2 9   ? 87.144  1.991   168.188 1.00 44.36  ? 845  DC  G "O5'" 1 
ATOM   5542 C  "C5'" . DC  C 2 9   ? 86.176  2.814   167.528 1.00 39.69  ? 845  DC  G "C5'" 1 
ATOM   5543 C  "C4'" . DC  C 2 9   ? 86.633  3.154   166.123 1.00 37.53  ? 845  DC  G "C4'" 1 
ATOM   5544 O  "O4'" . DC  C 2 9   ? 87.854  3.915   166.183 1.00 33.96  ? 845  DC  G "O4'" 1 
ATOM   5545 C  "C3'" . DC  C 2 9   ? 86.932  1.933   165.249 1.00 42.18  ? 845  DC  G "C3'" 1 
ATOM   5546 O  "O3'" . DC  C 2 9   ? 86.108  1.935   164.116 1.00 39.19  ? 845  DC  G "O3'" 1 
ATOM   5547 C  "C2'" . DC  C 2 9   ? 88.399  2.065   164.861 1.00 33.33  ? 845  DC  G "C2'" 1 
ATOM   5548 C  "C1'" . DC  C 2 9   ? 88.679  3.544   165.102 1.00 32.26  ? 845  DC  G "C1'" 1 
ATOM   5549 N  N1    . DC  C 2 9   ? 90.099  3.799   165.476 1.00 31.91  ? 845  DC  G N1    1 
ATOM   5550 C  C2    . DC  C 2 9   ? 90.888  4.649   164.680 1.00 33.32  ? 845  DC  G C2    1 
ATOM   5551 O  O2    . DC  C 2 9   ? 90.378  5.203   163.692 1.00 35.34  ? 845  DC  G O2    1 
ATOM   5552 N  N3    . DC  C 2 9   ? 92.181  4.868   165.032 1.00 36.15  ? 845  DC  G N3    1 
ATOM   5553 C  C4    . DC  C 2 9   ? 92.688  4.260   166.112 1.00 30.43  ? 845  DC  G C4    1 
ATOM   5554 N  N4    . DC  C 2 9   ? 93.969  4.496   166.416 1.00 32.29  ? 845  DC  G N4    1 
ATOM   5555 C  C5    . DC  C 2 9   ? 91.908  3.385   166.923 1.00 26.72  ? 845  DC  G C5    1 
ATOM   5556 C  C6    . DC  C 2 9   ? 90.626  3.173   166.566 1.00 26.54  ? 845  DC  G C6    1 
ATOM   5557 P  P     . DC  C 2 10  ? 86.127  0.667   163.135 1.00 48.31  ? 846  DC  G P     1 
ATOM   5558 O  OP1   . DC  C 2 10  ? 84.721  0.545   162.708 1.00 45.89  ? 846  DC  G OP1   1 
ATOM   5559 O  OP2   . DC  C 2 10  ? 86.875  -0.465  163.729 1.00 48.85  ? 846  DC  G OP2   1 
ATOM   5560 O  "O5'" . DC  C 2 10  ? 87.017  1.172   161.914 1.00 45.31  ? 846  DC  G "O5'" 1 
ATOM   5561 C  "C5'" . DC  C 2 10  ? 86.676  2.409   161.293 1.00 37.34  ? 846  DC  G "C5'" 1 
ATOM   5562 C  "C4'" . DC  C 2 10  ? 87.702  2.760   160.254 1.00 39.15  ? 846  DC  G "C4'" 1 
ATOM   5563 O  "O4'" . DC  C 2 10  ? 88.919  3.152   160.915 1.00 40.48  ? 846  DC  G "O4'" 1 
ATOM   5564 C  "C3'" . DC  C 2 10  ? 88.057  1.605   159.324 1.00 37.97  ? 846  DC  G "C3'" 1 
ATOM   5565 O  "O3'" . DC  C 2 10  ? 87.845  1.984   157.997 1.00 46.23  ? 846  DC  G "O3'" 1 
ATOM   5566 C  "C2'" . DC  C 2 10  ? 89.531  1.307   159.611 1.00 35.29  ? 846  DC  G "C2'" 1 
ATOM   5567 C  "C1'" . DC  C 2 10  ? 90.024  2.601   160.245 1.00 35.68  ? 846  DC  G "C1'" 1 
ATOM   5568 N  N1    . DC  C 2 10  ? 91.110  2.407   161.255 1.00 31.17  ? 846  DC  G N1    1 
ATOM   5569 C  C2    . DC  C 2 10  ? 92.342  3.024   161.069 1.00 28.53  ? 846  DC  G C2    1 
ATOM   5570 O  O2    . DC  C 2 10  ? 92.530  3.695   160.049 1.00 32.72  ? 846  DC  G O2    1 
ATOM   5571 N  N3    . DC  C 2 10  ? 93.317  2.859   162.008 1.00 36.27  ? 846  DC  G N3    1 
ATOM   5572 C  C4    . DC  C 2 10  ? 93.085  2.127   163.094 1.00 27.48  ? 846  DC  G C4    1 
ATOM   5573 N  N4    . DC  C 2 10  ? 94.080  2.000   163.989 1.00 30.76  ? 846  DC  G N4    1 
ATOM   5574 C  C5    . DC  C 2 10  ? 91.826  1.490   163.310 1.00 30.68  ? 846  DC  G C5    1 
ATOM   5575 C  C6    . DC  C 2 10  ? 90.870  1.664   162.379 1.00 32.48  ? 846  DC  G C6    1 
ATOM   5576 P  P     . DT  C 2 11  ? 88.061  0.920   156.819 1.00 46.15  ? 847  DT  G P     1 
ATOM   5577 O  OP1   . DT  C 2 11  ? 87.103  1.276   155.756 1.00 44.89  ? 847  DT  G OP1   1 
ATOM   5578 O  OP2   . DT  C 2 11  ? 88.097  -0.447  157.400 1.00 46.93  ? 847  DT  G OP2   1 
ATOM   5579 O  "O5'" . DT  C 2 11  ? 89.542  1.200   156.307 1.00 41.61  ? 847  DT  G "O5'" 1 
ATOM   5580 C  "C5'" . DT  C 2 11  ? 89.912  2.500   155.897 1.00 40.52  ? 847  DT  G "C5'" 1 
ATOM   5581 C  "C4'" . DT  C 2 11  ? 91.374  2.533   155.525 1.00 42.53  ? 847  DT  G "C4'" 1 
ATOM   5582 O  "O4'" . DT  C 2 11  ? 92.176  2.463   156.726 1.00 45.85  ? 847  DT  G "O4'" 1 
ATOM   5583 C  "C3'" . DT  C 2 11  ? 91.841  1.385   154.620 1.00 40.17  ? 847  DT  G "C3'" 1 
ATOM   5584 O  "O3'" . DT  C 2 11  ? 92.426  1.919   153.457 1.00 57.35  ? 847  DT  G "O3'" 1 
ATOM   5585 C  "C2'" . DT  C 2 11  ? 92.873  0.627   155.471 1.00 39.32  ? 847  DT  G "C2'" 1 
ATOM   5586 C  "C1'" . DT  C 2 11  ? 93.315  1.683   156.478 1.00 43.17  ? 847  DT  G "C1'" 1 
ATOM   5587 N  N1    . DT  C 2 11  ? 93.736  1.134   157.786 1.00 41.55  ? 847  DT  G N1    1 
ATOM   5588 C  C2    . DT  C 2 11  ? 94.959  1.491   158.311 1.00 47.13  ? 847  DT  G C2    1 
ATOM   5589 O  O2    . DT  C 2 11  ? 95.753  2.216   157.735 1.00 49.01  ? 847  DT  G O2    1 
ATOM   5590 N  N3    . DT  C 2 11  ? 95.229  0.957   159.536 1.00 43.67  ? 847  DT  G N3    1 
ATOM   5591 C  C4    . DT  C 2 11  ? 94.418  0.135   160.280 1.00 38.05  ? 847  DT  G C4    1 
ATOM   5592 O  O4    . DT  C 2 11  ? 94.752  -0.273  161.375 1.00 37.10  ? 847  DT  G O4    1 
ATOM   5593 C  C5    . DT  C 2 11  ? 93.142  -0.194  159.678 1.00 34.81  ? 847  DT  G C5    1 
ATOM   5594 C  C7    . DT  C 2 11  ? 92.167  -1.079  160.397 1.00 40.25  ? 847  DT  G C7    1 
ATOM   5595 C  C6    . DT  C 2 11  ? 92.863  0.327   158.479 1.00 38.22  ? 847  DT  G C6    1 
ATOM   5596 P  P     . DA  C 2 12  ? 92.520  1.045   152.113 1.00 60.55  ? 848  DA  G P     1 
ATOM   5597 O  OP1   . DA  C 2 12  ? 92.176  1.942   150.992 1.00 65.07  ? 848  DA  G OP1   1 
ATOM   5598 O  OP2   . DA  C 2 12  ? 91.868  -0.263  152.349 1.00 63.41  ? 848  DA  G OP2   1 
ATOM   5599 O  "O5'" . DA  C 2 12  ? 94.044  0.692   151.978 1.00 55.74  ? 848  DA  G "O5'" 1 
ATOM   5600 C  "C5'" . DA  C 2 12  ? 95.046  1.621   152.337 1.00 47.16  ? 848  DA  G "C5'" 1 
ATOM   5601 C  "C4'" . DA  C 2 12  ? 96.307  0.857   152.601 1.00 47.37  ? 848  DA  G "C4'" 1 
ATOM   5602 O  "O4'" . DA  C 2 12  ? 96.386  0.543   154.019 1.00 53.73  ? 848  DA  G "O4'" 1 
ATOM   5603 C  "C3'" . DA  C 2 12  ? 96.341  -0.489  151.866 1.00 57.79  ? 848  DA  G "C3'" 1 
ATOM   5604 O  "O3'" . DA  C 2 12  ? 97.587  -0.693  151.269 1.00 57.51  ? 848  DA  G "O3'" 1 
ATOM   5605 C  "C2'" . DA  C 2 12  ? 96.082  -1.508  152.969 1.00 62.34  ? 848  DA  G "C2'" 1 
ATOM   5606 C  "C1'" . DA  C 2 12  ? 96.720  -0.815  154.155 1.00 59.14  ? 848  DA  G "C1'" 1 
ATOM   5607 N  N9    . DA  C 2 12  ? 96.252  -1.331  155.436 1.00 47.96  ? 848  DA  G N9    1 
ATOM   5608 C  C8    . DA  C 2 12  ? 95.063  -1.945  155.691 1.00 51.85  ? 848  DA  G C8    1 
ATOM   5609 N  N7    . DA  C 2 12  ? 94.933  -2.349  156.932 1.00 56.08  ? 848  DA  G N7    1 
ATOM   5610 C  C5    . DA  C 2 12  ? 96.134  -1.997  157.518 1.00 43.26  ? 848  DA  G C5    1 
ATOM   5611 C  C6    . DA  C 2 12  ? 96.630  -2.156  158.819 1.00 41.43  ? 848  DA  G C6    1 
ATOM   5612 N  N6    . DA  C 2 12  ? 95.935  -2.738  159.802 1.00 43.07  ? 848  DA  G N6    1 
ATOM   5613 N  N1    . DA  C 2 12  ? 97.872  -1.692  159.077 1.00 43.72  ? 848  DA  G N1    1 
ATOM   5614 C  C2    . DA  C 2 12  ? 98.559  -1.116  158.093 1.00 43.01  ? 848  DA  G C2    1 
ATOM   5615 N  N3    . DA  C 2 12  ? 98.195  -0.910  156.831 1.00 51.60  ? 848  DA  G N3    1 
ATOM   5616 C  C4    . DA  C 2 12  ? 96.961  -1.380  156.609 1.00 50.61  ? 848  DA  G C4    1 
ATOM   5617 P  P     . DG  C 2 13  ? 97.736  -1.736  150.056 1.00 56.16  ? 849  DG  G P     1 
ATOM   5618 O  OP1   . DG  C 2 13  ? 97.279  -1.038  148.833 1.00 54.12  ? 849  DG  G OP1   1 
ATOM   5619 O  OP2   . DG  C 2 13  ? 97.124  -3.034  150.440 1.00 66.76  ? 849  DG  G OP2   1 
ATOM   5620 O  "O5'" . DG  C 2 13  ? 99.291  -1.945  149.976 1.00 57.64  ? 849  DG  G "O5'" 1 
ATOM   5621 C  "C5'" . DG  C 2 13  ? 100.137 -0.974  150.554 1.00 61.09  ? 849  DG  G "C5'" 1 
ATOM   5622 C  "C4'" . DG  C 2 13  ? 101.319 -1.644  151.203 1.00 58.62  ? 849  DG  G "C4'" 1 
ATOM   5623 O  "O4'" . DG  C 2 13  ? 101.003 -1.969  152.581 1.00 57.59  ? 849  DG  G "O4'" 1 
ATOM   5624 C  "C3'" . DG  C 2 13  ? 101.725 -2.948  150.544 1.00 58.19  ? 849  DG  G "C3'" 1 
ATOM   5625 O  "O3'" . DG  C 2 13  ? 103.114 -3.060  150.593 1.00 60.00  ? 849  DG  G "O3'" 1 
ATOM   5626 C  "C2'" . DG  C 2 13  ? 101.038 -4.009  151.409 1.00 52.79  ? 849  DG  G "C2'" 1 
ATOM   5627 C  "C1'" . DG  C 2 13  ? 101.104 -3.366  152.787 1.00 58.45  ? 849  DG  G "C1'" 1 
ATOM   5628 N  N9    . DG  C 2 13  ? 100.022 -3.771  153.682 1.00 51.44  ? 849  DG  G N9    1 
ATOM   5629 C  C8    . DG  C 2 13  ? 98.692  -3.914  153.368 1.00 49.22  ? 849  DG  G C8    1 
ATOM   5630 N  N7    . DG  C 2 13  ? 97.954  -4.271  154.385 1.00 55.12  ? 849  DG  G N7    1 
ATOM   5631 C  C5    . DG  C 2 13  ? 98.857  -4.369  155.441 1.00 55.11  ? 849  DG  G C5    1 
ATOM   5632 C  C6    . DG  C 2 13  ? 98.647  -4.723  156.802 1.00 54.78  ? 849  DG  G C6    1 
ATOM   5633 O  O6    . DG  C 2 13  ? 97.583  -5.034  157.367 1.00 49.63  ? 849  DG  G O6    1 
ATOM   5634 N  N1    . DG  C 2 13  ? 99.834  -4.693  157.529 1.00 51.10  ? 849  DG  G N1    1 
ATOM   5635 C  C2    . DG  C 2 13  ? 101.063 -4.365  157.015 1.00 53.87  ? 849  DG  G C2    1 
ATOM   5636 N  N2    . DG  C 2 13  ? 102.088 -4.390  157.873 1.00 51.40  ? 849  DG  G N2    1 
ATOM   5637 N  N3    . DG  C 2 13  ? 101.276 -4.038  155.746 1.00 56.80  ? 849  DG  G N3    1 
ATOM   5638 C  C4    . DG  C 2 13  ? 100.130 -4.059  155.022 1.00 56.00  ? 849  DG  G C4    1 
ATOM   5639 P  P     . DG  C 2 14  ? 103.846 -4.190  149.738 1.00 64.43  ? 850  DG  G P     1 
ATOM   5640 O  OP1   . DG  C 2 14  ? 105.056 -3.561  149.160 1.00 71.88  ? 850  DG  G OP1   1 
ATOM   5641 O  OP2   . DG  C 2 14  ? 102.828 -4.800  148.853 1.00 64.03  ? 850  DG  G OP2   1 
ATOM   5642 O  "O5'" . DG  C 2 14  ? 104.305 -5.258  150.843 1.00 67.01  ? 850  DG  G "O5'" 1 
ATOM   5643 C  "C5'" . DG  C 2 14  ? 105.409 -4.965  151.690 1.00 64.43  ? 850  DG  G "C5'" 1 
ATOM   5644 C  "C4'" . DG  C 2 14  ? 105.481 -5.932  152.862 1.00 59.48  ? 850  DG  G "C4'" 1 
ATOM   5645 O  "O4'" . DG  C 2 14  ? 104.213 -5.949  153.553 1.00 66.24  ? 850  DG  G "O4'" 1 
ATOM   5646 C  "C3'" . DG  C 2 14  ? 105.796 -7.391  152.501 1.00 54.61  ? 850  DG  G "C3'" 1 
ATOM   5647 O  "O3'" . DG  C 2 14  ? 106.922 -7.843  153.269 1.00 54.82  ? 850  DG  G "O3'" 1 
ATOM   5648 C  "C2'" . DG  C 2 14  ? 104.510 -8.143  152.854 1.00 56.16  ? 850  DG  G "C2'" 1 
ATOM   5649 C  "C1'" . DG  C 2 14  ? 103.930 -7.265  153.943 1.00 61.43  ? 850  DG  G "C1'" 1 
ATOM   5650 N  N9    . DG  C 2 14  ? 102.490 -7.380  154.113 1.00 56.61  ? 850  DG  G N9    1 
ATOM   5651 C  C8    . DG  C 2 14  ? 101.515 -7.208  153.156 1.00 55.45  ? 850  DG  G C8    1 
ATOM   5652 N  N7    . DG  C 2 14  ? 100.301 -7.350  153.622 1.00 55.81  ? 850  DG  G N7    1 
ATOM   5653 C  C5    . DG  C 2 14  ? 100.489 -7.625  154.978 1.00 54.06  ? 850  DG  G C5    1 
ATOM   5654 C  C6    . DG  C 2 14  ? 99.544  -7.878  156.001 1.00 43.07  ? 850  DG  G C6    1 
ATOM   5655 O  O6    . DG  C 2 14  ? 98.312  -7.899  155.916 1.00 43.67  ? 850  DG  G O6    1 
ATOM   5656 N  N1    . DG  C 2 14  ? 100.163 -8.108  157.237 1.00 39.59  ? 850  DG  G N1    1 
ATOM   5657 C  C2    . DG  C 2 14  ? 101.523 -8.097  157.448 1.00 52.26  ? 850  DG  G C2    1 
ATOM   5658 N  N2    . DG  C 2 14  ? 101.935 -8.345  158.700 1.00 51.74  ? 850  DG  G N2    1 
ATOM   5659 N  N3    . DG  C 2 14  ? 102.419 -7.875  156.494 1.00 53.22  ? 850  DG  G N3    1 
ATOM   5660 C  C4    . DG  C 2 14  ? 101.830 -7.640  155.292 1.00 58.02  ? 850  DG  G C4    1 
ATOM   5661 P  P     . DA  C 2 15  ? 107.462 -9.355  153.159 1.00 65.00  ? 851  DA  G P     1 
ATOM   5662 O  OP1   . DA  C 2 15  ? 108.948 -9.318  153.145 1.00 74.24  ? 851  DA  G OP1   1 
ATOM   5663 O  OP2   . DA  C 2 15  ? 106.718 -10.081 152.107 1.00 70.52  ? 851  DA  G OP2   1 
ATOM   5664 O  "O5'" . DA  C 2 15  ? 107.045 -10.001 154.546 1.00 48.64  ? 851  DA  G "O5'" 1 
ATOM   5665 C  "C5'" . DA  C 2 15  ? 107.176 -9.261  155.734 1.00 40.91  ? 851  DA  G "C5'" 1 
ATOM   5666 C  "C4'" . DA  C 2 15  ? 106.729 -10.098 156.906 1.00 40.50  ? 851  DA  G "C4'" 1 
ATOM   5667 O  "O4'" . DA  C 2 15  ? 105.282 -10.050 157.018 1.00 45.51  ? 851  DA  G "O4'" 1 
ATOM   5668 C  "C3'" . DA  C 2 15  ? 107.094 -11.565 156.790 1.00 41.86  ? 851  DA  G "C3'" 1 
ATOM   5669 O  "O3'" . DA  C 2 15  ? 107.410 -12.054 158.063 1.00 41.84  ? 851  DA  G "O3'" 1 
ATOM   5670 C  "C2'" . DA  C 2 15  ? 105.821 -12.205 156.217 1.00 42.00  ? 851  DA  G "C2'" 1 
ATOM   5671 C  "C1'" . DA  C 2 15  ? 104.730 -11.341 156.842 1.00 43.92  ? 851  DA  G "C1'" 1 
ATOM   5672 N  N9    . DA  C 2 15  ? 103.539 -11.186 156.011 1.00 49.98  ? 851  DA  G N9    1 
ATOM   5673 C  C8    . DA  C 2 15  ? 103.500 -10.835 154.688 1.00 46.97  ? 851  DA  G C8    1 
ATOM   5674 N  N7    . DA  C 2 15  ? 102.281 -10.733 154.203 1.00 45.36  ? 851  DA  G N7    1 
ATOM   5675 C  C5    . DA  C 2 15  ? 101.465 -11.017 155.292 1.00 42.04  ? 851  DA  G C5    1 
ATOM   5676 C  C6    . DA  C 2 15  ? 100.066 -11.077 155.434 1.00 42.01  ? 851  DA  G C6    1 
ATOM   5677 N  N6    . DA  C 2 15  ? 99.225  -10.829 154.426 1.00 40.78  ? 851  DA  G N6    1 
ATOM   5678 N  N1    . DA  C 2 15  ? 99.564  -11.392 156.658 1.00 41.50  ? 851  DA  G N1    1 
ATOM   5679 C  C2    . DA  C 2 15  ? 100.423 -11.639 157.656 1.00 50.29  ? 851  DA  G C2    1 
ATOM   5680 N  N3    . DA  C 2 15  ? 101.767 -11.609 157.640 1.00 41.85  ? 851  DA  G N3    1 
ATOM   5681 C  C4    . DA  C 2 15  ? 102.224 -11.295 156.415 1.00 42.03  ? 851  DA  G C4    1 
ATOM   5682 P  P     . DC  C 2 16  ? 107.999 -13.536 158.234 1.00 47.09  ? 852  DC  G P     1 
ATOM   5683 O  OP1   . DC  C 2 16  ? 108.694 -13.598 159.535 1.00 56.89  ? 852  DC  G OP1   1 
ATOM   5684 O  OP2   . DC  C 2 16  ? 108.672 -13.952 157.002 1.00 44.64  ? 852  DC  G OP2   1 
ATOM   5685 O  "O5'" . DC  C 2 16  ? 106.689 -14.409 158.366 1.00 51.42  ? 852  DC  G "O5'" 1 
ATOM   5686 C  "C5'" . DC  C 2 16  ? 105.871 -14.243 159.490 1.00 50.81  ? 852  DC  G "C5'" 1 
ATOM   5687 C  "C4'" . DC  C 2 16  ? 104.619 -15.074 159.345 1.00 52.66  ? 852  DC  G "C4'" 1 
ATOM   5688 O  "O4'" . DC  C 2 16  ? 103.776 -14.490 158.333 1.00 52.55  ? 852  DC  G "O4'" 1 
ATOM   5689 C  "C3'" . DC  C 2 16  ? 104.857 -16.521 158.906 1.00 58.13  ? 852  DC  G "C3'" 1 
ATOM   5690 O  "O3'" . DC  C 2 16  ? 104.415 -17.408 159.931 1.00 69.29  ? 852  DC  G "O3'" 1 
ATOM   5691 C  "C2'" . DC  C 2 16  ? 104.036 -16.663 157.609 1.00 56.12  ? 852  DC  G "C2'" 1 
ATOM   5692 C  "C1'" . DC  C 2 16  ? 103.046 -15.523 157.754 1.00 48.98  ? 852  DC  G "C1'" 1 
ATOM   5693 N  N1    . DC  C 2 16  ? 102.454 -15.036 156.482 1.00 44.30  ? 852  DC  G N1    1 
ATOM   5694 C  C2    . DC  C 2 16  ? 101.077 -14.886 156.408 1.00 42.38  ? 852  DC  G C2    1 
ATOM   5695 O  O2    . DC  C 2 16  ? 100.399 -15.158 157.399 1.00 42.01  ? 852  DC  G O2    1 
ATOM   5696 N  N3    . DC  C 2 16  ? 100.524 -14.441 155.263 1.00 42.42  ? 852  DC  G N3    1 
ATOM   5697 C  C4    . DC  C 2 16  ? 101.289 -14.150 154.219 1.00 49.28  ? 852  DC  G C4    1 
ATOM   5698 N  N4    . DC  C 2 16  ? 100.680 -13.718 153.110 1.00 44.61  ? 852  DC  G N4    1 
ATOM   5699 C  C5    . DC  C 2 16  ? 102.713 -14.298 154.262 1.00 48.61  ? 852  DC  G C5    1 
ATOM   5700 C  C6    . DC  C 2 16  ? 103.248 -14.740 155.409 1.00 49.29  ? 852  DC  G C6    1 
ATOM   5701 P  P     . DC  C 2 17  ? 104.656 -18.992 159.807 1.00 70.84  ? 853  DC  G P     1 
ATOM   5702 O  OP1   . DC  C 2 17  ? 105.090 -19.469 161.139 1.00 77.59  ? 853  DC  G OP1   1 
ATOM   5703 O  OP2   . DC  C 2 17  ? 105.478 -19.277 158.607 1.00 63.31  ? 853  DC  G OP2   1 
ATOM   5704 O  "O5'" . DC  C 2 17  ? 103.187 -19.570 159.535 1.00 74.44  ? 853  DC  G "O5'" 1 
ATOM   5705 C  "C5'" . DC  C 2 17  ? 102.062 -19.004 160.214 1.00 64.91  ? 853  DC  G "C5'" 1 
ATOM   5706 C  "C4'" . DC  C 2 17  ? 100.769 -19.547 159.638 1.00 66.25  ? 853  DC  G "C4'" 1 
ATOM   5707 O  "O4'" . DC  C 2 17  ? 100.347 -18.713 158.529 1.00 61.11  ? 853  DC  G "O4'" 1 
ATOM   5708 C  "C3'" . DC  C 2 17  ? 100.865 -20.978 159.090 1.00 79.13  ? 853  DC  G "C3'" 1 
ATOM   5709 O  "O3'" . DC  C 2 17  ? 99.785  -21.764 159.575 1.00 90.51  ? 853  DC  G "O3'" 1 
ATOM   5710 C  "C2'" . DC  C 2 17  ? 100.791 -20.796 157.576 1.00 68.78  ? 853  DC  G "C2'" 1 
ATOM   5711 C  "C1'" . DC  C 2 17  ? 99.956  -19.532 157.461 1.00 60.02  ? 853  DC  G "C1'" 1 
ATOM   5712 N  N1    . DC  C 2 17  ? 100.178 -18.805 156.194 1.00 57.08  ? 853  DC  G N1    1 
ATOM   5713 C  C2    . DC  C 2 17  ? 99.079  -18.454 155.408 1.00 52.79  ? 853  DC  G C2    1 
ATOM   5714 O  O2    . DC  C 2 17  ? 97.948  -18.744 155.802 1.00 56.02  ? 853  DC  G O2    1 
ATOM   5715 N  N3    . DC  C 2 17  ? 99.288  -17.802 154.239 1.00 57.75  ? 853  DC  G N3    1 
ATOM   5716 C  C4    . DC  C 2 17  ? 100.535 -17.513 153.849 1.00 60.67  ? 853  DC  G C4    1 
ATOM   5717 N  N4    . DC  C 2 17  ? 100.691 -16.875 152.686 1.00 51.21  ? 853  DC  G N4    1 
ATOM   5718 C  C5    . DC  C 2 17  ? 101.675 -17.878 154.633 1.00 56.39  ? 853  DC  G C5    1 
ATOM   5719 C  C6    . DC  C 2 17  ? 101.453 -18.517 155.787 1.00 55.96  ? 853  DC  G C6    1 
ATOM   5720 P  P     . DC  C 2 18  ? 99.821  -23.365 159.445 1.00 90.75  ? 854  DC  G P     1 
ATOM   5721 O  OP1   . DC  C 2 18  ? 99.213  -23.881 160.691 1.00 100.66 ? 854  DC  G OP1   1 
ATOM   5722 O  OP2   . DC  C 2 18  ? 101.170 -23.806 159.039 1.00 70.89  ? 854  DC  G OP2   1 
ATOM   5723 O  "O5'" . DC  C 2 18  ? 98.855  -23.674 158.208 1.00 95.31  ? 854  DC  G "O5'" 1 
ATOM   5724 C  "C5'" . DC  C 2 18  ? 97.507  -23.201 158.208 1.00 85.07  ? 854  DC  G "C5'" 1 
ATOM   5725 C  "C4'" . DC  C 2 18  ? 96.857  -23.472 156.862 1.00 79.53  ? 854  DC  G "C4'" 1 
ATOM   5726 O  "O4'" . DC  C 2 18  ? 97.245  -22.441 155.927 1.00 72.29  ? 854  DC  G "O4'" 1 
ATOM   5727 C  "C3'" . DC  C 2 18  ? 97.247  -24.812 156.225 1.00 78.95  ? 854  DC  G "C3'" 1 
ATOM   5728 O  "O3'" . DC  C 2 18  ? 96.113  -25.661 156.143 1.00 85.54  ? 854  DC  G "O3'" 1 
ATOM   5729 C  "C2'" . DC  C 2 18  ? 97.790  -24.455 154.832 1.00 78.39  ? 854  DC  G "C2'" 1 
ATOM   5730 C  "C1'" . DC  C 2 18  ? 97.370  -22.996 154.642 1.00 81.46  ? 854  DC  G "C1'" 1 
ATOM   5731 N  N1    . DC  C 2 18  ? 98.378  -22.195 153.881 1.00 80.15  ? 854  DC  G N1    1 
ATOM   5732 C  C2    . DC  C 2 18  ? 97.973  -21.426 152.782 1.00 70.93  ? 854  DC  G C2    1 
ATOM   5733 O  O2    . DC  C 2 18  ? 96.784  -21.413 152.462 1.00 66.86  ? 854  DC  G O2    1 
ATOM   5734 N  N3    . DC  C 2 18  ? 98.904  -20.711 152.102 1.00 65.89  ? 854  DC  G N3    1 
ATOM   5735 C  C4    . DC  C 2 18  ? 100.182 -20.745 152.482 1.00 61.11  ? 854  DC  G C4    1 
ATOM   5736 N  N4    . DC  C 2 18  ? 101.060 -20.025 151.780 1.00 56.62  ? 854  DC  G N4    1 
ATOM   5737 C  C5    . DC  C 2 18  ? 100.617 -21.526 153.595 1.00 68.99  ? 854  DC  G C5    1 
ATOM   5738 C  C6    . DC  C 2 18  ? 99.691  -22.228 154.259 1.00 73.85  ? 854  DC  G C6    1 
ATOM   5739 O  "O5'" . DG  D 2 5   ? 94.991  -16.438 141.604 1.00 74.32  ? 860  DG  H "O5'" 1 
ATOM   5740 C  "C5'" . DG  D 2 5   ? 94.937  -15.600 142.766 1.00 80.22  ? 860  DG  H "C5'" 1 
ATOM   5741 C  "C4'" . DG  D 2 5   ? 94.302  -16.328 143.948 1.00 87.11  ? 860  DG  H "C4'" 1 
ATOM   5742 O  "O4'" . DG  D 2 5   ? 95.297  -17.165 144.607 1.00 90.25  ? 860  DG  H "O4'" 1 
ATOM   5743 C  "C3'" . DG  D 2 5   ? 93.727  -15.412 145.042 1.00 90.90  ? 860  DG  H "C3'" 1 
ATOM   5744 O  "O3'" . DG  D 2 5   ? 92.420  -15.842 145.420 1.00 104.86 ? 860  DG  H "O3'" 1 
ATOM   5745 C  "C2'" . DG  D 2 5   ? 94.709  -15.567 146.198 1.00 85.64  ? 860  DG  H "C2'" 1 
ATOM   5746 C  "C1'" . DG  D 2 5   ? 95.193  -16.994 146.003 1.00 85.42  ? 860  DG  H "C1'" 1 
ATOM   5747 N  N9    . DG  D 2 5   ? 96.497  -17.229 146.618 1.00 85.62  ? 860  DG  H N9    1 
ATOM   5748 C  C8    . DG  D 2 5   ? 97.709  -16.716 146.209 1.00 78.10  ? 860  DG  H C8    1 
ATOM   5749 N  N7    . DG  D 2 5   ? 98.709  -17.078 146.964 1.00 73.58  ? 860  DG  H N7    1 
ATOM   5750 C  C5    . DG  D 2 5   ? 98.123  -17.871 147.948 1.00 78.74  ? 860  DG  H C5    1 
ATOM   5751 C  C6    . DG  D 2 5   ? 98.711  -18.542 149.048 1.00 65.15  ? 860  DG  H C6    1 
ATOM   5752 O  O6    . DG  D 2 5   ? 99.897  -18.567 149.383 1.00 60.64  ? 860  DG  H O6    1 
ATOM   5753 N  N1    . DG  D 2 5   ? 97.767  -19.233 149.798 1.00 66.46  ? 860  DG  H N1    1 
ATOM   5754 C  C2    . DG  D 2 5   ? 96.424  -19.281 149.521 1.00 73.25  ? 860  DG  H C2    1 
ATOM   5755 N  N2    . DG  D 2 5   ? 95.677  -20.005 150.365 1.00 72.35  ? 860  DG  H N2    1 
ATOM   5756 N  N3    . DG  D 2 5   ? 95.852  -18.656 148.495 1.00 78.59  ? 860  DG  H N3    1 
ATOM   5757 C  C4    . DG  D 2 5   ? 96.761  -17.970 147.753 1.00 85.40  ? 860  DG  H C4    1 
ATOM   5758 P  P     . DG  D 2 6   ? 91.418  -14.831 146.175 1.00 109.39 ? 861  DG  H P     1 
ATOM   5759 O  OP1   . DG  D 2 6   ? 90.104  -14.979 145.506 1.00 102.83 ? 861  DG  H OP1   1 
ATOM   5760 O  OP2   . DG  D 2 6   ? 92.068  -13.502 146.271 1.00 109.01 ? 861  DG  H OP2   1 
ATOM   5761 O  "O5'" . DG  D 2 6   ? 91.348  -15.383 147.681 1.00 104.90 ? 861  DG  H "O5'" 1 
ATOM   5762 C  "C5'" . DG  D 2 6   ? 90.700  -16.624 147.976 1.00 93.23  ? 861  DG  H "C5'" 1 
ATOM   5763 C  "C4'" . DG  D 2 6   ? 90.649  -16.865 149.480 1.00 78.06  ? 861  DG  H "C4'" 1 
ATOM   5764 O  "O4'" . DG  D 2 6   ? 91.976  -17.222 149.962 1.00 76.08  ? 861  DG  H "O4'" 1 
ATOM   5765 C  "C3'" . DG  D 2 6   ? 90.210  -15.662 150.314 1.00 76.03  ? 861  DG  H "C3'" 1 
ATOM   5766 O  "O3'" . DG  D 2 6   ? 89.432  -16.096 151.433 1.00 74.81  ? 861  DG  H "O3'" 1 
ATOM   5767 C  "C2'" . DG  D 2 6   ? 91.539  -15.063 150.752 1.00 78.04  ? 861  DG  H "C2'" 1 
ATOM   5768 C  "C1'" . DG  D 2 6   ? 92.372  -16.313 150.961 1.00 78.93  ? 861  DG  H "C1'" 1 
ATOM   5769 N  N9    . DG  D 2 6   ? 93.800  -16.068 150.835 1.00 87.33  ? 861  DG  H N9    1 
ATOM   5770 C  C8    . DG  D 2 6   ? 94.424  -15.229 149.943 1.00 86.45  ? 861  DG  H C8    1 
ATOM   5771 N  N7    . DG  D 2 6   ? 95.719  -15.202 150.078 1.00 79.55  ? 861  DG  H N7    1 
ATOM   5772 C  C5    . DG  D 2 6   ? 95.967  -16.073 151.130 1.00 78.40  ? 861  DG  H C5    1 
ATOM   5773 C  C6    . DG  D 2 6   ? 97.187  -16.451 151.732 1.00 72.69  ? 861  DG  H C6    1 
ATOM   5774 O  O6    . DG  D 2 6   ? 98.329  -16.077 151.444 1.00 63.83  ? 861  DG  H O6    1 
ATOM   5775 N  N1    . DG  D 2 6   ? 96.989  -17.357 152.774 1.00 76.63  ? 861  DG  H N1    1 
ATOM   5776 C  C2    . DG  D 2 6   ? 95.765  -17.840 153.176 1.00 81.55  ? 861  DG  H C2    1 
ATOM   5777 N  N2    . DG  D 2 6   ? 95.767  -18.711 154.196 1.00 71.31  ? 861  DG  H N2    1 
ATOM   5778 N  N3    . DG  D 2 6   ? 94.617  -17.491 152.620 1.00 91.58  ? 861  DG  H N3    1 
ATOM   5779 C  C4    . DG  D 2 6   ? 94.794  -16.610 151.607 1.00 88.06  ? 861  DG  H C4    1 
ATOM   5780 P  P     . DG  D 2 7   ? 88.743  -15.028 152.422 1.00 78.02  ? 862  DG  H P     1 
ATOM   5781 O  OP1   . DG  D 2 7   ? 87.281  -15.232 152.333 1.00 89.64  ? 862  DG  H OP1   1 
ATOM   5782 O  OP2   . DG  D 2 7   ? 89.314  -13.684 152.192 1.00 82.52  ? 862  DG  H OP2   1 
ATOM   5783 O  "O5'" . DG  D 2 7   ? 89.233  -15.480 153.865 1.00 71.80  ? 862  DG  H "O5'" 1 
ATOM   5784 C  "C5'" . DG  D 2 7   ? 90.577  -15.854 154.044 1.00 76.01  ? 862  DG  H "C5'" 1 
ATOM   5785 C  "C4'" . DG  D 2 7   ? 90.852  -16.198 155.485 1.00 75.30  ? 862  DG  H "C4'" 1 
ATOM   5786 O  "O4'" . DG  D 2 7   ? 92.277  -16.350 155.662 1.00 67.18  ? 862  DG  H "O4'" 1 
ATOM   5787 C  "C3'" . DG  D 2 7   ? 90.460  -15.116 156.466 1.00 71.25  ? 862  DG  H "C3'" 1 
ATOM   5788 O  "O3'" . DG  D 2 7   ? 90.322  -15.668 157.756 1.00 67.26  ? 862  DG  H "O3'" 1 
ATOM   5789 C  "C2'" . DG  D 2 7   ? 91.658  -14.177 156.385 1.00 77.17  ? 862  DG  H "C2'" 1 
ATOM   5790 C  "C1'" . DG  D 2 7   ? 92.820  -15.154 156.185 1.00 71.29  ? 862  DG  H "C1'" 1 
ATOM   5791 N  N9    . DG  D 2 7   ? 93.822  -14.660 155.250 1.00 83.04  ? 862  DG  H N9    1 
ATOM   5792 C  C8    . DG  D 2 7   ? 93.594  -14.025 154.054 1.00 82.51  ? 862  DG  H C8    1 
ATOM   5793 N  N7    . DG  D 2 7   ? 94.687  -13.687 153.429 1.00 76.16  ? 862  DG  H N7    1 
ATOM   5794 C  C5    . DG  D 2 7   ? 95.703  -14.128 154.264 1.00 72.01  ? 862  DG  H C5    1 
ATOM   5795 C  C6    . DG  D 2 7   ? 97.104  -14.035 154.119 1.00 53.10  ? 862  DG  H C6    1 
ATOM   5796 O  O6    . DG  D 2 7   ? 97.748  -13.534 153.183 1.00 49.38  ? 862  DG  H O6    1 
ATOM   5797 N  N1    . DG  D 2 7   ? 97.768  -14.612 155.200 1.00 49.84  ? 862  DG  H N1    1 
ATOM   5798 C  C2    . DG  D 2 7   ? 97.153  -15.196 156.283 1.00 56.97  ? 862  DG  H C2    1 
ATOM   5799 N  N2    . DG  D 2 7   ? 97.954  -15.702 157.227 1.00 55.70  ? 862  DG  H N2    1 
ATOM   5800 N  N3    . DG  D 2 7   ? 95.842  -15.281 156.433 1.00 69.49  ? 862  DG  H N3    1 
ATOM   5801 C  C4    . DG  D 2 7   ? 95.183  -14.730 155.390 1.00 78.26  ? 862  DG  H C4    1 
ATOM   5802 P  P     . DT  D 2 8   ? 90.221  -14.699 159.031 1.00 71.47  ? 863  DT  H P     1 
ATOM   5803 O  OP1   . DT  D 2 8   ? 89.618  -15.482 160.133 1.00 78.78  ? 863  DT  H OP1   1 
ATOM   5804 O  OP2   . DT  D 2 8   ? 89.632  -13.414 158.605 1.00 67.62  ? 863  DT  H OP2   1 
ATOM   5805 O  "O5'" . DT  D 2 8   ? 91.735  -14.439 159.434 1.00 73.36  ? 863  DT  H "O5'" 1 
ATOM   5806 C  "C5'" . DT  D 2 8   ? 92.428  -15.405 160.188 1.00 71.61  ? 863  DT  H "C5'" 1 
ATOM   5807 C  "C4'" . DT  D 2 8   ? 93.723  -14.826 160.691 1.00 66.64  ? 863  DT  H "C4'" 1 
ATOM   5808 O  "O4'" . DT  D 2 8   ? 94.506  -14.410 159.549 1.00 57.02  ? 863  DT  H "O4'" 1 
ATOM   5809 C  "C3'" . DT  D 2 8   ? 93.567  -13.578 161.585 1.00 57.76  ? 863  DT  H "C3'" 1 
ATOM   5810 O  "O3'" . DT  D 2 8   ? 94.371  -13.711 162.774 1.00 70.54  ? 863  DT  H "O3'" 1 
ATOM   5811 C  "C2'" . DT  D 2 8   ? 94.056  -12.439 160.693 1.00 46.51  ? 863  DT  H "C2'" 1 
ATOM   5812 C  "C1'" . DT  D 2 8   ? 95.071  -13.159 159.834 1.00 55.50  ? 863  DT  H "C1'" 1 
ATOM   5813 N  N1    . DT  D 2 8   ? 95.384  -12.475 158.567 1.00 62.91  ? 863  DT  H N1    1 
ATOM   5814 C  C2    . DT  D 2 8   ? 96.698  -12.347 158.213 1.00 56.05  ? 863  DT  H C2    1 
ATOM   5815 O  O2    . DT  D 2 8   ? 97.605  -12.785 158.894 1.00 54.70  ? 863  DT  H O2    1 
ATOM   5816 N  N3    . DT  D 2 8   ? 96.915  -11.699 157.028 1.00 49.79  ? 863  DT  H N3    1 
ATOM   5817 C  C4    . DT  D 2 8   ? 95.962  -11.167 156.180 1.00 56.88  ? 863  DT  H C4    1 
ATOM   5818 O  O4    . DT  D 2 8   ? 96.257  -10.596 155.135 1.00 46.34  ? 863  DT  H O4    1 
ATOM   5819 C  C5    . DT  D 2 8   ? 94.588  -11.331 156.613 1.00 66.67  ? 863  DT  H C5    1 
ATOM   5820 C  C7    . DT  D 2 8   ? 93.467  -10.798 155.771 1.00 52.28  ? 863  DT  H C7    1 
ATOM   5821 C  C6    . DT  D 2 8   ? 94.367  -11.970 157.778 1.00 65.85  ? 863  DT  H C6    1 
ATOM   5822 P  P     . DC  D 2 9   ? 94.323  -12.604 163.948 1.00 81.25  ? 864  DC  H P     1 
ATOM   5823 O  OP1   . DC  D 2 9   ? 94.051  -13.333 165.204 1.00 86.72  ? 864  DC  H OP1   1 
ATOM   5824 O  OP2   . DC  D 2 9   ? 93.459  -11.477 163.539 1.00 71.58  ? 864  DC  H OP2   1 
ATOM   5825 O  "O5'" . DC  D 2 9   ? 95.823  -12.038 164.025 1.00 80.74  ? 864  DC  H "O5'" 1 
ATOM   5826 C  "C5'" . DC  D 2 9   ? 96.878  -12.877 164.487 1.00 70.31  ? 864  DC  H "C5'" 1 
ATOM   5827 C  "C4'" . DC  D 2 9   ? 98.234  -12.209 164.309 1.00 66.39  ? 864  DC  H "C4'" 1 
ATOM   5828 O  "O4'" . DC  D 2 9   ? 98.425  -11.863 162.911 1.00 62.93  ? 864  DC  H "O4'" 1 
ATOM   5829 C  "C3'" . DC  D 2 9   ? 98.448  -10.918 165.106 1.00 63.48  ? 864  DC  H "C3'" 1 
ATOM   5830 O  "O3'" . DC  D 2 9   ? 99.774  -10.889 165.641 1.00 73.88  ? 864  DC  H "O3'" 1 
ATOM   5831 C  "C2'" . DC  D 2 9   ? 98.240  -9.825  164.061 1.00 64.20  ? 864  DC  H "C2'" 1 
ATOM   5832 C  "C1'" . DC  D 2 9   ? 98.761  -10.497 162.795 1.00 61.33  ? 864  DC  H "C1'" 1 
ATOM   5833 N  N1    . DC  D 2 9   ? 98.131  -9.972  161.544 1.00 58.52  ? 864  DC  H N1    1 
ATOM   5834 C  C2    . DC  D 2 9   ? 98.933  -9.587  160.467 1.00 55.70  ? 864  DC  H C2    1 
ATOM   5835 O  O2    . DC  D 2 9   ? 100.160 -9.680  160.566 1.00 55.30  ? 864  DC  H O2    1 
ATOM   5836 N  N3    . DC  D 2 9   ? 98.340  -9.120  159.342 1.00 59.81  ? 864  DC  H N3    1 
ATOM   5837 C  C4    . DC  D 2 9   ? 97.014  -9.031  159.275 1.00 53.54  ? 864  DC  H C4    1 
ATOM   5838 N  N4    . DC  D 2 9   ? 96.475  -8.563  158.150 1.00 54.28  ? 864  DC  H N4    1 
ATOM   5839 C  C5    . DC  D 2 9   ? 96.179  -9.418  160.362 1.00 57.56  ? 864  DC  H C5    1 
ATOM   5840 C  C6    . DC  D 2 9   ? 96.774  -9.879  161.465 1.00 53.35  ? 864  DC  H C6    1 
ATOM   5841 P  P     . DC  D 2 10  ? 100.232 -9.705  166.628 1.00 82.28  ? 865  DC  H P     1 
ATOM   5842 O  OP1   . DC  D 2 10  ? 101.060 -10.298 167.705 1.00 81.90  ? 865  DC  H OP1   1 
ATOM   5843 O  OP2   . DC  D 2 10  ? 99.057  -8.863  166.938 1.00 73.86  ? 865  DC  H OP2   1 
ATOM   5844 O  "O5'" . DC  D 2 10  ? 101.186 -8.798  165.730 1.00 84.29  ? 865  DC  H "O5'" 1 
ATOM   5845 C  "C5'" . DC  D 2 10  ? 102.514 -9.196  165.477 1.00 70.34  ? 865  DC  H "C5'" 1 
ATOM   5846 C  "C4'" . DC  D 2 10  ? 103.169 -8.225  164.521 1.00 62.83  ? 865  DC  H "C4'" 1 
ATOM   5847 O  "O4'" . DC  D 2 10  ? 102.329 -8.072  163.350 1.00 52.81  ? 865  DC  H "O4'" 1 
ATOM   5848 C  "C3'" . DC  D 2 10  ? 103.387 -6.821  165.091 1.00 49.81  ? 865  DC  H "C3'" 1 
ATOM   5849 O  "O3'" . DC  D 2 10  ? 104.747 -6.476  164.979 1.00 50.20  ? 865  DC  H "O3'" 1 
ATOM   5850 C  "C2'" . DC  D 2 10  ? 102.494 -5.914  164.234 1.00 51.38  ? 865  DC  H "C2'" 1 
ATOM   5851 C  "C1'" . DC  D 2 10  ? 102.311 -6.732  162.959 1.00 50.00  ? 865  DC  H "C1'" 1 
ATOM   5852 N  N1    . DC  D 2 10  ? 101.017 -6.478  162.252 1.00 43.40  ? 865  DC  H N1    1 
ATOM   5853 C  C2    . DC  D 2 10  ? 101.029 -5.889  160.981 1.00 47.41  ? 865  DC  H C2    1 
ATOM   5854 O  O2    . DC  D 2 10  ? 102.113 -5.592  160.471 1.00 52.67  ? 865  DC  H O2    1 
ATOM   5855 N  N3    . DC  D 2 10  ? 99.851  -5.665  160.345 1.00 37.46  ? 865  DC  H N3    1 
ATOM   5856 C  C4    . DC  D 2 10  ? 98.703  -5.997  160.935 1.00 41.90  ? 865  DC  H C4    1 
ATOM   5857 N  N4    . DC  D 2 10  ? 97.564  -5.753  160.274 1.00 41.16  ? 865  DC  H N4    1 
ATOM   5858 C  C5    . DC  D 2 10  ? 98.669  -6.593  162.231 1.00 47.40  ? 865  DC  H C5    1 
ATOM   5859 C  C6    . DC  D 2 10  ? 99.840  -6.813  162.847 1.00 46.61  ? 865  DC  H C6    1 
ATOM   5860 P  P     . DT  D 2 11  ? 105.347 -5.300  165.891 1.00 69.78  ? 866  DT  H P     1 
ATOM   5861 O  OP1   . DT  D 2 11  ? 106.814 -5.508  165.941 1.00 75.25  ? 866  DT  H OP1   1 
ATOM   5862 O  OP2   . DT  D 2 11  ? 104.586 -5.227  167.154 1.00 60.80  ? 866  DT  H OP2   1 
ATOM   5863 O  "O5'" . DT  D 2 11  ? 105.045 -3.985  165.037 1.00 55.89  ? 866  DT  H "O5'" 1 
ATOM   5864 C  "C5'" . DT  D 2 11  ? 105.695 -3.810  163.798 1.00 47.10  ? 866  DT  H "C5'" 1 
ATOM   5865 C  "C4'" . DT  D 2 11  ? 105.032 -2.717  163.001 1.00 45.45  ? 866  DT  H "C4'" 1 
ATOM   5866 O  "O4'" . DT  D 2 11  ? 103.707 -3.112  162.641 1.00 43.34  ? 866  DT  H "O4'" 1 
ATOM   5867 C  "C3'" . DT  D 2 11  ? 104.864 -1.400  163.742 1.00 49.74  ? 866  DT  H "C3'" 1 
ATOM   5868 O  "O3'" . DT  D 2 11  ? 105.933 -0.556  163.399 1.00 42.08  ? 866  DT  H "O3'" 1 
ATOM   5869 C  "C2'" . DT  D 2 11  ? 103.503 -0.862  163.251 1.00 45.40  ? 866  DT  H "C2'" 1 
ATOM   5870 C  "C1'" . DT  D 2 11  ? 103.023 -1.952  162.283 1.00 38.13  ? 866  DT  H "C1'" 1 
ATOM   5871 N  N1    . DT  D 2 11  ? 101.590 -2.229  162.343 1.00 42.76  ? 866  DT  H N1    1 
ATOM   5872 C  C2    . DT  D 2 11  ? 100.787 -1.843  161.283 1.00 50.38  ? 866  DT  H C2    1 
ATOM   5873 O  O2    . DT  D 2 11  ? 101.212 -1.267  160.294 1.00 46.68  ? 866  DT  H O2    1 
ATOM   5874 N  N3    . DT  D 2 11  ? 99.464  -2.154  161.424 1.00 48.35  ? 866  DT  H N3    1 
ATOM   5875 C  C4    . DT  D 2 11  ? 98.867  -2.790  162.494 1.00 39.58  ? 866  DT  H C4    1 
ATOM   5876 O  O4    . DT  D 2 11  ? 97.673  -3.027  162.521 1.00 46.86  ? 866  DT  H O4    1 
ATOM   5877 C  C5    . DT  D 2 11  ? 99.760  -3.172  163.571 1.00 46.00  ? 866  DT  H C5    1 
ATOM   5878 C  C7    . DT  D 2 11  ? 99.221  -3.872  164.786 1.00 46.01  ? 866  DT  H C7    1 
ATOM   5879 C  C6    . DT  D 2 11  ? 101.067 -2.874  163.445 1.00 45.53  ? 866  DT  H C6    1 
ATOM   5880 P  P     . DA  D 2 12  ? 105.993 0.942   163.936 1.00 46.57  ? 867  DA  H P     1 
ATOM   5881 O  OP1   . DA  D 2 12  ? 107.383 1.384   163.796 1.00 39.68  ? 867  DA  H OP1   1 
ATOM   5882 O  OP2   . DA  D 2 12  ? 105.217 1.022   165.201 1.00 38.33  ? 867  DA  H OP2   1 
ATOM   5883 O  "O5'" . DA  D 2 12  ? 105.196 1.769   162.835 1.00 42.44  ? 867  DA  H "O5'" 1 
ATOM   5884 C  "C5'" . DA  D 2 12  ? 105.685 1.828   161.524 1.00 38.34  ? 867  DA  H "C5'" 1 
ATOM   5885 C  "C4'" . DA  D 2 12  ? 104.935 2.875   160.763 1.00 37.58  ? 867  DA  H "C4'" 1 
ATOM   5886 O  "O4'" . DA  D 2 12  ? 103.565 2.433   160.598 1.00 40.53  ? 867  DA  H "O4'" 1 
ATOM   5887 C  "C3'" . DA  D 2 12  ? 104.885 4.224   161.461 1.00 39.83  ? 867  DA  H "C3'" 1 
ATOM   5888 O  "O3'" . DA  D 2 12  ? 105.283 5.233   160.541 1.00 35.36  ? 867  DA  H "O3'" 1 
ATOM   5889 C  "C2'" . DA  D 2 12  ? 103.419 4.355   161.946 1.00 33.94  ? 867  DA  H "C2'" 1 
ATOM   5890 C  "C1'" . DA  D 2 12  ? 102.655 3.412   161.024 1.00 30.31  ? 867  DA  H "C1'" 1 
ATOM   5891 N  N9    . DA  D 2 12  ? 101.545 2.693   161.650 1.00 44.29  ? 867  DA  H N9    1 
ATOM   5892 C  C8    . DA  D 2 12  ? 101.537 2.093   162.879 1.00 47.04  ? 867  DA  H C8    1 
ATOM   5893 N  N7    . DA  D 2 12  ? 100.408 1.480   163.164 1.00 42.30  ? 867  DA  H N7    1 
ATOM   5894 C  C5    . DA  D 2 12  ? 99.631  1.662   162.034 1.00 37.07  ? 867  DA  H C5    1 
ATOM   5895 C  C6    . DA  D 2 12  ? 98.312  1.260   161.708 1.00 36.41  ? 867  DA  H C6    1 
ATOM   5896 N  N6    . DA  D 2 12  ? 97.537  0.548   162.522 1.00 36.54  ? 867  DA  H N6    1 
ATOM   5897 N  N1    . DA  D 2 12  ? 97.826  1.625   160.502 1.00 39.08  ? 867  DA  H N1    1 
ATOM   5898 C  C2    . DA  D 2 12  ? 98.609  2.345   159.682 1.00 35.86  ? 867  DA  H C2    1 
ATOM   5899 N  N3    . DA  D 2 12  ? 99.856  2.784   159.885 1.00 40.27  ? 867  DA  H N3    1 
ATOM   5900 C  C4    . DA  D 2 12  ? 100.314 2.404   161.087 1.00 39.00  ? 867  DA  H C4    1 
ATOM   5901 P  P     . DG  D 2 13  ? 105.150 6.793   160.891 1.00 40.69  ? 868  DG  H P     1 
ATOM   5902 O  OP1   . DG  D 2 13  ? 106.121 7.460   159.988 1.00 33.07  ? 868  DG  H OP1   1 
ATOM   5903 O  OP2   . DG  D 2 13  ? 105.182 7.047   162.357 1.00 45.60  ? 868  DG  H OP2   1 
ATOM   5904 O  "O5'" . DG  D 2 13  ? 103.684 7.138   160.382 1.00 43.69  ? 868  DG  H "O5'" 1 
ATOM   5905 C  "C5'" . DG  D 2 13  ? 103.289 6.701   159.091 1.00 42.38  ? 868  DG  H "C5'" 1 
ATOM   5906 C  "C4'" . DG  D 2 13  ? 101.844 7.065   158.836 1.00 41.50  ? 868  DG  H "C4'" 1 
ATOM   5907 O  "O4'" . DG  D 2 13  ? 100.991 6.143   159.532 1.00 38.80  ? 868  DG  H "O4'" 1 
ATOM   5908 C  "C3'" . DG  D 2 13  ? 101.436 8.461   159.304 1.00 39.33  ? 868  DG  H "C3'" 1 
ATOM   5909 O  "O3'" . DG  D 2 13  ? 100.943 9.186   158.190 1.00 42.05  ? 868  DG  H "O3'" 1 
ATOM   5910 C  "C2'" . DG  D 2 13  ? 100.346 8.210   160.366 1.00 32.94  ? 868  DG  H "C2'" 1 
ATOM   5911 C  "C1'" . DG  D 2 13  ? 99.865  6.825   159.996 1.00 34.25  ? 868  DG  H "C1'" 1 
ATOM   5912 N  N9    . DG  D 2 13  ? 99.311  6.044   161.091 1.00 34.77  ? 868  DG  H N9    1 
ATOM   5913 C  C8    . DG  D 2 13  ? 99.923  5.693   162.271 1.00 39.17  ? 868  DG  H C8    1 
ATOM   5914 N  N7    . DG  D 2 13  ? 99.174  4.940   163.038 1.00 37.85  ? 868  DG  H N7    1 
ATOM   5915 C  C5    . DG  D 2 13  ? 98.000  4.781   162.302 1.00 34.28  ? 868  DG  H C5    1 
ATOM   5916 C  C6    . DG  D 2 13  ? 96.817  4.079   162.608 1.00 33.58  ? 868  DG  H C6    1 
ATOM   5917 O  O6    . DG  D 2 13  ? 96.555  3.429   163.620 1.00 33.42  ? 868  DG  H O6    1 
ATOM   5918 N  N1    . DG  D 2 13  ? 95.876  4.185   161.579 1.00 33.77  ? 868  DG  H N1    1 
ATOM   5919 C  C2    . DG  D 2 13  ? 96.069  4.883   160.412 1.00 33.59  ? 868  DG  H C2    1 
ATOM   5920 N  N2    . DG  D 2 13  ? 95.061  4.882   159.533 1.00 33.92  ? 868  DG  H N2    1 
ATOM   5921 N  N3    . DG  D 2 13  ? 97.161  5.531   160.124 1.00 32.64  ? 868  DG  H N3    1 
ATOM   5922 C  C4    . DG  D 2 13  ? 98.081  5.444   161.107 1.00 34.26  ? 868  DG  H C4    1 
ATOM   5923 P  P     . DG  D 2 14  ? 100.694 10.765  158.274 1.00 40.12  ? 869  DG  H P     1 
ATOM   5924 O  OP1   . DG  D 2 14  ? 100.981 11.282  156.918 1.00 42.79  ? 869  DG  H OP1   1 
ATOM   5925 O  OP2   . DG  D 2 14  ? 101.391 11.340  159.438 1.00 49.34  ? 869  DG  H OP2   1 
ATOM   5926 O  "O5'" . DG  D 2 14  ? 99.133  10.859  158.525 1.00 40.42  ? 869  DG  H "O5'" 1 
ATOM   5927 C  "C5'" . DG  D 2 14  ? 98.247  10.268  157.579 1.00 36.78  ? 869  DG  H "C5'" 1 
ATOM   5928 C  "C4'" . DG  D 2 14  ? 96.838  10.232  158.126 1.00 36.32  ? 869  DG  H "C4'" 1 
ATOM   5929 O  "O4'" . DG  D 2 14  ? 96.725  9.176   159.123 1.00 39.21  ? 869  DG  H "O4'" 1 
ATOM   5930 C  "C3'" . DG  D 2 14  ? 96.404  11.527  158.839 1.00 42.18  ? 869  DG  H "C3'" 1 
ATOM   5931 O  "O3'" . DG  D 2 14  ? 95.121  11.875  158.434 1.00 49.62  ? 869  DG  H "O3'" 1 
ATOM   5932 C  "C2'" . DG  D 2 14  ? 96.415  11.127  160.308 1.00 43.55  ? 869  DG  H "C2'" 1 
ATOM   5933 C  "C1'" . DG  D 2 14  ? 95.973  9.685   160.189 1.00 35.59  ? 869  DG  H "C1'" 1 
ATOM   5934 N  N9    . DG  D 2 14  ? 96.199  8.903   161.402 1.00 31.80  ? 869  DG  H N9    1 
ATOM   5935 C  C8    . DG  D 2 14  ? 97.307  8.917   162.212 1.00 32.75  ? 869  DG  H C8    1 
ATOM   5936 N  N7    . DG  D 2 14  ? 97.197  8.124   163.252 1.00 42.17  ? 869  DG  H N7    1 
ATOM   5937 C  C5    . DG  D 2 14  ? 95.927  7.580   163.128 1.00 32.42  ? 869  DG  H C5    1 
ATOM   5938 C  C6    . DG  D 2 14  ? 95.244  6.672   163.961 1.00 31.33  ? 869  DG  H C6    1 
ATOM   5939 O  O6    . DG  D 2 14  ? 95.641  6.162   165.007 1.00 30.64  ? 869  DG  H O6    1 
ATOM   5940 N  N1    . DG  D 2 14  ? 93.956  6.380   163.475 1.00 33.51  ? 869  DG  H N1    1 
ATOM   5941 C  C2    . DG  D 2 14  ? 93.417  6.905   162.328 1.00 29.55  ? 869  DG  H C2    1 
ATOM   5942 N  N2    . DG  D 2 14  ? 92.173  6.515   162.018 1.00 28.73  ? 869  DG  H N2    1 
ATOM   5943 N  N3    . DG  D 2 14  ? 94.051  7.765   161.541 1.00 40.86  ? 869  DG  H N3    1 
ATOM   5944 C  C4    . DG  D 2 14  ? 95.295  8.058   162.005 1.00 25.93  ? 869  DG  H C4    1 
ATOM   5945 P  P     . DA  D 2 15  ? 94.660  13.413  158.379 1.00 54.14  ? 870  DA  H P     1 
ATOM   5946 O  OP1   . DA  D 2 15  ? 94.980  13.945  157.048 1.00 48.53  ? 870  DA  H OP1   1 
ATOM   5947 O  OP2   . DA  D 2 15  ? 95.121  14.070  159.618 1.00 47.76  ? 870  DA  H OP2   1 
ATOM   5948 O  "O5'" . DA  D 2 15  ? 93.068  13.311  158.448 1.00 46.23  ? 870  DA  H "O5'" 1 
ATOM   5949 C  "C5'" . DA  D 2 15  ? 92.401  12.257  157.792 1.00 35.65  ? 870  DA  H "C5'" 1 
ATOM   5950 C  "C4'" . DA  D 2 15  ? 91.159  11.866  158.578 1.00 30.77  ? 870  DA  H "C4'" 1 
ATOM   5951 O  "O4'" . DA  D 2 15  ? 91.531  10.940  159.626 1.00 32.45  ? 870  DA  H "O4'" 1 
ATOM   5952 C  "C3'" . DA  D 2 15  ? 90.463  13.034  159.252 1.00 32.10  ? 870  DA  H "C3'" 1 
ATOM   5953 O  "O3'" . DA  D 2 15  ? 89.057  12.983  158.975 1.00 29.40  ? 870  DA  H "O3'" 1 
ATOM   5954 C  "C2'" . DA  D 2 15  ? 90.782  12.849  160.736 1.00 26.14  ? 870  DA  H "C2'" 1 
ATOM   5955 C  "C1'" . DA  D 2 15  ? 90.983  11.346  160.852 1.00 28.78  ? 870  DA  H "C1'" 1 
ATOM   5956 N  N9    . DA  D 2 15  ? 91.918  10.962  161.930 1.00 32.78  ? 870  DA  H N9    1 
ATOM   5957 C  C8    . DA  D 2 15  ? 93.201  11.409  162.098 1.00 34.55  ? 870  DA  H C8    1 
ATOM   5958 N  N7    . DA  D 2 15  ? 93.808  10.894  163.154 1.00 28.70  ? 870  DA  H N7    1 
ATOM   5959 C  C5    . DA  D 2 15  ? 92.863  10.061  163.712 1.00 30.08  ? 870  DA  H C5    1 
ATOM   5960 C  C6    . DA  D 2 15  ? 92.895  9.240   164.853 1.00 26.82  ? 870  DA  H C6    1 
ATOM   5961 N  N6    . DA  D 2 15  ? 93.970  9.137   165.639 1.00 28.85  ? 870  DA  H N6    1 
ATOM   5962 N  N1    . DA  D 2 15  ? 91.787  8.538   165.155 1.00 27.57  ? 870  DA  H N1    1 
ATOM   5963 C  C2    . DA  D 2 15  ? 90.725  8.644   164.363 1.00 29.01  ? 870  DA  H C2    1 
ATOM   5964 N  N3    . DA  D 2 15  ? 90.570  9.385   163.265 1.00 26.82  ? 870  DA  H N3    1 
ATOM   5965 C  C4    . DA  D 2 15  ? 91.691  10.081  162.987 1.00 30.55  ? 870  DA  H C4    1 
ATOM   5966 P  P     . DC  D 2 16  ? 88.093  14.179  159.407 1.00 30.46  ? 871  DC  H P     1 
ATOM   5967 O  OP1   . DC  D 2 16  ? 86.906  14.070  158.549 1.00 37.16  ? 871  DC  H OP1   1 
ATOM   5968 O  OP2   . DC  D 2 16  ? 88.808  15.464  159.377 1.00 31.24  ? 871  DC  H OP2   1 
ATOM   5969 O  "O5'" . DC  D 2 16  ? 87.733  13.846  160.909 1.00 29.27  ? 871  DC  H "O5'" 1 
ATOM   5970 C  "C5'" . DC  D 2 16  ? 87.119  12.581  161.202 1.00 31.30  ? 871  DC  H "C5'" 1 
ATOM   5971 C  "C4'" . DC  D 2 16  ? 87.076  12.345  162.691 1.00 32.85  ? 871  DC  H "C4'" 1 
ATOM   5972 O  "O4'" . DC  D 2 16  ? 88.384  12.033  163.166 1.00 31.63  ? 871  DC  H "O4'" 1 
ATOM   5973 C  "C3'" . DC  D 2 16  ? 86.643  13.540  163.529 1.00 31.78  ? 871  DC  H "C3'" 1 
ATOM   5974 O  "O3'" . DC  D 2 16  ? 85.261  13.416  163.821 1.00 29.55  ? 871  DC  H "O3'" 1 
ATOM   5975 C  "C2'" . DC  D 2 16  ? 87.507  13.424  164.806 1.00 27.02  ? 871  DC  H "C2'" 1 
ATOM   5976 C  "C1'" . DC  D 2 16  ? 88.354  12.174  164.547 1.00 29.94  ? 871  DC  H "C1'" 1 
ATOM   5977 N  N1    . DC  D 2 16  ? 89.773  12.275  165.027 1.00 29.03  ? 871  DC  H N1    1 
ATOM   5978 C  C2    . DC  D 2 16  ? 90.183  11.519  166.126 1.00 30.79  ? 871  DC  H C2    1 
ATOM   5979 O  O2    . DC  D 2 16  ? 89.368  10.780  166.683 1.00 25.11  ? 871  DC  H O2    1 
ATOM   5980 N  N3    . DC  D 2 16  ? 91.477  11.628  166.554 1.00 27.06  ? 871  DC  H N3    1 
ATOM   5981 C  C4    . DC  D 2 16  ? 92.324  12.450  165.928 1.00 26.25  ? 871  DC  H C4    1 
ATOM   5982 N  N4    . DC  D 2 16  ? 93.603  12.517  166.378 1.00 26.49  ? 871  DC  H N4    1 
ATOM   5983 C  C5    . DC  D 2 16  ? 91.913  13.239  164.809 1.00 31.17  ? 871  DC  H C5    1 
ATOM   5984 C  C6    . DC  D 2 16  ? 90.647  13.122  164.398 1.00 30.30  ? 871  DC  H C6    1 
ATOM   5985 P  P     . DC  D 2 17  ? 84.494  14.518  164.688 1.00 30.75  ? 872  DC  H P     1 
ATOM   5986 O  OP1   . DC  D 2 17  ? 83.057  14.324  164.386 1.00 31.32  ? 872  DC  H OP1   1 
ATOM   5987 O  OP2   . DC  D 2 17  ? 85.115  15.811  164.419 1.00 31.05  ? 872  DC  H OP2   1 
ATOM   5988 O  "O5'" . DC  D 2 17  ? 84.661  14.047  166.197 1.00 27.53  ? 872  DC  H "O5'" 1 
ATOM   5989 C  "C5'" . DC  D 2 17  ? 84.283  12.679  166.567 1.00 23.10  ? 872  DC  H "C5'" 1 
ATOM   5990 C  "C4'" . DC  D 2 17  ? 84.596  12.446  168.026 1.00 31.51  ? 872  DC  H "C4'" 1 
ATOM   5991 O  "O4'" . DC  D 2 17  ? 86.036  12.245  168.190 1.00 34.91  ? 872  DC  H "O4'" 1 
ATOM   5992 C  "C3'" . DC  D 2 17  ? 84.242  13.658  168.885 1.00 30.58  ? 872  DC  H "C3'" 1 
ATOM   5993 O  "O3'" . DC  D 2 17  ? 83.400  13.287  169.930 1.00 41.78  ? 872  DC  H "O3'" 1 
ATOM   5994 C  "C2'" . DC  D 2 17  ? 85.586  14.179  169.414 1.00 33.61  ? 872  DC  H "C2'" 1 
ATOM   5995 C  "C1'" . DC  D 2 17  ? 86.475  12.956  169.331 1.00 34.24  ? 872  DC  H "C1'" 1 
ATOM   5996 N  N1    . DC  D 2 17  ? 87.935  13.314  169.176 1.00 29.03  ? 872  DC  H N1    1 
ATOM   5997 C  C2    . DC  D 2 17  ? 88.842  12.878  170.133 1.00 28.90  ? 872  DC  H C2    1 
ATOM   5998 O  O2    . DC  D 2 17  ? 88.424  12.184  171.057 1.00 28.10  ? 872  DC  H O2    1 
ATOM   5999 N  N3    . DC  D 2 17  ? 90.165  13.208  170.000 1.00 29.51  ? 872  DC  H N3    1 
ATOM   6000 C  C4    . DC  D 2 17  ? 90.559  13.966  168.961 1.00 27.77  ? 872  DC  H C4    1 
ATOM   6001 N  N4    . DC  D 2 17  ? 91.855  14.287  168.861 1.00 27.41  ? 872  DC  H N4    1 
ATOM   6002 C  C5    . DC  D 2 17  ? 89.628  14.443  167.983 1.00 28.44  ? 872  DC  H C5    1 
ATOM   6003 C  C6    . DC  D 2 17  ? 88.339  14.117  168.145 1.00 22.98  ? 872  DC  H C6    1 
ATOM   6004 P  P     . DC  D 2 18  ? 82.725  14.441  170.799 1.00 54.41  ? 873  DC  H P     1 
ATOM   6005 O  OP1   . DC  D 2 18  ? 81.495  13.875  171.339 1.00 68.60  ? 873  DC  H OP1   1 
ATOM   6006 O  OP2   . DC  D 2 18  ? 82.828  15.708  170.064 1.00 48.93  ? 873  DC  H OP2   1 
ATOM   6007 O  "O5'" . DC  D 2 18  ? 83.660  14.567  172.065 1.00 44.12  ? 873  DC  H "O5'" 1 
ATOM   6008 C  "C5'" . DC  D 2 18  ? 83.751  13.484  172.965 1.00 36.94  ? 873  DC  H "C5'" 1 
ATOM   6009 C  "C4'" . DC  D 2 18  ? 84.637  13.892  174.100 1.00 36.45  ? 873  DC  H "C4'" 1 
ATOM   6010 O  "O4'" . DC  D 2 18  ? 85.975  14.034  173.585 1.00 29.55  ? 873  DC  H "O4'" 1 
ATOM   6011 C  "C3'" . DC  D 2 18  ? 84.252  15.250  174.692 1.00 37.58  ? 873  DC  H "C3'" 1 
ATOM   6012 O  "O3'" . DC  D 2 18  ? 83.928  15.123  176.058 1.00 43.30  ? 873  DC  H "O3'" 1 
ATOM   6013 C  "C2'" . DC  D 2 18  ? 85.486  16.134  174.478 1.00 36.47  ? 873  DC  H "C2'" 1 
ATOM   6014 C  "C1'" . DC  D 2 18  ? 86.593  15.133  174.181 1.00 28.07  ? 873  DC  H "C1'" 1 
ATOM   6015 N  N1    . DC  D 2 18  ? 87.591  15.638  173.222 1.00 25.90  ? 873  DC  H N1    1 
ATOM   6016 C  C2    . DC  D 2 18  ? 88.887  15.822  173.653 1.00 20.98  ? 873  DC  H C2    1 
ATOM   6017 O  O2    . DC  D 2 18  ? 89.160  15.571  174.848 1.00 30.09  ? 873  DC  H O2    1 
ATOM   6018 N  N3    . DC  D 2 18  ? 89.803  16.252  172.771 1.00 24.38  ? 873  DC  H N3    1 
ATOM   6019 C  C4    . DC  D 2 18  ? 89.460  16.500  171.502 1.00 26.05  ? 873  DC  H C4    1 
ATOM   6020 N  N4    . DC  D 2 18  ? 90.410  16.933  170.667 1.00 22.22  ? 873  DC  H N4    1 
ATOM   6021 C  C5    . DC  D 2 18  ? 88.130  16.326  171.040 1.00 28.19  ? 873  DC  H C5    1 
ATOM   6022 C  C6    . DC  D 2 18  ? 87.234  15.897  171.927 1.00 25.07  ? 873  DC  H C6    1 
ATOM   6023 O  "O5'" . DT  E 2 1   ? 115.705 40.620  135.990 1.00 83.29  ? 837  DT  B "O5'" 1 
ATOM   6024 C  "C5'" . DT  E 2 1   ? 114.310 40.871  135.890 1.00 77.22  ? 837  DT  B "C5'" 1 
ATOM   6025 C  "C4'" . DT  E 2 1   ? 113.539 39.574  135.707 1.00 77.54  ? 837  DT  B "C4'" 1 
ATOM   6026 O  "O4'" . DT  E 2 1   ? 114.257 38.701  134.790 1.00 75.25  ? 837  DT  B "O4'" 1 
ATOM   6027 C  "C3'" . DT  E 2 1   ? 113.324 38.755  136.986 1.00 74.08  ? 837  DT  B "C3'" 1 
ATOM   6028 O  "O3'" . DT  E 2 1   ? 111.995 38.209  136.989 1.00 68.19  ? 837  DT  B "O3'" 1 
ATOM   6029 C  "C2'" . DT  E 2 1   ? 114.393 37.666  136.870 1.00 66.34  ? 837  DT  B "C2'" 1 
ATOM   6030 C  "C1'" . DT  E 2 1   ? 114.377 37.423  135.373 1.00 68.79  ? 837  DT  B "C1'" 1 
ATOM   6031 N  N1    . DT  E 2 1   ? 115.608 36.754  134.838 1.00 78.00  ? 837  DT  B N1    1 
ATOM   6032 C  C2    . DT  E 2 1   ? 115.515 35.460  134.369 1.00 71.70  ? 837  DT  B C2    1 
ATOM   6033 O  O2    . DT  E 2 1   ? 114.477 34.828  134.367 1.00 66.89  ? 837  DT  B O2    1 
ATOM   6034 N  N3    . DT  E 2 1   ? 116.686 34.930  133.898 1.00 73.72  ? 837  DT  B N3    1 
ATOM   6035 C  C4    . DT  E 2 1   ? 117.921 35.550  133.844 1.00 81.71  ? 837  DT  B C4    1 
ATOM   6036 O  O4    . DT  E 2 1   ? 118.917 34.987  133.398 1.00 85.47  ? 837  DT  B O4    1 
ATOM   6037 C  C5    . DT  E 2 1   ? 117.956 36.909  134.350 1.00 81.72  ? 837  DT  B C5    1 
ATOM   6038 C  C7    . DT  E 2 1   ? 119.243 37.683  134.346 1.00 80.68  ? 837  DT  B C7    1 
ATOM   6039 C  C6    . DT  E 2 1   ? 116.811 37.440  134.819 1.00 79.34  ? 837  DT  B C6    1 
ATOM   6040 P  P     . DC  E 2 2   ? 111.336 37.633  138.340 1.00 67.06  ? 838  DC  B P     1 
ATOM   6041 O  OP1   . DC  E 2 2   ? 109.921 37.324  138.039 1.00 71.49  ? 838  DC  B OP1   1 
ATOM   6042 O  OP2   . DC  E 2 2   ? 111.652 38.531  139.472 1.00 68.29  ? 838  DC  B OP2   1 
ATOM   6043 O  "O5'" . DC  E 2 2   ? 112.136 36.274  138.602 1.00 62.08  ? 838  DC  B "O5'" 1 
ATOM   6044 C  "C5'" . DC  E 2 2   ? 112.078 35.199  137.660 1.00 59.91  ? 838  DC  B "C5'" 1 
ATOM   6045 C  "C4'" . DC  E 2 2   ? 112.516 33.905  138.316 1.00 48.72  ? 838  DC  B "C4'" 1 
ATOM   6046 O  "O4'" . DC  E 2 2   ? 113.897 34.019  138.774 1.00 49.68  ? 838  DC  B "O4'" 1 
ATOM   6047 C  "C3'" . DC  E 2 2   ? 111.697 33.520  139.538 1.00 40.47  ? 838  DC  B "C3'" 1 
ATOM   6048 O  "O3'" . DC  E 2 2   ? 111.532 32.142  139.595 1.00 44.14  ? 838  DC  B "O3'" 1 
ATOM   6049 C  "C2'" . DC  E 2 2   ? 112.533 33.994  140.705 1.00 51.87  ? 838  DC  B "C2'" 1 
ATOM   6050 C  "C1'" . DC  E 2 2   ? 113.956 33.885  140.183 1.00 63.04  ? 838  DC  B "C1'" 1 
ATOM   6051 N  N1    . DC  E 2 2   ? 114.812 34.962  140.750 1.00 88.79  ? 838  DC  B N1    1 
ATOM   6052 C  C2    . DC  E 2 2   ? 116.050 34.645  141.326 1.00 94.67  ? 838  DC  B C2    1 
ATOM   6053 O  O2    . DC  E 2 2   ? 116.447 33.469  141.304 1.00 91.08  ? 838  DC  B O2    1 
ATOM   6054 N  N3    . DC  E 2 2   ? 116.793 35.650  141.871 1.00 94.81  ? 838  DC  B N3    1 
ATOM   6055 C  C4    . DC  E 2 2   ? 116.327 36.908  141.870 1.00 93.20  ? 838  DC  B C4    1 
ATOM   6056 N  N4    . DC  E 2 2   ? 117.090 37.866  142.416 1.00 88.89  ? 838  DC  B N4    1 
ATOM   6057 C  C5    . DC  E 2 2   ? 115.059 37.238  141.309 1.00 91.09  ? 838  DC  B C5    1 
ATOM   6058 C  C6    . DC  E 2 2   ? 114.339 36.245  140.779 1.00 90.23  ? 838  DC  B C6    1 
ATOM   6059 P  P     . DT  E 2 3   ? 110.084 31.540  139.905 1.00 42.87  ? 839  DT  B P     1 
ATOM   6060 O  OP1   . DT  E 2 3   ? 109.082 32.626  139.891 1.00 54.47  ? 839  DT  B OP1   1 
ATOM   6061 O  OP2   . DT  E 2 3   ? 110.268 30.604  141.038 1.00 40.99  ? 839  DT  B OP2   1 
ATOM   6062 O  "O5'" . DT  E 2 3   ? 109.777 30.709  138.623 1.00 42.91  ? 839  DT  B "O5'" 1 
ATOM   6063 C  "C5'" . DT  E 2 3   ? 110.613 29.753  138.325 1.00 47.32  ? 839  DT  B "C5'" 1 
ATOM   6064 C  "C4'" . DT  E 2 3   ? 111.048 29.794  136.891 1.00 33.79  ? 839  DT  B "C4'" 1 
ATOM   6065 O  "O4'" . DT  E 2 3   ? 112.244 30.625  136.768 1.00 33.97  ? 839  DT  B "O4'" 1 
ATOM   6066 C  "C3'" . DT  E 2 3   ? 111.465 28.419  136.491 1.00 27.85  ? 839  DT  B "C3'" 1 
ATOM   6067 O  "O3'" . DT  E 2 3   ? 110.400 27.798  135.807 1.00 32.71  ? 839  DT  B "O3'" 1 
ATOM   6068 C  "C2'" . DT  E 2 3   ? 112.706 28.643  135.638 1.00 35.19  ? 839  DT  B "C2'" 1 
ATOM   6069 C  "C1'" . DT  E 2 3   ? 113.332 29.829  136.353 1.00 32.46  ? 839  DT  B "C1'" 1 
ATOM   6070 N  N1    . DT  E 2 3   ? 114.190 29.448  137.577 1.00 43.73  ? 839  DT  B N1    1 
ATOM   6071 C  C2    . DT  E 2 3   ? 115.379 28.785  137.378 1.00 29.55  ? 839  DT  B C2    1 
ATOM   6072 O  O2    . DT  E 2 3   ? 115.779 28.484  136.287 1.00 33.04  ? 839  DT  B O2    1 
ATOM   6073 N  N3    . DT  E 2 3   ? 116.077 28.479  138.519 1.00 36.37  ? 839  DT  B N3    1 
ATOM   6074 C  C4    . DT  E 2 3   ? 115.716 28.781  139.827 1.00 39.76  ? 839  DT  B C4    1 
ATOM   6075 O  O4    . DT  E 2 3   ? 116.411 28.465  140.789 1.00 41.16  ? 839  DT  B O4    1 
ATOM   6076 C  C5    . DT  E 2 3   ? 114.455 29.483  139.972 1.00 39.72  ? 839  DT  B C5    1 
ATOM   6077 C  C7    . DT  E 2 3   ? 113.947 29.859  141.329 1.00 39.50  ? 839  DT  B C7    1 
ATOM   6078 C  C6    . DT  E 2 3   ? 113.770 29.786  138.853 1.00 36.18  ? 839  DT  B C6    1 
ATOM   6079 P  P     . DA  E 2 4   ? 110.093 26.250  136.064 1.00 31.43  ? 840  DA  B P     1 
ATOM   6080 O  OP1   . DA  E 2 4   ? 109.908 26.027  137.518 1.00 27.07  ? 840  DA  B OP1   1 
ATOM   6081 O  OP2   . DA  E 2 4   ? 111.120 25.476  135.344 1.00 29.55  ? 840  DA  B OP2   1 
ATOM   6082 O  "O5'" . DA  E 2 4   ? 108.701 26.039  135.306 1.00 29.79  ? 840  DA  B "O5'" 1 
ATOM   6083 C  "C5'" . DA  E 2 4   ? 107.531 26.798  135.674 1.00 27.96  ? 840  DA  B "C5'" 1 
ATOM   6084 C  "C4'" . DA  E 2 4   ? 106.267 26.046  135.281 1.00 31.53  ? 840  DA  B "C4'" 1 
ATOM   6085 O  "O4'" . DA  E 2 4   ? 106.195 25.930  133.836 1.00 32.42  ? 840  DA  B "O4'" 1 
ATOM   6086 C  "C3'" . DA  E 2 4   ? 106.178 24.629  135.805 1.00 28.47  ? 840  DA  B "C3'" 1 
ATOM   6087 O  "O3'" . DA  E 2 4   ? 104.797 24.281  136.040 1.00 30.36  ? 840  DA  B "O3'" 1 
ATOM   6088 C  "C2'" . DA  E 2 4   ? 106.782 23.795  134.675 1.00 30.12  ? 840  DA  B "C2'" 1 
ATOM   6089 C  "C1'" . DA  E 2 4   ? 106.425 24.599  133.426 1.00 27.42  ? 840  DA  B "C1'" 1 
ATOM   6090 N  N9    . DA  E 2 4   ? 107.498 24.628  132.425 1.00 30.02  ? 840  DA  B N9    1 
ATOM   6091 C  C8    . DA  E 2 4   ? 108.845 24.674  132.666 1.00 30.36  ? 840  DA  B C8    1 
ATOM   6092 N  N7    . DA  E 2 4   ? 109.581 24.712  131.571 1.00 28.38  ? 840  DA  B N7    1 
ATOM   6093 C  C5    . DA  E 2 4   ? 108.649 24.689  130.540 1.00 30.28  ? 840  DA  B C5    1 
ATOM   6094 C  C6    . DA  E 2 4   ? 108.777 24.724  129.135 1.00 32.87  ? 840  DA  B C6    1 
ATOM   6095 N  N6    . DA  E 2 4   ? 109.949 24.773  128.498 1.00 25.07  ? 840  DA  B N6    1 
ATOM   6096 N  N1    . DA  E 2 4   ? 107.640 24.704  128.402 1.00 28.05  ? 840  DA  B N1    1 
ATOM   6097 C  C2    . DA  E 2 4   ? 106.466 24.658  129.041 1.00 38.38  ? 840  DA  B C2    1 
ATOM   6098 N  N3    . DA  E 2 4   ? 106.224 24.629  130.350 1.00 36.18  ? 840  DA  B N3    1 
ATOM   6099 C  C4    . DA  E 2 4   ? 107.362 24.646  131.050 1.00 34.51  ? 840  DA  B C4    1 
ATOM   6100 P  P     . DG  E 2 5   ? 104.386 22.850  136.610 1.00 33.15  ? 841  DG  B P     1 
ATOM   6101 O  OP1   . DG  E 2 5   ? 103.110 23.049  137.326 1.00 32.47  ? 841  DG  B OP1   1 
ATOM   6102 O  OP2   . DG  E 2 5   ? 105.521 22.202  137.313 1.00 34.48  ? 841  DG  B OP2   1 
ATOM   6103 O  "O5'" . DG  E 2 5   ? 104.188 21.954  135.315 1.00 36.98  ? 841  DG  B "O5'" 1 
ATOM   6104 C  "C5'" . DG  E 2 5   ? 103.148 22.234  134.401 1.00 34.02  ? 841  DG  B "C5'" 1 
ATOM   6105 C  "C4'" . DG  E 2 5   ? 103.226 21.253  133.260 1.00 28.71  ? 841  DG  B "C4'" 1 
ATOM   6106 O  "O4'" . DG  E 2 5   ? 104.351 21.608  132.402 1.00 27.37  ? 841  DG  B "O4'" 1 
ATOM   6107 C  "C3'" . DG  E 2 5   ? 103.461 19.801  133.694 1.00 30.94  ? 841  DG  B "C3'" 1 
ATOM   6108 O  "O3'" . DG  E 2 5   ? 102.650 18.929  132.933 1.00 31.93  ? 841  DG  B "O3'" 1 
ATOM   6109 C  "C2'" . DG  E 2 5   ? 104.941 19.580  133.392 1.00 31.04  ? 841  DG  B "C2'" 1 
ATOM   6110 C  "C1'" . DG  E 2 5   ? 105.085 20.429  132.149 1.00 29.45  ? 841  DG  B "C1'" 1 
ATOM   6111 N  N9    . DG  E 2 5   ? 106.463 20.767  131.797 1.00 38.44  ? 841  DG  B N9    1 
ATOM   6112 C  C8    . DG  E 2 5   ? 107.530 20.978  132.640 1.00 32.21  ? 841  DG  B C8    1 
ATOM   6113 N  N7    . DG  E 2 5   ? 108.642 21.252  131.993 1.00 28.06  ? 841  DG  B N7    1 
ATOM   6114 C  C5    . DG  E 2 5   ? 108.281 21.220  130.657 1.00 25.80  ? 841  DG  B C5    1 
ATOM   6115 C  C6    . DG  E 2 5   ? 109.056 21.433  129.486 1.00 26.97  ? 841  DG  B C6    1 
ATOM   6116 O  O6    . DG  E 2 5   ? 110.261 21.707  129.399 1.00 29.42  ? 841  DG  B O6    1 
ATOM   6117 N  N1    . DG  E 2 5   ? 108.282 21.297  128.327 1.00 28.69  ? 841  DG  B N1    1 
ATOM   6118 C  C2    . DG  E 2 5   ? 106.942 20.995  128.308 1.00 34.82  ? 841  DG  B C2    1 
ATOM   6119 N  N2    . DG  E 2 5   ? 106.361 20.899  127.104 1.00 31.66  ? 841  DG  B N2    1 
ATOM   6120 N  N3    . DG  E 2 5   ? 106.217 20.796  129.393 1.00 30.19  ? 841  DG  B N3    1 
ATOM   6121 C  C4    . DG  E 2 5   ? 106.948 20.914  130.523 1.00 37.07  ? 841  DG  B C4    1 
ATOM   6122 P  P     . DG  E 2 6   ? 102.073 17.579  133.591 1.00 40.45  ? 842  DG  B P     1 
ATOM   6123 O  OP1   . DG  E 2 6   ? 100.662 17.860  133.947 1.00 74.25  ? 842  DG  B OP1   1 
ATOM   6124 O  OP2   . DG  E 2 6   ? 102.973 17.022  134.617 1.00 60.72  ? 842  DG  B OP2   1 
ATOM   6125 O  "O5'" . DG  E 2 6   ? 102.133 16.535  132.442 1.00 52.51  ? 842  DG  B "O5'" 1 
ATOM   6126 C  "C5'" . DG  E 2 6   ? 103.343 15.913  132.206 1.00 52.95  ? 842  DG  B "C5'" 1 
ATOM   6127 C  "C4'" . DG  E 2 6   ? 103.788 16.240  130.820 1.00 36.69  ? 842  DG  B "C4'" 1 
ATOM   6128 O  "O4'" . DG  E 2 6   ? 104.771 17.284  130.849 1.00 42.89  ? 842  DG  B "O4'" 1 
ATOM   6129 C  "C3'" . DG  E 2 6   ? 104.463 15.105  130.116 1.00 41.61  ? 842  DG  B "C3'" 1 
ATOM   6130 O  "O3'" . DG  E 2 6   ? 103.459 14.285  129.581 1.00 38.30  ? 842  DG  B "O3'" 1 
ATOM   6131 C  "C2'" . DG  E 2 6   ? 105.246 15.835  129.022 1.00 45.17  ? 842  DG  B "C2'" 1 
ATOM   6132 C  "C1'" . DG  E 2 6   ? 105.507 17.213  129.648 1.00 47.35  ? 842  DG  B "C1'" 1 
ATOM   6133 N  N9    . DG  E 2 6   ? 106.911 17.498  129.937 1.00 38.65  ? 842  DG  B N9    1 
ATOM   6134 C  C8    . DG  E 2 6   ? 107.493 17.661  131.173 1.00 33.74  ? 842  DG  B C8    1 
ATOM   6135 N  N7    . DG  E 2 6   ? 108.762 17.941  131.111 1.00 36.80  ? 842  DG  B N7    1 
ATOM   6136 C  C5    . DG  E 2 6   ? 109.036 17.967  129.752 1.00 32.75  ? 842  DG  B C5    1 
ATOM   6137 C  C6    . DG  E 2 6   ? 110.249 18.215  129.070 1.00 30.58  ? 842  DG  B C6    1 
ATOM   6138 O  O6    . DG  E 2 6   ? 111.363 18.474  129.551 1.00 30.89  ? 842  DG  B O6    1 
ATOM   6139 N  N1    . DG  E 2 6   ? 110.088 18.139  127.689 1.00 29.45  ? 842  DG  B N1    1 
ATOM   6140 C  C2    . DG  E 2 6   ? 108.904 17.861  127.047 1.00 36.94  ? 842  DG  B C2    1 
ATOM   6141 N  N2    . DG  E 2 6   ? 108.941 17.832  125.700 1.00 33.43  ? 842  DG  B N2    1 
ATOM   6142 N  N3    . DG  E 2 6   ? 107.762 17.631  127.676 1.00 36.46  ? 842  DG  B N3    1 
ATOM   6143 C  C4    . DG  E 2 6   ? 107.905 17.700  129.020 1.00 36.13  ? 842  DG  B C4    1 
ATOM   6144 P  P     . DG  E 2 7   ? 103.520 12.695  129.734 1.00 44.53  ? 843  DG  B P     1 
ATOM   6145 O  OP1   . DG  E 2 7   ? 102.139 12.259  129.446 1.00 52.85  ? 843  DG  B OP1   1 
ATOM   6146 O  OP2   . DG  E 2 7   ? 104.176 12.272  131.004 1.00 36.26  ? 843  DG  B OP2   1 
ATOM   6147 O  "O5'" . DG  E 2 7   ? 104.446 12.262  128.533 1.00 43.64  ? 843  DG  B "O5'" 1 
ATOM   6148 C  "C5'" . DG  E 2 7   ? 105.746 11.782  128.765 1.00 39.99  ? 843  DG  B "C5'" 1 
ATOM   6149 C  "C4'" . DG  E 2 7   ? 106.635 12.245  127.632 1.00 38.71  ? 843  DG  B "C4'" 1 
ATOM   6150 O  "O4'" . DG  E 2 7   ? 107.102 13.592  127.891 1.00 38.48  ? 843  DG  B "O4'" 1 
ATOM   6151 C  "C3'" . DG  E 2 7   ? 107.881 11.425  127.417 1.00 33.41  ? 843  DG  B "C3'" 1 
ATOM   6152 O  "O3'" . DG  E 2 7   ? 107.551 10.312  126.571 1.00 31.00  ? 843  DG  B "O3'" 1 
ATOM   6153 C  "C2'" . DG  E 2 7   ? 108.789 12.418  126.695 1.00 33.95  ? 843  DG  B "C2'" 1 
ATOM   6154 C  "C1'" . DG  E 2 7   ? 108.371 13.769  127.295 1.00 39.58  ? 843  DG  B "C1'" 1 
ATOM   6155 N  N9    . DG  E 2 7   ? 109.299 14.235  128.315 1.00 35.17  ? 843  DG  B N9    1 
ATOM   6156 C  C8    . DG  E 2 7   ? 109.084 14.310  129.667 1.00 32.21  ? 843  DG  B C8    1 
ATOM   6157 N  N7    . DG  E 2 7   ? 110.121 14.757  130.332 1.00 31.45  ? 843  DG  B N7    1 
ATOM   6158 C  C5    . DG  E 2 7   ? 111.080 14.984  129.346 1.00 36.29  ? 843  DG  B C5    1 
ATOM   6159 C  C6    . DG  E 2 7   ? 112.416 15.476  129.450 1.00 35.71  ? 843  DG  B C6    1 
ATOM   6160 O  O6    . DG  E 2 7   ? 113.031 15.824  130.470 1.00 29.92  ? 843  DG  B O6    1 
ATOM   6161 N  N1    . DG  E 2 7   ? 113.039 15.544  128.200 1.00 25.57  ? 843  DG  B N1    1 
ATOM   6162 C  C2    . DG  E 2 7   ? 112.440 15.191  127.001 1.00 31.22  ? 843  DG  B C2    1 
ATOM   6163 N  N2    . DG  E 2 7   ? 113.186 15.318  125.884 1.00 25.99  ? 843  DG  B N2    1 
ATOM   6164 N  N3    . DG  E 2 7   ? 111.195 14.746  126.902 1.00 26.11  ? 843  DG  B N3    1 
ATOM   6165 C  C4    . DG  E 2 7   ? 110.584 14.662  128.105 1.00 30.74  ? 843  DG  B C4    1 
ATOM   6166 P  P     . DT  E 2 8   ? 108.486 9.021   126.521 1.00 37.06  ? 844  DT  B P     1 
ATOM   6167 O  OP1   . DT  E 2 8   ? 107.763 8.096   125.621 1.00 35.66  ? 844  DT  B OP1   1 
ATOM   6168 O  OP2   . DT  E 2 8   ? 108.876 8.581   127.885 1.00 38.09  ? 844  DT  B OP2   1 
ATOM   6169 O  "O5'" . DT  E 2 8   ? 109.818 9.517   125.776 1.00 35.57  ? 844  DT  B "O5'" 1 
ATOM   6170 C  "C5'" . DT  E 2 8   ? 109.789 9.823   124.374 1.00 33.09  ? 844  DT  B "C5'" 1 
ATOM   6171 C  "C4'" . DT  E 2 8   ? 111.182 10.178  123.892 1.00 42.32  ? 844  DT  B "C4'" 1 
ATOM   6172 O  "O4'" . DT  E 2 8   ? 111.643 11.339  124.618 1.00 35.18  ? 844  DT  B "O4'" 1 
ATOM   6173 C  "C3'" . DT  E 2 8   ? 112.214 9.088   124.141 1.00 41.65  ? 844  DT  B "C3'" 1 
ATOM   6174 O  "O3'" . DT  E 2 8   ? 112.463 8.393   122.953 1.00 36.98  ? 844  DT  B "O3'" 1 
ATOM   6175 C  "C2'" . DT  E 2 8   ? 113.473 9.828   124.573 1.00 45.55  ? 844  DT  B "C2'" 1 
ATOM   6176 C  "C1'" . DT  E 2 8   ? 113.020 11.236  124.885 1.00 43.43  ? 844  DT  B "C1'" 1 
ATOM   6177 N  N1    . DT  E 2 8   ? 113.258 11.593  126.279 1.00 32.14  ? 844  DT  B N1    1 
ATOM   6178 C  C2    . DT  E 2 8   ? 114.441 12.198  126.601 1.00 41.99  ? 844  DT  B C2    1 
ATOM   6179 O  O2    . DT  E 2 8   ? 115.297 12.457  125.777 1.00 35.06  ? 844  DT  B O2    1 
ATOM   6180 N  N3    . DT  E 2 8   ? 114.582 12.508  127.927 1.00 30.71  ? 844  DT  B N3    1 
ATOM   6181 C  C4    . DT  E 2 8   ? 113.678 12.266  128.939 1.00 26.58  ? 844  DT  B C4    1 
ATOM   6182 O  O4    . DT  E 2 8   ? 113.898 12.594  130.101 1.00 30.04  ? 844  DT  B O4    1 
ATOM   6183 C  C5    . DT  E 2 8   ? 112.453 11.607  128.531 1.00 38.60  ? 844  DT  B C5    1 
ATOM   6184 C  C7    . DT  E 2 8   ? 111.388 11.280  129.546 1.00 35.56  ? 844  DT  B C7    1 
ATOM   6185 C  C6    . DT  E 2 8   ? 112.310 11.295  127.234 1.00 34.50  ? 844  DT  B C6    1 
ATOM   6186 P  P     . DC  E 2 9   ? 113.239 6.989   123.007 1.00 48.18  ? 845  DC  B P     1 
ATOM   6187 O  OP1   . DC  E 2 9   ? 113.186 6.406   121.655 1.00 58.77  ? 845  DC  B OP1   1 
ATOM   6188 O  OP2   . DC  E 2 9   ? 112.730 6.274   124.193 1.00 54.58  ? 845  DC  B OP2   1 
ATOM   6189 O  "O5'" . DC  E 2 9   ? 114.741 7.356   123.394 1.00 41.11  ? 845  DC  B "O5'" 1 
ATOM   6190 C  "C5'" . DC  E 2 9   ? 115.561 8.129   122.521 1.00 47.25  ? 845  DC  B "C5'" 1 
ATOM   6191 C  "C4'" . DC  E 2 9   ? 116.837 8.528   123.246 1.00 47.68  ? 845  DC  B "C4'" 1 
ATOM   6192 O  "O4'" . DC  E 2 9   ? 116.500 9.233   124.458 1.00 40.71  ? 845  DC  B "O4'" 1 
ATOM   6193 C  "C3'" . DC  E 2 9   ? 117.717 7.353   123.679 1.00 46.08  ? 845  DC  B "C3'" 1 
ATOM   6194 O  "O3'" . DC  E 2 9   ? 118.966 7.427   123.031 1.00 61.06  ? 845  DC  B "O3'" 1 
ATOM   6195 C  "C2'" . DC  E 2 9   ? 117.865 7.510   125.197 1.00 34.73  ? 845  DC  B "C2'" 1 
ATOM   6196 C  "C1'" . DC  E 2 9   ? 117.468 8.961   125.427 1.00 40.09  ? 845  DC  B "C1'" 1 
ATOM   6197 N  N1    . DC  E 2 9   ? 116.874 9.192   126.787 1.00 42.01  ? 845  DC  B N1    1 
ATOM   6198 C  C2    . DC  E 2 9   ? 117.548 10.007  127.714 1.00 38.76  ? 845  DC  B C2    1 
ATOM   6199 O  O2    . DC  E 2 9   ? 118.610 10.549  127.383 1.00 35.72  ? 845  DC  B O2    1 
ATOM   6200 N  N3    . DC  E 2 9   ? 117.006 10.183  128.950 1.00 37.14  ? 845  DC  B N3    1 
ATOM   6201 C  C4    . DC  E 2 9   ? 115.856 9.582   129.266 1.00 42.64  ? 845  DC  B C4    1 
ATOM   6202 N  N4    . DC  E 2 9   ? 115.364 9.780   130.492 1.00 39.38  ? 845  DC  B N4    1 
ATOM   6203 C  C5    . DC  E 2 9   ? 115.163 8.744   128.341 1.00 41.08  ? 845  DC  B C5    1 
ATOM   6204 C  C6    . DC  E 2 9   ? 115.705 8.575   127.127 1.00 41.99  ? 845  DC  B C6    1 
ATOM   6205 P  P     . DC  E 2 10  ? 120.059 6.274   123.266 1.00 71.51  ? 846  DC  B P     1 
ATOM   6206 O  OP1   . DC  E 2 10  ? 120.806 6.175   121.995 1.00 67.74  ? 846  DC  B OP1   1 
ATOM   6207 O  OP2   . DC  E 2 10  ? 119.400 5.091   123.879 1.00 71.62  ? 846  DC  B OP2   1 
ATOM   6208 O  "O5'" . DC  E 2 10  ? 121.014 6.878   124.387 1.00 61.76  ? 846  DC  B "O5'" 1 
ATOM   6209 C  "C5'" . DC  E 2 10  ? 121.740 8.061   124.134 1.00 54.12  ? 846  DC  B "C5'" 1 
ATOM   6210 C  "C4'" . DC  E 2 10  ? 122.502 8.446   125.373 1.00 50.57  ? 846  DC  B "C4'" 1 
ATOM   6211 O  "O4'" . DC  E 2 10  ? 121.551 8.796   126.407 1.00 45.76  ? 846  DC  B "O4'" 1 
ATOM   6212 C  "C3'" . DC  E 2 10  ? 123.369 7.312   125.943 1.00 46.87  ? 846  DC  B "C3'" 1 
ATOM   6213 O  "O3'" . DC  E 2 10  ? 124.743 7.686   125.938 1.00 40.65  ? 846  DC  B "O3'" 1 
ATOM   6214 C  "C2'" . DC  E 2 10  ? 122.841 7.091   127.365 1.00 52.25  ? 846  DC  B "C2'" 1 
ATOM   6215 C  "C1'" . DC  E 2 10  ? 122.044 8.363   127.647 1.00 48.82  ? 846  DC  B "C1'" 1 
ATOM   6216 N  N1    . DC  E 2 10  ? 120.888 8.123   128.550 1.00 45.88  ? 846  DC  B N1    1 
ATOM   6217 C  C2    . DC  E 2 10  ? 120.897 8.655   129.839 1.00 41.40  ? 846  DC  B C2    1 
ATOM   6218 O  O2    . DC  E 2 10  ? 121.868 9.344   130.206 1.00 44.82  ? 846  DC  B O2    1 
ATOM   6219 N  N3    . DC  E 2 10  ? 119.840 8.410   130.653 1.00 38.12  ? 846  DC  B N3    1 
ATOM   6220 C  C4    . DC  E 2 10  ? 118.815 7.667   130.221 1.00 35.33  ? 846  DC  B C4    1 
ATOM   6221 N  N4    . DC  E 2 10  ? 117.800 7.454   131.062 1.00 34.07  ? 846  DC  B N4    1 
ATOM   6222 C  C5    . DC  E 2 10  ? 118.795 7.106   128.914 1.00 40.26  ? 846  DC  B C5    1 
ATOM   6223 C  C6    . DC  E 2 10  ? 119.845 7.352   128.121 1.00 51.13  ? 846  DC  B C6    1 
ATOM   6224 P  P     . DT  E 2 11  ? 125.868 6.650   126.435 1.00 49.09  ? 847  DT  B P     1 
ATOM   6225 O  OP1   . DT  E 2 11  ? 127.126 6.951   125.709 1.00 54.39  ? 847  DT  B OP1   1 
ATOM   6226 O  OP2   . DT  E 2 11  ? 125.259 5.301   126.414 1.00 49.97  ? 847  DT  B OP2   1 
ATOM   6227 O  "O5'" . DT  E 2 11  ? 126.102 7.025   127.972 1.00 46.41  ? 847  DT  B "O5'" 1 
ATOM   6228 C  "C5'" . DT  E 2 11  ? 126.473 8.333   128.338 1.00 45.80  ? 847  DT  B "C5'" 1 
ATOM   6229 C  "C4'" . DT  E 2 11  ? 126.657 8.424   129.837 1.00 56.36  ? 847  DT  B "C4'" 1 
ATOM   6230 O  "O4'" . DT  E 2 11  ? 125.365 8.346   130.497 1.00 59.91  ? 847  DT  B "O4'" 1 
ATOM   6231 C  "C3'" . DT  E 2 11  ? 127.506 7.304   130.447 1.00 57.97  ? 847  DT  B "C3'" 1 
ATOM   6232 O  "O3'" . DT  E 2 11  ? 128.307 7.843   131.477 1.00 66.80  ? 847  DT  B "O3'" 1 
ATOM   6233 C  "C2'" . DT  E 2 11  ? 126.452 6.349   131.004 1.00 59.45  ? 847  DT  B "C2'" 1 
ATOM   6234 C  "C1'" . DT  E 2 11  ? 125.422 7.350   131.497 1.00 57.56  ? 847  DT  B "C1'" 1 
ATOM   6235 N  N1    . DT  E 2 11  ? 124.068 6.792   131.682 1.00 48.94  ? 847  DT  B N1    1 
ATOM   6236 C  C2    . DT  E 2 11  ? 123.373 7.110   132.832 1.00 46.74  ? 847  DT  B C2    1 
ATOM   6237 O  O2    . DT  E 2 11  ? 123.829 7.830   133.704 1.00 39.80  ? 847  DT  B O2    1 
ATOM   6238 N  N3    . DT  E 2 11  ? 122.119 6.556   132.926 1.00 36.15  ? 847  DT  B N3    1 
ATOM   6239 C  C4    . DT  E 2 11  ? 121.503 5.739   131.995 1.00 38.69  ? 847  DT  B C4    1 
ATOM   6240 O  O4    . DT  E 2 11  ? 120.361 5.295   132.163 1.00 34.86  ? 847  DT  B O4    1 
ATOM   6241 C  C5    . DT  E 2 11  ? 122.297 5.440   130.804 1.00 42.96  ? 847  DT  B C5    1 
ATOM   6242 C  C7    . DT  E 2 11  ? 121.741 4.549   129.726 1.00 38.15  ? 847  DT  B C7    1 
ATOM   6243 C  C6    . DT  E 2 11  ? 123.528 5.975   130.709 1.00 38.80  ? 847  DT  B C6    1 
ATOM   6244 P  P     . DA  E 2 12  ? 129.660 7.109   131.933 1.00 72.71  ? 848  DA  B P     1 
ATOM   6245 O  OP1   . DA  E 2 12  ? 130.774 7.808   131.260 1.00 77.63  ? 848  DA  B OP1   1 
ATOM   6246 O  OP2   . DA  E 2 12  ? 129.486 5.637   131.788 1.00 66.71  ? 848  DA  B OP2   1 
ATOM   6247 O  "O5'" . DA  E 2 12  ? 129.745 7.440   133.489 1.00 67.62  ? 848  DA  B "O5'" 1 
ATOM   6248 C  "C5'" . DA  E 2 12  ? 128.759 8.260   134.088 1.00 64.21  ? 848  DA  B "C5'" 1 
ATOM   6249 C  "C4'" . DA  E 2 12  ? 128.327 7.676   135.415 1.00 58.42  ? 848  DA  B "C4'" 1 
ATOM   6250 O  "O4'" . DA  E 2 12  ? 126.984 7.137   135.302 1.00 49.78  ? 848  DA  B "O4'" 1 
ATOM   6251 C  "C3'" . DA  E 2 12  ? 129.208 6.535   135.922 1.00 62.37  ? 848  DA  B "C3'" 1 
ATOM   6252 O  "O3'" . DA  E 2 12  ? 129.504 6.744   137.284 1.00 69.99  ? 848  DA  B "O3'" 1 
ATOM   6253 C  "C2'" . DA  E 2 12  ? 128.347 5.283   135.704 1.00 61.38  ? 848  DA  B "C2'" 1 
ATOM   6254 C  "C1'" . DA  E 2 12  ? 126.944 5.844   135.865 1.00 56.72  ? 848  DA  B "C1'" 1 
ATOM   6255 N  N9    . DA  E 2 12  ? 125.913 5.080   135.168 1.00 44.71  ? 848  DA  B N9    1 
ATOM   6256 C  C8    . DA  E 2 12  ? 126.016 4.470   133.960 1.00 49.13  ? 848  DA  B C8    1 
ATOM   6257 N  N7    . DA  E 2 12  ? 124.912 3.870   133.571 1.00 53.48  ? 848  DA  B N7    1 
ATOM   6258 C  C5    . DA  E 2 12  ? 124.024 4.105   134.602 1.00 46.14  ? 848  DA  B C5    1 
ATOM   6259 C  C6    . DA  E 2 12  ? 122.676 3.734   134.799 1.00 35.38  ? 848  DA  B C6    1 
ATOM   6260 N  N6    . DA  E 2 12  ? 121.969 3.013   133.912 1.00 32.56  ? 848  DA  B N6    1 
ATOM   6261 N  N1    . DA  E 2 12  ? 122.081 4.125   135.946 1.00 38.49  ? 848  DA  B N1    1 
ATOM   6262 C  C2    . DA  E 2 12  ? 122.787 4.849   136.827 1.00 45.54  ? 848  DA  B C2    1 
ATOM   6263 N  N3    . DA  E 2 12  ? 124.054 5.267   136.748 1.00 52.32  ? 848  DA  B N3    1 
ATOM   6264 C  C4    . DA  E 2 12  ? 124.621 4.854   135.597 1.00 54.51  ? 848  DA  B C4    1 
ATOM   6265 P  P     . DG  E 2 13  ? 130.686 5.922   137.996 1.00 74.60  ? 849  DG  B P     1 
ATOM   6266 O  OP1   . DG  E 2 13  ? 131.726 6.896   138.395 1.00 74.50  ? 849  DG  B OP1   1 
ATOM   6267 O  OP2   . DG  E 2 13  ? 131.024 4.721   137.198 1.00 73.21  ? 849  DG  B OP2   1 
ATOM   6268 O  "O5'" . DG  E 2 13  ? 129.989 5.371   139.303 1.00 68.60  ? 849  DG  B "O5'" 1 
ATOM   6269 C  "C5'" . DG  E 2 13  ? 129.158 6.216   140.049 1.00 58.53  ? 849  DG  B "C5'" 1 
ATOM   6270 C  "C4'" . DG  E 2 13  ? 128.327 5.393   140.992 1.00 52.79  ? 849  DG  B "C4'" 1 
ATOM   6271 O  "O4'" . DG  E 2 13  ? 127.204 4.848   140.268 1.00 50.04  ? 849  DG  B "O4'" 1 
ATOM   6272 C  "C3'" . DG  E 2 13  ? 129.065 4.199   141.606 1.00 52.73  ? 849  DG  B "C3'" 1 
ATOM   6273 O  "O3'" . DG  E 2 13  ? 128.723 4.086   142.964 1.00 57.37  ? 849  DG  B "O3'" 1 
ATOM   6274 C  "C2'" . DG  E 2 13  ? 128.558 3.007   140.792 1.00 48.97  ? 849  DG  B "C2'" 1 
ATOM   6275 C  "C1'" . DG  E 2 13  ? 127.144 3.451   140.447 1.00 54.42  ? 849  DG  B "C1'" 1 
ATOM   6276 N  N9    . DG  E 2 13  ? 126.616 2.867   139.214 1.00 52.62  ? 849  DG  B N9    1 
ATOM   6277 C  C8    . DG  E 2 13  ? 127.274 2.702   138.016 1.00 51.39  ? 849  DG  B C8    1 
ATOM   6278 N  N7    . DG  E 2 13  ? 126.530 2.166   137.084 1.00 53.72  ? 849  DG  B N7    1 
ATOM   6279 C  C5    . DG  E 2 13  ? 125.296 1.974   137.701 1.00 51.41  ? 849  DG  B C5    1 
ATOM   6280 C  C6    . DG  E 2 13  ? 124.086 1.425   137.192 1.00 39.71  ? 849  DG  B C6    1 
ATOM   6281 O  O6    . DG  E 2 13  ? 123.853 0.988   136.049 1.00 37.98  ? 849  DG  B O6    1 
ATOM   6282 N  N1    . DG  E 2 13  ? 123.080 1.416   138.162 1.00 42.63  ? 849  DG  B N1    1 
ATOM   6283 C  C2    . DG  E 2 13  ? 123.225 1.881   139.450 1.00 46.73  ? 849  DG  B C2    1 
ATOM   6284 N  N2    . DG  E 2 13  ? 122.147 1.789   140.243 1.00 43.35  ? 849  DG  B N2    1 
ATOM   6285 N  N3    . DG  E 2 13  ? 124.352 2.395   139.934 1.00 48.02  ? 849  DG  B N3    1 
ATOM   6286 C  C4    . DG  E 2 13  ? 125.336 2.411   139.011 1.00 49.02  ? 849  DG  B C4    1 
ATOM   6287 P  P     . DG  E 2 14  ? 129.446 3.000   143.903 1.00 67.11  ? 850  DG  B P     1 
ATOM   6288 O  OP1   . DG  E 2 14  ? 129.538 3.644   145.233 1.00 73.07  ? 850  DG  B OP1   1 
ATOM   6289 O  OP2   . DG  E 2 14  ? 130.654 2.463   143.236 1.00 60.16  ? 850  DG  B OP2   1 
ATOM   6290 O  "O5'" . DG  E 2 14  ? 128.387 1.814   143.975 1.00 57.67  ? 850  DG  B "O5'" 1 
ATOM   6291 C  "C5'" . DG  E 2 14  ? 127.081 2.093   144.420 1.00 58.68  ? 850  DG  B "C5'" 1 
ATOM   6292 C  "C4'" . DG  E 2 14  ? 126.168 0.926   144.154 1.00 66.64  ? 850  DG  B "C4'" 1 
ATOM   6293 O  "O4'" . DG  E 2 14  ? 125.891 0.821   142.732 1.00 72.61  ? 850  DG  B "O4'" 1 
ATOM   6294 C  "C3'" . DG  E 2 14  ? 126.728 -0.443  144.563 1.00 70.17  ? 850  DG  B "C3'" 1 
ATOM   6295 O  "O3'" . DG  E 2 14  ? 125.689 -1.191  145.112 1.00 75.67  ? 850  DG  B "O3'" 1 
ATOM   6296 C  "C2'" . DG  E 2 14  ? 127.148 -1.035  143.228 1.00 69.22  ? 850  DG  B "C2'" 1 
ATOM   6297 C  "C1'" . DG  E 2 14  ? 125.987 -0.539  142.399 1.00 68.73  ? 850  DG  B "C1'" 1 
ATOM   6298 N  N9    . DG  E 2 14  ? 126.145 -0.704  140.966 1.00 60.86  ? 850  DG  B N9    1 
ATOM   6299 C  C8    . DG  E 2 14  ? 127.285 -0.531  140.217 1.00 54.09  ? 850  DG  B C8    1 
ATOM   6300 N  N7    . DG  E 2 14  ? 127.110 -0.778  138.949 1.00 49.60  ? 850  DG  B N7    1 
ATOM   6301 C  C5    . DG  E 2 14  ? 125.769 -1.151  138.859 1.00 49.81  ? 850  DG  B C5    1 
ATOM   6302 C  C6    . DG  E 2 14  ? 124.998 -1.536  137.734 1.00 46.13  ? 850  DG  B C6    1 
ATOM   6303 O  O6    . DG  E 2 14  ? 125.360 -1.624  136.548 1.00 46.29  ? 850  DG  B O6    1 
ATOM   6304 N  N1    . DG  E 2 14  ? 123.678 -1.830  138.093 1.00 39.48  ? 850  DG  B N1    1 
ATOM   6305 C  C2    . DG  E 2 14  ? 123.173 -1.754  139.377 1.00 44.53  ? 850  DG  B C2    1 
ATOM   6306 N  N2    . DG  E 2 14  ? 121.884 -2.079  139.541 1.00 41.07  ? 850  DG  B N2    1 
ATOM   6307 N  N3    . DG  E 2 14  ? 123.888 -1.398  140.430 1.00 46.24  ? 850  DG  B N3    1 
ATOM   6308 C  C4    . DG  E 2 14  ? 125.168 -1.106  140.094 1.00 49.87  ? 850  DG  B C4    1 
ATOM   6309 P  P     . DA  E 2 15  ? 125.957 -2.211  146.316 1.00 71.46  ? 851  DA  B P     1 
ATOM   6310 O  OP1   . DA  E 2 15  ? 125.925 -1.430  147.573 1.00 80.79  ? 851  DA  B OP1   1 
ATOM   6311 O  OP2   . DA  E 2 15  ? 127.145 -3.026  145.962 1.00 59.87  ? 851  DA  B OP2   1 
ATOM   6312 O  "O5'" . DA  E 2 15  ? 124.646 -3.109  146.289 1.00 59.28  ? 851  DA  B "O5'" 1 
ATOM   6313 C  "C5'" . DA  E 2 15  ? 123.395 -2.484  146.053 1.00 46.73  ? 851  DA  B "C5'" 1 
ATOM   6314 C  "C4'" . DA  E 2 15  ? 122.450 -3.422  145.329 1.00 50.08  ? 851  DA  B "C4'" 1 
ATOM   6315 O  "O4'" . DA  E 2 15  ? 122.741 -3.421  143.902 1.00 49.27  ? 851  DA  B "O4'" 1 
ATOM   6316 C  "C3'" . DA  E 2 15  ? 122.507 -4.874  145.773 1.00 47.89  ? 851  DA  B "C3'" 1 
ATOM   6317 O  "O3'" . DA  E 2 15  ? 121.174 -5.401  145.794 1.00 49.53  ? 851  DA  B "O3'" 1 
ATOM   6318 C  "C2'" . DA  E 2 15  ? 123.392 -5.526  144.690 1.00 41.02  ? 851  DA  B "C2'" 1 
ATOM   6319 C  "C1'" . DA  E 2 15  ? 122.980 -4.733  143.451 1.00 43.04  ? 851  DA  B "C1'" 1 
ATOM   6320 N  N9    . DA  E 2 15  ? 123.997 -4.649  142.398 1.00 45.51  ? 851  DA  B N9    1 
ATOM   6321 C  C8    . DA  E 2 15  ? 125.304 -4.247  142.533 1.00 43.79  ? 851  DA  B C8    1 
ATOM   6322 N  N7    . DA  E 2 15  ? 125.973 -4.234  141.400 1.00 40.21  ? 851  DA  B N7    1 
ATOM   6323 C  C5    . DA  E 2 15  ? 125.033 -4.643  140.455 1.00 40.92  ? 851  DA  B C5    1 
ATOM   6324 C  C6    . DA  E 2 15  ? 125.105 -4.838  139.057 1.00 36.32  ? 851  DA  B C6    1 
ATOM   6325 N  N6    . DA  E 2 15  ? 126.209 -4.635  138.341 1.00 33.83  ? 851  DA  B N6    1 
ATOM   6326 N  N1    . DA  E 2 15  ? 123.990 -5.249  138.423 1.00 38.04  ? 851  DA  B N1    1 
ATOM   6327 C  C2    . DA  E 2 15  ? 122.883 -5.456  139.137 1.00 38.98  ? 851  DA  B C2    1 
ATOM   6328 N  N3    . DA  E 2 15  ? 122.691 -5.302  140.441 1.00 38.44  ? 851  DA  B N3    1 
ATOM   6329 C  C4    . DA  E 2 15  ? 123.815 -4.892  141.049 1.00 41.90  ? 851  DA  B C4    1 
ATOM   6330 P  P     . DC  E 2 16  ? 120.817 -6.749  146.598 1.00 71.13  ? 852  DC  B P     1 
ATOM   6331 O  OP1   . DC  E 2 16  ? 119.703 -6.488  147.540 1.00 79.81  ? 852  DC  B OP1   1 
ATOM   6332 O  OP2   . DC  E 2 16  ? 122.081 -7.368  147.067 1.00 73.64  ? 852  DC  B OP2   1 
ATOM   6333 O  "O5'" . DC  E 2 16  ? 120.262 -7.696  145.461 1.00 85.29  ? 852  DC  B "O5'" 1 
ATOM   6334 C  "C5'" . DC  E 2 16  ? 121.028 -7.856  144.327 1.00 75.29  ? 852  DC  B "C5'" 1 
ATOM   6335 C  "C4'" . DC  E 2 16  ? 120.218 -8.361  143.180 1.00 58.48  ? 852  DC  B "C4'" 1 
ATOM   6336 O  "O4'" . DC  E 2 16  ? 120.889 -7.955  141.973 1.00 48.34  ? 852  DC  B "O4'" 1 
ATOM   6337 C  "C3'" . DC  E 2 16  ? 120.151 -9.871  143.113 1.00 56.05  ? 852  DC  B "C3'" 1 
ATOM   6338 O  "O3'" . DC  E 2 16  ? 119.005 -10.296 142.374 1.00 60.62  ? 852  DC  B "O3'" 1 
ATOM   6339 C  "C2'" . DC  E 2 16  ? 121.460 -10.211 142.406 1.00 50.65  ? 852  DC  B "C2'" 1 
ATOM   6340 C  "C1'" . DC  E 2 16  ? 121.617 -9.039  141.440 1.00 46.00  ? 852  DC  B "C1'" 1 
ATOM   6341 N  N1    . DC  E 2 16  ? 123.030 -8.615  141.237 1.00 41.82  ? 852  DC  B N1    1 
ATOM   6342 C  C2    . DC  E 2 16  ? 123.547 -8.592  139.942 1.00 40.77  ? 852  DC  B C2    1 
ATOM   6343 O  O2    . DC  E 2 16  ? 122.809 -8.897  139.001 1.00 40.13  ? 852  DC  B O2    1 
ATOM   6344 N  N3    . DC  E 2 16  ? 124.835 -8.219  139.749 1.00 40.27  ? 852  DC  B N3    1 
ATOM   6345 C  C4    . DC  E 2 16  ? 125.600 -7.902  140.785 1.00 44.01  ? 852  DC  B C4    1 
ATOM   6346 N  N4    . DC  E 2 16  ? 126.861 -7.542  140.532 1.00 40.87  ? 852  DC  B N4    1 
ATOM   6347 C  C5    . DC  E 2 16  ? 125.103 -7.934  142.129 1.00 38.61  ? 852  DC  B C5    1 
ATOM   6348 C  C6    . DC  E 2 16  ? 123.823 -8.301  142.309 1.00 38.10  ? 852  DC  B C6    1 
ATOM   6349 P  P     . DC  E 2 17  ? 118.555 -11.845 142.391 1.00 55.74  ? 853  DC  B P     1 
ATOM   6350 O  OP1   . DC  E 2 17  ? 117.104 -11.891 142.097 1.00 66.04  ? 853  DC  B OP1   1 
ATOM   6351 O  OP2   . DC  E 2 17  ? 119.067 -12.492 143.618 1.00 57.85  ? 853  DC  B OP2   1 
ATOM   6352 O  "O5'" . DC  E 2 17  ? 119.356 -12.479 141.160 1.00 61.19  ? 853  DC  B "O5'" 1 
ATOM   6353 C  "C5'" . DC  E 2 17  ? 119.141 -11.980 139.841 1.00 60.27  ? 853  DC  B "C5'" 1 
ATOM   6354 C  "C4'" . DC  E 2 17  ? 119.942 -12.776 138.828 1.00 63.67  ? 853  DC  B "C4'" 1 
ATOM   6355 O  "O4'" . DC  E 2 17  ? 121.268 -12.199 138.677 1.00 64.14  ? 853  DC  B "O4'" 1 
ATOM   6356 C  "C3'" . DC  E 2 17  ? 120.159 -14.252 139.178 1.00 68.04  ? 853  DC  B "C3'" 1 
ATOM   6357 O  "O3'" . DC  E 2 17  ? 119.983 -15.032 138.004 1.00 79.58  ? 853  DC  B "O3'" 1 
ATOM   6358 C  "C2'" . DC  E 2 17  ? 121.614 -14.282 139.664 1.00 60.70  ? 853  DC  B "C2'" 1 
ATOM   6359 C  "C1'" . DC  E 2 17  ? 122.233 -13.225 138.763 1.00 59.30  ? 853  DC  B "C1'" 1 
ATOM   6360 N  N1    . DC  E 2 17  ? 123.515 -12.630 139.273 1.00 56.22  ? 853  DC  B N1    1 
ATOM   6361 C  C2    . DC  E 2 17  ? 124.551 -12.358 138.367 1.00 53.52  ? 853  DC  B C2    1 
ATOM   6362 O  O2    . DC  E 2 17  ? 124.396 -12.636 137.170 1.00 56.20  ? 853  DC  B O2    1 
ATOM   6363 N  N3    . DC  E 2 17  ? 125.696 -11.801 138.824 1.00 42.22  ? 853  DC  B N3    1 
ATOM   6364 C  C4    . DC  E 2 17  ? 125.836 -11.524 140.119 1.00 47.48  ? 853  DC  B C4    1 
ATOM   6365 N  N4    . DC  E 2 17  ? 126.992 -10.974 140.512 1.00 38.65  ? 853  DC  B N4    1 
ATOM   6366 C  C5    . DC  E 2 17  ? 124.791 -11.783 141.064 1.00 42.66  ? 853  DC  B C5    1 
ATOM   6367 C  C6    . DC  E 2 17  ? 123.655 -12.328 140.599 1.00 49.08  ? 853  DC  B C6    1 
ATOM   6368 P  P     . DC  E 2 18  ? 119.453 -16.549 138.073 1.00 76.12  ? 854  DC  B P     1 
ATOM   6369 O  OP1   . DC  E 2 18  ? 118.188 -16.588 137.304 1.00 78.58  ? 854  DC  B OP1   1 
ATOM   6370 O  OP2   . DC  E 2 18  ? 119.469 -17.030 139.473 1.00 77.70  ? 854  DC  B OP2   1 
ATOM   6371 O  "O5'" . DC  E 2 18  ? 120.565 -17.340 137.245 1.00 82.21  ? 854  DC  B "O5'" 1 
ATOM   6372 C  "C5'" . DC  E 2 18  ? 120.999 -16.816 135.991 1.00 78.13  ? 854  DC  B "C5'" 1 
ATOM   6373 C  "C4'" . DC  E 2 18  ? 122.382 -17.323 135.642 1.00 71.67  ? 854  DC  B "C4'" 1 
ATOM   6374 O  "O4'" . DC  E 2 18  ? 123.355 -16.340 136.020 1.00 65.04  ? 854  DC  B "O4'" 1 
ATOM   6375 C  "C3'" . DC  E 2 18  ? 122.793 -18.580 136.376 1.00 70.51  ? 854  DC  B "C3'" 1 
ATOM   6376 O  "O3'" . DC  E 2 18  ? 122.372 -19.721 135.640 1.00 78.17  ? 854  DC  B "O3'" 1 
ATOM   6377 C  "C2'" . DC  E 2 18  ? 124.320 -18.477 136.429 1.00 65.15  ? 854  DC  B "C2'" 1 
ATOM   6378 C  "C1'" . DC  E 2 18  ? 124.590 -16.979 136.258 1.00 63.72  ? 854  DC  B "C1'" 1 
ATOM   6379 N  N1    . DC  E 2 18  ? 125.224 -16.344 137.447 1.00 62.94  ? 854  DC  B N1    1 
ATOM   6380 C  C2    . DC  E 2 18  ? 126.393 -15.590 137.279 1.00 52.04  ? 854  DC  B C2    1 
ATOM   6381 O  O2    . DC  E 2 18  ? 126.879 -15.475 136.144 1.00 47.46  ? 854  DC  B O2    1 
ATOM   6382 N  N3    . DC  E 2 18  ? 126.961 -15.010 138.366 1.00 45.98  ? 854  DC  B N3    1 
ATOM   6383 C  C4    . DC  E 2 18  ? 126.408 -15.170 139.571 1.00 49.70  ? 854  DC  B C4    1 
ATOM   6384 N  N4    . DC  E 2 18  ? 127.004 -14.587 140.608 1.00 42.10  ? 854  DC  B N4    1 
ATOM   6385 C  C5    . DC  E 2 18  ? 125.214 -15.934 139.762 1.00 57.87  ? 854  DC  B C5    1 
ATOM   6386 C  C6    . DC  E 2 18  ? 124.662 -16.497 138.682 1.00 60.11  ? 854  DC  B C6    1 
ATOM   6387 O  "O5'" . DC  F 2 2   ? 140.026 -22.519 142.897 1.00 71.44  ? 857  DC  C "O5'" 1 
ATOM   6388 C  "C5'" . DC  F 2 2   ? 141.131 -23.093 143.596 1.00 73.81  ? 857  DC  C "C5'" 1 
ATOM   6389 C  "C4'" . DC  F 2 2   ? 140.884 -23.174 145.106 1.00 84.69  ? 857  DC  C "C4'" 1 
ATOM   6390 O  "O4'" . DC  F 2 2   ? 142.132 -23.564 145.751 1.00 94.62  ? 857  DC  C "O4'" 1 
ATOM   6391 C  "C3'" . DC  F 2 2   ? 140.447 -21.863 145.790 1.00 86.23  ? 857  DC  C "C3'" 1 
ATOM   6392 O  "O3'" . DC  F 2 2   ? 139.060 -21.883 146.079 1.00 88.14  ? 857  DC  C "O3'" 1 
ATOM   6393 C  "C2'" . DC  F 2 2   ? 141.264 -21.824 147.088 1.00 86.86  ? 857  DC  C "C2'" 1 
ATOM   6394 C  "C1'" . DC  F 2 2   ? 142.511 -22.622 146.737 1.00 94.36  ? 857  DC  C "C1'" 1 
ATOM   6395 N  N1    . DC  F 2 2   ? 143.668 -21.774 146.220 1.00 96.33  ? 857  DC  C N1    1 
ATOM   6396 C  C2    . DC  F 2 2   ? 144.858 -21.682 146.968 1.00 96.63  ? 857  DC  C C2    1 
ATOM   6397 O  O2    . DC  F 2 2   ? 144.958 -22.303 148.041 1.00 96.57  ? 857  DC  C O2    1 
ATOM   6398 N  N3    . DC  F 2 2   ? 145.875 -20.916 146.489 1.00 90.46  ? 857  DC  C N3    1 
ATOM   6399 C  C4    . DC  F 2 2   ? 145.737 -20.264 145.330 1.00 82.76  ? 857  DC  C C4    1 
ATOM   6400 N  N4    . DC  F 2 2   ? 146.767 -19.523 144.896 1.00 79.69  ? 857  DC  C N4    1 
ATOM   6401 C  C5    . DC  F 2 2   ? 144.543 -20.345 144.564 1.00 84.17  ? 857  DC  C C5    1 
ATOM   6402 C  C6    . DC  F 2 2   ? 143.547 -21.092 145.039 1.00 87.94  ? 857  DC  C C6    1 
ATOM   6403 P  P     . DT  F 2 3   ? 138.129 -20.676 145.572 1.00 96.04  ? 858  DT  C P     1 
ATOM   6404 O  OP1   . DT  F 2 3   ? 136.941 -21.285 144.931 1.00 99.25  ? 858  DT  C OP1   1 
ATOM   6405 O  OP2   . DT  F 2 3   ? 139.013 -19.763 144.815 1.00 99.00  ? 858  DT  C OP2   1 
ATOM   6406 O  "O5'" . DT  F 2 3   ? 137.642 -19.935 146.909 1.00 84.40  ? 858  DT  C "O5'" 1 
ATOM   6407 C  "C5'" . DT  F 2 3   ? 137.893 -18.548 147.077 1.00 58.04  ? 858  DT  C "C5'" 1 
ATOM   6408 C  "C4'" . DT  F 2 3   ? 136.608 -17.745 147.030 1.00 48.98  ? 858  DT  C "C4'" 1 
ATOM   6409 O  "O4'" . DT  F 2 3   ? 136.511 -16.926 148.229 1.00 42.88  ? 858  DT  C "O4'" 1 
ATOM   6410 C  "C3'" . DT  F 2 3   ? 136.501 -16.762 145.872 1.00 43.41  ? 858  DT  C "C3'" 1 
ATOM   6411 O  "O3'" . DT  F 2 3   ? 135.096 -16.501 145.609 1.00 41.76  ? 858  DT  C "O3'" 1 
ATOM   6412 C  "C2'" . DT  F 2 3   ? 137.217 -15.537 146.460 1.00 45.80  ? 858  DT  C "C2'" 1 
ATOM   6413 C  "C1'" . DT  F 2 3   ? 136.698 -15.563 147.897 1.00 42.34  ? 858  DT  C "C1'" 1 
ATOM   6414 N  N1    . DT  F 2 3   ? 137.609 -14.927 148.939 1.00 43.11  ? 858  DT  C N1    1 
ATOM   6415 C  C2    . DT  F 2 3   ? 137.132 -13.861 149.689 1.00 42.45  ? 858  DT  C C2    1 
ATOM   6416 O  O2    . DT  F 2 3   ? 136.019 -13.379 149.544 1.00 41.85  ? 858  DT  C O2    1 
ATOM   6417 N  N3    . DT  F 2 3   ? 138.018 -13.369 150.613 1.00 42.99  ? 858  DT  C N3    1 
ATOM   6418 C  C4    . DT  F 2 3   ? 139.298 -13.827 150.875 1.00 43.74  ? 858  DT  C C4    1 
ATOM   6419 O  O4    . DT  F 2 3   ? 140.007 -13.323 151.741 1.00 44.28  ? 858  DT  C O4    1 
ATOM   6420 C  C5    . DT  F 2 3   ? 139.736 -14.947 150.072 1.00 43.95  ? 858  DT  C C5    1 
ATOM   6421 C  C7    . DT  F 2 3   ? 141.109 -15.528 150.282 1.00 44.92  ? 858  DT  C C7    1 
ATOM   6422 C  C6    . DT  F 2 3   ? 138.884 -15.442 149.154 1.00 43.46  ? 858  DT  C C6    1 
ATOM   6423 P  P     . DA  F 2 4   ? 134.549 -16.010 144.181 1.00 45.60  ? 859  DA  C P     1 
ATOM   6424 O  OP1   . DA  F 2 4   ? 134.656 -14.542 144.212 1.00 81.62  ? 859  DA  C OP1   1 
ATOM   6425 O  OP2   . DA  F 2 4   ? 133.232 -16.609 143.924 1.00 72.23  ? 859  DA  C OP2   1 
ATOM   6426 O  "O5'" . DA  F 2 4   ? 135.603 -16.472 143.091 1.00 64.35  ? 859  DA  C "O5'" 1 
ATOM   6427 C  "C5'" . DA  F 2 4   ? 136.465 -15.474 142.495 1.00 46.60  ? 859  DA  C "C5'" 1 
ATOM   6428 C  "C4'" . DA  F 2 4   ? 135.921 -14.914 141.179 1.00 49.60  ? 859  DA  C "C4'" 1 
ATOM   6429 O  "O4'" . DA  F 2 4   ? 134.733 -15.633 140.757 1.00 45.27  ? 859  DA  C "O4'" 1 
ATOM   6430 C  "C3'" . DA  F 2 4   ? 135.520 -13.419 141.192 1.00 42.66  ? 859  DA  C "C3'" 1 
ATOM   6431 O  "O3'" . DA  F 2 4   ? 135.836 -12.858 139.948 1.00 51.97  ? 859  DA  C "O3'" 1 
ATOM   6432 C  "C2'" . DA  F 2 4   ? 134.007 -13.502 141.324 1.00 48.61  ? 859  DA  C "C2'" 1 
ATOM   6433 C  "C1'" . DA  F 2 4   ? 133.750 -14.669 140.389 1.00 56.02  ? 859  DA  C "C1'" 1 
ATOM   6434 N  N9    . DA  F 2 4   ? 132.424 -15.266 140.525 1.00 53.71  ? 859  DA  C N9    1 
ATOM   6435 C  C8    . DA  F 2 4   ? 131.649 -15.296 141.648 1.00 52.64  ? 859  DA  C C8    1 
ATOM   6436 N  N7    . DA  F 2 4   ? 130.515 -15.922 141.489 1.00 48.41  ? 859  DA  C N7    1 
ATOM   6437 C  C5    . DA  F 2 4   ? 130.543 -16.336 140.171 1.00 49.84  ? 859  DA  C C5    1 
ATOM   6438 C  C6    . DA  F 2 4   ? 129.621 -17.055 139.388 1.00 50.36  ? 859  DA  C C6    1 
ATOM   6439 N  N6    . DA  F 2 4   ? 128.443 -17.496 139.859 1.00 44.45  ? 859  DA  C N6    1 
ATOM   6440 N  N1    . DA  F 2 4   ? 129.955 -17.303 138.103 1.00 46.01  ? 859  DA  C N1    1 
ATOM   6441 C  C2    . DA  F 2 4   ? 131.135 -16.860 137.643 1.00 51.43  ? 859  DA  C C2    1 
ATOM   6442 N  N3    . DA  F 2 4   ? 132.085 -16.179 138.285 1.00 46.17  ? 859  DA  C N3    1 
ATOM   6443 C  C4    . DA  F 2 4   ? 131.718 -15.944 139.559 1.00 49.86  ? 859  DA  C C4    1 
ATOM   6444 P  P     . DG  F 2 5   ? 136.627 -11.467 139.800 1.00 40.16  ? 860  DG  C P     1 
ATOM   6445 O  OP1   . DG  F 2 5   ? 138.035 -11.738 140.128 1.00 44.30  ? 860  DG  C OP1   1 
ATOM   6446 O  OP2   . DG  F 2 5   ? 135.899 -10.374 140.485 1.00 43.75  ? 860  DG  C OP2   1 
ATOM   6447 O  "O5'" . DG  F 2 5   ? 136.529 -11.198 138.238 1.00 40.18  ? 860  DG  C "O5'" 1 
ATOM   6448 C  "C5'" . DG  F 2 5   ? 137.089 -12.142 137.342 1.00 40.97  ? 860  DG  C "C5'" 1 
ATOM   6449 C  "C4'" . DG  F 2 5   ? 136.251 -12.244 136.084 1.00 53.02  ? 860  DG  C "C4'" 1 
ATOM   6450 O  "O4'" . DG  F 2 5   ? 134.929 -12.761 136.385 1.00 42.98  ? 860  DG  C "O4'" 1 
ATOM   6451 C  "C3'" . DG  F 2 5   ? 136.031 -10.937 135.344 1.00 54.69  ? 860  DG  C "C3'" 1 
ATOM   6452 O  "O3'" . DG  F 2 5   ? 136.063 -11.211 133.977 1.00 67.07  ? 860  DG  C "O3'" 1 
ATOM   6453 C  "C2'" . DG  F 2 5   ? 134.638 -10.484 135.815 1.00 49.58  ? 860  DG  C "C2'" 1 
ATOM   6454 C  "C1'" . DG  F 2 5   ? 133.926 -11.812 136.043 1.00 44.87  ? 860  DG  C "C1'" 1 
ATOM   6455 N  N9    . DG  F 2 5   ? 132.969 -11.820 137.143 1.00 51.00  ? 860  DG  C N9    1 
ATOM   6456 C  C8    . DG  F 2 5   ? 133.091 -11.198 138.359 1.00 38.67  ? 860  DG  C C8    1 
ATOM   6457 N  N7    . DG  F 2 5   ? 132.101 -11.457 139.175 1.00 40.43  ? 860  DG  C N7    1 
ATOM   6458 C  C5    . DG  F 2 5   ? 131.282 -12.315 138.458 1.00 44.71  ? 860  DG  C C5    1 
ATOM   6459 C  C6    . DG  F 2 5   ? 130.061 -12.935 138.822 1.00 45.76  ? 860  DG  C C6    1 
ATOM   6460 O  O6    . DG  F 2 5   ? 129.441 -12.844 139.887 1.00 42.84  ? 860  DG  C O6    1 
ATOM   6461 N  N1    . DG  F 2 5   ? 129.564 -13.735 137.798 1.00 41.98  ? 860  DG  C N1    1 
ATOM   6462 C  C2    . DG  F 2 5   ? 130.170 -13.918 136.579 1.00 49.31  ? 860  DG  C C2    1 
ATOM   6463 N  N2    . DG  F 2 5   ? 129.540 -14.726 135.713 1.00 55.61  ? 860  DG  C N2    1 
ATOM   6464 N  N3    . DG  F 2 5   ? 131.319 -13.354 136.231 1.00 54.71  ? 860  DG  C N3    1 
ATOM   6465 C  C4    . DG  F 2 5   ? 131.811 -12.563 137.214 1.00 56.55  ? 860  DG  C C4    1 
ATOM   6466 P  P     . DG  F 2 6   ? 135.917 -10.040 132.900 1.00 64.53  ? 861  DG  C P     1 
ATOM   6467 O  OP1   . DG  F 2 6   ? 136.748 -10.469 131.758 1.00 57.76  ? 861  DG  C OP1   1 
ATOM   6468 O  OP2   . DG  F 2 6   ? 136.099 -8.718  133.554 1.00 72.75  ? 861  DG  C OP2   1 
ATOM   6469 O  "O5'" . DG  F 2 6   ? 134.392 -10.148 132.485 1.00 60.63  ? 861  DG  C "O5'" 1 
ATOM   6470 C  "C5'" . DG  F 2 6   ? 133.942 -11.324 131.878 1.00 53.65  ? 861  DG  C "C5'" 1 
ATOM   6471 C  "C4'" . DG  F 2 6   ? 132.453 -11.270 131.709 1.00 57.48  ? 861  DG  C "C4'" 1 
ATOM   6472 O  "O4'" . DG  F 2 6   ? 131.831 -11.344 133.003 1.00 53.33  ? 861  DG  C "O4'" 1 
ATOM   6473 C  "C3'" . DG  F 2 6   ? 131.925 -9.989  131.047 1.00 57.35  ? 861  DG  C "C3'" 1 
ATOM   6474 O  "O3'" . DG  F 2 6   ? 131.085 -10.359 129.979 1.00 57.55  ? 861  DG  C "O3'" 1 
ATOM   6475 C  "C2'" . DG  F 2 6   ? 131.152 -9.287  132.169 1.00 54.72  ? 861  DG  C "C2'" 1 
ATOM   6476 C  "C1'" . DG  F 2 6   ? 130.745 -10.467 133.035 1.00 53.50  ? 861  DG  C "C1'" 1 
ATOM   6477 N  N9    . DG  F 2 6   ? 130.492 -10.129 134.428 1.00 52.96  ? 861  DG  C N9    1 
ATOM   6478 C  C8    . DG  F 2 6   ? 131.228 -9.291  135.235 1.00 50.88  ? 861  DG  C C8    1 
ATOM   6479 N  N7    . DG  F 2 6   ? 130.754 -9.195  136.448 1.00 51.38  ? 861  DG  C N7    1 
ATOM   6480 C  C5    . DG  F 2 6   ? 129.640 -10.031 136.439 1.00 42.16  ? 861  DG  C C5    1 
ATOM   6481 C  C6    . DG  F 2 6   ? 128.715 -10.330 137.465 1.00 41.84  ? 861  DG  C C6    1 
ATOM   6482 O  O6    . DG  F 2 6   ? 128.706 -9.918  138.634 1.00 47.02  ? 861  DG  C O6    1 
ATOM   6483 N  N1    . DG  F 2 6   ? 127.733 -11.224 137.027 1.00 40.66  ? 861  DG  C N1    1 
ATOM   6484 C  C2    . DG  F 2 6   ? 127.659 -11.751 135.755 1.00 45.21  ? 861  DG  C C2    1 
ATOM   6485 N  N2    . DG  F 2 6   ? 126.649 -12.596 135.513 1.00 50.14  ? 861  DG  C N2    1 
ATOM   6486 N  N3    . DG  F 2 6   ? 128.516 -11.471 134.791 1.00 42.78  ? 861  DG  C N3    1 
ATOM   6487 C  C4    . DG  F 2 6   ? 129.478 -10.615 135.203 1.00 43.81  ? 861  DG  C C4    1 
ATOM   6488 P  P     . DG  F 2 7   ? 130.411 -9.259  129.025 1.00 58.83  ? 862  DG  C P     1 
ATOM   6489 O  OP1   . DG  F 2 7   ? 130.592 -9.781  127.663 1.00 59.43  ? 862  DG  C OP1   1 
ATOM   6490 O  OP2   . DG  F 2 7   ? 130.799 -7.880  129.419 1.00 42.93  ? 862  DG  C OP2   1 
ATOM   6491 O  "O5'" . DG  F 2 7   ? 128.874 -9.388  129.374 1.00 61.44  ? 862  DG  C "O5'" 1 
ATOM   6492 C  "C5'" . DG  F 2 7   ? 128.296 -10.665 129.446 1.00 60.89  ? 862  DG  C "C5'" 1 
ATOM   6493 C  "C4'" . DG  F 2 7   ? 126.931 -10.571 130.075 1.00 67.86  ? 862  DG  C "C4'" 1 
ATOM   6494 O  "O4'" . DG  F 2 7   ? 127.079 -10.353 131.493 1.00 65.36  ? 862  DG  C "O4'" 1 
ATOM   6495 C  "C3'" . DG  F 2 7   ? 126.064 -9.421  129.550 1.00 72.02  ? 862  DG  C "C3'" 1 
ATOM   6496 O  "O3'" . DG  F 2 7   ? 124.772 -9.916  129.255 1.00 76.31  ? 862  DG  C "O3'" 1 
ATOM   6497 C  "C2'" . DG  F 2 7   ? 126.050 -8.417  130.711 1.00 60.40  ? 862  DG  C "C2'" 1 
ATOM   6498 C  "C1'" . DG  F 2 7   ? 126.194 -9.350  131.901 1.00 63.53  ? 862  DG  C "C1'" 1 
ATOM   6499 N  N9    . DG  F 2 7   ? 126.731 -8.717  133.103 1.00 57.21  ? 862  DG  C N9    1 
ATOM   6500 C  C8    . DG  F 2 7   ? 127.879 -7.967  133.221 1.00 53.87  ? 862  DG  C C8    1 
ATOM   6501 N  N7    . DG  F 2 7   ? 128.093 -7.533  134.435 1.00 48.87  ? 862  DG  C N7    1 
ATOM   6502 C  C5    . DG  F 2 7   ? 127.024 -8.040  135.168 1.00 43.23  ? 862  DG  C C5    1 
ATOM   6503 C  C6    . DG  F 2 7   ? 126.712 -7.903  136.544 1.00 44.74  ? 862  DG  C C6    1 
ATOM   6504 O  O6    . DG  F 2 7   ? 127.346 -7.286  137.415 1.00 39.57  ? 862  DG  C O6    1 
ATOM   6505 N  N1    . DG  F 2 7   ? 125.530 -8.580  136.873 1.00 43.28  ? 862  DG  C N1    1 
ATOM   6506 C  C2    . DG  F 2 7   ? 124.753 -9.297  135.972 1.00 43.44  ? 862  DG  C C2    1 
ATOM   6507 N  N2    . DG  F 2 7   ? 123.649 -9.883  136.457 1.00 41.48  ? 862  DG  C N2    1 
ATOM   6508 N  N3    . DG  F 2 7   ? 125.038 -9.421  134.685 1.00 37.47  ? 862  DG  C N3    1 
ATOM   6509 C  C4    . DG  F 2 7   ? 126.180 -8.770  134.357 1.00 44.45  ? 862  DG  C C4    1 
ATOM   6510 P  P     . DT  F 2 8   ? 123.652 -8.962  128.615 1.00 78.49  ? 863  DT  C P     1 
ATOM   6511 O  OP1   . DT  F 2 8   ? 122.884 -9.819  127.687 1.00 85.02  ? 863  DT  C OP1   1 
ATOM   6512 O  OP2   . DT  F 2 8   ? 124.245 -7.671  128.178 1.00 61.82  ? 863  DT  C OP2   1 
ATOM   6513 O  "O5'" . DT  F 2 8   ? 122.700 -8.650  129.842 1.00 70.89  ? 863  DT  C "O5'" 1 
ATOM   6514 C  "C5'" . DT  F 2 8   ? 122.189 -9.712  130.599 1.00 59.11  ? 863  DT  C "C5'" 1 
ATOM   6515 C  "C4'" . DT  F 2 8   ? 121.402 -9.171  131.757 1.00 51.59  ? 863  DT  C "C4'" 1 
ATOM   6516 O  "O4'" . DT  F 2 8   ? 122.306 -8.662  132.756 1.00 46.06  ? 863  DT  C "O4'" 1 
ATOM   6517 C  "C3'" . DT  F 2 8   ? 120.456 -8.025  131.393 1.00 49.73  ? 863  DT  C "C3'" 1 
ATOM   6518 O  "O3'" . DT  F 2 8   ? 119.150 -8.430  131.753 1.00 56.19  ? 863  DT  C "O3'" 1 
ATOM   6519 C  "C2'" . DT  F 2 8   ? 120.977 -6.819  132.208 1.00 45.30  ? 863  DT  C "C2'" 1 
ATOM   6520 C  "C1'" . DT  F 2 8   ? 121.770 -7.497  133.324 1.00 43.06  ? 863  DT  C "C1'" 1 
ATOM   6521 N  N1    . DT  F 2 8   ? 122.921 -6.697  133.889 1.00 43.80  ? 863  DT  C N1    1 
ATOM   6522 C  C2    . DT  F 2 8   ? 122.981 -6.478  135.249 1.00 40.16  ? 863  DT  C C2    1 
ATOM   6523 O  O2    . DT  F 2 8   ? 122.129 -6.858  136.023 1.00 36.20  ? 863  DT  C O2    1 
ATOM   6524 N  N3    . DT  F 2 8   ? 124.077 -5.777  135.675 1.00 33.86  ? 863  DT  C N3    1 
ATOM   6525 C  C4    . DT  F 2 8   ? 125.103 -5.270  134.903 1.00 43.64  ? 863  DT  C C4    1 
ATOM   6526 O  O4    . DT  F 2 8   ? 126.048 -4.643  135.393 1.00 37.68  ? 863  DT  C O4    1 
ATOM   6527 C  C5    . DT  F 2 8   ? 124.992 -5.540  133.482 1.00 43.82  ? 863  DT  C C5    1 
ATOM   6528 C  C7    . DT  F 2 8   ? 126.053 -5.052  132.539 1.00 45.07  ? 863  DT  C C7    1 
ATOM   6529 C  C6    . DT  F 2 8   ? 123.925 -6.248  133.050 1.00 40.65  ? 863  DT  C C6    1 
ATOM   6530 P  P     . DC  F 2 9   ? 117.880 -7.463  131.620 1.00 58.64  ? 864  DC  C P     1 
ATOM   6531 O  OP1   . DC  F 2 9   ? 116.766 -8.399  131.342 1.00 65.73  ? 864  DC  C OP1   1 
ATOM   6532 O  OP2   . DC  F 2 9   ? 118.159 -6.306  130.736 1.00 57.47  ? 864  DC  C OP2   1 
ATOM   6533 O  "O5'" . DC  F 2 9   ? 117.706 -6.908  133.102 1.00 59.90  ? 864  DC  C "O5'" 1 
ATOM   6534 C  "C5'" . DC  F 2 9   ? 117.738 -7.814  134.192 1.00 48.23  ? 864  DC  C "C5'" 1 
ATOM   6535 C  "C4'" . DC  F 2 9   ? 117.644 -7.055  135.497 1.00 54.61  ? 864  DC  C "C4'" 1 
ATOM   6536 O  "O4'" . DC  F 2 9   ? 118.919 -6.407  135.794 1.00 47.89  ? 864  DC  C "O4'" 1 
ATOM   6537 C  "C3'" . DC  F 2 9   ? 116.589 -5.956  135.511 1.00 50.44  ? 864  DC  C "C3'" 1 
ATOM   6538 O  "O3'" . DC  F 2 9   ? 115.874 -6.033  136.752 1.00 57.53  ? 864  DC  C "O3'" 1 
ATOM   6539 C  "C2'" . DC  F 2 9   ? 117.432 -4.667  135.364 1.00 51.04  ? 864  DC  C "C2'" 1 
ATOM   6540 C  "C1'" . DC  F 2 9   ? 118.709 -5.047  136.111 1.00 50.45  ? 864  DC  C "C1'" 1 
ATOM   6541 N  N1    . DC  F 2 9   ? 119.955 -4.288  135.694 1.00 40.28  ? 864  DC  C N1    1 
ATOM   6542 C  C2    . DC  F 2 9   ? 120.789 -3.680  136.661 1.00 38.02  ? 864  DC  C C2    1 
ATOM   6543 O  O2    . DC  F 2 9   ? 120.464 -3.702  137.863 1.00 35.44  ? 864  DC  C O2    1 
ATOM   6544 N  N3    . DC  F 2 9   ? 121.917 -3.042  136.245 1.00 37.07  ? 864  DC  C N3    1 
ATOM   6545 C  C4    . DC  F 2 9   ? 122.232 -3.009  134.950 1.00 46.15  ? 864  DC  C C4    1 
ATOM   6546 N  N4    . DC  F 2 9   ? 123.351 -2.364  134.592 1.00 43.24  ? 864  DC  C N4    1 
ATOM   6547 C  C5    . DC  F 2 9   ? 121.412 -3.635  133.962 1.00 45.51  ? 864  DC  C C5    1 
ATOM   6548 C  C6    . DC  F 2 9   ? 120.303 -4.257  134.376 1.00 44.73  ? 864  DC  C C6    1 
ATOM   6549 P  P     . DC  F 2 10  ? 114.495 -5.234  136.986 1.00 58.12  ? 865  DC  C P     1 
ATOM   6550 O  OP1   . DC  F 2 10  ? 113.497 -6.192  137.513 1.00 66.87  ? 865  DC  C OP1   1 
ATOM   6551 O  OP2   . DC  F 2 10  ? 114.218 -4.412  135.784 1.00 57.75  ? 865  DC  C OP2   1 
ATOM   6552 O  "O5'" . DC  F 2 10  ? 114.861 -4.246  138.177 1.00 52.17  ? 865  DC  C "O5'" 1 
ATOM   6553 C  "C5'" . DC  F 2 10  ? 116.133 -3.687  138.209 1.00 55.73  ? 865  DC  C "C5'" 1 
ATOM   6554 C  "C4'" . DC  F 2 10  ? 116.413 -3.024  139.521 1.00 57.92  ? 865  DC  C "C4'" 1 
ATOM   6555 O  "O4'" . DC  F 2 10  ? 117.753 -2.477  139.467 1.00 45.37  ? 865  DC  C "O4'" 1 
ATOM   6556 C  "C3'" . DC  F 2 10  ? 115.524 -1.838  139.800 1.00 51.00  ? 865  DC  C "C3'" 1 
ATOM   6557 O  "O3'" . DC  F 2 10  ? 115.553 -1.540  141.202 1.00 59.74  ? 865  DC  C "O3'" 1 
ATOM   6558 C  "C2'" . DC  F 2 10  ? 116.208 -0.765  138.956 1.00 42.95  ? 865  DC  C "C2'" 1 
ATOM   6559 C  "C1'" . DC  F 2 10  ? 117.684 -1.088  139.203 1.00 45.98  ? 865  DC  C "C1'" 1 
ATOM   6560 N  N1    . DC  F 2 10  ? 118.605 -0.770  138.054 1.00 41.87  ? 865  DC  C N1    1 
ATOM   6561 C  C2    . DC  F 2 10  ? 119.783 -0.042  138.305 1.00 42.52  ? 865  DC  C C2    1 
ATOM   6562 O  O2    . DC  F 2 10  ? 120.032 0.328   139.462 1.00 41.76  ? 865  DC  C O2    1 
ATOM   6563 N  N3    . DC  F 2 10  ? 120.617 0.236   137.277 1.00 39.88  ? 865  DC  C N3    1 
ATOM   6564 C  C4    . DC  F 2 10  ? 120.320 -0.182  136.044 1.00 40.26  ? 865  DC  C C4    1 
ATOM   6565 N  N4    . DC  F 2 10  ? 121.183 0.120   135.071 1.00 39.14  ? 865  DC  C N4    1 
ATOM   6566 C  C5    . DC  F 2 10  ? 119.123 -0.923  135.757 1.00 36.25  ? 865  DC  C C5    1 
ATOM   6567 C  C6    . DC  F 2 10  ? 118.302 -1.190  136.784 1.00 36.15  ? 865  DC  C C6    1 
ATOM   6568 P  P     . DT  F 2 11  ? 114.460 -0.561  141.873 1.00 54.53  ? 866  DT  C P     1 
ATOM   6569 O  OP1   . DT  F 2 11  ? 114.402 -0.892  143.315 1.00 50.24  ? 866  DT  C OP1   1 
ATOM   6570 O  OP2   . DT  F 2 11  ? 113.217 -0.554  141.061 1.00 39.92  ? 866  DT  C OP2   1 
ATOM   6571 O  "O5'" . DT  F 2 11  ? 115.130 0.883   141.730 1.00 50.32  ? 866  DT  C "O5'" 1 
ATOM   6572 C  "C5'" . DT  F 2 11  ? 116.310 1.149   142.448 1.00 43.83  ? 866  DT  C "C5'" 1 
ATOM   6573 C  "C4'" . DT  F 2 11  ? 117.030 2.347   141.889 1.00 47.02  ? 866  DT  C "C4'" 1 
ATOM   6574 O  "O4'" . DT  F 2 11  ? 117.561 2.052   140.586 1.00 47.44  ? 866  DT  C "O4'" 1 
ATOM   6575 C  "C3'" . DT  F 2 11  ? 116.168 3.606   141.701 1.00 47.17  ? 866  DT  C "C3'" 1 
ATOM   6576 O  "O3'" . DT  F 2 11  ? 116.413 4.487   142.788 1.00 38.14  ? 866  DT  C "O3'" 1 
ATOM   6577 C  "C2'" . DT  F 2 11  ? 116.639 4.183   140.344 1.00 40.47  ? 866  DT  C "C2'" 1 
ATOM   6578 C  "C1'" . DT  F 2 11  ? 117.839 3.292   140.002 1.00 48.11  ? 866  DT  C "C1'" 1 
ATOM   6579 N  N1    . DT  F 2 11  ? 118.115 3.102   138.551 1.00 43.47  ? 866  DT  C N1    1 
ATOM   6580 C  C2    . DT  F 2 11  ? 119.328 3.516   138.072 1.00 44.50  ? 866  DT  C C2    1 
ATOM   6581 O  O2    . DT  F 2 11  ? 120.171 4.044   138.779 1.00 43.37  ? 866  DT  C O2    1 
ATOM   6582 N  N3    . DT  F 2 11  ? 119.523 3.303   136.733 1.00 43.62  ? 866  DT  C N3    1 
ATOM   6583 C  C4    . DT  F 2 11  ? 118.643 2.712   135.847 1.00 39.34  ? 866  DT  C C4    1 
ATOM   6584 O  O4    . DT  F 2 11  ? 118.918 2.553   134.669 1.00 47.90  ? 866  DT  C O4    1 
ATOM   6585 C  C5    . DT  F 2 11  ? 117.381 2.295   136.411 1.00 38.33  ? 866  DT  C C5    1 
ATOM   6586 C  C7    . DT  F 2 11  ? 116.345 1.643   135.538 1.00 35.95  ? 866  DT  C C7    1 
ATOM   6587 C  C6    . DT  F 2 11  ? 117.180 2.498   137.730 1.00 34.35  ? 866  DT  C C6    1 
ATOM   6588 P  P     . DA  F 2 12  ? 115.728 5.942   142.870 1.00 35.01  ? 867  DA  C P     1 
ATOM   6589 O  OP1   . DA  F 2 12  ? 115.517 6.254   144.302 1.00 30.65  ? 867  DA  C OP1   1 
ATOM   6590 O  OP2   . DA  F 2 12  ? 114.582 6.010   141.939 1.00 30.91  ? 867  DA  C OP2   1 
ATOM   6591 O  "O5'" . DA  F 2 12  ? 116.872 6.898   142.319 1.00 34.57  ? 867  DA  C "O5'" 1 
ATOM   6592 C  "C5'" . DA  F 2 12  ? 118.151 6.869   142.918 1.00 35.37  ? 867  DA  C "C5'" 1 
ATOM   6593 C  "C4'" . DA  F 2 12  ? 119.018 7.959   142.337 1.00 37.21  ? 867  DA  C "C4'" 1 
ATOM   6594 O  "O4'" . DA  F 2 12  ? 119.482 7.562   141.021 1.00 35.53  ? 867  DA  C "O4'" 1 
ATOM   6595 C  "C3'" . DA  F 2 12  ? 118.320 9.302   142.163 1.00 34.09  ? 867  DA  C "C3'" 1 
ATOM   6596 O  "O3'" . DA  F 2 12  ? 119.209 10.311  142.543 1.00 37.60  ? 867  DA  C "O3'" 1 
ATOM   6597 C  "C2'" . DA  F 2 12  ? 117.995 9.356   140.667 1.00 32.92  ? 867  DA  C "C2'" 1 
ATOM   6598 C  "C1'" . DA  F 2 12  ? 119.126 8.534   140.059 1.00 35.57  ? 867  DA  C "C1'" 1 
ATOM   6599 N  N9    . DA  F 2 12  ? 118.752 7.837   138.826 1.00 36.77  ? 867  DA  C N9    1 
ATOM   6600 C  C8    . DA  F 2 12  ? 117.571 7.192   138.565 1.00 39.58  ? 867  DA  C C8    1 
ATOM   6601 N  N7    . DA  F 2 12  ? 117.514 6.653   137.370 1.00 43.13  ? 867  DA  C N7    1 
ATOM   6602 C  C5    . DA  F 2 12  ? 118.743 6.954   136.807 1.00 44.23  ? 867  DA  C C5    1 
ATOM   6603 C  C6    . DA  F 2 12  ? 119.308 6.661   135.549 1.00 40.21  ? 867  DA  C C6    1 
ATOM   6604 N  N6    . DA  F 2 12  ? 118.670 5.962   134.604 1.00 33.19  ? 867  DA  C N6    1 
ATOM   6605 N  N1    . DA  F 2 12  ? 120.561 7.110   135.302 1.00 42.77  ? 867  DA  C N1    1 
ATOM   6606 C  C2    . DA  F 2 12  ? 121.199 7.799   136.259 1.00 42.95  ? 867  DA  C C2    1 
ATOM   6607 N  N3    . DA  F 2 12  ? 120.772 8.136   137.482 1.00 37.47  ? 867  DA  C N3    1 
ATOM   6608 C  C4    . DA  F 2 12  ? 119.525 7.678   137.693 1.00 41.26  ? 867  DA  C C4    1 
ATOM   6609 P  P     . DG  F 2 13  ? 118.776 11.841  142.481 1.00 40.48  ? 868  DG  C P     1 
ATOM   6610 O  OP1   . DG  F 2 13  ? 119.465 12.467  143.626 1.00 38.08  ? 868  DG  C OP1   1 
ATOM   6611 O  OP2   . DG  F 2 13  ? 117.318 11.950  142.275 1.00 39.93  ? 868  DG  C OP2   1 
ATOM   6612 O  "O5'" . DG  F 2 13  ? 119.449 12.331  141.139 1.00 44.41  ? 868  DG  C "O5'" 1 
ATOM   6613 C  "C5'" . DG  F 2 13  ? 120.845 12.219  140.998 1.00 45.38  ? 868  DG  C "C5'" 1 
ATOM   6614 C  "C4'" . DG  F 2 13  ? 121.257 12.613  139.607 1.00 39.07  ? 868  DG  C "C4'" 1 
ATOM   6615 O  "O4'" . DG  F 2 13  ? 120.788 11.620  138.672 1.00 45.83  ? 868  DG  C "O4'" 1 
ATOM   6616 C  "C3'" . DG  F 2 13  ? 120.679 13.950  139.135 1.00 42.02  ? 868  DG  C "C3'" 1 
ATOM   6617 O  "O3'" . DG  F 2 13  ? 121.727 14.741  138.633 1.00 54.23  ? 868  DG  C "O3'" 1 
ATOM   6618 C  "C2'" . DG  F 2 13  ? 119.703 13.552  138.026 1.00 40.30  ? 868  DG  C "C2'" 1 
ATOM   6619 C  "C1'" . DG  F 2 13  ? 120.353 12.283  137.520 1.00 42.26  ? 868  DG  C "C1'" 1 
ATOM   6620 N  N9    . DG  F 2 13  ? 119.457 11.417  136.769 1.00 35.59  ? 868  DG  C N9    1 
ATOM   6621 C  C8    . DG  F 2 13  ? 118.189 11.017  137.123 1.00 38.48  ? 868  DG  C C8    1 
ATOM   6622 N  N7    . DG  F 2 13  ? 117.624 10.243  136.229 1.00 36.12  ? 868  DG  C N7    1 
ATOM   6623 C  C5    . DG  F 2 13  ? 118.582 10.124  135.222 1.00 32.83  ? 868  DG  C C5    1 
ATOM   6624 C  C6    . DG  F 2 13  ? 118.540 9.409   133.994 1.00 31.61  ? 868  DG  C C6    1 
ATOM   6625 O  O6    . DG  F 2 13  ? 117.620 8.722   133.538 1.00 38.69  ? 868  DG  C O6    1 
ATOM   6626 N  N1    . DG  F 2 13  ? 119.722 9.556   133.270 1.00 34.11  ? 868  DG  C N1    1 
ATOM   6627 C  C2    . DG  F 2 13  ? 120.807 10.301  133.676 1.00 43.57  ? 868  DG  C C2    1 
ATOM   6628 N  N2    . DG  F 2 13  ? 121.857 10.326  132.838 1.00 44.94  ? 868  DG  C N2    1 
ATOM   6629 N  N3    . DG  F 2 13  ? 120.862 10.977  134.822 1.00 39.55  ? 868  DG  C N3    1 
ATOM   6630 C  C4    . DG  F 2 13  ? 119.713 10.842  135.540 1.00 38.45  ? 868  DG  C C4    1 
ATOM   6631 P  P     . DG  F 2 14  ? 121.480 16.264  138.204 1.00 50.92  ? 869  DG  C P     1 
ATOM   6632 O  OP1   . DG  F 2 14  ? 122.395 17.057  139.045 1.00 44.43  ? 869  DG  C OP1   1 
ATOM   6633 O  OP2   . DG  F 2 14  ? 120.028 16.556  138.180 1.00 68.67  ? 869  DG  C OP2   1 
ATOM   6634 O  "O5'" . DG  F 2 14  ? 121.969 16.307  136.691 1.00 43.17  ? 869  DG  C "O5'" 1 
ATOM   6635 C  "C5'" . DG  F 2 14  ? 123.035 15.469  136.263 1.00 53.51  ? 869  DG  C "C5'" 1 
ATOM   6636 C  "C4'" . DG  F 2 14  ? 123.212 15.593  134.769 1.00 61.45  ? 869  DG  C "C4'" 1 
ATOM   6637 O  "O4'" . DG  F 2 14  ? 122.468 14.536  134.098 1.00 67.73  ? 869  DG  C "O4'" 1 
ATOM   6638 C  "C3'" . DG  F 2 14  ? 122.689 16.907  134.202 1.00 59.20  ? 869  DG  C "C3'" 1 
ATOM   6639 O  "O3'" . DG  F 2 14  ? 123.535 17.366  133.191 1.00 73.25  ? 869  DG  C "O3'" 1 
ATOM   6640 C  "C2'" . DG  F 2 14  ? 121.319 16.536  133.657 1.00 62.00  ? 869  DG  C "C2'" 1 
ATOM   6641 C  "C1'" . DG  F 2 14  ? 121.532 15.103  133.205 1.00 64.43  ? 869  DG  C "C1'" 1 
ATOM   6642 N  N9    . DG  F 2 14  ? 120.300 14.325  133.244 1.00 52.11  ? 869  DG  C N9    1 
ATOM   6643 C  C8    . DG  F 2 14  ? 119.350 14.334  134.237 1.00 49.59  ? 869  DG  C C8    1 
ATOM   6644 N  N7    . DG  F 2 14  ? 118.333 13.559  133.988 1.00 44.62  ? 869  DG  C N7    1 
ATOM   6645 C  C5    . DG  F 2 14  ? 118.624 13.016  132.741 1.00 43.61  ? 869  DG  C C5    1 
ATOM   6646 C  C6    . DG  F 2 14  ? 117.885 12.099  131.958 1.00 38.93  ? 869  DG  C C6    1 
ATOM   6647 O  O6    . DG  F 2 14  ? 116.789 11.575  132.225 1.00 38.56  ? 869  DG  C O6    1 
ATOM   6648 N  N1    . DG  F 2 14  ? 118.529 11.815  130.755 1.00 34.33  ? 869  DG  C N1    1 
ATOM   6649 C  C2    . DG  F 2 14  ? 119.744 12.336  130.372 1.00 35.46  ? 869  DG  C C2    1 
ATOM   6650 N  N2    . DG  F 2 14  ? 120.215 11.934  129.189 1.00 42.46  ? 869  DG  C N2    1 
ATOM   6651 N  N3    . DG  F 2 14  ? 120.447 13.197  131.099 1.00 44.00  ? 869  DG  C N3    1 
ATOM   6652 C  C4    . DG  F 2 14  ? 119.827 13.485  132.270 1.00 32.24  ? 869  DG  C C4    1 
ATOM   6653 P  P     . DA  F 2 15  ? 123.351 18.852  132.605 1.00 71.90  ? 870  DA  C P     1 
ATOM   6654 O  OP1   . DA  F 2 15  ? 124.604 19.572  132.914 1.00 66.76  ? 870  DA  C OP1   1 
ATOM   6655 O  OP2   . DA  F 2 15  ? 122.033 19.413  132.990 1.00 48.36  ? 870  DA  C OP2   1 
ATOM   6656 O  "O5'" . DA  F 2 15  ? 123.295 18.598  131.039 1.00 58.80  ? 870  DA  C "O5'" 1 
ATOM   6657 C  "C5'" . DA  F 2 15  ? 123.884 17.427  130.496 1.00 42.42  ? 870  DA  C "C5'" 1 
ATOM   6658 C  "C4'" . DA  F 2 15  ? 123.348 17.198  129.107 1.00 35.97  ? 870  DA  C "C4'" 1 
ATOM   6659 O  "O4'" . DA  F 2 15  ? 122.223 16.293  129.173 1.00 33.61  ? 870  DA  C "O4'" 1 
ATOM   6660 C  "C3'" . DA  F 2 15  ? 122.854 18.462  128.423 1.00 37.31  ? 870  DA  C "C3'" 1 
ATOM   6661 O  "O3'" . DA  F 2 15  ? 123.357 18.478  127.100 1.00 38.92  ? 870  DA  C "O3'" 1 
ATOM   6662 C  "C2'" . DA  F 2 15  ? 121.321 18.347  128.482 1.00 31.97  ? 870  DA  C "C2'" 1 
ATOM   6663 C  "C1'" . DA  F 2 15  ? 121.106 16.836  128.518 1.00 32.59  ? 870  DA  C "C1'" 1 
ATOM   6664 N  N9    . DA  F 2 15  ? 119.928 16.428  129.287 1.00 34.72  ? 870  DA  C N9    1 
ATOM   6665 C  C8    . DA  F 2 15  ? 119.615 16.801  130.572 1.00 39.05  ? 870  DA  C C8    1 
ATOM   6666 N  N7    . DA  F 2 15  ? 118.508 16.263  131.023 1.00 28.48  ? 870  DA  C N7    1 
ATOM   6667 C  C5    . DA  F 2 15  ? 118.072 15.470  129.966 1.00 31.19  ? 870  DA  C C5    1 
ATOM   6668 C  C6    . DA  F 2 15  ? 116.945 14.638  129.803 1.00 33.82  ? 870  DA  C C6    1 
ATOM   6669 N  N6    . DA  F 2 15  ? 116.027 14.448  130.766 1.00 26.46  ? 870  DA  C N6    1 
ATOM   6670 N  N1    . DA  F 2 15  ? 116.808 13.989  128.620 1.00 35.17  ? 870  DA  C N1    1 
ATOM   6671 C  C2    . DA  F 2 15  ? 117.728 14.170  127.671 1.00 32.85  ? 870  DA  C C2    1 
ATOM   6672 N  N3    . DA  F 2 15  ? 118.827 14.922  127.708 1.00 33.31  ? 870  DA  C N3    1 
ATOM   6673 C  C4    . DA  F 2 15  ? 118.942 15.553  128.896 1.00 28.13  ? 870  DA  C C4    1 
ATOM   6674 P  P     . DC  F 2 16  ? 123.084 19.708  126.130 1.00 38.19  ? 871  DC  C P     1 
ATOM   6675 O  OP1   . DC  F 2 16  ? 124.130 19.557  125.079 1.00 35.22  ? 871  DC  C OP1   1 
ATOM   6676 O  OP2   . DC  F 2 16  ? 122.945 20.990  126.857 1.00 37.32  ? 871  DC  C OP2   1 
ATOM   6677 O  "O5'" . DC  F 2 16  ? 121.670 19.367  125.474 1.00 35.81  ? 871  DC  C "O5'" 1 
ATOM   6678 C  "C5'" . DC  F 2 16  ? 121.494 18.124  124.815 1.00 41.52  ? 871  DC  C "C5'" 1 
ATOM   6679 C  "C4'" . DC  F 2 16  ? 120.030 17.891  124.482 1.00 28.97  ? 871  DC  C "C4'" 1 
ATOM   6680 O  "O4'" . DC  F 2 16  ? 119.326 17.518  125.667 1.00 31.21  ? 871  DC  C "O4'" 1 
ATOM   6681 C  "C3'" . DC  F 2 16  ? 119.276 19.106  123.940 1.00 28.80  ? 871  DC  C "C3'" 1 
ATOM   6682 O  "O3'" . DC  F 2 16  ? 119.226 19.014  122.524 1.00 30.25  ? 871  DC  C "O3'" 1 
ATOM   6683 C  "C2'" . DC  F 2 16  ? 117.871 18.998  124.578 1.00 28.07  ? 871  DC  C "C2'" 1 
ATOM   6684 C  "C1'" . DC  F 2 16  ? 117.963 17.708  125.403 1.00 30.45  ? 871  DC  C "C1'" 1 
ATOM   6685 N  N1    . DC  F 2 16  ? 117.247 17.760  126.709 1.00 39.90  ? 871  DC  C N1    1 
ATOM   6686 C  C2    . DC  F 2 16  ? 116.163 16.904  126.920 1.00 32.66  ? 871  DC  C C2    1 
ATOM   6687 O  O2    . DC  F 2 16  ? 115.820 16.138  126.018 1.00 29.05  ? 871  DC  C O2    1 
ATOM   6688 N  N3    . DC  F 2 16  ? 115.520 16.944  128.097 1.00 34.13  ? 871  DC  C N3    1 
ATOM   6689 C  C4    . DC  F 2 16  ? 115.910 17.791  129.052 1.00 27.47  ? 871  DC  C C4    1 
ATOM   6690 N  N4    . DC  F 2 16  ? 115.231 17.767  130.206 1.00 25.99  ? 871  DC  C N4    1 
ATOM   6691 C  C5    . DC  F 2 16  ? 117.020 18.681  128.871 1.00 31.95  ? 871  DC  C C5    1 
ATOM   6692 C  C6    . DC  F 2 16  ? 117.659 18.628  127.689 1.00 36.07  ? 871  DC  C C6    1 
ATOM   6693 P  P     . DC  F 2 17  ? 118.449 20.087  121.626 1.00 34.80  ? 872  DC  C P     1 
ATOM   6694 O  OP1   . DC  F 2 17  ? 119.031 19.883  120.271 1.00 36.45  ? 872  DC  C OP1   1 
ATOM   6695 O  OP2   . DC  F 2 17  ? 118.435 21.415  122.281 1.00 34.53  ? 872  DC  C OP2   1 
ATOM   6696 O  "O5'" . DC  F 2 17  ? 116.953 19.565  121.593 1.00 34.97  ? 872  DC  C "O5'" 1 
ATOM   6697 C  "C5'" . DC  F 2 17  ? 116.675 18.279  121.078 1.00 34.04  ? 872  DC  C "C5'" 1 
ATOM   6698 C  "C4'" . DC  F 2 17  ? 115.188 18.023  121.122 1.00 32.75  ? 872  DC  C "C4'" 1 
ATOM   6699 O  "O4'" . DC  F 2 17  ? 114.755 17.854  122.498 1.00 32.38  ? 872  DC  C "O4'" 1 
ATOM   6700 C  "C3'" . DC  F 2 17  ? 114.335 19.140  120.531 1.00 35.22  ? 872  DC  C "C3'" 1 
ATOM   6701 O  "O3'" . DC  F 2 17  ? 113.419 18.576  119.611 1.00 47.09  ? 872  DC  C "O3'" 1 
ATOM   6702 C  "C2'" . DC  F 2 17  ? 113.618 19.746  121.742 1.00 33.39  ? 872  DC  C "C2'" 1 
ATOM   6703 C  "C1'" . DC  F 2 17  ? 113.557 18.558  122.696 1.00 35.92  ? 872  DC  C "C1'" 1 
ATOM   6704 N  N1    . DC  F 2 17  ? 113.477 18.933  124.161 1.00 37.00  ? 872  DC  C N1    1 
ATOM   6705 C  C2    . DC  F 2 17  ? 112.377 18.513  124.925 1.00 33.29  ? 872  DC  C C2    1 
ATOM   6706 O  O2    . DC  F 2 17  ? 111.482 17.854  124.382 1.00 32.63  ? 872  DC  C O2    1 
ATOM   6707 N  N3    . DC  F 2 17  ? 112.318 18.845  126.238 1.00 32.98  ? 872  DC  C N3    1 
ATOM   6708 C  C4    . DC  F 2 17  ? 113.305 19.548  126.796 1.00 30.80  ? 872  DC  C C4    1 
ATOM   6709 N  N4    . DC  F 2 17  ? 113.207 19.834  128.099 1.00 30.87  ? 872  DC  C N4    1 
ATOM   6710 C  C5    . DC  F 2 17  ? 114.431 19.992  126.040 1.00 31.28  ? 872  DC  C C5    1 
ATOM   6711 C  C6    . DC  F 2 17  ? 114.476 19.664  124.734 1.00 40.70  ? 872  DC  C C6    1 
ATOM   6712 P  P     . DC  F 2 18  ? 112.634 19.501  118.560 1.00 56.20  ? 873  DC  C P     1 
ATOM   6713 O  OP1   . DC  F 2 18  ? 112.414 18.645  117.371 1.00 63.62  ? 873  DC  C OP1   1 
ATOM   6714 O  OP2   . DC  F 2 18  ? 113.305 20.818  118.423 1.00 64.96  ? 873  DC  C OP2   1 
ATOM   6715 O  "O5'" . DC  F 2 18  ? 111.258 19.823  119.300 1.00 50.90  ? 873  DC  C "O5'" 1 
ATOM   6716 C  "C5'" . DC  F 2 18  ? 110.364 18.790  119.628 1.00 43.40  ? 873  DC  C "C5'" 1 
ATOM   6717 C  "C4'" . DC  F 2 18  ? 109.212 19.368  120.399 1.00 38.38  ? 873  DC  C "C4'" 1 
ATOM   6718 O  "O4'" . DC  F 2 18  ? 109.618 19.533  121.763 1.00 31.50  ? 873  DC  C "O4'" 1 
ATOM   6719 C  "C3'" . DC  F 2 18  ? 108.784 20.760  119.924 1.00 32.04  ? 873  DC  C "C3'" 1 
ATOM   6720 O  "O3'" . DC  F 2 18  ? 107.531 20.681  119.263 1.00 36.37  ? 873  DC  C "O3'" 1 
ATOM   6721 C  "C2'" . DC  F 2 18  ? 108.696 21.609  121.210 1.00 27.25  ? 873  DC  C "C2'" 1 
ATOM   6722 C  "C1'" . DC  F 2 18  ? 108.863 20.578  122.320 1.00 34.45  ? 873  DC  C "C1'" 1 
ATOM   6723 N  N1    . DC  F 2 18  ? 109.590 21.082  123.500 1.00 35.47  ? 873  DC  C N1    1 
ATOM   6724 C  C2    . DC  F 2 18  ? 108.928 21.151  124.718 1.00 38.45  ? 873  DC  C C2    1 
ATOM   6725 O  O2    . DC  F 2 18  ? 107.743 20.799  124.770 1.00 30.21  ? 873  DC  C O2    1 
ATOM   6726 N  N3    . DC  F 2 18  ? 109.598 21.597  125.809 1.00 29.88  ? 873  DC  C N3    1 
ATOM   6727 C  C4    . DC  F 2 18  ? 110.877 21.968  125.710 1.00 37.03  ? 873  DC  C C4    1 
ATOM   6728 N  N4    . DC  F 2 18  ? 111.484 22.397  126.818 1.00 31.04  ? 873  DC  C N4    1 
ATOM   6729 C  C5    . DC  F 2 18  ? 111.584 21.912  124.465 1.00 26.97  ? 873  DC  C C5    1 
ATOM   6730 C  C6    . DC  F 2 18  ? 110.904 21.461  123.393 1.00 34.18  ? 873  DC  C C6    1 
HETATM 6731 P  PA    . TTP G 3 .   ? 82.905  19.100  175.465 1.00 30.79  ? 900  TTP F PA    1 
HETATM 6732 O  O1A   . TTP G 3 .   ? 81.595  18.521  175.926 1.00 30.99  ? 900  TTP F O1A   1 
HETATM 6733 O  O2A   . TTP G 3 .   ? 83.082  18.959  173.961 1.00 27.71  ? 900  TTP F O2A   1 
HETATM 6734 O  O3A   . TTP G 3 .   ? 82.993  20.694  175.719 1.00 36.23  ? 900  TTP F O3A   1 
HETATM 6735 P  PB    . TTP G 3 .   ? 82.478  21.534  176.942 1.00 40.89  ? 900  TTP F PB    1 
HETATM 6736 O  O1B   . TTP G 3 .   ? 83.544  22.290  177.675 1.00 33.99  ? 900  TTP F O1B   1 
HETATM 6737 O  O2B   . TTP G 3 .   ? 81.784  20.719  177.923 1.00 26.86  ? 900  TTP F O2B   1 
HETATM 6738 O  O3B   . TTP G 3 .   ? 81.517  22.483  176.087 1.00 36.44  ? 900  TTP F O3B   1 
HETATM 6739 P  PG    . TTP G 3 .   ? 79.935  22.252  175.890 1.00 33.86  ? 900  TTP F PG    1 
HETATM 6740 O  O1G   . TTP G 3 .   ? 79.520  20.823  176.006 1.00 29.22  ? 900  TTP F O1G   1 
HETATM 6741 O  O2G   . TTP G 3 .   ? 79.685  22.673  174.483 1.00 30.56  ? 900  TTP F O2G   1 
HETATM 6742 O  O3G   . TTP G 3 .   ? 79.191  23.113  176.880 1.00 37.48  ? 900  TTP F O3G   1 
HETATM 6743 O  "O5'" . TTP G 3 .   ? 84.182  18.520  176.245 1.00 31.94  ? 900  TTP F "O5'" 1 
HETATM 6744 C  "C5'" . TTP G 3 .   ? 84.163  18.003  177.582 1.00 28.43  ? 900  TTP F "C5'" 1 
HETATM 6745 C  "C4'" . TTP G 3 .   ? 85.489  18.439  178.229 1.00 25.62  ? 900  TTP F "C4'" 1 
HETATM 6746 O  "O4'" . TTP G 3 .   ? 86.613  17.858  177.556 1.00 26.94  ? 900  TTP F "O4'" 1 
HETATM 6747 C  "C3'" . TTP G 3 .   ? 85.728  19.940  178.053 1.00 26.79  ? 900  TTP F "C3'" 1 
HETATM 6748 O  "O3'" . TTP G 3 .   ? 85.141  20.766  179.071 1.00 22.23  ? 900  TTP F "O3'" 1 
HETATM 6749 C  "C2'" . TTP G 3 .   ? 87.248  20.048  178.087 1.00 24.38  ? 900  TTP F "C2'" 1 
HETATM 6750 C  "C1'" . TTP G 3 .   ? 87.735  18.742  177.467 1.00 24.63  ? 900  TTP F "C1'" 1 
HETATM 6751 N  N1    . TTP G 3 .   ? 88.085  18.984  176.052 1.00 26.16  ? 900  TTP F N1    1 
HETATM 6752 C  C2    . TTP G 3 .   ? 89.429  19.174  175.693 1.00 21.21  ? 900  TTP F C2    1 
HETATM 6753 O  O2    . TTP G 3 .   ? 90.311  19.100  176.579 1.00 26.35  ? 900  TTP F O2    1 
HETATM 6754 N  N3    . TTP G 3 .   ? 89.777  19.416  174.421 1.00 24.50  ? 900  TTP F N3    1 
HETATM 6755 C  C4    . TTP G 3 .   ? 88.865  19.500  173.443 1.00 21.48  ? 900  TTP F C4    1 
HETATM 6756 O  O4    . TTP G 3 .   ? 89.197  19.749  172.259 1.00 27.24  ? 900  TTP F O4    1 
HETATM 6757 C  C5    . TTP G 3 .   ? 87.440  19.360  173.789 1.00 21.34  ? 900  TTP F C5    1 
HETATM 6758 C  C5M   . TTP G 3 .   ? 86.400  19.459  172.696 1.00 24.90  ? 900  TTP F C5M   1 
HETATM 6759 C  C6    . TTP G 3 .   ? 87.111  19.104  175.116 1.00 24.49  ? 900  TTP F C6    1 
HETATM 6760 MG MG    . MG  H 4 .   ? 80.137  19.134  177.384 1.00 24.36  ? 901  MG  F MG    1 
HETATM 6761 MG MG    . MG  I 4 .   ? 81.140  15.929  175.969 1.00 58.22  ? 902  MG  F MG    1 
HETATM 6762 P  PA    . TTP J 3 .   ? 108.173 24.522  118.659 1.00 35.09  ? 900  TTP A PA    1 
HETATM 6763 O  O1A   . TTP J 3 .   ? 107.954 23.959  117.269 1.00 29.94  ? 900  TTP A O1A   1 
HETATM 6764 O  O2A   . TTP J 3 .   ? 109.581 24.254  119.125 1.00 35.63  ? 900  TTP A O2A   1 
HETATM 6765 O  O3A   . TTP J 3 .   ? 107.938 26.108  118.709 1.00 33.53  ? 900  TTP A O3A   1 
HETATM 6766 P  PB    . TTP J 3 .   ? 106.830 26.932  117.884 1.00 31.59  ? 900  TTP A PB    1 
HETATM 6767 O  O1B   . TTP J 3 .   ? 105.999 27.756  118.845 1.00 30.21  ? 900  TTP A O1B   1 
HETATM 6768 O  O2B   . TTP J 3 .   ? 105.940 26.104  117.007 1.00 35.45  ? 900  TTP A O2B   1 
HETATM 6769 O  O3B   . TTP J 3 .   ? 107.730 28.019  117.143 1.00 31.04  ? 900  TTP A O3B   1 
HETATM 6770 P  PG    . TTP J 3 .   ? 108.468 27.789  115.717 1.00 35.13  ? 900  TTP A PG    1 
HETATM 6771 O  O1G   . TTP J 3 .   ? 108.579 26.312  115.403 1.00 43.81  ? 900  TTP A O1G   1 
HETATM 6772 O  O2G   . TTP J 3 .   ? 109.839 28.379  115.831 1.00 34.73  ? 900  TTP A O2G   1 
HETATM 6773 O  O3G   . TTP J 3 .   ? 107.701 28.523  114.661 1.00 32.33  ? 900  TTP A O3G   1 
HETATM 6774 O  "O5'" . TTP J 3 .   ? 107.109 24.038  119.759 1.00 34.15  ? 900  TTP A "O5'" 1 
HETATM 6775 C  "C5'" . TTP J 3 .   ? 105.782 23.621  119.415 1.00 29.44  ? 900  TTP A "C5'" 1 
HETATM 6776 C  "C4'" . TTP J 3 .   ? 104.864 24.005  120.578 1.00 24.21  ? 900  TTP A "C4'" 1 
HETATM 6777 O  "O4'" . TTP J 3 .   ? 105.265 23.307  121.771 1.00 28.81  ? 900  TTP A "O4'" 1 
HETATM 6778 C  "C3'" . TTP J 3 .   ? 104.931 25.475  120.934 1.00 35.67  ? 900  TTP A "C3'" 1 
HETATM 6779 O  "O3'" . TTP J 3 .   ? 104.035 26.273  120.138 1.00 37.15  ? 900  TTP A "O3'" 1 
HETATM 6780 C  "C2'" . TTP J 3 .   ? 104.585 25.479  122.419 1.00 28.86  ? 900  TTP A "C2'" 1 
HETATM 6781 C  "C1'" . TTP J 3 .   ? 105.133 24.146  122.925 1.00 27.46  ? 900  TTP A "C1'" 1 
HETATM 6782 N  N1    . TTP J 3 .   ? 106.449 24.376  123.547 1.00 32.95  ? 900  TTP A N1    1 
HETATM 6783 C  C2    . TTP J 3 .   ? 106.520 24.467  124.951 1.00 38.02  ? 900  TTP A C2    1 
HETATM 6784 O  O2    . TTP J 3 .   ? 105.480 24.341  125.618 1.00 32.29  ? 900  TTP A O2    1 
HETATM 6785 N  N3    . TTP J 3 .   ? 107.675 24.678  125.588 1.00 35.11  ? 900  TTP A N3    1 
HETATM 6786 C  C4    . TTP J 3 .   ? 108.818 24.833  124.914 1.00 34.13  ? 900  TTP A C4    1 
HETATM 6787 O  O4    . TTP J 3 .   ? 109.883 25.047  125.542 1.00 30.80  ? 900  TTP A O4    1 
HETATM 6788 C  C5    . TTP J 3 .   ? 108.796 24.750  123.432 1.00 27.52  ? 900  TTP A C5    1 
HETATM 6789 C  C5M   . TTP J 3 .   ? 110.071 24.926  122.627 1.00 24.79  ? 900  TTP A C5M   1 
HETATM 6790 C  C6    . TTP J 3 .   ? 107.563 24.521  122.811 1.00 28.05  ? 900  TTP A C6    1 
HETATM 6791 MG MG    . MG  K 4 .   ? 106.853 24.630  115.539 1.00 32.61  ? 901  MG  A MG    1 
HETATM 6792 MG MG    . MG  L 4 .   ? 107.729 21.662  116.424 1.00 78.41  ? 902  MG  A MG    1 
HETATM 6793 O  O     . HOH M 5 .   ? 82.795  36.734  169.913 1.00 47.25  ? 1001 HOH F O     1 
HETATM 6794 O  O     . HOH M 5 .   ? 72.387  23.312  193.349 1.00 52.14  ? 1002 HOH F O     1 
HETATM 6795 O  O     . HOH M 5 .   ? 108.413 17.508  158.057 1.00 49.08  ? 1003 HOH F O     1 
HETATM 6796 O  O     . HOH M 5 .   ? 73.929  0.085   155.888 1.00 49.48  ? 1004 HOH F O     1 
HETATM 6797 O  O     . HOH M 5 .   ? 92.741  24.445  186.722 1.00 43.09  ? 1005 HOH F O     1 
HETATM 6798 O  O     . HOH M 5 .   ? 77.472  -3.614  181.976 1.00 49.65  ? 1006 HOH F O     1 
HETATM 6799 O  O     . HOH M 5 .   ? 88.986  -7.559  175.992 1.00 62.73  ? 1007 HOH F O     1 
HETATM 6800 O  O     . HOH M 5 .   ? 101.104 -0.109  169.375 1.00 47.64  ? 1008 HOH F O     1 
HETATM 6801 O  O     . HOH M 5 .   ? 76.764  17.741  173.493 1.00 50.26  ? 1009 HOH F O     1 
HETATM 6802 O  O     . HOH M 5 .   ? 81.892  18.053  162.398 1.00 46.23  ? 1010 HOH F O     1 
HETATM 6803 O  O     . HOH M 5 .   ? 120.385 5.086   166.589 1.00 45.41  ? 1011 HOH F O     1 
HETATM 6804 O  O     . HOH M 5 .   ? 66.164  6.939   151.481 1.00 52.30  ? 1012 HOH F O     1 
HETATM 6805 O  O     . HOH M 5 .   ? 60.025  9.006   176.244 1.00 50.02  ? 1013 HOH F O     1 
HETATM 6806 O  O     . HOH M 5 .   ? 95.068  4.612   184.487 1.00 38.42  ? 1014 HOH F O     1 
HETATM 6807 O  O     . HOH M 5 .   ? 94.816  -2.979  174.138 1.00 43.03  ? 1015 HOH F O     1 
HETATM 6808 O  O     . HOH M 5 .   ? 94.005  -5.749  179.534 1.00 49.69  ? 1016 HOH F O     1 
HETATM 6809 O  O     . HOH M 5 .   ? 96.310  -6.063  172.861 1.00 40.25  ? 1017 HOH F O     1 
HETATM 6810 O  O     . HOH M 5 .   ? 117.869 18.159  166.044 1.00 45.09  ? 1018 HOH F O     1 
HETATM 6811 O  O     . HOH M 5 .   ? 83.377  -5.042  176.388 1.00 61.88  ? 1019 HOH F O     1 
HETATM 6812 O  O     . HOH M 5 .   ? 105.905 9.821   159.993 1.00 32.08  ? 1020 HOH F O     1 
HETATM 6813 O  O     . HOH M 5 .   ? 108.697 -3.464  188.794 1.00 68.44  ? 1021 HOH F O     1 
HETATM 6814 O  O     . HOH M 5 .   ? 70.764  0.749   172.492 1.00 37.43  ? 1022 HOH F O     1 
HETATM 6815 O  O     . HOH M 5 .   ? 110.911 12.731  159.166 1.00 53.63  ? 1023 HOH F O     1 
HETATM 6816 O  O     . HOH M 5 .   ? 92.311  18.917  178.536 1.00 32.20  ? 1024 HOH F O     1 
HETATM 6817 O  O     . HOH M 5 .   ? 68.956  22.879  193.621 1.00 66.92  ? 1025 HOH F O     1 
HETATM 6818 O  O     . HOH M 5 .   ? 119.232 14.671  163.015 1.00 49.58  ? 1026 HOH F O     1 
HETATM 6819 O  O     . HOH M 5 .   ? 67.298  0.624   161.214 1.00 48.76  ? 1027 HOH F O     1 
HETATM 6820 O  O     . HOH M 5 .   ? 80.218  17.148  173.910 1.00 37.64  ? 1028 HOH F O     1 
HETATM 6821 O  O     . HOH M 5 .   ? 72.506  -3.285  181.822 1.00 48.68  ? 1029 HOH F O     1 
HETATM 6822 O  O     . HOH M 5 .   ? 102.071 29.867  172.438 1.00 31.45  ? 1030 HOH F O     1 
HETATM 6823 O  O     . HOH M 5 .   ? 66.553  24.698  181.367 1.00 46.32  ? 1031 HOH F O     1 
HETATM 6824 O  O     . HOH M 5 .   ? 89.437  36.899  183.188 1.00 38.74  ? 1032 HOH F O     1 
HETATM 6825 O  O     . HOH M 5 .   ? 101.325 9.614   164.326 1.00 34.83  ? 1033 HOH F O     1 
HETATM 6826 O  O     . HOH M 5 .   ? 84.129  23.144  173.860 1.00 44.67  ? 1034 HOH F O     1 
HETATM 6827 O  O     . HOH M 5 .   ? 105.402 18.794  158.927 1.00 42.71  ? 1035 HOH F O     1 
HETATM 6828 O  O     . HOH M 5 .   ? 100.283 5.425   168.700 1.00 40.74  ? 1036 HOH F O     1 
HETATM 6829 O  O     . HOH M 5 .   ? 95.694  6.789   182.573 1.00 42.94  ? 1037 HOH F O     1 
HETATM 6830 O  O     . HOH M 5 .   ? 107.516 29.082  174.721 1.00 43.33  ? 1038 HOH F O     1 
HETATM 6831 O  O     . HOH M 5 .   ? 59.219  11.929  175.778 1.00 58.75  ? 1039 HOH F O     1 
HETATM 6832 O  O     . HOH M 5 .   ? 68.663  -1.807  175.542 1.00 52.96  ? 1040 HOH F O     1 
HETATM 6833 O  O     . HOH M 5 .   ? 64.872  7.218   159.867 1.00 42.71  ? 1041 HOH F O     1 
HETATM 6834 O  O     . HOH M 5 .   ? 76.123  19.133  167.191 1.00 55.45  ? 1042 HOH F O     1 
HETATM 6835 O  O     . HOH M 5 .   ? 87.078  20.584  194.058 1.00 56.48  ? 1043 HOH F O     1 
HETATM 6836 O  O     . HOH M 5 .   ? 77.494  17.536  165.909 1.00 50.48  ? 1044 HOH F O     1 
HETATM 6837 O  O     . HOH M 5 .   ? 100.103 16.134  172.608 1.00 27.21  ? 1045 HOH F O     1 
HETATM 6838 O  O     . HOH M 5 .   ? 103.449 3.117   165.798 1.00 39.35  ? 1046 HOH F O     1 
HETATM 6839 O  O     . HOH M 5 .   ? 95.005  37.592  180.036 1.00 46.06  ? 1047 HOH F O     1 
HETATM 6840 O  O     . HOH M 5 .   ? 78.245  22.085  184.041 1.00 40.52  ? 1048 HOH F O     1 
HETATM 6841 O  O     . HOH M 5 .   ? 84.435  17.740  191.682 1.00 38.72  ? 1049 HOH F O     1 
HETATM 6842 O  O     . HOH M 5 .   ? 112.701 8.006   185.291 1.00 52.30  ? 1050 HOH F O     1 
HETATM 6843 O  O     . HOH M 5 .   ? 105.177 -8.228  186.507 1.00 50.38  ? 1051 HOH F O     1 
HETATM 6844 O  O     . HOH M 5 .   ? 107.751 23.809  167.435 1.00 36.75  ? 1052 HOH F O     1 
HETATM 6845 O  O     . HOH M 5 .   ? 94.983  23.503  167.817 1.00 43.30  ? 1053 HOH F O     1 
HETATM 6846 O  O     . HOH M 5 .   ? 117.951 5.421   182.856 1.00 48.25  ? 1054 HOH F O     1 
HETATM 6847 O  O     . HOH M 5 .   ? 122.855 11.541  168.652 1.00 63.08  ? 1055 HOH F O     1 
HETATM 6848 O  O     . HOH M 5 .   ? 77.037  24.497  177.457 1.00 34.27  ? 1056 HOH F O     1 
HETATM 6849 O  O     . HOH M 5 .   ? 64.852  13.827  155.009 1.00 34.61  ? 1057 HOH F O     1 
HETATM 6850 O  O     . HOH M 5 .   ? 115.529 1.699   160.723 1.00 51.65  ? 1058 HOH F O     1 
HETATM 6851 O  O     . HOH M 5 .   ? 103.713 5.800   170.480 1.00 33.85  ? 1059 HOH F O     1 
HETATM 6852 O  O     . HOH M 5 .   ? 80.118  1.894   171.196 1.00 49.20  ? 1060 HOH F O     1 
HETATM 6853 O  O     . HOH M 5 .   ? 88.392  26.887  190.425 1.00 50.25  ? 1061 HOH F O     1 
HETATM 6854 O  O     . HOH M 5 .   ? 82.285  3.604   177.477 1.00 33.99  ? 1062 HOH F O     1 
HETATM 6855 O  O     . HOH M 5 .   ? 118.186 22.528  172.691 1.00 38.49  ? 1063 HOH F O     1 
HETATM 6856 O  O     . HOH M 5 .   ? 80.187  18.486  153.543 1.00 40.41  ? 1064 HOH F O     1 
HETATM 6857 O  O     . HOH M 5 .   ? 102.865 -9.550  178.981 1.00 39.05  ? 1065 HOH F O     1 
HETATM 6858 O  O     . HOH M 5 .   ? 71.809  3.891   167.948 1.00 26.74  ? 1066 HOH F O     1 
HETATM 6859 O  O     . HOH M 5 .   ? 68.036  20.256  160.327 1.00 41.71  ? 1067 HOH F O     1 
HETATM 6860 O  O     . HOH M 5 .   ? 88.319  1.342   174.138 1.00 41.62  ? 1068 HOH F O     1 
HETATM 6861 O  O     . HOH M 5 .   ? 79.420  32.432  183.323 1.00 52.24  ? 1069 HOH F O     1 
HETATM 6862 O  O     . HOH M 5 .   ? 99.285  2.246   167.973 1.00 47.79  ? 1070 HOH F O     1 
HETATM 6863 O  O     . HOH M 5 .   ? 67.391  -2.076  178.158 1.00 47.17  ? 1071 HOH F O     1 
HETATM 6864 O  O     . HOH M 5 .   ? 68.292  27.195  171.805 1.00 46.83  ? 1072 HOH F O     1 
HETATM 6865 O  O     . HOH M 5 .   ? 99.761  3.701   190.540 1.00 35.54  ? 1073 HOH F O     1 
HETATM 6866 O  O     . HOH M 5 .   ? 73.349  1.090   161.876 1.00 38.91  ? 1074 HOH F O     1 
HETATM 6867 O  O     . HOH M 5 .   ? 97.728  12.667  171.603 1.00 43.87  ? 1075 HOH F O     1 
HETATM 6868 O  O     . HOH M 5 .   ? 76.780  9.227   167.639 1.00 40.83  ? 1076 HOH F O     1 
HETATM 6869 O  O     . HOH M 5 .   ? 105.106 23.445  177.321 1.00 45.96  ? 1077 HOH F O     1 
HETATM 6870 O  O     . HOH M 5 .   ? 122.961 17.244  169.086 1.00 45.73  ? 1078 HOH F O     1 
HETATM 6871 O  O     . HOH M 5 .   ? 118.003 12.082  161.503 1.00 40.01  ? 1079 HOH F O     1 
HETATM 6872 O  O     . HOH M 5 .   ? 96.520  39.869  176.912 1.00 55.09  ? 1080 HOH F O     1 
HETATM 6873 O  O     . HOH M 5 .   ? 70.005  20.560  173.970 1.00 35.62  ? 1081 HOH F O     1 
HETATM 6874 O  O     . HOH M 5 .   ? 120.242 13.445  179.460 1.00 36.36  ? 1082 HOH F O     1 
HETATM 6875 O  O     . HOH M 5 .   ? 65.227  3.418   167.162 1.00 38.24  ? 1083 HOH F O     1 
HETATM 6876 O  O     . HOH M 5 .   ? 86.479  31.626  167.087 1.00 45.37  ? 1084 HOH F O     1 
HETATM 6877 O  O     . HOH M 5 .   ? 112.847 -3.227  171.142 1.00 49.83  ? 1085 HOH F O     1 
HETATM 6878 O  O     . HOH M 5 .   ? 98.383  -6.683  187.579 1.00 46.45  ? 1086 HOH F O     1 
HETATM 6879 O  O     . HOH M 5 .   ? 80.458  3.860   167.294 1.00 45.88  ? 1087 HOH F O     1 
HETATM 6880 O  O     . HOH M 5 .   ? 67.091  11.534  190.819 1.00 56.18  ? 1088 HOH F O     1 
HETATM 6881 O  O     . HOH M 5 .   ? 81.529  17.380  191.769 1.00 49.32  ? 1089 HOH F O     1 
HETATM 6882 O  O     . HOH M 5 .   ? 97.727  1.011   170.718 1.00 41.47  ? 1090 HOH F O     1 
HETATM 6883 O  O     . HOH M 5 .   ? 65.582  7.359   162.537 1.00 56.84  ? 1091 HOH F O     1 
HETATM 6884 O  O     . HOH M 5 .   ? 88.281  40.970  170.718 1.00 42.40  ? 1092 HOH F O     1 
HETATM 6885 O  O     . HOH M 5 .   ? 97.472  27.169  182.597 1.00 60.17  ? 1093 HOH F O     1 
HETATM 6886 O  O     . HOH M 5 .   ? 99.997  7.835   192.836 1.00 67.25  ? 1094 HOH F O     1 
HETATM 6887 O  O     . HOH M 5 .   ? 97.752  -4.728  179.850 1.00 29.58  ? 1095 HOH F O     1 
HETATM 6888 O  O     . HOH M 5 .   ? 105.847 5.824   189.206 1.00 38.45  ? 1096 HOH F O     1 
HETATM 6889 O  O     . HOH M 5 .   ? 68.455  2.804   162.909 1.00 31.44  ? 1097 HOH F O     1 
HETATM 6890 O  O     . HOH M 5 .   ? 58.360  10.416  160.673 1.00 51.90  ? 1098 HOH F O     1 
HETATM 6891 O  O     . HOH M 5 .   ? 115.636 -2.372  173.490 1.00 37.81  ? 1099 HOH F O     1 
HETATM 6892 O  O     . HOH M 5 .   ? 80.324  6.257   189.117 1.00 39.81  ? 1100 HOH F O     1 
HETATM 6893 O  O     . HOH M 5 .   ? 79.469  26.295  187.375 1.00 42.97  ? 1101 HOH F O     1 
HETATM 6894 O  O     . HOH M 5 .   ? 78.599  2.003   182.193 1.00 33.00  ? 1102 HOH F O     1 
HETATM 6895 O  O     . HOH M 5 .   ? 88.166  19.698  169.648 1.00 24.95  ? 1103 HOH F O     1 
HETATM 6896 O  O     . HOH M 5 .   ? 113.511 -0.662  169.697 1.00 55.21  ? 1104 HOH F O     1 
HETATM 6897 O  O     . HOH M 5 .   ? 110.177 -0.499  167.565 1.00 61.67  ? 1105 HOH F O     1 
HETATM 6898 O  O     . HOH M 5 .   ? 85.690  21.385  156.481 1.00 44.96  ? 1106 HOH F O     1 
HETATM 6899 O  O     . HOH M 5 .   ? 78.313  19.726  155.990 1.00 41.48  ? 1107 HOH F O     1 
HETATM 6900 O  O     . HOH M 5 .   ? 102.134 0.824   172.119 1.00 31.98  ? 1108 HOH F O     1 
HETATM 6901 O  O     . HOH M 5 .   ? 101.410 -8.435  172.504 1.00 41.83  ? 1109 HOH F O     1 
HETATM 6902 O  O     . HOH M 5 .   ? 111.938 -0.131  183.607 1.00 44.36  ? 1110 HOH F O     1 
HETATM 6903 O  O     . HOH M 5 .   ? 118.286 2.382   176.993 1.00 31.02  ? 1111 HOH F O     1 
HETATM 6904 O  O     . HOH M 5 .   ? 109.494 -6.595  169.891 1.00 45.39  ? 1112 HOH F O     1 
HETATM 6905 O  O     . HOH M 5 .   ? 59.574  14.969  159.627 1.00 38.98  ? 1113 HOH F O     1 
HETATM 6906 O  O     . HOH M 5 .   ? 71.413  20.773  184.840 1.00 38.04  ? 1114 HOH F O     1 
HETATM 6907 O  O     . HOH M 5 .   ? 111.816 26.651  170.476 1.00 43.08  ? 1115 HOH F O     1 
HETATM 6908 O  O     . HOH M 5 .   ? 112.993 22.702  175.953 1.00 40.08  ? 1116 HOH F O     1 
HETATM 6909 O  O     . HOH M 5 .   ? 118.825 2.392   170.462 1.00 39.95  ? 1117 HOH F O     1 
HETATM 6910 O  O     . HOH M 5 .   ? 102.862 21.221  177.732 1.00 32.62  ? 1118 HOH F O     1 
HETATM 6911 O  O     . HOH M 5 .   ? 66.344  0.407   179.129 1.00 41.76  ? 1119 HOH F O     1 
HETATM 6912 O  O     . HOH M 5 .   ? 101.101 9.808   186.387 1.00 45.86  ? 1120 HOH F O     1 
HETATM 6913 O  O     . HOH M 5 .   ? 78.344  1.393   169.526 1.00 45.61  ? 1121 HOH F O     1 
HETATM 6914 O  O     . HOH M 5 .   ? 101.193 23.145  176.599 1.00 51.06  ? 1122 HOH F O     1 
HETATM 6915 O  O     . HOH M 5 .   ? 61.774  18.007  162.865 1.00 41.35  ? 1123 HOH F O     1 
HETATM 6916 O  O     . HOH M 5 .   ? 99.596  14.390  164.593 1.00 58.74  ? 1124 HOH F O     1 
HETATM 6917 O  O     . HOH M 5 .   ? 82.920  -1.233  181.060 1.00 53.24  ? 1125 HOH F O     1 
HETATM 6918 O  O     . HOH M 5 .   ? 80.250  10.396  181.829 1.00 36.95  ? 1126 HOH F O     1 
HETATM 6919 O  O     . HOH M 5 .   ? 110.036 6.139   163.094 1.00 53.54  ? 1127 HOH F O     1 
HETATM 6920 O  O     . HOH M 5 .   ? 96.455  6.400   173.312 1.00 35.45  ? 1128 HOH F O     1 
HETATM 6921 O  O     . HOH M 5 .   ? 73.380  28.950  173.369 1.00 59.78  ? 1129 HOH F O     1 
HETATM 6922 O  O     . HOH M 5 .   ? 99.409  29.043  171.863 1.00 35.26  ? 1130 HOH F O     1 
HETATM 6923 O  O     . HOH M 5 .   ? 94.914  22.526  177.485 1.00 39.16  ? 1131 HOH F O     1 
HETATM 6924 O  O     . HOH M 5 .   ? 87.178  12.096  178.967 1.00 36.82  ? 1132 HOH F O     1 
HETATM 6925 O  O     . HOH M 5 .   ? 72.378  -3.464  166.642 1.00 49.84  ? 1133 HOH F O     1 
HETATM 6926 O  O     . HOH M 5 .   ? 62.259  19.374  172.306 1.00 44.24  ? 1134 HOH F O     1 
HETATM 6927 O  O     . HOH M 5 .   ? 89.275  16.693  151.905 1.00 44.80  ? 1135 HOH F O     1 
HETATM 6928 O  O     . HOH M 5 .   ? 110.016 -1.640  184.674 1.00 34.04  ? 1136 HOH F O     1 
HETATM 6929 O  O     . HOH M 5 .   ? 111.363 20.816  158.636 1.00 48.21  ? 1137 HOH F O     1 
HETATM 6930 O  O     . HOH M 5 .   ? 77.551  9.766   194.448 1.00 59.51  ? 1138 HOH F O     1 
HETATM 6931 O  O     . HOH M 5 .   ? 121.264 11.810  165.644 1.00 44.87  ? 1139 HOH F O     1 
HETATM 6932 O  O     . HOH M 5 .   ? 79.153  19.369  173.477 1.00 35.47  ? 1140 HOH F O     1 
HETATM 6933 O  O     . HOH M 5 .   ? 102.435 9.078   173.529 1.00 32.61  ? 1141 HOH F O     1 
HETATM 6934 O  O     . HOH M 5 .   ? 85.635  21.791  150.140 1.00 53.43  ? 1142 HOH F O     1 
HETATM 6935 O  O     . HOH M 5 .   ? 94.306  41.831  171.216 1.00 49.04  ? 1143 HOH F O     1 
HETATM 6936 O  O     . HOH M 5 .   ? 66.609  14.566  149.491 1.00 45.05  ? 1144 HOH F O     1 
HETATM 6937 O  O     . HOH M 5 .   ? 71.878  27.873  184.038 1.00 49.11  ? 1145 HOH F O     1 
HETATM 6938 O  O     . HOH M 5 .   ? 62.947  20.214  156.737 1.00 51.35  ? 1146 HOH F O     1 
HETATM 6939 O  O     . HOH M 5 .   ? 74.544  23.398  149.704 1.00 52.88  ? 1147 HOH F O     1 
HETATM 6940 O  O     . HOH M 5 .   ? 76.959  1.804   161.892 1.00 48.41  ? 1148 HOH F O     1 
HETATM 6941 O  O     . HOH M 5 .   ? 100.405 26.283  181.426 1.00 41.28  ? 1149 HOH F O     1 
HETATM 6942 O  O     . HOH M 5 .   ? 84.617  15.155  179.286 1.00 39.15  ? 1150 HOH F O     1 
HETATM 6943 O  O     . HOH M 5 .   ? 110.616 -5.734  180.183 1.00 33.13  ? 1151 HOH F O     1 
HETATM 6944 O  O     . HOH M 5 .   ? 115.194 14.405  183.784 1.00 39.16  ? 1152 HOH F O     1 
HETATM 6945 O  O     . HOH M 5 .   ? 56.895  9.924   166.715 1.00 45.89  ? 1153 HOH F O     1 
HETATM 6946 O  O     . HOH M 5 .   ? 77.502  24.651  185.456 1.00 51.12  ? 1154 HOH F O     1 
HETATM 6947 O  O     . HOH M 5 .   ? 80.363  -1.884  154.320 1.00 51.84  ? 1155 HOH F O     1 
HETATM 6948 O  O     . HOH M 5 .   ? 90.649  12.908  185.192 1.00 43.65  ? 1156 HOH F O     1 
HETATM 6949 O  O     . HOH M 5 .   ? 75.880  -2.300  168.223 1.00 49.02  ? 1157 HOH F O     1 
HETATM 6950 O  O     . HOH M 5 .   ? 107.474 25.399  165.304 1.00 40.63  ? 1158 HOH F O     1 
HETATM 6951 O  O     . HOH M 5 .   ? 80.723  -0.442  171.232 1.00 66.60  ? 1159 HOH F O     1 
HETATM 6952 O  O     . HOH M 5 .   ? 65.089  22.794  177.693 1.00 43.92  ? 1160 HOH F O     1 
HETATM 6953 O  O     . HOH M 5 .   ? 81.007  19.946  163.433 1.00 56.58  ? 1161 HOH F O     1 
HETATM 6954 O  O     . HOH M 5 .   ? 73.852  -2.770  180.346 1.00 53.53  ? 1162 HOH F O     1 
HETATM 6955 O  O     . HOH M 5 .   ? 79.965  33.006  170.315 1.00 41.11  ? 1163 HOH F O     1 
HETATM 6956 O  O     . HOH M 5 .   ? 92.451  -4.344  175.550 1.00 45.93  ? 1164 HOH F O     1 
HETATM 6957 O  O     . HOH M 5 .   ? 89.265  40.361  177.123 1.00 39.76  ? 1165 HOH F O     1 
HETATM 6958 O  O     . HOH M 5 .   ? 79.958  30.225  181.726 1.00 32.66  ? 1166 HOH F O     1 
HETATM 6959 O  O     . HOH M 5 .   ? 78.484  8.724   168.360 1.00 38.19  ? 1167 HOH F O     1 
HETATM 6960 O  O     . HOH M 5 .   ? 96.747  39.718  174.024 1.00 50.87  ? 1168 HOH F O     1 
HETATM 6961 O  O     . HOH M 5 .   ? 109.558 -8.174  172.877 1.00 48.76  ? 1169 HOH F O     1 
HETATM 6962 O  O     . HOH M 5 .   ? 84.372  25.375  172.100 1.00 38.65  ? 1170 HOH F O     1 
HETATM 6963 O  O     . HOH M 5 .   ? 76.543  20.829  176.797 1.00 32.77  ? 1171 HOH F O     1 
HETATM 6964 O  O     . HOH M 5 .   ? 97.744  23.221  176.548 1.00 29.53  ? 1172 HOH F O     1 
HETATM 6965 O  O     . HOH M 5 .   ? 95.982  34.059  183.063 1.00 51.06  ? 1173 HOH F O     1 
HETATM 6966 O  O     . HOH M 5 .   ? 85.385  8.978   161.733 1.00 48.42  ? 1174 HOH F O     1 
HETATM 6967 O  O     . HOH M 5 .   ? 79.205  33.236  174.591 1.00 33.70  ? 1175 HOH F O     1 
HETATM 6968 O  O     . HOH M 5 .   ? 109.090 23.000  178.873 1.00 35.85  ? 1176 HOH F O     1 
HETATM 6969 O  O     . HOH M 5 .   ? 62.062  18.838  176.813 1.00 44.35  ? 1177 HOH F O     1 
HETATM 6970 O  O     . HOH M 5 .   ? 77.072  23.719  156.356 1.00 46.70  ? 1178 HOH F O     1 
HETATM 6971 O  O     . HOH M 5 .   ? 115.975 24.324  173.998 1.00 52.28  ? 1179 HOH F O     1 
HETATM 6972 O  O     . HOH M 5 .   ? 86.040  -1.918  174.423 1.00 54.69  ? 1180 HOH F O     1 
HETATM 6973 O  O     . HOH M 5 .   ? 56.231  14.841  167.605 1.00 61.58  ? 1181 HOH F O     1 
HETATM 6974 O  O     . HOH M 5 .   ? 57.147  1.154   164.812 1.00 55.61  ? 1182 HOH F O     1 
HETATM 6975 O  O     . HOH M 5 .   ? 99.017  -0.888  191.753 1.00 47.01  ? 1183 HOH F O     1 
HETATM 6976 O  O     . HOH M 5 .   ? 69.537  25.198  186.941 1.00 52.69  ? 1184 HOH F O     1 
HETATM 6977 O  O     . HOH M 5 .   ? 65.715  -2.768  174.540 1.00 62.27  ? 1185 HOH F O     1 
HETATM 6978 O  O     . HOH M 5 .   ? 99.761  32.963  178.614 1.00 41.03  ? 1186 HOH F O     1 
HETATM 6979 O  O     . HOH M 5 .   ? 90.984  28.861  191.534 1.00 65.89  ? 1187 HOH F O     1 
HETATM 6980 O  O     . HOH M 5 .   ? 69.939  -1.560  168.511 1.00 63.52  ? 1188 HOH F O     1 
HETATM 6981 O  O     . HOH M 5 .   ? 102.859 19.563  182.830 1.00 58.84  ? 1189 HOH F O     1 
HETATM 6982 O  O     . HOH M 5 .   ? 77.387  0.575   159.241 1.00 46.83  ? 1190 HOH F O     1 
HETATM 6983 O  O     . HOH M 5 .   ? 82.627  -4.025  173.585 1.00 63.44  ? 1191 HOH F O     1 
HETATM 6984 O  O     . HOH M 5 .   ? 115.084 18.506  178.399 1.00 50.15  ? 1192 HOH F O     1 
HETATM 6985 O  O     . HOH M 5 .   ? 64.344  26.625  173.632 1.00 46.23  ? 1193 HOH F O     1 
HETATM 6986 O  O     . HOH M 5 .   ? 95.242  -4.585  181.093 1.00 42.63  ? 1194 HOH F O     1 
HETATM 6987 O  O     . HOH M 5 .   ? 77.298  3.922   186.040 1.00 51.52  ? 1195 HOH F O     1 
HETATM 6988 O  O     . HOH M 5 .   ? 80.955  1.396   178.305 1.00 40.07  ? 1196 HOH F O     1 
HETATM 6989 O  O     . HOH M 5 .   ? 89.361  25.671  167.262 1.00 48.61  ? 1197 HOH F O     1 
HETATM 6990 O  O     . HOH M 5 .   ? 95.362  21.201  180.896 1.00 57.50  ? 1198 HOH F O     1 
HETATM 6991 O  O     . HOH M 5 .   ? 100.712 23.698  180.170 1.00 50.42  ? 1199 HOH F O     1 
HETATM 6992 O  O     . HOH M 5 .   ? 98.991  9.427   167.925 1.00 41.01  ? 1200 HOH F O     1 
HETATM 6993 O  O     . HOH M 5 .   ? 84.814  6.528   177.958 1.00 64.26  ? 1201 HOH F O     1 
HETATM 6994 O  O     . HOH M 5 .   ? 66.022  4.214   162.578 1.00 42.73  ? 1202 HOH F O     1 
HETATM 6995 O  O     . HOH M 5 .   ? 116.554 2.523   185.536 1.00 58.60  ? 1203 HOH F O     1 
HETATM 6996 O  O     . HOH M 5 .   ? 81.334  1.556   180.898 1.00 43.41  ? 1204 HOH F O     1 
HETATM 6997 O  O     . HOH M 5 .   ? 102.524 -10.179 176.566 1.00 53.80  ? 1205 HOH F O     1 
HETATM 6998 O  O     . HOH M 5 .   ? 79.806  28.819  168.129 1.00 57.72  ? 1206 HOH F O     1 
HETATM 6999 O  O     . HOH M 5 .   ? 63.252  20.184  161.140 1.00 43.90  ? 1207 HOH F O     1 
HETATM 7000 O  O     . HOH M 5 .   ? 77.621  30.473  184.399 1.00 50.27  ? 1208 HOH F O     1 
HETATM 7001 O  O     . HOH M 5 .   ? 83.566  19.450  160.234 1.00 57.05  ? 1209 HOH F O     1 
HETATM 7002 O  O     . HOH M 5 .   ? 104.055 22.177  185.251 1.00 64.24  ? 1210 HOH F O     1 
HETATM 7003 O  O     . HOH M 5 .   ? 111.498 24.090  177.540 1.00 43.91  ? 1211 HOH F O     1 
HETATM 7004 O  O     . HOH M 5 .   ? 91.008  24.570  166.268 1.00 51.48  ? 1212 HOH F O     1 
HETATM 7005 O  O     . HOH M 5 .   ? 96.001  22.464  189.501 1.00 52.65  ? 1213 HOH F O     1 
HETATM 7006 O  O     . HOH M 5 .   ? 97.220  22.266  181.002 1.00 52.00  ? 1214 HOH F O     1 
HETATM 7007 O  O     . HOH M 5 .   ? 97.257  6.819   170.711 1.00 27.24  ? 1215 HOH F O     1 
HETATM 7008 O  O     . HOH M 5 .   ? 81.657  3.930   184.407 1.00 49.26  ? 1216 HOH F O     1 
HETATM 7009 O  O     . HOH M 5 .   ? 117.021 -1.658  176.200 1.00 43.07  ? 1217 HOH F O     1 
HETATM 7010 O  O     . HOH M 5 .   ? 87.636  9.540   157.039 1.00 63.85  ? 1218 HOH F O     1 
HETATM 7011 O  O     . HOH M 5 .   ? 79.384  32.178  172.553 1.00 46.12  ? 1219 HOH F O     1 
HETATM 7012 O  O     . HOH M 5 .   ? 87.203  14.839  179.501 1.00 43.30  ? 1220 HOH F O     1 
HETATM 7013 O  O     . HOH M 5 .   ? 120.324 24.464  171.386 1.00 61.73  ? 1221 HOH F O     1 
HETATM 7014 O  O     . HOH M 5 .   ? 88.526  42.849  175.941 1.00 46.14  ? 1222 HOH F O     1 
HETATM 7015 O  O     . HOH M 5 .   ? 99.016  4.172   167.451 1.00 39.87  ? 1223 HOH F O     1 
HETATM 7016 O  O     . HOH M 5 .   ? 98.753  1.521   191.911 1.00 54.07  ? 1224 HOH F O     1 
HETATM 7017 O  O     . HOH M 5 .   ? 88.505  0.758   140.939 1.00 71.53  ? 1225 HOH F O     1 
HETATM 7018 O  O     . HOH M 5 .   ? 102.317 7.251   171.038 1.00 39.98  ? 1226 HOH F O     1 
HETATM 7019 O  O     . HOH M 5 .   ? 75.256  -0.716  163.379 1.00 58.30  ? 1227 HOH F O     1 
HETATM 7020 O  O     . HOH M 5 .   ? 99.791  7.681   170.058 1.00 35.35  ? 1228 HOH F O     1 
HETATM 7021 O  O     . HOH M 5 .   ? 80.274  21.527  162.112 1.00 68.76  ? 1229 HOH F O     1 
HETATM 7022 O  O     . HOH M 5 .   ? 88.002  -3.913  175.181 1.00 53.66  ? 1230 HOH F O     1 
HETATM 7023 O  O     . HOH M 5 .   ? 78.712  4.519   188.777 1.00 53.78  ? 1231 HOH F O     1 
HETATM 7024 O  O     . HOH M 5 .   ? 98.259  -0.774  168.399 1.00 56.93  ? 1232 HOH F O     1 
HETATM 7025 O  O     . HOH M 5 .   ? 80.516  21.857  169.592 1.00 69.91  ? 1233 HOH F O     1 
HETATM 7026 O  O     . HOH M 5 .   ? 57.453  -3.265  164.661 1.00 58.29  ? 1234 HOH F O     1 
HETATM 7027 O  O     . HOH M 5 .   ? 97.650  4.438   168.863 1.00 40.61  ? 1235 HOH F O     1 
HETATM 7028 O  O     . HOH M 5 .   ? 97.628  14.828  166.344 1.00 53.32  ? 1236 HOH F O     1 
HETATM 7029 O  O     . HOH M 5 .   ? 72.013  27.045  187.107 1.00 54.67  ? 1237 HOH F O     1 
HETATM 7030 O  O     . HOH M 5 .   ? 106.636 -10.231 184.822 1.00 49.01  ? 1238 HOH F O     1 
HETATM 7031 O  O     . HOH M 5 .   ? 119.826 3.924   174.916 1.00 44.00  ? 1239 HOH F O     1 
HETATM 7032 O  O     . HOH M 5 .   ? 88.806  42.735  173.405 1.00 49.99  ? 1240 HOH F O     1 
HETATM 7033 O  O     . HOH M 5 .   ? 74.960  28.193  182.825 1.00 68.75  ? 1241 HOH F O     1 
HETATM 7034 O  O     . HOH M 5 .   ? 99.296  21.097  179.530 1.00 55.79  ? 1242 HOH F O     1 
HETATM 7035 O  O     . HOH M 5 .   ? 117.583 -1.851  171.149 1.00 56.33  ? 1243 HOH F O     1 
HETATM 7036 O  O     . HOH M 5 .   ? 120.487 3.087   168.116 1.00 44.18  ? 1244 HOH F O     1 
HETATM 7037 O  O     . HOH M 5 .   ? 63.001  18.545  165.459 1.00 54.64  ? 1245 HOH F O     1 
HETATM 7038 O  O     . HOH M 5 .   ? 82.941  2.895   182.077 1.00 60.54  ? 1246 HOH F O     1 
HETATM 7039 O  O     . HOH M 5 .   ? 108.807 6.127   155.950 1.00 39.12  ? 1247 HOH F O     1 
HETATM 7040 O  O     . HOH M 5 .   ? 98.564  20.897  181.725 1.00 77.04  ? 1248 HOH F O     1 
HETATM 7041 O  O     . HOH M 5 .   ? 78.733  22.105  156.235 1.00 45.35  ? 1249 HOH F O     1 
HETATM 7042 O  O     . HOH M 5 .   ? 86.785  7.611   178.213 1.00 70.24  ? 1250 HOH F O     1 
HETATM 7043 O  O     . HOH M 5 .   ? 117.817 3.055   181.471 1.00 46.49  ? 1251 HOH F O     1 
HETATM 7044 O  O     . HOH M 5 .   ? 112.862 1.708   185.784 1.00 37.71  ? 1252 HOH F O     1 
HETATM 7045 O  O     . HOH M 5 .   ? 104.636 20.036  184.709 1.00 58.52  ? 1253 HOH F O     1 
HETATM 7046 O  O     . HOH M 5 .   ? 91.003  15.239  151.094 1.00 50.34  ? 1254 HOH F O     1 
HETATM 7047 O  O     . HOH M 5 .   ? 88.633  10.003  180.728 1.00 56.82  ? 1255 HOH F O     1 
HETATM 7048 O  O     . HOH M 5 .   ? 108.298 -10.320 173.288 1.00 63.88  ? 1256 HOH F O     1 
HETATM 7049 O  O     . HOH M 5 .   ? 81.403  -6.889  176.027 1.00 54.43  ? 1257 HOH F O     1 
HETATM 7050 O  O     . HOH M 5 .   ? 78.876  4.029   183.860 1.00 46.02  ? 1258 HOH F O     1 
HETATM 7051 O  O     . HOH M 5 .   ? 65.111  21.374  161.930 1.00 55.28  ? 1259 HOH F O     1 
HETATM 7052 O  O     . HOH M 5 .   ? 67.724  25.881  188.516 1.00 57.74  ? 1260 HOH F O     1 
HETATM 7053 O  O     . HOH M 5 .   ? 106.720 -10.775 182.070 1.00 58.52  ? 1261 HOH F O     1 
HETATM 7054 O  O     . HOH M 5 .   ? 76.277  1.990   185.846 1.00 42.44  ? 1262 HOH F O     1 
HETATM 7055 O  O     . HOH M 5 .   ? 120.672 0.770   167.011 1.00 53.58  ? 1263 HOH F O     1 
HETATM 7056 O  O     . HOH M 5 .   ? 105.079 -12.085 180.598 1.00 45.45  ? 1264 HOH F O     1 
HETATM 7057 O  O     . HOH M 5 .   ? 118.094 13.736  183.505 1.00 51.11  ? 1265 HOH F O     1 
HETATM 7058 O  O     . HOH M 5 .   ? 119.144 3.173   179.465 1.00 42.36  ? 1266 HOH F O     1 
HETATM 7059 O  O     . HOH M 5 .   ? 120.427 2.501   173.105 1.00 53.88  ? 1267 HOH F O     1 
HETATM 7060 O  O     . HOH M 5 .   ? 116.344 27.674  169.803 1.00 52.21  ? 1268 HOH F O     1 
HETATM 7061 O  O     . HOH M 5 .   ? 77.535  28.077  182.522 1.00 53.90  ? 1269 HOH F O     1 
HETATM 7062 O  O     . HOH M 5 .   ? 100.857 -11.159 180.328 1.00 44.94  ? 1270 HOH F O     1 
HETATM 7063 O  O     . HOH M 5 .   ? 76.466  -0.708  140.690 1.00 63.23  ? 1271 HOH F O     1 
HETATM 7064 O  O     . HOH M 5 .   ? 99.334  -12.351 178.151 1.00 52.71  ? 1272 HOH F O     1 
HETATM 7065 O  O     . HOH M 5 .   ? 104.416 -12.823 183.429 1.00 58.70  ? 1273 HOH F O     1 
HETATM 7066 O  O     . HOH M 5 .   ? 102.876 -13.386 181.859 1.00 55.63  ? 1274 HOH F O     1 
HETATM 7067 O  O     . HOH N 5 .   ? 89.706  26.883  119.040 1.00 62.46  ? 1001 HOH A O     1 
HETATM 7068 O  O     . HOH N 5 .   ? 98.989  32.919  142.795 1.00 62.16  ? 1002 HOH A O     1 
HETATM 7069 O  O     . HOH N 5 .   ? 121.713 23.253  119.913 1.00 44.22  ? 1003 HOH A O     1 
HETATM 7070 O  O     . HOH N 5 .   ? 129.460 5.631   112.858 1.00 48.86  ? 1004 HOH A O     1 
HETATM 7071 O  O     . HOH N 5 .   ? 118.960 22.967  114.358 1.00 54.57  ? 1005 HOH A O     1 
HETATM 7072 O  O     . HOH N 5 .   ? 110.472 8.422   156.082 1.00 45.67  ? 1006 HOH A O     1 
HETATM 7073 O  O     . HOH N 5 .   ? 108.558 -4.228  131.185 1.00 56.09  ? 1007 HOH A O     1 
HETATM 7074 O  O     . HOH N 5 .   ? 134.121 8.614   126.517 1.00 60.66  ? 1008 HOH A O     1 
HETATM 7075 O  O     . HOH N 5 .   ? 134.759 30.172  117.865 1.00 51.88  ? 1009 HOH A O     1 
HETATM 7076 O  O     . HOH N 5 .   ? 120.117 20.495  154.048 1.00 45.19  ? 1010 HOH A O     1 
HETATM 7077 O  O     . HOH N 5 .   ? 101.434 33.892  145.568 1.00 43.08  ? 1011 HOH A O     1 
HETATM 7078 O  O     . HOH N 5 .   ? 103.270 -1.095  127.764 1.00 54.89  ? 1012 HOH A O     1 
HETATM 7079 O  O     . HOH N 5 .   ? 90.599  1.442   133.491 1.00 62.37  ? 1013 HOH A O     1 
HETATM 7080 O  O     . HOH N 5 .   ? 99.286  -6.228  131.091 1.00 55.93  ? 1014 HOH A O     1 
HETATM 7081 O  O     . HOH N 5 .   ? 91.901  4.468   141.905 1.00 75.21  ? 1015 HOH A O     1 
HETATM 7082 O  O     . HOH N 5 .   ? 117.955 9.569   108.703 1.00 33.79  ? 1016 HOH A O     1 
HETATM 7083 O  O     . HOH N 5 .   ? 110.315 22.385  116.532 1.00 56.51  ? 1017 HOH A O     1 
HETATM 7084 O  O     . HOH N 5 .   ? 100.363 32.021  146.783 1.00 59.92  ? 1018 HOH A O     1 
HETATM 7085 O  O     . HOH N 5 .   ? 92.321  32.184  121.012 1.00 48.30  ? 1019 HOH A O     1 
HETATM 7086 O  O     . HOH N 5 .   ? 102.120 24.890  127.756 1.00 42.25  ? 1020 HOH A O     1 
HETATM 7087 O  O     . HOH N 5 .   ? 139.598 8.128   113.680 1.00 49.77  ? 1021 HOH A O     1 
HETATM 7088 O  O     . HOH N 5 .   ? 111.706 29.737  147.145 1.00 45.03  ? 1022 HOH A O     1 
HETATM 7089 O  O     . HOH N 5 .   ? 105.985 6.754   115.323 1.00 40.21  ? 1023 HOH A O     1 
HETATM 7090 O  O     . HOH N 5 .   ? 120.786 12.591  115.542 1.00 51.35  ? 1024 HOH A O     1 
HETATM 7091 O  O     . HOH N 5 .   ? 95.782  9.795   99.685  1.00 55.08  ? 1025 HOH A O     1 
HETATM 7092 O  O     . HOH N 5 .   ? 102.024 5.775   154.360 1.00 54.21  ? 1026 HOH A O     1 
HETATM 7093 O  O     . HOH N 5 .   ? 112.014 16.322  155.634 1.00 42.59  ? 1027 HOH A O     1 
HETATM 7094 O  O     . HOH N 5 .   ? 110.209 14.715  119.957 1.00 48.59  ? 1028 HOH A O     1 
HETATM 7095 O  O     . HOH N 5 .   ? 110.671 5.741   133.229 1.00 45.66  ? 1029 HOH A O     1 
HETATM 7096 O  O     . HOH N 5 .   ? 99.696  13.816  156.586 1.00 48.42  ? 1030 HOH A O     1 
HETATM 7097 O  O     . HOH N 5 .   ? 99.681  42.413  123.714 1.00 38.84  ? 1031 HOH A O     1 
HETATM 7098 O  O     . HOH N 5 .   ? 113.311 6.556   106.634 1.00 39.19  ? 1032 HOH A O     1 
HETATM 7099 O  O     . HOH N 5 .   ? 92.089  23.505  116.870 1.00 58.82  ? 1033 HOH A O     1 
HETATM 7100 O  O     . HOH N 5 .   ? 97.602  33.714  143.629 1.00 60.49  ? 1034 HOH A O     1 
HETATM 7101 O  O     . HOH N 5 .   ? 110.755 24.958  115.395 1.00 39.50  ? 1035 HOH A O     1 
HETATM 7102 O  O     . HOH N 5 .   ? 107.602 30.333  112.756 1.00 35.78  ? 1036 HOH A O     1 
HETATM 7103 O  O     . HOH N 5 .   ? 121.659 23.791  147.667 1.00 26.70  ? 1037 HOH A O     1 
HETATM 7104 O  O     . HOH N 5 .   ? 107.756 3.924   108.707 1.00 48.06  ? 1038 HOH A O     1 
HETATM 7105 O  O     . HOH N 5 .   ? 107.244 0.705   127.302 1.00 46.91  ? 1039 HOH A O     1 
HETATM 7106 O  O     . HOH N 5 .   ? 120.026 23.945  141.475 1.00 44.36  ? 1040 HOH A O     1 
HETATM 7107 O  O     . HOH N 5 .   ? 130.869 3.115   119.243 1.00 64.13  ? 1041 HOH A O     1 
HETATM 7108 O  O     . HOH N 5 .   ? 120.248 7.547   104.547 1.00 59.10  ? 1042 HOH A O     1 
HETATM 7109 O  O     . HOH N 5 .   ? 93.916  3.221   141.371 1.00 55.35  ? 1043 HOH A O     1 
HETATM 7110 O  O     . HOH N 5 .   ? 97.404  16.585  154.356 1.00 42.69  ? 1044 HOH A O     1 
HETATM 7111 O  O     . HOH N 5 .   ? 101.230 27.693  100.994 1.00 57.37  ? 1045 HOH A O     1 
HETATM 7112 O  O     . HOH N 5 .   ? 94.842  30.213  125.774 1.00 51.06  ? 1046 HOH A O     1 
HETATM 7113 O  O     . HOH N 5 .   ? 107.478 20.852  136.116 1.00 25.29  ? 1047 HOH A O     1 
HETATM 7114 O  O     . HOH N 5 .   ? 98.954  14.907  95.754  1.00 55.79  ? 1048 HOH A O     1 
HETATM 7115 O  O     . HOH N 5 .   ? 134.098 25.326  109.108 1.00 55.60  ? 1049 HOH A O     1 
HETATM 7116 O  O     . HOH N 5 .   ? 103.597 27.407  137.197 1.00 48.03  ? 1050 HOH A O     1 
HETATM 7117 O  O     . HOH N 5 .   ? 102.542 7.495   112.425 1.00 45.27  ? 1051 HOH A O     1 
HETATM 7118 O  O     . HOH N 5 .   ? 105.485 2.498   108.432 1.00 56.57  ? 1052 HOH A O     1 
HETATM 7119 O  O     . HOH N 5 .   ? 106.194 9.057   117.105 1.00 41.48  ? 1053 HOH A O     1 
HETATM 7120 O  O     . HOH N 5 .   ? 104.578 25.407  154.421 1.00 51.82  ? 1054 HOH A O     1 
HETATM 7121 O  O     . HOH N 5 .   ? 96.510  17.304  100.541 1.00 67.46  ? 1055 HOH A O     1 
HETATM 7122 O  O     . HOH N 5 .   ? 129.979 25.726  102.121 1.00 52.97  ? 1056 HOH A O     1 
HETATM 7123 O  O     . HOH N 5 .   ? 121.887 15.001  123.240 1.00 53.30  ? 1057 HOH A O     1 
HETATM 7124 O  O     . HOH N 5 .   ? 93.044  13.114  120.006 1.00 55.37  ? 1058 HOH A O     1 
HETATM 7125 O  O     . HOH N 5 .   ? 102.223 25.364  138.372 1.00 34.25  ? 1059 HOH A O     1 
HETATM 7126 O  O     . HOH N 5 .   ? 114.674 8.616   149.949 1.00 47.65  ? 1060 HOH A O     1 
HETATM 7127 O  O     . HOH N 5 .   ? 102.421 -0.413  131.139 1.00 36.13  ? 1061 HOH A O     1 
HETATM 7128 O  O     . HOH N 5 .   ? 118.933 18.296  141.147 1.00 50.25  ? 1062 HOH A O     1 
HETATM 7129 O  O     . HOH N 5 .   ? 119.492 9.236   102.159 1.00 37.98  ? 1063 HOH A O     1 
HETATM 7130 O  O     . HOH N 5 .   ? 106.859 32.531  146.904 1.00 56.12  ? 1064 HOH A O     1 
HETATM 7131 O  O     . HOH N 5 .   ? 112.300 26.288  105.880 1.00 37.42  ? 1065 HOH A O     1 
HETATM 7132 O  O     . HOH N 5 .   ? 105.453 29.986  101.266 1.00 48.01  ? 1066 HOH A O     1 
HETATM 7133 O  O     . HOH N 5 .   ? 100.455 4.878   152.100 1.00 36.34  ? 1067 HOH A O     1 
HETATM 7134 O  O     . HOH N 5 .   ? 116.026 25.714  152.142 1.00 30.74  ? 1068 HOH A O     1 
HETATM 7135 O  O     . HOH N 5 .   ? 100.920 27.829  112.423 1.00 44.81  ? 1069 HOH A O     1 
HETATM 7136 O  O     . HOH N 5 .   ? 94.631  23.159  139.275 1.00 65.33  ? 1070 HOH A O     1 
HETATM 7137 O  O     . HOH N 5 .   ? 116.702 14.750  114.456 1.00 49.79  ? 1071 HOH A O     1 
HETATM 7138 O  O     . HOH N 5 .   ? 109.593 17.967  133.908 1.00 34.80  ? 1072 HOH A O     1 
HETATM 7139 O  O     . HOH N 5 .   ? 138.784 13.641  107.458 1.00 44.42  ? 1073 HOH A O     1 
HETATM 7140 O  O     . HOH N 5 .   ? 109.766 -2.640  144.294 1.00 48.67  ? 1074 HOH A O     1 
HETATM 7141 O  O     . HOH N 5 .   ? 102.045 27.733  140.644 1.00 41.57  ? 1075 HOH A O     1 
HETATM 7142 O  O     . HOH N 5 .   ? 91.617  34.353  111.982 1.00 57.11  ? 1076 HOH A O     1 
HETATM 7143 O  O     . HOH N 5 .   ? 101.472 26.277  105.600 1.00 40.99  ? 1077 HOH A O     1 
HETATM 7144 O  O     . HOH N 5 .   ? 109.450 23.888  139.220 1.00 25.41  ? 1078 HOH A O     1 
HETATM 7145 O  O     . HOH N 5 .   ? 104.394 33.296  143.784 1.00 38.24  ? 1079 HOH A O     1 
HETATM 7146 O  O     . HOH N 5 .   ? 111.315 27.584  144.934 1.00 33.12  ? 1080 HOH A O     1 
HETATM 7147 O  O     . HOH N 5 .   ? 94.281  17.661  148.672 1.00 43.09  ? 1081 HOH A O     1 
HETATM 7148 O  O     . HOH N 5 .   ? 123.476 6.785   111.638 1.00 44.18  ? 1082 HOH A O     1 
HETATM 7149 O  O     . HOH N 5 .   ? 113.988 22.066  136.014 1.00 43.80  ? 1083 HOH A O     1 
HETATM 7150 O  O     . HOH N 5 .   ? 108.412 3.492   120.944 1.00 48.10  ? 1084 HOH A O     1 
HETATM 7151 O  O     . HOH N 5 .   ? 116.228 14.970  154.503 1.00 37.33  ? 1085 HOH A O     1 
HETATM 7152 O  O     . HOH N 5 .   ? 109.547 -1.087  131.220 1.00 53.62  ? 1086 HOH A O     1 
HETATM 7153 O  O     . HOH N 5 .   ? 112.271 14.915  95.366  1.00 44.43  ? 1087 HOH A O     1 
HETATM 7154 O  O     . HOH N 5 .   ? 117.047 28.019  148.034 1.00 25.78  ? 1088 HOH A O     1 
HETATM 7155 O  O     . HOH N 5 .   ? 104.442 28.096  133.134 1.00 32.52  ? 1089 HOH A O     1 
HETATM 7156 O  O     . HOH N 5 .   ? 101.328 19.940  159.302 1.00 46.75  ? 1090 HOH A O     1 
HETATM 7157 O  O     . HOH N 5 .   ? 112.214 17.629  94.792  1.00 56.78  ? 1091 HOH A O     1 
HETATM 7158 O  O     . HOH N 5 .   ? 114.557 17.218  155.890 1.00 40.52  ? 1092 HOH A O     1 
HETATM 7159 O  O     . HOH N 5 .   ? 128.087 20.492  98.034  1.00 38.46  ? 1093 HOH A O     1 
HETATM 7160 O  O     . HOH N 5 .   ? 103.096 4.244   116.758 1.00 48.74  ? 1094 HOH A O     1 
HETATM 7161 O  O     . HOH N 5 .   ? 141.955 14.582  115.935 1.00 53.26  ? 1095 HOH A O     1 
HETATM 7162 O  O     . HOH N 5 .   ? 121.968 15.634  94.195  1.00 47.49  ? 1096 HOH A O     1 
HETATM 7163 O  O     . HOH N 5 .   ? 101.064 11.410  120.093 1.00 51.17  ? 1097 HOH A O     1 
HETATM 7164 O  O     . HOH N 5 .   ? 100.920 28.409  103.794 1.00 46.35  ? 1098 HOH A O     1 
HETATM 7165 O  O     . HOH N 5 .   ? 110.255 22.397  156.951 1.00 42.75  ? 1099 HOH A O     1 
HETATM 7166 O  O     . HOH N 5 .   ? 92.339  16.138  141.522 1.00 52.11  ? 1100 HOH A O     1 
HETATM 7167 O  O     . HOH N 5 .   ? 126.633 26.921  124.659 1.00 51.81  ? 1101 HOH A O     1 
HETATM 7168 O  O     . HOH N 5 .   ? 112.614 25.442  125.012 1.00 32.09  ? 1102 HOH A O     1 
HETATM 7169 O  O     . HOH N 5 .   ? 104.000 27.704  130.086 1.00 35.54  ? 1103 HOH A O     1 
HETATM 7170 O  O     . HOH N 5 .   ? 115.302 29.812  99.975  1.00 73.33  ? 1104 HOH A O     1 
HETATM 7171 O  O     . HOH N 5 .   ? 110.272 38.786  115.817 1.00 42.42  ? 1105 HOH A O     1 
HETATM 7172 O  O     . HOH N 5 .   ? 122.995 8.353   106.191 1.00 41.87  ? 1106 HOH A O     1 
HETATM 7173 O  O     . HOH N 5 .   ? 98.355  32.363  132.073 1.00 54.70  ? 1107 HOH A O     1 
HETATM 7174 O  O     . HOH N 5 .   ? 102.340 33.771  106.179 1.00 42.90  ? 1108 HOH A O     1 
HETATM 7175 O  O     . HOH N 5 .   ? 116.157 14.783  138.150 1.00 43.09  ? 1109 HOH A O     1 
HETATM 7176 O  O     . HOH N 5 .   ? 102.568 -5.675  135.977 1.00 46.74  ? 1110 HOH A O     1 
HETATM 7177 O  O     . HOH N 5 .   ? 108.607 10.947  131.666 1.00 37.96  ? 1111 HOH A O     1 
HETATM 7178 O  O     . HOH N 5 .   ? 131.777 19.198  104.126 1.00 37.26  ? 1112 HOH A O     1 
HETATM 7179 O  O     . HOH N 5 .   ? 98.475  39.498  129.963 1.00 49.10  ? 1113 HOH A O     1 
HETATM 7180 O  O     . HOH N 5 .   ? 113.461 28.255  132.361 1.00 40.55  ? 1114 HOH A O     1 
HETATM 7181 O  O     . HOH N 5 .   ? 97.638  9.343   128.350 1.00 56.53  ? 1115 HOH A O     1 
HETATM 7182 O  O     . HOH N 5 .   ? 100.998 37.440  138.639 1.00 45.89  ? 1116 HOH A O     1 
HETATM 7183 O  O     . HOH N 5 .   ? 126.629 13.086  103.098 1.00 52.57  ? 1117 HOH A O     1 
HETATM 7184 O  O     . HOH N 5 .   ? 106.931 5.615   154.011 1.00 41.94  ? 1118 HOH A O     1 
HETATM 7185 O  O     . HOH N 5 .   ? 111.655 30.468  121.508 1.00 46.82  ? 1119 HOH A O     1 
HETATM 7186 O  O     . HOH N 5 .   ? 90.946  9.159   138.141 1.00 59.08  ? 1120 HOH A O     1 
HETATM 7187 O  O     . HOH N 5 .   ? 113.151 10.890  114.808 1.00 55.57  ? 1121 HOH A O     1 
HETATM 7188 O  O     . HOH N 5 .   ? 103.875 18.070  121.786 1.00 44.16  ? 1122 HOH A O     1 
HETATM 7189 O  O     . HOH N 5 .   ? 112.937 7.085   115.955 1.00 39.02  ? 1123 HOH A O     1 
HETATM 7190 O  O     . HOH N 5 .   ? 136.820 20.241  106.907 1.00 52.49  ? 1124 HOH A O     1 
HETATM 7191 O  O     . HOH N 5 .   ? 96.959  -1.060  142.688 1.00 43.97  ? 1125 HOH A O     1 
HETATM 7192 O  O     . HOH N 5 .   ? 97.574  32.101  112.921 1.00 42.84  ? 1126 HOH A O     1 
HETATM 7193 O  O     . HOH N 5 .   ? 111.258 19.169  136.564 1.00 40.76  ? 1127 HOH A O     1 
HETATM 7194 O  O     . HOH N 5 .   ? 120.605 14.481  115.375 1.00 51.30  ? 1128 HOH A O     1 
HETATM 7195 O  O     . HOH N 5 .   ? 109.685 10.157  139.428 1.00 44.04  ? 1129 HOH A O     1 
HETATM 7196 O  O     . HOH N 5 .   ? 100.944 26.083  97.223  1.00 56.43  ? 1130 HOH A O     1 
HETATM 7197 O  O     . HOH N 5 .   ? 99.973  28.469  135.296 1.00 68.47  ? 1131 HOH A O     1 
HETATM 7198 O  O     . HOH N 5 .   ? 101.937 37.599  135.219 1.00 56.64  ? 1132 HOH A O     1 
HETATM 7199 O  O     . HOH N 5 .   ? 105.808 1.835   124.959 1.00 47.61  ? 1133 HOH A O     1 
HETATM 7200 O  O     . HOH N 5 .   ? 95.443  3.138   144.640 1.00 40.83  ? 1134 HOH A O     1 
HETATM 7201 O  O     . HOH N 5 .   ? 106.596 13.601  137.512 1.00 36.43  ? 1135 HOH A O     1 
HETATM 7202 O  O     . HOH N 5 .   ? 112.475 4.552   116.551 1.00 46.91  ? 1136 HOH A O     1 
HETATM 7203 O  O     . HOH N 5 .   ? 96.748  34.432  131.413 1.00 52.25  ? 1137 HOH A O     1 
HETATM 7204 O  O     . HOH N 5 .   ? 103.089 17.675  158.344 1.00 29.54  ? 1138 HOH A O     1 
HETATM 7205 O  O     . HOH N 5 .   ? 108.526 34.025  136.076 1.00 46.01  ? 1139 HOH A O     1 
HETATM 7206 O  O     . HOH N 5 .   ? 98.852  31.285  134.962 1.00 48.79  ? 1140 HOH A O     1 
HETATM 7207 O  O     . HOH N 5 .   ? 116.183 36.787  124.531 1.00 52.19  ? 1141 HOH A O     1 
HETATM 7208 O  O     . HOH N 5 .   ? 143.306 15.965  110.312 1.00 62.49  ? 1142 HOH A O     1 
HETATM 7209 O  O     . HOH N 5 .   ? 113.994 5.198   150.499 1.00 45.59  ? 1143 HOH A O     1 
HETATM 7210 O  O     . HOH N 5 .   ? 103.226 7.068   115.114 1.00 42.53  ? 1144 HOH A O     1 
HETATM 7211 O  O     . HOH N 5 .   ? 108.266 2.771   149.005 1.00 58.42  ? 1145 HOH A O     1 
HETATM 7212 O  O     . HOH N 5 .   ? 113.735 21.871  95.022  1.00 53.46  ? 1146 HOH A O     1 
HETATM 7213 O  O     . HOH N 5 .   ? 90.866  0.609   140.713 1.00 58.91  ? 1147 HOH A O     1 
HETATM 7214 O  O     . HOH N 5 .   ? 117.914 22.556  96.661  1.00 50.72  ? 1148 HOH A O     1 
HETATM 7215 O  O     . HOH N 5 .   ? 111.406 3.506   146.354 1.00 50.41  ? 1149 HOH A O     1 
HETATM 7216 O  O     . HOH N 5 .   ? 108.531 1.953   129.094 1.00 47.01  ? 1150 HOH A O     1 
HETATM 7217 O  O     . HOH N 5 .   ? 112.161 27.353  98.914  1.00 58.86  ? 1151 HOH A O     1 
HETATM 7218 O  O     . HOH N 5 .   ? 111.895 27.495  151.042 1.00 31.30  ? 1152 HOH A O     1 
HETATM 7219 O  O     . HOH N 5 .   ? 103.131 35.901  114.889 1.00 38.71  ? 1153 HOH A O     1 
HETATM 7220 O  O     . HOH N 5 .   ? 92.683  13.782  132.044 1.00 48.07  ? 1154 HOH A O     1 
HETATM 7221 O  O     . HOH N 5 .   ? 128.505 25.416  117.333 1.00 46.07  ? 1155 HOH A O     1 
HETATM 7222 O  O     . HOH N 5 .   ? 124.729 23.521  99.694  1.00 43.14  ? 1156 HOH A O     1 
HETATM 7223 O  O     . HOH N 5 .   ? 98.599  20.935  155.612 1.00 53.94  ? 1157 HOH A O     1 
HETATM 7224 O  O     . HOH N 5 .   ? 104.442 -0.532  118.321 1.00 59.80  ? 1158 HOH A O     1 
HETATM 7225 O  O     . HOH N 5 .   ? 96.233  2.573   147.207 1.00 49.36  ? 1159 HOH A O     1 
HETATM 7226 O  O     . HOH N 5 .   ? 109.932 28.623  100.622 1.00 45.28  ? 1160 HOH A O     1 
HETATM 7227 O  O     . HOH N 5 .   ? 110.240 5.793   121.296 1.00 51.38  ? 1161 HOH A O     1 
HETATM 7228 O  O     . HOH N 5 .   ? 129.726 22.649  128.894 1.00 45.91  ? 1162 HOH A O     1 
HETATM 7229 O  O     . HOH N 5 .   ? 142.796 6.745   115.673 1.00 49.67  ? 1163 HOH A O     1 
HETATM 7230 O  O     . HOH N 5 .   ? 108.036 30.376  148.489 1.00 32.17  ? 1164 HOH A O     1 
HETATM 7231 O  O     . HOH N 5 .   ? 115.627 41.915  120.427 1.00 57.71  ? 1165 HOH A O     1 
HETATM 7232 O  O     . HOH N 5 .   ? 96.765  30.293  99.843  1.00 49.03  ? 1166 HOH A O     1 
HETATM 7233 O  O     . HOH N 5 .   ? 103.164 22.679  126.632 1.00 47.44  ? 1167 HOH A O     1 
HETATM 7234 O  O     . HOH N 5 .   ? 105.048 -5.569  136.301 1.00 51.58  ? 1168 HOH A O     1 
HETATM 7235 O  O     . HOH N 5 .   ? 102.919 21.564  95.216  1.00 50.17  ? 1169 HOH A O     1 
HETATM 7236 O  O     . HOH N 5 .   ? 109.507 0.920   117.621 1.00 54.65  ? 1170 HOH A O     1 
HETATM 7237 O  O     . HOH N 5 .   ? 98.675  9.925   110.817 1.00 53.00  ? 1171 HOH A O     1 
HETATM 7238 O  O     . HOH N 5 .   ? 115.212 25.226  98.652  1.00 43.29  ? 1172 HOH A O     1 
HETATM 7239 O  O     . HOH N 5 .   ? 100.761 35.847  112.209 1.00 61.60  ? 1173 HOH A O     1 
HETATM 7240 O  O     . HOH N 5 .   ? 90.293  15.537  116.585 1.00 54.18  ? 1174 HOH A O     1 
HETATM 7241 O  O     . HOH N 5 .   ? 124.270 9.847   103.857 1.00 49.50  ? 1175 HOH A O     1 
HETATM 7242 O  O     . HOH N 5 .   ? 107.802 16.336  122.182 1.00 51.04  ? 1176 HOH A O     1 
HETATM 7243 O  O     . HOH N 5 .   ? 101.672 26.455  148.316 1.00 43.62  ? 1177 HOH A O     1 
HETATM 7244 O  O     . HOH N 5 .   ? 116.263 5.541   148.707 1.00 66.26  ? 1178 HOH A O     1 
HETATM 7245 O  O     . HOH N 5 .   ? 119.018 16.337  146.445 1.00 48.96  ? 1179 HOH A O     1 
HETATM 7246 O  O     . HOH N 5 .   ? 123.008 24.604  121.226 1.00 46.19  ? 1180 HOH A O     1 
HETATM 7247 O  O     . HOH N 5 .   ? 106.622 -4.566  137.105 1.00 57.64  ? 1181 HOH A O     1 
HETATM 7248 O  O     . HOH N 5 .   ? 103.010 32.997  109.079 1.00 48.61  ? 1182 HOH A O     1 
HETATM 7249 O  O     . HOH N 5 .   ? 114.918 6.504   114.532 1.00 51.13  ? 1183 HOH A O     1 
HETATM 7250 O  O     . HOH N 5 .   ? 98.695  21.263  149.978 1.00 46.15  ? 1184 HOH A O     1 
HETATM 7251 O  O     . HOH N 5 .   ? 112.228 14.359  135.652 1.00 49.39  ? 1185 HOH A O     1 
HETATM 7252 O  O     . HOH N 5 .   ? 136.203 7.115   128.207 1.00 65.89  ? 1186 HOH A O     1 
HETATM 7253 O  O     . HOH N 5 .   ? 108.072 1.999   111.020 1.00 49.65  ? 1187 HOH A O     1 
HETATM 7254 O  O     . HOH N 5 .   ? 99.944  21.292  137.207 1.00 52.39  ? 1188 HOH A O     1 
HETATM 7255 O  O     . HOH N 5 .   ? 92.233  22.971  114.192 1.00 61.09  ? 1189 HOH A O     1 
HETATM 7256 O  O     . HOH N 5 .   ? 111.206 24.559  97.776  1.00 46.89  ? 1190 HOH A O     1 
HETATM 7257 O  O     . HOH N 5 .   ? 114.056 3.349   144.990 1.00 55.87  ? 1191 HOH A O     1 
HETATM 7258 O  O     . HOH N 5 .   ? 109.952 -3.552  136.006 1.00 54.03  ? 1192 HOH A O     1 
HETATM 7259 O  O     . HOH N 5 .   ? 103.367 44.258  114.939 1.00 53.94  ? 1193 HOH A O     1 
HETATM 7260 O  O     . HOH N 5 .   ? 112.606 28.461  153.936 1.00 49.71  ? 1194 HOH A O     1 
HETATM 7261 O  O     . HOH N 5 .   ? 138.798 9.775   111.848 1.00 60.09  ? 1195 HOH A O     1 
HETATM 7262 O  O     . HOH N 5 .   ? 114.629 38.638  117.323 1.00 72.25  ? 1196 HOH A O     1 
HETATM 7263 O  O     . HOH N 5 .   ? 92.095  5.667   148.407 1.00 59.69  ? 1197 HOH A O     1 
HETATM 7264 O  O     . HOH N 5 .   ? 108.735 3.268   102.146 1.00 51.61  ? 1198 HOH A O     1 
HETATM 7265 O  O     . HOH N 5 .   ? 120.175 20.414  151.544 1.00 35.09  ? 1199 HOH A O     1 
HETATM 7266 O  O     . HOH N 5 .   ? 97.100  10.346  125.651 1.00 64.21  ? 1200 HOH A O     1 
HETATM 7267 O  O     . HOH N 5 .   ? 99.612  9.493   115.197 1.00 52.92  ? 1201 HOH A O     1 
HETATM 7268 O  O     . HOH N 5 .   ? 108.085 -1.574  117.312 1.00 61.37  ? 1202 HOH A O     1 
HETATM 7269 O  O     . HOH N 5 .   ? 112.815 29.852  144.992 1.00 47.96  ? 1203 HOH A O     1 
HETATM 7270 O  O     . HOH N 5 .   ? 112.024 37.881  116.302 1.00 55.22  ? 1204 HOH A O     1 
HETATM 7271 O  O     . HOH N 5 .   ? 110.709 11.571  133.067 1.00 38.70  ? 1205 HOH A O     1 
HETATM 7272 O  O     . HOH N 5 .   ? 115.254 30.145  147.318 1.00 37.19  ? 1206 HOH A O     1 
HETATM 7273 O  O     . HOH N 5 .   ? 107.783 1.388   122.783 1.00 56.40  ? 1207 HOH A O     1 
HETATM 7274 O  O     . HOH N 5 .   ? 99.788  33.079  144.846 1.00 58.13  ? 1208 HOH A O     1 
HETATM 7275 O  O     . HOH N 5 .   ? 108.953 25.118  95.965  1.00 55.61  ? 1209 HOH A O     1 
HETATM 7276 O  O     . HOH N 5 .   ? 98.973  45.022  123.149 1.00 53.82  ? 1210 HOH A O     1 
HETATM 7277 O  O     . HOH N 5 .   ? 103.509 0.160   125.141 1.00 53.34  ? 1211 HOH A O     1 
HETATM 7278 O  O     . HOH N 5 .   ? 109.563 32.359  147.326 1.00 55.30  ? 1212 HOH A O     1 
HETATM 7279 O  O     . HOH N 5 .   ? 117.381 14.818  119.397 1.00 54.23  ? 1213 HOH A O     1 
HETATM 7280 O  O     . HOH N 5 .   ? 96.775  32.468  136.155 1.00 60.54  ? 1214 HOH A O     1 
HETATM 7281 O  O     . HOH N 5 .   ? 121.051 17.862  150.753 1.00 49.57  ? 1215 HOH A O     1 
HETATM 7282 O  O     . HOH N 5 .   ? 114.329 19.506  134.730 1.00 39.58  ? 1216 HOH A O     1 
HETATM 7283 O  O     . HOH N 5 .   ? 113.396 2.937   150.709 1.00 66.07  ? 1217 HOH A O     1 
HETATM 7284 O  O     . HOH N 5 .   ? 110.652 11.996  135.725 1.00 47.29  ? 1218 HOH A O     1 
HETATM 7285 O  O     . HOH N 5 .   ? 111.590 -0.528  133.284 1.00 54.56  ? 1219 HOH A O     1 
HETATM 7286 O  O     . HOH N 5 .   ? 94.529  30.791  100.384 1.00 61.22  ? 1220 HOH A O     1 
HETATM 7287 O  O     . HOH N 5 .   ? 112.273 9.927   136.343 1.00 48.22  ? 1221 HOH A O     1 
HETATM 7288 O  O     . HOH N 5 .   ? 101.653 15.436  159.172 1.00 37.72  ? 1222 HOH A O     1 
HETATM 7289 O  O     . HOH N 5 .   ? 113.084 23.894  96.333  1.00 49.02  ? 1223 HOH A O     1 
HETATM 7290 O  O     . HOH N 5 .   ? 122.401 19.005  149.276 1.00 47.50  ? 1224 HOH A O     1 
HETATM 7291 O  O     . HOH N 5 .   ? 102.614 33.058  112.020 1.00 61.86  ? 1225 HOH A O     1 
HETATM 7292 O  O     . HOH N 5 .   ? 109.930 21.685  137.177 1.00 34.15  ? 1226 HOH A O     1 
HETATM 7293 O  O     . HOH N 5 .   ? 110.019 0.075   123.476 1.00 53.28  ? 1227 HOH A O     1 
HETATM 7294 O  O     . HOH N 5 .   ? 110.713 1.865   129.315 1.00 50.79  ? 1228 HOH A O     1 
HETATM 7295 O  O     . HOH N 5 .   ? 116.907 39.385  123.589 1.00 50.24  ? 1229 HOH A O     1 
HETATM 7296 O  O     . HOH N 5 .   ? 100.692 9.672   112.560 1.00 43.35  ? 1230 HOH A O     1 
HETATM 7297 O  O     . HOH N 5 .   ? 108.929 12.180  137.508 1.00 41.14  ? 1231 HOH A O     1 
HETATM 7298 O  O     . HOH N 5 .   ? 99.237  31.541  100.919 1.00 53.30  ? 1232 HOH A O     1 
HETATM 7299 O  O     . HOH N 5 .   ? 93.785  16.169  151.338 1.00 44.75  ? 1233 HOH A O     1 
HETATM 7300 O  O     . HOH N 5 .   ? 121.424 17.447  154.919 1.00 57.33  ? 1234 HOH A O     1 
HETATM 7301 O  O     . HOH N 5 .   ? 124.884 26.975  121.831 1.00 55.84  ? 1235 HOH A O     1 
HETATM 7302 O  O     . HOH N 5 .   ? 99.053  7.510   109.716 1.00 48.54  ? 1236 HOH A O     1 
HETATM 7303 O  O     . HOH N 5 .   ? 130.730 20.358  130.452 1.00 71.51  ? 1237 HOH A O     1 
HETATM 7304 O  O     . HOH N 5 .   ? 109.537 31.302  154.240 1.00 57.80  ? 1238 HOH A O     1 
HETATM 7305 O  O     . HOH N 5 .   ? 116.290 32.252  129.357 1.00 65.14  ? 1239 HOH A O     1 
HETATM 7306 O  O     . HOH N 5 .   ? 101.789 -7.123  133.586 1.00 48.81  ? 1240 HOH A O     1 
HETATM 7307 O  O     . HOH N 5 .   ? 126.379 28.284  119.956 1.00 65.89  ? 1241 HOH A O     1 
HETATM 7308 O  O     . HOH O 5 .   ? 96.105  0.000   147.757 1.00 56.80  ? 901  HOH G O     1 
HETATM 7309 O  O     . HOH O 5 .   ? 104.502 -17.942 162.745 1.00 53.39  ? 902  HOH G O     1 
HETATM 7310 O  O     . HOH O 5 .   ? 105.314 29.297  170.441 1.00 43.24  ? 903  HOH G O     1 
HETATM 7311 O  O     . HOH O 5 .   ? 99.640  23.233  161.586 1.00 60.06  ? 904  HOH G O     1 
HETATM 7312 O  O     . HOH O 5 .   ? 98.185  -7.635  152.223 1.00 52.50  ? 905  HOH G O     1 
HETATM 7313 O  O     . HOH O 5 .   ? 102.749 19.458  170.134 1.00 28.78  ? 906  HOH G O     1 
HETATM 7314 O  O     . HOH O 5 .   ? 96.822  10.307  168.241 1.00 28.14  ? 907  HOH G O     1 
HETATM 7315 O  O     . HOH O 5 .   ? 96.316  7.984   168.528 1.00 33.38  ? 908  HOH G O     1 
HETATM 7316 O  O     . HOH O 5 .   ? 93.821  -1.852  163.297 1.00 37.62  ? 909  HOH G O     1 
HETATM 7317 O  O     . HOH O 5 .   ? 94.296  17.172  169.117 1.00 32.37  ? 910  HOH G O     1 
HETATM 7318 O  O     . HOH O 5 .   ? 102.280 -7.301  149.650 1.00 58.46  ? 911  HOH G O     1 
HETATM 7319 O  O     . HOH O 5 .   ? 96.965  16.486  169.931 1.00 33.80  ? 912  HOH G O     1 
HETATM 7320 O  O     . HOH O 5 .   ? 102.595 -16.183 150.838 1.00 56.71  ? 913  HOH G O     1 
HETATM 7321 O  O     . HOH O 5 .   ? 98.721  10.732  175.220 1.00 31.60  ? 914  HOH G O     1 
HETATM 7322 O  O     . HOH O 5 .   ? 86.310  3.916   155.793 1.00 42.83  ? 915  HOH G O     1 
HETATM 7323 O  O     . HOH O 5 .   ? 96.862  8.675   175.105 1.00 33.32  ? 916  HOH G O     1 
HETATM 7324 O  O     . HOH O 5 .   ? 88.205  6.008   162.152 1.00 37.53  ? 917  HOH G O     1 
HETATM 7325 O  O     . HOH O 5 .   ? 93.141  2.185   170.895 1.00 33.38  ? 918  HOH G O     1 
HETATM 7326 O  O     . HOH O 5 .   ? 97.315  10.400  170.820 1.00 27.99  ? 919  HOH G O     1 
HETATM 7327 O  O     . HOH O 5 .   ? 94.423  17.127  177.825 1.00 24.92  ? 920  HOH G O     1 
HETATM 7328 O  O     . HOH O 5 .   ? 86.872  6.625   166.000 1.00 55.15  ? 921  HOH G O     1 
HETATM 7329 O  O     . HOH O 5 .   ? 92.388  19.514  168.661 1.00 36.00  ? 922  HOH G O     1 
HETATM 7330 O  O     . HOH O 5 .   ? 96.017  13.513  169.627 1.00 38.38  ? 923  HOH G O     1 
HETATM 7331 O  O     . HOH O 5 .   ? 88.638  9.188   172.317 1.00 37.53  ? 924  HOH G O     1 
HETATM 7332 O  O     . HOH O 5 .   ? 101.711 -10.354 151.416 1.00 49.11  ? 925  HOH G O     1 
HETATM 7333 O  O     . HOH O 5 .   ? 93.858  0.228   166.277 1.00 41.88  ? 926  HOH G O     1 
HETATM 7334 O  O     . HOH O 5 .   ? 106.164 27.216  167.272 1.00 51.60  ? 927  HOH G O     1 
HETATM 7335 O  O     . HOH O 5 .   ? 85.956  0.441   172.704 1.00 52.04  ? 928  HOH G O     1 
HETATM 7336 O  O     . HOH O 5 .   ? 90.254  11.347  176.996 1.00 53.79  ? 929  HOH G O     1 
HETATM 7337 O  O     . HOH O 5 .   ? 96.027  21.079  168.529 1.00 37.32  ? 930  HOH G O     1 
HETATM 7338 O  O     . HOH O 5 .   ? 96.229  20.387  177.315 1.00 37.42  ? 931  HOH G O     1 
HETATM 7339 O  O     . HOH O 5 .   ? 95.082  2.934   168.839 1.00 40.53  ? 932  HOH G O     1 
HETATM 7340 O  O     . HOH O 5 .   ? 91.928  7.594   180.214 1.00 52.33  ? 933  HOH G O     1 
HETATM 7341 O  O     . HOH O 5 .   ? 102.505 -13.138 150.424 1.00 58.03  ? 934  HOH G O     1 
HETATM 7342 O  O     . HOH O 5 .   ? 100.004 -23.283 150.118 1.00 48.92  ? 935  HOH G O     1 
HETATM 7343 O  O     . HOH O 5 .   ? 95.375  25.105  165.638 1.00 54.63  ? 936  HOH G O     1 
HETATM 7344 O  O     . HOH O 5 .   ? 94.526  4.178   149.272 1.00 54.64  ? 937  HOH G O     1 
HETATM 7345 O  O     . HOH O 5 .   ? 97.501  12.715  168.110 1.00 51.42  ? 938  HOH G O     1 
HETATM 7346 O  O     . HOH O 5 .   ? 88.868  9.172   175.358 1.00 45.94  ? 939  HOH G O     1 
HETATM 7347 O  O     . HOH O 5 .   ? 90.317  6.483   179.150 1.00 54.44  ? 940  HOH G O     1 
HETATM 7348 O  O     . HOH O 5 .   ? 97.985  -23.432 149.265 1.00 59.62  ? 941  HOH G O     1 
HETATM 7349 O  O     . HOH O 5 .   ? 97.127  17.507  167.208 1.00 56.51  ? 942  HOH G O     1 
HETATM 7350 O  O     . HOH O 5 .   ? 93.919  -6.461  153.745 1.00 59.54  ? 943  HOH G O     1 
HETATM 7351 O  O     . HOH P 5 .   ? 88.886  -17.570 159.914 1.00 55.95  ? 901  HOH H O     1 
HETATM 7352 O  O     . HOH P 5 .   ? 97.812  6.340   166.381 1.00 36.38  ? 902  HOH H O     1 
HETATM 7353 O  O     . HOH P 5 .   ? 81.208  15.821  163.310 1.00 32.74  ? 903  HOH H O     1 
HETATM 7354 O  O     . HOH P 5 .   ? 108.949 -4.062  165.488 1.00 44.04  ? 904  HOH H O     1 
HETATM 7355 O  O     . HOH P 5 .   ? 97.095  -11.863 151.267 1.00 52.87  ? 905  HOH H O     1 
HETATM 7356 O  O     . HOH P 5 .   ? 100.944 3.878   157.750 1.00 52.23  ? 906  HOH H O     1 
HETATM 7357 O  O     . HOH P 5 .   ? 89.566  -16.282 162.652 1.00 45.44  ? 907  HOH H O     1 
HETATM 7358 O  O     . HOH P 5 .   ? 107.225 5.847   158.202 1.00 49.90  ? 908  HOH H O     1 
HETATM 7359 O  O     . HOH P 5 .   ? 89.367  -12.918 161.197 1.00 57.58  ? 909  HOH H O     1 
HETATM 7360 O  O     . HOH P 5 .   ? 97.480  3.331   166.108 1.00 35.63  ? 910  HOH H O     1 
HETATM 7361 O  O     . HOH P 5 .   ? 102.713 7.411   163.268 1.00 40.23  ? 911  HOH H O     1 
HETATM 7362 O  O     . HOH P 5 .   ? 102.431 13.388  160.775 1.00 39.17  ? 912  HOH H O     1 
HETATM 7363 O  O     . HOH P 5 .   ? 88.204  8.908   162.091 1.00 35.02  ? 913  HOH H O     1 
HETATM 7364 O  O     . HOH P 5 .   ? 86.698  10.977  172.734 1.00 42.82  ? 914  HOH H O     1 
HETATM 7365 O  O     . HOH P 5 .   ? 99.941  4.526   165.604 1.00 47.44  ? 915  HOH H O     1 
HETATM 7366 O  O     . HOH P 5 .   ? 102.849 0.400   158.897 1.00 52.69  ? 916  HOH H O     1 
HETATM 7367 O  O     . HOH P 5 .   ? 100.152 0.468   165.776 1.00 52.10  ? 917  HOH H O     1 
HETATM 7368 O  O     . HOH P 5 .   ? 93.196  15.969  167.041 1.00 33.22  ? 918  HOH H O     1 
HETATM 7369 O  O     . HOH P 5 .   ? 87.114  17.364  163.132 1.00 42.94  ? 919  HOH H O     1 
HETATM 7370 O  O     . HOH P 5 .   ? 89.941  18.557  168.379 1.00 46.59  ? 920  HOH H O     1 
HETATM 7371 O  O     . HOH P 5 .   ? 101.386 -16.120 146.579 1.00 57.53  ? 921  HOH H O     1 
HETATM 7372 O  O     . HOH P 5 .   ? 95.222  14.660  165.345 1.00 47.54  ? 922  HOH H O     1 
HETATM 7373 O  O     . HOH P 5 .   ? 96.437  11.656  164.080 1.00 40.55  ? 923  HOH H O     1 
HETATM 7374 O  O     . HOH P 5 .   ? 86.780  16.837  166.577 1.00 45.62  ? 924  HOH H O     1 
HETATM 7375 O  O     . HOH P 5 .   ? 100.233 11.190  162.108 1.00 42.45  ? 925  HOH H O     1 
HETATM 7376 O  O     . HOH P 5 .   ? 96.814  6.592   157.353 1.00 55.31  ? 926  HOH H O     1 
HETATM 7377 O  O     . HOH P 5 .   ? 91.383  16.685  160.292 1.00 52.73  ? 927  HOH H O     1 
HETATM 7378 O  O     . HOH P 5 .   ? 99.256  8.199   165.442 1.00 42.22  ? 928  HOH H O     1 
HETATM 7379 O  O     . HOH P 5 .   ? 97.765  14.629  161.038 1.00 49.10  ? 929  HOH H O     1 
HETATM 7380 O  O     . HOH P 5 .   ? 95.695  -8.362  153.075 1.00 67.59  ? 930  HOH H O     1 
HETATM 7381 O  O     . HOH P 5 .   ? 94.960  -5.374  161.895 1.00 57.83  ? 931  HOH H O     1 
HETATM 7382 O  O     . HOH P 5 .   ? 108.345 4.111   160.326 1.00 46.26  ? 932  HOH H O     1 
HETATM 7383 O  O     . HOH P 5 .   ? 108.841 4.361   163.172 1.00 50.21  ? 933  HOH H O     1 
HETATM 7384 O  O     . HOH P 5 .   ? 88.365  12.753  176.633 1.00 55.84  ? 934  HOH H O     1 
HETATM 7385 O  O     . HOH P 5 .   ? 99.495  13.216  162.037 1.00 59.26  ? 935  HOH H O     1 
HETATM 7386 O  O     . HOH P 5 .   ? 85.877  17.824  168.997 1.00 48.98  ? 936  HOH H O     1 
HETATM 7387 O  O     . HOH P 5 .   ? 89.340  8.930   156.414 1.00 67.38  ? 937  HOH H O     1 
HETATM 7388 O  O     . HOH Q 5 .   ? 123.682 -8.583  145.821 1.00 50.09  ? 901  HOH B O     1 
HETATM 7389 O  O     . HOH Q 5 .   ? 110.947 7.601   128.666 1.00 37.97  ? 902  HOH B O     1 
HETATM 7390 O  O     . HOH Q 5 .   ? 111.596 23.081  135.455 1.00 38.55  ? 903  HOH B O     1 
HETATM 7391 O  O     . HOH Q 5 .   ? 113.061 15.232  132.878 1.00 36.63  ? 904  HOH B O     1 
HETATM 7392 O  O     . HOH Q 5 .   ? 112.489 25.791  133.176 1.00 37.51  ? 905  HOH B O     1 
HETATM 7393 O  O     . HOH Q 5 .   ? 118.679 3.799   130.784 1.00 45.63  ? 906  HOH B O     1 
HETATM 7394 O  O     . HOH Q 5 .   ? 103.747 24.890  131.261 1.00 39.73  ? 907  HOH B O     1 
HETATM 7395 O  O     . HOH Q 5 .   ? 111.042 31.456  143.439 1.00 52.76  ? 908  HOH B O     1 
HETATM 7396 O  O     . HOH Q 5 .   ? 112.594 13.051  132.420 1.00 37.53  ? 909  HOH B O     1 
HETATM 7397 O  O     . HOH Q 5 .   ? 112.534 21.955  130.840 1.00 33.05  ? 910  HOH B O     1 
HETATM 7398 O  O     . HOH Q 5 .   ? 116.563 28.814  143.488 1.00 37.59  ? 911  HOH B O     1 
HETATM 7399 O  O     . HOH Q 5 .   ? 105.884 17.306  125.726 1.00 37.69  ? 912  HOH B O     1 
HETATM 7400 O  O     . HOH Q 5 .   ? 121.687 -13.253 143.354 1.00 41.03  ? 913  HOH B O     1 
HETATM 7401 O  O     . HOH Q 5 .   ? 108.751 6.613   123.531 1.00 41.85  ? 914  HOH B O     1 
HETATM 7402 O  O     . HOH Q 5 .   ? 112.274 18.365  132.171 1.00 43.45  ? 915  HOH B O     1 
HETATM 7403 O  O     . HOH Q 5 .   ? 125.499 0.553   133.848 1.00 55.25  ? 916  HOH B O     1 
HETATM 7404 O  O     . HOH Q 5 .   ? 127.418 1.111   134.667 1.00 53.34  ? 917  HOH B O     1 
HETATM 7405 O  O     . HOH Q 5 .   ? 99.523  19.717  135.689 1.00 56.96  ? 918  HOH B O     1 
HETATM 7406 O  O     . HOH Q 5 .   ? 103.554 21.677  129.293 1.00 39.98  ? 919  HOH B O     1 
HETATM 7407 O  O     . HOH Q 5 .   ? 110.350 15.505  133.030 1.00 36.69  ? 920  HOH B O     1 
HETATM 7408 O  O     . HOH Q 5 .   ? 110.262 14.272  124.286 1.00 42.38  ? 921  HOH B O     1 
HETATM 7409 O  O     . HOH Q 5 .   ? 111.123 21.135  133.367 1.00 31.62  ? 922  HOH B O     1 
HETATM 7410 O  O     . HOH Q 5 .   ? 127.277 -10.758 143.351 1.00 45.30  ? 923  HOH B O     1 
HETATM 7411 O  O     . HOH Q 5 .   ? 126.758 9.640   124.795 1.00 47.26  ? 924  HOH B O     1 
HETATM 7412 O  O     . HOH Q 5 .   ? 113.044 8.189   131.072 1.00 45.80  ? 925  HOH B O     1 
HETATM 7413 O  O     . HOH Q 5 .   ? 128.755 -3.759  140.795 1.00 53.59  ? 926  HOH B O     1 
HETATM 7414 O  O     . HOH Q 5 .   ? 113.274 6.122   127.050 1.00 55.44  ? 927  HOH B O     1 
HETATM 7415 O  O     . HOH Q 5 .   ? 106.841 12.691  132.153 1.00 46.02  ? 928  HOH B O     1 
HETATM 7416 O  O     . HOH Q 5 .   ? 118.727 27.238  138.085 1.00 46.97  ? 929  HOH B O     1 
HETATM 7417 O  O     . HOH Q 5 .   ? 132.988 6.091   135.341 1.00 61.24  ? 930  HOH B O     1 
HETATM 7418 O  O     . HOH Q 5 .   ? 119.431 28.090  141.447 1.00 55.06  ? 931  HOH B O     1 
HETATM 7419 O  O     . HOH Q 5 .   ? 116.446 32.169  132.474 1.00 44.37  ? 932  HOH B O     1 
HETATM 7420 O  O     . HOH Q 5 .   ? 124.836 7.500   138.785 1.00 58.26  ? 933  HOH B O     1 
HETATM 7421 O  O     . HOH Q 5 .   ? 118.748 -7.348  139.380 1.00 46.66  ? 934  HOH B O     1 
HETATM 7422 O  O     . HOH Q 5 .   ? 113.283 24.517  129.453 1.00 45.17  ? 935  HOH B O     1 
HETATM 7423 O  O     . HOH Q 5 .   ? 119.892 34.567  143.299 1.00 66.22  ? 936  HOH B O     1 
HETATM 7424 O  O     . HOH Q 5 .   ? 123.972 6.269   141.470 1.00 64.05  ? 937  HOH B O     1 
HETATM 7425 O  O     . HOH Q 5 .   ? 112.654 9.207   133.424 1.00 42.96  ? 938  HOH B O     1 
HETATM 7426 O  O     . HOH Q 5 .   ? 123.527 -11.685 144.766 1.00 49.64  ? 939  HOH B O     1 
HETATM 7427 O  O     . HOH R 5 .   ? 129.106 -6.382  137.509 1.00 43.85  ? 901  HOH C O     1 
HETATM 7428 O  O     . HOH R 5 .   ? 130.072 -9.002  140.030 1.00 58.59  ? 902  HOH C O     1 
HETATM 7429 O  O     . HOH R 5 .   ? 118.354 1.562   132.639 1.00 53.72  ? 903  HOH C O     1 
HETATM 7430 O  O     . HOH R 5 .   ? 136.127 -19.932 143.141 1.00 39.94  ? 904  HOH C O     1 
HETATM 7431 O  O     . HOH R 5 .   ? 136.428 -10.264 142.892 1.00 41.79  ? 905  HOH C O     1 
HETATM 7432 O  O     . HOH R 5 .   ? 126.250 17.812  132.373 1.00 52.36  ? 906  HOH C O     1 
HETATM 7433 O  O     . HOH R 5 .   ? 115.262 9.676   136.709 1.00 50.62  ? 907  HOH C O     1 
HETATM 7434 O  O     . HOH R 5 .   ? 123.068 -12.236 128.197 1.00 56.80  ? 908  HOH C O     1 
HETATM 7435 O  O     . HOH R 5 .   ? 146.469 -23.070 149.868 1.00 64.99  ? 909  HOH C O     1 
HETATM 7436 O  O     . HOH R 5 .   ? 119.638 23.412  121.309 1.00 49.55  ? 910  HOH C O     1 
HETATM 7437 O  O     . HOH R 5 .   ? 134.268 -15.744 136.855 1.00 43.86  ? 911  HOH C O     1 
HETATM 7438 O  O     . HOH R 5 .   ? 145.517 -20.348 149.757 1.00 51.13  ? 912  HOH C O     1 
HETATM 7439 O  O     . HOH R 5 .   ? 114.645 7.832   139.994 1.00 34.26  ? 913  HOH C O     1 
HETATM 7440 O  O     . HOH R 5 .   ? 119.963 -0.120  142.099 1.00 50.85  ? 914  HOH C O     1 
HETATM 7441 O  O     . HOH R 5 .   ? 120.548 -0.483  132.542 1.00 50.47  ? 915  HOH C O     1 
HETATM 7442 O  O     . HOH R 5 .   ? 116.441 12.273  139.738 1.00 32.00  ? 916  HOH C O     1 
HETATM 7443 O  O     . HOH R 5 .   ? 109.911 16.545  122.567 1.00 38.98  ? 917  HOH C O     1 
HETATM 7444 O  O     . HOH R 5 .   ? 119.272 15.167  144.019 1.00 41.87  ? 918  HOH C O     1 
HETATM 7445 O  O     . HOH R 5 .   ? 119.902 -5.117  140.136 1.00 42.74  ? 919  HOH C O     1 
HETATM 7446 O  O     . HOH R 5 .   ? 122.837 9.204   138.939 1.00 56.69  ? 920  HOH C O     1 
HETATM 7447 O  O     . HOH R 5 .   ? 120.233 21.673  118.574 1.00 41.02  ? 921  HOH C O     1 
HETATM 7448 O  O     . HOH R 5 .   ? 117.226 17.329  133.226 1.00 44.13  ? 922  HOH C O     1 
HETATM 7449 O  O     . HOH R 5 .   ? 110.775 -5.981  137.010 1.00 48.88  ? 923  HOH C O     1 
HETATM 7450 O  O     . HOH R 5 .   ? 120.438 14.428  125.497 1.00 42.16  ? 924  HOH C O     1 
HETATM 7451 O  O     . HOH R 5 .   ? 142.571 -12.897 152.749 1.00 35.75  ? 925  HOH C O     1 
HETATM 7452 O  O     . HOH R 5 .   ? 116.111 14.711  123.600 1.00 33.07  ? 926  HOH C O     1 
HETATM 7453 O  O     . HOH R 5 .   ? 131.822 -16.522 146.390 1.00 48.04  ? 927  HOH C O     1 
HETATM 7454 O  O     . HOH R 5 .   ? 120.148 -10.614 127.504 1.00 51.82  ? 928  HOH C O     1 
HETATM 7455 O  O     . HOH R 5 .   ? 130.357 -11.627 142.303 1.00 56.02  ? 929  HOH C O     1 
HETATM 7456 O  O     . HOH R 5 .   ? 135.798 -7.962  138.953 1.00 49.01  ? 930  HOH C O     1 
HETATM 7457 O  O     . HOH R 5 .   ? 120.355 -8.525  137.529 1.00 43.94  ? 931  HOH C O     1 
HETATM 7458 O  O     . HOH R 5 .   ? 115.554 19.787  132.242 1.00 44.36  ? 932  HOH C O     1 
HETATM 7459 O  O     . HOH R 5 .   ? 141.008 -25.765 147.244 1.00 67.85  ? 933  HOH C O     1 
HETATM 7460 O  O     . HOH R 5 .   ? 126.985 -19.500 138.288 1.00 51.33  ? 934  HOH C O     1 
HETATM 7461 O  O     . HOH R 5 .   ? 116.366 4.114   146.172 1.00 50.76  ? 935  HOH C O     1 
HETATM 7462 O  O     . HOH R 5 .   ? 114.134 23.748  126.852 1.00 44.02  ? 936  HOH C O     1 
HETATM 7463 O  O     . HOH R 5 .   ? 115.473 15.780  133.409 1.00 35.91  ? 937  HOH C O     1 
HETATM 7464 O  O     . HOH R 5 .   ? 139.067 -9.206  133.971 1.00 59.16  ? 938  HOH C O     1 
HETATM 7465 O  O     . HOH R 5 .   ? 133.082 -13.594 148.651 1.00 41.14  ? 939  HOH C O     1 
HETATM 7466 O  O     . HOH R 5 .   ? 114.517 11.228  134.273 1.00 53.03  ? 940  HOH C O     1 
HETATM 7467 O  O     . HOH R 5 .   ? 124.372 -1.635  131.777 1.00 55.81  ? 941  HOH C O     1 
HETATM 7468 O  O     . HOH R 5 .   ? 121.719 5.396   141.242 1.00 50.12  ? 942  HOH C O     1 
HETATM 7469 O  O     . HOH R 5 .   ? 133.866 -10.862 149.200 1.00 51.03  ? 943  HOH C O     1 
HETATM 7470 O  O     . HOH R 5 .   ? 106.533 18.006  123.062 1.00 53.39  ? 944  HOH C O     1 
HETATM 7471 O  O     . HOH R 5 .   ? 140.568 -18.669 148.442 1.00 46.43  ? 945  HOH C O     1 
HETATM 7472 O  O     . HOH R 5 .   ? 125.872 -10.486 125.341 1.00 49.51  ? 946  HOH C O     1 
HETATM 7473 O  O     . HOH R 5 .   ? 118.404 15.155  122.182 1.00 49.72  ? 947  HOH C O     1 
HETATM 7474 O  O     . HOH R 5 .   ? 118.099 25.256  120.219 1.00 62.04  ? 948  HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . GLY A 1   ? 0.8564 0.8713 1.4157 -0.1291 -0.1014 0.0593  0   GLY F N     
2    C  CA    . GLY A 1   ? 0.8906 0.8808 1.4248 -0.1255 -0.0944 0.0606  0   GLY F CA    
3    C  C     . GLY A 1   ? 0.7811 0.7751 1.3088 -0.1081 -0.0883 0.0591  0   GLY F C     
4    O  O     . GLY A 1   ? 0.8423 0.8152 1.3454 -0.1003 -0.0923 0.0559  0   GLY F O     
5    N  N     . SER A 2   ? 0.7370 0.7575 1.2860 -0.1021 -0.0785 0.0610  1   SER F N     
6    C  CA    . SER A 2   ? 0.7216 0.7462 1.2652 -0.0864 -0.0732 0.0591  1   SER F CA    
7    C  C     . SER A 2   ? 0.6622 0.6813 1.1972 -0.0855 -0.0565 0.0638  1   SER F C     
8    O  O     . SER A 2   ? 0.7823 0.8110 1.3290 -0.0941 -0.0431 0.0694  1   SER F O     
9    C  CB    . SER A 2   ? 0.6849 0.7356 1.2514 -0.0794 -0.0711 0.0581  1   SER F CB    
10   O  OG    . SER A 2   ? 0.6240 0.6748 1.1902 -0.0762 -0.0878 0.0536  1   SER F OG    
11   N  N     . ARG A 3   ? 0.6044 0.6090 1.1181 -0.0756 -0.0571 0.0615  2   ARG F N     
12   C  CA    . ARG A 3   ? 0.3897 0.3904 0.8941 -0.0724 -0.0419 0.0656  2   ARG F CA    
13   C  C     . ARG A 3   ? 0.3811 0.4042 0.9002 -0.0632 -0.0317 0.0649  2   ARG F C     
14   O  O     . ARG A 3   ? 0.3481 0.3831 0.8775 -0.0565 -0.0391 0.0605  2   ARG F O     
15   C  CB    . ARG A 3   ? 0.3048 0.2814 0.7800 -0.0656 -0.0475 0.0632  2   ARG F CB    
16   C  CG    . ARG A 3   ? 0.4771 0.4248 0.9310 -0.0729 -0.0541 0.0642  2   ARG F CG    
17   C  CD    . ARG A 3   ? 0.5551 0.4815 0.9802 -0.0624 -0.0605 0.0600  2   ARG F CD    
18   N  NE    . ARG A 3   ? 0.5978 0.5290 1.0225 -0.0557 -0.0753 0.0515  2   ARG F NE    
19   C  CZ    . ARG A 3   ? 0.4995 0.4261 0.9079 -0.0448 -0.0804 0.0464  2   ARG F CZ    
20   N  NH1   . ARG A 3   ? 0.3934 0.3104 0.7838 -0.0375 -0.0723 0.0485  2   ARG F NH1   
21   N  NH2   . ARG A 3   ? 0.5156 0.4473 0.9242 -0.0412 -0.0937 0.0394  2   ARG F NH2   
22   N  N     . LYS A 4   ? 0.4406 0.4665 0.9575 -0.0629 -0.0147 0.0693  3   LYS F N     
23   C  CA    . LYS A 4   ? 0.3157 0.3574 0.8397 -0.0532 -0.0043 0.0676  3   LYS F CA    
24   C  C     . LYS A 4   ? 0.2878 0.3151 0.7885 -0.0470 -0.0002 0.0681  3   LYS F C     
25   O  O     . LYS A 4   ? 0.3593 0.3751 0.8466 -0.0518 0.0102  0.0740  3   LYS F O     
26   C  CB    . LYS A 4   ? 0.3978 0.4592 0.9400 -0.0578 0.0137  0.0713  3   LYS F CB    
27   C  CG    . LYS A 4   ? 0.4747 0.5528 1.0413 -0.0663 0.0110  0.0719  3   LYS F CG    
28   C  CD    . LYS A 4   ? 0.5143 0.6117 1.0953 -0.0728 0.0310  0.0763  3   LYS F CD    
29   C  CE    . LYS A 4   ? 0.6505 0.7535 1.2433 -0.0893 0.0309  0.0812  3   LYS F CE    
30   N  NZ    . LYS A 4   ? 0.6861 0.7940 1.2761 -0.0995 0.0507  0.0884  3   LYS F NZ    
31   N  N     . ILE A 5   ? 0.3066 0.3340 0.8008 -0.0369 -0.0081 0.0626  4   ILE F N     
32   C  CA    . ILE A 5   ? 0.3195 0.3353 0.7923 -0.0314 -0.0065 0.0625  4   ILE F CA    
33   C  C     . ILE A 5   ? 0.3424 0.3729 0.8196 -0.0233 0.0017  0.0597  4   ILE F C     
34   O  O     . ILE A 5   ? 0.3100 0.3503 0.7962 -0.0178 -0.0043 0.0548  4   ILE F O     
35   C  CB    . ILE A 5   ? 0.1935 0.1944 0.6496 -0.0281 -0.0243 0.0581  4   ILE F CB    
36   C  CG1   . ILE A 5   ? 0.4579 0.4407 0.9047 -0.0352 -0.0305 0.0602  4   ILE F CG1   
37   C  CG2   . ILE A 5   ? 0.2349 0.2266 0.6592 -0.0182 -0.0231 0.0562  4   ILE F CG2   
38   C  CD1   . ILE A 5   ? 0.5244 0.4991 0.9641 -0.0339 -0.0486 0.0542  4   ILE F CD1   
39   N  N     . ILE A 6   ? 0.1972 0.2236 0.6546 -0.0201 0.0149  0.0619  5   ILE F N     
40   C  CA    . ILE A 6   ? 0.2215 0.2566 0.6718 -0.0112 0.0223  0.0579  5   ILE F CA    
41   C  C     . ILE A 6   ? 0.3064 0.3277 0.7206 -0.0041 0.0153  0.0555  5   ILE F C     
42   O  O     . ILE A 6   ? 0.3015 0.3079 0.6930 -0.0049 0.0133  0.0586  5   ILE F O     
43   C  CB    . ILE A 6   ? 0.2632 0.3057 0.7142 -0.0125 0.0433  0.0610  5   ILE F CB    
44   C  CG1   . ILE A 6   ? 0.2793 0.3409 0.7694 -0.0198 0.0514  0.0632  5   ILE F CG1   
45   C  CG2   . ILE A 6   ? 0.2307 0.2783 0.6709 -0.0030 0.0497  0.0554  5   ILE F CG2   
46   C  CD1   . ILE A 6   ? 0.2523 0.3208 0.7420 -0.0244 0.0733  0.0679  5   ILE F CD1   
47   N  N     . HIS A 7   ? 0.2313 0.2577 0.6412 0.0026  0.0104  0.0501  6   HIS F N     
48   C  CA    . HIS A 7   ? 0.2623 0.2810 0.6397 0.0083  0.0069  0.0479  6   HIS F CA    
49   C  C     . HIS A 7   ? 0.2891 0.3125 0.6591 0.0123  0.0182  0.0455  6   HIS F C     
50   O  O     . HIS A 7   ? 0.2616 0.2927 0.6484 0.0148  0.0179  0.0417  6   HIS F O     
51   C  CB    . HIS A 7   ? 0.2239 0.2423 0.5979 0.0106  -0.0103 0.0438  6   HIS F CB    
52   C  CG    . HIS A 7   ? 0.2401 0.2548 0.5830 0.0151  -0.0139 0.0416  6   HIS F CG    
53   N  ND1   . HIS A 7   ? 0.2249 0.2435 0.5605 0.0176  -0.0147 0.0383  6   HIS F ND1   
54   C  CD2   . HIS A 7   ? 0.2992 0.3077 0.6175 0.0173  -0.0171 0.0424  6   HIS F CD2   
55   C  CE1   . HIS A 7   ? 0.2600 0.2770 0.5685 0.0194  -0.0182 0.0374  6   HIS F CE1   
56   N  NE2   . HIS A 7   ? 0.3075 0.3199 0.6060 0.0202  -0.0195 0.0397  6   HIS F NE2   
57   N  N     . VAL A 8   ? 0.2717 0.2891 0.6160 0.0132  0.0278  0.0476  7   VAL F N     
58   C  CA    . VAL A 8   ? 0.2578 0.2769 0.5896 0.0164  0.0387  0.0446  7   VAL F CA    
59   C  C     . VAL A 8   ? 0.2608 0.2750 0.5638 0.0195  0.0303  0.0418  7   VAL F C     
60   O  O     . VAL A 8   ? 0.2928 0.3025 0.5776 0.0197  0.0236  0.0443  7   VAL F O     
61   C  CB    . VAL A 8   ? 0.3026 0.3195 0.6238 0.0139  0.0555  0.0491  7   VAL F CB    
62   C  CG1   . VAL A 8   ? 0.2761 0.2944 0.5845 0.0172  0.0671  0.0444  7   VAL F CG1   
63   C  CG2   . VAL A 8   ? 0.2616 0.2850 0.6118 0.0082  0.0634  0.0534  7   VAL F CG2   
64   N  N     . ASP A 9   ? 0.3085 0.3237 0.6076 0.0219  0.0304  0.0364  8   ASP F N     
65   C  CA    . ASP A 9   ? 0.3205 0.3328 0.5958 0.0225  0.0209  0.0337  8   ASP F CA    
66   C  C     . ASP A 9   ? 0.2478 0.2561 0.5082 0.0236  0.0288  0.0291  8   ASP F C     
67   O  O     . ASP A 9   ? 0.2897 0.2969 0.5651 0.0258  0.0317  0.0249  8   ASP F O     
68   C  CB    . ASP A 9   ? 0.3720 0.3865 0.6593 0.0222  0.0058  0.0317  8   ASP F CB    
69   C  CG    . ASP A 9   ? 0.4078 0.4224 0.6708 0.0206  -0.0047 0.0305  8   ASP F CG    
70   O  OD1   . ASP A 9   ? 0.4454 0.4580 0.6859 0.0198  -0.0010 0.0290  8   ASP F OD1   
71   O  OD2   . ASP A 9   ? 0.5075 0.5255 0.7734 0.0195  -0.0168 0.0309  8   ASP F OD2   
72   N  N     . MET A 10  ? 0.2715 0.2769 0.5021 0.0224  0.0312  0.0295  9   MET F N     
73   C  CA    . MET A 10  ? 0.2919 0.2912 0.5046 0.0224  0.0386  0.0245  9   MET F CA    
74   C  C     . MET A 10  ? 0.3201 0.3148 0.5298 0.0212  0.0281  0.0195  9   MET F C     
75   O  O     . MET A 10  ? 0.3366 0.3349 0.5438 0.0185  0.0148  0.0210  9   MET F O     
76   C  CB    . MET A 10  ? 0.3249 0.3231 0.5054 0.0203  0.0414  0.0266  9   MET F CB    
77   C  CG    . MET A 10  ? 0.3717 0.3706 0.5492 0.0209  0.0515  0.0328  9   MET F CG    
78   S  SD    . MET A 10  ? 0.3882 0.3852 0.5794 0.0219  0.0716  0.0316  9   MET F SD    
79   C  CE    . MET A 10  ? 0.3292 0.3184 0.4914 0.0218  0.0789  0.0236  9   MET F CE    
80   N  N     . ASP A 11  ? 0.2811 0.2669 0.4900 0.0232  0.0346  0.0133  10  ASP F N     
81   C  CA    . ASP A 11  ? 0.2415 0.2175 0.4450 0.0218  0.0248  0.0088  10  ASP F CA    
82   C  C     . ASP A 11  ? 0.3250 0.2964 0.4943 0.0150  0.0197  0.0075  10  ASP F C     
83   O  O     . ASP A 11  ? 0.3281 0.2960 0.4765 0.0141  0.0286  0.0053  10  ASP F O     
84   C  CB    . ASP A 11  ? 0.2566 0.2219 0.4707 0.0279  0.0333  0.0019  10  ASP F CB    
85   C  CG    . ASP A 11  ? 0.3284 0.3024 0.5805 0.0346  0.0375  0.0030  10  ASP F CG    
86   O  OD1   . ASP A 11  ? 0.3108 0.2913 0.5819 0.0338  0.0262  0.0072  10  ASP F OD1   
87   O  OD2   . ASP A 11  ? 0.3390 0.3145 0.6019 0.0403  0.0520  -0.0008 10  ASP F OD2   
88   N  N     . CYS A 12  ? 0.2647 0.2210 0.5201 0.0100  -0.0462 -0.0386 11  CYS F N     
89   C  CA    . CYS A 12  ? 0.3150 0.2669 0.5573 0.0053  -0.0522 -0.0337 11  CYS F CA    
90   C  C     . CYS A 12  ? 0.3491 0.3058 0.5655 -0.0018 -0.0470 -0.0343 11  CYS F C     
91   O  O     . CYS A 12  ? 0.3004 0.2525 0.5084 -0.0069 -0.0464 -0.0419 11  CYS F O     
92   C  CB    . CYS A 12  ? 0.4539 0.3957 0.7098 0.0050  -0.0554 -0.0439 11  CYS F CB    
93   S  SG    . CYS A 12  ? 0.4954 0.4290 0.7808 0.0127  -0.0640 -0.0424 11  CYS F SG    
94   N  N     . PHE A 13  ? 0.3228 0.2871 0.5258 -0.0019 -0.0447 -0.0259 12  PHE F N     
95   C  CA    . PHE A 13  ? 0.3416 0.3104 0.5220 -0.0080 -0.0376 -0.0289 12  PHE F CA    
96   C  C     . PHE A 13  ? 0.2753 0.2402 0.4389 -0.0148 -0.0408 -0.0303 12  PHE F C     
97   O  O     . PHE A 13  ? 0.3608 0.3219 0.5153 -0.0191 -0.0348 -0.0426 12  PHE F O     
98   C  CB    . PHE A 13  ? 0.3327 0.3079 0.5006 -0.0069 -0.0387 -0.0168 12  PHE F CB    
99   C  CG    . PHE A 13  ? 0.3639 0.3427 0.5088 -0.0132 -0.0322 -0.0188 12  PHE F CG    
100  C  CD1   . PHE A 13  ? 0.4098 0.3890 0.5521 -0.0170 -0.0212 -0.0316 12  PHE F CD1   
101  C  CD2   . PHE A 13  ? 0.3330 0.3144 0.4581 -0.0152 -0.0369 -0.0077 12  PHE F CD2   
102  C  CE1   . PHE A 13  ? 0.4980 0.4792 0.6164 -0.0234 -0.0152 -0.0326 12  PHE F CE1   
103  C  CE2   . PHE A 13  ? 0.3145 0.2975 0.4175 -0.0214 -0.0323 -0.0091 12  PHE F CE2   
104  C  CZ    . PHE A 13  ? 0.4106 0.3930 0.5092 -0.0259 -0.0216 -0.0210 12  PHE F CZ    
105  N  N     . PHE A 14  ? 0.3000 0.2659 0.4587 -0.0158 -0.0501 -0.0176 13  PHE F N     
106  C  CA    . PHE A 14  ? 0.3664 0.3293 0.5107 -0.0230 -0.0547 -0.0177 13  PHE F CA    
107  C  C     . PHE A 14  ? 0.3896 0.3418 0.5414 -0.0255 -0.0559 -0.0308 13  PHE F C     
108  O  O     . PHE A 14  ? 0.3932 0.3396 0.5289 -0.0313 -0.0550 -0.0397 13  PHE F O     
109  C  CB    . PHE A 14  ? 0.3264 0.2936 0.4718 -0.0233 -0.0646 -0.0015 13  PHE F CB    
110  C  CG    . PHE A 14  ? 0.3321 0.3085 0.4661 -0.0206 -0.0646 0.0111  13  PHE F CG    
111  C  CD1   . PHE A 14  ? 0.2705 0.2497 0.3947 -0.0186 -0.0579 0.0089  13  PHE F CD1   
112  C  CD2   . PHE A 14  ? 0.3277 0.3101 0.4621 -0.0200 -0.0717 0.0256  13  PHE F CD2   
113  C  CE1   . PHE A 14  ? 0.3464 0.3319 0.4598 -0.0154 -0.0596 0.0204  13  PHE F CE1   
114  C  CE2   . PHE A 14  ? 0.3357 0.3261 0.4598 -0.0162 -0.0720 0.0366  13  PHE F CE2   
115  C  CZ    . PHE A 14  ? 0.2711 0.2618 0.3839 -0.0136 -0.0667 0.0338  13  PHE F CZ    
116  N  N     . ALA A 15  ? 0.3533 0.3011 0.5281 -0.0208 -0.0590 -0.0323 14  ALA F N     
117  C  CA    . ALA A 15  ? 0.4423 0.3779 0.6258 -0.0221 -0.0619 -0.0447 14  ALA F CA    
118  C  C     . ALA A 15  ? 0.4236 0.3555 0.6033 -0.0208 -0.0505 -0.0633 14  ALA F C     
119  O  O     . ALA A 15  ? 0.4400 0.3614 0.6120 -0.0237 -0.0508 -0.0759 14  ALA F O     
120  C  CB    . ALA A 15  ? 0.3605 0.2915 0.5700 -0.0172 -0.0690 -0.0404 14  ALA F CB    
121  N  N     . ALA A 16  ? 0.4272 0.3672 0.6129 -0.0160 -0.0406 -0.0654 15  ALA F N     
122  C  CA    . ALA A 16  ? 0.4758 0.4156 0.6590 -0.0148 -0.0274 -0.0817 15  ALA F CA    
123  C  C     . ALA A 16  ? 0.4421 0.3804 0.5938 -0.0217 -0.0218 -0.0868 15  ALA F C     
124  O  O     . ALA A 16  ? 0.4440 0.3759 0.5868 -0.0222 -0.0140 -0.1023 15  ALA F O     
125  C  CB    . ALA A 16  ? 0.4339 0.3848 0.6308 -0.0099 -0.0187 -0.0800 15  ALA F CB    
126  N  N     . VAL A 17  ? 0.4590 0.4024 0.5925 -0.0266 -0.0258 -0.0742 16  VAL F N     
127  C  CA    . VAL A 17  ? 0.4311 0.3718 0.5333 -0.0336 -0.0224 -0.0776 16  VAL F CA    
128  C  C     . VAL A 17  ? 0.4505 0.3771 0.5417 -0.0379 -0.0312 -0.0845 16  VAL F C     
129  O  O     . VAL A 17  ? 0.5153 0.4333 0.5850 -0.0410 -0.0260 -0.0971 16  VAL F O     
130  C  CB    . VAL A 17  ? 0.4536 0.4025 0.5413 -0.0371 -0.0264 -0.0618 16  VAL F CB    
131  C  CG1   . VAL A 17  ? 0.3942 0.3372 0.4501 -0.0450 -0.0284 -0.0634 16  VAL F CG1   
132  C  CG2   . VAL A 17  ? 0.3861 0.3459 0.4778 -0.0341 -0.0168 -0.0577 16  VAL F CG2   
133  N  N     . GLU A 18  ? 0.4611 0.3844 0.5665 -0.0383 -0.0450 -0.0763 17  GLU F N     
134  C  CA    . GLU A 18  ? 0.4710 0.3802 0.5691 -0.0432 -0.0558 -0.0816 17  GLU F CA    
135  C  C     . GLU A 18  ? 0.5231 0.4186 0.6261 -0.0397 -0.0522 -0.1008 17  GLU F C     
136  O  O     . GLU A 18  ? 0.6027 0.4835 0.6885 -0.0436 -0.0571 -0.1110 17  GLU F O     
137  C  CB    . GLU A 18  ? 0.4720 0.3823 0.5882 -0.0447 -0.0708 -0.0670 17  GLU F CB    
138  C  CG    . GLU A 18  ? 0.4357 0.3597 0.5488 -0.0469 -0.0751 -0.0477 17  GLU F CG    
139  C  CD    . GLU A 18  ? 0.5253 0.4486 0.6106 -0.0541 -0.0780 -0.0461 17  GLU F CD    
140  O  OE1   . GLU A 18  ? 0.5515 0.4615 0.6196 -0.0589 -0.0804 -0.0581 17  GLU F OE1   
141  O  OE2   . GLU A 18  ? 0.4552 0.3900 0.5348 -0.0546 -0.0785 -0.0331 17  GLU F OE2   
142  N  N     . MET A 19  ? 0.5302 0.4293 0.6563 -0.0320 -0.0447 -0.1062 18  MET F N     
143  C  CA    . MET A 19  ? 0.5676 0.4541 0.7010 -0.0272 -0.0412 -0.1249 18  MET F CA    
144  C  C     . MET A 19  ? 0.5988 0.4838 0.7099 -0.0262 -0.0252 -0.1408 18  MET F C     
145  O  O     . MET A 19  ? 0.6281 0.4978 0.7266 -0.0253 -0.0244 -0.1570 18  MET F O     
146  C  CB    . MET A 19  ? 0.4963 0.3872 0.6641 -0.0188 -0.0395 -0.1250 18  MET F CB    
147  C  CG    . MET A 19  ? 0.5100 0.3939 0.6994 -0.0187 -0.0557 -0.1159 18  MET F CG    
148  S  SD    . MET A 19  ? 0.5515 0.4428 0.7767 -0.0090 -0.0529 -0.1130 18  MET F SD    
149  C  CE    . MET A 19  ? 0.7838 0.6589 1.0306 -0.0080 -0.0696 -0.1120 18  MET F CE    
150  N  N     . ARG A 20  ? 0.6014 0.5014 0.7072 -0.0260 -0.0121 -0.1364 19  ARG F N     
151  C  CA    . ARG A 20  ? 0.5396 0.4398 0.6201 -0.0270 0.0037  -0.1480 19  ARG F CA    
152  C  C     . ARG A 20  ? 0.6754 0.5610 0.7186 -0.0344 -0.0026 -0.1519 19  ARG F C     
153  O  O     . ARG A 20  ? 0.8235 0.6968 0.8466 -0.0333 0.0042  -0.1685 19  ARG F O     
154  C  CB    . ARG A 20  ? 0.5219 0.4400 0.6008 -0.0284 0.0146  -0.1376 19  ARG F CB    
155  C  CG    . ARG A 20  ? 0.5550 0.4742 0.6049 -0.0313 0.0310  -0.1462 19  ARG F CG    
156  C  CD    . ARG A 20  ? 0.4886 0.4228 0.5330 -0.0353 0.0373  -0.1327 19  ARG F CD    
157  N  NE    . ARG A 20  ? 0.5741 0.5056 0.5970 -0.0426 0.0245  -0.1191 19  ARG F NE    
158  C  CZ    . ARG A 20  ? 0.5986 0.5405 0.6175 -0.0458 0.0243  -0.1048 19  ARG F CZ    
159  N  NH1   . ARG A 20  ? 0.5450 0.5000 0.5797 -0.0433 0.0354  -0.1020 19  ARG F NH1   
160  N  NH2   . ARG A 20  ? 0.6000 0.5390 0.6004 -0.0515 0.0122  -0.0934 19  ARG F NH2   
161  N  N     . ASP A 21  ? 0.6001 0.4864 0.6338 -0.0414 -0.0161 -0.1369 20  ASP F N     
162  C  CA    . ASP A 21  ? 0.6116 0.4849 0.6107 -0.0492 -0.0243 -0.1382 20  ASP F CA    
163  C  C     . ASP A 21  ? 0.7187 0.5726 0.7175 -0.0508 -0.0401 -0.1453 20  ASP F C     
164  O  O     . ASP A 21  ? 0.7467 0.5881 0.7190 -0.0577 -0.0504 -0.1458 20  ASP F O     
165  C  CB    . ASP A 21  ? 0.5482 0.4314 0.5396 -0.0557 -0.0325 -0.1191 20  ASP F CB    
166  C  CG    . ASP A 21  ? 0.6214 0.5195 0.6062 -0.0554 -0.0186 -0.1130 20  ASP F CG    
167  O  OD1   . ASP A 21  ? 0.7394 0.6421 0.7291 -0.0507 -0.0024 -0.1225 20  ASP F OD1   
168  O  OD2   . ASP A 21  ? 0.7288 0.6341 0.7050 -0.0597 -0.0240 -0.0987 20  ASP F OD2   
169  N  N     . ASN A 22  ? 0.7038 0.5535 0.7311 -0.0449 -0.0437 -0.1506 21  ASN F N     
170  C  CA    . ASN A 22  ? 0.6814 0.5106 0.7103 -0.0461 -0.0589 -0.1586 21  ASN F CA    
171  C  C     . ASN A 22  ? 0.7299 0.5559 0.7890 -0.0371 -0.0561 -0.1681 21  ASN F C     
172  O  O     . ASN A 22  ? 0.7429 0.5731 0.8319 -0.0361 -0.0657 -0.1573 21  ASN F O     
173  C  CB    . ASN A 22  ? 0.6885 0.5178 0.7268 -0.0536 -0.0791 -0.1412 21  ASN F CB    
174  C  CG    . ASN A 22  ? 0.8526 0.6595 0.8927 -0.0566 -0.0968 -0.1483 21  ASN F CG    
175  O  OD1   . ASN A 22  ? 0.8716 0.6614 0.9064 -0.0518 -0.0947 -0.1671 21  ASN F OD1   
176  N  ND2   . ASN A 22  ? 0.8300 0.6371 0.8788 -0.0642 -0.1145 -0.1332 21  ASN F ND2   
177  N  N     . PRO A 23  ? 0.7632 0.5817 0.8155 -0.0299 -0.0429 -0.1880 22  PRO F N     
178  C  CA    . PRO A 23  ? 0.7847 0.6031 0.8691 -0.0200 -0.0386 -0.1969 22  PRO F CA    
179  C  C     . PRO A 23  ? 0.7942 0.5958 0.8977 -0.0199 -0.0581 -0.1972 22  PRO F C     
180  O  O     . PRO A 23  ? 0.8573 0.6591 0.9912 -0.0124 -0.0581 -0.2006 22  PRO F O     
181  C  CB    . PRO A 23  ? 0.8958 0.7071 0.9626 -0.0129 -0.0213 -0.2195 22  PRO F CB    
182  C  CG    . PRO A 23  ? 0.8943 0.7109 0.9240 -0.0190 -0.0111 -0.2174 22  PRO F CG    
183  C  CD    . PRO A 23  ? 0.8441 0.6551 0.8592 -0.0299 -0.0302 -0.2028 22  PRO F CD    
184  N  N     . ALA A 24  ? 0.8058 0.5929 0.8942 -0.0284 -0.0757 -0.1929 23  ALA F N     
185  C  CA    . ALA A 24  ? 0.8375 0.6092 0.9459 -0.0301 -0.0957 -0.1904 23  ALA F CA    
186  C  C     . ALA A 24  ? 0.8229 0.6100 0.9653 -0.0311 -0.1020 -0.1696 23  ALA F C     
187  O  O     . ALA A 24  ? 0.7918 0.5685 0.9570 -0.0308 -0.1156 -0.1669 23  ALA F O     
188  C  CB    . ALA A 24  ? 0.8687 0.6234 0.9546 -0.0403 -0.1138 -0.1883 23  ALA F CB    
189  N  N     . LEU A 25  ? 0.7406 0.5504 0.8852 -0.0323 -0.0931 -0.1548 24  LEU F N     
190  C  CA    . LEU A 25  ? 0.6426 0.4667 0.8148 -0.0323 -0.0977 -0.1352 24  LEU F CA    
191  C  C     . LEU A 25  ? 0.7014 0.5341 0.8980 -0.0222 -0.0869 -0.1385 24  LEU F C     
192  O  O     . LEU A 25  ? 0.7318 0.5740 0.9499 -0.0210 -0.0908 -0.1235 24  LEU F O     
193  C  CB    . LEU A 25  ? 0.6346 0.4771 0.7956 -0.0380 -0.0954 -0.1173 24  LEU F CB    
194  C  CG    . LEU A 25  ? 0.6595 0.4958 0.7949 -0.0477 -0.1046 -0.1144 24  LEU F CG    
195  C  CD1   . LEU A 25  ? 0.6502 0.5054 0.7732 -0.0513 -0.0996 -0.0995 24  LEU F CD1   
196  C  CD2   . LEU A 25  ? 0.6104 0.4362 0.7595 -0.0541 -0.1246 -0.1058 24  LEU F CD2   
197  N  N     . ARG A 26  ? 0.7067 0.5356 0.9006 -0.0147 -0.0741 -0.1579 25  ARG F N     
198  C  CA    . ARG A 26  ? 0.7199 0.5601 0.9375 -0.0053 -0.0625 -0.1610 25  ARG F CA    
199  C  C     . ARG A 26  ? 0.7180 0.5516 0.9686 -0.0008 -0.0741 -0.1568 25  ARG F C     
200  O  O     . ARG A 26  ? 0.6400 0.4853 0.9120 0.0038  -0.0712 -0.1484 25  ARG F O     
201  C  CB    . ARG A 26  ? 0.8197 0.6571 1.0297 0.0018  -0.0463 -0.1834 25  ARG F CB    
202  C  CG    . ARG A 26  ? 0.8596 0.7083 1.0983 0.0121  -0.0344 -0.1890 25  ARG F CG    
203  C  CD    . ARG A 26  ? 0.8647 0.7366 1.1052 0.0111  -0.0226 -0.1772 25  ARG F CD    
204  N  NE    . ARG A 26  ? 0.9206 0.7986 1.1283 0.0057  -0.0108 -0.1792 25  ARG F NE    
205  C  CZ    . ARG A 26  ? 0.8026 0.6972 1.0025 0.0018  -0.0036 -0.1670 25  ARG F CZ    
206  N  NH1   . ARG A 26  ? 0.5411 0.4475 0.7630 0.0033  -0.0072 -0.1525 25  ARG F NH1   
207  N  NH2   . ARG A 26  ? 0.8087 0.7063 0.9773 -0.0035 0.0060  -0.1691 25  ARG F NH2   
208  N  N     . ASP A 27  ? 0.7130 0.5263 0.9677 -0.0021 -0.0883 -0.1623 26  ASP F N     
209  C  CA    . ASP A 27  ? 0.7197 0.5260 1.0045 0.0033  -0.0979 -0.1600 26  ASP F CA    
210  C  C     . ASP A 27  ? 0.6827 0.4852 0.9725 -0.0041 -0.1157 -0.1403 26  ASP F C     
211  O  O     . ASP A 27  ? 0.6491 0.4509 0.9562 -0.0004 -0.1231 -0.1333 26  ASP F O     
212  C  CB    . ASP A 27  ? 0.8062 0.6012 1.0919 0.0114  -0.0953 -0.1788 26  ASP F CB    
213  C  CG    . ASP A 27  ? 0.8416 0.6439 1.1255 0.0198  -0.0752 -0.1972 26  ASP F CG    
214  O  OD1   . ASP A 27  ? 0.7150 0.5342 1.0178 0.0249  -0.0657 -0.1929 26  ASP F OD1   
215  O  OD2   . ASP A 27  ? 0.9000 0.6916 1.1628 0.0211  -0.0686 -0.2154 26  ASP F OD2   
216  N  N     . ILE A 28  ? 0.5839 0.3855 0.8599 -0.0145 -0.1226 -0.1304 27  ILE F N     
217  C  CA    . ILE A 28  ? 0.6136 0.4158 0.8966 -0.0218 -0.1374 -0.1094 27  ILE F CA    
218  C  C     . ILE A 28  ? 0.5399 0.3601 0.8294 -0.0237 -0.1343 -0.0896 27  ILE F C     
219  O  O     . ILE A 28  ? 0.5583 0.3943 0.8350 -0.0216 -0.1209 -0.0895 27  ILE F O     
220  C  CB    . ILE A 28  ? 0.5964 0.3879 0.8619 -0.0321 -0.1485 -0.1091 27  ILE F CB    
221  C  CG1   . ILE A 28  ? 0.5606 0.3606 0.7999 -0.0361 -0.1394 -0.1124 27  ILE F CG1   
222  C  CG2   . ILE A 28  ? 0.6114 0.3833 0.8709 -0.0296 -0.1549 -0.1248 27  ILE F CG2   
223  C  CD1   . ILE A 28  ? 0.6371 0.4288 0.8593 -0.0470 -0.1520 -0.1089 27  ILE F CD1   
224  N  N     . PRO A 29  ? 0.5310 0.3551 0.8342 -0.0261 -0.1436 -0.0701 28  PRO F N     
225  C  CA    . PRO A 29  ? 0.4303 0.2707 0.7361 -0.0272 -0.1405 -0.0505 28  PRO F CA    
226  C  C     . PRO A 29  ? 0.4290 0.2814 0.7147 -0.0348 -0.1387 -0.0420 28  PRO F C     
227  O  O     . PRO A 29  ? 0.4575 0.3040 0.7403 -0.0434 -0.1492 -0.0377 28  PRO F O     
228  C  CB    . PRO A 29  ? 0.4260 0.2661 0.7473 -0.0280 -0.1510 -0.0330 28  PRO F CB    
229  C  CG    . PRO A 29  ? 0.5167 0.3433 0.8381 -0.0320 -0.1618 -0.0389 28  PRO F CG    
230  C  CD    . PRO A 29  ? 0.5125 0.3281 0.8258 -0.0270 -0.1561 -0.0640 28  PRO F CD    
231  N  N     . ILE A 30  ? 0.3940 0.2627 0.6666 -0.0317 -0.1263 -0.0397 29  ILE F N     
232  C  CA    . ILE A 30  ? 0.3717 0.2525 0.6253 -0.0377 -0.1243 -0.0312 29  ILE F CA    
233  C  C     . ILE A 30  ? 0.4109 0.3098 0.6637 -0.0338 -0.1176 -0.0153 29  ILE F C     
234  O  O     . ILE A 30  ? 0.3752 0.2771 0.6358 -0.0260 -0.1116 -0.0154 29  ILE F O     
235  C  CB    . ILE A 30  ? 0.4226 0.3019 0.6526 -0.0387 -0.1160 -0.0477 29  ILE F CB    
236  C  CG1   . ILE A 30  ? 0.3598 0.2496 0.5849 -0.0311 -0.1008 -0.0531 29  ILE F CG1   
237  C  CG2   . ILE A 30  ? 0.5467 0.4060 0.7747 -0.0395 -0.1203 -0.0672 29  ILE F CG2   
238  C  CD1   . ILE A 30  ? 0.4882 0.3806 0.6877 -0.0332 -0.0914 -0.0637 29  ILE F CD1   
239  N  N     . ALA A 31  ? 0.4119 0.3223 0.6547 -0.0389 -0.1192 -0.0020 30  ALA F N     
240  C  CA    . ALA A 31  ? 0.3982 0.3250 0.6363 -0.0345 -0.1128 0.0120  30  ALA F CA    
241  C  C     . ALA A 31  ? 0.4684 0.4053 0.6885 -0.0397 -0.1120 0.0169  30  ALA F C     
242  O  O     . ALA A 31  ? 0.4401 0.3732 0.6575 -0.0478 -0.1200 0.0168  30  ALA F O     
243  C  CB    . ALA A 31  ? 0.2713 0.2028 0.5249 -0.0328 -0.1178 0.0311  30  ALA F CB    
244  N  N     . ILE A 32  ? 0.3630 0.3115 0.5710 -0.0351 -0.1037 0.0210  31  ILE F N     
245  C  CA    . ILE A 32  ? 0.3303 0.2900 0.5235 -0.0384 -0.1038 0.0296  31  ILE F CA    
246  C  C     . ILE A 32  ? 0.3254 0.2974 0.5290 -0.0358 -0.1064 0.0501  31  ILE F C     
247  O  O     . ILE A 32  ? 0.3749 0.3503 0.5828 -0.0277 -0.1019 0.0562  31  ILE F O     
248  C  CB    . ILE A 32  ? 0.3815 0.3460 0.5554 -0.0347 -0.0941 0.0238  31  ILE F CB    
249  C  CG1   . ILE A 32  ? 0.3696 0.3238 0.5301 -0.0384 -0.0901 0.0048  31  ILE F CG1   
250  C  CG2   . ILE A 32  ? 0.3744 0.3512 0.5356 -0.0364 -0.0956 0.0358  31  ILE F CG2   
251  C  CD1   . ILE A 32  ? 0.4176 0.3629 0.5888 -0.0339 -0.0848 -0.0089 31  ILE F CD1   
252  N  N     . GLY A 33  ? 0.3422 0.3206 0.5498 -0.0422 -0.1135 0.0607  32  GLY F N     
253  C  CA    . GLY A 33  ? 0.3627 0.3550 0.5807 -0.0395 -0.1143 0.0807  32  GLY F CA    
254  C  C     . GLY A 33  ? 0.4146 0.4138 0.6419 -0.0486 -0.1232 0.0908  32  GLY F C     
255  O  O     . GLY A 33  ? 0.3772 0.3662 0.6066 -0.0573 -0.1316 0.0826  32  GLY F O     
256  N  N     . GLY A 34  ? 0.3676 0.3839 0.6011 -0.0459 -0.1217 0.1088  33  GLY F N     
257  C  CA    . GLY A 34  ? 0.3416 0.3682 0.5887 -0.0540 -0.1298 0.1210  33  GLY F CA    
258  C  C     . GLY A 34  ? 0.4302 0.4515 0.7006 -0.0609 -0.1376 0.1277  33  GLY F C     
259  O  O     . GLY A 34  ? 0.3886 0.4041 0.6668 -0.0570 -0.1349 0.1300  33  GLY F O     
260  N  N     . SER A 35  ? 0.3394 0.3618 0.6213 -0.0718 -0.1488 0.1315  34  SER F N     
261  C  CA    . SER A 35  ? 0.3763 0.3926 0.6816 -0.0800 -0.1583 0.1385  34  SER F CA    
262  C  C     . SER A 35  ? 0.3719 0.4047 0.6960 -0.0767 -0.1530 0.1609  34  SER F C     
263  O  O     . SER A 35  ? 0.3735 0.4254 0.6947 -0.0694 -0.1437 0.1726  34  SER F O     
264  C  CB    . SER A 35  ? 0.4262 0.4408 0.7406 -0.0927 -0.1728 0.1393  34  SER F CB    
265  O  OG    . SER A 35  ? 0.4071 0.4449 0.7302 -0.0937 -0.1724 0.1557  34  SER F OG    
266  N  N     . ARG A 36  ? 0.3350 0.3590 0.6774 -0.0818 -0.1589 0.1666  35  ARG F N     
267  C  CA    . ARG A 36  ? 0.3314 0.3702 0.6931 -0.0813 -0.1552 0.1898  35  ARG F CA    
268  C  C     . ARG A 36  ? 0.4486 0.5118 0.8258 -0.0863 -0.1563 0.2076  35  ARG F C     
269  O  O     . ARG A 36  ? 0.3787 0.4623 0.7621 -0.0802 -0.1461 0.2255  35  ARG F O     
270  C  CB    . ARG A 36  ? 0.3732 0.3962 0.7525 -0.0886 -0.1646 0.1928  35  ARG F CB    
271  C  CG    . ARG A 36  ? 0.4789 0.5179 0.8760 -0.0889 -0.1625 0.2164  35  ARG F CG    
272  C  CD    . ARG A 36  ? 0.5884 0.6146 0.9917 -0.0883 -0.1659 0.2169  35  ARG F CD    
273  N  NE    . ARG A 36  ? 0.7128 0.7154 1.1169 -0.0940 -0.1800 0.2020  35  ARG F NE    
274  C  CZ    . ARG A 36  ? 0.8627 0.8478 1.2679 -0.0926 -0.1847 0.1947  35  ARG F CZ    
275  N  NH1   . ARG A 36  ? 0.8530 0.8411 1.2574 -0.0863 -0.1769 0.2005  35  ARG F NH1   
276  N  NH2   . ARG A 36  ? 0.8324 0.7966 1.2375 -0.0968 -0.1972 0.1808  35  ARG F NH2   
277  N  N     . GLU A 37  ? 0.4320 0.4897 0.8075 -0.0938 -0.1664 0.2010  36  GLU F N     
278  C  CA    . GLU A 37  ? 0.4389 0.5140 0.8227 -0.0963 -0.1666 0.2151  36  GLU F CA    
279  C  C     . GLU A 37  ? 0.3321 0.4256 0.7042 -0.0887 -0.1567 0.2162  36  GLU F C     
280  O  O     . GLU A 37  ? 0.3984 0.5114 0.7786 -0.0864 -0.1500 0.2319  36  GLU F O     
281  C  CB    . GLU A 37  ? 0.4651 0.5258 0.8485 -0.1059 -0.1819 0.2066  36  GLU F CB    
282  C  CG    . GLU A 37  ? 0.6375 0.6825 1.0341 -0.1124 -0.1931 0.2084  36  GLU F CG    
283  C  CD    . GLU A 37  ? 0.7923 0.8118 1.1787 -0.1122 -0.1976 0.1896  36  GLU F CD    
284  O  OE1   . GLU A 37  ? 0.5567 0.5686 0.9259 -0.1082 -0.1930 0.1734  36  GLU F OE1   
285  O  OE2   . GLU A 37  ? 0.9110 0.9179 1.3074 -0.1157 -0.2060 0.1909  36  GLU F OE2   
286  N  N     . ARG A 38  ? 0.3093 0.3967 0.6616 -0.0837 -0.1554 0.1996  37  ARG F N     
287  C  CA    . ARG A 38  ? 0.3536 0.4554 0.6898 -0.0729 -0.1451 0.2002  37  ARG F CA    
288  C  C     . ARG A 38  ? 0.3805 0.4891 0.7096 -0.0594 -0.1298 0.2072  37  ARG F C     
289  O  O     . ARG A 38  ? 0.3145 0.4288 0.6236 -0.0492 -0.1194 0.2043  37  ARG F O     
290  C  CB    . ARG A 38  ? 0.3390 0.4260 0.6480 -0.0718 -0.1476 0.1787  37  ARG F CB    
291  C  CG    . ARG A 38  ? 0.4727 0.5545 0.7810 -0.0830 -0.1618 0.1720  37  ARG F CG    
292  C  CD    . ARG A 38  ? 0.4793 0.5786 0.7859 -0.0806 -0.1602 0.1810  37  ARG F CD    
293  N  NE    . ARG A 38  ? 0.4827 0.5884 0.7690 -0.0685 -0.1500 0.1774  37  ARG F NE    
294  C  CZ    . ARG A 38  ? 0.5767 0.6705 0.8364 -0.0674 -0.1512 0.1620  37  ARG F CZ    
295  N  NH1   . ARG A 38  ? 0.7040 0.7806 0.9540 -0.0775 -0.1622 0.1488  37  ARG F NH1   
296  N  NH2   . ARG A 38  ? 0.4789 0.5765 0.7197 -0.0562 -0.1410 0.1599  37  ARG F NH2   
297  N  N     . ARG A 39  ? 0.4037 0.5084 0.7448 -0.0595 -0.1280 0.2151  38  ARG F N     
298  C  CA    . ARG A 39  ? 0.4009 0.5073 0.7298 -0.0479 -0.1127 0.2195  38  ARG F CA    
299  C  C     . ARG A 39  ? 0.3410 0.4332 0.6421 -0.0376 -0.1078 0.2023  38  ARG F C     
300  O  O     . ARG A 39  ? 0.2882 0.3847 0.5700 -0.0268 -0.0946 0.2007  38  ARG F O     
301  C  CB    . ARG A 39  ? 0.3042 0.4340 0.6331 -0.0425 -0.0989 0.2329  38  ARG F CB    
302  C  CG    . ARG A 39  ? 0.3747 0.5205 0.7345 -0.0526 -0.1022 0.2527  38  ARG F CG    
303  C  CD    . ARG A 39  ? 0.3953 0.5644 0.7587 -0.0452 -0.0860 0.2682  38  ARG F CD    
304  N  NE    . ARG A 39  ? 0.3286 0.5123 0.6846 -0.0397 -0.0797 0.2687  38  ARG F NE    
305  C  CZ    . ARG A 39  ? 0.3721 0.5787 0.7353 -0.0339 -0.0672 0.2831  38  ARG F CZ    
306  N  NH1   . ARG A 39  ? 0.3292 0.5486 0.7073 -0.0330 -0.0590 0.2989  38  ARG F NH1   
307  N  NH2   . ARG A 39  ? 0.3092 0.5264 0.6653 -0.0285 -0.0630 0.2818  38  ARG F NH2   
308  N  N     . GLY A 40  ? 0.3614 0.4350 0.6584 -0.0419 -0.1169 0.1863  39  GLY F N     
309  C  CA    . GLY A 40  ? 0.3894 0.4507 0.6625 -0.0344 -0.1124 0.1691  39  GLY F CA    
310  C  C     . GLY A 40  ? 0.3288 0.3765 0.5973 -0.0273 -0.1084 0.1654  39  GLY F C     
311  O  O     . GLY A 40  ? 0.3147 0.3597 0.5970 -0.0287 -0.1098 0.1750  39  GLY F O     
312  N  N     . VAL A 41  ? 0.3288 0.3681 0.5781 -0.0198 -0.1038 0.1520  40  VAL F N     
313  C  CA    . VAL A 41  ? 0.4469 0.4711 0.6919 -0.0137 -0.1019 0.1444  40  VAL F CA    
314  C  C     . VAL A 41  ? 0.3860 0.3965 0.6233 -0.0165 -0.1037 0.1230  40  VAL F C     
315  O  O     . VAL A 41  ? 0.3046 0.3171 0.5343 -0.0215 -0.1049 0.1149  40  VAL F O     
316  C  CB    . VAL A 41  ? 0.4961 0.5234 0.7211 -0.0020 -0.0908 0.1456  40  VAL F CB    
317  C  CG1   . VAL A 41  ? 0.3025 0.3457 0.5236 0.0002  -0.0823 0.1588  40  VAL F CG1   
318  C  CG2   . VAL A 41  ? 0.4982 0.5252 0.7059 0.0032  -0.0883 0.1360  40  VAL F CG2   
319  N  N     . ILE A 42  ? 0.2515 0.2478 0.4908 -0.0129 -0.1038 0.1144  41  ILE F N     
320  C  CA    . ILE A 42  ? 0.2338 0.2179 0.4688 -0.0143 -0.1038 0.0943  41  ILE F CA    
321  C  C     . ILE A 42  ? 0.2552 0.2424 0.4727 -0.0070 -0.0967 0.0884  41  ILE F C     
322  O  O     . ILE A 42  ? 0.2830 0.2708 0.4957 0.0021  -0.0937 0.0946  41  ILE F O     
323  C  CB    . ILE A 42  ? 0.2493 0.2182 0.4974 -0.0128 -0.1072 0.0877  41  ILE F CB    
324  C  CG1   . ILE A 42  ? 0.3043 0.2676 0.5703 -0.0210 -0.1160 0.0934  41  ILE F CG1   
325  C  CG2   . ILE A 42  ? 0.2595 0.2186 0.5039 -0.0116 -0.1045 0.0672  41  ILE F CG2   
326  C  CD1   . ILE A 42  ? 0.2854 0.2490 0.5521 -0.0311 -0.1208 0.0874  41  ILE F CD1   
327  N  N     . SER A 43  ? 0.3015 0.2887 0.5081 -0.0110 -0.0947 0.0765  42  SER F N     
328  C  CA    . SER A 43  ? 0.2335 0.2214 0.4253 -0.0052 -0.0885 0.0698  42  SER F CA    
329  C  C     . SER A 43  ? 0.2355 0.2121 0.4339 -0.0021 -0.0864 0.0570  42  SER F C     
330  O  O     . SER A 43  ? 0.3251 0.3005 0.5207 0.0056  -0.0838 0.0575  42  SER F O     
331  C  CB    . SER A 43  ? 0.2132 0.2048 0.3896 -0.0109 -0.0866 0.0628  42  SER F CB    
332  O  OG    . SER A 43  ? 0.2976 0.3004 0.4690 -0.0129 -0.0893 0.0748  42  SER F OG    
333  N  N     . THR A 44  ? 0.3024 0.2704 0.5100 -0.0076 -0.0882 0.0450  43  THR F N     
334  C  CA    . THR A 44  ? 0.3538 0.3119 0.5727 -0.0042 -0.0867 0.0327  43  THR F CA    
335  C  C     . THR A 44  ? 0.2966 0.2445 0.5271 -0.0100 -0.0911 0.0228  43  THR F C     
336  O  O     . THR A 44  ? 0.3187 0.2666 0.5451 -0.0175 -0.0948 0.0229  43  THR F O     
337  C  CB    . THR A 44  ? 0.2819 0.2415 0.4916 -0.0023 -0.0786 0.0211  43  THR F CB    
338  O  OG1   . THR A 44  ? 0.3413 0.2943 0.5661 0.0032  -0.0774 0.0133  43  THR F OG1   
339  C  CG2   . THR A 44  ? 0.3042 0.2624 0.5043 -0.0097 -0.0750 0.0081  43  THR F CG2   
340  N  N     . ALA A 45  ? 0.2784 0.2168 0.5239 -0.0062 -0.0916 0.0137  44  ALA F N     
341  C  CA    . ALA A 45  ? 0.3130 0.2391 0.5711 -0.0097 -0.0967 0.0034  44  ALA F CA    
342  C  C     . ALA A 45  ? 0.3417 0.2622 0.6065 -0.0054 -0.0905 -0.0150 44  ALA F C     
343  O  O     . ALA A 45  ? 0.3732 0.2983 0.6404 0.0007  -0.0848 -0.0163 44  ALA F O     
344  C  CB    . ALA A 45  ? 0.3699 0.2886 0.6451 -0.0087 -0.1063 0.0139  44  ALA F CB    
345  N  N     . ASN A 46  ? 0.3288 0.2392 0.5975 -0.0084 -0.0919 -0.0291 45  ASN F N     
346  C  CA    . ASN A 46  ? 0.3457 0.2509 0.6241 -0.0033 -0.0855 -0.0469 45  ASN F CA    
347  C  C     . ASN A 46  ? 0.3584 0.2549 0.6620 0.0030  -0.0923 -0.0463 45  ASN F C     
348  O  O     . ASN A 46  ? 0.3778 0.2711 0.6881 0.0026  -0.1018 -0.0318 45  ASN F O     
349  C  CB    . ASN A 46  ? 0.3521 0.2486 0.6216 -0.0075 -0.0837 -0.0634 45  ASN F CB    
350  C  CG    . ASN A 46  ? 0.3648 0.2462 0.6421 -0.0116 -0.0970 -0.0633 45  ASN F CG    
351  O  OD1   . ASN A 46  ? 0.4472 0.3262 0.7365 -0.0125 -0.1069 -0.0494 45  ASN F OD1   
352  N  ND2   . ASN A 46  ? 0.3843 0.2546 0.6538 -0.0140 -0.0972 -0.0788 45  ASN F ND2   
353  N  N     . TYR A 47  ? 0.3749 0.2678 0.6930 0.0090  -0.0872 -0.0615 46  TYR F N     
354  C  CA    . TYR A 47  ? 0.3199 0.2044 0.6626 0.0155  -0.0945 -0.0619 46  TYR F CA    
355  C  C     . TYR A 47  ? 0.3187 0.1932 0.6652 0.0127  -0.1051 -0.0615 46  TYR F C     
356  O  O     . TYR A 47  ? 0.3575 0.2331 0.7108 0.0139  -0.1135 -0.0499 46  TYR F O     
357  C  CB    . TYR A 47  ? 0.3200 0.2108 0.6755 0.0225  -0.0851 -0.0767 46  TYR F CB    
358  C  CG    . TYR A 47  ? 0.3368 0.2400 0.6946 0.0262  -0.0801 -0.0694 46  TYR F CG    
359  C  CD1   . TYR A 47  ? 0.3899 0.2988 0.7517 0.0285  -0.0873 -0.0565 46  TYR F CD1   
360  C  CD2   . TYR A 47  ? 0.3631 0.2751 0.7117 0.0254  -0.0684 -0.0737 46  TYR F CD2   
361  C  CE1   . TYR A 47  ? 0.3452 0.2638 0.7049 0.0307  -0.0845 -0.0498 46  TYR F CE1   
362  C  CE2   . TYR A 47  ? 0.3638 0.2853 0.7145 0.0284  -0.0657 -0.0662 46  TYR F CE2   
363  C  CZ    . TYR A 47  ? 0.3362 0.2598 0.6929 0.0313  -0.0746 -0.0544 46  TYR F CZ    
364  O  OH    . TYR A 47  ? 0.3238 0.2561 0.6784 0.0331  -0.0736 -0.0473 46  TYR F OH    
365  N  N     . PRO A 48  ? 0.3262 0.1902 0.6669 0.0085  -0.1061 -0.0733 47  PRO F N     
366  C  CA    . PRO A 48  ? 0.5094 0.3635 0.8532 0.0051  -0.1185 -0.0696 47  PRO F CA    
367  C  C     . PRO A 48  ? 0.4624 0.3183 0.8043 -0.0008 -0.1282 -0.0475 47  PRO F C     
368  O  O     . PRO A 48  ? 0.3845 0.2378 0.7352 -0.0005 -0.1372 -0.0392 47  PRO F O     
369  C  CB    . PRO A 48  ? 0.4795 0.3221 0.8109 0.0003  -0.1179 -0.0848 47  PRO F CB    
370  C  CG    . PRO A 48  ? 0.4468 0.2927 0.7763 0.0058  -0.1037 -0.1028 47  PRO F CG    
371  C  CD    . PRO A 48  ? 0.4127 0.2743 0.7434 0.0079  -0.0959 -0.0923 47  PRO F CD    
372  N  N     . ALA A 49  ? 0.3958 0.2570 0.7272 -0.0060 -0.1261 -0.0371 48  ALA F N     
373  C  CA    . ALA A 49  ? 0.3995 0.2651 0.7302 -0.0106 -0.1331 -0.0149 48  ALA F CA    
374  C  C     . ALA A 49  ? 0.3543 0.2287 0.6891 -0.0037 -0.1318 -0.0023 48  ALA F C     
375  O  O     . ALA A 49  ? 0.3064 0.1824 0.6443 -0.0054 -0.1385 0.0127  48  ALA F O     
376  C  CB    . ALA A 49  ? 0.3196 0.1982 0.6313 -0.0168 -0.1285 -0.0068 48  ALA F CB    
377  N  N     . ARG A 50  ? 0.2886 0.1695 0.6217 0.0033  -0.1232 -0.0080 49  ARG F N     
378  C  CA    . ARG A 50  ? 0.2874 0.1769 0.6200 0.0089  -0.1225 0.0017  49  ARG F CA    
379  C  C     . ARG A 50  ? 0.3419 0.2281 0.6852 0.0103  -0.1296 0.0012  49  ARG F C     
380  O  O     . ARG A 50  ? 0.3087 0.1979 0.6478 0.0107  -0.1327 0.0134  49  ARG F O     
381  C  CB    . ARG A 50  ? 0.2632 0.1598 0.5941 0.0150  -0.1134 -0.0069 49  ARG F CB    
382  C  CG    . ARG A 50  ? 0.2877 0.1885 0.6058 0.0145  -0.1073 -0.0025 49  ARG F CG    
383  C  CD    . ARG A 50  ? 0.2505 0.1590 0.5671 0.0200  -0.0989 -0.0091 49  ARG F CD    
384  N  NE    . ARG A 50  ? 0.3424 0.2615 0.6388 0.0168  -0.0918 -0.0056 49  ARG F NE    
385  C  CZ    . ARG A 50  ? 0.5102 0.4377 0.7987 0.0196  -0.0852 -0.0061 49  ARG F CZ    
386  N  NH1   . ARG A 50  ? 0.5410 0.4668 0.8432 0.0260  -0.0851 -0.0101 49  ARG F NH1   
387  N  NH2   . ARG A 50  ? 0.4126 0.3496 0.6806 0.0157  -0.0797 -0.0025 49  ARG F NH2   
388  N  N     . LYS A 51  ? 0.3231 0.2021 0.6778 0.0113  -0.1316 -0.0134 50  LYS F N     
389  C  CA    . LYS A 51  ? 0.3711 0.2454 0.7371 0.0126  -0.1398 -0.0142 50  LYS F CA    
390  C  C     . LYS A 51  ? 0.4256 0.2960 0.7899 0.0068  -0.1495 0.0023  50  LYS F C     
391  O  O     . LYS A 51  ? 0.3905 0.2591 0.7594 0.0075  -0.1557 0.0076  50  LYS F O     
392  C  CB    . LYS A 51  ? 0.4824 0.3483 0.8583 0.0142  -0.1406 -0.0321 50  LYS F CB    
393  C  CG    . LYS A 51  ? 0.5038 0.3641 0.8929 0.0166  -0.1492 -0.0351 50  LYS F CG    
394  C  CD    . LYS A 51  ? 0.4857 0.3368 0.8816 0.0187  -0.1490 -0.0533 50  LYS F CD    
395  C  CE    . LYS A 51  ? 0.5508 0.3906 0.9391 0.0121  -0.1549 -0.0525 50  LYS F CE    
396  N  NZ    . LYS A 51  ? 0.5799 0.4081 0.9725 0.0148  -0.1566 -0.0704 50  LYS F NZ    
397  N  N     . PHE A 52  ? 0.4384 0.3074 0.7968 0.0005  -0.1510 0.0108  51  PHE F N     
398  C  CA    . PHE A 52  ? 0.4517 0.3199 0.8104 -0.0057 -0.1589 0.0284  51  PHE F CA    
399  C  C     . PHE A 52  ? 0.4730 0.3512 0.8201 -0.0057 -0.1545 0.0455  51  PHE F C     
400  O  O     . PHE A 52  ? 0.3910 0.2706 0.7375 -0.0107 -0.1586 0.0611  51  PHE F O     
401  C  CB    . PHE A 52  ? 0.3789 0.2432 0.7378 -0.0137 -0.1632 0.0317  51  PHE F CB    
402  C  CG    . PHE A 52  ? 0.3538 0.2056 0.7192 -0.0148 -0.1691 0.0163  51  PHE F CG    
403  C  CD1   . PHE A 52  ? 0.3960 0.2438 0.7577 -0.0114 -0.1627 -0.0034 51  PHE F CD1   
404  C  CD2   . PHE A 52  ? 0.3610 0.2046 0.7348 -0.0192 -0.1808 0.0212  51  PHE F CD2   
405  C  CE1   . PHE A 52  ? 0.4618 0.2973 0.8262 -0.0116 -0.1671 -0.0188 51  PHE F CE1   
406  C  CE2   . PHE A 52  ? 0.4540 0.2847 0.8314 -0.0194 -0.1866 0.0065  51  PHE F CE2   
407  C  CZ    . PHE A 52  ? 0.5040 0.3304 0.8758 -0.0154 -0.1795 -0.0139 51  PHE F CZ    
408  N  N     . GLY A 53  ? 0.4580 0.3434 0.7947 -0.0004 -0.1455 0.0430  52  GLY F N     
409  C  CA    . GLY A 53  ? 0.3876 0.2818 0.7079 0.0006  -0.1398 0.0575  52  GLY F CA    
410  C  C     . GLY A 53  ? 0.3854 0.2879 0.6960 -0.0005 -0.1335 0.0639  52  GLY F C     
411  O  O     . GLY A 53  ? 0.3678 0.2790 0.6623 0.0016  -0.1275 0.0753  52  GLY F O     
412  N  N     . VAL A 54  ? 0.2898 0.1891 0.6075 -0.0034 -0.1346 0.0564  53  VAL F N     
413  C  CA    . VAL A 54  ? 0.3465 0.2527 0.6553 -0.0049 -0.1301 0.0626  53  VAL F CA    
414  C  C     . VAL A 54  ? 0.3705 0.2838 0.6661 0.0027  -0.1212 0.0584  53  VAL F C     
415  O  O     . VAL A 54  ? 0.3498 0.2589 0.6492 0.0068  -0.1189 0.0436  53  VAL F O     
416  C  CB    . VAL A 54  ? 0.3674 0.2668 0.6814 -0.0118 -0.1329 0.0522  53  VAL F CB    
417  C  CG1   . VAL A 54  ? 0.3056 0.2218 0.6021 -0.0147 -0.1257 0.0566  53  VAL F CG1   
418  C  CG2   . VAL A 54  ? 0.4399 0.3305 0.7668 -0.0202 -0.1436 0.0569  53  VAL F CG2   
419  N  N     . ARG A 55  ? 0.3072 0.2328 0.5869 0.0044  -0.1159 0.0713  54  ARG F N     
420  C  CA    . ARG A 55  ? 0.3727 0.3051 0.6358 0.0111  -0.1082 0.0687  54  ARG F CA    
421  C  C     . ARG A 55  ? 0.3203 0.2640 0.5715 0.0111  -0.1042 0.0770  54  ARG F C     
422  O  O     . ARG A 55  ? 0.3169 0.2669 0.5698 0.0065  -0.1062 0.0884  54  ARG F O     
423  C  CB    . ARG A 55  ? 0.3076 0.2418 0.5551 0.0154  -0.1047 0.0743  54  ARG F CB    
424  C  CG    . ARG A 55  ? 0.4792 0.4038 0.7354 0.0161  -0.1092 0.0676  54  ARG F CG    
425  C  CD    . ARG A 55  ? 0.6062 0.5272 0.8705 0.0191  -0.1087 0.0517  54  ARG F CD    
426  N  NE    . ARG A 55  ? 0.6514 0.5655 0.9244 0.0199  -0.1134 0.0459  54  ARG F NE    
427  C  CZ    . ARG A 55  ? 0.7045 0.6124 0.9971 0.0174  -0.1194 0.0388  54  ARG F CZ    
428  N  NH1   . ARG A 55  ? 0.4581 0.3636 0.7624 0.0136  -0.1215 0.0357  54  ARG F NH1   
429  N  NH2   . ARG A 55  ? 0.7265 0.6295 1.0261 0.0187  -0.1240 0.0343  54  ARG F NH2   
430  N  N     . SER A 56  ? 0.2753 0.2230 0.5147 0.0161  -0.0990 0.0717  55  SER F N     
431  C  CA    . SER A 56  ? 0.2620 0.2218 0.4855 0.0172  -0.0948 0.0797  55  SER F CA    
432  C  C     . SER A 56  ? 0.2726 0.2405 0.4798 0.0189  -0.0901 0.0924  55  SER F C     
433  O  O     . SER A 56  ? 0.2710 0.2343 0.4714 0.0221  -0.0884 0.0932  55  SER F O     
434  C  CB    . SER A 56  ? 0.2944 0.2553 0.5061 0.0224  -0.0904 0.0721  55  SER F CB    
435  O  OG    . SER A 56  ? 0.3245 0.2827 0.5421 0.0181  -0.0881 0.0560  55  SER F OG    
436  N  N     . ALA A 57  ? 0.3201 0.3001 0.5209 0.0174  -0.0878 0.1019  56  ALA F N     
437  C  CA    . ALA A 57  ? 0.3278 0.3177 0.5151 0.0198  -0.0817 0.1136  56  ALA F CA    
438  C  C     . ALA A 57  ? 0.3699 0.3605 0.5709 0.0150  -0.0842 0.1235  56  ALA F C     
439  O  O     . ALA A 57  ? 0.4291 0.4284 0.6221 0.0171  -0.0788 0.1339  56  ALA F O     
440  C  CB    . ALA A 57  ? 0.3497 0.3364 0.5124 0.0293  -0.0752 0.1108  56  ALA F CB    
441  N  N     . MET A 58  ? 0.2373 0.2183 0.4587 0.0090  -0.0923 0.1202  57  MET F N     
442  C  CA    . MET A 58  ? 0.2321 0.2130 0.4672 0.0033  -0.0959 0.1303  57  MET F CA    
443  C  C     . MET A 58  ? 0.2675 0.2609 0.5148 -0.0042 -0.0984 0.1418  57  MET F C     
444  O  O     . MET A 58  ? 0.3875 0.3812 0.6412 -0.0077 -0.1035 0.1376  57  MET F O     
445  C  CB    . MET A 58  ? 0.2664 0.2311 0.5192 -0.0007 -0.1051 0.1216  57  MET F CB    
446  C  CG    . MET A 58  ? 0.3035 0.2666 0.5720 -0.0079 -0.1109 0.1318  57  MET F CG    
447  S  SD    . MET A 58  ? 0.4665 0.4099 0.7477 -0.0089 -0.1196 0.1199  57  MET F SD    
448  C  CE    . MET A 58  ? 0.4093 0.3422 0.7043 -0.0119 -0.1265 0.1045  57  MET F CE    
449  N  N     . PRO A 59  ? 0.3350 0.3392 0.5860 -0.0067 -0.0953 0.1565  58  PRO F N     
450  C  CA    . PRO A 59  ? 0.2999 0.3169 0.5675 -0.0154 -0.0991 0.1682  58  PRO F CA    
451  C  C     . PRO A 59  ? 0.3092 0.3132 0.5989 -0.0253 -0.1132 0.1647  58  PRO F C     
452  O  O     . PRO A 59  ? 0.3762 0.3650 0.6735 -0.0270 -0.1186 0.1596  58  PRO F O     
453  C  CB    . PRO A 59  ? 0.2901 0.3195 0.5607 -0.0157 -0.0928 0.1844  58  PRO F CB    
454  C  CG    . PRO A 59  ? 0.4345 0.4604 0.6805 -0.0042 -0.0831 0.1805  58  PRO F CG    
455  C  CD    . PRO A 59  ? 0.4005 0.4069 0.6397 -0.0011 -0.0878 0.1638  58  PRO F CD    
456  N  N     . THR A 60  ? 0.3371 0.3459 0.6344 -0.0319 -0.1192 0.1651  59  THR F N     
457  C  CA    . THR A 60  ? 0.3768 0.3717 0.6839 -0.0421 -0.1294 0.1519  59  THR F CA    
458  C  C     . THR A 60  ? 0.3604 0.3485 0.6894 -0.0505 -0.1384 0.1626  59  THR F C     
459  O  O     . THR A 60  ? 0.3708 0.3400 0.7070 -0.0548 -0.1469 0.1508  59  THR F O     
460  C  CB    . THR A 60  ? 0.3221 0.3251 0.6251 -0.0487 -0.1319 0.1463  59  THR F CB    
461  O  OG1   . THR A 60  ? 0.3483 0.3530 0.6299 -0.0414 -0.1245 0.1343  59  THR F OG1   
462  C  CG2   . THR A 60  ? 0.3369 0.3238 0.6472 -0.0591 -0.1434 0.1328  59  THR F CG2   
463  N  N     . GLY A 61  ? 0.3616 0.3645 0.7016 -0.0523 -0.1364 0.1849  60  GLY F N     
464  C  CA    . GLY A 61  ? 0.3692 0.3704 0.7269 -0.0600 -0.1426 0.1930  60  GLY F CA    
465  C  C     . GLY A 61  ? 0.4838 0.4701 0.8366 -0.0548 -0.1425 0.1849  60  GLY F C     
466  O  O     . GLY A 61  ? 0.4199 0.3941 0.7853 -0.0606 -0.1527 0.1822  60  GLY F O     
467  N  N     . MET A 62  ? 0.4094 0.3961 0.7426 -0.0437 -0.1318 0.1800  61  MET F N     
468  C  CA    . MET A 62  ? 0.4151 0.3868 0.7429 -0.0389 -0.1326 0.1711  61  MET F CA    
469  C  C     . MET A 62  ? 0.4949 0.4461 0.8263 -0.0385 -0.1411 0.1512  61  MET F C     
470  O  O     . MET A 62  ? 0.4127 0.3501 0.7518 -0.0395 -0.1483 0.1441  61  MET F O     
471  C  CB    . MET A 62  ? 0.3933 0.3699 0.6972 -0.0274 -0.1197 0.1707  61  MET F CB    
472  C  CG    . MET A 62  ? 0.4972 0.4571 0.7931 -0.0216 -0.1212 0.1590  61  MET F CG    
473  S  SD    . MET A 62  ? 0.7466 0.7089 1.0155 -0.0109 -0.1097 0.1640  61  MET F SD    
474  C  CE    . MET A 62  ? 0.7744 0.7451 1.0203 -0.0013 -0.0991 0.1574  61  MET F CE    
475  N  N     . ALA A 63  ? 0.4804 0.4296 0.8063 -0.0366 -0.1401 0.1416  62  ALA F N     
476  C  CA    . ALA A 63  ? 0.4508 0.3805 0.7793 -0.0362 -0.1458 0.1212  62  ALA F CA    
477  C  C     . ALA A 63  ? 0.4010 0.3191 0.7447 -0.0461 -0.1577 0.1159  62  ALA F C     
478  O  O     . ALA A 63  ? 0.4140 0.3177 0.7616 -0.0441 -0.1626 0.1013  62  ALA F O     
479  C  CB    . ALA A 63  ? 0.2688 0.2057 0.5824 -0.0343 -0.1391 0.1092  62  ALA F CB    
480  N  N     . LEU A 64  ? 0.3894 0.3157 0.7406 -0.0559 -0.1625 0.1271  63  LEU F N     
481  C  CA    . LEU A 64  ? 0.4079 0.3247 0.7691 -0.0641 -0.1745 0.1211  63  LEU F CA    
482  C  C     . LEU A 64  ? 0.5467 0.4593 0.9192 -0.0642 -0.1810 0.1282  63  LEU F C     
483  O  O     . LEU A 64  ? 0.4337 0.3317 0.8116 -0.0665 -0.1909 0.1179  63  LEU F O     
484  C  CB    . LEU A 64  ? 0.4083 0.3375 0.7737 -0.0738 -0.1784 0.1315  63  LEU F CB    
485  C  CG    . LEU A 64  ? 0.4242 0.3550 0.7778 -0.0766 -0.1764 0.1196  63  LEU F CG    
486  C  CD1   . LEU A 64  ? 0.4334 0.3817 0.7923 -0.0846 -0.1794 0.1342  63  LEU F CD1   
487  C  CD2   . LEU A 64  ? 0.4211 0.3315 0.7663 -0.0774 -0.1826 0.0950  63  LEU F CD2   
488  N  N     . LYS A 65  ? 0.4608 0.3859 0.8349 -0.0618 -0.1752 0.1450  64  LYS F N     
489  C  CA    . LYS A 65  ? 0.4054 0.3259 0.7877 -0.0624 -0.1805 0.1507  64  LYS F CA    
490  C  C     . LYS A 65  ? 0.5490 0.4527 0.9267 -0.0547 -0.1820 0.1332  64  LYS F C     
491  O  O     . LYS A 65  ? 0.5397 0.4318 0.9257 -0.0561 -0.1914 0.1292  64  LYS F O     
492  C  CB    . LYS A 65  ? 0.5736 0.5115 0.9535 -0.0616 -0.1713 0.1709  64  LYS F CB    
493  N  N     . LEU A 66  ? 0.4103 0.3136 0.7754 -0.0462 -0.1729 0.1230  65  LEU F N     
494  C  CA    . LEU A 66  ? 0.3739 0.2643 0.7368 -0.0387 -0.1738 0.1057  65  LEU F CA    
495  C  C     . LEU A 66  ? 0.4164 0.2930 0.7841 -0.0388 -0.1799 0.0859  65  LEU F C     
496  O  O     . LEU A 66  ? 0.4760 0.3413 0.8488 -0.0351 -0.1848 0.0737  65  LEU F O     
497  C  CB    . LEU A 66  ? 0.3880 0.2839 0.7362 -0.0297 -0.1621 0.1013  65  LEU F CB    
498  C  CG    . LEU A 66  ? 0.4176 0.3229 0.7534 -0.0262 -0.1545 0.1151  65  LEU F CG    
499  C  CD1   . LEU A 66  ? 0.4033 0.3149 0.7212 -0.0178 -0.1433 0.1104  65  LEU F CD1   
500  C  CD2   . LEU A 66  ? 0.4069 0.3030 0.7449 -0.0244 -0.1595 0.1140  65  LEU F CD2   
501  N  N     . CYS A 67  ? 0.4514 0.3287 0.8156 -0.0432 -0.1791 0.0818  66  CYS F N     
502  C  CA    . CYS A 67  ? 0.3929 0.2574 0.7544 -0.0428 -0.1814 0.0602  66  CYS F CA    
503  C  C     . CYS A 67  ? 0.3568 0.2204 0.7181 -0.0529 -0.1884 0.0633  66  CYS F C     
504  O  O     . CYS A 67  ? 0.3836 0.2526 0.7360 -0.0567 -0.1845 0.0612  66  CYS F O     
505  C  CB    . CYS A 67  ? 0.3958 0.2619 0.7464 -0.0367 -0.1703 0.0467  66  CYS F CB    
506  S  SG    . CYS A 67  ? 0.4939 0.3468 0.8373 -0.0362 -0.1694 0.0190  66  CYS F SG    
507  N  N     . PRO A 68  ? 0.5309 0.3883 0.9018 -0.0580 -0.1998 0.0688  67  PRO F N     
508  C  CA    . PRO A 68  ? 0.5076 0.3659 0.8795 -0.0679 -0.2078 0.0748  67  PRO F CA    
509  C  C     . PRO A 68  ? 0.4926 0.3413 0.8512 -0.0699 -0.2085 0.0557  67  PRO F C     
510  O  O     . PRO A 68  ? 0.4759 0.3299 0.8308 -0.0776 -0.2119 0.0610  67  PRO F O     
511  C  CB    . PRO A 68  ? 0.4793 0.3281 0.8637 -0.0710 -0.2206 0.0803  67  PRO F CB    
512  C  CG    . PRO A 68  ? 0.5809 0.4334 0.9724 -0.0655 -0.2176 0.0882  67  PRO F CG    
513  C  CD    . PRO A 68  ? 0.5466 0.3985 0.9285 -0.0558 -0.2064 0.0739  67  PRO F CD    
514  N  N     . HIS A 69  ? 0.5018 0.3373 0.8527 -0.0630 -0.2052 0.0336  68  HIS F N     
515  C  CA    . HIS A 69  ? 0.4857 0.3114 0.8211 -0.0644 -0.2046 0.0140  68  HIS F CA    
516  C  C     . HIS A 69  ? 0.4895 0.3244 0.8123 -0.0625 -0.1921 0.0078  68  HIS F C     
517  O  O     . HIS A 69  ? 0.5341 0.3606 0.8420 -0.0622 -0.1893 -0.0108 68  HIS F O     
518  C  CB    . HIS A 69  ? 0.5486 0.3555 0.8822 -0.0579 -0.2069 -0.0072 68  HIS F CB    
519  C  CG    . HIS A 69  ? 0.5668 0.3623 0.9111 -0.0603 -0.2209 -0.0031 68  HIS F CG    
520  N  ND1   . HIS A 69  ? 0.6559 0.4501 1.0150 -0.0557 -0.2241 0.0031  68  HIS F ND1   
521  C  CD2   . HIS A 69  ? 0.8112 0.5953 1.1530 -0.0672 -0.2336 -0.0039 68  HIS F CD2   
522  C  CE1   . HIS A 69  ? 0.7750 0.5577 1.1409 -0.0598 -0.2379 0.0059  68  HIS F CE1   
523  N  NE2   . HIS A 69  ? 0.8539 0.6301 1.2100 -0.0666 -0.2439 0.0019  68  HIS F NE2   
524  N  N     . LEU A 70  ? 0.4240 0.2751 0.7513 -0.0611 -0.1848 0.0228  69  LEU F N     
525  C  CA    . LEU A 70  ? 0.3993 0.2593 0.7156 -0.0596 -0.1740 0.0186  69  LEU F CA    
526  C  C     . LEU A 70  ? 0.4810 0.3429 0.7823 -0.0676 -0.1764 0.0140  69  LEU F C     
527  O  O     . LEU A 70  ? 0.5049 0.3714 0.8097 -0.0759 -0.1852 0.0265  69  LEU F O     
528  C  CB    . LEU A 70  ? 0.3953 0.2739 0.7161 -0.0573 -0.1675 0.0394  69  LEU F CB    
529  C  CG    . LEU A 70  ? 0.4058 0.3008 0.7083 -0.0508 -0.1533 0.0376  69  LEU F CG    
530  C  CD1   . LEU A 70  ? 0.4173 0.3048 0.7152 -0.0415 -0.1450 0.0189  69  LEU F CD1   
531  C  CD2   . LEU A 70  ? 0.3204 0.2328 0.6250 -0.0474 -0.1481 0.0590  69  LEU F CD2   
532  N  N     . THR A 71  ? 0.4366 0.2975 0.7177 -0.0633 -0.1671 -0.0035 70  THR F N     
533  C  CA    . THR A 71  ? 0.5541 0.4176 0.8145 -0.0690 -0.1675 -0.0084 70  THR F CA    
534  C  C     . THR A 71  ? 0.5615 0.4474 0.8105 -0.0662 -0.1560 0.0022  70  THR F C     
535  O  O     . THR A 71  ? 0.4862 0.3783 0.7281 -0.0580 -0.1432 -0.0033 70  THR F O     
536  C  CB    . THR A 71  ? 0.6274 0.4748 0.8692 -0.0664 -0.1640 -0.0336 70  THR F CB    
537  O  OG1   . THR A 71  ? 0.5810 0.4054 0.8312 -0.0693 -0.1769 -0.0438 70  THR F OG1   
538  C  CG2   . THR A 71  ? 0.5578 0.4085 0.7734 -0.0714 -0.1626 -0.0377 70  THR F CG2   
539  N  N     . LEU A 72  ? 0.5210 0.4188 0.7698 -0.0730 -0.1614 0.0174  71  LEU F N     
540  C  CA    . LEU A 72  ? 0.4685 0.3878 0.7107 -0.0699 -0.1527 0.0307  71  LEU F CA    
541  C  C     . LEU A 72  ? 0.4988 0.4199 0.7160 -0.0725 -0.1500 0.0223  71  LEU F C     
542  O  O     . LEU A 72  ? 0.4773 0.3909 0.6885 -0.0808 -0.1605 0.0192  71  LEU F O     
543  C  CB    . LEU A 72  ? 0.4832 0.4164 0.7433 -0.0747 -0.1592 0.0539  71  LEU F CB    
544  C  CG    . LEU A 72  ? 0.6015 0.5554 0.8630 -0.0676 -0.1492 0.0703  71  LEU F CG    
545  C  CD1   . LEU A 72  ? 0.5584 0.5092 0.8213 -0.0574 -0.1402 0.0668  71  LEU F CD1   
546  C  CD2   . LEU A 72  ? 0.6583 0.6244 0.9405 -0.0726 -0.1555 0.0923  71  LEU F CD2   
547  N  N     . LEU A 73  ? 0.4882 0.4180 0.6903 -0.0657 -0.1373 0.0190  72  LEU F N     
548  C  CA    . LEU A 73  ? 0.4859 0.4162 0.6623 -0.0676 -0.1336 0.0108  72  LEU F CA    
549  C  C     . LEU A 73  ? 0.4727 0.4221 0.6439 -0.0659 -0.1300 0.0260  72  LEU F C     
550  O  O     . LEU A 73  ? 0.4178 0.3793 0.6000 -0.0595 -0.1248 0.0379  72  LEU F O     
551  C  CB    . LEU A 73  ? 0.4800 0.4030 0.6415 -0.0618 -0.1214 -0.0072 72  LEU F CB    
552  C  CG    . LEU A 73  ? 0.5862 0.4890 0.7391 -0.0637 -0.1228 -0.0280 72  LEU F CG    
553  C  CD1   . LEU A 73  ? 0.6148 0.5049 0.7864 -0.0671 -0.1355 -0.0283 72  LEU F CD1   
554  C  CD2   . LEU A 73  ? 0.6985 0.5994 0.8501 -0.0554 -0.1089 -0.0414 72  LEU F CD2   
555  N  N     . PRO A 74  ? 0.4860 0.4372 0.6394 -0.0711 -0.1336 0.0258  73  PRO F N     
556  C  CA    . PRO A 74  ? 0.3562 0.3252 0.5058 -0.0689 -0.1315 0.0402  73  PRO F CA    
557  C  C     . PRO A 74  ? 0.4240 0.3979 0.5568 -0.0615 -0.1190 0.0367  73  PRO F C     
558  O  O     . PRO A 74  ? 0.5444 0.5324 0.6786 -0.0564 -0.1158 0.0493  73  PRO F O     
559  C  CB    . PRO A 74  ? 0.4679 0.4340 0.6056 -0.0780 -0.1426 0.0403  73  PRO F CB    
560  C  CG    . PRO A 74  ? 0.5150 0.4601 0.6349 -0.0822 -0.1442 0.0205  73  PRO F CG    
561  C  CD    . PRO A 74  ? 0.5104 0.4467 0.6489 -0.0796 -0.1429 0.0146  73  PRO F CD    
562  N  N     . GLY A 75  ? 0.4247 0.3876 0.5416 -0.0608 -0.1118 0.0204  74  GLY F N     
563  C  CA    . GLY A 75  ? 0.5352 0.5038 0.6381 -0.0551 -0.1011 0.0192  74  GLY F CA    
564  C  C     . GLY A 75  ? 0.4616 0.4281 0.5374 -0.0599 -0.1013 0.0156  74  GLY F C     
565  O  O     . GLY A 75  ? 0.5091 0.4791 0.5803 -0.0647 -0.1106 0.0235  74  GLY F O     
566  N  N     . ARG A 76  ? 0.4732 0.4345 0.5322 -0.0587 -0.0912 0.0044  75  ARG F N     
567  C  CA    . ARG A 76  ? 0.4199 0.3765 0.4498 -0.0636 -0.0895 -0.0008 75  ARG F CA    
568  C  C     . ARG A 76  ? 0.4861 0.4503 0.5094 -0.0584 -0.0797 0.0027  75  ARG F C     
569  O  O     . ARG A 76  ? 0.4226 0.3838 0.4419 -0.0565 -0.0687 -0.0068 75  ARG F O     
570  C  CB    . ARG A 76  ? 0.3847 0.3256 0.3989 -0.0681 -0.0858 -0.0188 75  ARG F CB    
571  C  CG    . ARG A 76  ? 0.4309 0.3610 0.4514 -0.0730 -0.0976 -0.0230 75  ARG F CG    
572  C  CD    . ARG A 76  ? 0.5743 0.4891 0.5903 -0.0729 -0.0923 -0.0419 75  ARG F CD    
573  N  NE    . ARG A 76  ? 0.6090 0.5164 0.5950 -0.0744 -0.0820 -0.0539 75  ARG F NE    
574  C  CZ    . ARG A 76  ? 0.6978 0.6044 0.6826 -0.0698 -0.0669 -0.0654 75  ARG F CZ    
575  N  NH1   . ARG A 76  ? 0.8167 0.7178 0.7729 -0.0721 -0.0570 -0.0745 75  ARG F NH1   
576  N  NH2   . ARG A 76  ? 0.6444 0.5557 0.6567 -0.0630 -0.0616 -0.0675 75  ARG F NH2   
577  N  N     . PHE A 77  ? 0.4392 0.5452 0.3787 -0.0006 -0.0293 0.0458  76  PHE F N     
578  C  CA    . PHE A 77  ? 0.4660 0.5661 0.4259 0.0112  -0.0253 0.0500  76  PHE F CA    
579  C  C     . PHE A 77  ? 0.4175 0.4990 0.3672 0.0179  -0.0165 0.0561  76  PHE F C     
580  O  O     . PHE A 77  ? 0.4243 0.4920 0.3894 0.0235  -0.0094 0.0584  76  PHE F O     
581  C  CB    . PHE A 77  ? 0.4162 0.5415 0.3892 0.0191  -0.0363 0.0528  76  PHE F CB    
582  C  CG    . PHE A 77  ? 0.5230 0.6624 0.5123 0.0130  -0.0414 0.0474  76  PHE F CG    
583  C  CD1   . PHE A 77  ? 0.5136 0.6435 0.5243 0.0158  -0.0379 0.0456  76  PHE F CD1   
584  C  CD2   . PHE A 77  ? 0.5544 0.7153 0.5363 0.0025  -0.0497 0.0445  76  PHE F CD2   
585  C  CE1   . PHE A 77  ? 0.4852 0.6262 0.5080 0.0093  -0.0428 0.0413  76  PHE F CE1   
586  C  CE2   . PHE A 77  ? 0.4410 0.6135 0.4357 -0.0051 -0.0539 0.0405  76  PHE F CE2   
587  C  CZ    . PHE A 77  ? 0.3640 0.5259 0.3781 -0.0014 -0.0505 0.0392  76  PHE F CZ    
588  N  N     . ASP A 78  ? 0.4296 0.5100 0.3528 0.0161  -0.0168 0.0592  77  ASP F N     
589  C  CA    . ASP A 78  ? 0.4648 0.5255 0.3751 0.0205  -0.0073 0.0656  77  ASP F CA    
590  C  C     . ASP A 78  ? 0.5538 0.5927 0.4649 0.0145  0.0084  0.0608  77  ASP F C     
591  O  O     . ASP A 78  ? 0.5321 0.5559 0.4483 0.0182  0.0188  0.0654  77  ASP F O     
592  C  CB    . ASP A 78  ? 0.5735 0.6388 0.4526 0.0198  -0.0125 0.0706  77  ASP F CB    
593  C  CG    . ASP A 78  ? 0.7361 0.8175 0.6158 0.0313  -0.0254 0.0790  77  ASP F CG    
594  O  OD1   . ASP A 78  ? 0.5993 0.6879 0.5026 0.0399  -0.0296 0.0799  77  ASP F OD1   
595  O  OD2   . ASP A 78  ? 0.7329 0.8197 0.5887 0.0324  -0.0318 0.0842  77  ASP F OD2   
596  N  N     . ALA A 79  ? 0.4912 0.5284 0.3979 0.0053  0.0103  0.0515  78  ALA F N     
597  C  CA    . ALA A 79  ? 0.4789 0.4971 0.3899 0.0020  0.0250  0.0454  78  ALA F CA    
598  C  C     . ALA A 79  ? 0.4424 0.4571 0.3874 0.0068  0.0294  0.0455  78  ALA F C     
599  O  O     . ALA A 79  ? 0.4333 0.4353 0.3870 0.0084  0.0426  0.0458  78  ALA F O     
600  C  CB    . ALA A 79  ? 0.5114 0.5260 0.4117 -0.0075 0.0236  0.0347  78  ALA F CB    
601  N  N     . TYR A 80  ? 0.3667 0.3944 0.3311 0.0086  0.0184  0.0451  79  TYR F N     
602  C  CA    . TYR A 80  ? 0.3740 0.3988 0.3691 0.0126  0.0206  0.0450  79  TYR F CA    
603  C  C     . TYR A 80  ? 0.4229 0.4436 0.4259 0.0201  0.0236  0.0536  79  TYR F C     
604  O  O     . TYR A 80  ? 0.4294 0.4405 0.4515 0.0215  0.0318  0.0544  79  TYR F O     
605  C  CB    . TYR A 80  ? 0.3769 0.4165 0.3867 0.0119  0.0079  0.0425  79  TYR F CB    
606  C  CG    . TYR A 80  ? 0.4297 0.4749 0.4288 0.0027  0.0016  0.0360  79  TYR F CG    
607  C  CD1   . TYR A 80  ? 0.3836 0.4134 0.3722 -0.0037 0.0087  0.0294  79  TYR F CD1   
608  C  CD2   . TYR A 80  ? 0.3777 0.4432 0.3768 0.0001  -0.0113 0.0361  79  TYR F CD2   
609  C  CE1   . TYR A 80  ? 0.3114 0.3423 0.2882 -0.0133 0.0018  0.0236  79  TYR F CE1   
610  C  CE2   . TYR A 80  ? 0.3889 0.4592 0.3778 -0.0107 -0.0175 0.0311  79  TYR F CE2   
611  C  CZ    . TYR A 80  ? 0.3809 0.4320 0.3579 -0.0178 -0.0115 0.0251  79  TYR F CZ    
612  O  OH    . TYR A 80  ? 0.4603 0.5125 0.4250 -0.0298 -0.0189 0.0202  79  TYR F OH    
613  N  N     . LYS A 81  ? 0.3822 0.4099 0.3715 0.0251  0.0161  0.0602  80  LYS F N     
614  C  CA    . LYS A 81  ? 0.4739 0.4929 0.4664 0.0323  0.0178  0.0690  80  LYS F CA    
615  C  C     . LYS A 81  ? 0.4976 0.4990 0.4800 0.0290  0.0327  0.0730  80  LYS F C     
616  O  O     . LYS A 81  ? 0.4556 0.4456 0.4502 0.0307  0.0390  0.0783  80  LYS F O     
617  C  CB    . LYS A 81  ? 0.4703 0.4989 0.4471 0.0397  0.0061  0.0753  80  LYS F CB    
618  C  CG    . LYS A 81  ? 0.5487 0.5630 0.5244 0.0476  0.0067  0.0851  80  LYS F CG    
619  C  CD    . LYS A 81  ? 0.7342 0.7585 0.6990 0.0582  -0.0069 0.0904  80  LYS F CD    
620  C  CE    . LYS A 81  ? 0.7878 0.8177 0.7228 0.0567  -0.0097 0.0943  80  LYS F CE    
621  N  NZ    . LYS A 81  ? 0.8985 0.9362 0.8240 0.0692  -0.0228 0.1013  80  LYS F NZ    
622  N  N     . GLU A 82  ? 0.3986 0.3979 0.3577 0.0235  0.0387  0.0705  81  GLU F N     
623  C  CA    . GLU A 82  ? 0.5114 0.4963 0.4586 0.0198  0.0545  0.0732  81  GLU F CA    
624  C  C     . GLU A 82  ? 0.4903 0.4701 0.4641 0.0173  0.0669  0.0681  81  GLU F C     
625  O  O     . GLU A 82  ? 0.4829 0.4541 0.4640 0.0165  0.0781  0.0735  81  GLU F O     
626  C  CB    . GLU A 82  ? 0.6607 0.6448 0.5762 0.0143  0.0578  0.0692  81  GLU F CB    
627  C  CG    . GLU A 82  ? 0.8461 0.8167 0.7443 0.0105  0.0752  0.0718  81  GLU F CG    
628  C  CD    . GLU A 82  ? 1.0985 1.0667 0.9640 0.0049  0.0788  0.0653  81  GLU F CD    
629  O  OE1   . GLU A 82  ? 1.1788 1.1506 1.0463 0.0020  0.0756  0.0543  81  GLU F OE1   
630  O  OE2   . GLU A 82  ? 1.1762 1.1373 1.0121 0.0029  0.0841  0.0714  81  GLU F OE2   
631  N  N     . ALA A 83  ? 0.4792 0.4646 0.4682 0.0157  0.0646  0.0582  82  ALA F N     
632  C  CA    . ALA A 83  ? 0.4759 0.4582 0.4930 0.0151  0.0744  0.0535  82  ALA F CA    
633  C  C     . ALA A 83  ? 0.3985 0.3818 0.4433 0.0182  0.0708  0.0593  82  ALA F C     
634  O  O     . ALA A 83  ? 0.4308 0.4105 0.4947 0.0170  0.0814  0.0608  82  ALA F O     
635  C  CB    . ALA A 83  ? 0.4693 0.4548 0.4954 0.0135  0.0700  0.0427  82  ALA F CB    
636  N  N     . SER A 84  ? 0.3663 0.3551 0.4134 0.0220  0.0561  0.0621  83  SER F N     
637  C  CA    . SER A 84  ? 0.4468 0.4340 0.5167 0.0253  0.0514  0.0665  83  SER F CA    
638  C  C     . SER A 84  ? 0.4273 0.4022 0.4923 0.0248  0.0593  0.0763  83  SER F C     
639  O  O     . SER A 84  ? 0.4053 0.3752 0.4921 0.0224  0.0653  0.0785  83  SER F O     
640  C  CB    . SER A 84  ? 0.4201 0.4157 0.4884 0.0308  0.0350  0.0669  83  SER F CB    
641  O  OG    . SER A 84  ? 0.3864 0.3783 0.4751 0.0342  0.0300  0.0693  83  SER F OG    
642  N  N     . ASN A 85  ? 0.4852 0.4549 0.5214 0.0262  0.0588  0.0830  84  ASN F N     
643  C  CA    . ASN A 85  ? 0.5183 0.4734 0.5457 0.0247  0.0659  0.0939  84  ASN F CA    
644  C  C     . ASN A 85  ? 0.5442 0.4959 0.5809 0.0168  0.0844  0.0938  84  ASN F C     
645  O  O     . ASN A 85  ? 0.3701 0.3135 0.4196 0.0131  0.0906  0.1004  84  ASN F O     
646  C  CB    . ASN A 85  ? 0.4706 0.4208 0.4621 0.0270  0.0627  0.1010  84  ASN F CB    
647  C  CG    . ASN A 85  ? 0.5531 0.5079 0.5383 0.0365  0.0447  0.1030  84  ASN F CG    
648  O  OD1   . ASN A 85  ? 0.4910 0.4475 0.4965 0.0415  0.0361  0.1012  84  ASN F OD1   
649  N  ND2   . ASN A 85  ? 0.4731 0.4312 0.4302 0.0394  0.0390  0.1063  84  ASN F ND2   
650  N  N     . HIS A 86  ? 0.4081 0.3667 0.4390 0.0140  0.0934  0.0858  85  HIS F N     
651  C  CA    . HIS A 86  ? 0.4646 0.4234 0.5041 0.0083  0.1123  0.0841  85  HIS F CA    
652  C  C     . HIS A 86  ? 0.4552 0.4199 0.5355 0.0072  0.1149  0.0810  85  HIS F C     
653  O  O     . HIS A 86  ? 0.4769 0.4406 0.5708 0.0019  0.1268  0.0861  85  HIS F O     
654  C  CB    . HIS A 86  ? 0.4712 0.4345 0.4948 0.0078  0.1195  0.0741  85  HIS F CB    
655  C  CG    . HIS A 86  ? 0.5781 0.5415 0.6004 0.0034  0.1407  0.0723  85  HIS F CG    
656  N  ND1   . HIS A 86  ? 0.6606 0.6231 0.6585 0.0026  0.1499  0.0648  85  HIS F ND1   
657  C  CD2   . HIS A 86  ? 0.6357 0.6016 0.6782 -0.0007 0.1550  0.0764  85  HIS F CD2   
658  C  CE1   . HIS A 86  ? 0.7504 0.7152 0.7531 -0.0005 0.1698  0.0639  85  HIS F CE1   
659  N  NE2   . HIS A 86  ? 0.6133 0.5819 0.6442 -0.0030 0.1734  0.0713  85  HIS F NE2   
660  N  N     . ILE A 87  ? 0.3742 0.3462 0.4742 0.0112  0.1036  0.0733  86  ILE F N     
661  C  CA    . ILE A 87  ? 0.4156 0.3939 0.5539 0.0101  0.1051  0.0704  86  ILE F CA    
662  C  C     . ILE A 87  ? 0.4738 0.4456 0.6250 0.0080  0.0995  0.0793  86  ILE F C     
663  O  O     . ILE A 87  ? 0.3899 0.3651 0.5688 0.0036  0.1051  0.0806  86  ILE F O     
664  C  CB    . ILE A 87  ? 0.3885 0.3744 0.5433 0.0142  0.0940  0.0607  86  ILE F CB    
665  C  CG1   . ILE A 87  ? 0.4755 0.4606 0.6312 0.0174  0.0756  0.0623  86  ILE F CG1   
666  C  CG2   . ILE A 87  ? 0.3232 0.3102 0.4591 0.0158  0.0963  0.0522  86  ILE F CG2   
667  C  CD1   . ILE A 87  ? 0.4357 0.4280 0.6019 0.0198  0.0647  0.0537  86  ILE F CD1   
668  N  N     . ARG A 88  ? 0.4370 0.3992 0.5687 0.0110  0.0882  0.0852  87  ARG F N     
669  C  CA    . ARG A 88  ? 0.4101 0.3610 0.5502 0.0094  0.0829  0.0933  87  ARG F CA    
670  C  C     . ARG A 88  ? 0.3890 0.3301 0.5217 0.0014  0.0967  0.1034  87  ARG F C     
671  O  O     . ARG A 88  ? 0.4567 0.3904 0.6058 -0.0043 0.0975  0.1092  87  ARG F O     
672  C  CB    . ARG A 88  ? 0.3205 0.2631 0.4417 0.0171  0.0669  0.0962  87  ARG F CB    
673  C  CG    . ARG A 88  ? 0.3785 0.3325 0.5088 0.0235  0.0533  0.0870  87  ARG F CG    
674  C  CD    . ARG A 88  ? 0.3639 0.3140 0.4755 0.0323  0.0393  0.0894  87  ARG F CD    
675  N  NE    . ARG A 88  ? 0.3483 0.3126 0.4679 0.0372  0.0278  0.0808  87  ARG F NE    
676  C  CZ    . ARG A 88  ? 0.4415 0.4095 0.5511 0.0455  0.0154  0.0800  87  ARG F CZ    
677  N  NH1   . ARG A 88  ? 0.4175 0.3744 0.5094 0.0518  0.0116  0.0873  87  ARG F NH1   
678  N  NH2   . ARG A 88  ? 0.4376 0.4209 0.5551 0.0479  0.0068  0.0724  87  ARG F NH2   
679  N  N     . GLU A 89  ? 0.4124 0.3526 0.5189 -0.0002 0.1075  0.1060  88  GLU F N     
680  C  CA    . GLU A 89  ? 0.4344 0.3678 0.5333 -0.0093 0.1232  0.1154  88  GLU F CA    
681  C  C     . GLU A 89  ? 0.4927 0.4412 0.6235 -0.0162 0.1384  0.1111  88  GLU F C     
682  O  O     . GLU A 89  ? 0.5155 0.4614 0.6575 -0.0256 0.1476  0.1190  88  GLU F O     
683  C  CB    . GLU A 89  ? 0.5193 0.4485 0.5791 -0.0092 0.1305  0.1185  88  GLU F CB    
684  C  CG    . GLU A 89  ? 0.7760 0.6976 0.8215 -0.0194 0.1474  0.1294  88  GLU F CG    
685  C  CD    . GLU A 89  ? 0.8181 0.7567 0.8765 -0.0250 0.1684  0.1228  88  GLU F CD    
686  O  OE1   . GLU A 89  ? 0.8690 0.8181 0.9228 -0.0196 0.1712  0.1113  88  GLU F OE1   
687  O  OE2   . GLU A 89  ? 0.8716 0.8131 0.9452 -0.0347 0.1820  0.1288  88  GLU F OE2   
688  N  N     . ILE A 90  ? 0.4930 0.4574 0.6398 -0.0115 0.1403  0.0988  89  ILE F N     
689  C  CA    . ILE A 90  ? 0.4673 0.4484 0.6490 -0.0151 0.1525  0.0936  89  ILE F CA    
690  C  C     . ILE A 90  ? 0.4284 0.4117 0.6452 -0.0186 0.1437  0.0958  89  ILE F C     
691  O  O     . ILE A 90  ? 0.4078 0.4005 0.6498 -0.0266 0.1543  0.0990  89  ILE F O     
692  C  CB    . ILE A 90  ? 0.4547 0.4478 0.6426 -0.0075 0.1540  0.0799  89  ILE F CB    
693  C  CG1   . ILE A 90  ? 0.4594 0.4511 0.6152 -0.0068 0.1675  0.0772  89  ILE F CG1   
694  C  CG2   . ILE A 90  ? 0.4029 0.4139 0.6330 -0.0076 0.1608  0.0736  89  ILE F CG2   
695  C  CD1   . ILE A 90  ? 0.4828 0.4789 0.6354 0.0008  0.1660  0.0636  89  ILE F CD1   
696  N  N     . PHE A 91  ? 0.4092 0.3851 0.6279 -0.0133 0.1243  0.0941  90  PHE F N     
697  C  CA    . PHE A 91  ? 0.4475 0.4218 0.6941 -0.0172 0.1146  0.0963  90  PHE F CA    
698  C  C     . PHE A 91  ? 0.4529 0.4132 0.6950 -0.0276 0.1192  0.1087  90  PHE F C     
699  O  O     . PHE A 91  ? 0.4312 0.3960 0.7014 -0.0363 0.1211  0.1115  90  PHE F O     
700  C  CB    . PHE A 91  ? 0.4303 0.3965 0.6720 -0.0094 0.0937  0.0926  90  PHE F CB    
701  C  CG    . PHE A 91  ? 0.3809 0.3584 0.6246 -0.0010 0.0870  0.0817  90  PHE F CG    
702  C  CD1   . PHE A 91  ? 0.3038 0.2969 0.5665 -0.0004 0.0954  0.0745  90  PHE F CD1   
703  C  CD2   . PHE A 91  ? 0.3613 0.3337 0.5883 0.0062  0.0719  0.0790  90  PHE F CD2   
704  C  CE1   . PHE A 91  ? 0.3701 0.3691 0.6320 0.0064  0.0880  0.0654  90  PHE F CE1   
705  C  CE2   . PHE A 91  ? 0.3736 0.3555 0.6007 0.0115  0.0655  0.0703  90  PHE F CE2   
706  C  CZ    . PHE A 91  ? 0.3687 0.3618 0.6123 0.0111  0.0730  0.0638  90  PHE F CZ    
707  N  N     . SER A 92  ? 0.3989 0.3416 0.6054 -0.0274 0.1200  0.1169  91  SER F N     
708  C  CA    . SER A 92  ? 0.4678 0.3919 0.6654 -0.0373 0.1227  0.1300  91  SER F CA    
709  C  C     . SER A 92  ? 0.4950 0.4308 0.7071 -0.0508 0.1431  0.1352  91  SER F C     
710  O  O     . SER A 92  ? 0.4542 0.3794 0.6725 -0.0628 0.1452  0.1452  91  SER F O     
711  C  CB    . SER A 92  ? 0.5070 0.4096 0.6613 -0.0330 0.1190  0.1382  91  SER F CB    
712  O  OG    . SER A 92  ? 0.4896 0.3988 0.6221 -0.0349 0.1345  0.1401  91  SER F OG    
713  N  N     . ARG A 93  ? 0.4388 0.3965 0.6571 -0.0493 0.1582  0.1285  92  ARG F N     
714  C  CA    . ARG A 93  ? 0.5474 0.5218 0.7836 -0.0610 0.1789  0.1320  92  ARG F CA    
715  C  C     . ARG A 93  ? 0.4591 0.4484 0.7414 -0.0684 0.1771  0.1307  92  ARG F C     
716  O  O     . ARG A 93  ? 0.4778 0.4792 0.7774 -0.0813 0.1918  0.1368  92  ARG F O     
717  C  CB    . ARG A 93  ? 0.5058 0.5010 0.7403 -0.0551 0.1951  0.1224  92  ARG F CB    
718  C  CG    . ARG A 93  ? 0.5640 0.5464 0.7518 -0.0506 0.1992  0.1240  92  ARG F CG    
719  C  CD    . ARG A 93  ? 0.5790 0.5787 0.7639 -0.0438 0.2129  0.1120  92  ARG F CD    
720  N  NE    . ARG A 93  ? 0.5467 0.5329 0.6883 -0.0370 0.2090  0.1102  92  ARG F NE    
721  C  CZ    . ARG A 93  ? 0.6091 0.6027 0.7388 -0.0299 0.2157  0.0988  92  ARG F CZ    
722  N  NH1   . ARG A 93  ? 0.5812 0.5944 0.7389 -0.0267 0.2273  0.0880  92  ARG F NH1   
723  N  NH2   . ARG A 93  ? 0.5803 0.5612 0.6700 -0.0256 0.2101  0.0980  92  ARG F NH2   
724  N  N     . TYR A 94  ? 0.4532 0.4434 0.7556 -0.0614 0.1595  0.1232  93  TYR F N     
725  C  CA    . TYR A 94  ? 0.4962 0.5023 0.8428 -0.0676 0.1558  0.1208  93  TYR F CA    
726  C  C     . TYR A 94  ? 0.4822 0.4677 0.8326 -0.0741 0.1385  0.1264  93  TYR F C     
727  O  O     . TYR A 94  ? 0.5066 0.5014 0.8886 -0.0854 0.1382  0.1288  93  TYR F O     
728  C  CB    . TYR A 94  ? 0.4524 0.4778 0.8230 -0.0555 0.1492  0.1072  93  TYR F CB    
729  C  CG    . TYR A 94  ? 0.4803 0.5279 0.8567 -0.0501 0.1671  0.1003  93  TYR F CG    
730  C  CD1   . TYR A 94  ? 0.4767 0.5170 0.8194 -0.0407 0.1714  0.0959  93  TYR F CD1   
731  C  CD2   . TYR A 94  ? 0.4710 0.5473 0.8865 -0.0541 0.1797  0.0976  93  TYR F CD2   
732  C  CE1   . TYR A 94  ? 0.5169 0.5743 0.8622 -0.0353 0.1879  0.0884  93  TYR F CE1   
733  C  CE2   . TYR A 94  ? 0.4586 0.5545 0.8790 -0.0470 0.1967  0.0900  93  TYR F CE2   
734  C  CZ    . TYR A 94  ? 0.4463 0.5308 0.8302 -0.0376 0.2008  0.0851  93  TYR F CZ    
735  O  OH    . TYR A 94  ? 0.5869 0.6875 0.9731 -0.0303 0.2175  0.0763  93  TYR F OH    
736  N  N     . THR A 95  ? 0.5049 0.4634 0.8244 -0.0670 0.1240  0.1279  94  THR F N     
737  C  CA    . THR A 95  ? 0.5149 0.4499 0.8336 -0.0706 0.1068  0.1315  94  THR F CA    
738  C  C     . THR A 95  ? 0.5394 0.4471 0.8178 -0.0599 0.0959  0.1337  94  THR F C     
739  O  O     . THR A 95  ? 0.5617 0.4743 0.8205 -0.0482 0.0969  0.1291  94  THR F O     
740  C  CB    . THR A 95  ? 0.4709 0.4171 0.8205 -0.0670 0.0921  0.1215  94  THR F CB    
741  O  OG1   . THR A 95  ? 0.5262 0.4467 0.8701 -0.0697 0.0755  0.1239  94  THR F OG1   
742  C  CG2   . THR A 95  ? 0.4781 0.4337 0.8211 -0.0507 0.0852  0.1105  94  THR F CG2   
743  N  N     . SER A 96  ? 0.5415 0.4204 0.8079 -0.0638 0.0850  0.1404  95  SER F N     
744  C  CA    . SER A 96  ? 0.4903 0.3439 0.7235 -0.0513 0.0716  0.1411  95  SER F CA    
745  C  C     . SER A 96  ? 0.5599 0.4118 0.8024 -0.0411 0.0531  0.1304  95  SER F C     
746  O  O     . SER A 96  ? 0.5408 0.3769 0.7597 -0.0286 0.0414  0.1287  95  SER F O     
747  C  CB    . SER A 96  ? 0.6713 0.4901 0.8822 -0.0591 0.0696  0.1544  95  SER F CB    
748  O  OG    . SER A 96  ? 0.7944 0.6012 1.0259 -0.0705 0.0625  0.1556  95  SER F OG    
749  N  N     . ARG A 97  ? 0.4319 0.3016 0.7082 -0.0458 0.0502  0.1231  96  ARG F N     
750  C  CA    . ARG A 97  ? 0.5087 0.3779 0.7937 -0.0378 0.0331  0.1130  96  ARG F CA    
751  C  C     . ARG A 97  ? 0.3793 0.2715 0.6639 -0.0253 0.0323  0.1035  96  ARG F C     
752  O  O     . ARG A 97  ? 0.3433 0.2585 0.6533 -0.0268 0.0341  0.0972  96  ARG F O     
753  C  CB    . ARG A 97  ? 0.4815 0.3580 0.8012 -0.0497 0.0288  0.1104  96  ARG F CB    
754  C  CG    . ARG A 97  ? 0.5747 0.4353 0.8964 -0.0657 0.0319  0.1193  96  ARG F CG    
755  C  CD    . ARG A 97  ? 0.4805 0.3106 0.7825 -0.0640 0.0153  0.1172  96  ARG F CD    
756  N  NE    . ARG A 97  ? 0.4629 0.3000 0.7797 -0.0613 0.0005  0.1056  96  ARG F NE    
757  C  CZ    . ARG A 97  ? 0.6282 0.4556 0.9311 -0.0477 -0.0128 0.0975  96  ARG F CZ    
758  N  NH1   . ARG A 97  ? 0.7281 0.5405 1.0038 -0.0343 -0.0137 0.0992  96  ARG F NH1   
759  N  NH2   . ARG A 97  ? 0.4629 0.2972 0.7782 -0.0472 -0.0253 0.0876  96  ARG F NH2   
760  N  N     . ILE A 98  ? 0.3921 0.2773 0.6472 -0.0131 0.0287  0.1028  97  ILE F N     
761  C  CA    . ILE A 98  ? 0.3558 0.2607 0.6046 -0.0032 0.0291  0.0957  97  ILE F CA    
762  C  C     . ILE A 98  ? 0.3764 0.2752 0.6078 0.0096  0.0142  0.0903  97  ILE F C     
763  O  O     . ILE A 98  ? 0.4184 0.2999 0.6254 0.0159  0.0103  0.0948  97  ILE F O     
764  C  CB    . ILE A 98  ? 0.3912 0.3001 0.6196 -0.0023 0.0426  0.1007  97  ILE F CB    
765  C  CG1   . ILE A 98  ? 0.3928 0.3094 0.6365 -0.0145 0.0596  0.1059  97  ILE F CG1   
766  C  CG2   . ILE A 98  ? 0.3525 0.2797 0.5731 0.0066  0.0415  0.0926  97  ILE F CG2   
767  C  CD1   . ILE A 98  ? 0.4433 0.3553 0.6605 -0.0158 0.0727  0.1134  97  ILE F CD1   
768  N  N     . GLU A 99  ? 0.3316 0.2457 0.5748 0.0138  0.0063  0.0809  98  GLU F N     
769  C  CA    . GLU A 99  ? 0.3560 0.2703 0.5838 0.0254  -0.0061 0.0750  98  GLU F CA    
770  C  C     . GLU A 99  ? 0.3287 0.2650 0.5511 0.0300  -0.0041 0.0702  98  GLU F C     
771  O  O     . GLU A 99  ? 0.3180 0.2692 0.5566 0.0278  -0.0064 0.0640  98  GLU F O     
772  C  CB    . GLU A 99  ? 0.3493 0.2604 0.5909 0.0255  -0.0187 0.0683  98  GLU F CB    
773  C  CG    . GLU A 99  ? 0.3503 0.2652 0.5764 0.0377  -0.0300 0.0613  98  GLU F CG    
774  C  CD    . GLU A 99  ? 0.5517 0.4613 0.7879 0.0376  -0.0418 0.0544  98  GLU F CD    
775  O  OE1   . GLU A 99  ? 0.4673 0.3642 0.7187 0.0284  -0.0427 0.0562  98  GLU F OE1   
776  O  OE2   . GLU A 99  ? 0.5611 0.4801 0.7895 0.0456  -0.0500 0.0471  98  GLU F OE2   
777  N  N     . PRO A 100 ? 0.3670 0.3050 0.5663 0.0354  -0.0005 0.0732  99  PRO F N     
778  C  CA    . PRO A 100 ? 0.3933 0.3508 0.5859 0.0381  0.0002  0.0683  99  PRO F CA    
779  C  C     . PRO A 100 ? 0.3451 0.3127 0.5364 0.0447  -0.0127 0.0611  99  PRO F C     
780  O  O     . PRO A 100 ? 0.3932 0.3533 0.5760 0.0522  -0.0208 0.0608  99  PRO F O     
781  C  CB    . PRO A 100 ? 0.4624 0.4172 0.6288 0.0418  0.0052  0.0740  99  PRO F CB    
782  C  CG    . PRO A 100 ? 0.5589 0.4917 0.7199 0.0395  0.0097  0.0832  99  PRO F CG    
783  C  CD    . PRO A 100 ? 0.3648 0.2861 0.5419 0.0388  0.0019  0.0815  99  PRO F CD    
784  N  N     . LEU A 101 ? 0.3873 0.3708 0.5871 0.0420  -0.0143 0.0553  100 LEU F N     
785  C  CA    . LEU A 101 ? 0.4258 0.4214 0.6232 0.0463  -0.0253 0.0490  100 LEU F CA    
786  C  C     . LEU A 101 ? 0.4599 0.4717 0.6396 0.0490  -0.0262 0.0476  100 LEU F C     
787  O  O     . LEU A 101 ? 0.4927 0.5175 0.6675 0.0526  -0.0344 0.0432  100 LEU F O     
788  C  CB    . LEU A 101 ? 0.3718 0.3730 0.5894 0.0403  -0.0290 0.0444  100 LEU F CB    
789  C  CG    . LEU A 101 ? 0.4339 0.4223 0.6716 0.0361  -0.0293 0.0456  100 LEU F CG    
790  C  CD1   . LEU A 101 ? 0.5501 0.5461 0.8094 0.0298  -0.0312 0.0425  100 LEU F CD1   
791  C  CD2   . LEU A 101 ? 0.4592 0.4386 0.6927 0.0412  -0.0392 0.0432  100 LEU F CD2   
792  N  N     . SER A 102 ? 0.4072 0.4192 0.5769 0.0464  -0.0177 0.0509  101 SER F N     
793  C  CA    . SER A 102 ? 0.3932 0.4195 0.5459 0.0464  -0.0183 0.0496  101 SER F CA    
794  C  C     . SER A 102 ? 0.3310 0.3499 0.4742 0.0428  -0.0072 0.0537  101 SER F C     
795  O  O     . SER A 102 ? 0.3486 0.3538 0.4995 0.0407  0.0009  0.0574  101 SER F O     
796  C  CB    . SER A 102 ? 0.3904 0.4295 0.5493 0.0408  -0.0228 0.0439  101 SER F CB    
797  O  OG    . SER A 102 ? 0.4232 0.4553 0.5957 0.0342  -0.0167 0.0426  101 SER F OG    
798  N  N     . LEU A 103 ? 0.3622 0.3904 0.4878 0.0411  -0.0064 0.0528  102 LEU F N     
799  C  CA    . LEU A 103 ? 0.3034 0.3245 0.4170 0.0371  0.0044  0.0552  102 LEU F CA    
800  C  C     . LEU A 103 ? 0.2836 0.2961 0.4143 0.0315  0.0143  0.0531  102 LEU F C     
801  O  O     . LEU A 103 ? 0.3450 0.3477 0.4749 0.0300  0.0254  0.0568  102 LEU F O     
802  C  CB    . LEU A 103 ? 0.3163 0.3488 0.4107 0.0338  0.0021  0.0521  102 LEU F CB    
803  C  CG    . LEU A 103 ? 0.3233 0.3672 0.3982 0.0390  -0.0056 0.0553  102 LEU F CG    
804  C  CD1   . LEU A 103 ? 0.4581 0.5123 0.5148 0.0326  -0.0070 0.0522  102 LEU F CD1   
805  C  CD2   . LEU A 103 ? 0.4122 0.4439 0.4758 0.0444  -0.0013 0.0631  102 LEU F CD2   
806  N  N     . ASP A 104 ? 0.2623 0.2794 0.4087 0.0286  0.0106  0.0474  103 ASP F N     
807  C  CA    . ASP A 104 ? 0.3172 0.3291 0.4774 0.0247  0.0192  0.0440  103 ASP F CA    
808  C  C     . ASP A 104 ? 0.3489 0.3579 0.5386 0.0247  0.0198  0.0443  103 ASP F C     
809  O  O     . ASP A 104 ? 0.3093 0.3173 0.5152 0.0228  0.0247  0.0409  103 ASP F O     
810  C  CB    . ASP A 104 ? 0.2935 0.3094 0.4490 0.0213  0.0147  0.0377  103 ASP F CB    
811  C  CG    . ASP A 104 ? 0.3183 0.3380 0.4927 0.0204  0.0045  0.0350  103 ASP F CG    
812  O  OD1   . ASP A 104 ? 0.3663 0.3910 0.5472 0.0226  -0.0036 0.0368  103 ASP F OD1   
813  O  OD2   . ASP A 104 ? 0.3499 0.3660 0.5312 0.0178  0.0045  0.0308  103 ASP F OD2   
814  N  N     . GLU A 105 ? 0.2642 0.2713 0.4616 0.0268  0.0142  0.0478  104 GLU F N     
815  C  CA    . GLU A 105 ? 0.2420 0.2470 0.4673 0.0251  0.0130  0.0476  104 GLU F CA    
816  C  C     . GLU A 105 ? 0.2977 0.2942 0.5265 0.0259  0.0121  0.0530  104 GLU F C     
817  O  O     . GLU A 105 ? 0.2804 0.2724 0.4907 0.0299  0.0085  0.0561  104 GLU F O     
818  C  CB    . GLU A 105 ? 0.3027 0.3142 0.5389 0.0249  0.0007  0.0428  104 GLU F CB    
819  C  CG    . GLU A 105 ? 0.5286 0.5428 0.7566 0.0280  -0.0114 0.0424  104 GLU F CG    
820  C  CD    . GLU A 105 ? 0.6524 0.6735 0.8888 0.0263  -0.0225 0.0380  104 GLU F CD    
821  O  OE1   . GLU A 105 ? 0.6098 0.6352 0.8425 0.0236  -0.0234 0.0354  104 GLU F OE1   
822  O  OE2   . GLU A 105 ? 0.8278 0.8482 1.0727 0.0272  -0.0307 0.0371  104 GLU F OE2   
823  N  N     . ALA A 106 ? 0.2962 0.2900 0.5498 0.0219  0.0148  0.0541  105 ALA F N     
824  C  CA    . ALA A 106 ? 0.2922 0.2748 0.5500 0.0202  0.0143  0.0595  105 ALA F CA    
825  C  C     . ALA A 106 ? 0.2499 0.2341 0.5387 0.0147  0.0120  0.0586  105 ALA F C     
826  O  O     . ALA A 106 ? 0.2928 0.2874 0.6016 0.0123  0.0162  0.0559  105 ALA F O     
827  C  CB    . ALA A 106 ? 0.2861 0.2605 0.5322 0.0176  0.0276  0.0667  105 ALA F CB    
828  N  N     . TYR A 107 ? 0.2615 0.2349 0.5537 0.0133  0.0042  0.0605  106 TYR F N     
829  C  CA    . TYR A 107 ? 0.2629 0.2350 0.5825 0.0057  0.0028  0.0616  106 TYR F CA    
830  C  C     . TYR A 107 ? 0.3239 0.2878 0.6458 -0.0014 0.0150  0.0696  106 TYR F C     
831  O  O     . TYR A 107 ? 0.3638 0.3132 0.6623 0.0003  0.0177  0.0749  106 TYR F O     
832  C  CB    . TYR A 107 ? 0.2539 0.2156 0.5736 0.0064  -0.0122 0.0590  106 TYR F CB    
833  C  CG    . TYR A 107 ? 0.2445 0.2156 0.5664 0.0105  -0.0246 0.0515  106 TYR F CG    
834  C  CD1   . TYR A 107 ? 0.2483 0.2332 0.5935 0.0072  -0.0267 0.0486  106 TYR F CD1   
835  C  CD2   . TYR A 107 ? 0.3231 0.2897 0.6238 0.0178  -0.0343 0.0476  106 TYR F CD2   
836  C  CE1   . TYR A 107 ? 0.2902 0.2816 0.6349 0.0099  -0.0387 0.0430  106 TYR F CE1   
837  C  CE2   . TYR A 107 ? 0.3603 0.3364 0.6612 0.0201  -0.0449 0.0414  106 TYR F CE2   
838  C  CZ    . TYR A 107 ? 0.4186 0.4059 0.7404 0.0154  -0.0472 0.0396  106 TYR F CZ    
839  O  OH    . TYR A 107 ? 0.4035 0.3986 0.7233 0.0167  -0.0580 0.0347  106 TYR F OH    
840  N  N     . LEU A 108 ? 0.3040 0.2781 0.6548 -0.0095 0.0219  0.0710  107 LEU F N     
841  C  CA    . LEU A 108 ? 0.3377 0.3072 0.6968 -0.0195 0.0331  0.0789  107 LEU F CA    
842  C  C     . LEU A 108 ? 0.2879 0.2580 0.6757 -0.0288 0.0254  0.0792  107 LEU F C     
843  O  O     . LEU A 108 ? 0.3847 0.3710 0.7980 -0.0288 0.0198  0.0738  107 LEU F O     
844  C  CB    . LEU A 108 ? 0.3091 0.2958 0.6785 -0.0216 0.0512  0.0801  107 LEU F CB    
845  C  CG    . LEU A 108 ? 0.4778 0.4607 0.8179 -0.0179 0.0639  0.0830  107 LEU F CG    
846  C  CD1   . LEU A 108 ? 0.4240 0.4029 0.7376 -0.0070 0.0559  0.0780  107 LEU F CD1   
847  C  CD2   . LEU A 108 ? 0.5478 0.5497 0.9032 -0.0196 0.0810  0.0814  107 LEU F CD2   
848  N  N     . ASP A 109 ? 0.3186 0.2701 0.7018 -0.0371 0.0239  0.0856  108 ASP F N     
849  C  CA    . ASP A 109 ? 0.3221 0.2749 0.7337 -0.0494 0.0184  0.0870  108 ASP F CA    
850  C  C     . ASP A 109 ? 0.4131 0.3781 0.8387 -0.0604 0.0352  0.0939  108 ASP F C     
851  O  O     . ASP A 109 ? 0.3769 0.3256 0.7845 -0.0666 0.0434  0.1025  108 ASP F O     
852  C  CB    . ASP A 109 ? 0.3807 0.3060 0.7731 -0.0512 0.0046  0.0872  108 ASP F CB    
853  C  CG    . ASP A 109 ? 0.4328 0.3634 0.8437 -0.0608 -0.0047 0.0842  108 ASP F CG    
854  O  OD1   . ASP A 109 ? 0.3898 0.3386 0.8232 -0.0700 0.0037  0.0871  108 ASP F OD1   
855  O  OD2   . ASP A 109 ? 0.4344 0.3513 0.8362 -0.0588 -0.0204 0.0786  108 ASP F OD2   
856  N  N     . VAL A 110 ? 0.3392 0.3328 0.7942 -0.0618 0.0399  0.0901  109 VAL F N     
857  C  CA    . VAL A 110 ? 0.3883 0.3988 0.8573 -0.0705 0.0566  0.0950  109 VAL F CA    
858  C  C     . VAL A 110 ? 0.4021 0.4224 0.8923 -0.0803 0.0498  0.0943  109 VAL F C     
859  O  O     . VAL A 110 ? 0.4000 0.4437 0.9112 -0.0855 0.0604  0.0951  109 VAL F O     
860  C  CB    . VAL A 110 ? 0.3898 0.4262 0.8733 -0.0627 0.0703  0.0908  109 VAL F CB    
861  C  CG1   . VAL A 110 ? 0.4295 0.4554 0.8883 -0.0553 0.0787  0.0923  109 VAL F CG1   
862  C  CG2   . VAL A 110 ? 0.3855 0.4375 0.8898 -0.0538 0.0582  0.0814  109 VAL F CG2   
863  N  N     . THR A 111 ? 0.4633 0.4662 0.9471 -0.0831 0.0322  0.0925  110 THR F N     
864  C  CA    . THR A 111 ? 0.5172 0.5265 1.0179 -0.0943 0.0249  0.0925  110 THR F CA    
865  C  C     . THR A 111 ? 0.4978 0.5081 0.9991 -0.1099 0.0385  0.1013  110 THR F C     
866  O  O     . THR A 111 ? 0.5207 0.5555 1.0464 -0.1178 0.0441  0.1019  110 THR F O     
867  C  CB    . THR A 111 ? 0.5161 0.5007 1.0022 -0.0956 0.0053  0.0894  110 THR F CB    
868  O  OG1   . THR A 111 ? 0.5103 0.4954 0.9939 -0.0819 -0.0066 0.0814  110 THR F OG1   
869  C  CG2   . THR A 111 ? 0.5042 0.4958 1.0075 -0.1083 -0.0026 0.0890  110 THR F CG2   
870  N  N     . ASP A 112 ? 0.4898 0.4732 0.9626 -0.1145 0.0434  0.1087  111 ASP F N     
871  C  CA    . ASP A 112 ? 0.7471 0.7257 1.2136 -0.1307 0.0553  0.1184  111 ASP F CA    
872  C  C     . ASP A 112 ? 0.6760 0.6717 1.1425 -0.1303 0.0775  0.1234  111 ASP F C     
873  O  O     . ASP A 112 ? 0.7025 0.6902 1.1552 -0.1427 0.0889  0.1327  111 ASP F O     
874  C  CB    . ASP A 112 ? 0.8759 0.8118 1.3071 -0.1360 0.0482  0.1246  111 ASP F CB    
875  C  CG    . ASP A 112 ? 0.9148 0.8308 1.3416 -0.1365 0.0272  0.1187  111 ASP F CG    
876  O  OD1   . ASP A 112 ? 0.9805 0.9135 1.4312 -0.1434 0.0205  0.1144  111 ASP F OD1   
877  O  OD2   . ASP A 112 ? 0.8561 0.7394 1.2542 -0.1292 0.0175  0.1180  111 ASP F OD2   
878  N  N     . SER A 113 ? 0.5215 0.5388 1.0003 -0.1166 0.0838  0.1172  112 SER F N     
879  C  CA    . SER A 113 ? 0.6191 0.6524 1.0957 -0.1152 0.1053  0.1202  112 SER F CA    
880  C  C     . SER A 113 ? 0.7591 0.8260 1.2634 -0.1241 0.1176  0.1200  112 SER F C     
881  O  O     . SER A 113 ? 0.7850 0.8710 1.3172 -0.1249 0.1091  0.1145  112 SER F O     
882  C  CB    . SER A 113 ? 0.7248 0.7672 1.2025 -0.0976 0.1078  0.1127  112 SER F CB    
883  O  OG    . SER A 113 ? 0.6928 0.7503 1.1665 -0.0961 0.1293  0.1144  112 SER F OG    
884  N  N     . VAL A 114 ? 0.7533 0.8277 1.2478 -0.1308 0.1377  0.1263  113 VAL F N     
885  C  CA    . VAL A 114 ? 0.7847 0.8943 1.3028 -0.1379 0.1531  0.1258  113 VAL F CA    
886  C  C     . VAL A 114 ? 0.8540 0.9775 1.3634 -0.1288 0.1736  0.1239  113 VAL F C     
887  O  O     . VAL A 114 ? 0.9857 1.1124 1.4803 -0.1387 0.1908  0.1310  113 VAL F O     
888  C  CB    . VAL A 114 ? 0.8582 0.9641 1.3710 -0.1606 0.1579  0.1363  113 VAL F CB    
889  C  CG1   . VAL A 114 ? 0.8763 1.0243 1.4199 -0.1688 0.1708  0.1347  113 VAL F CG1   
890  C  CG2   . VAL A 114 ? 0.8516 0.9315 1.3609 -0.1698 0.1369  0.1387  113 VAL F CG2   
891  N  N     . HIS A 115 ? 0.7500 0.8803 1.2656 -0.1105 0.1719  0.1142  114 HIS F N     
892  C  CA    . HIS A 115 ? 0.6751 0.8144 1.1785 -0.1007 0.1902  0.1106  114 HIS F CA    
893  C  C     . HIS A 115 ? 0.6978 0.8707 1.2298 -0.0896 0.1972  0.0994  114 HIS F C     
894  O  O     . HIS A 115 ? 0.7945 0.9843 1.3227 -0.0876 0.2169  0.0973  114 HIS F O     
895  C  CB    . HIS A 115 ? 0.5342 0.6483 1.0120 -0.0887 0.1844  0.1091  114 HIS F CB    
896  C  CG    . HIS A 115 ? 0.7401 0.8249 1.1797 -0.0963 0.1884  0.1204  114 HIS F CG    
897  N  ND1   . HIS A 115 ? 0.8649 0.9480 1.2775 -0.0964 0.2072  0.1240  114 HIS F ND1   
898  C  CD2   . HIS A 115 ? 0.8120 0.8663 1.2331 -0.1032 0.1751  0.1289  114 HIS F CD2   
899  C  CE1   . HIS A 115 ? 0.9494 1.0021 1.3285 -0.1031 0.2047  0.1354  114 HIS F CE1   
900  N  NE2   . HIS A 115 ? 0.8740 0.9081 1.2580 -0.1068 0.1852  0.1384  114 HIS F NE2   
901  N  N     . CYS A 116 ? 0.5125 0.6937 1.0702 -0.0814 0.1814  0.0920  115 CYS F N     
902  C  CA    . CYS A 116 ? 0.5167 0.7270 1.1011 -0.0700 0.1855  0.0819  115 CYS F CA    
903  C  C     . CYS A 116 ? 0.5085 0.7368 1.1255 -0.0753 0.1726  0.0812  115 CYS F C     
904  O  O     . CYS A 116 ? 0.5617 0.7956 1.1964 -0.0644 0.1591  0.0740  115 CYS F O     
905  C  CB    . CYS A 116 ? 0.5731 0.7738 1.1517 -0.0512 0.1787  0.0724  115 CYS F CB    
906  S  SG    . CYS A 116 ? 0.6227 0.8030 1.1619 -0.0449 0.1927  0.0723  115 CYS F SG    
907  N  N     . HIS A 117 ? 0.5606 0.7967 1.1836 -0.0935 0.1762  0.0893  116 HIS F N     
908  C  CA    . HIS A 117 ? 0.6034 0.8564 1.2552 -0.1024 0.1644  0.0900  116 HIS F CA    
909  C  C     . HIS A 117 ? 0.6642 0.8933 1.3139 -0.1006 0.1393  0.0892  116 HIS F C     
910  O  O     . HIS A 117 ? 0.7229 0.9647 1.3961 -0.0986 0.1257  0.0852  116 HIS F O     
911  C  CB    . HIS A 117 ? 0.6168 0.9077 1.3017 -0.0931 0.1691  0.0820  116 HIS F CB    
912  C  CG    . HIS A 117 ? 0.7383 1.0533 1.4238 -0.0905 0.1939  0.0801  116 HIS F CG    
913  N  ND1   . HIS A 117 ? 0.7582 1.0695 1.4305 -0.0735 0.2038  0.0727  116 HIS F ND1   
914  C  CD2   . HIS A 117 ? 0.7903 1.1335 1.4859 -0.1035 0.2111  0.0843  116 HIS F CD2   
915  C  CE1   . HIS A 117 ? 0.7888 1.1242 1.4625 -0.0749 0.2260  0.0718  116 HIS F CE1   
916  N  NE2   . HIS A 117 ? 0.8122 1.1685 1.5004 -0.0930 0.2312  0.0790  116 HIS F NE2   
917  N  N     . GLY A 118 ? 0.6459 0.8407 1.2662 -0.1009 0.1330  0.0929  117 GLY F N     
918  C  CA    . GLY A 118 ? 0.5380 0.7100 1.1528 -0.0972 0.1102  0.0909  117 GLY F CA    
919  C  C     . GLY A 118 ? 0.4380 0.6119 1.0593 -0.0789 0.0999  0.0815  117 GLY F C     
920  O  O     . GLY A 118 ? 0.4098 0.5680 1.0274 -0.0756 0.0807  0.0792  117 GLY F O     
921  N  N     . SER A 119 ? 0.4221 0.6132 1.0508 -0.0671 0.1119  0.0758  118 SER F N     
922  C  CA    . SER A 119 ? 0.4077 0.5968 1.0388 -0.0504 0.1021  0.0673  118 SER F CA    
923  C  C     . SER A 119 ? 0.4070 0.5690 1.0087 -0.0436 0.0990  0.0668  118 SER F C     
924  O  O     . SER A 119 ? 0.3736 0.5324 0.9591 -0.0409 0.1145  0.0674  118 SER F O     
925  C  CB    . SER A 119 ? 0.3975 0.6115 1.0442 -0.0401 0.1157  0.0610  118 SER F CB    
926  O  OG    . SER A 119 ? 0.4525 0.6557 1.0891 -0.0246 0.1106  0.0538  118 SER F OG    
927  N  N     . ALA A 120 ? 0.2597 0.4038 0.8538 -0.0409 0.0792  0.0654  119 ALA F N     
928  C  CA    . ALA A 120 ? 0.3239 0.4469 0.8929 -0.0339 0.0749  0.0641  119 ALA F CA    
929  C  C     . ALA A 120 ? 0.3905 0.5179 0.9577 -0.0198 0.0776  0.0564  119 ALA F C     
930  O  O     . ALA A 120 ? 0.3827 0.4996 0.9298 -0.0144 0.0827  0.0552  119 ALA F O     
931  C  CB    . ALA A 120 ? 0.2895 0.3944 0.8505 -0.0353 0.0532  0.0642  119 ALA F CB    
932  N  N     . THR A 121 ? 0.3914 0.5340 0.9786 -0.0142 0.0742  0.0514  120 THR F N     
933  C  CA    . THR A 121 ? 0.3572 0.5025 0.9423 -0.0012 0.0773  0.0439  120 THR F CA    
934  C  C     . THR A 121 ? 0.3979 0.5500 0.9757 0.0020  0.0999  0.0426  120 THR F C     
935  O  O     . THR A 121 ? 0.3070 0.4488 0.8666 0.0102  0.1034  0.0383  120 THR F O     
936  C  CB    . THR A 121 ? 0.3700 0.5324 0.9802 0.0036  0.0713  0.0399  120 THR F CB    
937  O  OG1   . THR A 121 ? 0.3496 0.5036 0.9624 0.0010  0.0499  0.0409  120 THR F OG1   
938  C  CG2   . THR A 121 ? 0.3319 0.4953 0.9393 0.0175  0.0748  0.0321  120 THR F CG2   
939  N  N     . LEU A 122 ? 0.3054 0.4744 0.8948 -0.0056 0.1156  0.0463  121 LEU F N     
940  C  CA    . LEU A 122 ? 0.3833 0.5604 0.9639 -0.0034 0.1386  0.0449  121 LEU F CA    
941  C  C     . LEU A 122 ? 0.3350 0.4943 0.8867 -0.0090 0.1467  0.0506  121 LEU F C     
942  O  O     . LEU A 122 ? 0.4447 0.6015 0.9788 -0.0034 0.1613  0.0474  121 LEU F O     
943  C  CB    . LEU A 122 ? 0.4539 0.6576 1.0554 -0.0107 0.1530  0.0472  121 LEU F CB    
944  C  CG    . LEU A 122 ? 0.3665 0.5948 0.9968 -0.0023 0.1522  0.0404  121 LEU F CG    
945  C  CD1   . LEU A 122 ? 0.3559 0.6145 1.0062 -0.0107 0.1685  0.0431  121 LEU F CD1   
946  C  CD2   . LEU A 122 ? 0.4406 0.6664 1.0636 0.0146  0.1570  0.0303  121 LEU F CD2   
947  N  N     . ILE A 123 ? 0.3706 0.5170 0.9159 -0.0199 0.1377  0.0589  122 ILE F N     
948  C  CA    . ILE A 123 ? 0.3179 0.4450 0.8345 -0.0243 0.1425  0.0650  122 ILE F CA    
949  C  C     . ILE A 123 ? 0.2901 0.4049 0.7900 -0.0129 0.1363  0.0593  122 ILE F C     
950  O  O     . ILE A 123 ? 0.3822 0.4867 0.8526 -0.0104 0.1462  0.0594  122 ILE F O     
951  C  CB    . ILE A 123 ? 0.3226 0.4346 0.8350 -0.0365 0.1305  0.0741  122 ILE F CB    
952  C  CG1   . ILE A 123 ? 0.4024 0.5237 0.9241 -0.0503 0.1396  0.0811  122 ILE F CG1   
953  C  CG2   . ILE A 123 ? 0.2506 0.3384 0.7315 -0.0381 0.1300  0.0799  122 ILE F CG2   
954  C  CD1   . ILE A 123 ? 0.4410 0.5466 0.9613 -0.0620 0.1250  0.0881  122 ILE F CD1   
955  N  N     . ALA A 124 ? 0.2175 0.3292 0.7263 -0.0061 0.1172  0.0539  123 ALA F N     
956  C  CA    . ALA A 124 ? 0.3042 0.4047 0.7968 0.0037  0.1092  0.0485  123 ALA F CA    
957  C  C     . ALA A 124 ? 0.2622 0.3677 0.7492 0.0139  0.1226  0.0405  123 ALA F C     
958  O  O     . ALA A 124 ? 0.3028 0.3924 0.7542 0.0180  0.1241  0.0376  123 ALA F O     
959  C  CB    . ALA A 124 ? 0.2935 0.3886 0.7934 0.0071  0.0860  0.0450  123 ALA F CB    
960  N  N     . GLN A 125 ? 0.2642 0.3842 0.7703 0.0177  0.1283  0.0357  124 GLN F N     
961  C  CA    . GLN A 125 ? 0.3241 0.4481 0.8248 0.0280  0.1422  0.0271  124 GLN F CA    
962  C  C     . GLN A 125 ? 0.3839 0.5083 0.8647 0.0248  0.1650  0.0292  124 GLN F C     
963  O  O     . GLN A 125 ? 0.4026 0.5168 0.8587 0.0319  0.1725  0.0229  124 GLN F O     
964  C  CB    . GLN A 125 ? 0.2800 0.4230 0.8074 0.0323  0.1449  0.0225  124 GLN F CB    
965  C  CG    . GLN A 125 ? 0.5623 0.7097 1.0862 0.0445  0.1584  0.0124  124 GLN F CG    
966  C  CD    . GLN A 125 ? 0.7300 0.8678 1.2560 0.0563  0.1431  0.0047  124 GLN F CD    
967  O  OE1   . GLN A 125 ? 0.5082 0.6274 1.0204 0.0565  0.1272  0.0054  124 GLN F OE1   
968  N  NE2   . GLN A 125 ? 0.8411 0.9919 1.3838 0.0659  0.1477  -0.0022 124 GLN F NE2   
969  N  N     . GLU A 126 ? 0.3410 0.4725 0.8243 0.0128  0.1741  0.0382  125 GLU F N     
970  C  CA    . GLU A 126 ? 0.3953 0.5257 0.8546 0.0079  0.1956  0.0415  125 GLU F CA    
971  C  C     . GLU A 126 ? 0.3805 0.4822 0.7906 0.0068  0.1870  0.0441  125 GLU F C     
972  O  O     . GLU A 126 ? 0.3677 0.4607 0.7452 0.0096  0.1979  0.0408  125 GLU F O     
973  C  CB    . GLU A 126 ? 0.4100 0.5509 0.8790 -0.0063 0.2034  0.0516  125 GLU F CB    
974  C  CG    . GLU A 126 ? 0.6443 0.7949 1.0994 -0.0100 0.2276  0.0524  125 GLU F CG    
975  C  CD    . GLU A 126 ? 0.6560 0.8165 1.1202 -0.0255 0.2328  0.0628  125 GLU F CD    
976  O  OE1   . GLU A 126 ? 0.7016 0.8839 1.1966 -0.0268 0.2315  0.0606  125 GLU F OE1   
977  O  OE2   . GLU A 126 ? 0.6296 0.7750 1.0692 -0.0367 0.2370  0.0737  125 GLU F OE2   
978  N  N     . ILE A 127 ? 0.3879 0.4758 0.7924 0.0030  0.1674  0.0496  126 ILE F N     
979  C  CA    . ILE A 127 ? 0.3929 0.4573 0.7556 0.0037  0.1569  0.0514  126 ILE F CA    
980  C  C     . ILE A 127 ? 0.3771 0.4343 0.7227 0.0141  0.1523  0.0410  126 ILE F C     
981  O  O     . ILE A 127 ? 0.3737 0.4183 0.6823 0.0152  0.1553  0.0398  126 ILE F O     
982  C  CB    . ILE A 127 ? 0.3089 0.3631 0.6743 -0.0003 0.1366  0.0572  126 ILE F CB    
983  C  CG1   . ILE A 127 ? 0.4423 0.4941 0.8108 -0.0120 0.1407  0.0685  126 ILE F CG1   
984  C  CG2   . ILE A 127 ? 0.2756 0.3112 0.6048 0.0041  0.1229  0.0561  126 ILE F CG2   
985  C  CD1   . ILE A 127 ? 0.3574 0.4018 0.7385 -0.0159 0.1221  0.0724  126 ILE F CD1   
986  N  N     . ARG A 128 ? 0.3897 0.4534 0.7606 0.0212  0.1439  0.0338  127 ARG F N     
987  C  CA    . ARG A 128 ? 0.3743 0.4275 0.7276 0.0298  0.1386  0.0245  127 ARG F CA    
988  C  C     . ARG A 128 ? 0.4506 0.5040 0.7882 0.0343  0.1579  0.0176  127 ARG F C     
989  O  O     . ARG A 128 ? 0.4807 0.5190 0.7841 0.0366  0.1569  0.0127  127 ARG F O     
990  C  CB    . ARG A 128 ? 0.3484 0.4065 0.7317 0.0366  0.1260  0.0192  127 ARG F CB    
991  C  CG    . ARG A 128 ? 0.2936 0.3466 0.6814 0.0331  0.1044  0.0239  127 ARG F CG    
992  C  CD    . ARG A 128 ? 0.4137 0.4668 0.8209 0.0399  0.0907  0.0185  127 ARG F CD    
993  N  NE    . ARG A 128 ? 0.5916 0.6617 1.0370 0.0460  0.0984  0.0149  127 ARG F NE    
994  C  CZ    . ARG A 128 ? 0.5387 0.6078 0.9883 0.0559  0.1039  0.0064  127 ARG F CZ    
995  N  NH1   . ARG A 128 ? 0.4879 0.5384 0.9074 0.0605  0.1032  0.0004  127 ARG F NH1   
996  N  NH2   . ARG A 128 ? 0.5374 0.6199 1.0094 0.0589  0.1071  0.0040  127 ARG F NH2   
997  N  N     . GLN A 129 ? 0.3904 0.4618 0.7516 0.0347  0.1760  0.0168  128 GLN F N     
998  C  CA    . GLN A 129 ? 0.4406 0.5140 0.7874 0.0398  0.1963  0.0090  128 GLN F CA    
999  C  C     . GLN A 129 ? 0.4439 0.5063 0.7479 0.0322  0.2055  0.0141  128 GLN F C     
1000 O  O     . GLN A 129 ? 0.4492 0.5000 0.7209 0.0358  0.2121  0.0068  128 GLN F O     
1001 C  CB    . GLN A 129 ? 0.4686 0.5689 0.8544 0.0422  0.2141  0.0071  128 GLN F CB    
1002 C  CG    . GLN A 129 ? 0.5216 0.6265 0.8964 0.0499  0.2362  -0.0033 128 GLN F CG    
1003 C  CD    . GLN A 129 ? 0.5750 0.6660 0.9438 0.0641  0.2301  -0.0171 128 GLN F CD    
1004 O  OE1   . GLN A 129 ? 0.6537 0.7487 1.0532 0.0722  0.2182  -0.0207 128 GLN F OE1   
1005 N  NE2   . GLN A 129 ? 0.5666 0.6394 0.8942 0.0666  0.2370  -0.0245 128 GLN F NE2   
1006 N  N     . THR A 130 ? 0.4189 0.4829 0.7205 0.0214  0.2052  0.0265  129 THR F N     
1007 C  CA    . THR A 130 ? 0.5036 0.5554 0.7635 0.0144  0.2114  0.0332  129 THR F CA    
1008 C  C     . THR A 130 ? 0.4965 0.5277 0.7196 0.0167  0.1958  0.0311  129 THR F C     
1009 O  O     . THR A 130 ? 0.5186 0.5399 0.7044 0.0164  0.2024  0.0288  129 THR F O     
1010 C  CB    . THR A 130 ? 0.4529 0.5060 0.7182 0.0031  0.2104  0.0476  129 THR F CB    
1011 O  OG1   . THR A 130 ? 0.5276 0.6025 0.8291 -0.0011 0.2250  0.0498  129 THR F OG1   
1012 C  CG2   . THR A 130 ? 0.4637 0.5033 0.6857 -0.0034 0.2171  0.0555  129 THR F CG2   
1013 N  N     . ILE A 131 ? 0.3716 0.3976 0.6041 0.0183  0.1750  0.0320  130 ILE F N     
1014 C  CA    . ILE A 131 ? 0.4118 0.4228 0.6133 0.0198  0.1599  0.0300  130 ILE F CA    
1015 C  C     . ILE A 131 ? 0.4922 0.4967 0.6766 0.0256  0.1645  0.0177  130 ILE F C     
1016 O  O     . ILE A 131 ? 0.4928 0.4861 0.6399 0.0240  0.1633  0.0160  130 ILE F O     
1017 C  CB    . ILE A 131 ? 0.3989 0.4090 0.6176 0.0209  0.1387  0.0315  130 ILE F CB    
1018 C  CG1   . ILE A 131 ? 0.3170 0.3278 0.5431 0.0153  0.1323  0.0428  130 ILE F CG1   
1019 C  CG2   . ILE A 131 ? 0.3373 0.3363 0.5283 0.0226  0.1242  0.0273  130 ILE F CG2   
1020 C  CD1   . ILE A 131 ? 0.3902 0.4018 0.6357 0.0168  0.1132  0.0429  130 ILE F CD1   
1021 N  N     . PHE A 132 ? 0.4344 0.4450 0.6454 0.0325  0.1692  0.0088  131 PHE F N     
1022 C  CA    . PHE A 132 ? 0.4522 0.4527 0.6461 0.0388  0.1739  -0.0037 131 PHE F CA    
1023 C  C     . PHE A 132 ? 0.5473 0.5467 0.7145 0.0378  0.1944  -0.0067 131 PHE F C     
1024 O  O     . PHE A 132 ? 0.6006 0.5853 0.7315 0.0378  0.1947  -0.0131 131 PHE F O     
1025 C  CB    . PHE A 132 ? 0.4590 0.4651 0.6881 0.0485  0.1745  -0.0124 131 PHE F CB    
1026 C  CG    . PHE A 132 ? 0.4969 0.4885 0.7084 0.0562  0.1789  -0.0260 131 PHE F CG    
1027 C  CD1   . PHE A 132 ? 0.5452 0.5161 0.7263 0.0543  0.1647  -0.0300 131 PHE F CD1   
1028 C  CD2   . PHE A 132 ? 0.6181 0.6167 0.8426 0.0652  0.1976  -0.0353 131 PHE F CD2   
1029 C  CE1   . PHE A 132 ? 0.6494 0.6028 0.8117 0.0604  0.1679  -0.0430 131 PHE F CE1   
1030 C  CE2   . PHE A 132 ? 0.6680 0.6497 0.8742 0.0735  0.2016  -0.0492 131 PHE F CE2   
1031 C  CZ    . PHE A 132 ? 0.6466 0.6035 0.8207 0.0707  0.1862  -0.0530 131 PHE F CZ    
1032 N  N     . ASN A 133 ? 0.4922 0.5073 0.6753 0.0355  0.2117  -0.0019 132 ASN F N     
1033 C  CA    . ASN A 133 ? 0.5227 0.5384 0.6801 0.0342  0.2330  -0.0048 132 ASN F CA    
1034 C  C     . ASN A 133 ? 0.6176 0.6193 0.7281 0.0260  0.2292  0.0022  132 ASN F C     
1035 O  O     . ASN A 133 ? 0.6539 0.6463 0.7289 0.0261  0.2384  -0.0043 132 ASN F O     
1036 C  CB    . ASN A 133 ? 0.5662 0.6040 0.7510 0.0311  0.2521  0.0009  132 ASN F CB    
1037 C  CG    . ASN A 133 ? 0.5562 0.6116 0.7845 0.0409  0.2605  -0.0083 132 ASN F CG    
1038 O  OD1   . ASN A 133 ? 0.5991 0.6469 0.8307 0.0517  0.2560  -0.0206 132 ASN F OD1   
1039 N  ND2   . ASN A 133 ? 0.4949 0.5742 0.7575 0.0371  0.2723  -0.0019 132 ASN F ND2   
1040 N  N     . GLU A 134 ? 0.5512 0.5510 0.6602 0.0195  0.2151  0.0149  133 GLU F N     
1041 C  CA    . GLU A 134 ? 0.5074 0.4965 0.5753 0.0127  0.2118  0.0233  133 GLU F CA    
1042 C  C     . GLU A 134 ? 0.5804 0.5568 0.6239 0.0133  0.1914  0.0211  133 GLU F C     
1043 O  O     . GLU A 134 ? 0.5967 0.5642 0.6012 0.0096  0.1896  0.0237  133 GLU F O     
1044 C  CB    . GLU A 134 ? 0.5089 0.5018 0.5856 0.0056  0.2101  0.0392  133 GLU F CB    
1045 C  CG    . GLU A 134 ? 0.6030 0.6092 0.6990 0.0010  0.2312  0.0440  133 GLU F CG    
1046 C  CD    . GLU A 134 ? 0.7180 0.7223 0.8168 -0.0080 0.2282  0.0607  133 GLU F CD    
1047 O  OE1   . GLU A 134 ? 0.5733 0.5644 0.6536 -0.0089 0.2112  0.0681  133 GLU F OE1   
1048 O  OE2   . GLU A 134 ? 0.6396 0.6556 0.7596 -0.0140 0.2425  0.0663  133 GLU F OE2   
1049 N  N     . LEU A 135 ? 0.5656 0.5420 0.6303 0.0171  0.1757  0.0171  134 LEU F N     
1050 C  CA    . LEU A 135 ? 0.5327 0.5005 0.5762 0.0162  0.1569  0.0156  134 LEU F CA    
1051 C  C     . LEU A 135 ? 0.4988 0.4583 0.5385 0.0197  0.1526  0.0022  134 LEU F C     
1052 O  O     . LEU A 135 ? 0.5419 0.4945 0.5608 0.0168  0.1381  0.0005  134 LEU F O     
1053 C  CB    . LEU A 135 ? 0.5677 0.5406 0.6314 0.0157  0.1391  0.0235  134 LEU F CB    
1054 C  CG    . LEU A 135 ? 0.6116 0.5864 0.6692 0.0123  0.1369  0.0371  134 LEU F CG    
1055 C  CD1   . LEU A 135 ? 0.5924 0.5744 0.6848 0.0119  0.1434  0.0428  134 LEU F CD1   
1056 C  CD2   . LEU A 135 ? 0.6015 0.5762 0.6517 0.0126  0.1166  0.0409  134 LEU F CD2   
1057 N  N     . GLN A 136 ? 0.4934 0.4531 0.5523 0.0257  0.1642  -0.0072 135 GLN F N     
1058 C  CA    . GLN A 136 ? 0.6418 0.5896 0.7000 0.0303  0.1590  -0.0199 135 GLN F CA    
1059 C  C     . GLN A 136 ? 0.5949 0.5409 0.6660 0.0289  0.1371  -0.0176 135 GLN F C     
1060 O  O     . GLN A 136 ? 0.5493 0.4823 0.6029 0.0270  0.1262  -0.0238 135 GLN F O     
1061 C  CB    . GLN A 136 ? 0.7402 0.6717 0.7545 0.0279  0.1620  -0.0288 135 GLN F CB    
1062 C  CG    . GLN A 136 ? 0.8734 0.8062 0.8581 0.0243  0.1774  -0.0264 135 GLN F CG    
1063 C  CD    . GLN A 136 ? 1.0912 1.0359 1.0963 0.0289  0.1995  -0.0264 135 GLN F CD    
1064 O  OE1   . GLN A 136 ? 1.1688 1.1154 1.1976 0.0373  0.2087  -0.0359 135 GLN F OE1   
1065 N  NE2   . GLN A 136 ? 1.1150 1.0685 1.1119 0.0234  0.2081  -0.0152 135 GLN F NE2   
1066 N  N     . LEU A 137 ? 0.4832 0.4420 0.5831 0.0287  0.1306  -0.0084 136 LEU F N     
1067 C  CA    . LEU A 137 ? 0.3619 0.3220 0.4775 0.0277  0.1116  -0.0057 136 LEU F CA    
1068 C  C     . LEU A 137 ? 0.4585 0.4285 0.6171 0.0330  0.1130  -0.0042 136 LEU F C     
1069 O  O     . LEU A 137 ? 0.4618 0.4424 0.6377 0.0343  0.1259  -0.0007 136 LEU F O     
1070 C  CB    . LEU A 137 ? 0.3475 0.3139 0.4509 0.0218  0.0995  0.0045  136 LEU F CB    
1071 C  CG    . LEU A 137 ? 0.4871 0.4486 0.5502 0.0164  0.0961  0.0052  136 LEU F CG    
1072 C  CD1   . LEU A 137 ? 0.3831 0.3539 0.4402 0.0138  0.0869  0.0160  136 LEU F CD1   
1073 C  CD2   . LEU A 137 ? 0.4344 0.3864 0.4814 0.0131  0.0847  -0.0024 136 LEU F CD2   
1074 N  N     . THR A 138 ? 0.4321 0.3996 0.6080 0.0349  0.0994  -0.0063 137 THR F N     
1075 C  CA    . THR A 138 ? 0.4195 0.3974 0.6363 0.0397  0.0988  -0.0045 137 THR F CA    
1076 C  C     . THR A 138 ? 0.3844 0.3703 0.6141 0.0354  0.0840  0.0042  137 THR F C     
1077 O  O     . THR A 138 ? 0.3426 0.3248 0.5530 0.0306  0.0713  0.0069  137 THR F O     
1078 C  CB    . THR A 138 ? 0.4119 0.3819 0.6450 0.0470  0.0946  -0.0128 137 THR F CB    
1079 O  OG1   . THR A 138 ? 0.4476 0.4058 0.6683 0.0434  0.0761  -0.0129 137 THR F OG1   
1080 C  CG2   . THR A 138 ? 0.4454 0.4058 0.6667 0.0535  0.1099  -0.0233 137 THR F CG2   
1081 N  N     . ALA A 139 ? 0.3554 0.3533 0.6186 0.0371  0.0859  0.0080  138 ALA F N     
1082 C  CA    . ALA A 139 ? 0.3090 0.3135 0.5862 0.0335  0.0732  0.0153  138 ALA F CA    
1083 C  C     . ALA A 139 ? 0.2942 0.3059 0.6089 0.0373  0.0676  0.0141  138 ALA F C     
1084 O  O     . ALA A 139 ? 0.3090 0.3260 0.6444 0.0429  0.0775  0.0098  138 ALA F O     
1085 C  CB    . ALA A 139 ? 0.3183 0.3291 0.5947 0.0291  0.0807  0.0232  138 ALA F CB    
1086 N  N     . SER A 140 ? 0.2438 0.2569 0.5669 0.0348  0.0514  0.0177  139 SER F N     
1087 C  CA    . SER A 140 ? 0.2372 0.2584 0.5953 0.0369  0.0439  0.0183  139 SER F CA    
1088 C  C     . SER A 140 ? 0.3206 0.3507 0.6933 0.0316  0.0412  0.0251  139 SER F C     
1089 O  O     . SER A 140 ? 0.2441 0.2709 0.5974 0.0273  0.0427  0.0293  139 SER F O     
1090 C  CB    . SER A 140 ? 0.2975 0.3107 0.6522 0.0378  0.0261  0.0165  139 SER F CB    
1091 O  OG    . SER A 140 ? 0.2847 0.2866 0.6278 0.0424  0.0287  0.0102  139 SER F OG    
1092 N  N     . ALA A 141 ? 0.2690 0.3095 0.6761 0.0321  0.0369  0.0261  140 ALA F N     
1093 C  CA    . ALA A 141 ? 0.2882 0.3348 0.7083 0.0257  0.0345  0.0320  140 ALA F CA    
1094 C  C     . ALA A 141 ? 0.2785 0.3261 0.7126 0.0225  0.0191  0.0319  140 ALA F C     
1095 O  O     . ALA A 141 ? 0.2820 0.3303 0.7230 0.0253  0.0148  0.0281  140 ALA F O     
1096 C  CB    . ALA A 141 ? 0.2285 0.2848 0.6624 0.0227  0.0523  0.0350  140 ALA F CB    
1097 N  N     . GLY A 142 ? 0.2612 0.3068 0.6957 0.0166  0.0104  0.0357  141 GLY F N     
1098 C  CA    . GLY A 142 ? 0.2013 0.2460 0.6458 0.0123  -0.0029 0.0357  141 GLY F CA    
1099 C  C     . GLY A 142 ? 0.1947 0.2440 0.6574 0.0064  -0.0001 0.0402  141 GLY F C     
1100 O  O     . GLY A 142 ? 0.2201 0.2686 0.6807 0.0037  0.0061  0.0443  141 GLY F O     
1101 N  N     . VAL A 143 ? 0.1623 0.2167 0.6436 0.0040  -0.0050 0.0400  142 VAL F N     
1102 C  CA    . VAL A 143 ? 0.2609 0.3210 0.7610 -0.0027 -0.0032 0.0441  142 VAL F CA    
1103 C  C     . VAL A 143 ? 0.2316 0.2867 0.7343 -0.0057 -0.0209 0.0433  142 VAL F C     
1104 O  O     . VAL A 143 ? 0.2804 0.3377 0.7873 -0.0029 -0.0283 0.0405  142 VAL F O     
1105 C  CB    . VAL A 143 ? 0.2213 0.2985 0.7450 -0.0029 0.0111  0.0447  142 VAL F CB    
1106 C  CG1   . VAL A 143 ? 0.2584 0.3425 0.7993 -0.0124 0.0129  0.0496  142 VAL F CG1   
1107 C  CG2   . VAL A 143 ? 0.2194 0.3012 0.7378 0.0007  0.0297  0.0446  142 VAL F CG2   
1108 N  N     . ALA A 144 ? 0.2368 0.2852 0.7374 -0.0113 -0.0275 0.0459  143 ALA F N     
1109 C  CA    . ALA A 144 ? 0.2345 0.2766 0.7334 -0.0138 -0.0445 0.0445  143 ALA F CA    
1110 C  C     . ALA A 144 ? 0.3140 0.3522 0.8172 -0.0215 -0.0470 0.0476  143 ALA F C     
1111 O  O     . ALA A 144 ? 0.2673 0.3040 0.7698 -0.0252 -0.0363 0.0512  143 ALA F O     
1112 C  CB    . ALA A 144 ? 0.2111 0.2406 0.6844 -0.0099 -0.0562 0.0409  143 ALA F CB    
1113 N  N     . PRO A 145 ? 0.2820 0.3166 0.7871 -0.0253 -0.0610 0.0464  144 PRO F N     
1114 C  CA    . PRO A 145 ? 0.3097 0.3372 0.8150 -0.0341 -0.0645 0.0484  144 PRO F CA    
1115 C  C     . PRO A 145 ? 0.3607 0.3706 0.8427 -0.0331 -0.0704 0.0466  144 PRO F C     
1116 O  O     . PRO A 145 ? 0.3276 0.3262 0.8047 -0.0404 -0.0716 0.0482  144 PRO F O     
1117 C  CB    . PRO A 145 ? 0.3046 0.3348 0.8189 -0.0383 -0.0783 0.0467  144 PRO F CB    
1118 C  CG    . PRO A 145 ? 0.2824 0.3251 0.8079 -0.0327 -0.0782 0.0455  144 PRO F CG    
1119 C  CD    . PRO A 145 ? 0.3550 0.3932 0.8652 -0.0238 -0.0724 0.0438  144 PRO F CD    
1120 N  N     . VAL A 146 ? 0.2638 0.2697 0.7297 -0.0252 -0.0745 0.0432  145 VAL F N     
1121 C  CA    . VAL A 146 ? 0.2659 0.2575 0.7104 -0.0236 -0.0809 0.0405  145 VAL F CA    
1122 C  C     . VAL A 146 ? 0.2812 0.2750 0.7151 -0.0169 -0.0745 0.0401  145 VAL F C     
1123 O  O     . VAL A 146 ? 0.2174 0.2214 0.6557 -0.0130 -0.0683 0.0405  145 VAL F O     
1124 C  CB    . VAL A 146 ? 0.3122 0.2965 0.7448 -0.0228 -0.0983 0.0347  145 VAL F CB    
1125 C  CG1   . VAL A 146 ? 0.3036 0.2839 0.7444 -0.0308 -0.1057 0.0346  145 VAL F CG1   
1126 C  CG2   . VAL A 146 ? 0.3006 0.2914 0.7281 -0.0171 -0.1029 0.0325  145 VAL F CG2   
1127 N  N     . LYS A 147 ? 0.2570 0.2360 0.6703 -0.0150 -0.0761 0.0387  146 LYS F N     
1128 C  CA    . LYS A 147 ? 0.2784 0.2601 0.6690 -0.0058 -0.0681 0.0386  146 LYS F CA    
1129 C  C     . LYS A 147 ? 0.2855 0.2808 0.6753 -0.0015 -0.0735 0.0352  146 LYS F C     
1130 O  O     . LYS A 147 ? 0.2385 0.2419 0.6261 0.0006  -0.0641 0.0364  146 LYS F O     
1131 C  CB    . LYS A 147 ? 0.2800 0.2457 0.6396 0.0004  -0.0708 0.0364  146 LYS F CB    
1132 C  CG    . LYS A 147 ? 0.3229 0.2734 0.6738 -0.0003 -0.0614 0.0417  146 LYS F CG    
1133 C  CD    . LYS A 147 ? 0.3656 0.3023 0.6863 0.0092  -0.0664 0.0384  146 LYS F CD    
1134 C  CE    . LYS A 147 ? 0.4043 0.3253 0.7095 0.0118  -0.0577 0.0444  146 LYS F CE    
1135 N  NZ    . LYS A 147 ? 0.4471 0.3600 0.7245 0.0241  -0.0630 0.0405  146 LYS F NZ    
1136 N  N     . PHE A 148 ? 0.2673 0.2601 0.6466 -0.0024 -0.0867 0.0301  147 PHE F N     
1137 C  CA    . PHE A 148 ? 0.2618 0.2584 0.6183 -0.0006 -0.0882 0.0268  147 PHE F CA    
1138 C  C     . PHE A 148 ? 0.3228 0.3231 0.6889 -0.0027 -0.0849 0.0284  147 PHE F C     
1139 O  O     . PHE A 148 ? 0.2221 0.2263 0.5769 -0.0007 -0.0807 0.0281  147 PHE F O     
1140 C  CB    . PHE A 148 ? 0.2135 0.2057 0.5527 -0.0003 -0.1013 0.0216  147 PHE F CB    
1141 C  CG    . PHE A 148 ? 0.3356 0.3238 0.6817 -0.0046 -0.1107 0.0207  147 PHE F CG    
1142 C  CD1   . PHE A 148 ? 0.2592 0.2413 0.6225 -0.0077 -0.1172 0.0209  147 PHE F CD1   
1143 C  CD2   . PHE A 148 ? 0.3732 0.3633 0.7063 -0.0048 -0.1140 0.0202  147 PHE F CD2   
1144 C  CE1   . PHE A 148 ? 0.2906 0.2709 0.6565 -0.0102 -0.1260 0.0205  147 PHE F CE1   
1145 C  CE2   . PHE A 148 ? 0.3450 0.3320 0.6824 -0.0073 -0.1230 0.0203  147 PHE F CE2   
1146 C  CZ    . PHE A 148 ? 0.3122 0.2950 0.6654 -0.0098 -0.1288 0.0203  147 PHE F CZ    
1147 N  N     . LEU A 149 ? 0.2697 0.2691 0.6572 -0.0056 -0.0869 0.0302  148 LEU F N     
1148 C  CA    . LEU A 149 ? 0.2509 0.2552 0.6497 -0.0055 -0.0838 0.0314  148 LEU F CA    
1149 C  C     . LEU A 149 ? 0.2758 0.2875 0.6838 -0.0033 -0.0690 0.0335  148 LEU F C     
1150 O  O     . LEU A 149 ? 0.2932 0.3083 0.7001 -0.0010 -0.0659 0.0326  148 LEU F O     
1151 C  CB    . LEU A 149 ? 0.2277 0.2334 0.6477 -0.0082 -0.0891 0.0328  148 LEU F CB    
1152 C  CG    . LEU A 149 ? 0.2897 0.2891 0.6987 -0.0097 -0.1044 0.0304  148 LEU F CG    
1153 C  CD1   . LEU A 149 ? 0.3102 0.3129 0.7394 -0.0131 -0.1108 0.0318  148 LEU F CD1   
1154 C  CD2   . LEU A 149 ? 0.2319 0.2302 0.6249 -0.0080 -0.1087 0.0291  148 LEU F CD2   
1155 N  N     . ALA A 150 ? 0.2886 0.3025 0.7060 -0.0037 -0.0601 0.0364  149 ALA F N     
1156 C  CA    . ALA A 150 ? 0.1968 0.2180 0.6206 -0.0011 -0.0448 0.0385  149 ALA F CA    
1157 C  C     . ALA A 150 ? 0.2409 0.2615 0.6407 0.0033  -0.0428 0.0363  149 ALA F C     
1158 O  O     . ALA A 150 ? 0.2236 0.2484 0.6242 0.0065  -0.0348 0.0355  149 ALA F O     
1159 C  CB    . ALA A 150 ? 0.1914 0.2142 0.6278 -0.0035 -0.0362 0.0433  149 ALA F CB    
1160 N  N     . LYS A 151 ? 0.2096 0.2253 0.5875 0.0041  -0.0503 0.0348  150 LYS F N     
1161 C  CA    . LYS A 151 ? 0.2746 0.2910 0.6287 0.0081  -0.0492 0.0332  150 LYS F CA    
1162 C  C     . LYS A 151 ? 0.3219 0.3382 0.6699 0.0074  -0.0551 0.0306  150 LYS F C     
1163 O  O     . LYS A 151 ? 0.2620 0.2801 0.6055 0.0102  -0.0502 0.0303  150 LYS F O     
1164 C  CB    . LYS A 151 ? 0.1645 0.1781 0.4979 0.0100  -0.0559 0.0321  150 LYS F CB    
1165 C  CG    . LYS A 151 ? 0.2954 0.3126 0.6056 0.0128  -0.0575 0.0304  150 LYS F CG    
1166 C  CD    . LYS A 151 ? 0.4251 0.4429 0.7189 0.0177  -0.0576 0.0307  150 LYS F CD    
1167 C  CE    . LYS A 151 ? 0.5048 0.5307 0.7817 0.0201  -0.0571 0.0304  150 LYS F CE    
1168 N  NZ    . LYS A 151 ? 0.5565 0.5812 0.8192 0.0238  -0.0474 0.0325  150 LYS F NZ    
1169 N  N     . ILE A 152 ? 0.2594 0.2721 0.6082 0.0041  -0.0662 0.0293  151 ILE F N     
1170 C  CA    . ILE A 152 ? 0.3163 0.3270 0.6632 0.0037  -0.0722 0.0284  151 ILE F CA    
1171 C  C     . ILE A 152 ? 0.3850 0.3991 0.7520 0.0061  -0.0643 0.0288  151 ILE F C     
1172 O  O     . ILE A 152 ? 0.3323 0.3456 0.6963 0.0086  -0.0638 0.0279  151 ILE F O     
1173 C  CB    . ILE A 152 ? 0.2725 0.2782 0.6186 0.0005  -0.0848 0.0279  151 ILE F CB    
1174 C  CG1   . ILE A 152 ? 0.2965 0.3004 0.6201 -0.0004 -0.0918 0.0263  151 ILE F CG1   
1175 C  CG2   . ILE A 152 ? 0.3221 0.3250 0.6704 0.0004  -0.0916 0.0283  151 ILE F CG2   
1176 C  CD1   . ILE A 152 ? 0.2852 0.2842 0.6068 -0.0028 -0.1032 0.0252  151 ILE F CD1   
1177 N  N     . ALA A 153 ? 0.1941 0.2123 0.5828 0.0057  -0.0578 0.0300  152 ALA F N     
1178 C  CA    . ALA A 153 ? 0.2999 0.3242 0.7091 0.0089  -0.0496 0.0297  152 ALA F CA    
1179 C  C     . ALA A 153 ? 0.3306 0.3570 0.7349 0.0139  -0.0374 0.0286  152 ALA F C     
1180 O  O     . ALA A 153 ? 0.2696 0.2976 0.6819 0.0185  -0.0336 0.0264  152 ALA F O     
1181 C  CB    . ALA A 153 ? 0.2732 0.3042 0.7070 0.0072  -0.0436 0.0318  152 ALA F CB    
1182 N  N     . SER A 154 ? 0.2022 0.2280 0.5935 0.0142  -0.0314 0.0298  153 SER F N     
1183 C  CA    . SER A 154 ? 0.2729 0.2996 0.6591 0.0195  -0.0194 0.0289  153 SER F CA    
1184 C  C     . SER A 154 ? 0.2573 0.2775 0.6279 0.0223  -0.0254 0.0262  153 SER F C     
1185 O  O     . SER A 154 ? 0.3170 0.3347 0.6866 0.0276  -0.0165 0.0240  153 SER F O     
1186 C  CB    . SER A 154 ? 0.3307 0.3580 0.7070 0.0199  -0.0126 0.0319  153 SER F CB    
1187 O  OG    . SER A 154 ? 0.3253 0.3485 0.6787 0.0191  -0.0225 0.0320  153 SER F OG    
1188 N  N     . ASP A 155 ? 0.2915 0.3076 0.6509 0.0186  -0.0400 0.0264  154 ASP F N     
1189 C  CA    . ASP A 155 ? 0.3817 0.3905 0.7294 0.0200  -0.0473 0.0252  154 ASP F CA    
1190 C  C     . ASP A 155 ? 0.4313 0.4358 0.7916 0.0228  -0.0504 0.0233  154 ASP F C     
1191 O  O     . ASP A 155 ? 0.4870 0.4816 0.8392 0.0255  -0.0540 0.0221  154 ASP F O     
1192 C  CB    . ASP A 155 ? 0.4121 0.4193 0.7429 0.0147  -0.0615 0.0270  154 ASP F CB    
1193 C  CG    . ASP A 155 ? 0.4798 0.4914 0.7936 0.0142  -0.0604 0.0282  154 ASP F CG    
1194 O  OD1   . ASP A 155 ? 0.6295 0.6409 0.9360 0.0165  -0.0490 0.0274  154 ASP F OD1   
1195 O  OD2   . ASP A 155 ? 0.6241 0.6384 0.9241 0.0101  -0.0695 0.0290  154 ASP F OD2   
1196 N  N     . MET A 156 ? 0.4111 0.4213 0.7906 0.0224  -0.0504 0.0232  155 MET F N     
1197 C  CA    . MET A 156 ? 0.3894 0.3961 0.7788 0.0251  -0.0578 0.0221  155 MET F CA    
1198 C  C     . MET A 156 ? 0.3857 0.3913 0.7858 0.0340  -0.0476 0.0183  155 MET F C     
1199 O  O     . MET A 156 ? 0.4144 0.4129 0.8169 0.0384  -0.0542 0.0169  155 MET F O     
1200 C  CB    . MET A 156 ? 0.4329 0.4457 0.8382 0.0217  -0.0639 0.0237  155 MET F CB    
1201 C  CG    . MET A 156 ? 0.4524 0.4613 0.8426 0.0143  -0.0754 0.0261  155 MET F CG    
1202 S  SD    . MET A 156 ? 0.6029 0.6159 1.0101 0.0109  -0.0812 0.0275  155 MET F SD    
1203 C  CE    . MET A 156 ? 0.5410 0.5552 0.9667 0.0163  -0.0868 0.0268  155 MET F CE    
1204 N  N     . ASN A 157 ? 0.3746 0.3851 0.7787 0.0376  -0.0316 0.0164  156 ASN F N     
1205 C  CA    . ASN A 157 ? 0.3387 0.3475 0.7510 0.0470  -0.0201 0.0115  156 ASN F CA    
1206 C  C     . ASN A 157 ? 0.3723 0.3726 0.7680 0.0501  -0.0085 0.0086  156 ASN F C     
1207 O  O     . ASN A 157 ? 0.4739 0.4771 0.8764 0.0565  0.0074  0.0045  156 ASN F O     
1208 C  CB    . ASN A 157 ? 0.4031 0.4283 0.8419 0.0494  -0.0093 0.0109  156 ASN F CB    
1209 C  CG    . ASN A 157 ? 0.4769 0.5041 0.9320 0.0580  -0.0102 0.0073  156 ASN F CG    
1210 O  OD1   . ASN A 157 ? 0.5335 0.5490 0.9815 0.0608  -0.0227 0.0066  156 ASN F OD1   
1211 N  ND2   . ASN A 157 ? 0.4208 0.4629 0.8976 0.0628  0.0030  0.0052  156 ASN F ND2   
1212 N  N     . LYS A 158 ? 0.3301 0.3198 0.7036 0.0458  -0.0159 0.0105  157 LYS F N     
1213 C  CA    . LYS A 158 ? 0.3468 0.3260 0.6992 0.0470  -0.0064 0.0077  157 LYS F CA    
1214 C  C     . LYS A 158 ? 0.3879 0.3454 0.7237 0.0502  -0.0103 0.0026  157 LYS F C     
1215 O  O     . LYS A 158 ? 0.3637 0.3121 0.7046 0.0513  -0.0245 0.0040  157 LYS F O     
1216 C  CB    . LYS A 158 ? 0.3967 0.3781 0.7230 0.0369  -0.0117 0.0120  157 LYS F CB    
1217 C  CG    . LYS A 158 ? 0.5018 0.4763 0.8131 0.0306  -0.0293 0.0148  157 LYS F CG    
1218 C  CD    . LYS A 158 ? 0.6172 0.6004 0.9082 0.0227  -0.0323 0.0185  157 LYS F CD    
1219 C  CE    . LYS A 158 ? 0.7210 0.7005 0.9943 0.0153  -0.0477 0.0209  157 LYS F CE    
1220 N  NZ    . LYS A 158 ? 0.6916 0.6830 0.9479 0.0096  -0.0503 0.0234  157 LYS F NZ    
1221 N  N     . PRO A 159 ? 0.3747 0.3222 0.6889 0.0513  0.0017  -0.0032 158 PRO F N     
1222 C  CA    . PRO A 159 ? 0.3416 0.2976 0.6451 0.0499  0.0185  -0.0047 158 PRO F CA    
1223 C  C     . PRO A 159 ? 0.3910 0.3585 0.7212 0.0591  0.0350  -0.0082 158 PRO F C     
1224 O  O     . PRO A 159 ? 0.3654 0.3313 0.7189 0.0688  0.0350  -0.0122 158 PRO F O     
1225 C  CB    . PRO A 159 ? 0.3324 0.2693 0.5993 0.0468  0.0208  -0.0102 158 PRO F CB    
1226 C  CG    . PRO A 159 ? 0.3672 0.2841 0.6382 0.0534  0.0137  -0.0154 158 PRO F CG    
1227 C  CD    . PRO A 159 ? 0.3414 0.2641 0.6373 0.0540  -0.0018 -0.0092 158 PRO F CD    
1228 N  N     . ASN A 160 ? 0.3133 0.2931 0.6403 0.0562  0.0487  -0.0062 159 ASN F N     
1229 C  CA    . ASN A 160 ? 0.3343 0.3259 0.6798 0.0625  0.0678  -0.0095 159 ASN F CA    
1230 C  C     . ASN A 160 ? 0.3843 0.3922 0.7751 0.0691  0.0663  -0.0084 159 ASN F C     
1231 O  O     . ASN A 160 ? 0.4096 0.4208 0.8177 0.0788  0.0740  -0.0146 159 ASN F O     
1232 C  CB    . ASN A 160 ? 0.3637 0.3411 0.6903 0.0692  0.0796  -0.0195 159 ASN F CB    
1233 C  CG    . ASN A 160 ? 0.4237 0.4147 0.7590 0.0734  0.1026  -0.0228 159 ASN F CG    
1234 O  OD1   . ASN A 160 ? 0.4495 0.4593 0.8006 0.0691  0.1099  -0.0163 159 ASN F OD1   
1235 N  ND2   . ASN A 160 ? 0.4316 0.4119 0.7546 0.0813  0.1143  -0.0331 159 ASN F ND2   
1236 N  N     . GLY A 161 ? 0.3038 0.3226 0.7113 0.0632  0.0553  -0.0007 160 GLY F N     
1237 C  CA    . GLY A 161 ? 0.3204 0.3534 0.7529 0.0620  0.0494  0.0015  160 GLY F CA    
1238 C  C     . GLY A 161 ? 0.3567 0.3986 0.7958 0.0518  0.0416  0.0095  160 GLY F C     
1239 O  O     . GLY A 161 ? 0.2971 0.3346 0.7211 0.0468  0.0392  0.0133  160 GLY F O     
1240 N  N     . GLN A 162 ? 0.3459 0.3997 0.8073 0.0493  0.0371  0.0117  161 GLN F N     
1241 C  CA    . GLN A 162 ? 0.3238 0.3827 0.7912 0.0398  0.0298  0.0182  161 GLN F CA    
1242 C  C     . GLN A 162 ? 0.3702 0.4319 0.8518 0.0379  0.0148  0.0190  161 GLN F C     
1243 O  O     . GLN A 162 ? 0.3002 0.3634 0.7909 0.0444  0.0118  0.0153  161 GLN F O     
1244 C  CB    . GLN A 162 ? 0.2082 0.2803 0.6895 0.0361  0.0459  0.0216  161 GLN F CB    
1245 C  CG    . GLN A 162 ? 0.2972 0.3858 0.8025 0.0402  0.0592  0.0189  161 GLN F CG    
1246 C  CD    . GLN A 162 ? 0.3417 0.4429 0.8556 0.0346  0.0770  0.0230  161 GLN F CD    
1247 O  OE1   . GLN A 162 ? 0.3749 0.4724 0.8734 0.0341  0.0896  0.0239  161 GLN F OE1   
1248 N  NE2   . GLN A 162 ? 0.3652 0.4813 0.9026 0.0295  0.0777  0.0261  161 GLN F NE2   
1249 N  N     . PHE A 163 ? 0.2256 0.2865 0.7074 0.0297  0.0047  0.0235  162 PHE F N     
1250 C  CA    . PHE A 163 ? 0.2056 0.2675 0.6980 0.0270  -0.0101 0.0245  162 PHE F CA    
1251 C  C     . PHE A 163 ? 0.2491 0.3156 0.7519 0.0192  -0.0120 0.0290  162 PHE F C     
1252 O  O     . PHE A 163 ? 0.2661 0.3264 0.7563 0.0146  -0.0113 0.0317  162 PHE F O     
1253 C  CB    . PHE A 163 ? 0.2420 0.2899 0.7131 0.0255  -0.0267 0.0241  162 PHE F CB    
1254 C  CG    . PHE A 163 ? 0.3829 0.4309 0.8632 0.0238  -0.0415 0.0249  162 PHE F CG    
1255 C  CD1   . PHE A 163 ? 0.4530 0.5055 0.9478 0.0304  -0.0440 0.0227  162 PHE F CD1   
1256 C  CD2   . PHE A 163 ? 0.3710 0.4136 0.8442 0.0167  -0.0532 0.0275  162 PHE F CD2   
1257 C  CE1   . PHE A 163 ? 0.5626 0.6155 1.0660 0.0293  -0.0581 0.0240  162 PHE F CE1   
1258 C  CE2   . PHE A 163 ? 0.4065 0.4485 0.8869 0.0154  -0.0668 0.0283  162 PHE F CE2   
1259 C  CZ    . PHE A 163 ? 0.5196 0.5671 1.0154 0.0213  -0.0694 0.0270  162 PHE F CZ    
1260 N  N     . VAL A 164 ? 0.1827 0.2598 0.7086 0.0182  -0.0155 0.0298  163 VAL F N     
1261 C  CA    . VAL A 164 ? 0.2760 0.3588 0.8151 0.0107  -0.0168 0.0338  163 VAL F CA    
1262 C  C     . VAL A 164 ? 0.3139 0.3918 0.8538 0.0076  -0.0352 0.0344  163 VAL F C     
1263 O  O     . VAL A 164 ? 0.2712 0.3541 0.8213 0.0114  -0.0421 0.0327  163 VAL F O     
1264 C  CB    . VAL A 164 ? 0.3371 0.4410 0.9045 0.0108  -0.0031 0.0346  163 VAL F CB    
1265 C  CG1   . VAL A 164 ? 0.3487 0.4586 0.9296 0.0013  -0.0061 0.0392  163 VAL F CG1   
1266 C  CG2   . VAL A 164 ? 0.3085 0.4168 0.8722 0.0137  0.0166  0.0339  163 VAL F CG2   
1267 N  N     . ILE A 165 ? 0.2754 0.3437 0.8048 0.0014  -0.0433 0.0367  164 ILE F N     
1268 C  CA    . ILE A 165 ? 0.3049 0.3688 0.8344 -0.0021 -0.0599 0.0372  164 ILE F CA    
1269 C  C     . ILE A 165 ? 0.3410 0.4144 0.8901 -0.0087 -0.0592 0.0402  164 ILE F C     
1270 O  O     . ILE A 165 ? 0.2223 0.2902 0.7651 -0.0133 -0.0563 0.0422  164 ILE F O     
1271 C  CB    . ILE A 165 ? 0.2430 0.2888 0.7431 -0.0035 -0.0709 0.0363  164 ILE F CB    
1272 C  CG1   . ILE A 165 ? 0.2883 0.3271 0.7691 0.0009  -0.0717 0.0337  164 ILE F CG1   
1273 C  CG2   . ILE A 165 ? 0.2815 0.3232 0.7807 -0.0070 -0.0872 0.0365  164 ILE F CG2   
1274 C  CD1   . ILE A 165 ? 0.2304 0.2554 0.6813 -0.0009 -0.0795 0.0328  164 ILE F CD1   
1275 N  N     . THR A 166 ? 0.2670 0.3328 0.7805 0.0280  -0.1235 -0.0562 165 THR F N     
1276 C  CA    . THR A 166 ? 0.2984 0.3746 0.8166 0.0256  -0.1179 -0.0559 165 THR F CA    
1277 C  C     . THR A 166 ? 0.3177 0.3836 0.8284 0.0217  -0.1243 -0.0491 165 THR F C     
1278 O  O     . THR A 166 ? 0.3124 0.3642 0.8166 0.0220  -0.1349 -0.0459 165 THR F O     
1279 C  CB    . THR A 166 ? 0.2465 0.3313 0.7807 0.0304  -0.1198 -0.0637 165 THR F CB    
1280 O  OG1   . THR A 166 ? 0.2977 0.3695 0.8330 0.0326  -0.1333 -0.0628 165 THR F OG1   
1281 C  CG2   . THR A 166 ? 0.3239 0.4172 0.8682 0.0358  -0.1159 -0.0727 165 THR F CG2   
1282 N  N     . PRO A 167 ? 0.4618 0.5350 0.9743 0.0178  -0.1185 -0.0473 166 PRO F N     
1283 C  CA    . PRO A 167 ? 0.2656 0.3305 0.7740 0.0143  -0.1253 -0.0432 166 PRO F CA    
1284 C  C     . PRO A 167 ? 0.2596 0.3166 0.7715 0.0170  -0.1397 -0.0448 166 PRO F C     
1285 O  O     . PRO A 167 ? 0.3364 0.3822 0.8402 0.0146  -0.1489 -0.0405 166 PRO F O     
1286 C  CB    . PRO A 167 ? 0.4428 0.5193 0.9578 0.0107  -0.1168 -0.0437 166 PRO F CB    
1287 C  CG    . PRO A 167 ? 0.3952 0.4821 0.9094 0.0099  -0.1037 -0.0429 166 PRO F CG    
1288 C  CD    . PRO A 167 ? 0.3856 0.4741 0.9018 0.0152  -0.1052 -0.0476 166 PRO F CD    
1289 N  N     . ALA A 168 ? 0.2971 0.3603 0.8214 0.0218  -0.1422 -0.0506 167 ALA F N     
1290 C  CA    . ALA A 168 ? 0.4393 0.4948 0.9678 0.0243  -0.1565 -0.0508 167 ALA F CA    
1291 C  C     . ALA A 168 ? 0.4460 0.4855 0.9648 0.0259  -0.1662 -0.0473 167 ALA F C     
1292 O  O     . ALA A 168 ? 0.4309 0.4603 0.9457 0.0250  -0.1791 -0.0432 167 ALA F O     
1293 C  CB    . ALA A 168 ? 0.4029 0.4692 0.9491 0.0297  -0.1565 -0.0575 167 ALA F CB    
1294 N  N     . GLU A 169 ? 0.3972 0.4344 0.9117 0.0276  -0.1609 -0.0481 168 GLU F N     
1295 C  CA    . GLU A 169 ? 0.3359 0.3581 0.8428 0.0289  -0.1702 -0.0449 168 GLU F CA    
1296 C  C     . GLU A 169 ? 0.3831 0.3954 0.8732 0.0235  -0.1727 -0.0361 168 GLU F C     
1297 O  O     . GLU A 169 ? 0.3155 0.3148 0.7979 0.0234  -0.1817 -0.0316 168 GLU F O     
1298 C  CB    . GLU A 169 ? 0.4553 0.4798 0.9667 0.0330  -0.1646 -0.0504 168 GLU F CB    
1299 C  CG    . GLU A 169 ? 0.5117 0.5484 1.0408 0.0386  -0.1605 -0.0602 168 GLU F CG    
1300 C  CD    . GLU A 169 ? 0.6123 0.6539 1.1456 0.0419  -0.1533 -0.0668 168 GLU F CD    
1301 O  OE1   . GLU A 169 ? 0.6797 0.7182 1.2236 0.0477  -0.1581 -0.0734 168 GLU F OE1   
1302 O  OE2   . GLU A 169 ? 0.5942 0.6428 1.1207 0.0385  -0.1432 -0.0653 168 GLU F OE2   
1303 N  N     . VAL A 170 ? 0.2841 0.3024 0.7695 0.0188  -0.1649 -0.0335 169 VAL F N     
1304 C  CA    . VAL A 170 ? 0.2861 0.2977 0.7581 0.0139  -0.1649 -0.0260 169 VAL F CA    
1305 C  C     . VAL A 170 ? 0.2849 0.2844 0.7480 0.0113  -0.1795 -0.0201 169 VAL F C     
1306 O  O     . VAL A 170 ? 0.2945 0.2850 0.7473 0.0094  -0.1839 -0.0139 169 VAL F O     
1307 C  CB    . VAL A 170 ? 0.3110 0.3319 0.7829 0.0096  -0.1530 -0.0252 169 VAL F CB    
1308 C  CG1   . VAL A 170 ? 0.2465 0.2612 0.7078 0.0042  -0.1547 -0.0183 169 VAL F CG1   
1309 C  CG2   . VAL A 170 ? 0.2606 0.2913 0.7357 0.0107  -0.1392 -0.0271 169 VAL F CG2   
1310 N  N     . PRO A 171 ? 0.3031 0.3022 0.7687 0.0103  -0.1880 -0.0209 170 PRO F N     
1311 C  CA    . PRO A 171 ? 0.3363 0.3244 0.7905 0.0064  -0.2028 -0.0143 170 PRO F CA    
1312 C  C     . PRO A 171 ? 0.3707 0.3461 0.8206 0.0091  -0.2137 -0.0098 170 PRO F C     
1313 O  O     . PRO A 171 ? 0.3359 0.3017 0.7721 0.0049  -0.2213 -0.0019 170 PRO F O     
1314 C  CB    . PRO A 171 ? 0.3808 0.3728 0.8406 0.0053  -0.2098 -0.0169 170 PRO F CB    
1315 C  CG    . PRO A 171 ? 0.4340 0.4393 0.9045 0.0056  -0.1962 -0.0234 170 PRO F CG    
1316 C  CD    . PRO A 171 ? 0.3188 0.3285 0.7957 0.0107  -0.1846 -0.0265 170 PRO F CD    
1317 N  N     . ALA A 172 ? 0.3542 0.3292 0.8158 0.0153  -0.2149 -0.0148 171 ALA F N     
1318 C  CA    . ALA A 172 ? 0.3520 0.3137 0.8116 0.0176  -0.2251 -0.0114 171 ALA F CA    
1319 C  C     . ALA A 172 ? 0.3037 0.2605 0.7557 0.0167  -0.2199 -0.0088 171 ALA F C     
1320 O  O     . ALA A 172 ? 0.4120 0.3559 0.8537 0.0143  -0.2291 -0.0012 171 ALA F O     
1321 C  CB    . ALA A 172 ? 0.3752 0.3392 0.8523 0.0243  -0.2266 -0.0190 171 ALA F CB    
1322 N  N     . PHE A 173 ? 0.3030 0.2704 0.7591 0.0178  -0.2054 -0.0139 172 PHE F N     
1323 C  CA    . PHE A 173 ? 0.3589 0.3237 0.8083 0.0163  -0.2003 -0.0108 172 PHE F CA    
1324 C  C     . PHE A 173 ? 0.3990 0.3584 0.8333 0.0099  -0.2037 -0.0002 172 PHE F C     
1325 O  O     . PHE A 173 ? 0.3597 0.3092 0.7855 0.0079  -0.2091 0.0065  172 PHE F O     
1326 C  CB    . PHE A 173 ? 0.3505 0.3296 0.8064 0.0176  -0.1844 -0.0169 172 PHE F CB    
1327 C  CG    . PHE A 173 ? 0.2594 0.2370 0.7108 0.0165  -0.1800 -0.0144 172 PHE F CG    
1328 C  CD1   . PHE A 173 ? 0.4145 0.3867 0.8715 0.0204  -0.1838 -0.0191 172 PHE F CD1   
1329 C  CD2   . PHE A 173 ? 0.2654 0.2470 0.7085 0.0114  -0.1731 -0.0074 172 PHE F CD2   
1330 C  CE1   . PHE A 173 ? 0.4483 0.4189 0.9017 0.0188  -0.1815 -0.0168 172 PHE F CE1   
1331 C  CE2   . PHE A 173 ? 0.3047 0.2857 0.7442 0.0097  -0.1703 -0.0040 172 PHE F CE2   
1332 C  CZ    . PHE A 173 ? 0.3089 0.2842 0.7532 0.0132  -0.1751 -0.0087 172 PHE F CZ    
1333 N  N     . LEU A 174 ? 0.3896 0.3558 0.8209 0.0060  -0.2010 0.0013  173 LEU F N     
1334 C  CA    . LEU A 174 ? 0.3043 0.2661 0.7175 -0.0014 -0.1997 0.0096  173 LEU F CA    
1335 C  C     . LEU A 174 ? 0.3362 0.2837 0.7341 -0.0052 -0.2141 0.0177  173 LEU F C     
1336 O  O     . LEU A 174 ? 0.3631 0.3029 0.7414 -0.0109 -0.2118 0.0257  173 LEU F O     
1337 C  CB    . LEU A 174 ? 0.3622 0.3311 0.7721 -0.0052 -0.1916 0.0067  173 LEU F CB    
1338 C  CG    . LEU A 174 ? 0.3604 0.3422 0.7806 -0.0040 -0.1756 0.0018  173 LEU F CG    
1339 C  CD1   . LEU A 174 ? 0.3286 0.3149 0.7488 -0.0074 -0.1716 -0.0019 173 LEU F CD1   
1340 C  CD2   . LEU A 174 ? 0.3737 0.3538 0.7821 -0.0067 -0.1644 0.0079  173 LEU F CD2   
1341 N  N     . GLN A 175 ? 0.3429 0.2879 0.7498 -0.0026 -0.2289 0.0167  174 GLN F N     
1342 C  CA    . GLN A 175 ? 0.3306 0.2639 0.7213 -0.0079 -0.2430 0.0253  174 GLN F CA    
1343 C  C     . GLN A 175 ? 0.3528 0.2729 0.7295 -0.0108 -0.2470 0.0350  174 GLN F C     
1344 O  O     . GLN A 175 ? 0.4396 0.3527 0.7931 -0.0188 -0.2482 0.0435  174 GLN F O     
1345 C  CB    . GLN A 175 ? 0.4343 0.3647 0.8359 -0.0038 -0.2559 0.0233  174 GLN F CB    
1346 C  CG    . GLN A 175 ? 0.4616 0.3839 0.8485 -0.0104 -0.2721 0.0323  174 GLN F CG    
1347 C  CD    . GLN A 175 ? 0.5338 0.4622 0.9057 -0.0187 -0.2688 0.0317  174 GLN F CD    
1348 O  OE1   . GLN A 175 ? 0.6378 0.5581 0.9845 -0.0272 -0.2729 0.0394  174 GLN F OE1   
1349 N  NE2   . GLN A 175 ? 0.4408 0.3814 0.8243 -0.0168 -0.2584 0.0219  174 GLN F NE2   
1350 N  N     . THR A 176 ? 0.3789 0.2958 0.7691 -0.0049 -0.2486 0.0333  175 THR F N     
1351 C  CA    . THR A 176 ? 0.5577 0.4611 0.9377 -0.0076 -0.2539 0.0421  175 THR F CA    
1352 C  C     . THR A 176 ? 0.4692 0.3758 0.8446 -0.0090 -0.2392 0.0416  175 THR F C     
1353 O  O     . THR A 176 ? 0.3505 0.2470 0.7197 -0.0114 -0.2428 0.0480  175 THR F O     
1354 C  CB    . THR A 176 ? 0.5240 0.4158 0.9131 -0.0033 -0.2628 0.0393  175 THR F CB    
1355 O  OG1   . THR A 176 ? 0.6044 0.5035 1.0103 0.0035  -0.2529 0.0267  175 THR F OG1   
1356 C  CG2   . THR A 176 ? 0.5779 0.4658 0.9692 -0.0029 -0.2747 0.0399  175 THR F CG2   
1357 N  N     . LEU A 177 ? 0.3802 0.3005 0.7589 -0.0083 -0.2237 0.0352  176 LEU F N     
1358 C  CA    . LEU A 177 ? 0.3410 0.2664 0.7169 -0.0099 -0.2103 0.0357  176 LEU F CA    
1359 C  C     . LEU A 177 ? 0.3634 0.2836 0.7174 -0.0184 -0.2066 0.0469  176 LEU F C     
1360 O  O     . LEU A 177 ? 0.3682 0.2919 0.7104 -0.0227 -0.2005 0.0493  176 LEU F O     
1361 C  CB    . LEU A 177 ? 0.4126 0.3541 0.7977 -0.0076 -0.1956 0.0279  176 LEU F CB    
1362 C  CG    . LEU A 177 ? 0.4559 0.4052 0.8380 -0.0100 -0.1810 0.0297  176 LEU F CG    
1363 C  CD1   . LEU A 177 ? 0.4438 0.3911 0.8329 -0.0076 -0.1830 0.0279  176 LEU F CD1   
1364 C  CD2   . LEU A 177 ? 0.4421 0.4062 0.8335 -0.0083 -0.1681 0.0236  176 LEU F CD2   
1365 N  N     . PRO A 178 ? 0.3809 0.2933 0.7295 -0.0213 -0.2094 0.0536  177 PRO F N     
1366 C  CA    . PRO A 178 ? 0.3752 0.2855 0.7050 -0.0296 -0.2045 0.0648  177 PRO F CA    
1367 C  C     . PRO A 178 ? 0.3567 0.2809 0.6844 -0.0311 -0.1866 0.0638  177 PRO F C     
1368 O  O     . PRO A 178 ? 0.4426 0.3767 0.7831 -0.0271 -0.1779 0.0575  177 PRO F O     
1369 C  CB    . PRO A 178 ? 0.4216 0.3237 0.7521 -0.0315 -0.2098 0.0698  177 PRO F CB    
1370 C  CG    . PRO A 178 ? 0.4331 0.3267 0.7787 -0.0246 -0.2224 0.0626  177 PRO F CG    
1371 C  CD    . PRO A 178 ? 0.4196 0.3252 0.7797 -0.0173 -0.2166 0.0506  177 PRO F CD    
1372 N  N     . LEU A 179 ? 0.3489 0.2739 0.6607 -0.0371 -0.1809 0.0704  178 LEU F N     
1373 C  CA    . LEU A 179 ? 0.3754 0.3122 0.6862 -0.0381 -0.1637 0.0702  178 LEU F CA    
1374 C  C     . LEU A 179 ? 0.3571 0.3004 0.6742 -0.0388 -0.1565 0.0746  178 LEU F C     
1375 O  O     . LEU A 179 ? 0.2976 0.2523 0.6241 -0.0364 -0.1445 0.0716  178 LEU F O     
1376 C  CB    . LEU A 179 ? 0.3340 0.2693 0.6258 -0.0445 -0.1590 0.0764  178 LEU F CB    
1377 C  CG    . LEU A 179 ? 0.3265 0.2569 0.6110 -0.0447 -0.1658 0.0711  178 LEU F CG    
1378 C  CD1   . LEU A 179 ? 0.3744 0.3019 0.6362 -0.0523 -0.1629 0.0770  178 LEU F CD1   
1379 C  CD2   . LEU A 179 ? 0.3132 0.2516 0.6105 -0.0394 -0.1580 0.0599  178 LEU F CD2   
1380 N  N     . ALA A 180 ? 0.3902 0.3260 0.7023 -0.0428 -0.1644 0.0822  179 ALA F N     
1381 C  CA    . ALA A 180 ? 0.4694 0.4112 0.7862 -0.0449 -0.1590 0.0870  179 ALA F CA    
1382 C  C     . ALA A 180 ? 0.4502 0.3988 0.7830 -0.0393 -0.1567 0.0780  179 ALA F C     
1383 O  O     . ALA A 180 ? 0.4214 0.3788 0.7588 -0.0410 -0.1498 0.0810  179 ALA F O     
1384 C  CB    . ALA A 180 ? 0.4872 0.4176 0.7967 -0.0506 -0.1704 0.0957  179 ALA F CB    
1385 N  N     . LYS A 181 ? 0.4422 0.3881 0.7837 -0.0331 -0.1623 0.0676  180 LYS F N     
1386 C  CA    . LYS A 181 ? 0.3454 0.2998 0.7014 -0.0281 -0.1585 0.0585  180 LYS F CA    
1387 C  C     . LYS A 181 ? 0.3411 0.3107 0.7036 -0.0265 -0.1441 0.0564  180 LYS F C     
1388 O  O     . LYS A 181 ? 0.3768 0.3565 0.7494 -0.0245 -0.1385 0.0522  180 LYS F O     
1389 C  CB    . LYS A 181 ? 0.5206 0.4690 0.8861 -0.0216 -0.1683 0.0481  180 LYS F CB    
1390 C  CG    . LYS A 181 ? 0.5570 0.4907 0.9221 -0.0215 -0.1822 0.0481  180 LYS F CG    
1391 C  CD    . LYS A 181 ? 0.6801 0.6167 1.0534 -0.0199 -0.1807 0.0418  180 LYS F CD    
1392 C  CE    . LYS A 181 ? 0.7533 0.6762 1.1343 -0.0151 -0.1937 0.0344  180 LYS F CE    
1393 N  NZ    . LYS A 181 ? 0.6982 0.6266 1.0901 -0.0111 -0.1903 0.0227  180 LYS F NZ    
1394 N  N     . ILE A 182 ? 0.3201 0.2913 0.6766 -0.0279 -0.1379 0.0594  181 ILE F N     
1395 C  CA    . ILE A 182 ? 0.3203 0.3038 0.6844 -0.0262 -0.1245 0.0574  181 ILE F CA    
1396 C  C     . ILE A 182 ? 0.3811 0.3742 0.7470 -0.0294 -0.1149 0.0659  181 ILE F C     
1397 O  O     . ILE A 182 ? 0.2817 0.2724 0.6383 -0.0339 -0.1140 0.0751  181 ILE F O     
1398 C  CB    . ILE A 182 ? 0.2960 0.2764 0.6527 -0.0270 -0.1207 0.0569  181 ILE F CB    
1399 C  CG1   . ILE A 182 ? 0.3551 0.3277 0.7110 -0.0246 -0.1315 0.0492  181 ILE F CG1   
1400 C  CG2   . ILE A 182 ? 0.3544 0.3453 0.7199 -0.0254 -0.1069 0.0553  181 ILE F CG2   
1401 C  CD1   . ILE A 182 ? 0.4059 0.3735 0.7498 -0.0272 -0.1302 0.0490  181 ILE F CD1   
1402 N  N     . PRO A 183 ? 0.4185 0.4236 0.7962 -0.0276 -0.1077 0.0643  182 PRO F N     
1403 C  CA    . PRO A 183 ? 0.4011 0.4168 0.7820 -0.0308 -0.0989 0.0739  182 PRO F CA    
1404 C  C     . PRO A 183 ? 0.3155 0.3328 0.6939 -0.0318 -0.0893 0.0802  182 PRO F C     
1405 O  O     . PRO A 183 ? 0.3591 0.3751 0.7393 -0.0290 -0.0842 0.0751  182 PRO F O     
1406 C  CB    . PRO A 183 ? 0.4622 0.4903 0.8563 -0.0285 -0.0932 0.0700  182 PRO F CB    
1407 C  CG    . PRO A 183 ? 0.4225 0.4461 0.8192 -0.0248 -0.1010 0.0582  182 PRO F CG    
1408 C  CD    . PRO A 183 ? 0.3595 0.3704 0.7490 -0.0232 -0.1073 0.0545  182 PRO F CD    
1409 N  N     . GLY A 184 ? 0.2693 0.2892 0.6435 -0.0360 -0.0868 0.0909  183 GLY F N     
1410 C  CA    . GLY A 184 ? 0.3078 0.3296 0.6795 -0.0369 -0.0771 0.0968  183 GLY F CA    
1411 C  C     . GLY A 184 ? 0.2682 0.2793 0.6236 -0.0402 -0.0819 0.0987  183 GLY F C     
1412 O  O     . GLY A 184 ? 0.3679 0.3820 0.7195 -0.0423 -0.0738 0.1050  183 GLY F O     
1413 N  N     . VAL A 185 ? 0.2908 0.2904 0.6372 -0.0409 -0.0947 0.0938  184 VAL F N     
1414 C  CA    . VAL A 185 ? 0.3124 0.3013 0.6425 -0.0453 -0.1019 0.0974  184 VAL F CA    
1415 C  C     . VAL A 185 ? 0.2578 0.2448 0.5856 -0.0502 -0.1102 0.1055  184 VAL F C     
1416 O  O     . VAL A 185 ? 0.3861 0.3661 0.7155 -0.0495 -0.1214 0.1016  184 VAL F O     
1417 C  CB    . VAL A 185 ? 0.3359 0.3128 0.6591 -0.0433 -0.1123 0.0886  184 VAL F CB    
1418 C  CG1   . VAL A 185 ? 0.3337 0.3000 0.6393 -0.0488 -0.1208 0.0943  184 VAL F CG1   
1419 C  CG2   . VAL A 185 ? 0.3541 0.3333 0.6805 -0.0393 -0.1045 0.0799  184 VAL F CG2   
1420 N  N     . GLY A 186 ? 0.2849 0.2783 0.6101 -0.0552 -0.1045 0.1166  185 GLY F N     
1421 C  CA    . GLY A 186 ? 0.2802 0.2724 0.6033 -0.0614 -0.1119 0.1256  185 GLY F CA    
1422 C  C     . GLY A 186 ? 0.3160 0.2982 0.6235 -0.0677 -0.1190 0.1324  185 GLY F C     
1423 O  O     . GLY A 186 ? 0.2935 0.2683 0.5901 -0.0671 -0.1204 0.1291  185 GLY F O     
1424 N  N     . LYS A 187 ? 0.3367 0.3193 0.6426 -0.0747 -0.1239 0.1428  186 LYS F N     
1425 C  CA    . LYS A 187 ? 0.4317 0.4039 0.7233 -0.0819 -0.1328 0.1508  186 LYS F CA    
1426 C  C     . LYS A 187 ? 0.3921 0.3684 0.6723 -0.0842 -0.1233 0.1550  186 LYS F C     
1427 O  O     . LYS A 187 ? 0.4002 0.3656 0.6657 -0.0871 -0.1305 0.1555  186 LYS F O     
1428 C  CB    . LYS A 187 ? 0.6228 0.5973 0.9165 -0.0900 -0.1375 0.1622  186 LYS F CB    
1429 C  CG    . LYS A 187 ? 0.7925 0.7723 1.0774 -0.0987 -0.1334 0.1761  186 LYS F CG    
1430 C  CD    . LYS A 187 ? 0.7739 0.7596 1.0644 -0.1071 -0.1367 0.1879  186 LYS F CD    
1431 C  CE    . LYS A 187 ? 0.7828 0.7789 1.0678 -0.1150 -0.1291 0.2018  186 LYS F CE    
1432 N  NZ    . LYS A 187 ? 0.9281 0.9227 1.2092 -0.1242 -0.1386 0.2125  186 LYS F NZ    
1433 N  N     . VAL A 188 ? 0.4068 0.3990 0.6939 -0.0830 -0.1073 0.1579  187 VAL F N     
1434 C  CA    . VAL A 188 ? 0.4275 0.4249 0.7041 -0.0853 -0.0962 0.1611  187 VAL F CA    
1435 C  C     . VAL A 188 ? 0.4147 0.4042 0.6822 -0.0805 -0.0950 0.1492  187 VAL F C     
1436 O  O     . VAL A 188 ? 0.4073 0.3904 0.6569 -0.0847 -0.0972 0.1500  187 VAL F O     
1437 C  CB    . VAL A 188 ? 0.4257 0.4422 0.7157 -0.0838 -0.0788 0.1662  187 VAL F CB    
1438 C  CG1   . VAL A 188 ? 0.5213 0.5425 0.8020 -0.0837 -0.0648 0.1647  187 VAL F CG1   
1439 C  CG2   . VAL A 188 ? 0.3925 0.4182 0.6889 -0.0912 -0.0806 0.1805  187 VAL F CG2   
1440 N  N     . SER A 189 ? 0.3363 0.3265 0.6155 -0.0724 -0.0923 0.1383  188 SER F N     
1441 C  CA    . SER A 189 ? 0.3136 0.2966 0.5858 -0.0682 -0.0919 0.1268  188 SER F CA    
1442 C  C     . SER A 189 ? 0.3273 0.2949 0.5873 -0.0705 -0.1095 0.1245  188 SER F C     
1443 O  O     . SER A 189 ? 0.4238 0.3848 0.6693 -0.0720 -0.1117 0.1206  188 SER F O     
1444 C  CB    . SER A 189 ? 0.2954 0.2829 0.5847 -0.0600 -0.0863 0.1170  188 SER F CB    
1445 O  OG    . SER A 189 ? 0.3761 0.3776 0.6788 -0.0578 -0.0710 0.1206  188 SER F OG    
1446 N  N     . ALA A 190 ? 0.3233 0.2846 0.5894 -0.0706 -0.1225 0.1266  189 ALA F N     
1447 C  CA    . ALA A 190 ? 0.4837 0.4299 0.7424 -0.0712 -0.1397 0.1241  189 ALA F CA    
1448 C  C     . ALA A 190 ? 0.4859 0.4248 0.7250 -0.0798 -0.1463 0.1341  189 ALA F C     
1449 O  O     . ALA A 190 ? 0.4505 0.3792 0.6785 -0.0810 -0.1566 0.1322  189 ALA F O     
1450 C  CB    . ALA A 190 ? 0.4365 0.3767 0.7071 -0.0691 -0.1511 0.1233  189 ALA F CB    
1451 N  N     . ALA A 191 ? 0.4503 0.3955 0.6857 -0.0865 -0.1410 0.1457  190 ALA F N     
1452 C  CA    . ALA A 191 ? 0.5212 0.4618 0.7377 -0.0961 -0.1457 0.1568  190 ALA F CA    
1453 C  C     . ALA A 191 ? 0.5018 0.4471 0.7023 -0.0978 -0.1354 0.1539  190 ALA F C     
1454 O  O     . ALA A 191 ? 0.4996 0.4371 0.6812 -0.1039 -0.1433 0.1576  190 ALA F O     
1455 C  CB    . ALA A 191 ? 0.5444 0.4930 0.7634 -0.1030 -0.1416 0.1699  190 ALA F CB    
1456 N  N     . LYS A 192 ? 0.4681 0.4255 0.6755 -0.0930 -0.1178 0.1471  191 LYS F N     
1457 C  CA    . LYS A 192 ? 0.4486 0.4087 0.6413 -0.0938 -0.1074 0.1411  191 LYS F CA    
1458 C  C     . LYS A 192 ? 0.5630 0.5115 0.7482 -0.0913 -0.1181 0.1310  191 LYS F C     
1459 O  O     . LYS A 192 ? 0.6143 0.5580 0.7783 -0.0970 -0.1215 0.1312  191 LYS F O     
1460 C  CB    . LYS A 192 ? 0.5217 0.4950 0.7276 -0.0877 -0.0872 0.1347  191 LYS F CB    
1461 C  CG    . LYS A 192 ? 0.7025 0.6796 0.8935 -0.0893 -0.0732 0.1291  191 LYS F CG    
1462 C  CD    . LYS A 192 ? 0.8159 0.8049 1.0245 -0.0822 -0.0535 0.1236  191 LYS F CD    
1463 C  CE    . LYS A 192 ? 0.9008 0.9021 1.1285 -0.0815 -0.0485 0.1347  191 LYS F CE    
1464 N  NZ    . LYS A 192 ? 0.9867 0.9991 1.2361 -0.0735 -0.0323 0.1304  191 LYS F NZ    
1465 N  N     . LEU A 193 ? 0.3855 0.3309 0.5879 -0.0832 -0.1236 0.1224  192 LEU F N     
1466 C  CA    . LEU A 193 ? 0.4083 0.3443 0.6074 -0.0806 -0.1348 0.1134  192 LEU F CA    
1467 C  C     . LEU A 193 ? 0.5267 0.4504 0.7131 -0.0864 -0.1543 0.1213  192 LEU F C     
1468 O  O     . LEU A 193 ? 0.5315 0.4493 0.7024 -0.0898 -0.1617 0.1194  192 LEU F O     
1469 C  CB    . LEU A 193 ? 0.3683 0.3053 0.5906 -0.0712 -0.1365 0.1042  192 LEU F CB    
1470 C  CG    . LEU A 193 ? 0.4030 0.3505 0.6376 -0.0655 -0.1189 0.0960  192 LEU F CG    
1471 C  CD1   . LEU A 193 ? 0.4092 0.3604 0.6671 -0.0578 -0.1195 0.0905  192 LEU F CD1   
1472 C  CD2   . LEU A 193 ? 0.4833 0.4288 0.7077 -0.0655 -0.1144 0.0861  192 LEU F CD2   
1473 N  N     . GLU A 194 ? 0.5328 0.4522 0.7254 -0.0882 -0.1633 0.1307  193 GLU F N     
1474 C  CA    . GLU A 194 ? 0.6046 0.5109 0.7874 -0.0937 -0.1824 0.1396  193 GLU F CA    
1475 C  C     . GLU A 194 ? 0.7020 0.6079 0.8582 -0.1043 -0.1823 0.1485  193 GLU F C     
1476 O  O     . GLU A 194 ? 0.6891 0.5854 0.8326 -0.1084 -0.1969 0.1520  193 GLU F O     
1477 C  CB    . GLU A 194 ? 0.6477 0.5492 0.8411 -0.0950 -0.1899 0.1484  193 GLU F CB    
1478 C  CG    . GLU A 194 ? 0.7946 0.6796 0.9837 -0.0988 -0.2114 0.1568  193 GLU F CG    
1479 C  CD    . GLU A 194 ? 1.0089 0.8845 1.2145 -0.0897 -0.2245 0.1473  193 GLU F CD    
1480 O  OE1   . GLU A 194 ? 1.0580 0.9396 1.2813 -0.0810 -0.2175 0.1360  193 GLU F OE1   
1481 O  OE2   . GLU A 194 ? 1.0119 0.8749 1.2135 -0.0913 -0.2417 0.1518  193 GLU F OE2   
1482 N  N     . ALA A 195 ? 0.6809 0.5981 0.8286 -0.1089 -0.1657 0.1523  194 ALA F N     
1483 C  CA    . ALA A 195 ? 0.7575 0.6762 0.8787 -0.1196 -0.1636 0.1605  194 ALA F CA    
1484 C  C     . ALA A 195 ? 0.7596 0.6789 0.8646 -0.1201 -0.1594 0.1501  194 ALA F C     
1485 O  O     . ALA A 195 ? 0.9050 0.8250 0.9847 -0.1296 -0.1585 0.1553  194 ALA F O     
1486 C  CB    . ALA A 195 ? 0.7381 0.6704 0.8570 -0.1242 -0.1461 0.1675  194 ALA F CB    
1487 N  N     . MET A 196 ? 0.5999 0.5192 0.7179 -0.1110 -0.1566 0.1358  195 MET F N     
1488 C  CA    . MET A 196 ? 0.6724 0.5894 0.7772 -0.1116 -0.1573 0.1254  195 MET F CA    
1489 C  C     . MET A 196 ? 0.6980 0.6039 0.8066 -0.1097 -0.1791 0.1243  195 MET F C     
1490 O  O     . MET A 196 ? 0.6709 0.5750 0.7733 -0.1093 -0.1821 0.1149  195 MET F O     
1491 C  CB    . MET A 196 ? 0.7246 0.6488 0.8421 -0.1035 -0.1403 0.1103  195 MET F CB    
1492 C  CG    . MET A 196 ? 0.7814 0.7170 0.8974 -0.1039 -0.1177 0.1095  195 MET F CG    
1493 S  SD    . MET A 196 ? 0.7545 0.6964 0.8950 -0.0923 -0.1014 0.0945  195 MET F SD    
1494 C  CE    . MET A 196 ? 0.7283 0.6612 0.8609 -0.0917 -0.1109 0.0809  195 MET F CE    
1495 N  N     . GLY A 197 ? 0.6429 0.5413 0.7634 -0.1083 -0.1943 0.1330  196 GLY F N     
1496 C  CA    . GLY A 197 ? 0.6617 0.5503 0.7920 -0.1043 -0.2140 0.1312  196 GLY F CA    
1497 C  C     . GLY A 197 ? 0.5539 0.4452 0.7095 -0.0926 -0.2117 0.1173  196 GLY F C     
1498 O  O     . GLY A 197 ? 0.6137 0.5004 0.7760 -0.0893 -0.2247 0.1125  196 GLY F O     
1499 N  N     . LEU A 198 ? 0.4732 0.3729 0.6436 -0.0868 -0.1957 0.1113  197 LEU F N     
1500 C  CA    . LEU A 198 ? 0.4775 0.3813 0.6713 -0.0766 -0.1919 0.0989  197 LEU F CA    
1501 C  C     . LEU A 198 ? 0.5568 0.4597 0.7709 -0.0711 -0.1946 0.1015  197 LEU F C     
1502 O  O     . LEU A 198 ? 0.5010 0.4098 0.7182 -0.0717 -0.1833 0.1053  197 LEU F O     
1503 C  CB    . LEU A 198 ? 0.4183 0.3325 0.6131 -0.0745 -0.1715 0.0896  197 LEU F CB    
1504 C  CG    . LEU A 198 ? 0.4760 0.3907 0.6502 -0.0800 -0.1660 0.0842  197 LEU F CG    
1505 C  CD1   . LEU A 198 ? 0.5894 0.5125 0.7700 -0.0762 -0.1457 0.0742  197 LEU F CD1   
1506 C  CD2   . LEU A 198 ? 0.4881 0.3968 0.6596 -0.0804 -0.1815 0.0790  197 LEU F CD2   
1507 N  N     . ARG A 199 ? 0.4663 0.3625 0.6948 -0.0658 -0.2094 0.0992  198 ARG F N     
1508 C  CA    . ARG A 199 ? 0.4775 0.3711 0.7243 -0.0607 -0.2131 0.0996  198 ARG F CA    
1509 C  C     . ARG A 199 ? 0.3698 0.2694 0.6394 -0.0508 -0.2101 0.0868  198 ARG F C     
1510 O  O     . ARG A 199 ? 0.3589 0.2630 0.6414 -0.0471 -0.2034 0.0844  198 ARG F O     
1511 C  CB    . ARG A 199 ? 0.4260 0.3051 0.6724 -0.0625 -0.2332 0.1080  198 ARG F CB    
1512 C  CG    . ARG A 199 ? 0.4777 0.3514 0.7390 -0.0591 -0.2370 0.1092  198 ARG F CG    
1513 C  CD    . ARG A 199 ? 0.5721 0.4289 0.8342 -0.0607 -0.2574 0.1174  198 ARG F CD    
1514 N  NE    . ARG A 199 ? 0.6393 0.4917 0.9145 -0.0535 -0.2698 0.1107  198 ARG F NE    
1515 C  CZ    . ARG A 199 ? 0.5961 0.4497 0.8943 -0.0434 -0.2709 0.0993  198 ARG F CZ    
1516 N  NH1   . ARG A 199 ? 0.5653 0.4234 0.8735 -0.0401 -0.2608 0.0935  198 ARG F NH1   
1517 N  NH2   . ARG A 199 ? 0.5929 0.4444 0.9043 -0.0370 -0.2819 0.0939  198 ARG F NH2   
1518 N  N     . THR A 200 ? 0.3994 0.3003 0.6738 -0.0474 -0.2146 0.0790  199 THR F N     
1519 C  CA    . THR A 200 ? 0.4694 0.3768 0.7663 -0.0386 -0.2131 0.0674  199 THR F CA    
1520 C  C     . THR A 200 ? 0.3827 0.2998 0.6795 -0.0381 -0.2018 0.0591  199 THR F C     
1521 O  O     . THR A 200 ? 0.3895 0.3063 0.6684 -0.0441 -0.1977 0.0610  199 THR F O     
1522 C  CB    . THR A 200 ? 0.3617 0.2621 0.6707 -0.0340 -0.2310 0.0653  199 THR F CB    
1523 O  OG1   . THR A 200 ? 0.4597 0.3592 0.7593 -0.0373 -0.2382 0.0653  199 THR F OG1   
1524 C  CG2   . THR A 200 ? 0.4228 0.3096 0.7295 -0.0356 -0.2446 0.0748  199 THR F CG2   
1525 N  N     . CYS A 201 ? 0.3281 0.2536 0.6450 -0.0311 -0.1969 0.0494  200 CYS F N     
1526 C  CA    . CYS A 201 ? 0.3212 0.2550 0.6410 -0.0306 -0.1878 0.0412  200 CYS F CA    
1527 C  C     . CYS A 201 ? 0.4432 0.3730 0.7559 -0.0334 -0.1991 0.0393  200 CYS F C     
1528 O  O     . CYS A 201 ? 0.4467 0.3785 0.7494 -0.0374 -0.1927 0.0356  200 CYS F O     
1529 C  CB    . CYS A 201 ? 0.3011 0.2453 0.6447 -0.0234 -0.1818 0.0326  200 CYS F CB    
1530 S  SG    . CYS A 201 ? 0.4374 0.3892 0.7874 -0.0218 -0.1664 0.0347  200 CYS F SG    
1531 N  N     . GLY A 202 ? 0.4353 0.3591 0.7536 -0.0315 -0.2164 0.0416  201 GLY F N     
1532 C  CA    . GLY A 202 ? 0.4434 0.3634 0.7535 -0.0354 -0.2296 0.0423  201 GLY F CA    
1533 C  C     . GLY A 202 ? 0.4536 0.3677 0.7339 -0.0454 -0.2285 0.0487  201 GLY F C     
1534 O  O     . GLY A 202 ? 0.5460 0.4612 0.8151 -0.0502 -0.2291 0.0450  201 GLY F O     
1535 N  N     . ASP A 203 ? 0.4411 0.3494 0.7076 -0.0491 -0.2266 0.0583  202 ASP F N     
1536 C  CA    . ASP A 203 ? 0.5222 0.4273 0.7601 -0.0588 -0.2219 0.0642  202 ASP F CA    
1537 C  C     . ASP A 203 ? 0.5904 0.5025 0.8220 -0.0603 -0.2033 0.0556  202 ASP F C     
1538 O  O     . ASP A 203 ? 0.5683 0.4790 0.7799 -0.0672 -0.2019 0.0537  202 ASP F O     
1539 C  CB    . ASP A 203 ? 0.4940 0.3948 0.7230 -0.0619 -0.2193 0.0753  202 ASP F CB    
1540 C  CG    . ASP A 203 ? 0.6367 0.5277 0.8705 -0.0614 -0.2379 0.0845  202 ASP F CG    
1541 O  OD1   . ASP A 203 ? 0.5879 0.4748 0.8276 -0.0598 -0.2538 0.0841  202 ASP F OD1   
1542 O  OD2   . ASP A 203 ? 0.5667 0.4537 0.7994 -0.0626 -0.2370 0.0925  202 ASP F OD2   
1543 N  N     . VAL A 204 ? 0.5117 0.4310 0.7595 -0.0544 -0.1889 0.0507  203 VAL F N     
1544 C  CA    . VAL A 204 ? 0.4067 0.3314 0.6505 -0.0553 -0.1708 0.0440  203 VAL F CA    
1545 C  C     . VAL A 204 ? 0.4635 0.3900 0.7122 -0.0549 -0.1721 0.0331  203 VAL F C     
1546 O  O     . VAL A 204 ? 0.5509 0.4774 0.7885 -0.0586 -0.1618 0.0271  203 VAL F O     
1547 C  CB    . VAL A 204 ? 0.3522 0.2843 0.6130 -0.0495 -0.1566 0.0440  203 VAL F CB    
1548 C  CG1   . VAL A 204 ? 0.4296 0.3672 0.6921 -0.0490 -0.1386 0.0368  203 VAL F CG1   
1549 C  CG2   . VAL A 204 ? 0.3543 0.2849 0.6072 -0.0521 -0.1548 0.0552  203 VAL F CG2   
1550 N  N     . GLN A 205 ? 0.5371 0.4652 0.8031 -0.0505 -0.1846 0.0300  204 GLN F N     
1551 C  CA    . GLN A 205 ? 0.5054 0.4359 0.7768 -0.0512 -0.1880 0.0207  204 GLN F CA    
1552 C  C     . GLN A 205 ? 0.5444 0.4686 0.7902 -0.0604 -0.1952 0.0205  204 GLN F C     
1553 O  O     . GLN A 205 ? 0.5741 0.4991 0.8166 -0.0637 -0.1922 0.0118  204 GLN F O     
1554 C  CB    . GLN A 205 ? 0.4550 0.3897 0.7501 -0.0451 -0.2016 0.0189  204 GLN F CB    
1555 C  CG    . GLN A 205 ? 0.5177 0.4609 0.8379 -0.0368 -0.1923 0.0153  204 GLN F CG    
1556 C  CD    . GLN A 205 ? 0.4434 0.3909 0.7865 -0.0303 -0.2049 0.0138  204 GLN F CD    
1557 O  OE1   . GLN A 205 ? 0.5092 0.4549 0.8534 -0.0315 -0.2199 0.0140  204 GLN F OE1   
1558 N  NE2   . GLN A 205 ? 0.3318 0.2857 0.6936 -0.0234 -0.1987 0.0121  204 GLN F NE2   
1559 N  N     . LYS A 206 ? 0.5753 0.4930 0.8021 -0.0656 -0.2049 0.0303  205 LYS F N     
1560 C  CA    . LYS A 206 ? 0.6928 0.6050 0.8916 -0.0758 -0.2119 0.0313  205 LYS F CA    
1561 C  C     . LYS A 206 ? 0.7969 0.7072 0.9711 -0.0820 -0.1951 0.0301  205 LYS F C     
1562 O  O     . LYS A 206 ? 0.8123 0.7181 0.9585 -0.0914 -0.1994 0.0333  205 LYS F O     
1563 C  CB    . LYS A 206 ? 0.6441 0.5506 0.8342 -0.0793 -0.2319 0.0437  205 LYS F CB    
1564 N  N     . CYS A 207 ? 0.7239 0.6383 0.9083 -0.0770 -0.1760 0.0258  206 CYS F N     
1565 C  CA    . CYS A 207 ? 0.7391 0.6531 0.9060 -0.0807 -0.1579 0.0243  206 CYS F CA    
1566 C  C     . CYS A 207 ? 0.6251 0.5397 0.7949 -0.0801 -0.1442 0.0105  206 CYS F C     
1567 O  O     . CYS A 207 ? 0.6986 0.6161 0.8907 -0.0747 -0.1445 0.0039  206 CYS F O     
1568 C  CB    . CYS A 207 ? 0.7748 0.6934 0.9528 -0.0755 -0.1462 0.0315  206 CYS F CB    
1569 S  SG    . CYS A 207 ? 0.8837 0.7996 1.0494 -0.0795 -0.1562 0.0479  206 CYS F SG    
1570 N  N     . ASP A 208 ? 0.5978 0.5096 0.7456 -0.0858 -0.1315 0.0064  207 ASP F N     
1571 C  CA    . ASP A 208 ? 0.6020 0.5119 0.7505 -0.0856 -0.1168 -0.0072 207 ASP F CA    
1572 C  C     . ASP A 208 ? 0.5304 0.4453 0.6983 -0.0776 -0.0975 -0.0069 207 ASP F C     
1573 O  O     . ASP A 208 ? 0.5032 0.4216 0.6675 -0.0767 -0.0895 0.0015  207 ASP F O     
1574 C  CB    . ASP A 208 ? 0.6567 0.5608 0.7716 -0.0955 -0.1117 -0.0132 207 ASP F CB    
1575 C  CG    . ASP A 208 ? 0.8968 0.7973 1.0119 -0.0947 -0.0932 -0.0276 207 ASP F CG    
1576 O  OD1   . ASP A 208 ? 0.9140 0.8128 1.0472 -0.0914 -0.0933 -0.0363 207 ASP F OD1   
1577 O  OD2   . ASP A 208 ? 1.1104 1.0099 1.2085 -0.0973 -0.0780 -0.0301 207 ASP F OD2   
1578 N  N     . LEU A 209 ? 0.5700 0.4856 0.7593 -0.0723 -0.0907 -0.0152 208 LEU F N     
1579 C  CA    . LEU A 209 ? 0.4223 0.3428 0.6321 -0.0648 -0.0736 -0.0142 208 LEU F CA    
1580 C  C     . LEU A 209 ? 0.4992 0.4179 0.6948 -0.0664 -0.0555 -0.0164 208 LEU F C     
1581 O  O     . LEU A 209 ? 0.5408 0.4660 0.7468 -0.0616 -0.0443 -0.0090 208 LEU F O     
1582 C  CB    . LEU A 209 ? 0.4098 0.3301 0.6424 -0.0606 -0.0701 -0.0228 208 LEU F CB    
1583 C  CG    . LEU A 209 ? 0.5158 0.4396 0.7693 -0.0537 -0.0520 -0.0227 208 LEU F CG    
1584 C  CD1   . LEU A 209 ? 0.3648 0.2989 0.6351 -0.0478 -0.0519 -0.0099 208 LEU F CD1   
1585 C  CD2   . LEU A 209 ? 0.4861 0.4075 0.7585 -0.0517 -0.0493 -0.0318 208 LEU F CD2   
1586 N  N     . VAL A 210 ? 0.5655 0.4763 0.7376 -0.0732 -0.0522 -0.0266 209 VAL F N     
1587 C  CA    . VAL A 210 ? 0.5966 0.5062 0.7559 -0.0742 -0.0332 -0.0308 209 VAL F CA    
1588 C  C     . VAL A 210 ? 0.6297 0.5462 0.7766 -0.0763 -0.0321 -0.0180 209 VAL F C     
1589 O  O     . VAL A 210 ? 0.6611 0.5832 0.8138 -0.0726 -0.0160 -0.0144 209 VAL F O     
1590 C  CB    . VAL A 210 ? 0.6496 0.5490 0.7823 -0.0824 -0.0309 -0.0455 209 VAL F CB    
1591 C  CG1   . VAL A 210 ? 0.6644 0.5629 0.7853 -0.0825 -0.0091 -0.0514 209 VAL F CG1   
1592 C  CG2   . VAL A 210 ? 0.5381 0.4300 0.6838 -0.0815 -0.0335 -0.0580 209 VAL F CG2   
1593 N  N     . MET A 211 ? 0.7134 0.6297 0.8445 -0.0823 -0.0497 -0.0101 210 MET F N     
1594 C  CA    . MET A 211 ? 0.7895 0.7115 0.9096 -0.0853 -0.0514 0.0037  210 MET F CA    
1595 C  C     . MET A 211 ? 0.6680 0.5989 0.8151 -0.0771 -0.0463 0.0143  210 MET F C     
1596 O  O     . MET A 211 ? 0.5865 0.5242 0.7332 -0.0766 -0.0338 0.0208  210 MET F O     
1597 C  CB    . MET A 211 ? 0.9981 0.9168 1.1029 -0.0921 -0.0743 0.0109  210 MET F CB    
1598 C  CG    . MET A 211 ? 1.2821 1.2014 1.3574 -0.1016 -0.0773 0.0197  210 MET F CG    
1599 S  SD    . MET A 211 ? 1.4693 1.3874 1.5465 -0.1038 -0.1031 0.0361  210 MET F SD    
1600 C  CE    . MET A 211 ? 1.3342 1.2463 1.4238 -0.1012 -0.1208 0.0276  210 MET F CE    
1601 N  N     . LEU A 212 ? 0.5297 0.4616 0.7006 -0.0711 -0.0555 0.0161  211 LEU F N     
1602 C  CA    . LEU A 212 ? 0.5632 0.5034 0.7578 -0.0644 -0.0526 0.0260  211 LEU F CA    
1603 C  C     . LEU A 212 ? 0.6169 0.5630 0.8277 -0.0586 -0.0319 0.0237  211 LEU F C     
1604 O  O     . LEU A 212 ? 0.6731 0.6279 0.8944 -0.0560 -0.0250 0.0337  211 LEU F O     
1605 C  CB    . LEU A 212 ? 0.5438 0.4841 0.7587 -0.0597 -0.0659 0.0263  211 LEU F CB    
1606 C  CG    . LEU A 212 ? 0.5504 0.4864 0.7556 -0.0636 -0.0869 0.0310  211 LEU F CG    
1607 C  CD1   . LEU A 212 ? 0.4836 0.4190 0.7072 -0.0591 -0.0977 0.0259  211 LEU F CD1   
1608 C  CD2   . LEU A 212 ? 0.5619 0.5011 0.7677 -0.0642 -0.0919 0.0446  211 LEU F CD2   
1609 N  N     . LEU A 213 ? 0.5349 0.4761 0.7493 -0.0566 -0.0225 0.0111  212 LEU F N     
1610 C  CA    . LEU A 213 ? 0.5250 0.4703 0.7568 -0.0504 -0.0030 0.0088  212 LEU F CA    
1611 C  C     . LEU A 213 ? 0.6168 0.5665 0.8358 -0.0525 0.0113  0.0117  212 LEU F C     
1612 O  O     . LEU A 213 ? 0.6372 0.5957 0.8737 -0.0472 0.0242  0.0180  212 LEU F O     
1613 C  CB    . LEU A 213 ? 0.4476 0.3839 0.6842 -0.0488 0.0030  -0.0060 212 LEU F CB    
1614 C  CG    . LEU A 213 ? 0.4876 0.4239 0.7483 -0.0442 -0.0042 -0.0072 212 LEU F CG    
1615 C  CD1   . LEU A 213 ? 0.4433 0.3694 0.7050 -0.0449 -0.0005 -0.0218 212 LEU F CD1   
1616 C  CD2   . LEU A 213 ? 0.5475 0.4938 0.8362 -0.0366 0.0047  0.0022  212 LEU F CD2   
1617 N  N     . LYS A 214 ? 0.6991 0.6440 0.8879 -0.0606 0.0092  0.0078  213 LYS F N     
1618 C  CA    . LYS A 214 ? 0.7591 0.7100 0.9341 -0.0635 0.0232  0.0109  213 LYS F CA    
1619 C  C     . LYS A 214 ? 0.7618 0.7241 0.9429 -0.0640 0.0195  0.0285  213 LYS F C     
1620 O  O     . LYS A 214 ? 0.9103 0.8830 1.1042 -0.0604 0.0340  0.0345  213 LYS F O     
1621 C  CB    . LYS A 214 ? 0.8266 0.7705 0.9649 -0.0737 0.0204  0.0036  213 LYS F CB    
1622 C  CG    . LYS A 214 ? 0.8607 0.7943 0.9893 -0.0744 0.0297  -0.0152 213 LYS F CG    
1623 C  CD    . LYS A 214 ? 0.9497 0.8807 1.0410 -0.0845 0.0344  -0.0215 213 LYS F CD    
1624 C  CE    . LYS A 214 ? 0.9945 0.9361 1.0840 -0.0833 0.0554  -0.0184 213 LYS F CE    
1625 N  NZ    . LYS A 214 ? 0.9602 0.9004 1.0668 -0.0750 0.0779  -0.0310 213 LYS F NZ    
1626 N  N     . ARG A 215 ? 0.7315 0.6919 0.9052 -0.0684 0.0000  0.0370  214 ARG F N     
1627 C  CA    . ARG A 215 ? 0.7624 0.7311 0.9374 -0.0710 -0.0053 0.0532  214 ARG F CA    
1628 C  C     . ARG A 215 ? 0.6721 0.6483 0.8774 -0.0638 -0.0063 0.0616  214 ARG F C     
1629 O  O     . ARG A 215 ? 0.5740 0.5579 0.7829 -0.0659 -0.0086 0.0748  214 ARG F O     
1630 C  CB    . ARG A 215 ? 0.8092 0.7711 0.9647 -0.0787 -0.0265 0.0592  214 ARG F CB    
1631 C  CG    . ARG A 215 ? 0.9604 0.9153 1.0832 -0.0876 -0.0294 0.0532  214 ARG F CG    
1632 C  CD    . ARG A 215 ? 1.1238 1.0724 1.2319 -0.0945 -0.0521 0.0619  214 ARG F CD    
1633 N  NE    . ARG A 215 ? 1.2869 1.2256 1.3926 -0.0943 -0.0667 0.0533  214 ARG F NE    
1634 C  CZ    . ARG A 215 ? 1.1993 1.1359 1.3287 -0.0868 -0.0743 0.0499  214 ARG F CZ    
1635 N  NH1   . ARG A 215 ? 1.3490 1.2920 1.5046 -0.0791 -0.0689 0.0541  214 ARG F NH1   
1636 N  NH2   . ARG A 215 ? 0.7468 0.6761 0.8739 -0.0874 -0.0875 0.0427  214 ARG F NH2   
1637 N  N     . PHE A 216 ? 0.5882 0.5628 0.8145 -0.0565 -0.0052 0.0550  215 PHE F N     
1638 C  CA    . PHE A 216 ? 0.5083 0.4906 0.7612 -0.0508 -0.0070 0.0632  215 PHE F CA    
1639 C  C     . PHE A 216 ? 0.4759 0.4622 0.7533 -0.0428 0.0063  0.0586  215 PHE F C     
1640 O  O     . PHE A 216 ? 0.5302 0.5248 0.8292 -0.0387 0.0059  0.0665  215 PHE F O     
1641 C  CB    . PHE A 216 ? 0.5106 0.4875 0.7665 -0.0509 -0.0263 0.0640  215 PHE F CB    
1642 C  CG    . PHE A 216 ? 0.6267 0.6004 0.8662 -0.0575 -0.0413 0.0724  215 PHE F CG    
1643 C  CD1   . PHE A 216 ? 0.7108 0.6914 0.9558 -0.0592 -0.0435 0.0854  215 PHE F CD1   
1644 C  CD2   . PHE A 216 ? 0.6466 0.6099 0.8662 -0.0623 -0.0540 0.0679  215 PHE F CD2   
1645 C  CE1   . PHE A 216 ? 0.6832 0.6590 0.9141 -0.0655 -0.0578 0.0934  215 PHE F CE1   
1646 C  CE2   . PHE A 216 ? 0.6256 0.5849 0.8317 -0.0683 -0.0686 0.0767  215 PHE F CE2   
1647 C  CZ    . PHE A 216 ? 0.7107 0.6755 0.9227 -0.0698 -0.0704 0.0894  215 PHE F CZ    
1648 N  N     . GLY A 217 ? 0.5471 0.5275 0.8221 -0.0408 0.0174  0.0464  216 GLY F N     
1649 C  CA    . GLY A 217 ? 0.5666 0.5489 0.8667 -0.0332 0.0285  0.0426  216 GLY F CA    
1650 C  C     . GLY A 217 ? 0.5561 0.5360 0.8708 -0.0305 0.0171  0.0412  216 GLY F C     
1651 O  O     . GLY A 217 ? 0.6093 0.5822 0.9125 -0.0339 0.0029  0.0367  216 GLY F O     
1652 N  N     . LYS A 218 ? 0.4626 0.4496 0.8037 -0.0245 0.0235  0.0460  217 LYS F N     
1653 C  CA    . LYS A 218 ? 0.4747 0.4614 0.8309 -0.0222 0.0151  0.0448  217 LYS F CA    
1654 C  C     . LYS A 218 ? 0.5486 0.5377 0.8992 -0.0252 -0.0018 0.0502  217 LYS F C     
1655 O  O     . LYS A 218 ? 0.5096 0.4963 0.8649 -0.0247 -0.0113 0.0459  217 LYS F O     
1656 C  CB    . LYS A 218 ? 0.5416 0.5376 0.9261 -0.0163 0.0244  0.0521  217 LYS F CB    
1657 C  CG    . LYS A 218 ? 0.6870 0.6783 1.0827 -0.0119 0.0403  0.0457  217 LYS F CG    
1658 C  CD    . LYS A 218 ? 0.7386 0.7399 1.1641 -0.0062 0.0480  0.0558  217 LYS F CD    
1659 C  CE    . LYS A 218 ? 0.7441 0.7375 1.1841 -0.0014 0.0612  0.0483  217 LYS F CE    
1660 N  NZ    . LYS A 218 ? 0.7974 0.7834 1.2246 -0.0009 0.0734  0.0391  217 LYS F NZ    
1661 N  N     . PHE A 219 ? 0.5567 0.5507 0.8984 -0.0283 -0.0055 0.0595  218 PHE F N     
1662 C  CA    . PHE A 219 ? 0.4355 0.4292 0.7710 -0.0312 -0.0218 0.0639  218 PHE F CA    
1663 C  C     . PHE A 219 ? 0.3082 0.2905 0.6253 -0.0347 -0.0338 0.0552  218 PHE F C     
1664 O  O     . PHE A 219 ? 0.3974 0.3777 0.7160 -0.0347 -0.0473 0.0543  218 PHE F O     
1665 C  CB    . PHE A 219 ? 0.3910 0.3909 0.7204 -0.0347 -0.0226 0.0759  218 PHE F CB    
1666 C  CG    . PHE A 219 ? 0.4677 0.4655 0.7912 -0.0380 -0.0390 0.0806  218 PHE F CG    
1667 C  CD1   . PHE A 219 ? 0.5134 0.5161 0.8518 -0.0356 -0.0452 0.0831  218 PHE F CD1   
1668 C  CD2   . PHE A 219 ? 0.5244 0.5152 0.8273 -0.0436 -0.0479 0.0827  218 PHE F CD2   
1669 C  CE1   . PHE A 219 ? 0.5037 0.5032 0.8371 -0.0381 -0.0595 0.0860  218 PHE F CE1   
1670 C  CE2   . PHE A 219 ? 0.5610 0.5481 0.8602 -0.0462 -0.0631 0.0871  218 PHE F CE2   
1671 C  CZ    . PHE A 219 ? 0.5650 0.5559 0.8799 -0.0431 -0.0687 0.0880  218 PHE F CZ    
1672 N  N     . GLY A 220 ? 0.3633 0.3385 0.6627 -0.0378 -0.0294 0.0489  219 GLY F N     
1673 C  CA    . GLY A 220 ? 0.4272 0.3923 0.7085 -0.0420 -0.0414 0.0414  219 GLY F CA    
1674 C  C     . GLY A 220 ? 0.4468 0.4081 0.7384 -0.0394 -0.0455 0.0313  219 GLY F C     
1675 O  O     . GLY A 220 ? 0.3861 0.3428 0.6725 -0.0412 -0.0600 0.0280  219 GLY F O     
1676 N  N     . ARG A 221 ? 0.3598 0.3233 0.6679 -0.0351 -0.0334 0.0269  220 ARG F N     
1677 C  CA    . ARG A 221 ? 0.3592 0.3210 0.6806 -0.0330 -0.0372 0.0192  220 ARG F CA    
1678 C  C     . ARG A 221 ? 0.3058 0.2748 0.6418 -0.0304 -0.0476 0.0244  220 ARG F C     
1679 O  O     . ARG A 221 ? 0.3008 0.2681 0.6393 -0.0307 -0.0586 0.0192  220 ARG F O     
1680 C  CB    . ARG A 221 ? 0.3013 0.2636 0.6392 -0.0292 -0.0221 0.0154  220 ARG F CB    
1681 C  CG    . ARG A 221 ? 0.3496 0.3101 0.7014 -0.0282 -0.0262 0.0078  220 ARG F CG    
1682 C  CD    . ARG A 221 ? 0.3439 0.3023 0.7115 -0.0252 -0.0119 0.0041  220 ARG F CD    
1683 N  NE    . ARG A 221 ? 0.3191 0.2657 0.6721 -0.0277 -0.0043 -0.0063 220 ARG F NE    
1684 C  CZ    . ARG A 221 ? 0.3340 0.2710 0.6765 -0.0322 -0.0102 -0.0179 220 ARG F CZ    
1685 N  NH1   . ARG A 221 ? 0.3830 0.3219 0.7299 -0.0340 -0.0237 -0.0197 220 ARG F NH1   
1686 N  NH2   . ARG A 221 ? 0.4161 0.3421 0.7436 -0.0351 -0.0025 -0.0281 220 ARG F NH2   
1687 N  N     . ILE A 222 ? 0.3130 0.2907 0.6588 -0.0281 -0.0444 0.0345  221 ILE F N     
1688 C  CA    . ILE A 222 ? 0.3521 0.3367 0.7099 -0.0262 -0.0533 0.0385  221 ILE F CA    
1689 C  C     . ILE A 222 ? 0.2647 0.2440 0.6101 -0.0285 -0.0693 0.0378  221 ILE F C     
1690 O  O     . ILE A 222 ? 0.3480 0.3283 0.7010 -0.0269 -0.0787 0.0337  221 ILE F O     
1691 C  CB    . ILE A 222 ? 0.3340 0.3284 0.7017 -0.0247 -0.0471 0.0497  221 ILE F CB    
1692 C  CG1   . ILE A 222 ? 0.4180 0.4193 0.8047 -0.0213 -0.0344 0.0511  221 ILE F CG1   
1693 C  CG2   . ILE A 222 ? 0.2909 0.2901 0.6633 -0.0244 -0.0581 0.0533  221 ILE F CG2   
1694 C  CD1   . ILE A 222 ? 0.5917 0.6043 0.9894 -0.0204 -0.0289 0.0632  221 ILE F CD1   
1695 N  N     . LEU A 223 ? 0.3027 0.2768 0.6300 -0.0324 -0.0725 0.0423  222 LEU F N     
1696 C  CA    . LEU A 223 ? 0.2840 0.2513 0.5991 -0.0351 -0.0885 0.0428  222 LEU F CA    
1697 C  C     . LEU A 223 ? 0.3082 0.2700 0.6212 -0.0354 -0.0971 0.0331  222 LEU F C     
1698 O  O     . LEU A 223 ? 0.2982 0.2591 0.6168 -0.0339 -0.1100 0.0313  222 LEU F O     
1699 C  CB    . LEU A 223 ? 0.3364 0.2987 0.6303 -0.0406 -0.0888 0.0491  222 LEU F CB    
1700 C  CG    . LEU A 223 ? 0.6351 0.5960 0.9215 -0.0436 -0.0972 0.0595  222 LEU F CG    
1701 C  CD1   . LEU A 223 ? 0.5664 0.5327 0.8698 -0.0400 -0.1008 0.0633  222 LEU F CD1   
1702 C  CD2   . LEU A 223 ? 0.5259 0.4898 0.8018 -0.0474 -0.0854 0.0662  222 LEU F CD2   
1703 N  N     . TRP A 224 ? 0.3843 0.3424 0.6897 -0.0376 -0.0901 0.0265  223 TRP F N     
1704 C  CA    . TRP A 224 ? 0.3140 0.2671 0.6162 -0.0393 -0.0986 0.0174  223 TRP F CA    
1705 C  C     . TRP A 224 ? 0.3426 0.3021 0.6679 -0.0347 -0.1012 0.0125  223 TRP F C     
1706 O  O     . TRP A 224 ? 0.3222 0.2812 0.6514 -0.0344 -0.1142 0.0092  223 TRP F O     
1707 C  CB    . TRP A 224 ? 0.4246 0.3723 0.7147 -0.0429 -0.0885 0.0103  223 TRP F CB    
1708 C  CG    . TRP A 224 ? 0.4441 0.3863 0.7283 -0.0464 -0.0974 0.0011  223 TRP F CG    
1709 C  CD1   . TRP A 224 ? 0.3965 0.3320 0.6597 -0.0525 -0.1091 0.0000  223 TRP F CD1   
1710 C  CD2   . TRP A 224 ? 0.4391 0.3827 0.7388 -0.0450 -0.0963 -0.0076 223 TRP F CD2   
1711 N  NE1   . TRP A 224 ? 0.4310 0.3641 0.6959 -0.0549 -0.1159 -0.0090 223 TRP F NE1   
1712 C  CE2   . TRP A 224 ? 0.4327 0.3705 0.7201 -0.0504 -0.1079 -0.0141 223 TRP F CE2   
1713 C  CE3   . TRP A 224 ? 0.4083 0.3580 0.7311 -0.0403 -0.0872 -0.0096 223 TRP F CE3   
1714 C  CZ2   . TRP A 224 ? 0.4588 0.3968 0.7570 -0.0515 -0.1105 -0.0230 223 TRP F CZ2   
1715 C  CZ3   . TRP A 224 ? 0.4653 0.4147 0.7986 -0.0414 -0.0895 -0.0182 223 TRP F CZ3   
1716 C  CH2   . TRP A 224 ? 0.4500 0.3937 0.7715 -0.0469 -0.1010 -0.0250 223 TRP F CH2   
1717 N  N     . GLU A 225 ? 0.2894 0.2559 0.6312 -0.0311 -0.0890 0.0129  224 GLU F N     
1718 C  CA    . GLU A 225 ? 0.2637 0.2381 0.6272 -0.0275 -0.0901 0.0094  224 GLU F CA    
1719 C  C     . GLU A 225 ? 0.2743 0.2537 0.6453 -0.0246 -0.1011 0.0124  224 GLU F C     
1720 O  O     . GLU A 225 ? 0.2910 0.2721 0.6697 -0.0234 -0.1110 0.0073  224 GLU F O     
1721 C  CB    . GLU A 225 ? 0.2693 0.2505 0.6475 -0.0249 -0.0753 0.0121  224 GLU F CB    
1722 C  CG    . GLU A 225 ? 0.2931 0.2692 0.6716 -0.0265 -0.0653 0.0063  224 GLU F CG    
1723 C  CD    . GLU A 225 ? 0.4947 0.4765 0.8892 -0.0236 -0.0511 0.0108  224 GLU F CD    
1724 O  OE1   . GLU A 225 ? 0.6304 0.6223 1.0363 -0.0211 -0.0501 0.0183  224 GLU F OE1   
1725 O  OE2   . GLU A 225 ? 0.5935 0.5696 0.9890 -0.0242 -0.0413 0.0068  224 GLU F OE2   
1726 N  N     . ARG A 226 ? 0.3064 0.2883 0.6763 -0.0234 -0.0993 0.0203  225 ARG F N     
1727 C  CA    . ARG A 226 ? 0.2934 0.2792 0.6711 -0.0206 -0.1081 0.0220  225 ARG F CA    
1728 C  C     . ARG A 226 ? 0.3280 0.3064 0.6992 -0.0209 -0.1240 0.0195  225 ARG F C     
1729 O  O     . ARG A 226 ? 0.4288 0.4106 0.8121 -0.0173 -0.1321 0.0161  225 ARG F O     
1730 C  CB    . ARG A 226 ? 0.2982 0.2852 0.6715 -0.0212 -0.1049 0.0312  225 ARG F CB    
1731 C  CG    . ARG A 226 ? 0.3231 0.3181 0.7034 -0.0210 -0.0902 0.0359  225 ARG F CG    
1732 C  CD    . ARG A 226 ? 0.2847 0.2910 0.6835 -0.0181 -0.0864 0.0338  225 ARG F CD    
1733 N  NE    . ARG A 226 ? 0.3528 0.3667 0.7593 -0.0183 -0.0734 0.0400  225 ARG F NE    
1734 C  CZ    . ARG A 226 ? 0.4414 0.4562 0.8545 -0.0180 -0.0639 0.0384  225 ARG F CZ    
1735 N  NH1   . ARG A 226 ? 0.3168 0.3254 0.7284 -0.0183 -0.0658 0.0300  225 ARG F NH1   
1736 N  NH2   . ARG A 226 ? 0.3759 0.3975 0.7980 -0.0176 -0.0530 0.0455  225 ARG F NH2   
1737 N  N     . SER A 227 ? 0.3045 0.2734 0.6572 -0.0252 -0.1285 0.0213  226 SER F N     
1738 C  CA    . SER A 227 ? 0.4073 0.3691 0.7538 -0.0261 -0.1448 0.0207  226 SER F CA    
1739 C  C     . SER A 227 ? 0.5095 0.4746 0.8681 -0.0243 -0.1515 0.0123  226 SER F C     
1740 O  O     . SER A 227 ? 0.5260 0.4878 0.8860 -0.0236 -0.1661 0.0119  226 SER F O     
1741 C  CB    . SER A 227 ? 0.3927 0.3449 0.7148 -0.0326 -0.1477 0.0251  226 SER F CB    
1742 O  OG    . SER A 227 ? 0.5010 0.4510 0.8141 -0.0343 -0.1444 0.0342  226 SER F OG    
1743 N  N     . GLN A 228 ? 0.4064 0.3784 0.7757 -0.0237 -0.1417 0.0064  227 GLN F N     
1744 C  CA    . GLN A 228 ? 0.3823 0.3596 0.7658 -0.0225 -0.1473 -0.0012 227 GLN F CA    
1745 C  C     . GLN A 228 ? 0.3914 0.3813 0.7987 -0.0172 -0.1424 -0.0043 227 GLN F C     
1746 O  O     . GLN A 228 ? 0.3788 0.3758 0.8007 -0.0164 -0.1445 -0.0104 227 GLN F O     
1747 C  CB    . GLN A 228 ? 0.4369 0.4116 0.8140 -0.0274 -0.1413 -0.0064 227 GLN F CB    
1748 C  CG    . GLN A 228 ? 0.5892 0.5534 0.9416 -0.0326 -0.1380 -0.0035 227 GLN F CG    
1749 C  CD    . GLN A 228 ? 0.6995 0.6575 1.0393 -0.0387 -0.1422 -0.0096 227 GLN F CD    
1750 O  OE1   . GLN A 228 ? 0.8800 0.8314 1.2031 -0.0430 -0.1337 -0.0110 227 GLN F OE1   
1751 N  NE2   . GLN A 228 ? 0.6472 0.6077 0.9951 -0.0393 -0.1552 -0.0137 227 GLN F NE2   
1752 N  N     . GLY A 229 ? 0.3609 0.3547 0.7719 -0.0144 -0.1362 -0.0001 228 GLY F N     
1753 C  CA    . GLY A 229 ? 0.3501 0.3568 0.7806 -0.0107 -0.1296 -0.0027 228 GLY F CA    
1754 C  C     . GLY A 229 ? 0.3151 0.3281 0.7513 -0.0126 -0.1154 -0.0026 228 GLY F C     
1755 O  O     . GLY A 229 ? 0.3367 0.3616 0.7891 -0.0107 -0.1099 -0.0044 228 GLY F O     
1756 N  N     . ILE A 230 ? 0.3180 0.3232 0.7418 -0.0163 -0.1091 -0.0004 229 ILE F N     
1757 C  CA    . ILE A 230 ? 0.2179 0.2266 0.6488 -0.0178 -0.0960 -0.0004 229 ILE F CA    
1758 C  C     . ILE A 230 ? 0.2376 0.2506 0.6693 -0.0166 -0.0860 0.0078  229 ILE F C     
1759 O  O     . ILE A 230 ? 0.2996 0.3067 0.7180 -0.0174 -0.0850 0.0133  229 ILE F O     
1760 C  CB    . ILE A 230 ? 0.3124 0.3102 0.7310 -0.0218 -0.0931 -0.0034 229 ILE F CB    
1761 C  CG1   . ILE A 230 ? 0.3139 0.3088 0.7324 -0.0242 -0.1036 -0.0114 229 ILE F CG1   
1762 C  CG2   . ILE A 230 ? 0.2844 0.2838 0.7118 -0.0225 -0.0786 -0.0026 229 ILE F CG2   
1763 C  CD1   . ILE A 230 ? 0.4001 0.3824 0.8004 -0.0294 -0.1030 -0.0152 229 ILE F CD1   
1860 N  N     . LYS A 242 ? 0.3296 0.4036 0.4170 0.0001  0.1239  0.1077  241 LYS F N     
1861 C  CA    . LYS A 242 ? 0.3168 0.3978 0.3951 0.0059  0.1250  0.1099  241 LYS F CA    
1862 C  C     . LYS A 242 ? 0.3474 0.4399 0.4198 0.0168  0.1172  0.1154  241 LYS F C     
1863 O  O     . LYS A 242 ? 0.3534 0.4512 0.4156 0.0243  0.1189  0.1173  241 LYS F O     
1864 C  CB    . LYS A 242 ? 0.2730 0.3788 0.3661 -0.0008 0.1216  0.1077  241 LYS F CB    
1865 C  CG    . LYS A 242 ? 0.3866 0.4842 0.4879 -0.0115 0.1305  0.1023  241 LYS F CG    
1866 C  CD    . LYS A 242 ? 0.4720 0.5959 0.5900 -0.0182 0.1273  0.0999  241 LYS F CD    
1867 C  CE    . LYS A 242 ? 0.4936 0.6092 0.6233 -0.0297 0.1367  0.0943  241 LYS F CE    
1868 N  NZ    . LYS A 242 ? 0.5743 0.7183 0.7248 -0.0370 0.1327  0.0914  241 LYS F NZ    
1869 N  N     . SER A 243 ? 0.3079 0.4067 0.3877 0.0181  0.1088  0.1181  242 SER F N     
1870 C  CA    . SER A 243 ? 0.2152 0.3286 0.2941 0.0267  0.1007  0.1238  242 SER F CA    
1871 C  C     . SER A 243 ? 0.3037 0.4078 0.3837 0.0291  0.0984  0.1262  242 SER F C     
1872 O  O     . SER A 243 ? 0.2833 0.3751 0.3676 0.0235  0.1010  0.1233  242 SER F O     
1873 C  CB    . SER A 243 ? 0.2638 0.4066 0.3565 0.0240  0.0894  0.1258  242 SER F CB    
1874 O  OG    . SER A 243 ? 0.2472 0.3934 0.3539 0.0162  0.0839  0.1250  242 SER F OG    
1875 N  N     . VAL A 244 ? 0.2955 0.4077 0.3723 0.0378  0.0942  0.1317  243 VAL F N     
1876 C  CA    . VAL A 244 ? 0.3770 0.4868 0.4573 0.0408  0.0909  0.1355  243 VAL F CA    
1877 C  C     . VAL A 244 ? 0.3718 0.5094 0.4633 0.0438  0.0800  0.1419  243 VAL F C     
1878 O  O     . VAL A 244 ? 0.2842 0.4351 0.3707 0.0502  0.0791  0.1442  243 VAL F O     
1879 C  CB    . VAL A 244 ? 0.3565 0.4415 0.4156 0.0499  0.0996  0.1362  243 VAL F CB    
1880 C  CG1   . VAL A 244 ? 0.2730 0.3555 0.3360 0.0517  0.0970  0.1395  243 VAL F CG1   
1881 C  CG2   . VAL A 244 ? 0.3124 0.3673 0.3558 0.0467  0.1111  0.1302  243 VAL F CG2   
1882 N  N     . GLY A 245 ? 0.2819 0.4282 0.3881 0.0394  0.0721  0.1449  244 GLY F N     
1883 C  CA    . GLY A 245 ? 0.2280 0.3976 0.3439 0.0401  0.0618  0.1517  244 GLY F CA    
1884 C  C     . GLY A 245 ? 0.2985 0.4675 0.4233 0.0405  0.0583  0.1568  244 GLY F C     
1885 O  O     . GLY A 245 ? 0.2828 0.4364 0.4103 0.0378  0.0614  0.1545  244 GLY F O     
1886 N  N     . VAL A 246 ? 0.2790 0.4657 0.4083 0.0435  0.0523  0.1641  245 VAL F N     
1887 C  CA    . VAL A 246 ? 0.2377 0.4276 0.3773 0.0429  0.0481  0.1707  245 VAL F CA    
1888 C  C     . VAL A 246 ? 0.2624 0.4714 0.4087 0.0376  0.0384  0.1770  245 VAL F C     
1889 O  O     . VAL A 246 ? 0.2096 0.4337 0.3505 0.0403  0.0376  0.1788  245 VAL F O     
1890 C  CB    . VAL A 246 ? 0.3176 0.5056 0.4512 0.0527  0.0544  0.1741  245 VAL F CB    
1891 C  CG1   . VAL A 246 ? 0.3997 0.5931 0.5465 0.0509  0.0500  0.1816  245 VAL F CG1   
1892 C  CG2   . VAL A 246 ? 0.3264 0.4848 0.4415 0.0569  0.0667  0.1665  245 VAL F CG2   
1893 N  N     . GLU A 247 ? 0.2336 0.4406 0.3899 0.0302  0.0324  0.1796  246 GLU F N     
1894 C  CA    . GLU A 247 ? 0.1939 0.4147 0.3543 0.0241  0.0254  0.1851  246 GLU F CA    
1895 C  C     . GLU A 247 ? 0.2948 0.5115 0.4685 0.0188  0.0206  0.1908  246 GLU F C     
1896 O  O     . GLU A 247 ? 0.1945 0.3979 0.3746 0.0193  0.0218  0.1896  246 GLU F O     
1897 C  CB    . GLU A 247 ? 0.2246 0.4497 0.3815 0.0206  0.0231  0.1834  246 GLU F CB    
1898 C  CG    . GLU A 247 ? 0.3521 0.5655 0.5141 0.0176  0.0219  0.1818  246 GLU F CG    
1899 C  CD    . GLU A 247 ? 0.4549 0.6723 0.6109 0.0164  0.0223  0.1784  246 GLU F CD    
1900 O  OE1   . GLU A 247 ? 0.5025 0.7244 0.6495 0.0195  0.0264  0.1738  246 GLU F OE1   
1901 O  OE2   . GLU A 247 ? 0.4318 0.6488 0.5929 0.0127  0.0188  0.1812  246 GLU F OE2   
1902 N  N     . ARG A 248 ? 0.3114 0.5403 0.4909 0.0135  0.0159  0.1962  247 ARG F N     
1903 C  CA    . ARG A 248 ? 0.2902 0.5161 0.4845 0.0073  0.0109  0.2018  247 ARG F CA    
1904 C  C     . ARG A 248 ? 0.2209 0.4579 0.4200 0.0008  0.0060  0.2070  247 ARG F C     
1905 O  O     . ARG A 248 ? 0.2687 0.5212 0.4634 0.0002  0.0068  0.2069  247 ARG F O     
1906 C  CB    . ARG A 248 ? 0.3731 0.6026 0.5763 0.0069  0.0108  0.2029  247 ARG F CB    
1907 C  CG    . ARG A 248 ? 0.4636 0.6788 0.6708 0.0111  0.0141  0.2022  247 ARG F CG    
1908 C  CD    . ARG A 248 ? 0.5529 0.7524 0.7653 0.0102  0.0133  0.2021  247 ARG F CD    
1909 N  NE    . ARG A 248 ? 0.5794 0.7666 0.7981 0.0144  0.0181  0.2006  247 ARG F NE    
1910 C  CZ    . ARG A 248 ? 0.7618 0.9405 0.9710 0.0217  0.0270  0.1942  247 ARG F CZ    
1911 N  NH1   . ARG A 248 ? 0.6715 0.8519 0.8659 0.0249  0.0304  0.1888  247 ARG F NH1   
1912 N  NH2   . ARG A 248 ? 0.7970 0.9631 1.0102 0.0247  0.0343  0.1920  247 ARG F NH2   
1913 N  N     . THR A 249 ? 0.2393 0.4694 0.4487 -0.0033 0.0015  0.2119  248 THR F N     
1914 C  CA    . THR A 249 ? 0.2107 0.4508 0.4287 -0.0097 -0.0033 0.2194  248 THR F CA    
1915 C  C     . THR A 249 ? 0.2296 0.4705 0.4642 -0.0155 -0.0070 0.2230  248 THR F C     
1916 O  O     . THR A 249 ? 0.3021 0.5300 0.5460 -0.0157 -0.0088 0.2229  248 THR F O     
1917 C  CB    . THR A 249 ? 0.2993 0.5336 0.5208 -0.0103 -0.0065 0.2237  248 THR F CB    
1918 O  OG1   . THR A 249 ? 0.2723 0.5099 0.4804 -0.0063 -0.0038 0.2199  248 THR F OG1   
1919 C  CG2   . THR A 249 ? 0.2479 0.4918 0.4816 -0.0170 -0.0119 0.2341  248 THR F CG2   
1920 N  N     . MET A 250 ? 0.2568 0.5140 0.4968 -0.0203 -0.0081 0.2253  249 MET F N     
1921 C  CA    . MET A 250 ? 0.3125 0.5737 0.5717 -0.0271 -0.0127 0.2275  249 MET F CA    
1922 C  C     . MET A 250 ? 0.3843 0.6407 0.6583 -0.0338 -0.0186 0.2366  249 MET F C     
1923 O  O     . MET A 250 ? 0.2968 0.5551 0.5670 -0.0341 -0.0190 0.2425  249 MET F O     
1924 C  CB    . MET A 250 ? 0.3487 0.6322 0.6119 -0.0297 -0.0116 0.2251  249 MET F CB    
1925 C  CG    . MET A 250 ? 0.4524 0.7423 0.7112 -0.0235 -0.0089 0.2155  249 MET F CG    
1926 S  SD    . MET A 250 ? 0.6051 0.8915 0.8378 -0.0134 -0.0012 0.2109  249 MET F SD    
1927 C  CE    . MET A 250 ? 0.4386 0.7427 0.6662 -0.0158 0.0009  0.2147  249 MET F CE    
1928 N  N     . ALA A 251 ? 0.3228 0.5737 0.6155 -0.0392 -0.0240 0.2376  250 ALA F N     
1929 C  CA    . ALA A 251 ? 0.3253 0.5708 0.6354 -0.0460 -0.0304 0.2463  250 ALA F CA    
1930 C  C     . ALA A 251 ? 0.3929 0.6560 0.7086 -0.0528 -0.0308 0.2532  250 ALA F C     
1931 O  O     . ALA A 251 ? 0.4187 0.6805 0.7408 -0.0562 -0.0337 0.2624  250 ALA F O     
1932 C  CB    . ALA A 251 ? 0.3589 0.5958 0.6896 -0.0511 -0.0371 0.2445  250 ALA F CB    
1933 N  N     . GLU A 252 ? 0.3996 0.6809 0.7155 -0.0549 -0.0278 0.2490  251 GLU F N     
1934 C  CA    . GLU A 252 ? 0.3902 0.6918 0.7107 -0.0608 -0.0257 0.2545  251 GLU F CA    
1935 C  C     . GLU A 252 ? 0.3327 0.6489 0.6351 -0.0544 -0.0184 0.2489  251 GLU F C     
1936 O  O     . GLU A 252 ? 0.2737 0.5896 0.5678 -0.0481 -0.0160 0.2394  251 GLU F O     
1937 C  CB    . GLU A 252 ? 0.4396 0.7541 0.7836 -0.0704 -0.0290 0.2535  251 GLU F CB    
1938 C  CG    . GLU A 252 ? 0.6133 0.9127 0.9776 -0.0769 -0.0377 0.2557  251 GLU F CG    
1939 C  CD    . GLU A 252 ? 0.8152 1.1062 1.1874 -0.0826 -0.0409 0.2683  251 GLU F CD    
1940 O  OE1   . GLU A 252 ? 0.8690 1.1710 1.2347 -0.0837 -0.0368 0.2759  251 GLU F OE1   
1941 O  OE2   . GLU A 252 ? 0.9657 1.2397 1.3517 -0.0859 -0.0481 0.2705  251 GLU F OE2   
1942 N  N     . ASP A 253 ? 0.3025 0.6327 0.6003 -0.0560 -0.0150 0.2552  252 ASP F N     
1943 C  CA    . ASP A 253 ? 0.2162 0.5623 0.4997 -0.0506 -0.0084 0.2499  252 ASP F CA    
1944 C  C     . ASP A 253 ? 0.4189 0.7825 0.7132 -0.0520 -0.0063 0.2418  252 ASP F C     
1945 O  O     . ASP A 253 ? 0.3370 0.7086 0.6527 -0.0602 -0.0092 0.2430  252 ASP F O     
1946 C  CB    . ASP A 253 ? 0.2173 0.5791 0.4979 -0.0535 -0.0056 0.2585  252 ASP F CB    
1947 C  CG    . ASP A 253 ? 0.4385 0.7883 0.7115 -0.0517 -0.0089 0.2663  252 ASP F CG    
1948 O  OD1   . ASP A 253 ? 0.3543 0.6844 0.6197 -0.0459 -0.0117 0.2627  252 ASP F OD1   
1949 O  OD2   . ASP A 253 ? 0.4839 0.8463 0.7600 -0.0561 -0.0083 0.2759  252 ASP F OD2   
1950 N  N     . ILE A 254 ? 0.3679 0.7392 0.6495 -0.0439 -0.0017 0.2330  253 ILE F N     
1951 C  CA    . ILE A 254 ? 0.3410 0.7330 0.6336 -0.0428 0.0000  0.2241  253 ILE F CA    
1952 C  C     . ILE A 254 ? 0.3438 0.7604 0.6351 -0.0431 0.0066  0.2254  253 ILE F C     
1953 O  O     . ILE A 254 ? 0.2238 0.6395 0.4984 -0.0402 0.0101  0.2297  253 ILE F O     
1954 C  CB    . ILE A 254 ? 0.3186 0.7045 0.6010 -0.0324 0.0001  0.2129  253 ILE F CB    
1955 C  CG1   . ILE A 254 ? 0.3514 0.7325 0.6088 -0.0239 0.0057  0.2116  253 ILE F CG1   
1956 C  CG2   . ILE A 254 ? 0.3530 0.7170 0.6388 -0.0325 -0.0059 0.2119  253 ILE F CG2   
1957 C  CD1   . ILE A 254 ? 0.3189 0.6978 0.5668 -0.0133 0.0071  0.2011  253 ILE F CD1   
1958 N  N     . HIS A 255 ? 0.3557 0.7964 0.6669 -0.0465 0.0078  0.2209  254 HIS F N     
1959 C  CA    . HIS A 255 ? 0.3508 0.8182 0.6653 -0.0477 0.0149  0.2221  254 HIS F CA    
1960 C  C     . HIS A 255 ? 0.3525 0.8420 0.6746 -0.0404 0.0174  0.2095  254 HIS F C     
1961 O  O     . HIS A 255 ? 0.2469 0.7610 0.5736 -0.0404 0.0240  0.2091  254 HIS F O     
1962 C  CB    . HIS A 255 ? 0.3350 0.8160 0.6714 -0.0611 0.0156  0.2313  254 HIS F CB    
1963 C  CG    . HIS A 255 ? 0.3540 0.8178 0.6832 -0.0671 0.0136  0.2449  254 HIS F CG    
1964 N  ND1   . HIS A 255 ? 0.3893 0.8299 0.7231 -0.0711 0.0061  0.2490  254 HIS F ND1   
1965 C  CD2   . HIS A 255 ? 0.4190 0.8864 0.7374 -0.0688 0.0173  0.2551  254 HIS F CD2   
1966 C  CE1   . HIS A 255 ? 0.3606 0.7913 0.6879 -0.0746 0.0052  0.2610  254 HIS F CE1   
1967 N  NE2   . HIS A 255 ? 0.4793 0.9264 0.7972 -0.0734 0.0116  0.2650  254 HIS F NE2   
1968 N  N     . HIS A 256 ? 0.2673 0.7499 0.5914 -0.0334 0.0122  0.1993  255 HIS F N     
1969 C  CA    . HIS A 256 ? 0.2605 0.7651 0.5963 -0.0253 0.0120  0.1865  255 HIS F CA    
1970 C  C     . HIS A 256 ? 0.2177 0.7086 0.5329 -0.0114 0.0109  0.1787  255 HIS F C     
1971 O  O     . HIS A 256 ? 0.2829 0.7482 0.5858 -0.0097 0.0070  0.1800  255 HIS F O     
1972 C  CB    . HIS A 256 ? 0.3035 0.8195 0.6700 -0.0299 0.0040  0.1800  255 HIS F CB    
1973 C  CG    . HIS A 256 ? 0.2566 0.7867 0.6462 -0.0446 0.0053  0.1873  255 HIS F CG    
1974 N  ND1   . HIS A 256 ? 0.2377 0.7960 0.6401 -0.0487 0.0132  0.1888  255 HIS F ND1   
1975 C  CD2   . HIS A 256 ? 0.3440 0.8635 0.7464 -0.0565 0.0004  0.1943  255 HIS F CD2   
1976 C  CE1   . HIS A 256 ? 0.2499 0.8146 0.6720 -0.0629 0.0135  0.1966  255 HIS F CE1   
1977 N  NE2   . HIS A 256 ? 0.3291 0.8702 0.7517 -0.0678 0.0054  0.2000  255 HIS F NE2   
1978 N  N     . TRP A 257 ? 0.2215 0.7300 0.5339 -0.0012 0.0146  0.1707  256 TRP F N     
1979 C  CA    . TRP A 257 ? 0.2763 0.7726 0.5690 0.0128  0.0139  0.1635  256 TRP F CA    
1980 C  C     . TRP A 257 ? 0.1923 0.6770 0.4915 0.0181  0.0042  0.1564  256 TRP F C     
1981 O  O     . TRP A 257 ? 0.1863 0.6492 0.4664 0.0250  0.0032  0.1556  256 TRP F O     
1982 C  CB    . TRP A 257 ? 0.2020 0.7215 0.4950 0.0239  0.0181  0.1550  256 TRP F CB    
1983 C  CG    . TRP A 257 ? 0.2057 0.7141 0.4842 0.0395  0.0149  0.1460  256 TRP F CG    
1984 C  CD1   . TRP A 257 ? 0.2019 0.7204 0.4919 0.0514  0.0079  0.1345  256 TRP F CD1   
1985 C  CD2   . TRP A 257 ? 0.1922 0.6757 0.4427 0.0451  0.0176  0.1482  256 TRP F CD2   
1986 N  NE1   . TRP A 257 ? 0.2511 0.7516 0.5193 0.0650  0.0065  0.1301  256 TRP F NE1   
1987 C  CE2   . TRP A 257 ? 0.2513 0.7310 0.4961 0.0607  0.0133  0.1383  256 TRP F CE2   
1988 C  CE3   . TRP A 257 ? 0.2597 0.7245 0.4902 0.0393  0.0227  0.1571  256 TRP F CE3   
1989 C  CZ2   . TRP A 257 ? 0.2694 0.7274 0.4894 0.0696  0.0157  0.1378  256 TRP F CZ2   
1990 C  CZ3   . TRP A 257 ? 0.3032 0.7479 0.5116 0.0475  0.0245  0.1557  256 TRP F CZ3   
1991 C  CH2   . TRP A 257 ? 0.2414 0.6830 0.4448 0.0621  0.0219  0.1466  256 TRP F CH2   
1992 N  N     . SER A 258 ? 0.2940 0.7942 0.6205 0.0155  -0.0036 0.1507  257 SER F N     
1993 C  CA    . SER A 258 ? 0.2748 0.7645 0.6074 0.0214  -0.0154 0.1433  257 SER F CA    
1994 C  C     . SER A 258 ? 0.2538 0.7135 0.5726 0.0157  -0.0165 0.1513  257 SER F C     
1995 O  O     . SER A 258 ? 0.2123 0.6546 0.5192 0.0248  -0.0217 0.1474  257 SER F O     
1996 C  CB    . SER A 258 ? 0.2908 0.8019 0.6575 0.0165  -0.0249 0.1368  257 SER F CB    
1997 O  OG    . SER A 258 ? 0.2495 0.7611 0.6292 -0.0007 -0.0225 0.1464  257 SER F OG    
1998 N  N     . GLU A 259 ? 0.1882 0.6411 0.5081 0.0017  -0.0119 0.1628  258 GLU F N     
1999 C  CA    . GLU A 259 ? 0.1934 0.6179 0.5018 -0.0032 -0.0128 0.1706  258 GLU F CA    
2000 C  C     . GLU A 259 ? 0.3037 0.7092 0.5831 0.0044  -0.0060 0.1729  258 GLU F C     
2001 O  O     . GLU A 259 ? 0.2702 0.6545 0.5401 0.0072  -0.0080 0.1736  258 GLU F O     
2002 C  CB    . GLU A 259 ? 0.2289 0.6500 0.5445 -0.0179 -0.0104 0.1825  258 GLU F CB    
2003 C  CG    . GLU A 259 ? 0.2882 0.7286 0.6337 -0.0273 -0.0156 0.1814  258 GLU F CG    
2004 C  CD    . GLU A 259 ? 0.4827 0.9190 0.8330 -0.0406 -0.0126 0.1944  258 GLU F CD    
2005 O  OE1   . GLU A 259 ? 0.7213 1.1452 1.0831 -0.0485 -0.0188 0.1988  258 GLU F OE1   
2006 O  OE2   . GLU A 259 ? 0.4161 0.8611 0.7582 -0.0422 -0.0047 0.2004  258 GLU F OE2   
2007 N  N     . CYS A 260 ? 0.2037 0.6173 0.4702 0.0074  0.0019  0.1739  259 CYS F N     
2008 C  CA    . CYS A 260 ? 0.1711 0.5679 0.4118 0.0139  0.0077  0.1754  259 CYS F CA    
2009 C  C     . CYS A 260 ? 0.2064 0.5974 0.4391 0.0275  0.0056  0.1666  259 CYS F C     
2010 O  O     . CYS A 260 ? 0.2028 0.5727 0.4213 0.0309  0.0072  0.1683  259 CYS F O     
2011 C  CB    . CYS A 260 ? 0.1803 0.5899 0.4107 0.0153  0.0147  0.1767  259 CYS F CB    
2012 S  SG    . CYS A 260 ? 0.2640 0.6541 0.4653 0.0214  0.0205  0.1784  259 CYS F SG    
2013 N  N     . GLU A 261 ? 0.1821 0.5919 0.4242 0.0364  0.0017  0.1570  260 GLU F N     
2014 C  CA    . GLU A 261 ? 0.1796 0.5835 0.4126 0.0523  -0.0025 0.1481  260 GLU F CA    
2015 C  C     . GLU A 261 ? 0.2196 0.6058 0.4546 0.0541  -0.0111 0.1473  260 GLU F C     
2016 O  O     . GLU A 261 ? 0.2592 0.6273 0.4764 0.0655  -0.0117 0.1450  260 GLU F O     
2017 C  CB    . GLU A 261 ? 0.2633 0.6911 0.5092 0.0618  -0.0079 0.1377  260 GLU F CB    
2018 C  CG    . GLU A 261 ? 0.3771 0.7997 0.6066 0.0815  -0.0100 0.1289  260 GLU F CG    
2019 C  CD    . GLU A 261 ? 0.6427 1.0473 0.8667 0.0926  -0.0219 0.1235  260 GLU F CD    
2020 O  OE1   . GLU A 261 ? 0.7546 1.1376 0.9536 0.1050  -0.0203 0.1224  260 GLU F OE1   
2021 O  OE2   . GLU A 261 ? 0.7626 1.1729 1.0054 0.0895  -0.0333 0.1201  260 GLU F OE2   
2022 N  N     . ALA A 262 ? 0.3025 0.6928 0.5580 0.0436  -0.0180 0.1491  261 ALA F N     
2023 C  CA    . ALA A 262 ? 0.3133 0.6870 0.5712 0.0449  -0.0273 0.1484  261 ALA F CA    
2024 C  C     . ALA A 262 ? 0.2926 0.6412 0.5341 0.0417  -0.0198 0.1571  261 ALA F C     
2025 O  O     . ALA A 262 ? 0.2840 0.6142 0.5137 0.0511  -0.0234 0.1552  261 ALA F O     
2026 C  CB    . ALA A 262 ? 0.3374 0.7214 0.6223 0.0326  -0.0357 0.1491  261 ALA F CB    
2027 N  N     . ILE A 263 ? 0.2151 0.5612 0.4542 0.0298  -0.0101 0.1664  262 ILE F N     
2028 C  CA    . ILE A 263 ? 0.2530 0.5768 0.4784 0.0268  -0.0030 0.1741  262 ILE F CA    
2029 C  C     . ILE A 263 ? 0.2406 0.5549 0.4445 0.0399  0.0032  0.1709  262 ILE F C     
2030 O  O     . ILE A 263 ? 0.2728 0.5683 0.4680 0.0447  0.0051  0.1725  262 ILE F O     
2031 C  CB    . ILE A 263 ? 0.1819 0.5046 0.4049 0.0153  0.0029  0.1828  262 ILE F CB    
2032 C  CG1   . ILE A 263 ? 0.2975 0.6255 0.5400 0.0032  -0.0026 0.1877  262 ILE F CG1   
2033 C  CG2   . ILE A 263 ? 0.2100 0.5108 0.4180 0.0150  0.0086  0.1881  262 ILE F CG2   
2034 C  CD1   . ILE A 263 ? 0.4779 0.7916 0.7318 -0.0009 -0.0088 0.1900  262 ILE F CD1   
2035 N  N     . ILE A 264 ? 0.1828 0.5095 0.3781 0.0463  0.0071  0.1668  263 ILE F N     
2036 C  CA    . ILE A 264 ? 0.1619 0.4795 0.3368 0.0597  0.0128  0.1635  263 ILE F CA    
2037 C  C     . ILE A 264 ? 0.1849 0.4889 0.3517 0.0748  0.0058  0.1573  263 ILE F C     
2038 O  O     . ILE A 264 ? 0.2078 0.4903 0.3558 0.0838  0.0107  0.1582  263 ILE F O     
2039 C  CB    . ILE A 264 ? 0.2029 0.5380 0.3726 0.0654  0.0158  0.1587  263 ILE F CB    
2040 C  CG1   . ILE A 264 ? 0.2432 0.5846 0.4128 0.0533  0.0214  0.1649  263 ILE F CG1   
2041 C  CG2   . ILE A 264 ? 0.2678 0.5920 0.4167 0.0809  0.0206  0.1546  263 ILE F CG2   
2042 C  CD1   . ILE A 264 ? 0.2785 0.6382 0.4441 0.0587  0.0243  0.1603  263 ILE F CD1   
2043 N  N     . GLU A 265 ? 0.2615 0.5748 0.4389 0.0793  -0.0065 0.1503  264 GLU F N     
2044 C  CA    . GLU A 265 ? 0.3183 0.6124 0.4815 0.0948  -0.0169 0.1440  264 GLU F CA    
2045 C  C     . GLU A 265 ? 0.2642 0.5323 0.4193 0.0932  -0.0164 0.1496  264 GLU F C     
2046 O  O     . GLU A 265 ? 0.3130 0.5521 0.4407 0.1075  -0.0183 0.1469  264 GLU F O     
2047 C  CB    . GLU A 265 ? 0.2958 0.6056 0.4761 0.0973  -0.0327 0.1357  264 GLU F CB    
2048 C  CG    . GLU A 265 ? 0.3622 0.6942 0.5482 0.1040  -0.0346 0.1281  264 GLU F CG    
2049 C  CD    . GLU A 265 ? 0.4535 0.7679 0.6109 0.1251  -0.0371 0.1210  264 GLU F CD    
2050 O  OE1   . GLU A 265 ? 0.4877 0.7695 0.6174 0.1346  -0.0371 0.1221  264 GLU F OE1   
2051 O  OE2   . GLU A 265 ? 0.4543 0.7848 0.6152 0.1325  -0.0385 0.1145  264 GLU F OE2   
2052 N  N     . ARG A 266 ? 0.2701 0.5436 0.4450 0.0765  -0.0134 0.1573  265 ARG F N     
2053 C  CA    . ARG A 266 ? 0.3241 0.5735 0.4936 0.0755  -0.0120 0.1625  265 ARG F CA    
2054 C  C     . ARG A 266 ? 0.3620 0.5961 0.5168 0.0755  0.0036  0.1687  265 ARG F C     
2055 O  O     . ARG A 266 ? 0.3793 0.5836 0.5147 0.0830  0.0070  0.1699  265 ARG F O     
2056 C  CB    . ARG A 266 ? 0.3729 0.6319 0.5706 0.0589  -0.0167 0.1675  265 ARG F CB    
2057 C  CG    . ARG A 266 ? 0.4417 0.7162 0.6568 0.0581  -0.0324 0.1608  265 ARG F CG    
2058 C  CD    . ARG A 266 ? 0.6216 0.8980 0.8620 0.0433  -0.0384 0.1655  265 ARG F CD    
2059 N  NE    . ARG A 266 ? 0.7508 1.0444 1.0091 0.0264  -0.0327 0.1711  265 ARG F NE    
2060 C  CZ    . ARG A 266 ? 0.8341 1.1347 1.1152 0.0142  -0.0398 0.1731  265 ARG F CZ    
2061 N  NH1   . ARG A 266 ? 0.8325 1.1279 1.1257 0.0157  -0.0537 0.1690  265 ARG F NH1   
2062 N  NH2   . ARG A 266 ? 0.8269 1.1374 1.1163 0.0017  -0.0340 0.1793  265 ARG F NH2   
2063 N  N     . LEU A 267 ? 0.2534 0.5037 0.4132 0.0678  0.0133  0.1719  266 LEU F N     
2064 C  CA    . LEU A 267 ? 0.2162 0.4553 0.3662 0.0668  0.0268  0.1774  266 LEU F CA    
2065 C  C     . LEU A 267 ? 0.2731 0.4920 0.3942 0.0841  0.0316  0.1729  266 LEU F C     
2066 O  O     . LEU A 267 ? 0.3069 0.5002 0.4121 0.0868  0.0412  0.1758  266 LEU F O     
2067 C  CB    . LEU A 267 ? 0.1971 0.4518 0.3522 0.0547  0.0317  0.1811  266 LEU F CB    
2068 C  CG    . LEU A 267 ? 0.2774 0.5358 0.4462 0.0388  0.0269  0.1862  266 LEU F CG    
2069 C  CD1   . LEU A 267 ? 0.2392 0.5075 0.4017 0.0349  0.0270  0.1858  266 LEU F CD1   
2070 C  CD2   . LEU A 267 ? 0.2911 0.5300 0.4621 0.0338  0.0288  0.1913  266 LEU F CD2   
2071 N  N     . TYR A 268 ? 0.2641 0.4893 0.3750 0.0950  0.0259  0.1654  267 TYR F N     
2072 C  CA    . TYR A 268 ? 0.2782 0.4809 0.3583 0.1105  0.0310  0.1611  267 TYR F CA    
2073 C  C     . TYR A 268 ? 0.2696 0.4256 0.3165 0.1194  0.0334  0.1594  267 TYR F C     
2074 O  O     . TYR A 268 ? 0.3347 0.4646 0.3604 0.1207  0.0458  0.1603  267 TYR F O     
2075 C  CB    . TYR A 268 ? 0.3020 0.5173 0.3773 0.1219  0.0223  0.1521  267 TYR F CB    
2076 C  CG    . TYR A 268 ? 0.3294 0.5156 0.3702 0.1382  0.0268  0.1475  267 TYR F CG    
2077 C  CD1   . TYR A 268 ? 0.3043 0.4951 0.3416 0.1394  0.0373  0.1493  267 TYR F CD1   
2078 C  CD2   . TYR A 268 ? 0.3273 0.4775 0.3365 0.1519  0.0206  0.1412  267 TYR F CD2   
2079 C  CE1   . TYR A 268 ? 0.2634 0.4227 0.2680 0.1534  0.0418  0.1450  267 TYR F CE1   
2080 C  CE2   . TYR A 268 ? 0.3809 0.4980 0.3554 0.1646  0.0257  0.1369  267 TYR F CE2   
2081 C  CZ    . TYR A 268 ? 0.3396 0.4611 0.3127 0.1652  0.0364  0.1388  267 TYR F CZ    
2082 O  OH    . TYR A 268 ? 0.4361 0.5225 0.3751 0.1773  0.0413  0.1343  267 TYR F OH    
2083 N  N     . PRO A 269 ? 0.4020 0.5429 0.4402 0.1242  0.0229  0.1557  268 PRO F N     
2084 C  CA    . PRO A 269 ? 0.4737 0.5661 0.4736 0.1316  0.0277  0.1528  268 PRO F CA    
2085 C  C     . PRO A 269 ? 0.4215 0.4968 0.4221 0.1198  0.0425  0.1585  268 PRO F C     
2086 O  O     . PRO A 269 ? 0.4290 0.4663 0.3986 0.1223  0.0534  0.1548  268 PRO F O     
2087 C  CB    . PRO A 269 ? 0.5258 0.6130 0.5218 0.1383  0.0113  0.1482  268 PRO F CB    
2088 C  CG    . PRO A 269 ? 0.4665 0.5979 0.5067 0.1279  0.0014  0.1513  268 PRO F CG    
2089 C  CD    . PRO A 269 ? 0.3803 0.5451 0.4416 0.1220  0.0072  0.1532  268 PRO F CD    
2090 N  N     . GLU A 270 ? 0.3746 0.4770 0.4108 0.1047  0.0438  0.1644  269 GLU F N     
2091 C  CA    . GLU A 270 ? 0.4000 0.4894 0.4402 0.0935  0.0577  0.1681  269 GLU F CA    
2092 C  C     . GLU A 270 ? 0.3443 0.4312 0.3792 0.0904  0.0707  0.1660  269 GLU F C     
2093 O  O     . GLU A 270 ? 0.3228 0.3827 0.3437 0.0870  0.0819  0.1602  269 GLU F O     
2094 C  CB    . GLU A 270 ? 0.3796 0.4981 0.4595 0.0792  0.0541  0.1745  269 GLU F CB    
2095 C  CG    . GLU A 270 ? 0.4280 0.5449 0.5160 0.0789  0.0415  0.1727  269 GLU F CG    
2096 C  CD    . GLU A 270 ? 0.6735 0.7495 0.7346 0.0834  0.0463  0.1671  269 GLU F CD    
2097 O  OE1   . GLU A 270 ? 0.7335 0.8014 0.8038 0.0750  0.0553  0.1694  269 GLU F OE1   
2098 O  OE2   . GLU A 270 ? 0.7190 0.7709 0.7487 0.0960  0.0414  0.1604  269 GLU F OE2   
2099 N  N     . LEU A 271 ? 0.3184 0.4338 0.3654 0.0915  0.0683  0.1686  270 LEU F N     
2100 C  CA    . LEU A 271 ? 0.3215 0.4327 0.3621 0.0900  0.0780  0.1644  270 LEU F CA    
2101 C  C     . LEU A 271 ? 0.3584 0.4286 0.3594 0.1012  0.0838  0.1574  270 LEU F C     
2102 O  O     . LEU A 271 ? 0.3331 0.3806 0.3243 0.0963  0.0940  0.1519  270 LEU F O     
2103 C  CB    . LEU A 271 ? 0.2755 0.4252 0.3331 0.0913  0.0739  0.1688  270 LEU F CB    
2104 C  CG    . LEU A 271 ? 0.2895 0.4346 0.3386 0.0920  0.0811  0.1632  270 LEU F CG    
2105 C  CD1   . LEU A 271 ? 0.3280 0.4620 0.3874 0.0782  0.0844  0.1570  270 LEU F CD1   
2106 C  CD2   . LEU A 271 ? 0.3101 0.4940 0.3727 0.0952  0.0769  0.1663  270 LEU F CD2   
2107 N  N     . GLU A 272 ? 0.3388 0.3979 0.3179 0.1158  0.0751  0.1559  271 GLU F N     
2108 C  CA    . GLU A 272 ? 0.4166 0.4340 0.3559 0.1266  0.0789  0.1487  271 GLU F CA    
2109 C  C     . GLU A 272 ? 0.4532 0.4338 0.3746 0.1207  0.0887  0.1448  271 GLU F C     
2110 O  O     . GLU A 272 ? 0.4197 0.3710 0.3203 0.1202  0.0990  0.1400  271 GLU F O     
2111 C  CB    . GLU A 272 ? 0.4419 0.4566 0.3648 0.1427  0.0641  0.1450  271 GLU F CB    
2112 C  CG    . GLU A 272 ? 0.6364 0.6064 0.5168 0.1540  0.0654  0.1376  271 GLU F CG    
2113 C  CD    . GLU A 272 ? 0.8769 0.8485 0.7458 0.1688  0.0481  0.1324  271 GLU F CD    
2114 O  OE1   . GLU A 272 ? 1.0582 1.0414 0.9377 0.1684  0.0371  0.1326  271 GLU F OE1   
2115 O  OE2   . GLU A 272 ? 0.8819 0.8440 0.7332 0.1807  0.0447  0.1274  271 GLU F OE2   
2116 N  N     . ARG A 273 ? 0.3820 0.3641 0.3119 0.1162  0.0857  0.1467  272 ARG F N     
2117 C  CA    . ARG A 273 ? 0.4571 0.4070 0.3701 0.1120  0.0952  0.1427  272 ARG F CA    
2118 C  C     . ARG A 273 ? 0.4710 0.4218 0.4008 0.0981  0.1084  0.1404  272 ARG F C     
2119 O  O     . ARG A 273 ? 0.4752 0.3971 0.3866 0.0961  0.1189  0.1349  272 ARG F O     
2120 C  CB    . ARG A 273 ? 0.5505 0.5043 0.4715 0.1112  0.0884  0.1457  272 ARG F CB    
2121 C  CG    . ARG A 273 ? 0.5159 0.4460 0.4295 0.1048  0.0999  0.1427  272 ARG F CG    
2122 C  CD    . ARG A 273 ? 0.5376 0.4748 0.4645 0.1039  0.0929  0.1471  272 ARG F CD    
2123 N  NE    . ARG A 273 ? 0.5754 0.4936 0.4992 0.0980  0.1055  0.1443  272 ARG F NE    
2124 C  CZ    . ARG A 273 ? 0.5521 0.4877 0.5086 0.0857  0.1121  0.1455  272 ARG F CZ    
2125 N  NH1   . ARG A 273 ? 0.4400 0.4112 0.4326 0.0774  0.1065  0.1496  272 ARG F NH1   
2126 N  NH2   . ARG A 273 ? 0.5966 0.5147 0.5495 0.0825  0.1236  0.1419  272 ARG F NH2   
2127 N  N     . ARG A 274 ? 0.3519 0.3367 0.3175 0.0884  0.1066  0.1436  273 ARG F N     
2128 C  CA    . ARG A 274 ? 0.3810 0.3681 0.3638 0.0760  0.1143  0.1393  273 ARG F CA    
2129 C  C     . ARG A 274 ? 0.4128 0.3884 0.3835 0.0765  0.1200  0.1353  273 ARG F C     
2130 O  O     . ARG A 274 ? 0.3756 0.3328 0.3415 0.0701  0.1288  0.1300  273 ARG F O     
2131 C  CB    . ARG A 274 ? 0.3478 0.3717 0.3693 0.0666  0.1070  0.1427  273 ARG F CB    
2132 C  CG    . ARG A 274 ? 0.4211 0.4470 0.4545 0.0635  0.1049  0.1451  273 ARG F CG    
2133 C  CD    . ARG A 274 ? 0.4537 0.5140 0.5214 0.0569  0.0949  0.1502  273 ARG F CD    
2134 N  NE    . ARG A 274 ? 0.4897 0.5636 0.5724 0.0495  0.0927  0.1463  273 ARG F NE    
2135 C  CZ    . ARG A 274 ? 0.5332 0.6322 0.6400 0.0437  0.0826  0.1490  273 ARG F CZ    
2136 N  NH1   . ARG A 274 ? 0.3090 0.4237 0.4313 0.0433  0.0748  0.1560  273 ARG F NH1   
2137 N  NH2   . ARG A 274 ? 0.3436 0.4496 0.4559 0.0381  0.0802  0.1451  273 ARG F NH2   
2138 N  N     . LEU A 275 ? 0.4543 0.4399 0.4193 0.0845  0.1156  0.1382  274 LEU F N     
2139 C  CA    . LEU A 275 ? 0.3717 0.3417 0.3211 0.0869  0.1217  0.1350  274 LEU F CA    
2140 C  C     . LEU A 275 ? 0.4080 0.3341 0.3220 0.0924  0.1296  0.1306  274 LEU F C     
2141 O  O     . LEU A 275 ? 0.4995 0.4061 0.4070 0.0864  0.1389  0.1265  274 LEU F O     
2142 C  CB    . LEU A 275 ? 0.3805 0.3681 0.3265 0.0981  0.1155  0.1391  274 LEU F CB    
2143 C  CG    . LEU A 275 ? 0.4298 0.3967 0.3551 0.1031  0.1222  0.1361  274 LEU F CG    
2144 C  CD1   . LEU A 275 ? 0.4077 0.3812 0.3518 0.0885  0.1286  0.1331  274 LEU F CD1   
2145 C  CD2   . LEU A 275 ? 0.4200 0.4060 0.3405 0.1171  0.1155  0.1397  274 LEU F CD2   
2146 N  N     . ALA A 276 ? 0.5628 0.4733 0.4537 0.1034  0.1250  0.1313  275 ALA F N     
2147 C  CA    . ALA A 276 ? 0.6040 0.4724 0.4577 0.1100  0.1308  0.1269  275 ALA F CA    
2148 C  C     . ALA A 276 ? 0.7040 0.5547 0.5584 0.0989  0.1427  0.1231  275 ALA F C     
2149 O  O     . ALA A 276 ? 0.6725 0.4915 0.5028 0.1000  0.1515  0.1196  275 ALA F O     
2150 C  CB    . ALA A 276 ? 0.5458 0.4040 0.3764 0.1233  0.1208  0.1273  275 ALA F CB    
2151 N  N     . LYS A 277 ? 0.6399 0.5110 0.5220 0.0888  0.1431  0.1237  276 LYS F N     
2152 C  CA    . LYS A 277 ? 0.6351 0.4931 0.5206 0.0793  0.1541  0.1196  276 LYS F CA    
2153 C  C     . LYS A 277 ? 0.6585 0.5115 0.5506 0.0707  0.1622  0.1163  276 LYS F C     
2154 O  O     . LYS A 277 ? 0.6658 0.4964 0.5474 0.0667  0.1731  0.1128  276 LYS F O     
2155 C  CB    . LYS A 277 ? 0.5357 0.4187 0.4523 0.0710  0.1518  0.1205  276 LYS F CB    
2156 C  CG    . LYS A 277 ? 0.5740 0.4566 0.4832 0.0781  0.1465  0.1237  276 LYS F CG    
2157 C  CD    . LYS A 277 ? 0.6063 0.5061 0.5439 0.0697  0.1474  0.1240  276 LYS F CD    
2158 C  CE    . LYS A 277 ? 0.6924 0.5880 0.6218 0.0762  0.1436  0.1275  276 LYS F CE    
2159 N  NZ    . LYS A 277 ? 0.6301 0.5394 0.5873 0.0685  0.1463  0.1279  276 LYS F NZ    
2160 N  N     . VAL A 278 ? 0.5020 0.3755 0.4108 0.0678  0.1576  0.1177  277 VAL F N     
2161 C  CA    . VAL A 278 ? 0.5942 0.4648 0.5106 0.0591  0.1643  0.1148  277 VAL F CA    
2162 C  C     . VAL A 278 ? 0.6529 0.5026 0.5446 0.0670  0.1670  0.1154  277 VAL F C     
2163 O  O     . VAL A 278 ? 0.6365 0.4681 0.5223 0.0616  0.1762  0.1126  277 VAL F O     
2164 C  CB    . VAL A 278 ? 0.6334 0.5413 0.5864 0.0490  0.1576  0.1151  277 VAL F CB    
2165 C  CG1   . VAL A 278 ? 0.7666 0.6751 0.7254 0.0421  0.1620  0.1129  277 VAL F CG1   
2166 C  CG2   . VAL A 278 ? 0.7160 0.6352 0.6899 0.0402  0.1578  0.1128  277 VAL F CG2   
2167 N  N     . LYS A 279 ? 0.7325 0.5825 0.6086 0.0804  0.1594  0.1189  278 LYS F N     
2168 C  CA    . LYS A 279 ? 0.6193 0.4468 0.4681 0.0912  0.1608  0.1193  278 LYS F CA    
2169 C  C     . LYS A 279 ? 0.6093 0.4229 0.4301 0.1076  0.1532  0.1206  278 LYS F C     
2170 O  O     . LYS A 279 ? 0.6075 0.4436 0.4337 0.1167  0.1422  0.1239  278 LYS F O     
2171 C  CB    . LYS A 279 ? 0.5820 0.4342 0.4464 0.0918  0.1572  0.1218  278 LYS F CB    
2172 C  CG    . LYS A 279 ? 0.7713 0.6045 0.6297 0.0861  0.1675  0.1192  278 LYS F CG    
2173 C  CD    . LYS A 279 ? 0.8793 0.6898 0.7074 0.1013  0.1675  0.1204  278 LYS F CD    
2174 C  CE    . LYS A 279 ? 0.9067 0.6814 0.7183 0.0962  0.1799  0.1173  278 LYS F CE    
2175 N  NZ    . LYS A 279 ? 0.9710 0.7631 0.8140 0.0765  0.1867  0.1149  278 LYS F NZ    
2176 N  N     . PRO A 280 ? 0.7262 0.5049 0.5177 0.1115  0.1581  0.1179  279 PRO F N     
2177 C  CA    . PRO A 280 ? 0.7004 0.4667 0.4650 0.1265  0.1489  0.1181  279 PRO F CA    
2178 C  C     . PRO A 280 ? 0.6935 0.4572 0.4408 0.1426  0.1389  0.1186  279 PRO F C     
2179 O  O     . PRO A 280 ? 0.6944 0.4665 0.4344 0.1543  0.1261  0.1189  279 PRO F O     
2180 C  CB    . PRO A 280 ? 0.7985 0.5249 0.5330 0.1262  0.1587  0.1149  279 PRO F CB    
2181 C  CG    . PRO A 280 ? 0.7596 0.4918 0.5175 0.1092  0.1709  0.1137  279 PRO F CG    
2182 C  CD    . PRO A 280 ? 0.7039 0.4600 0.4909 0.1008  0.1713  0.1147  279 PRO F CD    
2183 N  N     . ASP A 281 ? 0.6180 0.3698 0.3585 0.1442  0.1437  0.1182  280 ASP F N     
2184 C  CA    . ASP A 281 ? 0.7432 0.4929 0.4677 0.1613  0.1341  0.1179  280 ASP F CA    
2185 C  C     . ASP A 281 ? 0.6451 0.4390 0.3986 0.1644  0.1255  0.1213  280 ASP F C     
2186 O  O     . ASP A 281 ? 0.5967 0.3952 0.3416 0.1797  0.1169  0.1205  280 ASP F O     
2187 C  CB    . ASP A 281 ? 0.9021 0.6167 0.6036 0.1633  0.1430  0.1160  280 ASP F CB    
2188 C  CG    . ASP A 281 ? 0.9382 0.6603 0.6620 0.1481  0.1549  0.1173  280 ASP F CG    
2189 O  OD1   . ASP A 281 ? 0.7532 0.5117 0.5113 0.1375  0.1547  0.1197  280 ASP F OD1   
2190 O  OD2   . ASP A 281 ? 0.8840 0.5752 0.5911 0.1462  0.1640  0.1156  280 ASP F OD2   
2191 N  N     . LEU A 282 ? 0.5961 0.4233 0.3841 0.1506  0.1277  0.1247  281 LEU F N     
2192 C  CA    . LEU A 282 ? 0.4925 0.3673 0.3116 0.1507  0.1204  0.1293  281 LEU F CA    
2193 C  C     . LEU A 282 ? 0.5156 0.4012 0.3388 0.1537  0.1236  0.1306  281 LEU F C     
2194 O  O     . LEU A 282 ? 0.4770 0.4024 0.3191 0.1588  0.1165  0.1341  281 LEU F O     
2195 C  CB    . LEU A 282 ? 0.5139 0.4088 0.3330 0.1650  0.1044  0.1298  281 LEU F CB    
2196 C  CG    . LEU A 282 ? 0.5603 0.4463 0.3734 0.1636  0.0992  0.1285  281 LEU F CG    
2197 C  CD1   . LEU A 282 ? 0.5963 0.5065 0.4144 0.1765  0.0815  0.1277  281 LEU F CD1   
2198 C  CD2   . LEU A 282 ? 0.6348 0.5360 0.4744 0.1455  0.1059  0.1317  281 LEU F CD2   
2199 N  N     . LEU A 283 ? 0.5946 0.4472 0.4006 0.1505  0.1345  0.1280  282 LEU F N     
2200 C  CA    . LEU A 283 ? 0.5524 0.4115 0.3590 0.1533  0.1378  0.1275  282 LEU F CA    
2201 C  C     . LEU A 283 ? 0.4958 0.3930 0.3403 0.1343  0.1424  0.1276  282 LEU F C     
2202 O  O     . LEU A 283 ? 0.5750 0.4679 0.4330 0.1177  0.1498  0.1283  282 LEU F O     
2203 C  CB    . LEU A 283 ? 0.6030 0.4092 0.3772 0.1556  0.1479  0.1247  282 LEU F CB    
2204 C  CG    . LEU A 283 ? 0.7125 0.4822 0.4502 0.1753  0.1406  0.1215  282 LEU F CG    
2205 C  CD1   . LEU A 283 ? 0.7351 0.4537 0.4432 0.1762  0.1502  0.1180  282 LEU F CD1   
2206 C  CD2   . LEU A 283 ? 0.6726 0.4708 0.4137 0.1959  0.1244  0.1193  282 LEU F CD2   
2207 N  N     . ILE A 284 ? 0.4752 0.4127 0.3411 0.1361  0.1350  0.1232  283 ILE F N     
2208 C  CA    . ILE A 284 ? 0.4548 0.4342 0.3561 0.1204  0.1360  0.1244  283 ILE F CA    
2209 C  C     . ILE A 284 ? 0.4199 0.4163 0.3264 0.1224  0.1341  0.1161  283 ILE F C     
2210 O  O     . ILE A 284 ? 0.5109 0.4906 0.3967 0.1369  0.1313  0.1094  283 ILE F O     
2211 C  CB    . ILE A 284 ? 0.4783 0.5012 0.4053 0.1194  0.1266  0.1305  283 ILE F CB    
2212 C  CG1   . ILE A 284 ? 0.3798 0.4226 0.3035 0.1371  0.1147  0.1274  283 ILE F CG1   
2213 C  CG2   . ILE A 284 ? 0.4834 0.4889 0.4081 0.1150  0.1277  0.1361  283 ILE F CG2   
2214 C  CD1   . ILE A 284 ? 0.3551 0.4452 0.3073 0.1356  0.1051  0.1329  283 ILE F CD1   
2215 N  N     . ALA A 285 ? 0.4294 0.4595 0.3630 0.1088  0.1350  0.1163  284 ALA F N     
2216 C  CA    . ALA A 285 ? 0.4534 0.5033 0.3913 0.1107  0.1325  0.1079  284 ALA F CA    
2217 C  C     . ALA A 285 ? 0.4570 0.5576 0.4130 0.1166  0.1233  0.1092  284 ALA F C     
2218 O  O     . ALA A 285 ? 0.4782 0.5906 0.4280 0.1277  0.1197  0.1014  284 ALA F O     
2219 C  CB    . ALA A 285 ? 0.4175 0.4707 0.3701 0.0931  0.1386  0.1054  284 ALA F CB    
2220 N  N     . ARG A 286 ? 0.3943 0.5250 0.3729 0.1093  0.1199  0.1189  285 ARG F N     
2221 C  CA    . ARG A 286 ? 0.2537 0.4310 0.2517 0.1116  0.1110  0.1212  285 ARG F CA    
2222 C  C     . ARG A 286 ? 0.3061 0.4908 0.3178 0.1080  0.1031  0.1293  285 ARG F C     
2223 O  O     . ARG A 286 ? 0.3603 0.5227 0.3729 0.1000  0.1050  0.1330  285 ARG F O     
2224 C  CB    . ARG A 286 ? 0.3268 0.5292 0.3435 0.0968  0.1058  0.1188  285 ARG F CB    
2225 C  CG    . ARG A 286 ? 0.3589 0.5508 0.3649 0.0956  0.1152  0.1114  285 ARG F CG    
2226 C  CD    . ARG A 286 ? 0.3985 0.6113 0.4220 0.0801  0.1105  0.1103  285 ARG F CD    
2227 N  NE    . ARG A 286 ? 0.5036 0.7511 0.5381 0.0795  0.0992  0.1114  285 ARG F NE    
2228 C  CZ    . ARG A 286 ? 0.6999 0.9687 0.7280 0.0874  0.0986  0.1052  285 ARG F CZ    
2229 N  NH1   . ARG A 286 ? 0.8091 1.0687 0.8196 0.0984  0.1077  0.0958  285 ARG F NH1   
2230 N  NH2   . ARG A 286 ? 0.7077 1.0043 0.7446 0.0850  0.0895  0.1078  285 ARG F NH2   
2231 N  N     . GLN A 287 ? 0.2790 0.4951 0.3020 0.1135  0.0943  0.1310  286 GLN F N     
2232 C  CA    . GLN A 287 ? 0.2840 0.5119 0.3235 0.1074  0.0859  0.1386  286 GLN F CA    
2233 C  C     . GLN A 287 ? 0.3180 0.5799 0.3733 0.1007  0.0756  0.1394  286 GLN F C     
2234 O  O     . GLN A 287 ? 0.2922 0.5710 0.3440 0.1058  0.0753  0.1340  286 GLN F O     
2235 C  CB    . GLN A 287 ? 0.3152 0.5355 0.3442 0.1235  0.0878  0.1417  286 GLN F CB    
2236 C  CG    . GLN A 287 ? 0.3068 0.5406 0.3280 0.1433  0.0839  0.1353  286 GLN F CG    
2237 C  CD    . GLN A 287 ? 0.3184 0.5397 0.3327 0.1543  0.0751  0.1355  286 GLN F CD    
2238 O  OE1   . GLN A 287 ? 0.3145 0.5027 0.3159 0.1518  0.0756  0.1383  286 GLN F OE1   
2239 N  NE2   . GLN A 287 ? 0.2812 0.5290 0.3037 0.1663  0.0669  0.1318  286 GLN F NE2   
2240 N  N     . GLY A 288 ? 0.3112 0.5792 0.3809 0.0891  0.0680  0.1457  287 GLY F N     
2241 C  CA    . GLY A 288 ? 0.1850 0.4765 0.2641 0.0809  0.0604  0.1472  287 GLY F CA    
2242 C  C     . GLY A 288 ? 0.2832 0.5756 0.3740 0.0711  0.0535  0.1545  287 GLY F C     
2243 O  O     . GLY A 288 ? 0.1808 0.4591 0.2741 0.0714  0.0538  0.1580  287 GLY F O     
2244 N  N     . VAL A 289 ? 0.2269 0.5359 0.3239 0.0634  0.0484  0.1568  288 VAL F N     
2245 C  CA    . VAL A 289 ? 0.2243 0.5350 0.3315 0.0548  0.0427  0.1633  288 VAL F CA    
2246 C  C     . VAL A 289 ? 0.2508 0.5639 0.3621 0.0446  0.0386  0.1666  288 VAL F C     
2247 O  O     . VAL A 289 ? 0.1911 0.5109 0.2978 0.0444  0.0397  0.1638  288 VAL F O     
2248 C  CB    . VAL A 289 ? 0.1929 0.5235 0.3051 0.0577  0.0417  0.1635  288 VAL F CB    
2249 C  CG1   . VAL A 289 ? 0.1836 0.5143 0.2907 0.0716  0.0452  0.1585  288 VAL F CG1   
2250 C  CG2   . VAL A 289 ? 0.1977 0.5502 0.3097 0.0570  0.0419  0.1618  288 VAL F CG2   
2251 N  N     . LYS A 290 ? 0.2714 0.5796 0.3914 0.0369  0.0338  0.1727  289 LYS F N     
2252 C  CA    . LYS A 290 ? 0.1761 0.4857 0.3004 0.0288  0.0295  0.1774  289 LYS F CA    
2253 C  C     . LYS A 290 ? 0.1944 0.5136 0.3281 0.0235  0.0261  0.1843  289 LYS F C     
2254 O  O     . LYS A 290 ? 0.2298 0.5431 0.3696 0.0229  0.0253  0.1856  289 LYS F O     
2255 C  CB    . LYS A 290 ? 0.1453 0.4338 0.2723 0.0255  0.0276  0.1773  289 LYS F CB    
2256 C  CG    . LYS A 290 ? 0.2855 0.5749 0.4182 0.0185  0.0224  0.1835  289 LYS F CG    
2257 C  CD    . LYS A 290 ? 0.4729 0.7482 0.6058 0.0172  0.0224  0.1802  289 LYS F CD    
2258 C  CE    . LYS A 290 ? 0.5015 0.7600 0.6430 0.0146  0.0198  0.1824  289 LYS F CE    
2259 N  NZ    . LYS A 290 ? 0.5303 0.7737 0.6721 0.0146  0.0225  0.1762  289 LYS F NZ    
2260 N  N     . LEU A 291 ? 0.2072 0.5423 0.3428 0.0195  0.0246  0.1888  290 LEU F N     
2261 C  CA    . LEU A 291 ? 0.2858 0.6286 0.4326 0.0128  0.0216  0.1966  290 LEU F CA    
2262 C  C     . LEU A 291 ? 0.2433 0.5843 0.3926 0.0073  0.0174  0.2039  290 LEU F C     
2263 O  O     . LEU A 291 ? 0.2061 0.5544 0.3489 0.0084  0.0178  0.2038  290 LEU F O     
2264 C  CB    . LEU A 291 ? 0.2179 0.5862 0.3682 0.0130  0.0245  0.1969  290 LEU F CB    
2265 C  CG    . LEU A 291 ? 0.1736 0.5493 0.3238 0.0198  0.0283  0.1893  290 LEU F CG    
2266 C  CD1   . LEU A 291 ? 0.2097 0.6126 0.3678 0.0187  0.0308  0.1901  290 LEU F CD1   
2267 C  CD2   . LEU A 291 ? 0.2428 0.6056 0.4008 0.0191  0.0262  0.1887  290 LEU F CD2   
2268 N  N     . LYS A 292 ? 0.2151 0.5482 0.3749 0.0018  0.0133  0.2106  291 LYS F N     
2269 C  CA    . LYS A 292 ? 0.2185 0.5543 0.3833 -0.0030 0.0089  0.2197  291 LYS F CA    
2270 C  C     . LYS A 292 ? 0.2663 0.6148 0.4439 -0.0094 0.0073  0.2291  291 LYS F C     
2271 O  O     . LYS A 292 ? 0.3031 0.6450 0.4897 -0.0122 0.0066  0.2288  291 LYS F O     
2272 C  CB    . LYS A 292 ? 0.1622 0.4775 0.3304 -0.0033 0.0049  0.2210  291 LYS F CB    
2273 C  CG    . LYS A 292 ? 0.2412 0.5626 0.4151 -0.0065 0.0001  0.2312  291 LYS F CG    
2274 C  CD    . LYS A 292 ? 0.3373 0.6399 0.5191 -0.0071 -0.0039 0.2331  291 LYS F CD    
2275 C  CE    . LYS A 292 ? 0.4769 0.7675 0.6518 -0.0030 -0.0021 0.2252  291 LYS F CE    
2276 N  NZ    . LYS A 292 ? 0.3417 0.6120 0.5251 -0.0038 -0.0034 0.2230  291 LYS F NZ    
2277 N  N     . PHE A 293 ? 0.3019 0.6691 0.4812 -0.0124 0.0068  0.2374  292 PHE F N     
2278 C  CA    . PHE A 293 ? 0.2701 0.6537 0.4614 -0.0191 0.0071  0.2461  292 PHE F CA    
2279 C  C     . PHE A 293 ? 0.3094 0.6865 0.5132 -0.0251 0.0011  0.2574  292 PHE F C     
2280 O  O     . PHE A 293 ? 0.3147 0.6777 0.5176 -0.0234 -0.0033 0.2589  292 PHE F O     
2281 C  CB    . PHE A 293 ? 0.2380 0.6478 0.4245 -0.0190 0.0115  0.2482  292 PHE F CB    
2282 C  CG    . PHE A 293 ? 0.2824 0.6988 0.4580 -0.0123 0.0173  0.2364  292 PHE F CG    
2283 C  CD1   . PHE A 293 ? 0.2923 0.7133 0.4731 -0.0115 0.0211  0.2301  292 PHE F CD1   
2284 C  CD2   . PHE A 293 ? 0.3171 0.7365 0.4792 -0.0066 0.0187  0.2313  292 PHE F CD2   
2285 C  CE1   . PHE A 293 ? 0.4284 0.8575 0.6009 -0.0041 0.0259  0.2202  292 PHE F CE1   
2286 C  CE2   . PHE A 293 ? 0.2804 0.7067 0.4337 0.0001  0.0238  0.2212  292 PHE F CE2   
2287 C  CZ    . PHE A 293 ? 0.3163 0.7472 0.4745 0.0019  0.0273  0.2159  292 PHE F CZ    
2288 N  N     . ASP A 294 ? 0.3420 0.7304 0.5592 -0.0326 0.0015  0.2652  293 ASP F N     
2289 C  CA    . ASP A 294 ? 0.4142 0.7962 0.6455 -0.0390 -0.0039 0.2760  293 ASP F CA    
2290 C  C     . ASP A 294 ? 0.4406 0.8295 0.6705 -0.0395 -0.0070 0.2853  293 ASP F C     
2291 O  O     . ASP A 294 ? 0.3395 0.7186 0.5795 -0.0423 -0.0127 0.2924  293 ASP F O     
2292 C  CB    . ASP A 294 ? 0.3810 0.7749 0.6283 -0.0482 -0.0018 0.2820  293 ASP F CB    
2293 C  CG    . ASP A 294 ? 0.4988 0.9210 0.7447 -0.0508 0.0053  0.2845  293 ASP F CG    
2294 O  OD1   . ASP A 294 ? 0.3777 0.8118 0.6114 -0.0468 0.0076  0.2851  293 ASP F OD1   
2295 O  OD2   . ASP A 294 ? 0.4923 0.9262 0.7513 -0.0575 0.0091  0.2854  293 ASP F OD2   
2296 N  N     . ASP A 295 ? 0.2777 0.6841 0.4965 -0.0368 -0.0036 0.2849  294 ASP F N     
2297 C  CA    . ASP A 295 ? 0.2347 0.6496 0.4518 -0.0368 -0.0066 0.2925  294 ASP F CA    
2298 C  C     . ASP A 295 ? 0.2540 0.6571 0.4617 -0.0295 -0.0098 0.2855  294 ASP F C     
2299 O  O     . ASP A 295 ? 0.3274 0.7406 0.5344 -0.0291 -0.0127 0.2915  294 ASP F O     
2300 C  CB    . ASP A 295 ? 0.3014 0.7442 0.5125 -0.0386 -0.0010 0.2969  294 ASP F CB    
2301 C  CG    . ASP A 295 ? 0.2873 0.7374 0.4839 -0.0322 0.0051  0.2844  294 ASP F CG    
2302 O  OD1   . ASP A 295 ? 0.2758 0.7094 0.4648 -0.0261 0.0044  0.2731  294 ASP F OD1   
2303 O  OD2   . ASP A 295 ? 0.5559 1.0288 0.7491 -0.0335 0.0113  0.2861  294 ASP F OD2   
2304 N  N     . PHE A 296 ? 0.3248 0.7084 0.5259 -0.0245 -0.0087 0.2734  295 PHE F N     
2305 C  CA    . PHE A 296 ? 0.3382 0.7058 0.5319 -0.0188 -0.0103 0.2657  295 PHE F CA    
2306 C  C     . PHE A 296 ? 0.3342 0.7112 0.5131 -0.0141 -0.0065 0.2580  295 PHE F C     
2307 O  O     . PHE A 296 ? 0.4002 0.7647 0.5735 -0.0104 -0.0070 0.2515  295 PHE F O     
2308 C  CB    . PHE A 296 ? 0.3047 0.6654 0.5075 -0.0205 -0.0158 0.2720  295 PHE F CB    
2309 C  CG    . PHE A 296 ? 0.3484 0.6838 0.5595 -0.0209 -0.0174 0.2679  295 PHE F CG    
2310 C  CD1   . PHE A 296 ? 0.5642 0.8984 0.7883 -0.0245 -0.0204 0.2757  295 PHE F CD1   
2311 C  CD2   . PHE A 296 ? 0.5127 0.8273 0.7194 -0.0177 -0.0159 0.2570  295 PHE F CD2   
2312 C  CE1   . PHE A 296 ? 0.7499 1.0626 0.9822 -0.0247 -0.0219 0.2718  295 PHE F CE1   
2313 C  CE2   . PHE A 296 ? 0.6378 0.9316 0.8526 -0.0177 -0.0169 0.2535  295 PHE F CE2   
2314 C  CZ    . PHE A 296 ? 0.6319 0.9247 0.8592 -0.0210 -0.0199 0.2604  295 PHE F CZ    
2315 N  N     . GLN A 297 ? 0.3501 0.7485 0.5232 -0.0143 -0.0022 0.2582  296 GLN F N     
2316 C  CA    . GLN A 297 ? 0.2729 0.6779 0.4322 -0.0091 0.0023  0.2484  296 GLN F CA    
2317 C  C     . GLN A 297 ? 0.3245 0.7114 0.4783 -0.0049 0.0060  0.2358  296 GLN F C     
2318 O  O     . GLN A 297 ? 0.3185 0.6991 0.4780 -0.0065 0.0068  0.2354  296 GLN F O     
2319 C  CB    . GLN A 297 ? 0.3376 0.7712 0.4931 -0.0097 0.0069  0.2513  296 GLN F CB    
2320 C  CG    . GLN A 297 ? 0.3365 0.7816 0.4784 -0.0040 0.0115  0.2419  296 GLN F CG    
2321 C  CD    . GLN A 297 ? 0.5128 0.9861 0.6519 -0.0040 0.0176  0.2437  296 GLN F CD    
2322 O  OE1   . GLN A 297 ? 0.5423 1.0213 0.6884 -0.0071 0.0204  0.2469  296 GLN F OE1   
2323 N  NE2   . GLN A 297 ? 0.3616 0.8539 0.4913 -0.0009 0.0201  0.2416  296 GLN F NE2   
2324 N  N     . GLN A 298 ? 0.3166 0.6964 0.4607 -0.0002 0.0082  0.2261  297 GLN F N     
2325 C  CA    . GLN A 298 ? 0.3300 0.6946 0.4693 0.0040  0.0121  0.2149  297 GLN F CA    
2326 C  C     . GLN A 298 ? 0.3209 0.6958 0.4492 0.0093  0.0172  0.2061  297 GLN F C     
2327 O  O     . GLN A 298 ? 0.3585 0.7453 0.4818 0.0099  0.0173  0.2065  297 GLN F O     
2328 C  CB    . GLN A 298 ? 0.4137 0.7520 0.5552 0.0045  0.0103  0.2107  297 GLN F CB    
2329 C  CG    . GLN A 298 ? 0.5791 0.9118 0.7154 0.0060  0.0109  0.2057  297 GLN F CG    
2330 C  CD    . GLN A 298 ? 0.5876 0.8947 0.7264 0.0069  0.0116  0.1992  297 GLN F CD    
2331 O  OE1   . GLN A 298 ? 0.6509 0.9460 0.7979 0.0049  0.0086  0.2032  297 GLN F OE1   
2332 N  NE2   . GLN A 298 ? 0.4115 0.7116 0.5442 0.0098  0.0163  0.1895  297 GLN F NE2   
2333 N  N     . THR A 299 ? 0.2550 0.6267 0.3801 0.0137  0.0214  0.1985  298 THR F N     
2334 C  CA    . THR A 299 ? 0.1732 0.5535 0.2889 0.0201  0.0267  0.1896  298 THR F CA    
2335 C  C     . THR A 299 ? 0.1997 0.5607 0.3132 0.0248  0.0293  0.1812  298 THR F C     
2336 O  O     . THR A 299 ? 0.2697 0.6190 0.3885 0.0240  0.0282  0.1824  298 THR F O     
2337 C  CB    . THR A 299 ? 0.3353 0.7410 0.4501 0.0226  0.0304  0.1899  298 THR F CB    
2338 O  OG1   . THR A 299 ? 0.3520 0.7669 0.4577 0.0303  0.0355  0.1806  298 THR F OG1   
2339 C  CG2   . THR A 299 ? 0.4197 0.8244 0.5425 0.0219  0.0310  0.1911  298 THR F CG2   
2340 N  N     . THR A 300 ? 0.2144 0.5733 0.3204 0.0296  0.0331  0.1732  299 THR F N     
2341 C  CA    . THR A 300 ? 0.2534 0.5970 0.3562 0.0353  0.0370  0.1657  299 THR F CA    
2342 C  C     . THR A 300 ? 0.4009 0.7596 0.4957 0.0440  0.0425  0.1588  299 THR F C     
2343 O  O     . THR A 300 ? 0.3137 0.6883 0.4037 0.0449  0.0440  0.1569  299 THR F O     
2344 C  CB    . THR A 300 ? 0.3437 0.6677 0.4463 0.0332  0.0379  0.1620  299 THR F CB    
2345 O  OG1   . THR A 300 ? 0.2491 0.5837 0.3471 0.0325  0.0395  0.1592  299 THR F OG1   
2346 C  CG2   . THR A 300 ? 0.2529 0.5624 0.3640 0.0261  0.0326  0.1678  299 THR F CG2   
2347 N  N     . GLN A 301 ? 0.2501 0.6058 0.3432 0.0516  0.0456  0.1550  300 GLN F N     
2348 C  CA    . GLN A 301 ? 0.2213 0.5865 0.3056 0.0623  0.0513  0.1467  300 GLN F CA    
2349 C  C     . GLN A 301 ? 0.2110 0.5582 0.2912 0.0706  0.0552  0.1423  300 GLN F C     
2350 O  O     . GLN A 301 ? 0.2574 0.5981 0.3412 0.0725  0.0539  0.1454  300 GLN F O     
2351 C  CB    . GLN A 301 ? 0.3286 0.7195 0.4128 0.0678  0.0523  0.1454  300 GLN F CB    
2352 C  CG    . GLN A 301 ? 0.5383 0.9351 0.6298 0.0690  0.0508  0.1481  300 GLN F CG    
2353 C  CD    . GLN A 301 ? 0.7240 1.1491 0.8171 0.0745  0.0531  0.1448  300 GLN F CD    
2354 O  OE1   . GLN A 301 ? 0.7523 1.1918 0.8547 0.0679  0.0515  0.1503  300 GLN F OE1   
2355 N  NE2   . GLN A 301 ? 0.6698 1.1028 0.7544 0.0869  0.0574  0.1354  300 GLN F NE2   
2356 N  N     . GLU A 302 ? 0.2111 0.5506 0.2831 0.0755  0.0607  0.1356  301 GLU F N     
2357 C  CA    . GLU A 302 ? 0.3213 0.6388 0.3867 0.0827  0.0667  0.1320  301 GLU F CA    
2358 C  C     . GLU A 302 ? 0.3324 0.6537 0.3848 0.0950  0.0736  0.1225  301 GLU F C     
2359 O  O     . GLU A 302 ? 0.3235 0.6615 0.3737 0.0942  0.0736  0.1184  301 GLU F O     
2360 C  CB    . GLU A 302 ? 0.3155 0.6110 0.3843 0.0722  0.0680  0.1334  301 GLU F CB    
2361 C  CG    . GLU A 302 ? 0.5582 0.8510 0.6393 0.0606  0.0602  0.1409  301 GLU F CG    
2362 C  CD    . GLU A 302 ? 0.7420 1.0226 0.8281 0.0500  0.0595  0.1406  301 GLU F CD    
2363 O  OE1   . GLU A 302 ? 0.7974 1.0717 0.8788 0.0496  0.0656  0.1350  301 GLU F OE1   
2364 O  OE2   . GLU A 302 ? 0.6638 0.9417 0.7586 0.0425  0.0531  0.1459  301 GLU F OE2   
2365 N  N     . HIS A 303 ? 0.2765 0.5799 0.3180 0.1075  0.0798  0.1187  302 HIS F N     
2366 C  CA    . HIS A 303 ? 0.3350 0.6364 0.3606 0.1224  0.0864  0.1083  302 HIS F CA    
2367 C  C     . HIS A 303 ? 0.3787 0.6452 0.3877 0.1325  0.0953  0.1060  302 HIS F C     
2368 O  O     . HIS A 303 ? 0.2752 0.5249 0.2846 0.1321  0.0958  0.1127  302 HIS F O     
2369 C  CB    . HIS A 303 ? 0.2800 0.6036 0.3046 0.1359  0.0825  0.1039  302 HIS F CB    
2370 C  CG    . HIS A 303 ? 0.3353 0.6585 0.3647 0.1417  0.0782  0.1090  302 HIS F CG    
2371 N  ND1   . HIS A 303 ? 0.3591 0.7031 0.4036 0.1325  0.0711  0.1155  302 HIS F ND1   
2372 C  CD2   . HIS A 303 ? 0.3965 0.6983 0.4158 0.1556  0.0803  0.1083  302 HIS F CD2   
2373 C  CE1   . HIS A 303 ? 0.4282 0.7672 0.4740 0.1399  0.0684  0.1174  302 HIS F CE1   
2374 N  NE2   . HIS A 303 ? 0.4118 0.7258 0.4422 0.1549  0.0732  0.1134  302 HIS F NE2   
2375 N  N     . VAL A 304 ? 0.3912 0.6437 0.3823 0.1422  0.1030  0.0960  303 VAL F N     
2376 C  CA    . VAL A 304 ? 0.4583 0.6632 0.4245 0.1524  0.1077  0.0904  303 VAL F CA    
2377 C  C     . VAL A 304 ? 0.3488 0.5439 0.3083 0.1670  0.1024  0.0926  303 VAL F C     
2378 O  O     . VAL A 304 ? 0.3315 0.5562 0.2978 0.1799  0.0974  0.0901  303 VAL F O     
2379 C  CB    . VAL A 304 ? 0.4574 0.6472 0.4048 0.1619  0.1095  0.0758  303 VAL F CB    
2380 C  CG1   . VAL A 304 ? 0.5354 0.6714 0.4552 0.1737  0.1103  0.0698  303 VAL F CG1   
2381 C  CG2   . VAL A 304 ? 0.4886 0.6796 0.4407 0.1454  0.1136  0.0731  303 VAL F CG2   
2382 N  N     . TRP A 305 ? 0.3673 0.5230 0.3145 0.1649  0.1036  0.0972  304 TRP F N     
2383 C  CA    . TRP A 305 ? 0.4123 0.5537 0.3493 0.1790  0.0973  0.0990  304 TRP F CA    
2384 C  C     . TRP A 305 ? 0.3959 0.4806 0.3076 0.1770  0.1021  0.1009  304 TRP F C     
2385 O  O     . TRP A 305 ? 0.4551 0.5280 0.3715 0.1599  0.1093  0.1059  304 TRP F O     
2386 C  CB    . TRP A 305 ? 0.4080 0.5857 0.3701 0.1741  0.0914  0.1086  304 TRP F CB    
2387 C  CG    . TRP A 305 ? 0.3644 0.5381 0.3198 0.1909  0.0819  0.1079  304 TRP F CG    
2388 C  CD1   . TRP A 305 ? 0.3872 0.5286 0.3280 0.1937  0.0787  0.1120  304 TRP F CD1   
2389 C  CD2   . TRP A 305 ? 0.3313 0.5353 0.2946 0.2076  0.0742  0.1022  304 TRP F CD2   
2390 N  NE1   . TRP A 305 ? 0.3881 0.5372 0.3267 0.2112  0.0677  0.1091  304 TRP F NE1   
2391 C  CE2   . TRP A 305 ? 0.4505 0.6390 0.4047 0.2200  0.0649  0.1029  304 TRP F CE2   
2392 C  CE3   . TRP A 305 ? 0.3284 0.5722 0.3055 0.2134  0.0742  0.0960  304 TRP F CE3   
2393 C  CZ2   . TRP A 305 ? 0.3591 0.5681 0.3184 0.2335  0.0545  0.0961  304 TRP F CZ2   
2394 C  CZ3   . TRP A 305 ? 0.4040 0.6635 0.3836 0.2240  0.0641  0.0893  304 TRP F CZ3   
2395 C  CH2   . TRP A 305 ? 0.3659 0.6096 0.3386 0.2335  0.0548  0.0891  304 TRP F CH2   
2396 N  N     . PRO A 306 ? 0.4141 0.4634 0.2988 0.1938  0.0988  0.0972  305 PRO F N     
2397 C  CA    . PRO A 306 ? 0.4660 0.4567 0.3214 0.1919  0.1056  0.0986  305 PRO F CA    
2398 C  C     . PRO A 306 ? 0.4600 0.4331 0.3096 0.1875  0.1057  0.1081  305 PRO F C     
2399 O  O     . PRO A 306 ? 0.4740 0.4054 0.3052 0.1798  0.1150  0.1111  305 PRO F O     
2400 C  CB    . PRO A 306 ? 0.5410 0.5010 0.3673 0.2144  0.1008  0.0907  305 PRO F CB    
2401 C  CG    . PRO A 306 ? 0.5727 0.5732 0.4136 0.2296  0.0885  0.0891  305 PRO F CG    
2402 C  CD    . PRO A 306 ? 0.4354 0.4942 0.3133 0.2164  0.0894  0.0903  305 PRO F CD    
2403 N  N     . ARG A 307 ? 0.4989 0.5016 0.3633 0.1920  0.0961  0.1122  306 ARG F N     
2404 C  CA    . ARG A 307 ? 0.4933 0.4750 0.3471 0.1913  0.0944  0.1191  306 ARG F CA    
2405 C  C     . ARG A 307 ? 0.4804 0.5084 0.3645 0.1883  0.0849  0.1233  306 ARG F C     
2406 O  O     . ARG A 307 ? 0.4892 0.5530 0.3889 0.1981  0.0754  0.1199  306 ARG F O     
2407 C  CB    . ARG A 307 ? 0.4782 0.4171 0.2943 0.2115  0.0887  0.1168  306 ARG F CB    
2408 C  CG    . ARG A 307 ? 0.6352 0.5492 0.4346 0.2121  0.0860  0.1221  306 ARG F CG    
2409 C  CD    . ARG A 307 ? 0.7034 0.5807 0.4687 0.2278  0.0785  0.1139  306 ARG F CD    
2410 N  NE    . ARG A 307 ? 0.8465 0.6986 0.5952 0.2228  0.0773  0.1132  306 ARG F NE    
2411 C  CZ    . ARG A 307 ? 0.9512 0.8221 0.7086 0.2253  0.0649  0.1118  306 ARG F CZ    
2412 N  NH1   . ARG A 307 ? 0.9626 0.8796 0.7484 0.2307  0.0529  0.1106  306 ARG F NH1   
2413 N  NH2   . ARG A 307 ? 0.8548 0.6992 0.5933 0.2219  0.0647  0.1110  306 ARG F NH2   
2414 N  N     . LEU A 308 ? 0.4483 0.4750 0.3414 0.1747  0.0879  0.1303  307 LEU F N     
2415 C  CA    . LEU A 308 ? 0.3860 0.4528 0.3091 0.1688  0.0797  0.1350  307 LEU F CA    
2416 C  C     . LEU A 308 ? 0.3899 0.4731 0.3136 0.1859  0.0649  0.1316  307 LEU F C     
2417 O  O     . LEU A 308 ? 0.4920 0.5426 0.3868 0.2007  0.0595  0.1282  307 LEU F O     
2418 C  CB    . LEU A 308 ? 0.4192 0.4659 0.3397 0.1579  0.0837  0.1411  307 LEU F CB    
2419 C  CG    . LEU A 308 ? 0.3987 0.4835 0.3518 0.1493  0.0758  0.1461  307 LEU F CG    
2420 C  CD1   . LEU A 308 ? 0.3419 0.4656 0.3285 0.1339  0.0801  0.1499  307 LEU F CD1   
2421 C  CD2   . LEU A 308 ? 0.3586 0.4179 0.3031 0.1438  0.0772  0.1492  307 LEU F CD2   
2422 N  N     . ASN A 309 ? 0.3260 0.4605 0.2825 0.1841  0.0586  0.1317  308 ASN F N     
2423 C  CA    . ASN A 309 ? 0.3202 0.4755 0.2827 0.1967  0.0455  0.1250  308 ASN F CA    
2424 C  C     . ASN A 309 ? 0.3128 0.5146 0.3129 0.1824  0.0397  0.1272  308 ASN F C     
2425 O  O     . ASN A 309 ? 0.2565 0.4918 0.2796 0.1711  0.0447  0.1302  308 ASN F O     
2426 C  CB    . ASN A 309 ? 0.3805 0.5433 0.3363 0.2107  0.0456  0.1169  308 ASN F CB    
2427 C  CG    . ASN A 309 ? 0.3285 0.5124 0.2922 0.2195  0.0330  0.1072  308 ASN F CG    
2428 O  OD1   . ASN A 309 ? 0.3810 0.6084 0.3751 0.2103  0.0298  0.1065  308 ASN F OD1   
2429 N  ND2   . ASN A 309 ? 0.3690 0.5203 0.3047 0.2363  0.0262  0.0998  308 ASN F ND2   
2430 N  N     . LYS A 310 ? 0.2886 0.4888 0.2923 0.1819  0.0289  0.1249  309 LYS F N     
2431 C  CA    . LYS A 310 ? 0.3056 0.5411 0.3429 0.1665  0.0235  0.1277  309 LYS F CA    
2432 C  C     . LYS A 310 ? 0.2475 0.5222 0.3062 0.1646  0.0203  0.1224  309 LYS F C     
2433 O  O     . LYS A 310 ? 0.2707 0.5731 0.3524 0.1483  0.0237  0.1271  309 LYS F O     
2434 C  CB    . LYS A 310 ? 0.3074 0.5295 0.3423 0.1685  0.0112  0.1252  309 LYS F CB    
2435 C  CG    . LYS A 310 ? 0.2633 0.5147 0.3318 0.1516  0.0061  0.1289  309 LYS F CG    
2436 C  CD    . LYS A 310 ? 0.5178 0.7752 0.5942 0.1570  -0.0101 0.1214  309 LYS F CD    
2437 C  CE    . LYS A 310 ? 0.5961 0.8157 0.6468 0.1663  -0.0177 0.1196  309 LYS F CE    
2438 N  NZ    . LYS A 310 ? 0.4507 0.6793 0.5112 0.1717  -0.0353 0.1118  309 LYS F NZ    
2439 N  N     . ALA A 311 ? 0.2674 0.5412 0.3162 0.1809  0.0139  0.1128  310 ALA F N     
2440 C  CA    . ALA A 311 ? 0.3727 0.6831 0.4427 0.1798  0.0109  0.1070  310 ALA F CA    
2441 C  C     . ALA A 311 ? 0.3493 0.6792 0.4243 0.1727  0.0223  0.1097  310 ALA F C     
2442 O  O     . ALA A 311 ? 0.2369 0.5975 0.3332 0.1607  0.0234  0.1107  310 ALA F O     
2443 C  CB    . ALA A 311 ? 0.2887 0.5919 0.3464 0.2003  0.0017  0.0958  310 ALA F CB    
2444 N  N     . ASP A 312 ? 0.2687 0.5782 0.3225 0.1797  0.0306  0.1108  311 ASP F N     
2445 C  CA    . ASP A 312 ? 0.3294 0.6557 0.3867 0.1725  0.0399  0.1126  311 ASP F CA    
2446 C  C     . ASP A 312 ? 0.2634 0.6015 0.3368 0.1493  0.0439  0.1230  311 ASP F C     
2447 O  O     . ASP A 312 ? 0.2148 0.5740 0.2972 0.1389  0.0464  0.1242  311 ASP F O     
2448 C  CB    . ASP A 312 ? 0.2601 0.5593 0.2926 0.1854  0.0473  0.1106  311 ASP F CB    
2449 C  CG    . ASP A 312 ? 0.2500 0.5634 0.2858 0.1763  0.0558  0.1121  311 ASP F CG    
2450 O  OD1   . ASP A 312 ? 0.3091 0.6445 0.3488 0.1790  0.0553  0.1056  311 ASP F OD1   
2451 O  OD2   . ASP A 312 ? 0.2974 0.5995 0.3322 0.1659  0.0625  0.1189  311 ASP F OD2   
2452 N  N     . LEU A 313 ? 0.2143 0.5362 0.2897 0.1414  0.0435  0.1302  312 LEU F N     
2453 C  CA    . LEU A 313 ? 0.2165 0.5458 0.3062 0.1201  0.0453  0.1394  312 LEU F CA    
2454 C  C     . LEU A 313 ? 0.2091 0.5619 0.3187 0.1096  0.0390  0.1395  312 LEU F C     
2455 O  O     . LEU A 313 ? 0.2644 0.6293 0.3815 0.0963  0.0402  0.1439  312 LEU F O     
2456 C  CB    . LEU A 313 ? 0.1986 0.5046 0.2865 0.1154  0.0469  0.1464  312 LEU F CB    
2457 C  CG    . LEU A 313 ? 0.3286 0.6095 0.4001 0.1221  0.0560  0.1487  312 LEU F CG    
2458 C  CD1   . LEU A 313 ? 0.2250 0.4823 0.2949 0.1208  0.0577  0.1549  312 LEU F CD1   
2459 C  CD2   . LEU A 313 ? 0.2907 0.5751 0.3635 0.1107  0.0608  0.1508  312 LEU F CD2   
2460 N  N     . ILE A 314 ? 0.1971 0.5549 0.3145 0.1169  0.0312  0.1341  313 ILE F N     
2461 C  CA    . ILE A 314 ? 0.2033 0.5851 0.3427 0.1082  0.0258  0.1332  313 ILE F CA    
2462 C  C     . ILE A 314 ? 0.1982 0.6040 0.3407 0.1088  0.0295  0.1298  313 ILE F C     
2463 O  O     . ILE A 314 ? 0.1935 0.6152 0.3481 0.0957  0.0310  0.1344  313 ILE F O     
2464 C  CB    . ILE A 314 ? 0.2034 0.5860 0.3511 0.1180  0.0147  0.1259  313 ILE F CB    
2465 C  CG1   . ILE A 314 ? 0.2072 0.5683 0.3541 0.1144  0.0098  0.1301  313 ILE F CG1   
2466 C  CG2   . ILE A 314 ? 0.2039 0.6156 0.3768 0.1123  0.0096  0.1226  313 ILE F CG2   
2467 C  CD1   . ILE A 314 ? 0.2857 0.6365 0.4287 0.1293  -0.0026 0.1218  313 ILE F CD1   
2468 N  N     . ALA A 315 ? 0.2958 0.7029 0.4261 0.1255  0.0309  0.1216  314 ALA F N     
2469 C  CA    . ALA A 315 ? 0.3051 0.7353 0.4376 0.1283  0.0347  0.1172  314 ALA F CA    
2470 C  C     . ALA A 315 ? 0.2295 0.6618 0.3567 0.1156  0.0416  0.1244  314 ALA F C     
2471 O  O     . ALA A 315 ? 0.3273 0.7809 0.4637 0.1082  0.0435  0.1258  314 ALA F O     
2472 C  CB    . ALA A 315 ? 0.2998 0.7248 0.4163 0.1496  0.0351  0.1071  314 ALA F CB    
2473 N  N     . THR A 316 ? 0.2034 0.6132 0.3161 0.1135  0.0448  0.1287  315 THR F N     
2474 C  CA    . THR A 316 ? 0.1984 0.6075 0.3060 0.1025  0.0486  0.1342  315 THR F CA    
2475 C  C     . THR A 316 ? 0.2964 0.7096 0.4168 0.0848  0.0458  0.1433  315 THR F C     
2476 O  O     . THR A 316 ? 0.2403 0.6673 0.3630 0.0778  0.0469  0.1461  315 THR F O     
2477 C  CB    . THR A 316 ? 0.3042 0.6879 0.3976 0.1042  0.0516  0.1357  315 THR F CB    
2478 O  OG1   . THR A 316 ? 0.3723 0.7508 0.4524 0.1222  0.0549  0.1270  315 THR F OG1   
2479 C  CG2   . THR A 316 ? 0.2414 0.6242 0.3321 0.0932  0.0530  0.1395  315 THR F CG2   
2480 N  N     . ALA A 317 ? 0.2020 0.6035 0.3305 0.0789  0.0420  0.1477  316 ALA F N     
2481 C  CA    . ALA A 317 ? 0.2581 0.6620 0.3992 0.0638  0.0389  0.1557  316 ALA F CA    
2482 C  C     . ALA A 317 ? 0.1851 0.6165 0.3411 0.0613  0.0385  0.1546  316 ALA F C     
2483 O  O     . ALA A 317 ? 0.2814 0.7203 0.4433 0.0506  0.0386  0.1613  316 ALA F O     
2484 C  CB    . ALA A 317 ? 0.1964 0.5840 0.3446 0.0599  0.0348  0.1588  316 ALA F CB    
2485 N  N     . ARG A 318 ? 0.1983 0.6457 0.3613 0.0720  0.0380  0.1461  317 ARG F N     
2486 C  CA    . ARG A 318 ? 0.3141 0.7901 0.4945 0.0702  0.0383  0.1440  317 ARG F CA    
2487 C  C     . ARG A 318 ? 0.2459 0.7382 0.4194 0.0699  0.0444  0.1448  317 ARG F C     
2488 O  O     . ARG A 318 ? 0.2183 0.7272 0.4025 0.0607  0.0462  0.1501  317 ARG F O     
2489 C  CB    . ARG A 318 ? 0.2046 0.6932 0.3948 0.0839  0.0348  0.1330  317 ARG F CB    
2490 C  CG    . ARG A 318 ? 0.2128 0.7339 0.4254 0.0832  0.0353  0.1293  317 ARG F CG    
2491 C  CD    . ARG A 318 ? 0.4754 1.0018 0.7107 0.0691  0.0313  0.1348  317 ARG F CD    
2492 N  NE    . ARG A 318 ? 0.7188 1.2705 0.9807 0.0729  0.0272  0.1270  317 ARG F NE    
2493 C  CZ    . ARG A 318 ? 0.6692 1.2477 0.9522 0.0651  0.0306  0.1286  317 ARG F CZ    
2494 N  NH1   . ARG A 318 ? 0.6873 1.2696 0.9654 0.0536  0.0380  0.1383  317 ARG F NH1   
2495 N  NH2   . ARG A 318 ? 0.5941 1.1957 0.9039 0.0692  0.0262  0.1205  317 ARG F NH2   
2496 N  N     . LYS A 319 ? 0.2080 0.6957 0.3637 0.0803  0.0476  0.1397  318 LYS F N     
2497 C  CA    . LYS A 319 ? 0.2389 0.7404 0.3861 0.0807  0.0527  0.1398  318 LYS F CA    
2498 C  C     . LYS A 319 ? 0.3256 0.8202 0.4698 0.0666  0.0523  0.1506  318 LYS F C     
2499 O  O     . LYS A 319 ? 0.2768 0.7907 0.4254 0.0612  0.0551  0.1546  318 LYS F O     
2500 C  CB    . LYS A 319 ? 0.3328 0.8250 0.4614 0.0941  0.0550  0.1319  318 LYS F CB    
2501 C  CG    . LYS A 319 ? 0.5893 1.0978 0.7090 0.0981  0.0600  0.1284  318 LYS F CG    
2502 C  CD    . LYS A 319 ? 0.6290 1.1287 0.7331 0.1140  0.0620  0.1179  318 LYS F CD    
2503 C  CE    . LYS A 319 ? 0.6200 1.1193 0.7281 0.1284  0.0600  0.1095  318 LYS F CE    
2504 N  NZ    . LYS A 319 ? 0.7055 1.1907 0.7964 0.1458  0.0614  0.0995  318 LYS F NZ    
2505 N  N     . THR A 320 ? 0.2997 0.7674 0.4369 0.0613  0.0489  0.1554  319 THR F N     
2506 C  CA    . THR A 320 ? 0.2865 0.7460 0.4218 0.0497  0.0468  0.1649  319 THR F CA    
2507 C  C     . THR A 320 ? 0.2483 0.7180 0.3996 0.0391  0.0451  0.1730  319 THR F C     
2508 O  O     . THR A 320 ? 0.2969 0.7767 0.4494 0.0323  0.0457  0.1801  319 THR F O     
2509 C  CB    . THR A 320 ? 0.2726 0.7018 0.4010 0.0470  0.0431  0.1672  319 THR F CB    
2510 O  OG1   . THR A 320 ? 0.2722 0.6908 0.3893 0.0572  0.0454  0.1594  319 THR F OG1   
2511 C  CG2   . THR A 320 ? 0.2344 0.6571 0.3586 0.0393  0.0408  0.1738  319 THR F CG2   
2512 N  N     . TRP A 321 ? 0.1974 0.6649 0.3619 0.0377  0.0428  0.1720  320 TRP F N     
2513 C  CA    . TRP A 321 ? 0.2209 0.6989 0.4038 0.0277  0.0414  0.1784  320 TRP F CA    
2514 C  C     . TRP A 321 ? 0.2810 0.7905 0.4727 0.0271  0.0467  0.1785  320 TRP F C     
2515 O  O     . TRP A 321 ? 0.2623 0.7807 0.4584 0.0183  0.0480  0.1873  320 TRP F O     
2516 C  CB    . TRP A 321 ? 0.2435 0.7181 0.4410 0.0285  0.0378  0.1741  320 TRP F CB    
2517 C  CG    . TRP A 321 ? 0.2036 0.6893 0.4237 0.0182  0.0357  0.1789  320 TRP F CG    
2518 C  CD1   . TRP A 321 ? 0.2089 0.7228 0.4484 0.0168  0.0381  0.1764  320 TRP F CD1   
2519 C  CD2   . TRP A 321 ? 0.2477 0.7168 0.4752 0.0082  0.0308  0.1863  320 TRP F CD2   
2520 N  NE1   . TRP A 321 ? 0.2110 0.7269 0.4701 0.0056  0.0350  0.1819  320 TRP F NE1   
2521 C  CE2   . TRP A 321 ? 0.2496 0.7378 0.5010 0.0005  0.0302  0.1881  320 TRP F CE2   
2522 C  CE3   . TRP A 321 ? 0.2073 0.6481 0.4248 0.0052  0.0269  0.1912  320 TRP F CE3   
2523 C  CZ2   . TRP A 321 ? 0.2621 0.7410 0.5267 -0.0102 0.0256  0.1949  320 TRP F CZ2   
2524 C  CZ3   . TRP A 321 ? 0.2806 0.7123 0.5110 -0.0044 0.0223  0.1977  320 TRP F CZ3   
2525 C  CH2   . TRP A 321 ? 0.2540 0.7043 0.5072 -0.0120 0.0215  0.1997  320 TRP F CH2   
2526 N  N     . ASP A 322 ? 0.2728 0.8004 0.4677 0.0372  0.0501  0.1687  321 ASP F N     
2527 C  CA    . ASP A 322 ? 0.2842 0.8440 0.4891 0.0376  0.0562  0.1676  321 ASP F CA    
2528 C  C     . ASP A 322 ? 0.2769 0.8434 0.4675 0.0357  0.0604  0.1732  321 ASP F C     
2529 O  O     . ASP A 322 ? 0.2910 0.8772 0.4901 0.0286  0.0646  0.1797  321 ASP F O     
2530 C  CB    . ASP A 322 ? 0.2342 0.8108 0.4429 0.0517  0.0586  0.1547  321 ASP F CB    
2531 C  CG    . ASP A 322 ? 0.3314 0.9105 0.5603 0.0539  0.0538  0.1489  321 ASP F CG    
2532 O  OD1   . ASP A 322 ? 0.3537 0.9306 0.5986 0.0426  0.0506  0.1547  321 ASP F OD1   
2533 O  OD2   . ASP A 322 ? 0.2993 0.8827 0.5285 0.0675  0.0524  0.1380  321 ASP F OD2   
2534 N  N     . GLU A 323 ? 0.3156 0.8666 0.4856 0.0416  0.0593  0.1707  322 GLU F N     
2535 C  CA    . GLU A 323 ? 0.4319 0.9956 0.5896 0.0432  0.0634  0.1722  322 GLU F CA    
2536 C  C     . GLU A 323 ? 0.4008 0.9562 0.5539 0.0327  0.0605  0.1841  322 GLU F C     
2537 O  O     . GLU A 323 ? 0.4055 0.9806 0.5574 0.0297  0.0645  0.1892  322 GLU F O     
2538 C  CB    . GLU A 323 ? 0.3989 0.9545 0.5390 0.0553  0.0639  0.1623  322 GLU F CB    
2539 C  CG    . GLU A 323 ? 0.5622 1.1338 0.7054 0.0684  0.0680  0.1502  322 GLU F CG    
2540 C  CD    . GLU A 323 ? 0.6899 1.2514 0.8160 0.0813  0.0685  0.1401  322 GLU F CD    
2541 O  OE1   . GLU A 323 ? 0.7422 1.2855 0.8554 0.0790  0.0663  0.1422  322 GLU F OE1   
2542 O  OE2   . GLU A 323 ? 0.6533 1.2254 0.7802 0.0942  0.0710  0.1295  322 GLU F OE2   
2543 N  N     . ARG A 324 ? 0.2425 0.7708 0.3934 0.0277  0.0539  0.1886  323 ARG F N     
2544 C  CA    . ARG A 324 ? 0.2741 0.7941 0.4186 0.0214  0.0503  0.1976  323 ARG F CA    
2545 C  C     . ARG A 324 ? 0.4065 0.9125 0.5621 0.0112  0.0451  0.2075  323 ARG F C     
2546 O  O     . ARG A 324 ? 0.7807 1.2680 0.9323 0.0079  0.0395  0.2124  323 ARG F O     
2547 C  CB    . ARG A 324 ? 0.3725 0.8740 0.5019 0.0269  0.0474  0.1921  323 ARG F CB    
2548 C  CG    . ARG A 324 ? 0.4840 0.9961 0.6041 0.0263  0.0476  0.1954  323 ARG F CG    
2549 C  CD    . ARG A 324 ? 0.5511 1.0458 0.6598 0.0308  0.0451  0.1890  323 ARG F CD    
2550 N  NE    . ARG A 324 ? 0.6321 1.1284 0.7373 0.0263  0.0416  0.1955  323 ARG F NE    
2551 C  CZ    . ARG A 324 ? 0.7622 1.2460 0.8738 0.0189  0.0355  0.2049  323 ARG F CZ    
2552 N  NH1   . ARG A 324 ? 0.8578 1.3252 0.9788 0.0149  0.0327  0.2083  323 ARG F NH1   
2553 N  NH2   . ARG A 324 ? 0.8581 1.3475 0.9673 0.0159  0.0323  0.2107  323 ARG F NH2   
2554 N  N     . ARG A 325 ? 0.4755 0.9920 0.6471 0.0062  0.0470  0.2101  324 ARG F N     
2555 C  CA    . ARG A 325 ? 0.4873 0.9912 0.6715 -0.0032 0.0424  0.2183  324 ARG F CA    
2556 C  C     . ARG A 325 ? 0.4543 0.9774 0.6512 -0.0128 0.0451  0.2293  324 ARG F C     
2557 O  O     . ARG A 325 ? 0.4057 0.9177 0.6083 -0.0204 0.0405  0.2391  324 ARG F O     
2558 C  CB    . ARG A 325 ? 0.3085 0.8055 0.5043 -0.0023 0.0412  0.2118  324 ARG F CB    
2559 C  CG    . ARG A 325 ? 0.3901 0.8760 0.6006 -0.0117 0.0366  0.2189  324 ARG F CG    
2560 C  CD    . ARG A 325 ? 0.4955 0.9775 0.7180 -0.0100 0.0350  0.2111  324 ARG F CD    
2561 N  NE    . ARG A 325 ? 0.4982 0.9970 0.7444 -0.0184 0.0359  0.2141  324 ARG F NE    
2562 C  CZ    . ARG A 325 ? 0.5033 1.0308 0.7631 -0.0181 0.0414  0.2102  324 ARG F CZ    
2563 N  NH1   . ARG A 325 ? 0.4561 0.9986 0.7065 -0.0088 0.0466  0.2031  324 ARG F NH1   
2564 N  NH2   . ARG A 325 ? 0.5190 1.0611 0.8033 -0.0271 0.0419  0.2128  324 ARG F NH2   
2565 N  N     . GLY A 326 ? 0.4179 0.9699 0.6207 -0.0124 0.0529  0.2281  325 GLY F N     
2566 C  CA    . GLY A 326 ? 0.4157 0.9884 0.6285 -0.0216 0.0577  0.2389  325 GLY F CA    
2567 C  C     . GLY A 326 ? 0.4175 0.9841 0.6490 -0.0331 0.0550  0.2479  325 GLY F C     
2568 O  O     . GLY A 326 ? 0.4470 1.0137 0.6802 -0.0409 0.0540  0.2604  325 GLY F O     
2569 N  N     . GLY A 327 ? 0.3056 0.8683 0.5521 -0.0342 0.0536  0.2417  326 GLY F N     
2570 C  CA    . GLY A 327 ? 0.4401 0.9988 0.7068 -0.0453 0.0509  0.2488  326 GLY F CA    
2571 C  C     . GLY A 327 ? 0.4353 0.9666 0.6985 -0.0495 0.0421  0.2576  326 GLY F C     
2572 O  O     . GLY A 327 ? 0.3954 0.9239 0.6753 -0.0594 0.0399  0.2651  326 GLY F O     
2573 N  N     . ARG A 328 ? 0.4664 0.9778 0.7100 -0.0424 0.0370  0.2563  327 ARG F N     
2574 C  CA    . ARG A 328 ? 0.2990 0.7852 0.5414 -0.0451 0.0287  0.2633  327 ARG F CA    
2575 C  C     . ARG A 328 ? 0.3339 0.7988 0.5823 -0.0439 0.0239  0.2557  327 ARG F C     
2576 O  O     . ARG A 328 ? 0.3148 0.7801 0.5618 -0.0381 0.0258  0.2438  327 ARG F O     
2577 C  CB    . ARG A 328 ? 0.3189 0.7937 0.5419 -0.0384 0.0252  0.2637  327 ARG F CB    
2578 C  CG    . ARG A 328 ? 0.4152 0.9067 0.6334 -0.0409 0.0274  0.2734  327 ARG F CG    
2579 C  CD    . ARG A 328 ? 0.4120 0.8941 0.6131 -0.0334 0.0238  0.2701  327 ARG F CD    
2580 N  NE    . ARG A 328 ? 0.5034 0.9897 0.6918 -0.0246 0.0281  0.2570  327 ARG F NE    
2581 C  CZ    . ARG A 328 ? 0.3963 0.8761 0.5703 -0.0177 0.0262  0.2514  327 ARG F CZ    
2582 N  NH1   . ARG A 328 ? 0.3462 0.8155 0.5174 -0.0183 0.0202  0.2567  327 ARG F NH1   
2583 N  NH2   . ARG A 328 ? 0.2619 0.7469 0.4261 -0.0101 0.0305  0.2402  327 ARG F NH2   
2584 N  N     . GLY A 329 ? 0.3410 0.7878 0.5968 -0.0493 0.0175  0.2625  328 GLY F N     
2585 C  CA    . GLY A 329 ? 0.3096 0.7328 0.5672 -0.0470 0.0126  0.2554  328 GLY F CA    
2586 C  C     . GLY A 329 ? 0.2390 0.6445 0.4767 -0.0369 0.0111  0.2482  328 GLY F C     
2587 O  O     . GLY A 329 ? 0.2787 0.6841 0.5035 -0.0333 0.0109  0.2513  328 GLY F O     
2588 N  N     . VAL A 330 ? 0.2360 0.6285 0.4728 -0.0328 0.0100  0.2393  329 VAL F N     
2589 C  CA    . VAL A 330 ? 0.1919 0.5656 0.4121 -0.0245 0.0093  0.2326  329 VAL F CA    
2590 C  C     . VAL A 330 ? 0.2872 0.6370 0.5124 -0.0262 0.0038  0.2344  329 VAL F C     
2591 O  O     . VAL A 330 ? 0.2148 0.5613 0.4530 -0.0296 0.0018  0.2329  329 VAL F O     
2592 C  CB    . VAL A 330 ? 0.1863 0.5653 0.4007 -0.0173 0.0133  0.2213  329 VAL F CB    
2593 C  CG1   . VAL A 330 ? 0.1758 0.5327 0.3769 -0.0105 0.0126  0.2153  329 VAL F CG1   
2594 C  CG2   . VAL A 330 ? 0.2922 0.6934 0.4994 -0.0137 0.0188  0.2189  329 VAL F CG2   
2595 N  N     . ARG A 331 ? 0.2566 0.5914 0.4734 -0.0237 0.0013  0.2368  330 ARG F N     
2596 C  CA    . ARG A 331 ? 0.3180 0.6310 0.5400 -0.0240 -0.0031 0.2376  330 ARG F CA    
2597 C  C     . ARG A 331 ? 0.2597 0.5570 0.4711 -0.0170 -0.0010 0.2281  330 ARG F C     
2598 O  O     . ARG A 331 ? 0.2920 0.5738 0.5096 -0.0172 -0.0031 0.2271  330 ARG F O     
2599 C  CB    . ARG A 331 ? 0.2464 0.5539 0.4709 -0.0255 -0.0075 0.2459  330 ARG F CB    
2600 C  CG    . ARG A 331 ? 0.2968 0.6066 0.5075 -0.0203 -0.0062 0.2440  330 ARG F CG    
2601 C  CD    . ARG A 331 ? 0.2614 0.5696 0.4783 -0.0217 -0.0114 0.2532  330 ARG F CD    
2602 N  NE    . ARG A 331 ? 0.2917 0.5793 0.5158 -0.0206 -0.0148 0.2521  330 ARG F NE    
2603 C  CZ    . ARG A 331 ? 0.3608 0.6437 0.6013 -0.0250 -0.0198 0.2601  330 ARG F CZ    
2604 N  NH1   . ARG A 331 ? 0.3136 0.5792 0.5613 -0.0230 -0.0223 0.2585  330 ARG F NH1   
2605 N  NH2   . ARG A 331 ? 0.3431 0.6388 0.5943 -0.0318 -0.0218 0.2696  330 ARG F NH2   
2606 N  N     . LEU A 332 ? 0.2156 0.5172 0.4124 -0.0110 0.0034  0.2214  331 LEU F N     
2607 C  CA    . LEU A 332 ? 0.2221 0.5089 0.4095 -0.0045 0.0059  0.2134  331 LEU F CA    
2608 C  C     . LEU A 332 ? 0.2262 0.5233 0.4039 0.0011  0.0111  0.2063  331 LEU F C     
2609 O  O     . LEU A 332 ? 0.2100 0.5226 0.3821 0.0022  0.0132  0.2058  331 LEU F O     
2610 C  CB    . LEU A 332 ? 0.2284 0.5042 0.4087 -0.0019 0.0053  0.2122  331 LEU F CB    
2611 C  CG    . LEU A 332 ? 0.2843 0.5467 0.4552 0.0043  0.0091  0.2034  331 LEU F CG    
2612 C  CD1   . LEU A 332 ? 0.2824 0.5317 0.4558 0.0041  0.0072  0.2033  331 LEU F CD1   
2613 C  CD2   . LEU A 332 ? 0.1947 0.4669 0.3531 0.0090  0.0135  0.1975  331 LEU F CD2   
2614 N  N     . VAL A 333 ? 0.1784 0.4672 0.3544 0.0055  0.0133  0.2012  332 VAL F N     
2615 C  CA    . VAL A 333 ? 0.2442 0.5398 0.4105 0.0130  0.0182  0.1945  332 VAL F CA    
2616 C  C     . VAL A 333 ? 0.2229 0.5000 0.3811 0.0186  0.0208  0.1908  332 VAL F C     
2617 O  O     . VAL A 333 ? 0.2421 0.5048 0.4058 0.0176  0.0197  0.1924  332 VAL F O     
2618 C  CB    . VAL A 333 ? 0.2189 0.5277 0.3938 0.0148  0.0185  0.1918  332 VAL F CB    
2619 C  CG1   . VAL A 333 ? 0.1886 0.5063 0.3535 0.0251  0.0233  0.1845  332 VAL F CG1   
2620 C  CG2   . VAL A 333 ? 0.2118 0.5397 0.4003 0.0080  0.0158  0.1949  332 VAL F CG2   
2621 N  N     . GLY A 334 ? 0.1661 0.4442 0.3128 0.0245  0.0247  0.1858  333 GLY F N     
2622 C  CA    . GLY A 334 ? 0.1406 0.4024 0.2811 0.0301  0.0285  0.1818  333 GLY F CA    
2623 C  C     . GLY A 334 ? 0.2035 0.4711 0.3337 0.0395  0.0343  0.1769  333 GLY F C     
2624 O  O     . GLY A 334 ? 0.2079 0.4924 0.3343 0.0417  0.0350  0.1750  333 GLY F O     
2625 N  N     . LEU A 335 ? 0.2074 0.4609 0.3334 0.0463  0.0392  0.1750  334 LEU F N     
2626 C  CA    . LEU A 335 ? 0.1969 0.4500 0.3114 0.0573  0.0462  0.1707  334 LEU F CA    
2627 C  C     . LEU A 335 ? 0.2828 0.5175 0.3930 0.0565  0.0511  0.1651  334 LEU F C     
2628 O  O     . LEU A 335 ? 0.2434 0.4634 0.3596 0.0500  0.0504  0.1642  334 LEU F O     
2629 C  CB    . LEU A 335 ? 0.2139 0.4643 0.3245 0.0682  0.0507  0.1728  334 LEU F CB    
2630 C  CG    . LEU A 335 ? 0.1991 0.4671 0.3182 0.0678  0.0454  0.1736  334 LEU F CG    
2631 C  CD1   . LEU A 335 ? 0.2579 0.5193 0.3720 0.0822  0.0461  0.1704  334 LEU F CD1   
2632 C  CD2   . LEU A 335 ? 0.1737 0.4639 0.2935 0.0682  0.0424  0.1690  334 LEU F CD2   
2633 N  N     . HIS A 336 ? 0.2862 0.5215 0.3859 0.0627  0.0568  0.1601  335 HIS F N     
2634 C  CA    . HIS A 336 ? 0.2329 0.4513 0.3282 0.0588  0.0623  0.1537  335 HIS F CA    
2635 C  C     . HIS A 336 ? 0.3262 0.5324 0.4049 0.0692  0.0728  0.1497  335 HIS F C     
2636 O  O     . HIS A 336 ? 0.2447 0.4633 0.3156 0.0804  0.0742  0.1501  335 HIS F O     
2637 C  CB    . HIS A 336 ? 0.2008 0.4321 0.2999 0.0509  0.0577  0.1515  335 HIS F CB    
2638 C  CG    . HIS A 336 ? 0.2541 0.4711 0.3529 0.0442  0.0616  0.1460  335 HIS F CG    
2639 N  ND1   . HIS A 336 ? 0.3604 0.5751 0.4506 0.0459  0.0686  0.1405  335 HIS F ND1   
2640 C  CD2   . HIS A 336 ? 0.3411 0.5467 0.4475 0.0360  0.0598  0.1450  335 HIS F CD2   
2641 C  CE1   . HIS A 336 ? 0.3852 0.5886 0.4789 0.0377  0.0709  0.1367  335 HIS F CE1   
2642 N  NE2   . HIS A 336 ? 0.2811 0.4794 0.3846 0.0320  0.0655  0.1391  335 HIS F NE2   
2643 N  N     . VAL A 337 ? 0.2709 0.4506 0.3421 0.0659  0.0807  0.1452  336 VAL F N     
2644 C  CA    . VAL A 337 ? 0.3654 0.5249 0.4159 0.0737  0.0918  0.1413  336 VAL F CA    
2645 C  C     . VAL A 337 ? 0.3616 0.5101 0.4134 0.0628  0.0964  0.1354  336 VAL F C     
2646 O  O     . VAL A 337 ? 0.3003 0.4431 0.3635 0.0516  0.0943  0.1339  336 VAL F O     
2647 C  CB    . VAL A 337 ? 0.4659 0.5944 0.4979 0.0816  0.0988  0.1430  336 VAL F CB    
2648 C  CG1   . VAL A 337 ? 0.6334 0.7253 0.6439 0.0815  0.1103  0.1381  336 VAL F CG1   
2649 C  CG2   . VAL A 337 ? 0.3020 0.4407 0.3227 0.0983  0.0970  0.1478  336 VAL F CG2   
2650 N  N     . THR A 338 ? 0.2797 0.4261 0.3194 0.0672  0.1031  0.1317  337 THR F N     
2651 C  CA    . THR A 338 ? 0.2871 0.4200 0.3255 0.0581  0.1105  0.1266  337 THR F CA    
2652 C  C     . THR A 338 ? 0.3930 0.4864 0.4073 0.0637  0.1238  0.1252  337 THR F C     
2653 O  O     . THR A 338 ? 0.3651 0.4468 0.3569 0.0784  0.1287  0.1259  337 THR F O     
2654 C  CB    . THR A 338 ? 0.3400 0.4956 0.3804 0.0583  0.1100  0.1229  337 THR F CB    
2655 O  OG1   . THR A 338 ? 0.3721 0.5594 0.4287 0.0544  0.0975  0.1249  337 THR F OG1   
2656 C  CG2   . THR A 338 ? 0.2861 0.4322 0.3295 0.0476  0.1174  0.1182  337 THR F CG2   
2657 N  N     . LEU A 339 ? 0.3419 0.4125 0.3584 0.0529  0.1293  0.1228  338 LEU F N     
2658 C  CA    . LEU A 339 ? 0.3680 0.3957 0.3605 0.0559  0.1415  0.1216  338 LEU F CA    
2659 C  C     . LEU A 339 ? 0.4146 0.4269 0.3940 0.0562  0.1528  0.1182  338 LEU F C     
2660 O  O     . LEU A 339 ? 0.4751 0.5096 0.4706 0.0483  0.1526  0.1153  338 LEU F O     
2661 C  CB    . LEU A 339 ? 0.3451 0.3569 0.3465 0.0438  0.1436  0.1191  338 LEU F CB    
2662 C  CG    . LEU A 339 ? 0.3657 0.3850 0.3758 0.0443  0.1353  0.1214  338 LEU F CG    
2663 C  CD1   . LEU A 339 ? 0.4678 0.4729 0.4848 0.0340  0.1388  0.1174  338 LEU F CD1   
2664 C  CD2   . LEU A 339 ? 0.3616 0.3658 0.3491 0.0594  0.1352  0.1256  338 LEU F CD2   
2665 N  N     . LEU A 340 ? 0.4568 0.4279 0.4040 0.0658  0.1627  0.1184  339 LEU F N     
2666 C  CA    . LEU A 340 ? 0.5835 0.5279 0.5156 0.0645  0.1711  0.1115  339 LEU F CA    
2667 C  C     . LEU A 340 ? 0.6312 0.5707 0.5818 0.0450  0.1813  0.1097  339 LEU F C     
2668 O  O     . LEU A 340 ? 0.6159 0.5551 0.5811 0.0352  0.1793  0.1098  339 LEU F O     
2669 C  CB    . LEU A 340 ? 0.5826 0.4752 0.4763 0.0762  0.1761  0.1107  339 LEU F CB    
2670 C  CG    . LEU A 340 ? 0.5877 0.4782 0.4597 0.0978  0.1655  0.1101  339 LEU F CG    
2671 C  CD1   . LEU A 340 ? 0.7130 0.5488 0.5468 0.1077  0.1710  0.1125  339 LEU F CD1   
2672 C  CD2   . LEU A 340 ? 0.6116 0.5157 0.4828 0.1060  0.1584  0.1001  339 LEU F CD2   
2673 N  N     . ASP A 341 ? 0.6454 0.5811 0.5982 0.0396  0.1820  0.1002  340 ASP F N     
2674 C  CA    . ASP A 341 ? 0.6681 0.6070 0.6440 0.0208  0.1889  0.0964  340 ASP F CA    
2675 C  C     . ASP A 341 ? 0.8860 0.7833 0.8552 0.0098  0.2053  0.0977  340 ASP F C     
2676 O  O     . ASP A 341 ? 1.0496 0.9512 1.0413 -0.0063 0.2105  0.0930  340 ASP F O     
2677 C  CB    . ASP A 341 ? 0.6940 0.6385 0.6719 0.0187  0.1838  0.0842  340 ASP F CB    
2678 C  CG    . ASP A 341 ? 0.8987 0.8943 0.8945 0.0219  0.1701  0.0827  340 ASP F CG    
2679 O  OD1   . ASP A 341 ? 1.0227 1.0469 1.0274 0.0268  0.1645  0.0917  340 ASP F OD1   
2680 O  OD2   . ASP A 341 ? 0.9781 0.9843 0.9778 0.0192  0.1651  0.0724  340 ASP F OD2   
2681 N  N     . PRO A 342 ? 0.9270 0.7862 0.8677 0.0181  0.2093  0.1010  341 PRO F N     
2682 C  CA    . PRO A 342 ? 0.9991 0.8350 0.9437 0.0064  0.2156  0.0973  341 PRO F CA    
2683 C  C     . PRO A 342 ? 0.9718 0.8415 0.9495 -0.0034 0.2075  0.0956  341 PRO F C     
2684 O  O     . PRO A 342 ? 0.9641 0.8356 0.9609 -0.0174 0.2124  0.0906  341 PRO F O     
2685 C  CB    . PRO A 342 ? 1.0506 0.8483 0.9594 0.0193  0.2176  0.1003  341 PRO F CB    
2686 C  CG    . PRO A 342 ? 1.0687 0.8684 0.9556 0.0380  0.2110  0.1057  341 PRO F CG    
2687 C  CD    . PRO A 342 ? 1.0165 0.8435 0.9176 0.0363  0.2096  0.1039  341 PRO F CD    
2688 N  N     . GLY B 1   ? 1.5171 1.0173 0.8433 -0.0370 -0.0142 -0.1323 0   GLY A N     
2689 C  CA    . GLY B 1   ? 1.5607 1.0454 0.8984 -0.0478 -0.0292 -0.1356 0   GLY A CA    
2690 C  C     . GLY B 1   ? 1.6125 1.1017 0.9758 -0.0543 -0.0285 -0.1269 0   GLY A C     
2691 O  O     . GLY B 1   ? 1.7003 1.1735 1.0747 -0.0567 -0.0331 -0.1303 0   GLY A O     
2692 N  N     . SER B 2   ? 1.5458 1.0562 0.9182 -0.0569 -0.0231 -0.1154 1   SER A N     
2693 C  CA    . SER B 2   ? 1.3855 0.9104 0.7912 -0.0622 -0.0220 -0.1044 1   SER A CA    
2694 C  C     . SER B 2   ? 1.3614 0.9038 0.7789 -0.0769 -0.0355 -0.0945 1   SER A C     
2695 O  O     . SER B 2   ? 1.4311 0.9721 0.8301 -0.0837 -0.0467 -0.0969 1   SER A O     
2696 C  CB    . SER B 2   ? 1.3497 0.8948 0.7732 -0.0512 -0.0036 -0.0963 1   SER A CB    
2697 O  OG    . SER B 2   ? 1.3605 0.9248 0.7773 -0.0497 0.0013  -0.0891 1   SER A OG    
2698 N  N     . ARG B 3   ? 1.0309 0.5911 0.4798 -0.0814 -0.0344 -0.0834 2   ARG A N     
2699 C  CA    . ARG B 3   ? 0.8704 0.4468 0.3343 -0.0952 -0.0468 -0.0746 2   ARG A CA    
2700 C  C     . ARG B 3   ? 0.9580 0.5626 0.4288 -0.0942 -0.0437 -0.0642 2   ARG A C     
2701 O  O     . ARG B 3   ? 0.9050 0.5190 0.3772 -0.0837 -0.0304 -0.0609 2   ARG A O     
2702 C  CB    . ARG B 3   ? 0.9045 0.4853 0.3967 -0.1004 -0.0477 -0.0680 2   ARG A CB    
2703 C  CG    . ARG B 3   ? 1.1051 0.6606 0.5929 -0.1088 -0.0588 -0.0744 2   ARG A CG    
2704 C  CD    . ARG B 3   ? 1.0381 0.5996 0.5525 -0.1135 -0.0587 -0.0660 2   ARG A CD    
2705 N  NE    . ARG B 3   ? 1.0108 0.5769 0.5377 -0.1004 -0.0443 -0.0640 2   ARG A NE    
2706 C  CZ    . ARG B 3   ? 0.9095 0.4915 0.4611 -0.1006 -0.0404 -0.0546 2   ARG A CZ    
2707 N  NH1   . ARG B 3   ? 0.8388 0.4343 0.4047 -0.1125 -0.0484 -0.0458 2   ARG A NH1   
2708 N  NH2   . ARG B 3   ? 0.8086 0.3936 0.3706 -0.0886 -0.0286 -0.0541 2   ARG A NH2   
2709 N  N     . LYS B 4   ? 0.8193 0.4377 0.2961 -0.1056 -0.0565 -0.0587 3   LYS A N     
2710 C  CA    . LYS B 4   ? 0.7681 0.4145 0.2564 -0.1054 -0.0556 -0.0479 3   LYS A CA    
2711 C  C     . LYS B 4   ? 0.7740 0.4402 0.2925 -0.1141 -0.0606 -0.0384 3   LYS A C     
2712 O  O     . LYS B 4   ? 0.7447 0.4131 0.2666 -0.1264 -0.0739 -0.0380 3   LYS A O     
2713 C  CB    . LYS B 4   ? 0.9363 0.5847 0.4025 -0.1087 -0.0659 -0.0497 3   LYS A CB    
2714 C  CG    . LYS B 4   ? 1.0242 0.6621 0.4627 -0.0970 -0.0566 -0.0547 3   LYS A CG    
2715 C  CD    . LYS B 4   ? 1.2491 0.8662 0.6542 -0.0998 -0.0672 -0.0665 3   LYS A CD    
2716 C  CE    . LYS B 4   ? 1.2849 0.9154 0.6815 -0.1065 -0.0813 -0.0627 3   LYS A CE    
2717 N  NZ    . LYS B 4   ? 1.2363 0.8529 0.6076 -0.1057 -0.0898 -0.0729 3   LYS A NZ    
2718 N  N     . ILE B 5   ? 0.7300 0.4114 0.2701 -0.1079 -0.0500 -0.0309 4   ILE A N     
2719 C  CA    . ILE B 5   ? 0.6904 0.3907 0.2579 -0.1137 -0.0522 -0.0225 4   ILE A CA    
2720 C  C     . ILE B 5   ? 0.7248 0.4517 0.3047 -0.1103 -0.0504 -0.0135 4   ILE A C     
2721 O  O     . ILE B 5   ? 0.7105 0.4404 0.2880 -0.1001 -0.0409 -0.0117 4   ILE A O     
2722 C  CB    . ILE B 5   ? 0.7510 0.4460 0.3336 -0.1090 -0.0430 -0.0220 4   ILE A CB    
2723 C  CG1   . ILE B 5   ? 0.7035 0.3696 0.2731 -0.1100 -0.0443 -0.0311 4   ILE A CG1   
2724 C  CG2   . ILE B 5   ? 0.6889 0.4031 0.2966 -0.1150 -0.0456 -0.0134 4   ILE A CG2   
2725 C  CD1   . ILE B 5   ? 0.7101 0.3644 0.2719 -0.1238 -0.0590 -0.0343 4   ILE A CD1   
2726 N  N     . ILE B 6   ? 0.7154 0.4619 0.3096 -0.1186 -0.0594 -0.0075 5   ILE A N     
2727 C  CA    . ILE B 6   ? 0.6476 0.4203 0.2573 -0.1150 -0.0584 0.0011  5   ILE A CA    
2728 C  C     . ILE B 6   ? 0.6510 0.4398 0.2867 -0.1171 -0.0561 0.0068  5   ILE A C     
2729 O  O     . ILE B 6   ? 0.6634 0.4519 0.3056 -0.1270 -0.0619 0.0070  5   ILE A O     
2730 C  CB    . ILE B 6   ? 0.6620 0.4481 0.2671 -0.1212 -0.0710 0.0034  5   ILE A CB    
2731 C  CG1   . ILE B 6   ? 0.8477 0.6172 0.4235 -0.1186 -0.0740 -0.0026 5   ILE A CG1   
2732 C  CG2   . ILE B 6   ? 0.6259 0.4392 0.2490 -0.1161 -0.0700 0.0122  5   ILE A CG2   
2733 C  CD1   . ILE B 6   ? 0.8085 0.5897 0.3776 -0.1249 -0.0884 -0.0011 5   ILE A CD1   
2734 N  N     . HIS B 7   ? 0.6175 0.4190 0.2670 -0.1079 -0.0477 0.0115  6   HIS A N     
2735 C  CA    . HIS B 7   ? 0.5607 0.3814 0.2335 -0.1079 -0.0457 0.0170  6   HIS A CA    
2736 C  C     . HIS B 7   ? 0.6011 0.4462 0.2843 -0.1047 -0.0488 0.0230  6   HIS A C     
2737 O  O     . HIS B 7   ? 0.5709 0.4160 0.2497 -0.0961 -0.0453 0.0242  6   HIS A O     
2738 C  CB    . HIS B 7   ? 0.6609 0.4757 0.3417 -0.0990 -0.0347 0.0164  6   HIS A CB    
2739 C  CG    . HIS B 7   ? 0.6430 0.4761 0.3445 -0.0980 -0.0328 0.0210  6   HIS A CG    
2740 N  ND1   . HIS B 7   ? 0.6170 0.4516 0.3251 -0.1052 -0.0350 0.0222  6   HIS A ND1   
2741 C  CD2   . HIS B 7   ? 0.5584 0.4084 0.2739 -0.0903 -0.0292 0.0247  6   HIS A CD2   
2742 C  CE1   . HIS B 7   ? 0.4993 0.3523 0.2236 -0.1016 -0.0320 0.0263  6   HIS A CE1   
2743 N  NE2   . HIS B 7   ? 0.6494 0.5116 0.3787 -0.0923 -0.0288 0.0271  6   HIS A NE2   
2744 N  N     . VAL B 8   ? 0.5777 0.4437 0.2749 -0.1116 -0.0553 0.0273  7   VAL A N     
2745 C  CA    . VAL B 8   ? 0.5498 0.4415 0.2593 -0.1083 -0.0590 0.0328  7   VAL A CA    
2746 C  C     . VAL B 8   ? 0.6103 0.5206 0.3412 -0.1042 -0.0535 0.0366  7   VAL A C     
2747 O  O     . VAL B 8   ? 0.6103 0.5240 0.3486 -0.1111 -0.0529 0.0374  7   VAL A O     
2748 C  CB    . VAL B 8   ? 0.6405 0.5456 0.3507 -0.1189 -0.0715 0.0346  7   VAL A CB    
2749 C  CG1   . VAL B 8   ? 0.5476 0.4811 0.2728 -0.1136 -0.0752 0.0405  7   VAL A CG1   
2750 C  CG2   . VAL B 8   ? 0.6492 0.5337 0.3352 -0.1231 -0.0782 0.0295  7   VAL A CG2   
2751 N  N     . ASP B 9   ? 0.5944 0.5158 0.3341 -0.0929 -0.0496 0.0389  8   ASP A N     
2752 C  CA    . ASP B 9   ? 0.5692 0.5051 0.3264 -0.0865 -0.0436 0.0407  8   ASP A CA    
2753 C  C     . ASP B 9   ? 0.5680 0.5275 0.3380 -0.0790 -0.0463 0.0446  8   ASP A C     
2754 O  O     . ASP B 9   ? 0.5155 0.4702 0.2804 -0.0716 -0.0471 0.0453  8   ASP A O     
2755 C  CB    . ASP B 9   ? 0.6903 0.6081 0.4446 -0.0779 -0.0346 0.0373  8   ASP A CB    
2756 C  CG    . ASP B 9   ? 0.8031 0.7328 0.5728 -0.0715 -0.0293 0.0376  8   ASP A CG    
2757 O  OD1   . ASP B 9   ? 0.8259 0.7705 0.6062 -0.0630 -0.0290 0.0392  8   ASP A OD1   
2758 O  OD2   . ASP B 9   ? 0.9376 0.8603 0.7074 -0.0743 -0.0259 0.0358  8   ASP A OD2   
2759 N  N     . MET B 10  ? 0.5405 0.5257 0.3270 -0.0805 -0.0475 0.0477  9   MET A N     
2760 C  CA    . MET B 10  ? 0.5335 0.5422 0.3336 -0.0718 -0.0500 0.0509  9   MET A CA    
2761 C  C     . MET B 10  ? 0.4608 0.4648 0.2655 -0.0572 -0.0431 0.0490  9   MET A C     
2762 O  O     . MET B 10  ? 0.4909 0.4855 0.2959 -0.0549 -0.0362 0.0459  9   MET A O     
2763 C  CB    . MET B 10  ? 0.5244 0.5643 0.3424 -0.0762 -0.0515 0.0545  9   MET A CB    
2764 C  CG    . MET B 10  ? 0.5430 0.5899 0.3604 -0.0920 -0.0591 0.0571  9   MET A CG    
2765 S  SD    . MET B 10  ? 0.5735 0.6219 0.3842 -0.0940 -0.0714 0.0584  9   MET A SD    
2766 C  CE    . MET B 10  ? 0.6285 0.7114 0.4615 -0.0808 -0.0726 0.0626  9   MET A CE    
2767 N  N     . ASP B 11  ? 0.5241 0.5342 0.3327 -0.0475 -0.0460 0.0510  10  ASP A N     
2768 C  CA    . ASP B 11  ? 0.4614 0.4660 0.2755 -0.0339 -0.0409 0.0493  10  ASP A CA    
2769 C  C     . ASP B 11  ? 0.4317 0.4607 0.2638 -0.0265 -0.0386 0.0485  10  ASP A C     
2770 O  O     . ASP B 11  ? 0.4352 0.4899 0.2785 -0.0260 -0.0430 0.0516  10  ASP A O     
2771 C  CB    . ASP B 11  ? 0.4512 0.4496 0.2614 -0.0260 -0.0451 0.0525  10  ASP A CB    
2772 C  CG    . ASP B 11  ? 0.5689 0.5452 0.3592 -0.0324 -0.0469 0.0536  10  ASP A CG    
2773 O  OD1   . ASP B 11  ? 0.5279 0.4838 0.3085 -0.0361 -0.0410 0.0505  10  ASP A OD1   
2774 O  OD2   . ASP B 11  ? 0.5246 0.5045 0.3085 -0.0330 -0.0543 0.0576  10  ASP A OD2   
2775 N  N     . CYS B 12  ? 0.6214 0.4663 0.3337 0.0254  -0.0081 0.0902  11  CYS A N     
2776 C  CA    . CYS B 12  ? 0.5919 0.4490 0.3165 0.0308  -0.0036 0.0881  11  CYS A CA    
2777 C  C     . CYS B 12  ? 0.5225 0.4245 0.2688 0.0315  -0.0125 0.0880  11  CYS A C     
2778 O  O     . CYS B 12  ? 0.5709 0.4890 0.3217 0.0467  -0.0131 0.0901  11  CYS A O     
2779 C  CB    . CYS B 12  ? 0.7170 0.5515 0.4253 0.0502  0.0036  0.0912  11  CYS A CB    
2780 S  SG    . CYS B 12  ? 0.8001 0.5813 0.4850 0.0479  0.0162  0.0912  11  CYS A SG    
2781 N  N     . PHE B 13  ? 0.5924 0.5138 0.3528 0.0146  -0.0186 0.0855  12  PHE A N     
2782 C  CA    . PHE B 13  ? 0.5383 0.5005 0.3164 0.0129  -0.0296 0.0864  12  PHE A CA    
2783 C  C     . PHE B 13  ? 0.5008 0.4916 0.2945 0.0240  -0.0287 0.0873  12  PHE A C     
2784 O  O     . PHE B 13  ? 0.5544 0.5659 0.3510 0.0381  -0.0349 0.0911  12  PHE A O     
2785 C  CB    . PHE B 13  ? 0.5020 0.4763 0.2936 -0.0086 -0.0332 0.0830  12  PHE A CB    
2786 C  CG    . PHE B 13  ? 0.5438 0.5579 0.3538 -0.0134 -0.0442 0.0834  12  PHE A CG    
2787 C  CD1   . PHE B 13  ? 0.5444 0.5732 0.3507 -0.0039 -0.0545 0.0863  12  PHE A CD1   
2788 C  CD2   . PHE B 13  ? 0.5948 0.6318 0.4255 -0.0277 -0.0445 0.0812  12  PHE A CD2   
2789 C  CE1   . PHE B 13  ? 0.6389 0.7065 0.4640 -0.0098 -0.0654 0.0862  12  PHE A CE1   
2790 C  CE2   . PHE B 13  ? 0.6211 0.6947 0.4699 -0.0339 -0.0541 0.0816  12  PHE A CE2   
2791 C  CZ    . PHE B 13  ? 0.6503 0.7399 0.4971 -0.0255 -0.0649 0.0837  12  PHE A CZ    
2792 N  N     . PHE B 14  ? 0.5448 0.5383 0.3487 0.0185  -0.0209 0.0840  13  PHE A N     
2793 C  CA    . PHE B 14  ? 0.5799 0.6015 0.3987 0.0286  -0.0188 0.0847  13  PHE A CA    
2794 C  C     . PHE B 14  ? 0.5257 0.5361 0.3318 0.0521  -0.0148 0.0878  13  PHE A C     
2795 O  O     . PHE B 14  ? 0.5440 0.5834 0.3608 0.0657  -0.0182 0.0911  13  PHE A O     
2796 C  CB    . PHE B 14  ? 0.4651 0.4852 0.2912 0.0201  -0.0099 0.0804  13  PHE A CB    
2797 C  CG    . PHE B 14  ? 0.5087 0.5463 0.3505 -0.0006 -0.0130 0.0785  13  PHE A CG    
2798 C  CD1   . PHE B 14  ? 0.4539 0.5034 0.3017 -0.0119 -0.0226 0.0797  13  PHE A CD1   
2799 C  CD2   . PHE B 14  ? 0.5046 0.5453 0.3535 -0.0084 -0.0062 0.0754  13  PHE A CD2   
2800 C  CE1   . PHE B 14  ? 0.4213 0.4831 0.2819 -0.0304 -0.0245 0.0782  13  PHE A CE1   
2801 C  CE2   . PHE B 14  ? 0.4825 0.5373 0.3444 -0.0262 -0.0084 0.0747  13  PHE A CE2   
2802 C  CZ    . PHE B 14  ? 0.5012 0.5660 0.3693 -0.0372 -0.0172 0.0762  13  PHE A CZ    
2803 N  N     . ALA B 15  ? 0.6199 0.5884 0.4038 0.0572  -0.0071 0.0871  14  ALA A N     
2804 C  CA    . ALA B 15  ? 0.6728 0.6249 0.4421 0.0798  -0.0019 0.0903  14  ALA A CA    
2805 C  C     . ALA B 15  ? 0.7303 0.6903 0.4928 0.0933  -0.0111 0.0969  14  ALA A C     
2806 O  O     . ALA B 15  ? 0.6922 0.6595 0.4523 0.1143  -0.0106 0.1011  14  ALA A O     
2807 C  CB    . ALA B 15  ? 0.7146 0.6177 0.4618 0.0795  0.0091  0.0878  14  ALA A CB    
2808 N  N     . ALA B 16  ? 0.7476 0.7057 0.5057 0.0824  -0.0194 0.0978  15  ALA A N     
2809 C  CA    . ALA B 16  ? 0.6393 0.6067 0.3896 0.0943  -0.0296 0.1036  15  ALA A CA    
2810 C  C     . ALA B 16  ? 0.5378 0.5565 0.3117 0.1002  -0.0399 0.1057  15  ALA A C     
2811 O  O     . ALA B 16  ? 0.6523 0.6837 0.4231 0.1197  -0.0451 0.1113  15  ALA A O     
2812 C  CB    . ALA B 16  ? 0.5992 0.5534 0.3389 0.0798  -0.0360 0.1029  15  ALA A CB    
2813 N  N     . VAL B 17  ? 0.5835 0.6328 0.3816 0.0838  -0.0428 0.1017  16  VAL A N     
2814 C  CA    . VAL B 17  ? 0.6227 0.7230 0.4464 0.0875  -0.0514 0.1037  16  VAL A CA    
2815 C  C     . VAL B 17  ? 0.7496 0.8609 0.5787 0.1094  -0.0442 0.1067  16  VAL A C     
2816 O  O     . VAL B 17  ? 0.7371 0.8782 0.5752 0.1255  -0.0510 0.1117  16  VAL A O     
2817 C  CB    . VAL B 17  ? 0.5444 0.6708 0.3918 0.0647  -0.0532 0.0992  16  VAL A CB    
2818 C  CG1   . VAL B 17  ? 0.5476 0.7281 0.4240 0.0683  -0.0599 0.1014  16  VAL A CG1   
2819 C  CG2   . VAL B 17  ? 0.5021 0.6184 0.3438 0.0445  -0.0609 0.0964  16  VAL A CG2   
2820 N  N     . GLU B 18  ? 0.6893 0.7767 0.5126 0.1106  -0.0304 0.1035  17  GLU A N     
2821 C  CA    . GLU B 18  ? 0.6883 0.7809 0.5136 0.1318  -0.0219 0.1055  17  GLU A CA    
2822 C  C     . GLU B 18  ? 0.6657 0.7399 0.4714 0.1566  -0.0221 0.1116  17  GLU A C     
2823 O  O     . GLU B 18  ? 0.6895 0.7892 0.5042 0.1770  -0.0234 0.1164  17  GLU A O     
2824 C  CB    . GLU B 18  ? 0.7241 0.7877 0.5417 0.1270  -0.0074 0.0997  17  GLU A CB    
2825 C  CG    . GLU B 18  ? 0.8160 0.8978 0.6517 0.1046  -0.0065 0.0945  17  GLU A CG    
2826 C  CD    . GLU B 18  ? 0.8862 1.0181 0.7496 0.1076  -0.0079 0.0960  17  GLU A CD    
2827 O  OE1   . GLU B 18  ? 0.8858 1.0354 0.7540 0.1290  -0.0066 0.1001  17  GLU A OE1   
2828 O  OE2   . GLU B 18  ? 0.8567 1.0104 0.7374 0.0889  -0.0097 0.0936  17  GLU A OE2   
2829 N  N     . MET B 19  ? 0.5583 0.5892 0.3376 0.1559  -0.0206 0.1122  18  MET A N     
2830 C  CA    . MET B 19  ? 0.7342 0.7435 0.4919 0.1797  -0.0199 0.1190  18  MET A CA    
2831 C  C     . MET B 19  ? 0.7909 0.8368 0.5567 0.1906  -0.0351 0.1257  18  MET A C     
2832 O  O     . MET B 19  ? 0.6901 0.7401 0.4499 0.2156  -0.0357 0.1324  18  MET A O     
2833 C  CB    . MET B 19  ? 0.7715 0.7280 0.4998 0.1743  -0.0149 0.1187  18  MET A CB    
2834 C  CG    . MET B 19  ? 0.7339 0.6485 0.4492 0.1706  0.0007  0.1137  18  MET A CG    
2835 S  SD    . MET B 19  ? 0.9145 0.7795 0.6038 0.1568  0.0037  0.1132  18  MET A SD    
2836 C  CE    . MET B 19  ? 0.9980 0.8101 0.6613 0.1720  0.0200  0.1140  18  MET A CE    
2837 N  N     . ARG B 20  ? 0.7955 0.8674 0.5739 0.1723  -0.0478 0.1238  19  ARG A N     
2838 C  CA    . ARG B 20  ? 0.8325 0.9421 0.6197 0.1799  -0.0639 0.1289  19  ARG A CA    
2839 C  C     . ARG B 20  ? 0.7975 0.9571 0.6128 0.1936  -0.0666 0.1319  19  ARG A C     
2840 O  O     . ARG B 20  ? 0.8326 1.0110 0.6479 0.2157  -0.0732 0.1389  19  ARG A O     
2841 C  CB    . ARG B 20  ? 0.8176 0.9436 0.6134 0.1547  -0.0760 0.1246  19  ARG A CB    
2842 C  CG    . ARG B 20  ? 0.6492 0.8213 0.4594 0.1577  -0.0941 0.1278  19  ARG A CG    
2843 C  CD    . ARG B 20  ? 0.7546 0.9468 0.5798 0.1296  -0.1036 0.1216  19  ARG A CD    
2844 N  NE    . ARG B 20  ? 0.6351 0.8578 0.4912 0.1162  -0.0993 0.1176  19  ARG A NE    
2845 C  CZ    . ARG B 20  ? 0.6333 0.8717 0.5049 0.0910  -0.1041 0.1121  19  ARG A CZ    
2846 N  NH1   . ARG B 20  ? 0.5213 0.7468 0.3802 0.0763  -0.1133 0.1092  19  ARG A NH1   
2847 N  NH2   . ARG B 20  ? 0.5524 0.8174 0.4507 0.0807  -0.0990 0.1098  19  ARG A NH2   
2848 N  N     . ASP B 21  ? 0.6536 0.8359 0.4932 0.1814  -0.0610 0.1270  20  ASP A N     
2849 C  CA    . ASP B 21  ? 0.7392 0.9723 0.6085 0.1918  -0.0624 0.1295  20  ASP A CA    
2850 C  C     . ASP B 21  ? 0.7861 1.0079 0.6490 0.2190  -0.0495 0.1332  20  ASP A C     
2851 O  O     . ASP B 21  ? 0.8857 1.1485 0.7695 0.2353  -0.0511 0.1376  20  ASP A O     
2852 C  CB    . ASP B 21  ? 0.6355 0.8944 0.5309 0.1685  -0.0598 0.1236  20  ASP A CB    
2853 C  CG    . ASP B 21  ? 0.7709 1.0401 0.6729 0.1418  -0.0719 0.1199  20  ASP A CG    
2854 O  OD1   . ASP B 21  ? 0.8354 1.1054 0.7278 0.1432  -0.0848 0.1223  20  ASP A OD1   
2855 O  OD2   . ASP B 21  ? 0.7509 1.0262 0.6661 0.1201  -0.0684 0.1148  20  ASP A OD2   
2856 N  N     . ASN B 22  ? 0.7614 0.9290 0.5964 0.2241  -0.0366 0.1313  21  ASN A N     
2857 C  CA    . ASN B 22  ? 0.7958 0.9435 0.6189 0.2503  -0.0238 0.1343  21  ASN A CA    
2858 C  C     . ASN B 22  ? 0.8988 0.9893 0.6850 0.2601  -0.0194 0.1368  21  ASN A C     
2859 O  O     . ASN B 22  ? 0.8927 0.9373 0.6600 0.2493  -0.0089 0.1315  21  ASN A O     
2860 C  CB    . ASN B 22  ? 0.7505 0.8897 0.5792 0.2445  -0.0087 0.1275  21  ASN A CB    
2861 C  CG    . ASN B 22  ? 0.8784 1.0020 0.6972 0.2723  0.0046  0.1298  21  ASN A CG    
2862 O  OD1   . ASN B 22  ? 0.9462 1.0498 0.7467 0.2949  0.0050  0.1361  21  ASN A OD1   
2863 N  ND2   . ASN B 22  ? 0.9353 1.0667 0.7645 0.2712  0.0159  0.1247  21  ASN A ND2   
2864 N  N     . PRO B 23  ? 0.8703 0.9626 0.6456 0.2805  -0.0271 0.1454  22  PRO A N     
2865 C  CA    . PRO B 23  ? 0.9305 0.9673 0.6692 0.2894  -0.0226 0.1490  22  PRO A CA    
2866 C  C     . PRO B 23  ? 0.9727 0.9619 0.6906 0.3035  -0.0040 0.1480  22  PRO A C     
2867 O  O     . PRO B 23  ? 0.9424 0.8792 0.6307 0.3037  0.0027  0.1488  22  PRO A O     
2868 C  CB    . PRO B 23  ? 0.9493 1.0072 0.6841 0.3114  -0.0355 0.1594  22  PRO A CB    
2869 C  CG    . PRO B 23  ? 0.9670 1.0880 0.7365 0.3207  -0.0428 0.1615  22  PRO A CG    
2870 C  CD    . PRO B 23  ? 0.8914 1.0378 0.6875 0.2938  -0.0416 0.1523  22  PRO A CD    
2871 N  N     . ALA B 24  ? 1.0203 1.0242 0.7518 0.3148  0.0050  0.1461  23  ALA A N     
2872 C  CA    . ALA B 24  ? 0.9922 0.9480 0.7022 0.3267  0.0229  0.1436  23  ALA A CA    
2873 C  C     . ALA B 24  ? 1.0840 0.9979 0.7812 0.3014  0.0320  0.1338  23  ALA A C     
2874 O  O     . ALA B 24  ? 1.0558 0.9221 0.7308 0.3076  0.0460  0.1310  23  ALA A O     
2875 C  CB    . ALA B 24  ? 0.8588 0.8416 0.5865 0.3429  0.0309  0.1425  23  ALA A CB    
2876 N  N     . LEU B 25  ? 0.9358 0.8658 0.6461 0.2733  0.0242  0.1287  24  LEU A N     
2877 C  CA    . LEU B 25  ? 0.9545 0.8508 0.6561 0.2488  0.0313  0.1199  24  LEU A CA    
2878 C  C     . LEU B 25  ? 1.0030 0.8634 0.6835 0.2376  0.0286  0.1215  24  LEU A C     
2879 O  O     . LEU B 25  ? 0.9960 0.8333 0.6721 0.2156  0.0326  0.1149  24  LEU A O     
2880 C  CB    . LEU B 25  ? 0.8312 0.7657 0.5601 0.2253  0.0262  0.1133  24  LEU A CB    
2881 C  CG    . LEU B 25  ? 0.8097 0.7817 0.5610 0.2326  0.0300  0.1112  24  LEU A CG    
2882 C  CD1   . LEU B 25  ? 0.8124 0.8217 0.5894 0.2085  0.0238  0.1066  24  LEU A CD1   
2883 C  CD2   . LEU B 25  ? 0.7648 0.7023 0.5012 0.2408  0.0462  0.1056  24  LEU A CD2   
2884 N  N     . ARG B 26  ? 0.8515 0.7073 0.5186 0.2529  0.0222  0.1305  25  ARG A N     
2885 C  CA    . ARG B 26  ? 0.9485 0.7769 0.5971 0.2420  0.0184  0.1327  25  ARG A CA    
2886 C  C     . ARG B 26  ? 0.9976 0.7648 0.6193 0.2386  0.0331  0.1306  25  ARG A C     
2887 O  O     . ARG B 26  ? 0.8981 0.6436 0.5127 0.2184  0.0342  0.1273  25  ARG A O     
2888 C  CB    . ARG B 26  ? 1.0411 0.8809 0.6801 0.2611  0.0077  0.1433  25  ARG A CB    
2889 C  CG    . ARG B 26  ? 1.0164 0.8286 0.6332 0.2527  0.0038  0.1467  25  ARG A CG    
2890 C  CD    . ARG B 26  ? 1.0885 0.9250 0.7206 0.2258  -0.0066 0.1411  25  ARG A CD    
2891 N  NE    . ARG B 26  ? 1.1577 1.0529 0.8175 0.2250  -0.0212 0.1410  25  ARG A NE    
2892 C  CZ    . ARG B 26  ? 1.0635 0.9850 0.7364 0.2054  -0.0329 0.1376  25  ARG A CZ    
2893 N  NH1   . ARG B 26  ? 0.9417 0.8364 0.6019 0.1867  -0.0316 0.1343  25  ARG A NH1   
2894 N  NH2   . ARG B 26  ? 1.0360 1.0103 0.7348 0.2044  -0.0456 0.1374  25  ARG A NH2   
2895 N  N     . ASP B 27  ? 1.0123 0.7504 0.6190 0.2580  0.0449  0.1323  26  ASP A N     
2896 C  CA    . ASP B 27  ? 1.0372 0.7145 0.6157 0.2572  0.0586  0.1316  26  ASP A CA    
2897 C  C     . ASP B 27  ? 1.0453 0.6999 0.6241 0.2496  0.0717  0.1217  26  ASP A C     
2898 O  O     . ASP B 27  ? 1.0307 0.6344 0.5868 0.2508  0.0843  0.1205  26  ASP A O     
2899 C  CB    . ASP B 27  ? 1.1550 0.8053 0.7085 0.2859  0.0626  0.1424  26  ASP A CB    
2900 C  CG    . ASP B 27  ? 1.2491 0.9130 0.7957 0.2921  0.0501  0.1522  26  ASP A CG    
2901 O  OD1   . ASP B 27  ? 1.1812 0.8431 0.7271 0.2714  0.0451  0.1504  26  ASP A OD1   
2902 O  OD2   . ASP B 27  ? 1.4100 1.0904 0.9556 0.3151  0.0452  0.1593  26  ASP A OD2   
2903 N  N     . ILE B 28  ? 0.9989 0.6893 0.6018 0.2410  0.0692  0.1145  27  ILE A N     
2904 C  CA    . ILE B 28  ? 1.0077 0.6799 0.6104 0.2334  0.0804  0.1044  27  ILE A CA    
2905 C  C     . ILE B 28  ? 0.9299 0.6165 0.5488 0.2030  0.0764  0.0960  27  ILE A C     
2906 O  O     . ILE B 28  ? 0.8388 0.5616 0.4753 0.1921  0.0646  0.0979  27  ILE A O     
2907 C  CB    . ILE B 28  ? 0.8784 0.5765 0.4920 0.2524  0.0833  0.1035  27  ILE A CB    
2908 C  CG1   . ILE B 28  ? 0.9036 0.6657 0.5478 0.2501  0.0702  0.1057  27  ILE A CG1   
2909 C  CG2   . ILE B 28  ? 0.8871 0.5629 0.4814 0.2839  0.0896  0.1116  27  ILE A CG2   
2910 C  CD1   . ILE B 28  ? 0.8912 0.6842 0.5501 0.2664  0.0735  0.1047  27  ILE A CD1   
2911 N  N     . PRO B 29  ? 0.8520 0.5112 0.4652 0.1885  0.0854  0.0866  28  PRO A N     
2912 C  CA    . PRO B 29  ? 0.7861 0.4597 0.4147 0.1608  0.0812  0.0794  28  PRO A CA    
2913 C  C     . PRO B 29  ? 0.7261 0.4484 0.3794 0.1580  0.0755  0.0761  28  PRO A C     
2914 O  O     . PRO B 29  ? 0.7498 0.4762 0.4038 0.1682  0.0818  0.0721  28  PRO A O     
2915 C  CB    . PRO B 29  ? 0.8179 0.4472 0.4314 0.1498  0.0926  0.0706  28  PRO A CB    
2916 C  CG    . PRO B 29  ? 0.8646 0.4574 0.4555 0.1723  0.1037  0.0721  28  PRO A CG    
2917 C  CD    . PRO B 29  ? 0.8549 0.4735 0.4492 0.1980  0.0992  0.0815  28  PRO A CD    
2918 N  N     . ILE B 30  ? 0.7417 0.5000 0.4144 0.1442  0.0644  0.0779  29  ILE A N     
2919 C  CA    . ILE B 30  ? 0.6460 0.4507 0.3432 0.1383  0.0589  0.0756  29  ILE A CA    
2920 C  C     . ILE B 30  ? 0.6919 0.5052 0.4006 0.1114  0.0542  0.0711  29  ILE A C     
2921 O  O     . ILE B 30  ? 0.6882 0.4823 0.3902 0.0992  0.0520  0.0718  29  ILE A O     
2922 C  CB    . ILE B 30  ? 0.7087 0.5574 0.4223 0.1505  0.0489  0.0834  29  ILE A CB    
2923 C  CG1   . ILE B 30  ? 0.5935 0.4543 0.3130 0.1369  0.0374  0.0872  29  ILE A CG1   
2924 C  CG2   . ILE B 30  ? 0.6711 0.5100 0.3720 0.1789  0.0522  0.0899  29  ILE A CG2   
2925 C  CD1   . ILE B 30  ? 0.6062 0.5122 0.3428 0.1451  0.0256  0.0938  29  ILE A CD1   
2926 N  N     . ALA B 31  ? 0.6025 0.4456 0.3284 0.1031  0.0531  0.0669  30  ALA A N     
2927 C  CA    . ALA B 31  ? 0.6095 0.4665 0.3485 0.0796  0.0481  0.0637  30  ALA A CA    
2928 C  C     . ALA B 31  ? 0.6166 0.5201 0.3783 0.0775  0.0438  0.0643  30  ALA A C     
2929 O  O     . ALA B 31  ? 0.6212 0.5396 0.3865 0.0913  0.0483  0.0640  30  ALA A O     
2930 C  CB    . ALA B 31  ? 0.6339 0.4614 0.3632 0.0661  0.0552  0.0555  30  ALA A CB    
2931 N  N     . ILE B 32  ? 0.5312 0.4569 0.3079 0.0606  0.0358  0.0655  31  ILE A N     
2932 C  CA    . ILE B 32  ? 0.5225 0.4883 0.3206 0.0534  0.0329  0.0655  31  ILE A CA    
2933 C  C     . ILE B 32  ? 0.5959 0.5513 0.3928 0.0370  0.0370  0.0592  31  ILE A C     
2934 O  O     . ILE B 32  ? 0.5178 0.4538 0.3097 0.0225  0.0351  0.0575  31  ILE A O     
2935 C  CB    . ILE B 32  ? 0.5212 0.5164 0.3359 0.0443  0.0217  0.0704  31  ILE A CB    
2936 C  CG1   . ILE B 32  ? 0.6589 0.6715 0.4769 0.0610  0.0159  0.0765  31  ILE A CG1   
2937 C  CG2   . ILE B 32  ? 0.4928 0.5244 0.3288 0.0332  0.0199  0.0702  31  ILE A CG2   
2938 C  CD1   . ILE B 32  ? 0.5868 0.5679 0.3849 0.0697  0.0146  0.0791  31  ILE A CD1   
2939 N  N     . GLY B 33  ? 0.5986 0.5671 0.3993 0.0399  0.0428  0.0560  32  GLY A N     
2940 C  CA    . GLY B 33  ? 0.5804 0.5417 0.3790 0.0253  0.0459  0.0503  32  GLY A CA    
2941 C  C     . GLY B 33  ? 0.5880 0.5651 0.3884 0.0325  0.0528  0.0475  32  GLY A C     
2942 O  O     . GLY B 33  ? 0.5959 0.5849 0.3976 0.0500  0.0569  0.0492  32  GLY A O     
2943 N  N     . GLY B 34  ? 0.5395 0.5172 0.3395 0.0193  0.0544  0.0433  33  GLY A N     
2944 C  CA    . GLY B 34  ? 0.5450 0.5350 0.3434 0.0249  0.0617  0.0400  33  GLY A CA    
2945 C  C     . GLY B 34  ? 0.5457 0.5022 0.3211 0.0350  0.0701  0.0320  33  GLY A C     
2946 O  O     . GLY B 34  ? 0.6168 0.5386 0.3775 0.0299  0.0701  0.0273  33  GLY A O     
2947 N  N     . SER B 35  ? 0.5995 0.5663 0.3717 0.0493  0.0781  0.0303  34  SER A N     
2948 C  CA    . SER B 35  ? 0.6243 0.5585 0.3733 0.0609  0.0870  0.0224  34  SER A CA    
2949 C  C     . SER B 35  ? 0.7544 0.6639 0.4877 0.0462  0.0877  0.0133  34  SER A C     
2950 O  O     . SER B 35  ? 0.6682 0.5906 0.4093 0.0291  0.0823  0.0137  34  SER A O     
2951 C  CB    . SER B 35  ? 0.6448 0.5975 0.3938 0.0788  0.0961  0.0222  34  SER A CB    
2952 O  OG    . SER B 35  ? 0.5812 0.5559 0.3352 0.0693  0.0976  0.0207  34  SER A OG    
2953 N  N     . ARG B 36  ? 0.6403 0.5136 0.3507 0.0533  0.0945  0.0049  35  ARG A N     
2954 C  CA    . ARG B 36  ? 0.7370 0.5871 0.4312 0.0401  0.0950  -0.0051 35  ARG A CA    
2955 C  C     . ARG B 36  ? 0.6967 0.5695 0.3904 0.0380  0.0978  -0.0078 35  ARG A C     
2956 O  O     . ARG B 36  ? 0.7538 0.6308 0.4478 0.0214  0.0927  -0.0103 35  ARG A O     
2957 C  CB    . ARG B 36  ? 0.7907 0.5959 0.4598 0.0485  0.1022  -0.0140 35  ARG A CB    
2958 C  CG    . ARG B 36  ? 0.9417 0.7192 0.5946 0.0326  0.1009  -0.0249 35  ARG A CG    
2959 C  CD    . ARG B 36  ? 1.1015 0.8315 0.7337 0.0366  0.1062  -0.0318 35  ARG A CD    
2960 N  NE    . ARG B 36  ? 1.2571 0.9614 0.8738 0.0209  0.1050  -0.0436 35  ARG A NE    
2961 C  CZ    . ARG B 36  ? 1.3165 0.9895 0.9085 0.0256  0.1122  -0.0551 35  ARG A CZ    
2962 N  NH1   . ARG B 36  ? 1.2335 0.8948 0.8126 0.0471  0.1224  -0.0561 35  ARG A NH1   
2963 N  NH2   . ARG B 36  ? 1.4256 1.0786 1.0054 0.0090  0.1092  -0.0659 35  ARG A NH2   
2964 N  N     . GLU B 37  ? 0.8301 0.7193 0.5235 0.0554  0.1060  -0.0066 36  GLU A N     
2965 C  CA    . GLU B 37  ? 0.8414 0.7528 0.5331 0.0551  0.1105  -0.0084 36  GLU A CA    
2966 C  C     . GLU B 37  ? 0.7457 0.6913 0.4581 0.0392  0.1029  -0.0010 36  GLU A C     
2967 O  O     . GLU B 37  ? 0.7483 0.7033 0.4555 0.0313  0.1037  -0.0034 36  GLU A O     
2968 C  CB    . GLU B 37  ? 0.9027 0.8330 0.5969 0.0773  0.1209  -0.0056 36  GLU A CB    
2969 C  CG    . GLU B 37  ? 1.0539 1.0130 0.7734 0.0870  0.1185  0.0060  36  GLU A CG    
2970 C  CD    . GLU B 37  ? 0.9607 0.9631 0.6976 0.0991  0.1249  0.0128  36  GLU A CD    
2971 O  OE1   . GLU B 37  ? 0.9696 0.9908 0.7071 0.0939  0.1287  0.0121  36  GLU A OE1   
2972 O  OE2   . GLU B 37  ? 0.7648 0.7838 0.5158 0.1140  0.1258  0.0195  36  GLU A OE2   
2973 N  N     . ARG B 38  ? 0.6668 0.6303 0.4012 0.0349  0.0959  0.0082  37  ARG A N     
2974 C  CA    . ARG B 38  ? 0.6260 0.6202 0.3805 0.0203  0.0893  0.0158  37  ARG A CA    
2975 C  C     . ARG B 38  ? 0.5721 0.5507 0.3262 0.0013  0.0800  0.0147  37  ARG A C     
2976 O  O     . ARG B 38  ? 0.5982 0.5971 0.3689 -0.0108 0.0737  0.0215  37  ARG A O     
2977 C  CB    . ARG B 38  ? 0.6361 0.6608 0.4149 0.0260  0.0869  0.0259  37  ARG A CB    
2978 C  CG    . ARG B 38  ? 0.7159 0.7659 0.5004 0.0434  0.0961  0.0284  37  ARG A CG    
2979 C  CD    . ARG B 38  ? 0.9075 0.9971 0.7202 0.0455  0.0930  0.0387  37  ARG A CD    
2980 N  NE    . ARG B 38  ? 1.0349 1.1401 0.8639 0.0260  0.0838  0.0443  37  ARG A NE    
2981 C  CZ    . ARG B 38  ? 0.9446 1.0635 0.7774 0.0125  0.0840  0.0460  37  ARG A CZ    
2982 N  NH1   . ARG B 38  ? 0.9737 1.0938 0.7945 0.0158  0.0925  0.0424  37  ARG A NH1   
2983 N  NH2   . ARG B 38  ? 0.8725 1.0021 0.7195 -0.0040 0.0759  0.0513  37  ARG A NH2   
2984 N  N     . ARG B 39  ? 0.5042 0.4470 0.2398 -0.0016 0.0796  0.0062  38  ARG A N     
2985 C  CA    . ARG B 39  ? 0.5336 0.4604 0.2685 -0.0189 0.0717  0.0043  38  ARG A CA    
2986 C  C     . ARG B 39  ? 0.6642 0.5981 0.4172 -0.0247 0.0648  0.0125  38  ARG A C     
2987 O  O     . ARG B 39  ? 0.5887 0.5291 0.3512 -0.0392 0.0582  0.0158  38  ARG A O     
2988 C  CB    . ARG B 39  ? 0.5496 0.4885 0.2831 -0.0317 0.0687  0.0031  38  ARG A CB    
2989 C  CG    . ARG B 39  ? 0.5715 0.5031 0.2840 -0.0250 0.0757  -0.0055 38  ARG A CG    
2990 C  CD    . ARG B 39  ? 0.5945 0.5227 0.2963 -0.0382 0.0714  -0.0105 38  ARG A CD    
2991 N  NE    . ARG B 39  ? 0.5689 0.5285 0.2817 -0.0436 0.0700  -0.0026 38  ARG A NE    
2992 C  CZ    . ARG B 39  ? 0.6289 0.5932 0.3321 -0.0516 0.0677  -0.0048 38  ARG A CZ    
2993 N  NH1   . ARG B 39  ? 0.7127 0.6539 0.3956 -0.0558 0.0655  -0.0155 38  ARG A NH1   
2994 N  NH2   . ARG B 39  ? 0.5396 0.5313 0.2527 -0.0554 0.0676  0.0039  38  ARG A NH2   
2995 N  N     . GLY B 40  ? 0.5717 0.5021 0.3277 -0.0124 0.0666  0.0156  39  GLY A N     
2996 C  CA    . GLY B 40  ? 0.5399 0.4793 0.3113 -0.0155 0.0604  0.0234  39  GLY A CA    
2997 C  C     . GLY B 40  ? 0.4772 0.3865 0.2424 -0.0222 0.0571  0.0218  39  GLY A C     
2998 O  O     . GLY B 40  ? 0.4978 0.3780 0.2479 -0.0251 0.0595  0.0145  39  GLY A O     
2999 N  N     . VAL B 41  ? 0.4502 0.3675 0.2277 -0.0260 0.0514  0.0286  40  VAL A N     
3000 C  CA    . VAL B 41  ? 0.5398 0.4310 0.3123 -0.0298 0.0492  0.0288  40  VAL A CA    
3001 C  C     . VAL B 41  ? 0.4629 0.3585 0.2390 -0.0182 0.0478  0.0351  40  VAL A C     
3002 O  O     . VAL B 41  ? 0.5256 0.4488 0.3122 -0.0101 0.0466  0.0396  40  VAL A O     
3003 C  CB    . VAL B 41  ? 0.6061 0.4987 0.3873 -0.0476 0.0432  0.0308  40  VAL A CB    
3004 C  CG1   . VAL B 41  ? 0.6024 0.4935 0.3809 -0.0588 0.0432  0.0254  40  VAL A CG1   
3005 C  CG2   . VAL B 41  ? 0.4671 0.3891 0.2655 -0.0509 0.0376  0.0384  40  VAL A CG2   
3006 N  N     . ILE B 42  ? 0.4917 0.3609 0.2595 -0.0182 0.0476  0.0357  41  ILE A N     
3007 C  CA    . ILE B 42  ? 0.4847 0.3541 0.2530 -0.0083 0.0452  0.0419  41  ILE A CA    
3008 C  C     . ILE B 42  ? 0.4858 0.3751 0.2686 -0.0192 0.0371  0.0473  41  ILE A C     
3009 O  O     . ILE B 42  ? 0.5190 0.3992 0.3034 -0.0335 0.0351  0.0466  41  ILE A O     
3010 C  CB    . ILE B 42  ? 0.5780 0.4082 0.3291 -0.0043 0.0493  0.0407  41  ILE A CB    
3011 C  CG1   . ILE B 42  ? 0.5087 0.3140 0.2436 0.0051  0.0580  0.0343  41  ILE A CG1   
3012 C  CG2   . ILE B 42  ? 0.5067 0.3365 0.2558 0.0067  0.0463  0.0479  41  ILE A CG2   
3013 C  CD1   . ILE B 42  ? 0.6145 0.4345 0.3485 0.0238  0.0612  0.0354  41  ILE A CD1   
3014 N  N     . SER B 43  ? 0.4758 0.3919 0.2691 -0.0124 0.0324  0.0527  42  SER A N     
3015 C  CA    . SER B 43  ? 0.4884 0.4185 0.2920 -0.0214 0.0245  0.0574  42  SER A CA    
3016 C  C     . SER B 43  ? 0.5441 0.4507 0.3359 -0.0175 0.0229  0.0599  42  SER A C     
3017 O  O     . SER B 43  ? 0.4769 0.3741 0.2684 -0.0288 0.0201  0.0608  42  SER A O     
3018 C  CB    . SER B 43  ? 0.5064 0.4746 0.3261 -0.0172 0.0194  0.0616  42  SER A CB    
3019 O  OG    . SER B 43  ? 0.5660 0.5570 0.3979 -0.0246 0.0208  0.0604  42  SER A OG    
3020 N  N     . THR B 44  ? 0.5827 0.4790 0.3639 -0.0006 0.0254  0.0615  43  THR A N     
3021 C  CA    . THR B 44  ? 0.5700 0.4404 0.3366 0.0046  0.0253  0.0644  43  THR A CA    
3022 C  C     . THR B 44  ? 0.5422 0.3965 0.2948 0.0245  0.0308  0.0654  43  THR A C     
3023 O  O     . THR B 44  ? 0.5239 0.3915 0.2801 0.0349  0.0336  0.0641  43  THR A O     
3024 C  CB    . THR B 44  ? 0.5536 0.4416 0.3260 0.0029  0.0158  0.0695  43  THR A CB    
3025 O  OG1   . THR B 44  ? 0.5870 0.4467 0.3428 0.0056  0.0165  0.0721  43  THR A OG1   
3026 C  CG2   . THR B 44  ? 0.5044 0.4226 0.2851 0.0171  0.0108  0.0732  43  THR A CG2   
3027 N  N     . ALA B 45  ? 0.5781 0.4029 0.3138 0.0305  0.0330  0.0681  44  ALA A N     
3028 C  CA    . ALA B 45  ? 0.6430 0.4458 0.3624 0.0495  0.0393  0.0697  44  ALA A CA    
3029 C  C     . ALA B 45  ? 0.6543 0.4431 0.3604 0.0584  0.0364  0.0765  44  ALA A C     
3030 O  O     . ALA B 45  ? 0.6881 0.4733 0.3935 0.0473  0.0324  0.0782  44  ALA A O     
3031 C  CB    . ALA B 45  ? 0.7007 0.4667 0.4069 0.0461  0.0500  0.0637  44  ALA A CB    
3032 N  N     . ASN B 46  ? 0.6205 0.4013 0.3151 0.0795  0.0388  0.0807  45  ASN A N     
3033 C  CA    . ASN B 46  ? 0.6519 0.4180 0.3308 0.0904  0.0363  0.0881  45  ASN A CA    
3034 C  C     . ASN B 46  ? 0.6675 0.3840 0.3243 0.0884  0.0467  0.0879  45  ASN A C     
3035 O  O     . ASN B 46  ? 0.7066 0.4027 0.3621 0.0783  0.0548  0.0817  45  ASN A O     
3036 C  CB    . ASN B 46  ? 0.7066 0.4875 0.3832 0.1149  0.0337  0.0938  45  ASN A CB    
3037 C  CG    . ASN B 46  ? 0.6981 0.4528 0.3618 0.1308  0.0452  0.0926  45  ASN A CG    
3038 O  OD1   . ASN B 46  ? 0.7500 0.4801 0.4090 0.1221  0.0544  0.0860  45  ASN A OD1   
3039 N  ND2   . ASN B 46  ? 0.6619 0.4225 0.3199 0.1544  0.0445  0.0988  45  ASN A ND2   
3040 N  N     . TYR B 47  ? 0.7421 0.4390 0.3811 0.0977  0.0464  0.0949  46  TYR A N     
3041 C  CA    . TYR B 47  ? 0.7222 0.3725 0.3410 0.0940  0.0569  0.0956  46  TYR A CA    
3042 C  C     . TYR B 47  ? 0.6969 0.3141 0.3017 0.1051  0.0689  0.0940  46  TYR A C     
3043 O  O     . TYR B 47  ? 0.7981 0.3817 0.3947 0.0942  0.0786  0.0901  46  TYR A O     
3044 C  CB    . TYR B 47  ? 0.8170 0.4538 0.4181 0.1015  0.0543  0.1042  46  TYR A CB    
3045 C  CG    . TYR B 47  ? 0.7941 0.4424 0.4025 0.0833  0.0484  0.1033  46  TYR A CG    
3046 C  CD1   . TYR B 47  ? 0.8037 0.4272 0.4094 0.0662  0.0562  0.1003  46  TYR A CD1   
3047 C  CD2   . TYR B 47  ? 0.8292 0.5139 0.4484 0.0827  0.0351  0.1049  46  TYR A CD2   
3048 C  CE1   . TYR B 47  ? 0.8283 0.4659 0.4453 0.0503  0.0513  0.0979  46  TYR A CE1   
3049 C  CE2   . TYR B 47  ? 0.8291 0.5216 0.4535 0.0662  0.0304  0.1034  46  TYR A CE2   
3050 C  CZ    . TYR B 47  ? 0.8613 0.5277 0.4820 0.0512  0.0391  0.1009  46  TYR A CZ    
3051 O  OH    . TYR B 47  ? 0.7490 0.4254 0.3779 0.0361  0.0350  0.0985  46  TYR A OH    
3052 N  N     . PRO B 48  ? 0.8033 0.4267 0.4042 0.1266  0.0691  0.0968  47  PRO A N     
3053 C  CA    . PRO B 48  ? 0.8397 0.4293 0.4271 0.1356  0.0815  0.0936  47  PRO A CA    
3054 C  C     . PRO B 48  ? 0.9410 0.5305 0.5395 0.1190  0.0859  0.0824  47  PRO A C     
3055 O  O     . PRO B 48  ? 0.8414 0.3928 0.4267 0.1153  0.0967  0.0777  47  PRO A O     
3056 C  CB    . PRO B 48  ? 0.7849 0.3922 0.3715 0.1618  0.0791  0.0985  47  PRO A CB    
3057 C  CG    . PRO B 48  ? 0.8306 0.4589 0.4169 0.1701  0.0683  0.1078  47  PRO A CG    
3058 C  CD    . PRO B 48  ? 0.8530 0.5046 0.4556 0.1461  0.0598  0.1045  47  PRO A CD    
3059 N  N     . ALA B 49  ? 0.8680 0.4984 0.4897 0.1081  0.0778  0.0780  48  ALA A N     
3060 C  CA    . ALA B 49  ? 0.7352 0.3663 0.3661 0.0918  0.0812  0.0679  48  ALA A CA    
3061 C  C     . ALA B 49  ? 0.7557 0.3695 0.3875 0.0688  0.0827  0.0645  48  ALA A C     
3062 O  O     . ALA B 49  ? 0.7365 0.3286 0.3649 0.0578  0.0894  0.0569  48  ALA A O     
3063 C  CB    . ALA B 49  ? 0.6966 0.3762 0.3508 0.0884  0.0729  0.0654  48  ALA A CB    
3064 N  N     . ARG B 50  ? 0.7270 0.3501 0.3630 0.0615  0.0767  0.0698  49  ARG A N     
3065 C  CA    . ARG B 50  ? 0.7404 0.3497 0.3789 0.0409  0.0787  0.0674  49  ARG A CA    
3066 C  C     . ARG B 50  ? 0.7406 0.3021 0.3601 0.0394  0.0905  0.0669  49  ARG A C     
3067 O  O     . ARG B 50  ? 0.7780 0.3262 0.4014 0.0215  0.0945  0.0620  49  ARG A O     
3068 C  CB    . ARG B 50  ? 0.6738 0.2996 0.3172 0.0364  0.0710  0.0737  49  ARG A CB    
3069 C  CG    . ARG B 50  ? 0.6695 0.3406 0.3338 0.0319  0.0598  0.0728  49  ARG A CG    
3070 C  CD    . ARG B 50  ? 0.7131 0.3985 0.3816 0.0254  0.0521  0.0773  49  ARG A CD    
3071 N  NE    . ARG B 50  ? 0.6874 0.4145 0.3752 0.0217  0.0419  0.0764  49  ARG A NE    
3072 C  CZ    . ARG B 50  ? 0.9620 0.7070 0.6587 0.0112  0.0345  0.0776  49  ARG A CZ    
3073 N  NH1   . ARG B 50  ? 1.0545 0.7801 0.7422 0.0043  0.0365  0.0798  49  ARG A NH1   
3074 N  NH2   . ARG B 50  ? 0.8168 0.5982 0.5311 0.0077  0.0260  0.0767  49  ARG A NH2   
3075 N  N     . LYS B 51  ? 0.7820 0.3171 0.3815 0.0576  0.0964  0.0721  50  LYS A N     
3076 C  CA    . LYS B 51  ? 0.8636 0.3567 0.4486 0.0539  0.1077  0.0705  50  LYS A CA    
3077 C  C     . LYS B 51  ? 0.8340 0.3061 0.4167 0.0461  0.1153  0.0608  50  LYS A C     
3078 O  O     . LYS B 51  ? 0.8817 0.3416 0.4683 0.0335  0.1208  0.0538  50  LYS A O     
3079 C  CB    . LYS B 51  ? 0.9272 0.4041 0.4957 0.0745  0.1115  0.0768  50  LYS A CB    
3080 C  CG    . LYS B 51  ? 1.1075 0.5608 0.6594 0.0925  0.1186  0.0768  50  LYS A CG    
3081 C  CD    . LYS B 51  ? 1.0995 0.5313 0.6371 0.1047  0.1253  0.0799  50  LYS A CD    
3082 C  CE    . LYS B 51  ? 1.1608 0.5752 0.6817 0.1284  0.1306  0.0824  50  LYS A CE    
3083 N  NZ    . LYS B 51  ? 1.1965 0.6357 0.7175 0.1491  0.1217  0.0917  50  LYS A NZ    
3084 N  N     . PHE B 52  ? 0.8614 0.3506 0.4494 0.0519  0.1124  0.0559  51  PHE A N     
3085 C  CA    . PHE B 52  ? 0.9264 0.4034 0.5144 0.0426  0.1172  0.0446  51  PHE A CA    
3086 C  C     . PHE B 52  ? 0.9310 0.4302 0.5388 0.0188  0.1116  0.0377  51  PHE A C     
3087 O  O     . PHE B 52  ? 0.8807 0.3725 0.4891 0.0089  0.1141  0.0278  51  PHE A O     
3088 C  CB    . PHE B 52  ? 0.7952 0.2865 0.3819 0.0594  0.1166  0.0415  51  PHE A CB    
3089 C  CG    . PHE B 52  ? 0.9040 0.3697 0.4702 0.0841  0.1237  0.0470  51  PHE A CG    
3090 C  CD1   . PHE B 52  ? 0.8747 0.2954 0.4205 0.0883  0.1354  0.0418  51  PHE A CD1   
3091 C  CD2   . PHE B 52  ? 0.8800 0.3664 0.4471 0.1034  0.1185  0.0573  51  PHE A CD2   
3092 C  CE1   . PHE B 52  ? 1.0087 0.4035 0.5345 0.1124  0.1426  0.0476  51  PHE A CE1   
3093 C  CE2   . PHE B 52  ? 0.8862 0.3502 0.4346 0.1278  0.1246  0.0632  51  PHE A CE2   
3094 C  CZ    . PHE B 52  ? 0.9624 0.3795 0.4897 0.1329  0.1372  0.0587  51  PHE A CZ    
3095 N  N     . GLY B 53  ? 0.8636 0.3894 0.486