data_5YUY
# 
_entry.id   5YUY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5YUY         
WWPDB D_1300005349 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5YUY 
_pdbx_database_status.recvd_initial_deposition_date   2017-11-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kottur, J.' 1 ? 
'Nair, D.T.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                5875 
_citation.page_last                 5885 
_citation.title                     'Pyrophosphate hydrolysis is an intrinsic and critical step of the DNA synthesis reaction' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky402 
_citation.pdbx_database_id_PubMed   29850882 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kottur, J.' 1 ? 
primary 'Nair, D.T.' 2 ? 
# 
_cell.entry_id           5YUY 
_cell.length_a           86.460 
_cell.length_b           57.050 
_cell.length_c           110.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.03 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5YUY 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'         39589.895 2   2.7.7.7 ? ? ? 
2 polymer     syn DTN1                        5492.554  2   ?       ? ? ? 
3 polymer     syn DTN                         5796.747  2   ?       ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'             24.305    4   ?       ? ? ? 
5 non-polymer syn DIPHOSPHATE                 173.943   2   ?       ? ? ? 
6 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE" 482.168   2   ?       ? ? ? 
7 water       nat water                       18.015    999 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV,Translesion synthesis polymerase IV,TSL polymerase IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAY
KEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPN
GQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERL
RKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKT
WDERRGGRGVRLVGLHVTLLDPQMERQLVLGL
;
;GSRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAY
KEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPN
GQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERL
RKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKT
WDERRGGRGVRLVGLHVTLLDPQMERQLVLGL
;
F,A ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DT)(DA)(DG)(DG)(DG)(DT)(DC)(DC)(DT)(DA)(DG)(DG)(DA)(DC)(DC)(DC)' TCTAGGGTCCTAGGACCC G,B 
? 
3 polydeoxyribonucleotide no no '(DT)(DC)(DT)(DA)(DG)(DG)(DG)(DT)(DC)(DC)(DT)(DA)(DG)(DG)(DA)(DC)(DC)(DC)(DT)' TCTAGGGTCCTAGGACCCT 
H,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ARG n 
1 4   LYS n 
1 5   ILE n 
1 6   ILE n 
1 7   HIS n 
1 8   VAL n 
1 9   ASP n 
1 10  MET n 
1 11  ASP n 
1 12  CYS n 
1 13  PHE n 
1 14  PHE n 
1 15  ALA n 
1 16  ALA n 
1 17  VAL n 
1 18  GLU n 
1 19  MET n 
1 20  ARG n 
1 21  ASP n 
1 22  ASN n 
1 23  PRO n 
1 24  ALA n 
1 25  LEU n 
1 26  ARG n 
1 27  ASP n 
1 28  ILE n 
1 29  PRO n 
1 30  ILE n 
1 31  ALA n 
1 32  ILE n 
1 33  GLY n 
1 34  GLY n 
1 35  SER n 
1 36  ARG n 
1 37  GLU n 
1 38  ARG n 
1 39  ARG n 
1 40  GLY n 
1 41  VAL n 
1 42  ILE n 
1 43  SER n 
1 44  THR n 
1 45  ALA n 
1 46  ASN n 
1 47  TYR n 
1 48  PRO n 
1 49  ALA n 
1 50  ARG n 
1 51  LYS n 
1 52  PHE n 
1 53  GLY n 
1 54  VAL n 
1 55  ARG n 
1 56  SER n 
1 57  ALA n 
1 58  MET n 
1 59  PRO n 
1 60  THR n 
1 61  GLY n 
1 62  MET n 
1 63  ALA n 
1 64  LEU n 
1 65  LYS n 
1 66  LEU n 
1 67  CYS n 
1 68  PRO n 
1 69  HIS n 
1 70  LEU n 
1 71  THR n 
1 72  LEU n 
1 73  LEU n 
1 74  PRO n 
1 75  GLY n 
1 76  ARG n 
1 77  PHE n 
1 78  ASP n 
1 79  ALA n 
1 80  TYR n 
1 81  LYS n 
1 82  GLU n 
1 83  ALA n 
1 84  SER n 
1 85  ASN n 
1 86  HIS n 
1 87  ILE n 
1 88  ARG n 
1 89  GLU n 
1 90  ILE n 
1 91  PHE n 
1 92  SER n 
1 93  ARG n 
1 94  TYR n 
1 95  THR n 
1 96  SER n 
1 97  ARG n 
1 98  ILE n 
1 99  GLU n 
1 100 PRO n 
1 101 LEU n 
1 102 SER n 
1 103 LEU n 
1 104 ASP n 
1 105 GLU n 
1 106 ALA n 
1 107 TYR n 
1 108 LEU n 
1 109 ASP n 
1 110 VAL n 
1 111 THR n 
1 112 ASP n 
1 113 SER n 
1 114 VAL n 
1 115 HIS n 
1 116 CYS n 
1 117 HIS n 
1 118 GLY n 
1 119 SER n 
1 120 ALA n 
1 121 THR n 
1 122 LEU n 
1 123 ILE n 
1 124 ALA n 
1 125 GLN n 
1 126 GLU n 
1 127 ILE n 
1 128 ARG n 
1 129 GLN n 
1 130 THR n 
1 131 ILE n 
1 132 PHE n 
1 133 ASN n 
1 134 GLU n 
1 135 LEU n 
1 136 GLN n 
1 137 LEU n 
1 138 THR n 
1 139 ALA n 
1 140 SER n 
1 141 ALA n 
1 142 GLY n 
1 143 VAL n 
1 144 ALA n 
1 145 PRO n 
1 146 VAL n 
1 147 LYS n 
1 148 PHE n 
1 149 LEU n 
1 150 ALA n 
1 151 LYS n 
1 152 ILE n 
1 153 ALA n 
1 154 SER n 
1 155 ASP n 
1 156 MET n 
1 157 ASN n 
1 158 LYS n 
1 159 PRO n 
1 160 ASN n 
1 161 GLY n 
1 162 GLN n 
1 163 PHE n 
1 164 VAL n 
1 165 ILE n 
1 166 THR n 
1 167 PRO n 
1 168 ALA n 
1 169 GLU n 
1 170 VAL n 
1 171 PRO n 
1 172 ALA n 
1 173 PHE n 
1 174 LEU n 
1 175 GLN n 
1 176 THR n 
1 177 LEU n 
1 178 PRO n 
1 179 LEU n 
1 180 ALA n 
1 181 LYS n 
1 182 ILE n 
1 183 PRO n 
1 184 GLY n 
1 185 VAL n 
1 186 GLY n 
1 187 LYS n 
1 188 VAL n 
1 189 SER n 
1 190 ALA n 
1 191 ALA n 
1 192 LYS n 
1 193 LEU n 
1 194 GLU n 
1 195 ALA n 
1 196 MET n 
1 197 GLY n 
1 198 LEU n 
1 199 ARG n 
1 200 THR n 
1 201 CYS n 
1 202 GLY n 
1 203 ASP n 
1 204 VAL n 
1 205 GLN n 
1 206 LYS n 
1 207 CYS n 
1 208 ASP n 
1 209 LEU n 
1 210 VAL n 
1 211 MET n 
1 212 LEU n 
1 213 LEU n 
1 214 LYS n 
1 215 ARG n 
1 216 PHE n 
1 217 GLY n 
1 218 LYS n 
1 219 PHE n 
1 220 GLY n 
1 221 ARG n 
1 222 ILE n 
1 223 LEU n 
1 224 TRP n 
1 225 GLU n 
1 226 ARG n 
1 227 SER n 
1 228 GLN n 
1 229 GLY n 
1 230 ILE n 
1 231 ASP n 
1 232 GLU n 
1 233 ARG n 
1 234 ASP n 
1 235 VAL n 
1 236 ASN n 
1 237 SER n 
1 238 GLU n 
1 239 ARG n 
1 240 LEU n 
1 241 ARG n 
1 242 LYS n 
1 243 SER n 
1 244 VAL n 
1 245 GLY n 
1 246 VAL n 
1 247 GLU n 
1 248 ARG n 
1 249 THR n 
1 250 MET n 
1 251 ALA n 
1 252 GLU n 
1 253 ASP n 
1 254 ILE n 
1 255 HIS n 
1 256 HIS n 
1 257 TRP n 
1 258 SER n 
1 259 GLU n 
1 260 CYS n 
1 261 GLU n 
1 262 ALA n 
1 263 ILE n 
1 264 ILE n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 TYR n 
1 269 PRO n 
1 270 GLU n 
1 271 LEU n 
1 272 GLU n 
1 273 ARG n 
1 274 ARG n 
1 275 LEU n 
1 276 ALA n 
1 277 LYS n 
1 278 VAL n 
1 279 LYS n 
1 280 PRO n 
1 281 ASP n 
1 282 LEU n 
1 283 LEU n 
1 284 ILE n 
1 285 ALA n 
1 286 ARG n 
1 287 GLN n 
1 288 GLY n 
1 289 VAL n 
1 290 LYS n 
1 291 LEU n 
1 292 LYS n 
1 293 PHE n 
1 294 ASP n 
1 295 ASP n 
1 296 PHE n 
1 297 GLN n 
1 298 GLN n 
1 299 THR n 
1 300 THR n 
1 301 GLN n 
1 302 GLU n 
1 303 HIS n 
1 304 VAL n 
1 305 TRP n 
1 306 PRO n 
1 307 ARG n 
1 308 LEU n 
1 309 ASN n 
1 310 LYS n 
1 311 ALA n 
1 312 ASP n 
1 313 LEU n 
1 314 ILE n 
1 315 ALA n 
1 316 THR n 
1 317 ALA n 
1 318 ARG n 
1 319 LYS n 
1 320 THR n 
1 321 TRP n 
1 322 ASP n 
1 323 GLU n 
1 324 ARG n 
1 325 ARG n 
1 326 GLY n 
1 327 GLY n 
1 328 ARG n 
1 329 GLY n 
1 330 VAL n 
1 331 ARG n 
1 332 LEU n 
1 333 VAL n 
1 334 GLY n 
1 335 LEU n 
1 336 HIS n 
1 337 VAL n 
1 338 THR n 
1 339 LEU n 
1 340 LEU n 
1 341 ASP n 
1 342 PRO n 
1 343 GLN n 
1 344 MET n 
1 345 GLU n 
1 346 ARG n 
1 347 GLN n 
1 348 LEU n 
1 349 VAL n 
1 350 LEU n 
1 351 GLY n 
1 352 LEU n 
2 1   DT  n 
2 2   DC  n 
2 3   DT  n 
2 4   DA  n 
2 5   DG  n 
2 6   DG  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DT  n 
2 12  DA  n 
2 13  DG  n 
2 14  DG  n 
2 15  DA  n 
2 16  DC  n 
2 17  DC  n 
2 18  DC  n 
3 1   DT  n 
3 2   DC  n 
3 3   DT  n 
3 4   DA  n 
3 5   DG  n 
3 6   DG  n 
3 7   DG  n 
3 8   DT  n 
3 9   DC  n 
3 10  DC  n 
3 11  DT  n 
3 12  DA  n 
3 13  DG  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
3 19  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   352 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K-12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 18 'Escherichia coli K-12' ? 83333 ? 
3 1 sample 1 19 'Escherichia coli K-12' ? 83333 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPO4_ECOLI Q47155 ? 1 
;RKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKE
ASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQ
FVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRK
SVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWD
ERRGGRGVRLVGLHVTLLDPQMERQLVLGL
;
2 
2 PDB 5YUY       5YUY   ? 2 ? 1 
3 PDB 5YUY       5YUY   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5YUY F 3 ? 352 ? Q47155 2   ? 351 ? 2   351 
2 1 5YUY A 3 ? 352 ? Q47155 2   ? 351 ? 2   351 
3 2 5YUY G 1 ? 18  ? 5YUY   837 ? 854 ? 837 854 
4 3 5YUY H 1 ? 19  ? 5YUY   856 ? 874 ? 856 874 
5 2 5YUY B 1 ? 18  ? 5YUY   837 ? 854 ? 837 854 
6 3 5YUY C 1 ? 19  ? 5YUY   856 ? 874 ? 856 874 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5YUY GLY F 1 ? UNP Q47155 ? ? 'expression tag' 0 1 
1 5YUY SER F 2 ? UNP Q47155 ? ? 'expression tag' 1 2 
2 5YUY GLY A 1 ? UNP Q47155 ? ? 'expression tag' 0 3 
2 5YUY SER A 2 ? UNP Q47155 ? ? 'expression tag' 1 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ? 'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"          ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5YUY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.66 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.76 
_exptl_crystal.description                 'THE ENTRY CONTAINS FRIEDEL PAIRS IN I/F_PLUS/MINUS COLUMNS.' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15% MPD , pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MAR CCD 130 mm' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-09-18 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95372 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.95372 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5YUY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.74 
_reflns.d_resolution_low                 54.87 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       110068 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                0.06 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.996 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.74 
_reflns_shell.d_res_low                   1.83 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           15993 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.587 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.751 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5YUY 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     110068 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.01 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.542 
_refine.ls_d_res_high                            1.740 
_refine.ls_percent_reflns_obs                    99.77 
_refine.ls_R_factor_obs                          0.1895 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1881 
_refine.ls_R_factor_R_free                       0.2153 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  10768 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4IR1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.22 
_refine.pdbx_overall_phase_error                 24.48 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5382 
_refine_hist.pdbx_number_atoms_nucleic_acid   1440 
_refine_hist.pdbx_number_atoms_ligand         80 
_refine_hist.number_atoms_solvent             999 
_refine_hist.number_atoms_total               7901 
_refine_hist.d_res_high                       1.740 
_refine_hist.d_res_low                        44.542 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 7223  'X-RAY DIFFRACTION' ? 
f_angle_d          1.040  ? ? 10080 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 22.125 ? ? 4201  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.054  ? ? 1115  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1038  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.7400 1.7598  6729 0.3555 99.00  0.3759 . . 350 . . . . 
'X-RAY DIFFRACTION' . 1.7598 1.7805  6863 0.3016 100.00 0.3513 . . 393 . . . . 
'X-RAY DIFFRACTION' . 1.7805 1.8022  6693 0.3038 100.00 0.3406 . . 396 . . . . 
'X-RAY DIFFRACTION' . 1.8022 1.8250  6801 0.2801 100.00 0.3087 . . 345 . . . . 
'X-RAY DIFFRACTION' . 1.8250 1.8490  6901 0.2781 100.00 0.3334 . . 339 . . . . 
'X-RAY DIFFRACTION' . 1.8490 1.8744  6764 0.2725 100.00 0.3318 . . 337 . . . . 
'X-RAY DIFFRACTION' . 1.8744 1.9011  6816 0.2663 100.00 0.3106 . . 355 . . . . 
'X-RAY DIFFRACTION' . 1.9011 1.9295  6794 0.2549 100.00 0.3036 . . 358 . . . . 
'X-RAY DIFFRACTION' . 1.9295 1.9597  6876 0.2381 100.00 0.2596 . . 376 . . . . 
'X-RAY DIFFRACTION' . 1.9597 1.9918  6729 0.2372 100.00 0.2705 . . 386 . . . . 
'X-RAY DIFFRACTION' . 1.9918 2.0261  6839 0.2308 100.00 0.2796 . . 354 . . . . 
'X-RAY DIFFRACTION' . 2.0261 2.0630  6819 0.2258 100.00 0.2325 . . 342 . . . . 
'X-RAY DIFFRACTION' . 2.0630 2.1027  6886 0.2167 100.00 0.2623 . . 332 . . . . 
'X-RAY DIFFRACTION' . 2.1027 2.1456  6817 0.2161 100.00 0.2548 . . 324 . . . . 
'X-RAY DIFFRACTION' . 2.1456 2.1922  6834 0.1945 100.00 0.2405 . . 328 . . . . 
'X-RAY DIFFRACTION' . 2.1922 2.2432  6810 0.1983 100.00 0.2331 . . 341 . . . . 
'X-RAY DIFFRACTION' . 2.2432 2.2993  6812 0.1998 100.00 0.2601 . . 422 . . . . 
'X-RAY DIFFRACTION' . 2.2993 2.3615  6739 0.1940 100.00 0.2419 . . 355 . . . . 
'X-RAY DIFFRACTION' . 2.3615 2.4310  6853 0.1949 100.00 0.2271 . . 345 . . . . 
'X-RAY DIFFRACTION' . 2.4310 2.5094  6814 0.1981 100.00 0.2189 . . 337 . . . . 
'X-RAY DIFFRACTION' . 2.5094 2.5991  6846 0.2000 100.00 0.2506 . . 414 . . . . 
'X-RAY DIFFRACTION' . 2.5991 2.7032  6758 0.2028 100.00 0.2335 . . 378 . . . . 
'X-RAY DIFFRACTION' . 2.7032 2.8262  6718 0.1908 100.00 0.2262 . . 402 . . . . 
'X-RAY DIFFRACTION' . 2.8262 2.9751  6910 0.1851 100.00 0.1970 . . 329 . . . . 
'X-RAY DIFFRACTION' . 2.9751 3.1615  6810 0.1711 100.00 0.2240 . . 355 . . . . 
'X-RAY DIFFRACTION' . 3.1615 3.4055  6829 0.1584 100.00 0.1798 . . 304 . . . . 
'X-RAY DIFFRACTION' . 3.4055 3.7481  6832 0.1575 100.00 0.1670 . . 365 . . . . 
'X-RAY DIFFRACTION' . 3.7481 4.2900  6822 0.1482 100.00 0.1888 . . 354 . . . . 
'X-RAY DIFFRACTION' . 4.2900 5.4035  6776 0.1557 100.00 0.1767 . . 386 . . . . 
'X-RAY DIFFRACTION' . 5.4035 44.5570 6457 0.1776 95.00  0.1616 . . 366 . . . . 
# 
_struct.entry_id                     5YUY 
_struct.title                        'DNA polymerase IV - DNA ternary complex 9' 
_struct.pdbx_descriptor              'DNA polymerase IV/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5YUY 
_struct_keywords.text            'DNA POLYMERASE, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 7 ? 
P N N 7 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 12  ? ASN A 22  ? CYS F 11  ASN F 21  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 23  ? ARG A 26  ? PRO F 22  ARG F 25  5 ? 4  
HELX_P HELX_P3  AA3 ASN A 46  ? LYS A 51  ? ASN F 45  LYS F 50  1 ? 6  
HELX_P HELX_P4  AA4 PRO A 59  ? CYS A 67  ? PRO F 58  CYS F 66  1 ? 9  
HELX_P HELX_P5  AA5 ARG A 76  ? ARG A 93  ? ARG F 75  ARG F 92  1 ? 18 
HELX_P HELX_P6  AA6 VAL A 114 ? GLY A 118 ? VAL F 113 GLY F 117 5 ? 5  
HELX_P HELX_P7  AA7 SER A 119 ? GLN A 136 ? SER F 118 GLN F 135 1 ? 18 
HELX_P HELX_P8  AA8 VAL A 146 ? ASN A 157 ? VAL F 145 ASN F 156 1 ? 12 
HELX_P HELX_P9  AA9 THR A 166 ? ALA A 168 ? THR F 165 ALA F 167 5 ? 3  
HELX_P HELX_P10 AB1 GLU A 169 ? THR A 176 ? GLU F 168 THR F 175 1 ? 8  
HELX_P HELX_P11 AB2 PRO A 178 ? ILE A 182 ? PRO F 177 ILE F 181 5 ? 5  
HELX_P HELX_P12 AB3 GLY A 186 ? MET A 196 ? GLY F 185 MET F 195 1 ? 11 
HELX_P HELX_P13 AB4 THR A 200 ? LYS A 206 ? THR F 199 LYS F 205 1 ? 7  
HELX_P HELX_P14 AB5 ASP A 208 ? GLY A 217 ? ASP F 207 GLY F 216 1 ? 10 
HELX_P HELX_P15 AB6 GLY A 217 ? SER A 227 ? GLY F 216 SER F 226 1 ? 11 
HELX_P HELX_P16 AB7 HIS A 256 ? LYS A 279 ? HIS F 255 LYS F 278 1 ? 24 
HELX_P HELX_P17 AB8 ASN A 309 ? ARG A 325 ? ASN F 308 ARG F 324 1 ? 17 
HELX_P HELX_P18 AB9 CYS B 12  ? ASN B 22  ? CYS A 11  ASN A 21  1 ? 11 
HELX_P HELX_P19 AC1 PRO B 23  ? ARG B 26  ? PRO A 22  ARG A 25  5 ? 4  
HELX_P HELX_P20 AC2 ASN B 46  ? LYS B 51  ? ASN A 45  LYS A 50  1 ? 6  
HELX_P HELX_P21 AC3 PRO B 59  ? CYS B 67  ? PRO A 58  CYS A 66  1 ? 9  
HELX_P HELX_P22 AC4 ARG B 76  ? SER B 92  ? ARG A 75  SER A 91  1 ? 17 
HELX_P HELX_P23 AC5 VAL B 114 ? GLY B 118 ? VAL A 113 GLY A 117 5 ? 5  
HELX_P HELX_P24 AC6 SER B 119 ? GLN B 136 ? SER A 118 GLN A 135 1 ? 18 
HELX_P HELX_P25 AC7 VAL B 146 ? ASP B 155 ? VAL A 145 ASP A 154 1 ? 10 
HELX_P HELX_P26 AC8 THR B 166 ? ALA B 168 ? THR A 165 ALA A 167 5 ? 3  
HELX_P HELX_P27 AC9 GLU B 169 ? THR B 176 ? GLU A 168 THR A 175 1 ? 8  
HELX_P HELX_P28 AD1 PRO B 178 ? ILE B 182 ? PRO A 177 ILE A 181 5 ? 5  
HELX_P HELX_P29 AD2 GLY B 186 ? MET B 196 ? GLY A 185 MET A 195 1 ? 11 
HELX_P HELX_P30 AD3 THR B 200 ? LYS B 206 ? THR A 199 LYS A 205 1 ? 7  
HELX_P HELX_P31 AD4 ASP B 208 ? GLY B 217 ? ASP A 207 GLY A 216 1 ? 10 
HELX_P HELX_P32 AD5 GLY B 217 ? SER B 227 ? GLY A 216 SER A 226 1 ? 11 
HELX_P HELX_P33 AD6 HIS B 256 ? LYS B 279 ? HIS A 255 LYS A 278 1 ? 24 
HELX_P HELX_P34 AD7 ASN B 309 ? ARG B 325 ? ASN A 308 ARG A 324 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?   ? A ASP 9   OD1   A ? ? 1_555 G MG  .  MG  ? ? F ASP 8   F MG  901  1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc2  metalc ?   ? A ASP 9   OD1   B ? ? 1_555 H MG  .  MG  ? ? F ASP 8   F MG  902  1_555 ? ? ? ? ? ? ?            2.615 ? 
metalc3  metalc ?   ? A ASP 9   OD1   B ? ? 1_555 G MG  .  MG  ? ? F ASP 8   F MG  901  1_555 ? ? ? ? ? ? ?            2.445 ? 
metalc4  metalc ?   ? A ASP 9   OD2   A ? ? 1_555 H MG  .  MG  ? ? F ASP 8   F MG  902  1_555 ? ? ? ? ? ? ?            2.618 ? 
metalc5  metalc ?   ? A MET 10  O     ? ? ? 1_555 G MG  .  MG  ? ? F MET 9   F MG  901  1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc6  metalc ?   ? A ASP 104 OD1   ? ? ? 1_555 H MG  .  MG  ? ? F ASP 103 F MG  902  1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc7  metalc ?   ? A ASP 104 OD2   ? ? ? 1_555 G MG  .  MG  ? ? F ASP 103 F MG  901  1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc8  metalc ?   ? A GLU 105 OE2   ? ? ? 1_555 H MG  .  MG  ? ? F GLU 104 F MG  902  1_555 ? ? ? ? ? ? ?            2.000 ? 
metalc9  metalc ?   ? B ASP 9   OD1   ? ? ? 1_555 J MG  .  MG  ? ? A ASP 8   A MG  901  1_555 ? ? ? ? ? ? ?            2.658 ? 
metalc10 metalc ?   ? B ASP 9   OD1   ? ? ? 1_555 K MG  .  MG  ? ? A ASP 8   A MG  902  1_555 ? ? ? ? ? ? ?            2.218 ? 
metalc11 metalc ?   ? B ASP 9   OD2   ? ? ? 1_555 J MG  .  MG  ? ? A ASP 8   A MG  901  1_555 ? ? ? ? ? ? ?            2.474 ? 
metalc12 metalc ?   ? B MET 10  O     ? ? ? 1_555 J MG  .  MG  ? ? A MET 9   A MG  901  1_555 ? ? ? ? ? ? ?            2.292 ? 
metalc13 metalc ?   ? B ASP 104 OD1   ? ? ? 1_555 K MG  .  MG  ? ? A ASP 103 A MG  902  1_555 ? ? ? ? ? ? ?            2.414 ? 
metalc14 metalc ?   ? B ASP 104 OD2   ? ? ? 1_555 J MG  .  MG  ? ? A ASP 103 A MG  901  1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc15 metalc ?   ? B GLU 105 OE2   ? ? ? 1_555 K MG  .  MG  ? ? A GLU 104 A MG  902  1_555 ? ? ? ? ? ? ?            2.147 ? 
metalc16 metalc ?   ? D DC  18  "O3'" A ? ? 1_555 H MG  .  MG  ? ? H DC  873 F MG  902  1_555 ? ? ? ? ? ? ?            2.512 ? 
covale1  covale one ? D DC  18  "O3'" A ? ? 1_555 M TTP .  PA  A ? H DC  873 H TTP 901  1_555 ? ? ? ? ? ? ?            1.702 ? 
metalc17 metalc ?   ? D DC  18  "O3'" B ? ? 1_555 H MG  .  MG  ? ? H DC  873 F MG  902  1_555 ? ? ? ? ? ? ?            2.518 ? 
metalc18 metalc ?   ? D DT  19  OP1   B ? ? 1_555 H MG  .  MG  ? ? H DT  874 F MG  902  1_555 ? ? ? ? ? ? ?            2.033 ? 
metalc19 metalc ?   ? D DT  19  OP1   B ? ? 1_555 G MG  .  MG  ? ? H DT  874 F MG  901  1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc20 metalc ?   ? F DC  18  "O3'" A ? ? 1_555 K MG  .  MG  ? ? C DC  873 A MG  902  1_555 ? ? ? ? ? ? ?            2.557 ? 
covale2  covale one ? F DC  18  "O3'" A ? ? 1_555 N TTP .  PA  A ? C DC  873 C TTP 901  1_555 ? ? ? ? ? ? ?            1.729 ? 
metalc21 metalc ?   ? F DC  18  "O3'" B ? ? 1_555 K MG  .  MG  ? ? C DC  873 A MG  902  1_555 ? ? ? ? ? ? ?            2.586 ? 
metalc22 metalc ?   ? F DT  19  OP1   B ? ? 1_555 J MG  .  MG  ? ? C DT  874 A MG  901  1_555 ? ? ? ? ? ? ?            2.264 ? 
metalc23 metalc ?   ? F DT  19  OP1   B ? ? 1_555 K MG  .  MG  ? ? C DT  874 A MG  902  1_555 ? ? ? ? ? ? ?            2.240 ? 
metalc24 metalc ?   ? G MG  .   MG    ? ? ? 1_555 I DPO .  O3  B ? F MG  901 F DPO 903  1_555 ? ? ? ? ? ? ?            2.505 ? 
metalc25 metalc ?   ? G MG  .   MG    ? ? ? 1_555 I DPO .  O7  B ? F MG  901 F DPO 903  1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc26 metalc ?   ? G MG  .   MG    ? ? ? 1_555 M TTP .  O2A A ? F MG  901 H TTP 901  1_555 ? ? ? ? ? ? ?            2.072 ? 
metalc27 metalc ?   ? G MG  .   MG    ? ? ? 1_555 M TTP .  O2B A ? F MG  901 H TTP 901  1_555 ? ? ? ? ? ? ?            2.200 ? 
metalc28 metalc ?   ? G MG  .   MG    ? ? ? 1_555 M TTP .  O2G A ? F MG  901 H TTP 901  1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc29 metalc ?   ? H MG  .   MG    ? ? ? 1_555 O HOH .  O   ? ? F MG  902 F HOH 1002 1_555 ? ? ? ? ? ? ?            2.448 ? 
metalc30 metalc ?   ? H MG  .   MG    ? ? ? 1_555 M TTP .  O2A A ? F MG  902 H TTP 901  1_555 ? ? ? ? ? ? ?            2.118 ? 
metalc31 metalc ?   ? J MG  .   MG    ? ? ? 1_555 L DPO .  O3  B ? A MG  901 A DPO 903  1_555 ? ? ? ? ? ? ?            2.584 ? 
metalc32 metalc ?   ? J MG  .   MG    ? ? ? 1_555 N TTP .  O3G A ? A MG  901 C TTP 901  1_555 ? ? ? ? ? ? ?            2.444 ? 
metalc33 metalc ?   ? J MG  .   MG    ? ? ? 1_555 L DPO .  O5  B ? A MG  901 A DPO 903  1_555 ? ? ? ? ? ? ?            2.569 ? 
metalc34 metalc ?   ? J MG  .   MG    ? ? ? 1_555 N TTP .  O1A A ? A MG  901 C TTP 901  1_555 ? ? ? ? ? ? ?            2.107 ? 
metalc35 metalc ?   ? J MG  .   MG    ? ? ? 1_555 N TTP .  O1B A ? A MG  901 C TTP 901  1_555 ? ? ? ? ? ? ?            2.239 ? 
metalc36 metalc ?   ? K MG  .   MG    ? ? ? 1_555 P HOH .  O   ? ? A MG  902 A HOH 1075 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc37 metalc ?   ? K MG  .   MG    ? ? ? 1_555 N TTP .  O1A A ? A MG  902 C TTP 901  1_555 ? ? ? ? ? ? ?            2.270 ? 
hydrog1  hydrog ?   ? E DA  4   N1    ? ? ? 1_555 F DT  19 N3  B ? B DA  840 C DT  874  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?   ? E DA  4   N6    ? ? ? 1_555 F DT  19 O4  B ? B DA  840 C DT  874  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?   ? E DG  5   N1    ? ? ? 1_555 F DC  18 N3  A ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?   ? E DG  5   N1    ? ? ? 1_555 F DC  18 N3  B ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?   ? E DG  5   N2    ? ? ? 1_555 F DC  18 O2  A ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?   ? E DG  5   N2    ? ? ? 1_555 F DC  18 O2  B ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?   ? E DG  5   O6    ? ? ? 1_555 F DC  18 N4  A ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?   ? E DG  5   O6    ? ? ? 1_555 F DC  18 N4  B ? B DG  841 C DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?   ? E DG  6   N1    ? ? ? 1_555 F DC  17 N3  ? ? B DG  842 C DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?   ? E DG  6   N2    ? ? ? 1_555 F DC  17 O2  ? ? B DG  842 C DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?   ? E DG  6   O6    ? ? ? 1_555 F DC  17 N4  ? ? B DG  842 C DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?   ? E DG  7   N1    ? ? ? 1_555 F DC  16 N3  ? ? B DG  843 C DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?   ? E DG  7   N2    ? ? ? 1_555 F DC  16 O2  ? ? B DG  843 C DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?   ? E DG  7   O6    ? ? ? 1_555 F DC  16 N4  ? ? B DG  843 C DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?   ? E DT  8   N3    ? ? ? 1_555 F DA  15 N1  ? ? B DT  844 C DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?   ? E DT  8   O4    ? ? ? 1_555 F DA  15 N6  ? ? B DT  844 C DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?   ? E DC  9   N3    ? ? ? 1_555 F DG  14 N1  ? ? B DC  845 C DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?   ? E DC  9   N4    ? ? ? 1_555 F DG  14 O6  ? ? B DC  845 C DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?   ? E DC  9   O2    ? ? ? 1_555 F DG  14 N2  ? ? B DC  845 C DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?   ? E DC  10  N3    ? ? ? 1_555 F DG  13 N1  ? ? B DC  846 C DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?   ? E DC  10  N4    ? ? ? 1_555 F DG  13 O6  ? ? B DC  846 C DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?   ? E DC  10  O2    ? ? ? 1_555 F DG  13 N2  ? ? B DC  846 C DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?   ? E DT  11  N3    ? ? ? 1_555 F DA  12 N1  ? ? B DT  847 C DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?   ? E DT  11  O4    ? ? ? 1_555 F DA  12 N6  ? ? B DT  847 C DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?   ? E DA  12  N1    ? ? ? 1_555 F DT  11 N3  ? ? B DA  848 C DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?   ? E DA  12  N6    ? ? ? 1_555 F DT  11 O4  ? ? B DA  848 C DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?   ? E DG  13  N1    ? ? ? 1_555 F DC  10 N3  ? ? B DG  849 C DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?   ? E DG  13  N2    ? ? ? 1_555 F DC  10 O2  ? ? B DG  849 C DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?   ? E DG  13  O6    ? ? ? 1_555 F DC  10 N4  ? ? B DG  849 C DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?   ? E DG  14  N1    ? ? ? 1_555 F DC  9  N3  ? ? B DG  850 C DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?   ? E DG  14  N2    ? ? ? 1_555 F DC  9  O2  ? ? B DG  850 C DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?   ? E DG  14  O6    ? ? ? 1_555 F DC  9  N4  ? ? B DG  850 C DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?   ? E DA  15  N1    ? ? ? 1_555 F DT  8  N3  ? ? B DA  851 C DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?   ? E DA  15  N6    ? ? ? 1_555 F DT  8  O4  ? ? B DA  851 C DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?   ? E DC  16  N3    ? ? ? 1_555 F DG  7  N1  ? ? B DC  852 C DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?   ? E DC  16  N4    ? ? ? 1_555 F DG  7  O6  ? ? B DC  852 C DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?   ? E DC  16  O2    ? ? ? 1_555 F DG  7  N2  ? ? B DC  852 C DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?   ? E DC  17  N3    ? ? ? 1_555 F DG  6  N1  ? ? B DC  853 C DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?   ? E DC  17  N4    ? ? ? 1_555 F DG  6  O6  ? ? B DC  853 C DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?   ? E DC  17  O2    ? ? ? 1_555 F DG  6  N2  ? ? B DC  853 C DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?   ? E DC  18  N3    ? ? ? 1_555 F DG  5  N1  ? ? B DC  854 C DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?   ? E DC  18  N4    ? ? ? 1_555 F DG  5  O6  ? ? B DC  854 C DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?   ? E DC  18  O2    ? ? ? 1_555 F DG  5  N2  ? ? B DC  854 C DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?   ? C DA  4   N1    ? ? ? 1_555 D DT  19 N3  B ? G DA  840 H DT  874  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?   ? C DA  4   N6    ? ? ? 1_555 D DT  19 O4  B ? G DA  840 H DT  874  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?   ? C DG  5   N1    ? ? ? 1_555 D DC  18 N3  A ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?   ? C DG  5   N1    ? ? ? 1_555 D DC  18 N3  B ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?   ? C DG  5   N2    ? ? ? 1_555 D DC  18 O2  A ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?   ? C DG  5   N2    ? ? ? 1_555 D DC  18 O2  B ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?   ? C DG  5   O6    ? ? ? 1_555 D DC  18 N4  A ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?   ? C DG  5   O6    ? ? ? 1_555 D DC  18 N4  B ? G DG  841 H DC  873  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?   ? C DG  6   N1    ? ? ? 1_555 D DC  17 N3  ? ? G DG  842 H DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?   ? C DG  6   N2    ? ? ? 1_555 D DC  17 O2  ? ? G DG  842 H DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?   ? C DG  6   O6    ? ? ? 1_555 D DC  17 N4  ? ? G DG  842 H DC  872  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?   ? C DG  7   N1    ? ? ? 1_555 D DC  16 N3  ? ? G DG  843 H DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ?   ? C DG  7   N2    ? ? ? 1_555 D DC  16 O2  ? ? G DG  843 H DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ?   ? C DG  7   O6    ? ? ? 1_555 D DC  16 N4  ? ? G DG  843 H DC  871  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ?   ? C DT  8   N3    ? ? ? 1_555 D DA  15 N1  ? ? G DT  844 H DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ?   ? C DT  8   O4    ? ? ? 1_555 D DA  15 N6  ? ? G DT  844 H DA  870  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ?   ? C DC  9   N3    ? ? ? 1_555 D DG  14 N1  ? ? G DC  845 H DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ?   ? C DC  9   N4    ? ? ? 1_555 D DG  14 O6  ? ? G DC  845 H DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ?   ? C DC  9   O2    ? ? ? 1_555 D DG  14 N2  ? ? G DC  845 H DG  869  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ?   ? C DC  10  N3    ? ? ? 1_555 D DG  13 N1  ? ? G DC  846 H DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ?   ? C DC  10  N4    ? ? ? 1_555 D DG  13 O6  ? ? G DC  846 H DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ?   ? C DC  10  O2    ? ? ? 1_555 D DG  13 N2  ? ? G DC  846 H DG  868  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ?   ? C DT  11  N3    ? ? ? 1_555 D DA  12 N1  ? ? G DT  847 H DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ?   ? C DT  11  O4    ? ? ? 1_555 D DA  12 N6  ? ? G DT  847 H DA  867  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ?   ? C DA  12  N1    ? ? ? 1_555 D DT  11 N3  ? ? G DA  848 H DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ?   ? C DA  12  N6    ? ? ? 1_555 D DT  11 O4  ? ? G DA  848 H DT  866  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ?   ? C DG  13  N1    ? ? ? 1_555 D DC  10 N3  ? ? G DG  849 H DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ?   ? C DG  13  N2    ? ? ? 1_555 D DC  10 O2  ? ? G DG  849 H DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ?   ? C DG  13  O6    ? ? ? 1_555 D DC  10 N4  ? ? G DG  849 H DC  865  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ?   ? C DG  14  N1    ? ? ? 1_555 D DC  9  N3  ? ? G DG  850 H DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ?   ? C DG  14  N2    ? ? ? 1_555 D DC  9  O2  ? ? G DG  850 H DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ?   ? C DG  14  O6    ? ? ? 1_555 D DC  9  N4  ? ? G DG  850 H DC  864  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ?   ? C DA  15  N1    ? ? ? 1_555 D DT  8  N3  ? ? G DA  851 H DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77 hydrog ?   ? C DA  15  N6    ? ? ? 1_555 D DT  8  O4  ? ? G DA  851 H DT  863  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ?   ? C DC  16  N3    ? ? ? 1_555 D DG  7  N1  ? ? G DC  852 H DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79 hydrog ?   ? C DC  16  N4    ? ? ? 1_555 D DG  7  O6  ? ? G DC  852 H DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80 hydrog ?   ? C DC  16  O2    ? ? ? 1_555 D DG  7  N2  ? ? G DC  852 H DG  862  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81 hydrog ?   ? C DC  17  N3    ? ? ? 1_555 D DG  6  N1  ? ? G DC  853 H DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82 hydrog ?   ? C DC  17  N4    ? ? ? 1_555 D DG  6  O6  ? ? G DC  853 H DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83 hydrog ?   ? C DC  17  O2    ? ? ? 1_555 D DG  6  N2  ? ? G DC  853 H DG  861  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84 hydrog ?   ? C DC  18  N3    ? ? ? 1_555 D DG  5  N1  ? ? G DC  854 H DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85 hydrog ?   ? C DC  18  N4    ? ? ? 1_555 D DG  5  O6  ? ? G DC  854 H DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86 hydrog ?   ? C DC  18  O2    ? ? ? 1_555 D DG  5  N2  ? ? G DC  854 H DG  860  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 158 A . ? LYS 157 F PRO 159 A ? PRO 158 F 1 -3.61 
2 LYS 158 B . ? LYS 157 A PRO 159 B ? PRO 158 A 1 -0.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 98  ? SER A 102 ? ILE F 97  SER F 101 
AA1 2 GLU A 105 ? ASP A 109 ? GLU F 104 ASP F 108 
AA1 3 ILE A 5   ? MET A 10  ? ILE F 4   MET F 9   
AA1 4 ALA A 139 ? ALA A 144 ? ALA F 138 ALA F 143 
AA1 5 GLN A 162 ? VAL A 164 ? GLN F 161 VAL F 163 
AA2 1 ILE A 42  ? ALA A 45  ? ILE F 41  ALA F 44  
AA2 2 ILE A 30  ? GLY A 33  ? ILE F 29  GLY F 32  
AA2 3 THR A 71  ? LEU A 73  ? THR F 70  LEU F 72  
AA3 1 SER A 243 ? ILE A 254 ? SER F 242 ILE F 253 
AA3 2 VAL A 330 ? THR A 338 ? VAL F 329 THR F 337 
AA3 3 ARG A 286 ? PHE A 293 ? ARG F 285 PHE F 292 
AA3 4 GLN A 298 ? VAL A 304 ? GLN F 297 VAL F 303 
AA4 1 ILE B 98  ? SER B 102 ? ILE A 97  SER A 101 
AA4 2 GLU B 105 ? ASP B 109 ? GLU A 104 ASP A 108 
AA4 3 ILE B 5   ? MET B 10  ? ILE A 4   MET A 9   
AA4 4 ALA B 139 ? ALA B 144 ? ALA A 138 ALA A 143 
AA4 5 GLN B 162 ? VAL B 164 ? GLN A 161 VAL A 163 
AA5 1 ILE B 42  ? ALA B 45  ? ILE A 41  ALA A 44  
AA5 2 ILE B 30  ? GLY B 33  ? ILE A 29  GLY A 32  
AA5 3 THR B 71  ? LEU B 73  ? THR A 70  LEU A 72  
AA6 1 SER B 243 ? ILE B 254 ? SER A 242 ILE A 253 
AA6 2 VAL B 330 ? THR B 338 ? VAL A 329 THR A 337 
AA6 3 ARG B 286 ? PHE B 293 ? ARG A 285 PHE A 292 
AA6 4 GLN B 298 ? VAL B 304 ? GLN A 297 VAL A 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 99  ? N GLU F 98  O TYR A 107 ? O TYR F 106 
AA1 2 3 O LEU A 108 ? O LEU F 107 N ILE A 6   ? N ILE F 5   
AA1 3 4 N ASP A 9   ? N ASP F 8   O SER A 140 ? O SER F 139 
AA1 4 5 N VAL A 143 ? N VAL F 142 O PHE A 163 ? O PHE F 162 
AA2 1 2 O SER A 43  ? O SER F 42  N ILE A 32  ? N ILE F 31  
AA2 2 3 N ALA A 31  ? N ALA F 30  O LEU A 73  ? O LEU F 72  
AA3 1 2 N VAL A 246 ? N VAL F 245 O LEU A 335 ? O LEU F 334 
AA3 2 3 O HIS A 336 ? O HIS F 335 N GLY A 288 ? N GLY F 287 
AA3 3 4 N LEU A 291 ? N LEU F 290 O THR A 299 ? O THR F 298 
AA4 1 2 N GLU B 99  ? N GLU A 98  O TYR B 107 ? O TYR A 106 
AA4 2 3 O LEU B 108 ? O LEU A 107 N ILE B 6   ? N ILE A 5   
AA4 3 4 N ASP B 9   ? N ASP A 8   O SER B 140 ? O SER A 139 
AA4 4 5 N VAL B 143 ? N VAL A 142 O PHE B 163 ? O PHE A 162 
AA5 1 2 O SER B 43  ? O SER A 42  N ILE B 32  ? N ILE A 31  
AA5 2 3 N ALA B 31  ? N ALA A 30  O LEU B 73  ? O LEU A 72  
AA6 1 2 N VAL B 246 ? N VAL A 245 O LEU B 335 ? O LEU A 334 
AA6 2 3 O THR B 338 ? O THR A 337 N ARG B 286 ? N ARG A 285 
AA6 3 4 N LEU B 291 ? N LEU A 290 O THR B 299 ? O THR A 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software F MG  901 ? 7  'binding site for residue MG F 901'                     
AC2 Software F MG  902 ? 8  'binding site for residue MG F 902'                     
AC3 Software F DPO 903 ? 15 'binding site for residue DPO F 903'                    
AC4 Software A MG  901 ? 7  'binding site for residue MG A 901'                     
AC5 Software A MG  902 ? 8  'binding site for residue MG A 902'                     
AC6 Software A DPO 903 ? 15 'binding site for residue DPO A 903'                    
AC7 Software C TTP 901 ? 31 'binding site for Di-nucleotide TTP C 901 and DC C 873' 
AC8 Software H TTP 901 ? 31 'binding site for Di-nucleotide TTP H 901 and DC H 873' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7  ASP A 9   ? ASP F 8    . ? 1_555 ? 
2   AC1 7  MET A 10  ? MET F 9    . ? 1_555 ? 
3   AC1 7  ASP A 104 ? ASP F 103  . ? 1_555 ? 
4   AC1 7  MG  H .   ? MG  F 902  . ? 1_555 ? 
5   AC1 7  DPO I .   ? DPO F 903  . ? 1_555 ? 
6   AC1 7  DT  D 19  ? DT  H 874  . ? 1_555 ? 
7   AC1 7  TTP M .   ? TTP H 901  . ? 1_555 ? 
8   AC2 8  ASP A 9   ? ASP F 8    . ? 1_555 ? 
9   AC2 8  ASP A 104 ? ASP F 103  . ? 1_555 ? 
10  AC2 8  GLU A 105 ? GLU F 104  . ? 1_555 ? 
11  AC2 8  MG  G .   ? MG  F 901  . ? 1_555 ? 
12  AC2 8  HOH O .   ? HOH F 1002 . ? 1_555 ? 
13  AC2 8  DC  D 18  ? DC  H 873  . ? 1_555 ? 
14  AC2 8  DT  D 19  ? DT  H 874  . ? 1_555 ? 
15  AC2 8  TTP M .   ? TTP H 901  . ? 1_555 ? 
16  AC3 15 ASP A 9   ? ASP F 8    . ? 1_555 ? 
17  AC3 15 MET A 10  ? MET F 9    . ? 1_555 ? 
18  AC3 15 ASP A 11  ? ASP F 10   . ? 1_555 ? 
19  AC3 15 CYS A 12  ? CYS F 11   . ? 1_555 ? 
20  AC3 15 PHE A 13  ? PHE F 12   . ? 1_555 ? 
21  AC3 15 THR A 44  ? THR F 43   . ? 1_555 ? 
22  AC3 15 ARG A 50  ? ARG F 49   . ? 1_555 ? 
23  AC3 15 ASP A 104 ? ASP F 103  . ? 1_555 ? 
24  AC3 15 LYS A 158 ? LYS F 157  . ? 1_555 ? 
25  AC3 15 MG  G .   ? MG  F 901  . ? 1_555 ? 
26  AC3 15 HOH O .   ? HOH F 1010 . ? 1_555 ? 
27  AC3 15 HOH O .   ? HOH F 1042 . ? 1_555 ? 
28  AC3 15 HOH O .   ? HOH F 1046 . ? 1_555 ? 
29  AC3 15 DT  D 19  ? DT  H 874  . ? 1_555 ? 
30  AC3 15 TTP M .   ? TTP H 901  . ? 1_555 ? 
31  AC4 7  ASP B 9   ? ASP A 8    . ? 1_555 ? 
32  AC4 7  MET B 10  ? MET A 9    . ? 1_555 ? 
33  AC4 7  ASP B 104 ? ASP A 103  . ? 1_555 ? 
34  AC4 7  MG  K .   ? MG  A 902  . ? 1_555 ? 
35  AC4 7  DPO L .   ? DPO A 903  . ? 1_555 ? 
36  AC4 7  DT  F 19  ? DT  C 874  . ? 1_555 ? 
37  AC4 7  TTP N .   ? TTP C 901  . ? 1_555 ? 
38  AC5 8  ASP B 9   ? ASP A 8    . ? 1_555 ? 
39  AC5 8  ASP B 104 ? ASP A 103  . ? 1_555 ? 
40  AC5 8  GLU B 105 ? GLU A 104  . ? 1_555 ? 
41  AC5 8  MG  J .   ? MG  A 901  . ? 1_555 ? 
42  AC5 8  HOH P .   ? HOH A 1075 . ? 1_555 ? 
43  AC5 8  DC  F 18  ? DC  C 873  . ? 1_555 ? 
44  AC5 8  DT  F 19  ? DT  C 874  . ? 1_555 ? 
45  AC5 8  TTP N .   ? TTP C 901  . ? 1_555 ? 
46  AC6 15 ASP B 9   ? ASP A 8    . ? 1_555 ? 
47  AC6 15 MET B 10  ? MET A 9    . ? 1_555 ? 
48  AC6 15 ASP B 11  ? ASP A 10   . ? 1_555 ? 
49  AC6 15 CYS B 12  ? CYS A 11   . ? 1_555 ? 
50  AC6 15 PHE B 13  ? PHE A 12   . ? 1_555 ? 
51  AC6 15 THR B 44  ? THR A 43   . ? 1_555 ? 
52  AC6 15 ARG B 50  ? ARG A 49   . ? 1_555 ? 
53  AC6 15 ASP B 104 ? ASP A 103  . ? 1_555 ? 
54  AC6 15 LYS B 158 ? LYS A 157  . ? 1_555 ? 
55  AC6 15 MG  J .   ? MG  A 901  . ? 1_555 ? 
56  AC6 15 HOH P .   ? HOH A 1022 . ? 1_555 ? 
57  AC6 15 HOH P .   ? HOH A 1103 . ? 1_555 ? 
58  AC6 15 DT  F 19  ? DT  C 874  . ? 1_555 ? 
59  AC6 15 TTP N .   ? TTP C 901  . ? 1_555 ? 
60  AC6 15 HOH T .   ? HOH C 1034 . ? 1_555 ? 
61  AC7 31 ASP B 9   ? ASP A 8    . ? 1_555 ? 
62  AC7 31 MET B 10  ? MET A 9    . ? 1_555 ? 
63  AC7 31 ASP B 11  ? ASP A 10   . ? 1_555 ? 
64  AC7 31 CYS B 12  ? CYS A 11   . ? 1_555 ? 
65  AC7 31 PHE B 13  ? PHE A 12   . ? 1_555 ? 
66  AC7 31 PHE B 14  ? PHE A 13   . ? 1_555 ? 
67  AC7 31 SER B 43  ? SER A 42   . ? 1_555 ? 
68  AC7 31 THR B 44  ? THR A 43   . ? 1_555 ? 
69  AC7 31 ARG B 50  ? ARG A 49   . ? 1_555 ? 
70  AC7 31 SER B 56  ? SER A 55   . ? 1_555 ? 
71  AC7 31 ASP B 104 ? ASP A 103  . ? 1_555 ? 
72  AC7 31 GLU B 105 ? GLU A 104  . ? 1_555 ? 
73  AC7 31 LYS B 151 ? LYS A 150  . ? 1_555 ? 
74  AC7 31 LYS B 158 ? LYS A 157  . ? 1_555 ? 
75  AC7 31 MG  J .   ? MG  A 901  . ? 1_555 ? 
76  AC7 31 MG  K .   ? MG  A 902  . ? 1_555 ? 
77  AC7 31 DPO L .   ? DPO A 903  . ? 1_555 ? 
78  AC7 31 HOH P .   ? HOH A 1022 . ? 1_555 ? 
79  AC7 31 DA  E 4   ? DA  B 840  . ? 1_555 ? 
80  AC7 31 DG  E 5   ? DG  B 841  . ? 1_555 ? 
81  AC7 31 DG  E 6   ? DG  B 842  . ? 1_555 ? 
82  AC7 31 DC  F 17  ? DC  C 872  . ? 1_555 ? 
83  AC7 31 DT  F 19  ? DT  C 874  . ? 1_555 ? 
84  AC7 31 HOH T .   ? HOH C 1017 . ? 1_555 ? 
85  AC7 31 HOH T .   ? HOH C 1020 . ? 1_555 ? 
86  AC7 31 HOH T .   ? HOH C 1025 . ? 1_555 ? 
87  AC7 31 HOH T .   ? HOH C 1034 . ? 1_555 ? 
88  AC7 31 HOH T .   ? HOH C 1041 . ? 1_555 ? 
89  AC7 31 HOH T .   ? HOH C 1044 . ? 1_555 ? 
90  AC7 31 HOH T .   ? HOH C 1045 . ? 1_555 ? 
91  AC7 31 HOH T .   ? HOH C 1052 . ? 1_555 ? 
92  AC8 31 ASP A 9   ? ASP F 8    . ? 1_555 ? 
93  AC8 31 MET A 10  ? MET F 9    . ? 1_555 ? 
94  AC8 31 ASP A 11  ? ASP F 10   . ? 1_555 ? 
95  AC8 31 CYS A 12  ? CYS F 11   . ? 1_555 ? 
96  AC8 31 PHE A 13  ? PHE F 12   . ? 1_555 ? 
97  AC8 31 PHE A 14  ? PHE F 13   . ? 1_555 ? 
98  AC8 31 SER A 43  ? SER F 42   . ? 1_555 ? 
99  AC8 31 THR A 44  ? THR F 43   . ? 1_555 ? 
100 AC8 31 ARG A 50  ? ARG F 49   . ? 1_555 ? 
101 AC8 31 SER A 102 ? SER F 101  . ? 1_555 ? 
102 AC8 31 ASP A 104 ? ASP F 103  . ? 1_555 ? 
103 AC8 31 GLU A 105 ? GLU F 104  . ? 1_555 ? 
104 AC8 31 LYS A 151 ? LYS F 150  . ? 1_555 ? 
105 AC8 31 LYS A 158 ? LYS F 157  . ? 1_555 ? 
106 AC8 31 MG  G .   ? MG  F 901  . ? 1_555 ? 
107 AC8 31 MG  H .   ? MG  F 902  . ? 1_555 ? 
108 AC8 31 DPO I .   ? DPO F 903  . ? 1_555 ? 
109 AC8 31 HOH O .   ? HOH F 1010 . ? 1_555 ? 
110 AC8 31 HOH O .   ? HOH F 1023 . ? 1_555 ? 
111 AC8 31 HOH O .   ? HOH F 1046 . ? 1_555 ? 
112 AC8 31 DA  C 4   ? DA  G 840  . ? 1_555 ? 
113 AC8 31 DG  C 5   ? DG  G 841  . ? 1_555 ? 
114 AC8 31 DG  C 6   ? DG  G 842  . ? 1_555 ? 
115 AC8 31 DC  D 17  ? DC  H 872  . ? 1_555 ? 
116 AC8 31 DT  D 19  ? DT  H 874  . ? 1_555 ? 
117 AC8 31 HOH R .   ? HOH H 1004 . ? 1_555 ? 
118 AC8 31 HOH R .   ? HOH H 1010 . ? 1_555 ? 
119 AC8 31 HOH R .   ? HOH H 1012 . ? 1_555 ? 
120 AC8 31 HOH R .   ? HOH H 1018 . ? 1_555 ? 
121 AC8 31 HOH R .   ? HOH H 1024 . ? 1_555 ? 
122 AC8 31 HOH R .   ? HOH H 1028 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5YUY 
_atom_sites.fract_transf_matrix[1][1]   0.011566 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001018 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017528 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009112 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 58.711  -0.828  166.217 1.00 67.29  ?  0    GLY F N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 59.639  -0.875  167.334 1.00 70.73  ?  0    GLY F CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 60.684  0.231   167.340 1.00 55.36  ?  0    GLY F C     1 
ATOM   4    O  O     . GLY A 1 1   ? 61.836  0.012   166.968 1.00 63.66  ?  0    GLY F O     1 
ATOM   5    N  N     . SER A 1 2   ? 60.285  1.428   167.762 1.00 58.49  ?  1    SER F N     1 
ATOM   6    C  CA    . SER A 1 2   ? 61.206  2.554   167.853 1.00 61.95  ?  1    SER F CA    1 
ATOM   7    C  C     . SER A 1 2   ? 61.888  2.586   169.214 1.00 55.33  ?  1    SER F C     1 
ATOM   8    O  O     . SER A 1 2   ? 61.244  2.400   170.252 1.00 62.16  ?  1    SER F O     1 
ATOM   9    C  CB    . SER A 1 2   ? 60.473  3.876   167.615 1.00 66.08  ?  1    SER F CB    1 
ATOM   10   O  OG    . SER A 1 2   ? 60.374  4.169   166.234 1.00 67.40  ?  1    SER F OG    1 
ATOM   11   N  N     . ARG A 1 3   ? 63.196  2.837   169.205 1.00 47.08  ?  2    ARG F N     1 
ATOM   12   C  CA    . ARG A 1 3   ? 63.916  3.025   170.450 1.00 31.86  ?  2    ARG F CA    1 
ATOM   13   C  C     . ARG A 1 3   ? 63.759  4.462   170.943 1.00 31.38  ?  2    ARG F C     1 
ATOM   14   O  O     . ARG A 1 3   ? 63.351  5.366   170.205 1.00 33.31  ?  2    ARG F O     1 
ATOM   15   C  CB    . ARG A 1 3   ? 65.402  2.694   170.280 1.00 27.91  ?  2    ARG F CB    1 
ATOM   16   C  CG    . ARG A 1 3   ? 65.692  1.181   170.160 1.00 34.75  ?  2    ARG F CG    1 
ATOM   17   C  CD    . ARG A 1 3   ? 67.171  0.968   169.885 1.00 43.45  ?  2    ARG F CD    1 
ATOM   18   N  NE    . ARG A 1 3   ? 67.510  1.494   168.564 1.00 39.95  ?  2    ARG F NE    1 
ATOM   19   C  CZ    . ARG A 1 3   ? 68.699  1.953   168.193 1.00 34.43  ?  2    ARG F CZ    1 
ATOM   20   N  NH1   . ARG A 1 3   ? 68.856  2.400   166.948 1.00 31.89  ?  2    ARG F NH1   1 
ATOM   21   N  NH2   . ARG A 1 3   ? 69.718  1.999   169.052 1.00 30.75  ?  2    ARG F NH2   1 
ATOM   22   N  N     . LYS A 1 4   ? 64.093  4.664   172.215 1.00 34.37  ?  3    LYS F N     1 
ATOM   23   C  CA    . LYS A 1 4   ? 64.176  5.988   172.822 1.00 32.71  ?  3    LYS F CA    1 
ATOM   24   C  C     . LYS A 1 4   ? 65.598  6.173   173.344 1.00 25.94  ?  3    LYS F C     1 
ATOM   25   O  O     . LYS A 1 4   ? 65.974  5.570   174.357 1.00 29.44  ?  3    LYS F O     1 
ATOM   26   C  CB    . LYS A 1 4   ? 63.158  6.149   173.947 1.00 34.86  ?  3    LYS F CB    1 
ATOM   27   C  CG    . LYS A 1 4   ? 61.702  5.924   173.539 1.00 41.90  ?  3    LYS F CG    1 
ATOM   28   C  CD    . LYS A 1 4   ? 60.808  5.977   174.763 1.00 48.11  ?  3    LYS F CD    1 
ATOM   29   C  CE    . LYS A 1 4   ? 60.073  4.667   174.977 1.00 64.98  ?  3    LYS F CE    1 
ATOM   30   N  NZ    . LYS A 1 4   ? 59.510  4.563   176.358 1.00 67.88  ?  3    LYS F NZ    1 
ATOM   31   N  N     . ILE A 1 5   ? 66.377  7.012   172.664 1.00 23.63  ?  4    ILE F N     1 
ATOM   32   C  CA    . ILE A 1 5   ? 67.775  7.263   173.003 1.00 22.16  ?  4    ILE F CA    1 
ATOM   33   C  C     . ILE A 1 5   ? 67.885  8.692   173.530 1.00 27.59  ?  4    ILE F C     1 
ATOM   34   O  O     . ILE A 1 5   ? 67.377  9.636   172.905 1.00 26.51  ?  4    ILE F O     1 
ATOM   35   C  CB    . ILE A 1 5   ? 68.701  7.051   171.790 1.00 24.17  ?  4    ILE F CB    1 
ATOM   36   C  CG1   . ILE A 1 5   ? 68.443  5.689   171.132 1.00 29.25  ?  4    ILE F CG1   1 
ATOM   37   C  CG2   . ILE A 1 5   ? 70.188  7.224   172.197 1.00 21.76  ?  4    ILE F CG2   1 
ATOM   38   C  CD1   . ILE A 1 5   ? 68.544  4.519   172.082 1.00 27.19  ?  4    ILE F CD1   1 
ATOM   39   N  N     . ILE A 1 6   ? 68.518  8.844   174.691 1.00 23.90  ?  5    ILE F N     1 
ATOM   40   C  CA    . ILE A 1 6   ? 68.856  10.154  175.245 1.00 19.77  ?  5    ILE F CA    1 
ATOM   41   C  C     . ILE A 1 6   ? 70.362  10.341  175.130 1.00 20.82  ?  5    ILE F C     1 
ATOM   42   O  O     . ILE A 1 6   ? 71.129  9.420   175.432 1.00 24.47  ?  5    ILE F O     1 
ATOM   43   C  CB    . ILE A 1 6   ? 68.418  10.281  176.715 1.00 23.69  ?  5    ILE F CB    1 
ATOM   44   C  CG1   . ILE A 1 6   ? 66.903  10.085  176.865 1.00 23.05  ?  5    ILE F CG1   1 
ATOM   45   C  CG2   . ILE A 1 6   ? 68.799  11.680  177.274 1.00 24.55  ?  5    ILE F CG2   1 
ATOM   46   C  CD1   . ILE A 1 6   ? 66.461  9.992   178.325 1.00 26.36  ?  5    ILE F CD1   1 
ATOM   47   N  N     . HIS A 1 7   ? 70.787  11.528  174.715 1.00 21.06  ?  6    HIS F N     1 
ATOM   48   C  CA    . HIS A 1 7   ? 72.180  11.921  174.839 1.00 21.88  ?  6    HIS F CA    1 
ATOM   49   C  C     . HIS A 1 7   ? 72.252  13.067  175.843 1.00 27.00  ?  6    HIS F C     1 
ATOM   50   O  O     . HIS A 1 7   ? 71.591  14.085  175.655 1.00 21.23  ?  6    HIS F O     1 
ATOM   51   C  CB    . HIS A 1 7   ? 72.753  12.316  173.481 1.00 18.52  ?  6    HIS F CB    1 
ATOM   52   C  CG    . HIS A 1 7   ? 74.201  12.690  173.530 1.00 21.10  ?  6    HIS F CG    1 
ATOM   53   N  ND1   . HIS A 1 7   ? 74.629  13.999  173.609 1.00 20.05  ?  6    HIS F ND1   1 
ATOM   54   C  CD2   . HIS A 1 7   ? 75.318  11.924  173.550 1.00 23.59  ?  6    HIS F CD2   1 
ATOM   55   C  CE1   . HIS A 1 7   ? 75.951  14.025  173.650 1.00 21.84  ?  6    HIS F CE1   1 
ATOM   56   N  NE2   . HIS A 1 7   ? 76.395  12.779  173.621 1.00 24.94  ?  6    HIS F NE2   1 
ATOM   57   N  N     . VAL A 1 8   ? 73.007  12.883  176.932 1.00 22.52  ?  7    VAL F N     1 
ATOM   58   C  CA    . VAL A 1 8   ? 73.180  13.917  177.958 1.00 19.17  ?  7    VAL F CA    1 
ATOM   59   C  C     . VAL A 1 8   ? 74.581  14.486  177.832 1.00 21.17  ?  7    VAL F C     1 
ATOM   60   O  O     . VAL A 1 8   ? 75.547  13.736  177.681 1.00 22.00  ?  7    VAL F O     1 
ATOM   61   C  CB    . VAL A 1 8   ? 72.941  13.348  179.372 1.00 23.29  ?  7    VAL F CB    1 
ATOM   62   C  CG1   . VAL A 1 8   ? 73.082  14.442  180.410 1.00 22.65  ?  7    VAL F CG1   1 
ATOM   63   C  CG2   . VAL A 1 8   ? 71.550  12.697  179.478 1.00 27.31  ?  7    VAL F CG2   1 
ATOM   64   N  N     . ASP A 1 9   ? 74.700  15.812  177.898 1.00 22.72  ?  8    ASP F N     1 
ATOM   65   C  CA    . ASP A 1 9   ? 75.961  16.471  177.593 1.00 24.59  ?  8    ASP F CA    1 
ATOM   66   C  C     . ASP A 1 9   ? 76.123  17.658  178.527 1.00 22.56  ?  8    ASP F C     1 
ATOM   67   O  O     . ASP A 1 9   ? 75.283  18.556  178.503 1.00 23.33  ?  8    ASP F O     1 
ATOM   68   C  CB    A ASP A 1 9   ? 76.009  16.937  176.132 0.50 24.38  ?  8    ASP F CB    1 
ATOM   69   C  CB    B ASP A 1 9   ? 75.979  16.920  176.128 0.50 24.57  ?  8    ASP F CB    1 
ATOM   70   C  CG    A ASP A 1 9   ? 77.374  17.476  175.738 0.50 28.88  ?  8    ASP F CG    1 
ATOM   71   C  CG    B ASP A 1 9   ? 77.332  17.418  175.682 0.50 28.76  ?  8    ASP F CG    1 
ATOM   72   O  OD1   A ASP A 1 9   ? 77.756  18.553  176.235 0.50 24.22  ?  8    ASP F OD1   1 
ATOM   73   O  OD1   B ASP A 1 9   ? 78.319  17.277  176.441 0.50 21.80  ?  8    ASP F OD1   1 
ATOM   74   O  OD2   A ASP A 1 9   ? 78.068  16.828  174.926 0.50 32.54  ?  8    ASP F OD2   1 
ATOM   75   O  OD2   B ASP A 1 9   ? 77.406  17.931  174.546 0.50 33.45  ?  8    ASP F OD2   1 
ATOM   76   N  N     . MET A 1 10  ? 77.192  17.679  179.326 1.00 21.57  ?  9    MET F N     1 
ATOM   77   C  CA    . MET A 1 10  ? 77.382  18.783  180.272 1.00 21.32  ?  9    MET F CA    1 
ATOM   78   C  C     . MET A 1 10  ? 77.705  20.082  179.542 1.00 21.99  ?  9    MET F C     1 
ATOM   79   O  O     . MET A 1 10  ? 78.364  20.089  178.499 1.00 20.63  ?  9    MET F O     1 
ATOM   80   C  CB    . MET A 1 10  ? 78.499  18.463  181.270 1.00 21.50  ?  9    MET F CB    1 
ATOM   81   C  CG    . MET A 1 10  ? 78.245  17.207  182.118 1.00 22.33  ?  9    MET F CG    1 
ATOM   82   S  SD    . MET A 1 10  ? 76.822  17.321  183.215 1.00 24.84  ?  9    MET F SD    1 
ATOM   83   C  CE    . MET A 1 10  ? 77.394  18.561  184.373 1.00 26.16  ?  9    MET F CE    1 
ATOM   84   N  N     . ASP A 1 11  ? 77.227  21.198  180.103 1.00 22.62  ?  10   ASP F N     1 
ATOM   85   C  CA    . ASP A 1 11  ? 77.462  22.507  179.505 1.00 20.52  ?  10   ASP F CA    1 
ATOM   86   C  C     . ASP A 1 11  ? 78.840  23.041  179.897 1.00 22.21  ?  10   ASP F C     1 
ATOM   87   O  O     . ASP A 1 11  ? 79.167  23.098  181.086 1.00 21.74  ?  10   ASP F O     1 
ATOM   88   C  CB    . ASP A 1 11  ? 76.386  23.495  179.953 1.00 19.10  ?  10   ASP F CB    1 
ATOM   89   C  CG    . ASP A 1 11  ? 74.994  23.108  179.477 1.00 22.77  ?  10   ASP F CG    1 
ATOM   90   O  OD1   . ASP A 1 11  ? 74.833  22.663  178.309 1.00 27.65  ?  10   ASP F OD1   1 
ATOM   91   O  OD2   . ASP A 1 11  ? 74.063  23.238  180.284 1.00 29.18  ?  10   ASP F OD2   1 
ATOM   92   N  N     . CYS A 1 12  ? 79.625  23.450  178.895 1.00 24.07  ?  11   CYS F N     1 
ATOM   93   C  CA    . CYS A 1 12  ? 80.980  24.006  179.065 1.00 25.86  ?  11   CYS F CA    1 
ATOM   94   C  C     . CYS A 1 12  ? 81.733  23.317  180.201 1.00 26.77  ?  11   CYS F C     1 
ATOM   95   O  O     . CYS A 1 12  ? 82.204  23.959  181.136 1.00 23.01  ?  11   CYS F O     1 
ATOM   96   C  CB    . CYS A 1 12  ? 80.943  25.519  179.304 1.00 32.07  ?  11   CYS F CB    1 
ATOM   97   S  SG    . CYS A 1 12  ? 80.087  26.470  178.046 1.00 35.16  ?  11   CYS F SG    1 
ATOM   98   N  N     . PHE A 1 13  ? 81.866  21.984  180.083 1.00 20.79  ?  12   PHE F N     1 
ATOM   99   C  CA    . PHE A 1 13  ? 82.086  21.131  181.249 1.00 20.99  ?  12   PHE F CA    1 
ATOM   100  C  C     . PHE A 1 13  ? 83.250  21.593  182.127 1.00 22.46  ?  12   PHE F C     1 
ATOM   101  O  O     . PHE A 1 13  ? 83.060  21.842  183.321 1.00 24.92  ?  12   PHE F O     1 
ATOM   102  C  CB    . PHE A 1 13  ? 82.289  19.680  180.801 1.00 19.63  ?  12   PHE F CB    1 
ATOM   103  C  CG    . PHE A 1 13  ? 82.513  18.705  181.951 1.00 22.95  ?  12   PHE F CG    1 
ATOM   104  C  CD1   . PHE A 1 13  ? 81.698  18.736  183.069 1.00 23.95  ?  12   PHE F CD1   1 
ATOM   105  C  CD2   . PHE A 1 13  ? 83.540  17.765  181.900 1.00 21.94  ?  12   PHE F CD2   1 
ATOM   106  C  CE1   . PHE A 1 13  ? 81.887  17.842  184.121 1.00 27.73  ?  12   PHE F CE1   1 
ATOM   107  C  CE2   . PHE A 1 13  ? 83.743  16.863  182.948 1.00 23.90  ?  12   PHE F CE2   1 
ATOM   108  C  CZ    . PHE A 1 13  ? 82.924  16.909  184.065 1.00 25.93  ?  12   PHE F CZ    1 
ATOM   109  N  N     . PHE A 1 14  ? 84.477  21.659  181.585 1.00 21.17  ?  13   PHE F N     1 
ATOM   110  C  CA    . PHE A 1 14  ? 85.606  21.993  182.458 1.00 24.57  ?  13   PHE F CA    1 
ATOM   111  C  C     . PHE A 1 14  ? 85.416  23.382  183.062 1.00 25.72  ?  13   PHE F C     1 
ATOM   112  O  O     . PHE A 1 14  ? 85.657  23.592  184.254 1.00 25.67  ?  13   PHE F O     1 
ATOM   113  C  CB    . PHE A 1 14  ? 86.957  21.968  181.726 1.00 24.25  ?  13   PHE F CB    1 
ATOM   114  C  CG    . PHE A 1 14  ? 87.419  20.616  181.264 1.00 24.20  ?  13   PHE F CG    1 
ATOM   115  C  CD1   . PHE A 1 14  ? 86.641  19.475  181.425 1.00 24.62  ?  13   PHE F CD1   1 
ATOM   116  C  CD2   . PHE A 1 14  ? 88.674  20.487  180.660 1.00 25.24  ?  13   PHE F CD2   1 
ATOM   117  C  CE1   . PHE A 1 14  ? 87.083  18.256  180.973 1.00 25.72  ?  13   PHE F CE1   1 
ATOM   118  C  CE2   . PHE A 1 14  ? 89.122  19.245  180.213 1.00 23.73  ?  13   PHE F CE2   1 
ATOM   119  C  CZ    . PHE A 1 14  ? 88.331  18.134  180.362 1.00 23.70  ?  13   PHE F CZ    1 
ATOM   120  N  N     . ALA A 1 15  ? 84.990  24.343  182.245 1.00 26.07  ?  14   ALA F N     1 
ATOM   121  C  CA    . ALA A 1 15  ? 84.802  25.707  182.740 1.00 27.67  ?  14   ALA F CA    1 
ATOM   122  C  C     . ALA A 1 15  ? 83.670  25.781  183.759 1.00 28.85  ?  14   ALA F C     1 
ATOM   123  O  O     . ALA A 1 15  ? 83.748  26.548  184.725 1.00 28.87  ?  14   ALA F O     1 
ATOM   124  C  CB    . ALA A 1 15  ? 84.520  26.655  181.575 1.00 29.02  ?  14   ALA F CB    1 
ATOM   125  N  N     . ALA A 1 16  ? 82.603  25.001  183.553 1.00 27.97  ?  15   ALA F N     1 
ATOM   126  C  CA    . ALA A 1 16  ? 81.501  25.004  184.509 1.00 32.56  ?  15   ALA F CA    1 
ATOM   127  C  C     . ALA A 1 16  ? 81.958  24.495  185.867 1.00 29.93  ?  15   ALA F C     1 
ATOM   128  O  O     . ALA A 1 16  ? 81.523  24.997  186.909 1.00 32.51  ?  15   ALA F O     1 
ATOM   129  C  CB    . ALA A 1 16  ? 80.346  24.159  183.982 1.00 30.57  ?  15   ALA F CB    1 
ATOM   130  N  N     . VAL A 1 17  ? 82.846  23.501  185.878 1.00 27.99  ?  16   VAL F N     1 
ATOM   131  C  CA    . VAL A 1 17  ? 83.375  23.012  187.148 1.00 27.24  ?  16   VAL F CA    1 
ATOM   132  C  C     . VAL A 1 17  ? 84.210  24.089  187.824 1.00 31.17  ?  16   VAL F C     1 
ATOM   133  O  O     . VAL A 1 17  ? 84.090  24.321  189.034 1.00 34.00  ?  16   VAL F O     1 
ATOM   134  C  CB    . VAL A 1 17  ? 84.181  21.721  186.924 1.00 25.92  ?  16   VAL F CB    1 
ATOM   135  C  CG1   . VAL A 1 17  ? 84.991  21.382  188.153 1.00 29.39  ?  16   VAL F CG1   1 
ATOM   136  C  CG2   . VAL A 1 17  ? 83.223  20.555  186.538 1.00 23.35  ?  16   VAL F CG2   1 
ATOM   137  N  N     . GLU A 1 18  ? 85.071  24.765  187.056 1.00 30.07  ?  17   GLU F N     1 
ATOM   138  C  CA    . GLU A 1 18  ? 85.928  25.790  187.646 1.00 28.46  ?  17   GLU F CA    1 
ATOM   139  C  C     . GLU A 1 18  ? 85.122  26.968  188.181 1.00 38.33  ?  17   GLU F C     1 
ATOM   140  O  O     . GLU A 1 18  ? 85.492  27.554  189.203 1.00 38.64  ?  17   GLU F O     1 
ATOM   141  C  CB    . GLU A 1 18  ? 86.965  26.275  186.628 1.00 29.89  ?  17   GLU F CB    1 
ATOM   142  C  CG    . GLU A 1 18  ? 87.891  25.180  186.081 1.00 29.66  ?  17   GLU F CG    1 
ATOM   143  C  CD    . GLU A 1 18  ? 88.739  24.484  187.149 1.00 34.70  ?  17   GLU F CD    1 
ATOM   144  O  OE1   . GLU A 1 18  ? 88.823  24.959  188.303 1.00 34.35  ?  17   GLU F OE1   1 
ATOM   145  O  OE2   . GLU A 1 18  ? 89.341  23.449  186.822 1.00 31.92  ?  17   GLU F OE2   1 
ATOM   146  N  N     . MET A 1 19  ? 84.022  27.328  187.521 1.00 35.52  ?  18   MET F N     1 
ATOM   147  C  CA    . MET A 1 19  ? 83.211  28.441  188.011 1.00 39.05  ?  18   MET F CA    1 
ATOM   148  C  C     . MET A 1 19  ? 82.449  28.067  189.278 1.00 43.93  ?  18   MET F C     1 
ATOM   149  O  O     . MET A 1 19  ? 82.292  28.896  190.186 1.00 40.38  ?  18   MET F O     1 
ATOM   150  C  CB    . MET A 1 19  ? 82.240  28.898  186.928 1.00 32.13  ?  18   MET F CB    1 
ATOM   151  C  CG    . MET A 1 19  ? 82.909  29.578  185.754 1.00 38.13  ?  18   MET F CG    1 
ATOM   152  S  SD    . MET A 1 19  ? 81.713  30.173  184.553 1.00 34.08  ?  18   MET F SD    1 
ATOM   153  C  CE    . MET A 1 19  ? 80.925  28.619  184.105 1.00 27.49  ?  18   MET F CE    1 
ATOM   154  N  N     . ARG A 1 20  ? 81.948  26.833  189.346 1.00 41.53  ?  19   ARG F N     1 
ATOM   155  C  CA    . ARG A 1 20  ? 81.292  26.357  190.558 1.00 36.88  ?  19   ARG F CA    1 
ATOM   156  C  C     . ARG A 1 20  ? 82.245  26.375  191.741 1.00 39.03  ?  19   ARG F C     1 
ATOM   157  O  O     . ARG A 1 20  ? 81.872  26.791  192.844 1.00 42.95  ?  19   ARG F O     1 
ATOM   158  C  CB    . ARG A 1 20  ? 80.758  24.940  190.344 1.00 35.68  ?  19   ARG F CB    1 
ATOM   159  C  CG    . ARG A 1 20  ? 80.147  24.333  191.601 1.00 34.90  ?  19   ARG F CG    1 
ATOM   160  C  CD    . ARG A 1 20  ? 80.034  22.831  191.488 1.00 33.07  ?  19   ARG F CD    1 
ATOM   161  N  NE    . ARG A 1 20  ? 81.340  22.183  191.517 1.00 33.68  ?  19   ARG F NE    1 
ATOM   162  C  CZ    . ARG A 1 20  ? 81.543  20.907  191.205 1.00 31.74  ?  19   ARG F CZ    1 
ATOM   163  N  NH1   . ARG A 1 20  ? 80.527  20.142  190.838 1.00 33.15  ?  19   ARG F NH1   1 
ATOM   164  N  NH2   . ARG A 1 20  ? 82.762  20.393  191.268 1.00 34.68  ?  19   ARG F NH2   1 
ATOM   165  N  N     . ASP A 1 21  ? 83.486  25.940  191.530 1.00 35.73  ?  20   ASP F N     1 
ATOM   166  C  CA    . ASP A 1 21  ? 84.448  25.850  192.618 1.00 35.02  ?  20   ASP F CA    1 
ATOM   167  C  C     . ASP A 1 21  ? 85.138  27.172  192.919 1.00 42.95  ?  20   ASP F C     1 
ATOM   168  O  O     . ASP A 1 21  ? 85.791  27.279  193.962 1.00 45.09  ?  20   ASP F O     1 
ATOM   169  C  CB    . ASP A 1 21  ? 85.479  24.764  192.304 1.00 32.16  ?  20   ASP F CB    1 
ATOM   170  C  CG    . ASP A 1 21  ? 84.848  23.392  192.220 1.00 38.66  ?  20   ASP F CG    1 
ATOM   171  O  OD1   . ASP A 1 21  ? 83.691  23.268  192.669 1.00 47.15  ?  20   ASP F OD1   1 
ATOM   172  O  OD2   . ASP A 1 21  ? 85.492  22.447  191.721 1.00 42.70  ?  20   ASP F OD2   1 
ATOM   173  N  N     . ASN A 1 22  ? 84.991  28.179  192.059 1.00 45.63  ?  21   ASN F N     1 
ATOM   174  C  CA    . ASN A 1 22  ? 85.536  29.512  192.320 1.00 45.78  ?  21   ASN F CA    1 
ATOM   175  C  C     . ASN A 1 22  ? 84.614  30.530  191.671 1.00 45.91  ?  21   ASN F C     1 
ATOM   176  O  O     . ASN A 1 22  ? 84.802  30.910  190.507 1.00 43.27  ?  21   ASN F O     1 
ATOM   177  C  CB    . ASN A 1 22  ? 86.964  29.653  191.794 1.00 47.63  ?  21   ASN F CB    1 
ATOM   178  C  CG    . ASN A 1 22  ? 87.549  31.037  192.041 1.00 54.87  ?  21   ASN F CG    1 
ATOM   179  O  OD1   . ASN A 1 22  ? 86.975  31.857  192.759 1.00 48.35  ?  21   ASN F OD1   1 
ATOM   180  N  ND2   . ASN A 1 22  ? 88.705  31.297  191.443 1.00 61.66  ?  21   ASN F ND2   1 
ATOM   181  N  N     . PRO A 1 23  ? 83.595  31.000  192.398 1.00 47.46  ?  22   PRO F N     1 
ATOM   182  C  CA    . PRO A 1 23  ? 82.581  31.869  191.774 1.00 50.01  ?  22   PRO F CA    1 
ATOM   183  C  C     . PRO A 1 23  ? 83.127  33.193  191.270 1.00 50.07  ?  22   PRO F C     1 
ATOM   184  O  O     . PRO A 1 23  ? 82.422  33.884  190.524 1.00 55.55  ?  22   PRO F O     1 
ATOM   185  C  CB    . PRO A 1 23  ? 81.556  32.078  192.897 1.00 56.64  ?  22   PRO F CB    1 
ATOM   186  C  CG    . PRO A 1 23  ? 81.775  30.935  193.829 1.00 55.94  ?  22   PRO F CG    1 
ATOM   187  C  CD    . PRO A 1 23  ? 83.249  30.665  193.787 1.00 53.18  ?  22   PRO F CD    1 
ATOM   188  N  N     . ALA A 1 24  ? 84.355  33.564  191.637 1.00 49.25  ?  23   ALA F N     1 
ATOM   189  C  CA    . ALA A 1 24  ? 84.954  34.771  191.077 1.00 56.11  ?  23   ALA F CA    1 
ATOM   190  C  C     . ALA A 1 24  ? 85.117  34.684  189.567 1.00 55.58  ?  23   ALA F C     1 
ATOM   191  O  O     . ALA A 1 24  ? 85.243  35.721  188.907 1.00 48.26  ?  23   ALA F O     1 
ATOM   192  C  CB    . ALA A 1 24  ? 86.312  35.037  191.725 1.00 53.35  ?  23   ALA F CB    1 
ATOM   193  N  N     . LEU A 1 25  ? 85.104  33.476  189.007 1.00 48.42  ?  24   LEU F N     1 
ATOM   194  C  CA    . LEU A 1 25  ? 85.302  33.269  187.581 1.00 45.80  ?  24   LEU F CA    1 
ATOM   195  C  C     . LEU A 1 25  ? 84.001  33.278  186.797 1.00 41.93  ?  24   LEU F C     1 
ATOM   196  O  O     . LEU A 1 25  ? 84.040  33.173  185.569 1.00 38.85  ?  24   LEU F O     1 
ATOM   197  C  CB    . LEU A 1 25  ? 86.022  31.937  187.340 1.00 44.46  ?  24   LEU F CB    1 
ATOM   198  C  CG    . LEU A 1 25  ? 87.252  31.614  188.191 1.00 37.13  ?  24   LEU F CG    1 
ATOM   199  C  CD1   . LEU A 1 25  ? 87.728  30.192  187.896 1.00 38.80  ?  24   LEU F CD1   1 
ATOM   200  C  CD2   . LEU A 1 25  ? 88.353  32.628  187.933 1.00 45.41  ?  24   LEU F CD2   1 
ATOM   201  N  N     . ARG A 1 26  ? 82.859  33.420  187.478 1.00 38.81  ?  25   ARG F N     1 
ATOM   202  C  CA    . ARG A 1 26  ? 81.560  33.205  186.845 1.00 40.23  ?  25   ARG F CA    1 
ATOM   203  C  C     . ARG A 1 26  ? 81.286  34.207  185.723 1.00 41.78  ?  25   ARG F C     1 
ATOM   204  O  O     . ARG A 1 26  ? 80.731  33.845  184.679 1.00 40.87  ?  25   ARG F O     1 
ATOM   205  C  CB    . ARG A 1 26  ? 80.460  33.280  187.904 1.00 52.71  ?  25   ARG F CB    1 
ATOM   206  C  CG    . ARG A 1 26  ? 79.046  33.322  187.351 1.00 57.65  ?  25   ARG F CG    1 
ATOM   207  C  CD    . ARG A 1 26  ? 78.617  31.967  186.836 1.00 59.01  ?  25   ARG F CD    1 
ATOM   208  N  NE    . ARG A 1 26  ? 78.716  30.944  187.870 1.00 60.53  ?  25   ARG F NE    1 
ATOM   209  C  CZ    . ARG A 1 26  ? 78.658  29.640  187.629 1.00 53.96  ?  25   ARG F CZ    1 
ATOM   210  N  NH1   . ARG A 1 26  ? 78.504  29.208  186.385 1.00 46.88  ?  25   ARG F NH1   1 
ATOM   211  N  NH2   . ARG A 1 26  ? 78.758  28.769  188.625 1.00 54.70  ?  25   ARG F NH2   1 
ATOM   212  N  N     . ASP A 1 27  ? 81.650  35.468  185.909 1.00 40.69  ?  26   ASP F N     1 
ATOM   213  C  CA    . ASP A 1 27  ? 81.163  36.498  185.000 1.00 52.46  ?  26   ASP F CA    1 
ATOM   214  C  C     . ASP A 1 27  ? 82.234  37.087  184.096 1.00 49.12  ?  26   ASP F C     1 
ATOM   215  O  O     . ASP A 1 27  ? 81.923  37.967  183.285 1.00 54.67  ?  26   ASP F O     1 
ATOM   216  C  CB    . ASP A 1 27  ? 80.468  37.604  185.803 1.00 57.53  ?  26   ASP F CB    1 
ATOM   217  C  CG    . ASP A 1 27  ? 79.148  37.137  186.397 1.00 60.91  ?  26   ASP F CG    1 
ATOM   218  O  OD1   . ASP A 1 27  ? 78.330  36.567  185.645 1.00 58.09  ?  26   ASP F OD1   1 
ATOM   219  O  OD2   . ASP A 1 27  ? 78.938  37.311  187.615 1.00 65.19  ?  26   ASP F OD2   1 
ATOM   220  N  N     . ILE A 1 28  ? 83.472  36.620  184.193 1.00 38.17  ?  27   ILE F N     1 
ATOM   221  C  CA    . ILE A 1 28  ? 84.559  37.105  183.350 1.00 43.49  ?  27   ILE F CA    1 
ATOM   222  C  C     . ILE A 1 28  ? 84.894  36.021  182.335 1.00 39.32  ?  27   ILE F C     1 
ATOM   223  O  O     . ILE A 1 28  ? 84.565  34.848  182.562 1.00 35.87  ?  27   ILE F O     1 
ATOM   224  C  CB    . ILE A 1 28  ? 85.794  37.478  184.184 1.00 48.59  ?  27   ILE F CB    1 
ATOM   225  C  CG1   . ILE A 1 28  ? 86.228  36.288  185.042 1.00 45.42  ?  27   ILE F CG1   1 
ATOM   226  C  CG2   . ILE A 1 28  ? 85.523  38.714  185.035 1.00 47.01  ?  27   ILE F CG2   1 
ATOM   227  C  CD1   . ILE A 1 28  ? 87.570  36.493  185.717 1.00 51.64  ?  27   ILE F CD1   1 
ATOM   228  N  N     . PRO A 1 29  ? 85.532  36.354  181.213 1.00 40.66  ?  28   PRO F N     1 
ATOM   229  C  CA    . PRO A 1 29  ? 85.912  35.317  180.237 1.00 34.21  ?  28   PRO F CA    1 
ATOM   230  C  C     . PRO A 1 29  ? 87.023  34.425  180.780 1.00 32.93  ?  28   PRO F C     1 
ATOM   231  O  O     . PRO A 1 29  ? 88.099  34.904  181.161 1.00 35.42  ?  28   PRO F O     1 
ATOM   232  C  CB    . PRO A 1 29  ? 86.375  36.127  179.024 1.00 34.49  ?  28   PRO F CB    1 
ATOM   233  C  CG    . PRO A 1 29  ? 86.803  37.485  179.614 1.00 35.20  ?  28   PRO F CG    1 
ATOM   234  C  CD    . PRO A 1 29  ? 85.862  37.719  180.750 1.00 38.22  ?  28   PRO F CD    1 
ATOM   235  N  N     . ILE A 1 30  ? 86.758  33.116  180.823 1.00 33.30  ?  29   ILE F N     1 
ATOM   236  C  CA    . ILE A 1 30  ? 87.745  32.144  181.282 1.00 27.72  ?  29   ILE F CA    1 
ATOM   237  C  C     . ILE A 1 30  ? 87.836  30.994  180.285 1.00 29.45  ?  29   ILE F C     1 
ATOM   238  O  O     . ILE A 1 30  ? 86.914  30.728  179.514 1.00 27.79  ?  29   ILE F O     1 
ATOM   239  C  CB    . ILE A 1 30  ? 87.417  31.577  182.682 1.00 29.69  ?  29   ILE F CB    1 
ATOM   240  C  CG1   . ILE A 1 30  ? 86.295  30.551  182.595 1.00 27.84  ?  29   ILE F CG1   1 
ATOM   241  C  CG2   . ILE A 1 30  ? 87.041  32.676  183.660 1.00 33.97  ?  29   ILE F CG2   1 
ATOM   242  C  CD1   . ILE A 1 30  ? 86.193  29.684  183.825 1.00 30.99  ?  29   ILE F CD1   1 
ATOM   243  N  N     . ALA A 1 31  ? 88.959  30.288  180.336 1.00 29.57  ?  30   ALA F N     1 
ATOM   244  C  CA    . ALA A 1 31  ? 89.164  29.105  179.519 1.00 30.31  ?  30   ALA F CA    1 
ATOM   245  C  C     . ALA A 1 31  ? 90.168  28.195  180.206 1.00 30.57  ?  30   ALA F C     1 
ATOM   246  O  O     . ALA A 1 31  ? 91.075  28.656  180.901 1.00 31.51  ?  30   ALA F O     1 
ATOM   247  C  CB    . ALA A 1 31  ? 89.658  29.458  178.109 1.00 26.05  ?  30   ALA F CB    1 
ATOM   248  N  N     . ILE A 1 32  ? 89.982  26.896  180.022 1.00 23.68  ?  31   ILE F N     1 
ATOM   249  C  CA    . ILE A 1 32  ? 90.993  25.914  180.388 1.00 24.20  ?  31   ILE F CA    1 
ATOM   250  C  C     . ILE A 1 32  ? 91.853  25.677  179.159 1.00 26.74  ?  31   ILE F C     1 
ATOM   251  O  O     . ILE A 1 32  ? 91.334  25.370  178.078 1.00 29.11  ?  31   ILE F O     1 
ATOM   252  C  CB    . ILE A 1 32  ? 90.354  24.604  180.881 1.00 28.22  ?  31   ILE F CB    1 
ATOM   253  C  CG1   . ILE A 1 32  ? 89.683  24.807  182.237 1.00 29.18  ?  31   ILE F CG1   1 
ATOM   254  C  CG2   . ILE A 1 32  ? 91.421  23.503  181.005 1.00 30.59  ?  31   ILE F CG2   1 
ATOM   255  C  CD1   . ILE A 1 32  ? 88.300  25.386  182.190 1.00 29.65  ?  31   ILE F CD1   1 
ATOM   256  N  N     . GLY A 1 33  ? 93.157  25.842  179.310 1.00 27.97  ?  32   GLY F N     1 
ATOM   257  C  CA    . GLY A 1 33  ? 94.059  25.669  178.193 1.00 25.84  ?  32   GLY F CA    1 
ATOM   258  C  C     . GLY A 1 33  ? 95.472  26.057  178.558 1.00 28.75  ?  32   GLY F C     1 
ATOM   259  O  O     . GLY A 1 33  ? 95.677  26.804  179.518 1.00 34.86  ?  32   GLY F O     1 
ATOM   260  N  N     . GLY A 1 34  ? 96.446  25.564  177.794 1.00 33.55  ?  33   GLY F N     1 
ATOM   261  C  CA    . GLY A 1 34  ? 97.832  25.917  178.038 1.00 28.27  ?  33   GLY F CA    1 
ATOM   262  C  C     . GLY A 1 34  ? 98.116  27.365  177.681 1.00 34.76  ?  33   GLY F C     1 
ATOM   263  O  O     . GLY A 1 34  ? 97.498  27.951  176.792 1.00 31.40  ?  33   GLY F O     1 
ATOM   264  N  N     . SER A 1 35  ? 99.072  27.952  178.393 1.00 31.92  ?  34   SER F N     1 
ATOM   265  C  CA    . SER A 1 35  ? 99.426  29.335  178.132 1.00 34.14  ?  34   SER F CA    1 
ATOM   266  C  C     . SER A 1 35  ? 99.992  29.485  176.722 1.00 32.46  ?  34   SER F C     1 
ATOM   267  O  O     . SER A 1 35  ? 100.378 28.514  176.064 1.00 32.53  ?  34   SER F O     1 
ATOM   268  C  CB    . SER A 1 35  ? 100.434 29.833  179.164 1.00 36.37  ?  34   SER F CB    1 
ATOM   269  O  OG    . SER A 1 35  ? 101.651 29.133  179.035 1.00 34.88  ?  34   SER F OG    1 
ATOM   270  N  N     . ARG A 1 36  ? 100.017 30.730  176.250 1.00 32.74  ?  35   ARG F N     1 
ATOM   271  C  CA    . ARG A 1 36  ? 100.656 31.003  174.971 1.00 30.28  ?  35   ARG F CA    1 
ATOM   272  C  C     . ARG A 1 36  ? 102.126 30.601  175.006 1.00 35.95  ?  35   ARG F C     1 
ATOM   273  O  O     . ARG A 1 36  ? 102.665 30.107  174.009 1.00 34.00  ?  35   ARG F O     1 
ATOM   274  C  CB    . ARG A 1 36  ? 100.491 32.488  174.615 1.00 36.49  ?  35   ARG F CB    1 
ATOM   275  C  CG    . ARG A 1 36  ? 101.290 32.948  173.404 1.00 43.43  ?  35   ARG F CG    1 
ATOM   276  C  CD    . ARG A 1 36  ? 100.977 34.416  173.045 1.00 54.49  ?  35   ARG F CD    1 
ATOM   277  N  NE    . ARG A 1 36  ? 100.359 35.119  174.167 1.00 65.66  ?  35   ARG F NE    1 
ATOM   278  C  CZ    . ARG A 1 36  ? 101.030 35.705  175.156 1.00 77.13  ?  35   ARG F CZ    1 
ATOM   279  N  NH1   . ARG A 1 36  ? 102.359 35.688  175.164 1.00 82.48  ?  35   ARG F NH1   1 
ATOM   280  N  NH2   . ARG A 1 36  ? 100.372 36.314  176.135 1.00 78.60  ?  35   ARG F NH2   1 
ATOM   281  N  N     . GLU A 1 37  ? 102.789 30.797  176.156 1.00 36.46  ?  36   GLU F N     1 
ATOM   282  C  CA    . GLU A 1 37  ? 104.194 30.427  176.293 1.00 36.71  ?  36   GLU F CA    1 
ATOM   283  C  C     . GLU A 1 37  ? 104.379 28.913  176.281 1.00 37.30  ?  36   GLU F C     1 
ATOM   284  O  O     . GLU A 1 37  ? 105.394 28.422  175.775 1.00 39.23  ?  36   GLU F O     1 
ATOM   285  C  CB    . GLU A 1 37  ? 104.772 31.030  177.576 1.00 42.12  ?  36   GLU F CB    1 
ATOM   286  C  CG    . GLU A 1 37  ? 104.882 32.571  177.581 1.00 56.41  ?  36   GLU F CG    1 
ATOM   287  C  CD    . GLU A 1 37  ? 103.551 33.314  177.791 1.00 66.63  ?  36   GLU F CD    1 
ATOM   288  O  OE1   . GLU A 1 37  ? 103.571 34.564  177.738 1.00 78.48  ?  36   GLU F OE1   1 
ATOM   289  O  OE2   . GLU A 1 37  ? 102.491 32.676  178.008 1.00 45.92  ?  36   GLU F OE2   1 
ATOM   290  N  N     . ARG A 1 38  ? 103.420 28.164  176.826 1.00 28.69  ?  37   ARG F N     1 
ATOM   291  C  CA    . ARG A 1 38  ? 103.419 26.705  176.730 1.00 28.05  ?  37   ARG F CA    1 
ATOM   292  C  C     . ARG A 1 38  ? 102.925 26.217  175.374 1.00 32.24  ?  37   ARG F C     1 
ATOM   293  O  O     . ARG A 1 38  ? 102.764 25.002  175.185 1.00 29.35  ?  37   ARG F O     1 
ATOM   294  C  CB    . ARG A 1 38  ? 102.557 26.109  177.846 1.00 30.61  ?  37   ARG F CB    1 
ATOM   295  C  CG    . ARG A 1 38  ? 103.192 26.200  179.224 1.00 35.70  ?  37   ARG F CG    1 
ATOM   296  C  CD    . ARG A 1 38  ? 104.229 25.109  179.423 1.00 37.47  ?  37   ARG F CD    1 
ATOM   297  N  NE    . ARG A 1 38  ? 103.659 23.776  179.233 1.00 34.89  ?  37   ARG F NE    1 
ATOM   298  C  CZ    . ARG A 1 38  ? 103.108 23.048  180.201 1.00 39.87  ?  37   ARG F CZ    1 
ATOM   299  N  NH1   . ARG A 1 38  ? 103.060 23.520  181.439 1.00 47.66  ?  37   ARG F NH1   1 
ATOM   300  N  NH2   . ARG A 1 38  ? 102.609 21.842  179.935 1.00 34.20  ?  37   ARG F NH2   1 
ATOM   301  N  N     . ARG A 1 39  ? 102.640 27.145  174.451 1.00 32.55  ?  38   ARG F N     1 
ATOM   302  C  CA    . ARG A 1 39  ? 102.173 26.819  173.101 1.00 33.86  ?  38   ARG F CA    1 
ATOM   303  C  C     . ARG A 1 39  ? 100.852 26.050  173.144 1.00 31.43  ?  38   ARG F C     1 
ATOM   304  O  O     . ARG A 1 39  ? 100.645 25.073  172.419 1.00 28.59  ?  38   ARG F O     1 
ATOM   305  C  CB    . ARG A 1 39  ? 103.245 26.053  172.329 1.00 33.48  ?  38   ARG F CB    1 
ATOM   306  C  CG    . ARG A 1 39  ? 104.564 26.848  172.279 1.00 32.39  ?  38   ARG F CG    1 
ATOM   307  C  CD    . ARG A 1 39  ? 105.410 26.472  171.082 1.00 35.03  ?  38   ARG F CD    1 
ATOM   308  N  NE    . ARG A 1 39  ? 106.121 25.221  171.312 1.00 36.00  ?  38   ARG F NE    1 
ATOM   309  C  CZ    . ARG A 1 39  ? 107.067 24.751  170.505 1.00 37.30  ?  38   ARG F CZ    1 
ATOM   310  N  NH1   . ARG A 1 39  ? 107.401 25.432  169.418 1.00 41.21  ?  38   ARG F NH1   1 
ATOM   311  N  NH2   . ARG A 1 39  ? 107.674 23.605  170.787 1.00 34.34  ?  38   ARG F NH2   1 
ATOM   312  N  N     . GLY A 1 40  ? 99.954  26.498  174.011 1.00 30.33  ?  39   GLY F N     1 
ATOM   313  C  CA    . GLY A 1 40  ? 98.761  25.741  174.309 1.00 29.77  ?  39   GLY F CA    1 
ATOM   314  C  C     . GLY A 1 40  ? 97.611  26.010  173.357 1.00 28.75  ?  39   GLY F C     1 
ATOM   315  O  O     . GLY A 1 40  ? 97.659  26.914  172.509 1.00 27.99  ?  39   GLY F O     1 
ATOM   316  N  N     . VAL A 1 41  ? 96.573  25.182  173.500 1.00 27.98  ?  40   VAL F N     1 
ATOM   317  C  CA    . VAL A 1 41  ? 95.275  25.422  172.885 1.00 30.39  ?  40   VAL F CA    1 
ATOM   318  C  C     . VAL A 1 41  ? 94.215  25.431  173.974 1.00 24.90  ?  40   VAL F C     1 
ATOM   319  O  O     . VAL A 1 41  ? 94.447  25.020  175.116 1.00 28.03  ?  40   VAL F O     1 
ATOM   320  C  CB    . VAL A 1 41  ? 94.897  24.394  171.804 1.00 39.65  ?  40   VAL F CB    1 
ATOM   321  C  CG1   . VAL A 1 41  ? 96.019  24.162  170.840 1.00 26.94  ?  40   VAL F CG1   1 
ATOM   322  C  CG2   . VAL A 1 41  ? 94.418  23.122  172.438 1.00 42.07  ?  40   VAL F CG2   1 
ATOM   323  N  N     . ILE A 1 42  ? 93.037  25.909  173.593 1.00 21.96  ?  41   ILE F N     1 
ATOM   324  C  CA    . ILE A 1 42  ? 91.899  25.980  174.495 1.00 22.20  ?  41   ILE F CA    1 
ATOM   325  C  C     . ILE A 1 42  ? 91.229  24.619  174.561 1.00 24.02  ?  41   ILE F C     1 
ATOM   326  O  O     . ILE A 1 42  ? 90.881  24.036  173.527 1.00 22.48  ?  41   ILE F O     1 
ATOM   327  C  CB    . ILE A 1 42  ? 90.905  27.052  174.032 1.00 21.42  ?  41   ILE F CB    1 
ATOM   328  C  CG1   . ILE A 1 42  ? 91.574  28.436  173.972 1.00 26.34  ?  41   ILE F CG1   1 
ATOM   329  C  CG2   . ILE A 1 42  ? 89.696  27.047  174.924 1.00 25.38  ?  41   ILE F CG2   1 
ATOM   330  C  CD1   . ILE A 1 42  ? 92.217  28.860  175.272 1.00 30.33  ?  41   ILE F CD1   1 
ATOM   331  N  N     . SER A 1 43  ? 91.055  24.103  175.782 1.00 24.06  ?  42   SER F N     1 
ATOM   332  C  CA    . SER A 1 43  ? 90.240  22.906  175.958 1.00 23.10  ?  42   SER F CA    1 
ATOM   333  C  C     . SER A 1 43  ? 88.766  23.250  175.899 1.00 21.13  ?  42   SER F C     1 
ATOM   334  O  O     . SER A 1 43  ? 87.985  22.555  175.232 1.00 22.02  ?  42   SER F O     1 
ATOM   335  C  CB    . SER A 1 43  ? 90.572  22.216  177.278 1.00 21.76  ?  42   SER F CB    1 
ATOM   336  O  OG    . SER A 1 43  ? 91.713  21.397  177.115 1.00 23.08  ?  42   SER F OG    1 
ATOM   337  N  N     . THR A 1 44  ? 88.367  24.286  176.623 1.00 20.64  ?  43   THR F N     1 
ATOM   338  C  CA    . THR A 1 44  ? 87.023  24.839  176.513 1.00 22.47  ?  43   THR F CA    1 
ATOM   339  C  C     . THR A 1 44  ? 87.013  26.212  177.169 1.00 23.94  ?  43   THR F C     1 
ATOM   340  O  O     . THR A 1 44  ? 87.954  26.593  177.860 1.00 24.39  ?  43   THR F O     1 
ATOM   341  C  CB    . THR A 1 44  ? 85.981  23.938  177.165 1.00 21.73  ?  43   THR F CB    1 
ATOM   342  O  OG1   . THR A 1 44  ? 84.680  24.344  176.735 1.00 23.73  ?  43   THR F OG1   1 
ATOM   343  C  CG2   . THR A 1 44  ? 86.072  24.028  178.686 1.00 24.62  ?  43   THR F CG2   1 
ATOM   344  N  N     . ALA A 1 45  ? 85.914  26.936  176.958 1.00 22.55  ?  44   ALA F N     1 
ATOM   345  C  CA    . ALA A 1 45  ? 85.763  28.289  177.476 1.00 23.22  ?  44   ALA F CA    1 
ATOM   346  C  C     . ALA A 1 45  ? 84.351  28.465  178.016 1.00 25.21  ?  44   ALA F C     1 
ATOM   347  O  O     . ALA A 1 45  ? 83.441  27.728  177.650 1.00 26.72  ?  44   ALA F O     1 
ATOM   348  C  CB    . ALA A 1 45  ? 86.060  29.328  176.388 1.00 31.97  ?  44   ALA F CB    1 
ATOM   349  N  N     . ASN A 1 46  ? 84.169  29.450  178.899 1.00 24.49  ?  45   ASN F N     1 
ATOM   350  C  CA    . ASN A 1 46  ? 82.819  29.744  179.342 1.00 31.62  ?  45   ASN F CA    1 
ATOM   351  C  C     . ASN A 1 46  ? 82.157  30.704  178.346 1.00 27.87  ?  45   ASN F C     1 
ATOM   352  O  O     . ASN A 1 46  ? 82.775  31.151  177.378 1.00 30.62  ?  45   ASN F O     1 
ATOM   353  C  CB    . ASN A 1 46  ? 82.825  30.290  180.776 1.00 29.12  ?  45   ASN F CB    1 
ATOM   354  C  CG    . ASN A 1 46  ? 83.463  31.674  180.897 1.00 31.36  ?  45   ASN F CG    1 
ATOM   355  O  OD1   . ASN A 1 46  ? 83.999  32.220  179.936 1.00 32.14  ?  45   ASN F OD1   1 
ATOM   356  N  ND2   . ASN A 1 46  ? 83.417  32.238  182.100 1.00 33.56  ?  45   ASN F ND2   1 
ATOM   357  N  N     . TYR A 1 47  ? 80.862  30.982  178.559 1.00 26.81  ?  46   TYR F N     1 
ATOM   358  C  CA    . TYR A 1 47  ? 80.129  31.777  177.579 1.00 26.89  ?  46   TYR F CA    1 
ATOM   359  C  C     . TYR A 1 47  ? 80.661  33.206  177.480 1.00 30.11  ?  46   TYR F C     1 
ATOM   360  O  O     . TYR A 1 47  ? 80.751  33.733  176.365 1.00 29.21  ?  46   TYR F O     1 
ATOM   361  C  CB    . TYR A 1 47  ? 78.622  31.755  177.870 1.00 25.49  ?  46   TYR F CB    1 
ATOM   362  C  CG    . TYR A 1 47  ? 78.005  30.513  177.250 1.00 25.80  ?  46   TYR F CG    1 
ATOM   363  C  CD1   . TYR A 1 47  ? 77.811  30.432  175.877 1.00 30.05  ?  46   TYR F CD1   1 
ATOM   364  C  CD2   . TYR A 1 47  ? 77.701  29.403  178.018 1.00 29.15  ?  46   TYR F CD2   1 
ATOM   365  C  CE1   . TYR A 1 47  ? 77.307  29.293  175.289 1.00 29.60  ?  46   TYR F CE1   1 
ATOM   366  C  CE2   . TYR A 1 47  ? 77.187  28.267  177.442 1.00 28.91  ?  46   TYR F CE2   1 
ATOM   367  C  CZ    . TYR A 1 47  ? 76.988  28.219  176.075 1.00 28.48  ?  46   TYR F CZ    1 
ATOM   368  O  OH    . TYR A 1 47  ? 76.469  27.077  175.504 1.00 29.57  ?  46   TYR F OH    1 
ATOM   369  N  N     . PRO A 1 48  ? 81.046  33.863  178.580 1.00 30.69  ?  47   PRO F N     1 
ATOM   370  C  CA    . PRO A 1 48  ? 81.679  35.188  178.429 1.00 35.28  ?  47   PRO F CA    1 
ATOM   371  C  C     . PRO A 1 48  ? 82.888  35.190  177.501 1.00 36.24  ?  47   PRO F C     1 
ATOM   372  O  O     . PRO A 1 48  ? 83.073  36.156  176.760 1.00 33.48  ?  47   PRO F O     1 
ATOM   373  C  CB    . PRO A 1 48  ? 82.058  35.547  179.868 1.00 34.91  ?  47   PRO F CB    1 
ATOM   374  C  CG    . PRO A 1 48  ? 80.992  34.919  180.675 1.00 34.49  ?  47   PRO F CG    1 
ATOM   375  C  CD    . PRO A 1 48  ? 80.746  33.582  179.998 1.00 32.24  ?  47   PRO F CD    1 
ATOM   376  N  N     . ALA A 1 49  ? 83.695  34.118  177.487 1.00 33.62  ?  48   ALA F N     1 
ATOM   377  C  CA    . ALA A 1 49  ? 84.807  34.030  176.543 1.00 29.86  ?  48   ALA F CA    1 
ATOM   378  C  C     . ALA A 1 49  ? 84.339  33.646  175.142 1.00 27.88  ?  48   ALA F C     1 
ATOM   379  O  O     . ALA A 1 49  ? 84.898  34.131  174.149 1.00 28.18  ?  48   ALA F O     1 
ATOM   380  C  CB    . ALA A 1 49  ? 85.849  33.011  177.036 1.00 27.69  ?  48   ALA F CB    1 
ATOM   381  N  N     . ARG A 1 50  ? 83.360  32.735  175.045 1.00 29.48  ?  49   ARG F N     1 
ATOM   382  C  CA    . ARG A 1 50  ? 82.843  32.329  173.739 1.00 25.06  ?  49   ARG F CA    1 
ATOM   383  C  C     . ARG A 1 50  ? 82.246  33.508  172.980 1.00 26.75  ?  49   ARG F C     1 
ATOM   384  O  O     . ARG A 1 50  ? 82.238  33.512  171.746 1.00 25.98  ?  49   ARG F O     1 
ATOM   385  C  CB    . ARG A 1 50  ? 81.779  31.243  173.897 1.00 26.93  ?  49   ARG F CB    1 
ATOM   386  C  CG    . ARG A 1 50  ? 82.362  29.903  174.305 1.00 23.00  ?  49   ARG F CG    1 
ATOM   387  C  CD    . ARG A 1 50  ? 81.279  28.860  174.520 1.00 21.72  ?  49   ARG F CD    1 
ATOM   388  N  NE    . ARG A 1 50  ? 81.908  27.685  175.109 1.00 24.33  ?  49   ARG F NE    1 
ATOM   389  C  CZ    . ARG A 1 50  ? 81.384  26.465  175.132 1.00 35.80  ?  49   ARG F CZ    1 
ATOM   390  N  NH1   . ARG A 1 50  ? 80.189  26.220  174.595 1.00 39.51  ?  49   ARG F NH1   1 
ATOM   391  N  NH2   . ARG A 1 50  ? 82.061  25.491  175.720 1.00 34.72  ?  49   ARG F NH2   1 
ATOM   392  N  N     . LYS A 1 51  ? 81.732  34.504  173.699 1.00 30.15  ?  50   LYS F N     1 
ATOM   393  C  CA    . LYS A 1 51  ? 81.217  35.707  173.049 1.00 32.06  ?  50   LYS F CA    1 
ATOM   394  C  C     . LYS A 1 51  ? 82.271  36.381  172.171 1.00 32.97  ?  50   LYS F C     1 
ATOM   395  O  O     . LYS A 1 51  ? 81.941  36.959  171.127 1.00 28.90  ?  50   LYS F O     1 
ATOM   396  C  CB    . LYS A 1 51  ? 80.713  36.675  174.118 1.00 34.96  ?  50   LYS F CB    1 
ATOM   397  C  CG    . LYS A 1 51  ? 80.120  37.952  173.586 1.00 38.40  ?  50   LYS F CG    1 
ATOM   398  C  CD    . LYS A 1 51  ? 79.659  38.839  174.737 1.00 33.27  ?  50   LYS F CD    1 
ATOM   399  C  CE    . LYS A 1 51  ? 80.812  39.235  175.645 1.00 42.35  ?  50   LYS F CE    1 
ATOM   400  N  NZ    . LYS A 1 51  ? 80.342  40.251  176.628 1.00 44.38  ?  50   LYS F NZ    1 
ATOM   401  N  N     . PHE A 1 52  ? 83.538  36.317  172.573 1.00 29.51  ?  51   PHE F N     1 
ATOM   402  C  CA    . PHE A 1 52  ? 84.627  36.894  171.792 1.00 32.41  ?  51   PHE F CA    1 
ATOM   403  C  C     . PHE A 1 52  ? 85.086  35.984  170.665 1.00 37.05  ?  51   PHE F C     1 
ATOM   404  O  O     . PHE A 1 52  ? 85.969  36.379  169.898 1.00 30.84  ?  51   PHE F O     1 
ATOM   405  C  CB    . PHE A 1 52  ? 85.835  37.207  172.683 1.00 31.31  ?  51   PHE F CB    1 
ATOM   406  C  CG    . PHE A 1 52  ? 85.578  38.258  173.715 1.00 32.15  ?  51   PHE F CG    1 
ATOM   407  C  CD1   . PHE A 1 52  ? 84.915  37.945  174.892 1.00 32.55  ?  51   PHE F CD1   1 
ATOM   408  C  CD2   . PHE A 1 52  ? 86.025  39.569  173.523 1.00 31.25  ?  51   PHE F CD2   1 
ATOM   409  C  CE1   . PHE A 1 52  ? 84.687  38.910  175.851 1.00 31.08  ?  51   PHE F CE1   1 
ATOM   410  C  CE2   . PHE A 1 52  ? 85.796  40.530  174.477 1.00 36.46  ?  51   PHE F CE2   1 
ATOM   411  C  CZ    . PHE A 1 52  ? 85.122  40.205  175.642 1.00 32.35  ?  51   PHE F CZ    1 
ATOM   412  N  N     . GLY A 1 53  ? 84.538  34.775  170.564 1.00 35.08  ?  52   GLY F N     1 
ATOM   413  C  CA    . GLY A 1 53  ? 84.953  33.833  169.551 1.00 27.52  ?  52   GLY F CA    1 
ATOM   414  C  C     . GLY A 1 53  ? 85.865  32.726  170.051 1.00 28.73  ?  52   GLY F C     1 
ATOM   415  O  O     . GLY A 1 53  ? 86.295  31.891  169.246 1.00 32.77  ?  52   GLY F O     1 
ATOM   416  N  N     . VAL A 1 54  ? 86.179  32.697  171.348 1.00 25.26  ?  53   VAL F N     1 
ATOM   417  C  CA    . VAL A 1 54  ? 87.058  31.669  171.887 1.00 23.93  ?  53   VAL F CA    1 
ATOM   418  C  C     . VAL A 1 54  ? 86.330  30.335  171.818 1.00 29.85  ?  53   VAL F C     1 
ATOM   419  O  O     . VAL A 1 54  ? 85.149  30.245  172.173 1.00 28.49  ?  53   VAL F O     1 
ATOM   420  C  CB    . VAL A 1 54  ? 87.480  31.999  173.329 1.00 26.94  ?  53   VAL F CB    1 
ATOM   421  C  CG1   . VAL A 1 54  ? 88.354  30.878  173.896 1.00 25.80  ?  53   VAL F CG1   1 
ATOM   422  C  CG2   . VAL A 1 54  ? 88.240  33.327  173.396 1.00 29.77  ?  53   VAL F CG2   1 
ATOM   423  N  N     . ARG A 1 55  ? 87.027  29.301  171.343 1.00 26.31  ?  54   ARG F N     1 
ATOM   424  C  CA    . ARG A 1 55  ? 86.424  27.998  171.068 1.00 28.15  ?  54   ARG F CA    1 
ATOM   425  C  C     . ARG A 1 55  ? 87.405  26.910  171.495 1.00 24.23  ?  54   ARG F C     1 
ATOM   426  O  O     . ARG A 1 55  ? 88.610  27.147  171.564 1.00 25.62  ?  54   ARG F O     1 
ATOM   427  C  CB    . ARG A 1 55  ? 86.112  27.813  169.572 1.00 24.81  ?  54   ARG F CB    1 
ATOM   428  C  CG    . ARG A 1 55  ? 85.067  28.738  168.964 1.00 35.11  ?  54   ARG F CG    1 
ATOM   429  C  CD    . ARG A 1 55  ? 83.692  28.490  169.556 1.00 46.17  ?  54   ARG F CD    1 
ATOM   430  N  NE    . ARG A 1 55  ? 82.663  29.338  168.953 1.00 47.40  ?  54   ARG F NE    1 
ATOM   431  C  CZ    . ARG A 1 55  ? 82.361  30.562  169.380 1.00 48.90  ?  54   ARG F CZ    1 
ATOM   432  N  NH1   . ARG A 1 55  ? 83.010  31.075  170.417 1.00 29.38  ?  54   ARG F NH1   1 
ATOM   433  N  NH2   . ARG A 1 55  ? 81.405  31.264  168.783 1.00 49.63  ?  54   ARG F NH2   1 
ATOM   434  N  N     . SER A 1 56  ? 86.891  25.696  171.750 1.00 23.24  ?  55   SER F N     1 
ATOM   435  C  CA    . SER A 1 56  ? 87.786  24.552  171.934 1.00 18.63  ?  55   SER F CA    1 
ATOM   436  C  C     . SER A 1 56  ? 88.631  24.342  170.684 1.00 21.11  ?  55   SER F C     1 
ATOM   437  O  O     . SER A 1 56  ? 88.184  24.608  169.555 1.00 22.72  ?  55   SER F O     1 
ATOM   438  C  CB    . SER A 1 56  ? 87.000  23.253  172.217 1.00 22.43  ?  55   SER F CB    1 
ATOM   439  O  OG    . SER A 1 56  ? 86.116  23.386  173.309 1.00 24.88  ?  55   SER F OG    1 
ATOM   440  N  N     . ALA A 1 57  ? 89.862  23.873  170.901 1.00 23.03  ?  56   ALA F N     1 
ATOM   441  C  CA    . ALA A 1 57  ? 90.904  23.565  169.921 1.00 26.80  ?  56   ALA F CA    1 
ATOM   442  C  C     . ALA A 1 57  ? 91.520  24.816  169.309 1.00 29.00  ?  56   ALA F C     1 
ATOM   443  O  O     . ALA A 1 57  ? 92.385  24.696  168.428 1.00 31.91  ?  56   ALA F O     1 
ATOM   444  C  CB    . ALA A 1 57  ? 90.414  22.653  168.787 1.00 28.48  ?  56   ALA F CB    1 
ATOM   445  N  N     . MET A 1 58  ? 91.116  26.003  169.739 1.00 22.37  ?  57   MET F N     1 
ATOM   446  C  CA    . MET A 1 58  ? 91.716  27.231  169.256 1.00 25.06  ?  57   MET F CA    1 
ATOM   447  C  C     . MET A 1 58  ? 93.076  27.425  169.914 1.00 27.47  ?  57   MET F C     1 
ATOM   448  O  O     . MET A 1 58  ? 93.180  27.324  171.141 1.00 29.77  ?  57   MET F O     1 
ATOM   449  C  CB    . MET A 1 58  ? 90.815  28.417  169.558 1.00 25.66  ?  57   MET F CB    1 
ATOM   450  C  CG    . MET A 1 58  ? 91.436  29.792  169.278 1.00 30.71  ?  57   MET F CG    1 
ATOM   451  S  SD    . MET A 1 58  ? 90.203  31.102  169.499 1.00 32.01  ?  57   MET F SD    1 
ATOM   452  C  CE    . MET A 1 58  ? 89.094  30.760  168.134 1.00 32.89  ?  57   MET F CE    1 
ATOM   453  N  N     . PRO A 1 59  ? 94.124  27.706  169.142 1.00 27.83  ?  58   PRO F N     1 
ATOM   454  C  CA    . PRO A 1 59  ? 95.421  28.031  169.746 1.00 27.38  ?  58   PRO F CA    1 
ATOM   455  C  C     . PRO A 1 59  ? 95.263  29.192  170.710 1.00 25.16  ?  58   PRO F C     1 
ATOM   456  O  O     . PRO A 1 59  ? 94.516  30.139  170.453 1.00 30.40  ?  58   PRO F O     1 
ATOM   457  C  CB    . PRO A 1 59  ? 96.291  28.411  168.544 1.00 32.52  ?  58   PRO F CB    1 
ATOM   458  C  CG    . PRO A 1 59  ? 95.676  27.662  167.402 1.00 34.38  ?  58   PRO F CG    1 
ATOM   459  C  CD    . PRO A 1 59  ? 94.186  27.656  167.674 1.00 30.29  ?  58   PRO F CD    1 
ATOM   460  N  N     . THR A 1 60  ? 95.941  29.082  171.852 1.00 29.37  ?  59   THR F N     1 
ATOM   461  C  CA    . THR A 1 60  ? 95.734  30.059  172.910 1.00 33.51  ?  59   THR F CA    1 
ATOM   462  C  C     . THR A 1 60  ? 96.137  31.460  172.454 1.00 33.50  ?  59   THR F C     1 
ATOM   463  O  O     . THR A 1 60  ? 95.469  32.446  172.800 1.00 35.44  ?  59   THR F O     1 
ATOM   464  C  CB    . THR A 1 60  ? 96.487  29.601  174.163 1.00 32.16  ?  59   THR F CB    1 
ATOM   465  O  OG1   . THR A 1 60  ? 95.921  28.358  174.603 1.00 31.39  ?  59   THR F OG1   1 
ATOM   466  C  CG2   . THR A 1 60  ? 96.362  30.615  175.280 1.00 32.78  ?  59   THR F CG2   1 
ATOM   467  N  N     . GLY A 1 61  ? 97.184  31.565  171.630 1.00 33.91  ?  60   GLY F N     1 
ATOM   468  C  CA    . GLY A 1 61  ? 97.556  32.865  171.089 1.00 32.39  ?  60   GLY F CA    1 
ATOM   469  C  C     . GLY A 1 61  ? 96.442  33.518  170.294 1.00 37.12  ?  60   GLY F C     1 
ATOM   470  O  O     . GLY A 1 61  ? 96.309  34.745  170.294 1.00 37.67  ?  60   GLY F O     1 
ATOM   471  N  N     . MET A 1 62  ? 95.626  32.714  169.610 1.00 32.72  ?  61   MET F N     1 
ATOM   472  C  CA    . MET A 1 62  ? 94.473  33.263  168.901 1.00 33.11  ?  61   MET F CA    1 
ATOM   473  C  C     . MET A 1 62  ? 93.366  33.675  169.866 1.00 35.97  ?  61   MET F C     1 
ATOM   474  O  O     . MET A 1 62  ? 92.742  34.734  169.694 1.00 33.51  ?  61   MET F O     1 
ATOM   475  C  CB    . MET A 1 62  ? 93.936  32.246  167.903 1.00 32.20  ?  61   MET F CB    1 
ATOM   476  C  CG    . MET A 1 62  ? 92.956  32.861  166.939 1.00 41.55  ?  61   MET F CG    1 
ATOM   477  S  SD    . MET A 1 62  ? 92.028  31.663  166.000 1.00 50.55  ?  61   MET F SD    1 
ATOM   478  C  CE    . MET A 1 62  ? 93.199  30.354  165.737 1.00 64.88  ?  61   MET F CE    1 
ATOM   479  N  N     . ALA A 1 63  ? 93.104  32.845  170.876 1.00 32.53  ?  62   ALA F N     1 
ATOM   480  C  CA    . ALA A 1 63  ? 92.062  33.157  171.848 1.00 34.05  ?  62   ALA F CA    1 
ATOM   481  C  C     . ALA A 1 63  ? 92.369  34.463  172.577 1.00 36.97  ?  62   ALA F C     1 
ATOM   482  O  O     . ALA A 1 63  ? 91.466  35.262  172.856 1.00 34.53  ?  62   ALA F O     1 
ATOM   483  C  CB    . ALA A 1 63  ? 91.910  31.996  172.840 1.00 27.34  ?  62   ALA F CB    1 
ATOM   484  N  N     . LEU A 1 64  ? 93.642  34.696  172.889 1.00 34.20  ?  63   LEU F N     1 
ATOM   485  C  CA    . LEU A 1 64  ? 94.023  35.912  173.597 1.00 33.44  ?  63   LEU F CA    1 
ATOM   486  C  C     . LEU A 1 64  ? 93.997  37.127  172.679 1.00 38.69  ?  63   LEU F C     1 
ATOM   487  O  O     . LEU A 1 64  ? 93.806  38.255  173.148 1.00 37.07  ?  63   LEU F O     1 
ATOM   488  C  CB    . LEU A 1 64  ? 95.409  35.737  174.220 1.00 36.56  ?  63   LEU F CB    1 
ATOM   489  C  CG    . LEU A 1 64  ? 95.461  34.964  175.544 1.00 37.62  ?  63   LEU F CG    1 
ATOM   490  C  CD1   . LEU A 1 64  ? 96.893  34.601  175.847 1.00 42.98  ?  63   LEU F CD1   1 
ATOM   491  C  CD2   . LEU A 1 64  ? 94.877  35.790  176.678 1.00 41.92  ?  63   LEU F CD2   1 
ATOM   492  N  N     . LYS A 1 65  ? 94.201  36.926  171.376 1.00 39.77  ?  64   LYS F N     1 
ATOM   493  C  CA    . LYS A 1 65  ? 94.034  38.037  170.445 1.00 39.41  ?  64   LYS F CA    1 
ATOM   494  C  C     . LYS A 1 65  ? 92.561  38.403  170.296 1.00 41.89  ?  64   LYS F C     1 
ATOM   495  O  O     . LYS A 1 65  ? 92.221  39.584  170.167 1.00 38.59  ?  64   LYS F O     1 
ATOM   496  C  CB    . LYS A 1 65  ? 94.646  37.689  169.090 1.00 48.87  ?  64   LYS F CB    1 
ATOM   497  N  N     . LEU A 1 66  ? 91.673  37.405  170.307 1.00 33.95  ?  65   LEU F N     1 
ATOM   498  C  CA    . LEU A 1 66  ? 90.241  37.685  170.272 1.00 31.73  ?  65   LEU F CA    1 
ATOM   499  C  C     . LEU A 1 66  ? 89.745  38.225  171.603 1.00 33.18  ?  65   LEU F C     1 
ATOM   500  O  O     . LEU A 1 66  ? 88.831  39.059  171.633 1.00 37.76  ?  65   LEU F O     1 
ATOM   501  C  CB    . LEU A 1 66  ? 89.464  36.421  169.901 1.00 33.99  ?  65   LEU F CB    1 
ATOM   502  C  CG    . LEU A 1 66  ? 89.669  35.907  168.480 1.00 34.26  ?  65   LEU F CG    1 
ATOM   503  C  CD1   . LEU A 1 66  ? 89.149  34.481  168.332 1.00 30.59  ?  65   LEU F CD1   1 
ATOM   504  C  CD2   . LEU A 1 66  ? 88.973  36.830  167.489 1.00 34.85  ?  65   LEU F CD2   1 
ATOM   505  N  N     . CYS A 1 67  ? 90.347  37.791  172.703 1.00 38.46  ?  66   CYS F N     1 
ATOM   506  C  CA    . CYS A 1 67  ? 89.849  38.086  174.047 1.00 30.89  ?  66   CYS F CA    1 
ATOM   507  C  C     . CYS A 1 67  ? 91.033  38.411  174.946 1.00 31.32  ?  66   CYS F C     1 
ATOM   508  O  O     . CYS A 1 67  ? 91.550  37.550  175.670 1.00 33.51  ?  66   CYS F O     1 
ATOM   509  C  CB    . CYS A 1 67  ? 89.027  36.909  174.572 1.00 32.79  ?  66   CYS F CB    1 
ATOM   510  S  SG    . CYS A 1 67  ? 88.362  37.099  176.216 1.00 38.01  ?  66   CYS F SG    1 
ATOM   511  N  N     . PRO A 1 68  ? 91.500  39.664  174.923 1.00 35.13  ?  67   PRO F N     1 
ATOM   512  C  CA    . PRO A 1 68  ? 92.733  39.999  175.656 1.00 38.45  ?  67   PRO F CA    1 
ATOM   513  C  C     . PRO A 1 68  ? 92.640  39.778  177.151 1.00 38.35  ?  67   PRO F C     1 
ATOM   514  O  O     . PRO A 1 68  ? 93.666  39.518  177.789 1.00 37.95  ?  67   PRO F O     1 
ATOM   515  C  CB    . PRO A 1 68  ? 92.944  41.485  175.323 1.00 39.88  ?  67   PRO F CB    1 
ATOM   516  C  CG    . PRO A 1 68  ? 92.221  41.688  174.048 1.00 43.31  ?  67   PRO F CG    1 
ATOM   517  C  CD    . PRO A 1 68  ? 91.025  40.787  174.101 1.00 43.41  ?  67   PRO F CD    1 
ATOM   518  N  N     . HIS A 1 69  ? 91.452  39.876  177.736 1.00 38.62  ?  68   HIS F N     1 
ATOM   519  C  CA    . HIS A 1 69  ? 91.284  39.690  179.170 1.00 37.98  ?  68   HIS F CA    1 
ATOM   520  C  C     . HIS A 1 69  ? 91.054  38.242  179.561 1.00 34.77  ?  68   HIS F C     1 
ATOM   521  O  O     . HIS A 1 69  ? 90.761  37.983  180.732 1.00 40.57  ?  68   HIS F O     1 
ATOM   522  C  CB    . HIS A 1 69  ? 90.117  40.521  179.687 1.00 40.69  ?  68   HIS F CB    1 
ATOM   523  C  CG    . HIS A 1 69  ? 90.382  41.990  179.699 1.00 45.63  ?  68   HIS F CG    1 
ATOM   524  N  ND1   . HIS A 1 69  ? 90.188  42.785  178.591 1.00 47.72  ?  68   HIS F ND1   1 
ATOM   525  C  CD2   . HIS A 1 69  ? 90.826  42.807  180.682 1.00 51.87  ?  68   HIS F CD2   1 
ATOM   526  C  CE1   . HIS A 1 69  ? 90.495  44.033  178.895 1.00 52.72  ?  68   HIS F CE1   1 
ATOM   527  N  NE2   . HIS A 1 69  ? 90.887  44.074  180.155 1.00 60.02  ?  68   HIS F NE2   1 
ATOM   528  N  N     . LEU A 1 70  ? 91.161  37.306  178.613 1.00 34.53  ?  69   LEU F N     1 
ATOM   529  C  CA    . LEU A 1 70  ? 90.928  35.893  178.898 1.00 35.15  ?  69   LEU F CA    1 
ATOM   530  C  C     . LEU A 1 70  ? 91.742  35.430  180.100 1.00 36.96  ?  69   LEU F C     1 
ATOM   531  O  O     . LEU A 1 70  ? 92.953  35.651  180.164 1.00 35.18  ?  69   LEU F O     1 
ATOM   532  C  CB    . LEU A 1 70  ? 91.293  35.051  177.673 1.00 30.66  ?  69   LEU F CB    1 
ATOM   533  C  CG    . LEU A 1 70  ? 90.930  33.562  177.736 1.00 28.95  ?  69   LEU F CG    1 
ATOM   534  C  CD1   . LEU A 1 70  ? 89.402  33.367  177.780 1.00 36.36  ?  69   LEU F CD1   1 
ATOM   535  C  CD2   . LEU A 1 70  ? 91.538  32.788  176.575 1.00 31.71  ?  69   LEU F CD2   1 
ATOM   536  N  N     . THR A 1 71  ? 91.065  34.811  181.065 1.00 34.72  ?  70   THR F N     1 
ATOM   537  C  CA    . THR A 1 71  ? 91.726  34.184  182.203 1.00 41.05  ?  70   THR F CA    1 
ATOM   538  C  C     . THR A 1 71  ? 91.942  32.709  181.898 1.00 39.89  ?  70   THR F C     1 
ATOM   539  O  O     . THR A 1 71  ? 90.981  31.969  181.653 1.00 34.82  ?  70   THR F O     1 
ATOM   540  C  CB    . THR A 1 71  ? 90.910  34.341  183.481 1.00 44.61  ?  70   THR F CB    1 
ATOM   541  O  OG1   . THR A 1 71  ? 90.938  35.711  183.894 1.00 40.17  ?  70   THR F OG1   1 
ATOM   542  C  CG2   . THR A 1 71  ? 91.498  33.474  184.589 1.00 39.64  ?  70   THR F CG2   1 
ATOM   543  N  N     . LEU A 1 72  ? 93.195  32.280  181.928 1.00 37.34  ?  71   LEU F N     1 
ATOM   544  C  CA    . LEU A 1 72  ? 93.559  30.941  181.500 1.00 39.28  ?  71   LEU F CA    1 
ATOM   545  C  C     . LEU A 1 72  ? 93.786  30.057  182.715 1.00 37.72  ?  71   LEU F C     1 
ATOM   546  O  O     . LEU A 1 72  ? 94.473  30.461  183.657 1.00 33.52  ?  71   LEU F O     1 
ATOM   547  C  CB    . LEU A 1 72  ? 94.804  30.990  180.626 1.00 40.53  ?  71   LEU F CB    1 
ATOM   548  C  CG    . LEU A 1 72  ? 94.902  30.016  179.464 1.00 46.26  ?  71   LEU F CG    1 
ATOM   549  C  CD1   . LEU A 1 72  ? 93.681  30.107  178.545 1.00 40.31  ?  71   LEU F CD1   1 
ATOM   550  C  CD2   . LEU A 1 72  ? 96.162  30.376  178.724 1.00 56.82  ?  71   LEU F CD2   1 
ATOM   551  N  N     . LEU A 1 73  ? 93.203  28.854  182.688 1.00 36.44  ?  72   LEU F N     1 
ATOM   552  C  CA    . LEU A 1 73  ? 93.252  27.920  183.798 1.00 35.21  ?  72   LEU F CA    1 
ATOM   553  C  C     . LEU A 1 73  ? 93.913  26.623  183.363 1.00 31.80  ?  72   LEU F C     1 
ATOM   554  O  O     . LEU A 1 73  ? 93.707  26.179  182.231 1.00 32.38  ?  72   LEU F O     1 
ATOM   555  C  CB    . LEU A 1 73  ? 91.848  27.607  184.337 1.00 32.60  ?  72   LEU F CB    1 
ATOM   556  C  CG    . LEU A 1 73  ? 91.254  28.577  185.366 1.00 51.63  ?  72   LEU F CG    1 
ATOM   557  C  CD1   . LEU A 1 73  ? 91.144  29.969  184.822 1.00 51.71  ?  72   LEU F CD1   1 
ATOM   558  C  CD2   . LEU A 1 73  ? 89.889  28.106  185.803 1.00 60.67  ?  72   LEU F CD2   1 
ATOM   559  N  N     . PRO A 1 74  ? 94.694  25.982  184.242 1.00 30.30  ?  73   PRO F N     1 
ATOM   560  C  CA    . PRO A 1 74  ? 95.414  24.769  183.833 1.00 30.13  ?  73   PRO F CA    1 
ATOM   561  C  C     . PRO A 1 74  ? 94.581  23.498  183.847 1.00 35.88  ?  73   PRO F C     1 
ATOM   562  O  O     . PRO A 1 74  ? 95.019  22.493  183.267 1.00 39.38  ?  73   PRO F O     1 
ATOM   563  C  CB    . PRO A 1 74  ? 96.544  24.675  184.865 1.00 34.38  ?  73   PRO F CB    1 
ATOM   564  C  CG    . PRO A 1 74  ? 95.927  25.261  186.100 1.00 31.15  ?  73   PRO F CG    1 
ATOM   565  C  CD    . PRO A 1 74  ? 95.109  26.442  185.581 1.00 34.84  ?  73   PRO F CD    1 
ATOM   566  N  N     . GLY A 1 75  ? 93.430  23.481  184.505 1.00 28.74  ?  74   GLY F N     1 
ATOM   567  C  CA    . GLY A 1 75  ? 92.657  22.249  184.532 1.00 38.70  ?  74   GLY F CA    1 
ATOM   568  C  C     . GLY A 1 75  ? 92.898  21.403  185.767 1.00 31.74  ?  74   GLY F C     1 
ATOM   569  O  O     . GLY A 1 75  ? 94.041  21.239  186.207 1.00 35.76  ?  74   GLY F O     1 
ATOM   570  N  N     . ARG A 1 76  ? 91.819  20.877  186.346 1.00 28.30  ?  75   ARG F N     1 
ATOM   571  C  CA    . ARG A 1 76  ? 91.868  20.047  187.554 1.00 25.74  ?  75   ARG F CA    1 
ATOM   572  C  C     . ARG A 1 76  ? 91.145  18.744  187.229 1.00 29.09  ?  75   ARG F C     1 
ATOM   573  O  O     . ARG A 1 76  ? 89.938  18.605  187.454 1.00 30.34  ?  75   ARG F O     1 
ATOM   574  C  CB    . ARG A 1 76  ? 91.245  20.770  188.737 1.00 25.67  ?  75   ARG F CB    1 
ATOM   575  C  CG    . ARG A 1 76  ? 92.037  21.983  189.186 1.00 30.16  ?  75   ARG F CG    1 
ATOM   576  C  CD    . ARG A 1 76  ? 91.398  22.627  190.384 1.00 32.46  ?  75   ARG F CD    1 
ATOM   577  N  NE    . ARG A 1 76  ? 90.035  23.045  190.092 1.00 33.95  ?  75   ARG F NE    1 
ATOM   578  C  CZ    . ARG A 1 76  ? 88.967  22.595  190.736 1.00 43.36  ?  75   ARG F CZ    1 
ATOM   579  N  NH1   . ARG A 1 76  ? 89.110  21.721  191.724 1.00 46.34  ?  75   ARG F NH1   1 
ATOM   580  N  NH2   . ARG A 1 76  ? 87.759  23.026  190.401 1.00 42.07  ?  75   ARG F NH2   1 
ATOM   581  N  N     . PHE A 1 77  ? 91.888  17.769  186.701 1.00 26.28  ?  76   PHE F N     1 
ATOM   582  C  CA    . PHE A 1 77  ? 91.220  16.635  186.073 1.00 27.46  ?  76   PHE F CA    1 
ATOM   583  C  C     . PHE A 1 77  ? 90.554  15.706  187.078 1.00 25.48  ?  76   PHE F C     1 
ATOM   584  O  O     . PHE A 1 77  ? 89.544  15.086  186.739 1.00 27.91  ?  76   PHE F O     1 
ATOM   585  C  CB    . PHE A 1 77  ? 92.197  15.887  185.163 1.00 24.62  ?  76   PHE F CB    1 
ATOM   586  C  CG    . PHE A 1 77  ? 92.391  16.578  183.838 1.00 29.90  ?  76   PHE F CG    1 
ATOM   587  C  CD1   . PHE A 1 77  ? 91.468  16.403  182.814 1.00 31.95  ?  76   PHE F CD1   1 
ATOM   588  C  CD2   . PHE A 1 77  ? 93.453  17.453  183.638 1.00 33.63  ?  76   PHE F CD2   1 
ATOM   589  C  CE1   . PHE A 1 77  ? 91.608  17.070  181.595 1.00 30.83  ?  76   PHE F CE1   1 
ATOM   590  C  CE2   . PHE A 1 77  ? 93.602  18.125  182.425 1.00 32.20  ?  76   PHE F CE2   1 
ATOM   591  C  CZ    . PHE A 1 77  ? 92.668  17.934  181.404 1.00 27.06  ?  76   PHE F CZ    1 
ATOM   592  N  N     . ASP A 1 78  ? 91.071  15.594  188.308 1.00 27.03  ?  77   ASP F N     1 
ATOM   593  C  CA    . ASP A 1 78  ? 90.346  14.802  189.298 1.00 32.76  ?  77   ASP F CA    1 
ATOM   594  C  C     . ASP A 1 78  ? 88.990  15.421  189.606 1.00 31.54  ?  77   ASP F C     1 
ATOM   595  O  O     . ASP A 1 78  ? 88.021  14.700  189.862 1.00 26.77  ?  77   ASP F O     1 
ATOM   596  C  CB    . ASP A 1 78  ? 91.171  14.626  190.577 1.00 33.78  ?  77   ASP F CB    1 
ATOM   597  C  CG    . ASP A 1 78  ? 92.171  13.486  190.472 1.00 42.99  ?  77   ASP F CG    1 
ATOM   598  O  OD1   . ASP A 1 78  ? 92.169  12.781  189.436 1.00 31.35  ?  77   ASP F OD1   1 
ATOM   599  O  OD2   . ASP A 1 78  ? 92.955  13.290  191.426 1.00 44.83  ?  77   ASP F OD2   1 
ATOM   600  N  N     . ALA A 1 79  ? 88.894  16.755  189.578 1.00 28.56  ?  78   ALA F N     1 
ATOM   601  C  CA    . ALA A 1 79  ? 87.600  17.408  189.773 1.00 25.98  ?  78   ALA F CA    1 
ATOM   602  C  C     . ALA A 1 79  ? 86.629  17.059  188.650 1.00 24.07  ?  78   ALA F C     1 
ATOM   603  O  O     . ALA A 1 79  ? 85.437  16.835  188.892 1.00 27.77  ?  78   ALA F O     1 
ATOM   604  C  CB    . ALA A 1 79  ? 87.779  18.926  189.866 1.00 29.59  ?  78   ALA F CB    1 
ATOM   605  N  N     . TYR A 1 80  ? 87.113  17.011  187.411 1.00 26.56  ?  79   TYR F N     1 
ATOM   606  C  CA    . TYR A 1 80  ? 86.224  16.657  186.310 1.00 23.60  ?  79   TYR F CA    1 
ATOM   607  C  C     . TYR A 1 80  ? 85.848  15.186  186.374 1.00 24.87  ?  79   TYR F C     1 
ATOM   608  O  O     . TYR A 1 80  ? 84.693  14.821  186.122 1.00 26.14  ?  79   TYR F O     1 
ATOM   609  C  CB    . TYR A 1 80  ? 86.881  16.968  184.969 1.00 22.18  ?  79   TYR F CB    1 
ATOM   610  C  CG    . TYR A 1 80  ? 87.540  18.324  184.913 1.00 25.00  ?  79   TYR F CG    1 
ATOM   611  C  CD1   . TYR A 1 80  ? 87.012  19.419  185.608 1.00 24.88  ?  79   TYR F CD1   1 
ATOM   612  C  CD2   . TYR A 1 80  ? 88.678  18.521  184.140 1.00 26.67  ?  79   TYR F CD2   1 
ATOM   613  C  CE1   . TYR A 1 80  ? 87.631  20.660  185.551 1.00 19.46  ?  79   TYR F CE1   1 
ATOM   614  C  CE2   . TYR A 1 80  ? 89.295  19.762  184.073 1.00 25.50  ?  79   TYR F CE2   1 
ATOM   615  C  CZ    . TYR A 1 80  ? 88.769  20.822  184.777 1.00 26.87  ?  79   TYR F CZ    1 
ATOM   616  O  OH    . TYR A 1 80  ? 89.406  22.044  184.698 1.00 30.38  ?  79   TYR F OH    1 
ATOM   617  N  N     . LYS A 1 81  ? 86.814  14.331  186.705 1.00 23.96  ?  80   LYS F N     1 
ATOM   618  C  CA    . LYS A 1 81  ? 86.523  12.903  186.840 1.00 23.65  ?  80   LYS F CA    1 
ATOM   619  C  C     . LYS A 1 81  ? 85.494  12.661  187.939 1.00 23.16  ?  80   LYS F C     1 
ATOM   620  O  O     . LYS A 1 81  ? 84.629  11.783  187.807 1.00 26.14  ?  80   LYS F O     1 
ATOM   621  C  CB    . LYS A 1 81  ? 87.819  12.127  187.123 1.00 27.24  ?  80   LYS F CB    1 
ATOM   622  C  CG    . LYS A 1 81  ? 87.596  10.655  187.367 1.00 35.23  ?  80   LYS F CG    1 
ATOM   623  C  CD    . LYS A 1 81  ? 88.913  9.897   187.560 1.00 48.74  ?  80   LYS F CD    1 
ATOM   624  C  CE    . LYS A 1 81  ? 89.572  10.273  188.883 1.00 59.16  ?  80   LYS F CE    1 
ATOM   625  N  NZ    . LYS A 1 81  ? 90.880  9.593   189.090 1.00 68.72  ?  80   LYS F NZ    1 
ATOM   626  N  N     . GLU A 1 82  ? 85.567  13.433  189.032 1.00 21.76  ?  81   GLU F N     1 
ATOM   627  C  CA    . GLU A 1 82  ? 84.600  13.254  190.108 1.00 27.11  ?  81   GLU F CA    1 
ATOM   628  C  C     . GLU A 1 82  ? 83.206  13.666  189.658 1.00 28.34  ?  81   GLU F C     1 
ATOM   629  O  O     . GLU A 1 82  ? 82.222  12.986  189.964 1.00 28.70  ?  81   GLU F O     1 
ATOM   630  C  CB    . GLU A 1 82  ? 85.028  14.047  191.339 1.00 33.70  ?  81   GLU F CB    1 
ATOM   631  C  CG    . GLU A 1 82  ? 83.914  14.265  192.339 1.00 43.63  ?  81   GLU F CG    1 
ATOM   632  C  CD    . GLU A 1 82  ? 84.401  14.949  193.598 1.00 67.20  ?  81   GLU F CD    1 
ATOM   633  O  OE1   . GLU A 1 82  ? 84.683  14.240  194.587 1.00 75.30  ?  81   GLU F OE1   1 
ATOM   634  O  OE2   . GLU A 1 82  ? 84.516  16.194  193.594 1.00 71.96  ?  81   GLU F OE2   1 
ATOM   635  N  N     . ALA A 1 83  ? 83.104  14.772  188.926 1.00 31.18  ?  82   ALA F N     1 
ATOM   636  C  CA    . ALA A 1 83  ? 81.822  15.150  188.351 1.00 26.64  ?  82   ALA F CA    1 
ATOM   637  C  C     . ALA A 1 83  ? 81.324  14.082  187.389 1.00 29.18  ?  82   ALA F C     1 
ATOM   638  O  O     . ALA A 1 83  ? 80.142  13.725  187.405 1.00 26.85  ?  82   ALA F O     1 
ATOM   639  C  CB    . ALA A 1 83  ? 81.948  16.499  187.642 1.00 26.98  ?  82   ALA F CB    1 
ATOM   640  N  N     . SER A 1 84  ? 82.219  13.562  186.547 1.00 26.22  ?  83   SER F N     1 
ATOM   641  C  CA    . SER A 1 84  ? 81.857  12.499  185.611 1.00 24.93  ?  83   SER F CA    1 
ATOM   642  C  C     . SER A 1 84  ? 81.308  11.279  186.338 1.00 25.30  ?  83   SER F C     1 
ATOM   643  O  O     . SER A 1 84  ? 80.252  10.749  185.969 1.00 24.78  ?  83   SER F O     1 
ATOM   644  C  CB    . SER A 1 84  ? 83.066  12.125  184.762 1.00 28.39  ?  83   SER F CB    1 
ATOM   645  O  OG    . SER A 1 84  ? 82.734  11.070  183.871 1.00 22.78  ?  83   SER F OG    1 
ATOM   646  N  N     . ASN A 1 85  ? 82.024  10.802  187.364 1.00 27.13  ?  84   ASN F N     1 
ATOM   647  C  CA    . ASN A 1 85  ? 81.532  9.659   188.129 1.00 27.05  ?  84   ASN F CA    1 
ATOM   648  C  C     . ASN A 1 85  ? 80.143  9.933   188.688 1.00 28.01  ?  84   ASN F C     1 
ATOM   649  O  O     . ASN A 1 85  ? 79.268  9.053   188.660 1.00 27.31  ?  84   ASN F O     1 
ATOM   650  C  CB    . ASN A 1 85  ? 82.502  9.309   189.259 1.00 28.84  ?  84   ASN F CB    1 
ATOM   651  C  CG    . ASN A 1 85  ? 83.820  8.740   188.754 1.00 26.75  ?  84   ASN F CG    1 
ATOM   652  O  OD1   . ASN A 1 85  ? 83.906  8.221   187.642 1.00 30.18  ?  84   ASN F OD1   1 
ATOM   653  N  ND2   . ASN A 1 85  ? 84.850  8.827   189.581 1.00 34.34  ?  84   ASN F ND2   1 
ATOM   654  N  N     . HIS A 1 86  ? 79.908  11.166  189.162 1.00 26.20  ?  85   HIS F N     1 
ATOM   655  C  CA    . HIS A 1 86  ? 78.640  11.492  189.801 1.00 27.56  ?  85   HIS F CA    1 
ATOM   656  C  C     . HIS A 1 86  ? 77.488  11.488  188.793 1.00 27.95  ?  85   HIS F C     1 
ATOM   657  O  O     . HIS A 1 86  ? 76.403  10.971  189.088 1.00 28.98  ?  85   HIS F O     1 
ATOM   658  C  CB    . HIS A 1 86  ? 78.757  12.850  190.509 1.00 26.47  ?  85   HIS F CB    1 
ATOM   659  C  CG    . HIS A 1 86  ? 77.648  13.140  191.474 1.00 34.85  ?  85   HIS F CG    1 
ATOM   660  N  ND1   . HIS A 1 86  ? 77.775  14.069  192.486 1.00 37.12  ?  85   HIS F ND1   1 
ATOM   661  C  CD2   . HIS A 1 86  ? 76.395  12.636  191.580 1.00 35.95  ?  85   HIS F CD2   1 
ATOM   662  C  CE1   . HIS A 1 86  ? 76.648  14.122  193.175 1.00 38.38  ?  85   HIS F CE1   1 
ATOM   663  N  NE2   . HIS A 1 86  ? 75.795  13.262  192.645 1.00 35.88  ?  85   HIS F NE2   1 
ATOM   664  N  N     . ILE A 1 87  ? 77.696  12.039  187.594 1.00 25.66  ?  86   ILE F N     1 
ATOM   665  C  CA    . ILE A 1 87  ? 76.579  12.051  186.650 1.00 26.72  ?  86   ILE F CA    1 
ATOM   666  C  C     . ILE A 1 87  ? 76.313  10.652  186.116 1.00 26.49  ?  86   ILE F C     1 
ATOM   667  O  O     . ILE A 1 87  ? 75.165  10.312  185.813 1.00 27.50  ?  86   ILE F O     1 
ATOM   668  C  CB    . ILE A 1 87  ? 76.782  13.065  185.502 1.00 26.64  ?  86   ILE F CB    1 
ATOM   669  C  CG1   . ILE A 1 87  ? 77.857  12.643  184.501 1.00 29.21  ?  86   ILE F CG1   1 
ATOM   670  C  CG2   . ILE A 1 87  ? 77.073  14.446  186.070 1.00 21.11  ?  86   ILE F CG2   1 
ATOM   671  C  CD1   . ILE A 1 87  ? 78.040  13.687  183.371 1.00 25.95  ?  86   ILE F CD1   1 
ATOM   672  N  N     . ARG A 1 88  ? 77.349  9.816   186.003 1.00 27.34  ?  87   ARG F N     1 
ATOM   673  C  CA    . ARG A 1 88  ? 77.120  8.447   185.561 1.00 27.75  ?  87   ARG F CA    1 
ATOM   674  C  C     . ARG A 1 88  ? 76.372  7.650   186.617 1.00 28.18  ?  87   ARG F C     1 
ATOM   675  O  O     . ARG A 1 88  ? 75.587  6.756   186.280 1.00 26.95  ?  87   ARG F O     1 
ATOM   676  C  CB    . ARG A 1 88  ? 78.452  7.771   185.211 1.00 20.28  ?  87   ARG F CB    1 
ATOM   677  C  CG    . ARG A 1 88  ? 79.107  8.367   183.965 1.00 20.35  ?  87   ARG F CG    1 
ATOM   678  C  CD    . ARG A 1 88  ? 80.481  7.770   183.700 1.00 27.26  ?  87   ARG F CD    1 
ATOM   679  N  NE    . ARG A 1 88  ? 81.141  8.454   182.590 1.00 24.51  ?  87   ARG F NE    1 
ATOM   680  C  CZ    . ARG A 1 88  ? 82.369  8.180   182.152 1.00 24.59  ?  87   ARG F CZ    1 
ATOM   681  N  NH1   . ARG A 1 88  ? 83.080  7.200   182.719 1.00 24.40  ?  87   ARG F NH1   1 
ATOM   682  N  NH2   . ARG A 1 88  ? 82.881  8.880   181.142 1.00 22.57  ?  87   ARG F NH2   1 
ATOM   683  N  N     . GLU A 1 89  ? 76.603  7.954   187.893 1.00 26.19  ?  88   GLU F N     1 
ATOM   684  C  CA    . GLU A 1 89  ? 75.804  7.338   188.946 1.00 28.53  ?  88   GLU F CA    1 
ATOM   685  C  C     . GLU A 1 89  ? 74.361  7.829   188.886 1.00 29.59  ?  88   GLU F C     1 
ATOM   686  O  O     . GLU A 1 89  ? 73.426  7.049   189.105 1.00 33.07  ?  88   GLU F O     1 
ATOM   687  C  CB    . GLU A 1 89  ? 76.444  7.608   190.312 1.00 30.82  ?  88   GLU F CB    1 
ATOM   688  C  CG    . GLU A 1 89  ? 75.740  6.946   191.502 1.00 35.75  ?  88   GLU F CG    1 
ATOM   689  C  CD    . GLU A 1 89  ? 74.589  7.780   192.058 1.00 43.85  ?  88   GLU F CD    1 
ATOM   690  O  OE1   . GLU A 1 89  ? 73.498  7.214   192.298 1.00 48.50  ?  88   GLU F OE1   1 
ATOM   691  O  OE2   . GLU A 1 89  ? 74.775  9.006   192.244 1.00 48.68  ?  88   GLU F OE2   1 
ATOM   692  N  N     . ILE A 1 90  ? 74.153  9.104   188.549 1.00 27.13  ?  89   ILE F N     1 
ATOM   693  C  CA    . ILE A 1 90  ? 72.790  9.604   188.383 1.00 32.06  ?  89   ILE F CA    1 
ATOM   694  C  C     . ILE A 1 90  ? 72.107  8.931   187.195 1.00 31.12  ?  89   ILE F C     1 
ATOM   695  O  O     . ILE A 1 90  ? 70.916  8.605   187.257 1.00 32.89  ?  89   ILE F O     1 
ATOM   696  C  CB    . ILE A 1 90  ? 72.795  11.137  188.248 1.00 29.77  ?  89   ILE F CB    1 
ATOM   697  C  CG1   . ILE A 1 90  ? 73.162  11.785  189.580 1.00 27.56  ?  89   ILE F CG1   1 
ATOM   698  C  CG2   . ILE A 1 90  ? 71.442  11.651  187.802 1.00 28.97  ?  89   ILE F CG2   1 
ATOM   699  C  CD1   . ILE A 1 90  ? 73.475  13.263  189.463 1.00 33.56  ?  89   ILE F CD1   1 
ATOM   700  N  N     . PHE A 1 91  ? 72.835  8.726   186.090 1.00 26.39  ?  90   PHE F N     1 
ATOM   701  C  CA    . PHE A 1 91  ? 72.259  7.993   184.958 1.00 31.14  ?  90   PHE F CA    1 
ATOM   702  C  C     . PHE A 1 91  ? 71.797  6.604   185.386 1.00 27.10  ?  90   PHE F C     1 
ATOM   703  O  O     . PHE A 1 91  ? 70.746  6.130   184.943 1.00 30.05  ?  90   PHE F O     1 
ATOM   704  C  CB    . PHE A 1 91  ? 73.266  7.848   183.806 1.00 26.70  ?  90   PHE F CB    1 
ATOM   705  C  CG    . PHE A 1 91  ? 73.805  9.153   183.261 1.00 24.86  ?  90   PHE F CG    1 
ATOM   706  C  CD1   . PHE A 1 91  ? 73.083  10.334  183.348 1.00 20.97  ?  90   PHE F CD1   1 
ATOM   707  C  CD2   . PHE A 1 91  ? 75.047  9.174   182.632 1.00 25.51  ?  90   PHE F CD2   1 
ATOM   708  C  CE1   . PHE A 1 91  ? 73.610  11.535  182.847 1.00 26.23  ?  90   PHE F CE1   1 
ATOM   709  C  CE2   . PHE A 1 91  ? 75.579  10.365  182.127 1.00 26.65  ?  90   PHE F CE2   1 
ATOM   710  C  CZ    . PHE A 1 91  ? 74.861  11.545  182.226 1.00 25.22  ?  90   PHE F CZ    1 
ATOM   711  N  N     . SER A 1 92  ? 72.580  5.938   186.242 1.00 27.70  ?  91   SER F N     1 
ATOM   712  C  CA    . SER A 1 92  ? 72.288  4.571   186.662 1.00 27.49  ?  91   SER F CA    1 
ATOM   713  C  C     . SER A 1 92  ? 70.986  4.470   187.451 1.00 33.28  ?  91   SER F C     1 
ATOM   714  O  O     . SER A 1 92  ? 70.371  3.399   187.474 1.00 32.87  ?  91   SER F O     1 
ATOM   715  C  CB    . SER A 1 92  ? 73.452  4.013   187.488 1.00 27.92  ?  91   SER F CB    1 
ATOM   716  O  OG    . SER A 1 92  ? 73.490  4.567   188.797 1.00 33.11  ?  91   SER F OG    1 
ATOM   717  N  N     . ARG A 1 93  ? 70.544  5.561   188.075 1.00 32.48  ?  92   ARG F N     1 
ATOM   718  C  CA    . ARG A 1 93  ? 69.259  5.556   188.764 1.00 37.30  ?  92   ARG F CA    1 
ATOM   719  C  C     . ARG A 1 93  ? 68.091  5.385   187.802 1.00 36.75  ?  92   ARG F C     1 
ATOM   720  O  O     . ARG A 1 93  ? 66.995  5.016   188.237 1.00 37.08  ?  92   ARG F O     1 
ATOM   721  C  CB    . ARG A 1 93  ? 69.083  6.848   189.565 1.00 35.82  ?  92   ARG F CB    1 
ATOM   722  C  CG    . ARG A 1 93  ? 70.232  7.139   190.516 1.00 37.85  ?  92   ARG F CG    1 
ATOM   723  C  CD    . ARG A 1 93  ? 70.023  8.451   191.267 1.00 34.29  ?  92   ARG F CD    1 
ATOM   724  N  NE    . ARG A 1 93  ? 71.252  8.919   191.902 1.00 34.08  ?  92   ARG F NE    1 
ATOM   725  C  CZ    . ARG A 1 93  ? 71.402  10.139  192.412 1.00 39.27  ?  92   ARG F CZ    1 
ATOM   726  N  NH1   . ARG A 1 93  ? 70.398  10.999  192.364 1.00 38.47  ?  92   ARG F NH1   1 
ATOM   727  N  NH2   . ARG A 1 93  ? 72.554  10.507  192.962 1.00 35.66  ?  92   ARG F NH2   1 
ATOM   728  N  N     . TYR A 1 94  ? 68.294  5.645   186.510 1.00 34.51  ?  93   TYR F N     1 
ATOM   729  C  CA    . TYR A 1 94  ? 67.216  5.552   185.536 1.00 37.38  ?  93   TYR F CA    1 
ATOM   730  C  C     . TYR A 1 94  ? 67.324  4.344   184.626 1.00 39.58  ?  93   TYR F C     1 
ATOM   731  O  O     . TYR A 1 94  ? 66.293  3.798   184.224 1.00 41.10  ?  93   TYR F O     1 
ATOM   732  C  CB    . TYR A 1 94  ? 67.151  6.834   184.691 1.00 34.15  ?  93   TYR F CB    1 
ATOM   733  C  CG    . TYR A 1 94  ? 66.698  8.026   185.506 1.00 36.26  ?  93   TYR F CG    1 
ATOM   734  C  CD1   . TYR A 1 94  ? 67.614  8.788   186.226 1.00 35.32  ?  93   TYR F CD1   1 
ATOM   735  C  CD2   . TYR A 1 94  ? 65.347  8.365   185.594 1.00 35.88  ?  93   TYR F CD2   1 
ATOM   736  C  CE1   . TYR A 1 94  ? 67.203  9.871   186.990 1.00 38.82  ?  93   TYR F CE1   1 
ATOM   737  C  CE2   . TYR A 1 94  ? 64.928  9.450   186.356 1.00 40.37  ?  93   TYR F CE2   1 
ATOM   738  C  CZ    . TYR A 1 94  ? 65.859  10.198  187.049 1.00 38.62  ?  93   TYR F CZ    1 
ATOM   739  O  OH    . TYR A 1 94  ? 65.447  11.269  187.811 1.00 46.11  ?  93   TYR F OH    1 
ATOM   740  N  N     . THR A 1 95  ? 68.539  3.894   184.323 1.00 33.78  ?  94   THR F N     1 
ATOM   741  C  CA    . THR A 1 95  ? 68.751  2.753   183.442 1.00 36.30  ?  94   THR F CA    1 
ATOM   742  C  C     . THR A 1 95  ? 70.167  2.236   183.645 1.00 34.72  ?  94   THR F C     1 
ATOM   743  O  O     . THR A 1 95  ? 71.055  2.981   184.061 1.00 33.95  ?  94   THR F O     1 
ATOM   744  C  CB    . THR A 1 95  ? 68.549  3.128   181.967 1.00 32.24  ?  94   THR F CB    1 
ATOM   745  O  OG1   . THR A 1 95  ? 68.785  1.974   181.150 1.00 39.72  ?  94   THR F OG1   1 
ATOM   746  C  CG2   . THR A 1 95  ? 69.515  4.221   181.559 1.00 32.56  ?  94   THR F CG2   1 
ATOM   747  N  N     . SER A 1 96  ? 70.372  0.950   183.355 1.00 31.93  ?  95   SER F N     1 
ATOM   748  C  CA    . SER A 1 96  ? 71.729  0.435   183.247 1.00 31.31  ?  95   SER F CA    1 
ATOM   749  C  C     . SER A 1 96  ? 72.273  0.547   181.832 1.00 30.74  ?  95   SER F C     1 
ATOM   750  O  O     . SER A 1 96  ? 73.459  0.268   181.604 1.00 30.37  ?  95   SER F O     1 
ATOM   751  C  CB    . SER A 1 96  ? 71.781  -1.027  183.697 1.00 32.67  ?  95   SER F CB    1 
ATOM   752  O  OG    . SER A 1 96  ? 70.958  -1.818  182.863 1.00 41.59  ?  95   SER F OG    1 
ATOM   753  N  N     . ARG A 1 97  ? 71.437  0.975   180.886 1.00 27.91  ?  96   ARG F N     1 
ATOM   754  C  CA    . ARG A 1 97  ? 71.813  1.039   179.476 1.00 28.08  ?  96   ARG F CA    1 
ATOM   755  C  C     . ARG A 1 97  ? 72.500  2.375   179.208 1.00 27.94  ?  96   ARG F C     1 
ATOM   756  O  O     . ARG A 1 97  ? 71.908  3.312   178.663 1.00 27.51  ?  96   ARG F O     1 
ATOM   757  C  CB    . ARG A 1 97  ? 70.579  0.852   178.606 1.00 27.82  ?  96   ARG F CB    1 
ATOM   758  C  CG    . ARG A 1 97  ? 69.945  -0.531  178.751 1.00 31.72  ?  96   ARG F CG    1 
ATOM   759  C  CD    . ARG A 1 97  ? 70.397  -1.373  177.590 1.00 29.78  ?  96   ARG F CD    1 
ATOM   760  N  NE    . ARG A 1 97  ? 69.346  -1.465  176.595 1.00 47.23  ?  96   ARG F NE    1 
ATOM   761  C  CZ    . ARG A 1 97  ? 69.551  -1.432  175.286 1.00 40.71  ?  96   ARG F CZ    1 
ATOM   762  N  NH1   . ARG A 1 97  ? 68.523  -1.542  174.455 1.00 47.81  ?  96   ARG F NH1   1 
ATOM   763  N  NH2   . ARG A 1 97  ? 70.777  -1.280  174.813 1.00 26.92  ?  96   ARG F NH2   1 
ATOM   764  N  N     . ILE A 1 98  ? 73.775  2.458   179.616 1.00 24.92  ?  97   ILE F N     1 
ATOM   765  C  CA    . ILE A 1 98  ? 74.563  3.700   179.617 1.00 22.71  ?  97   ILE F CA    1 
ATOM   766  C  C     . ILE A 1 98  ? 75.834  3.485   178.800 1.00 24.91  ?  97   ILE F C     1 
ATOM   767  O  O     . ILE A 1 98  ? 76.629  2.585   179.106 1.00 26.72  ?  97   ILE F O     1 
ATOM   768  C  CB    . ILE A 1 98  ? 74.945  4.137   181.044 1.00 23.21  ?  97   ILE F CB    1 
ATOM   769  C  CG1   . ILE A 1 98  ? 73.714  4.340   181.923 1.00 24.78  ?  97   ILE F CG1   1 
ATOM   770  C  CG2   . ILE A 1 98  ? 75.791  5.432   181.013 1.00 20.81  ?  97   ILE F CG2   1 
ATOM   771  C  CD1   . ILE A 1 98  ? 74.043  4.262   183.410 1.00 32.22  ?  97   ILE F CD1   1 
ATOM   772  N  N     . GLU A 1 99  ? 76.037  4.308   177.777 1.00 21.93  ?  98   GLU F N     1 
ATOM   773  C  CA    . GLU A 1 99  ? 77.285  4.288   177.019 1.00 23.81  ?  98   GLU F CA    1 
ATOM   774  C  C     . GLU A 1 99  ? 77.965  5.639   177.164 1.00 21.44  ?  98   GLU F C     1 
ATOM   775  O  O     . GLU A 1 99  ? 77.637  6.589   176.423 1.00 21.04  ?  98   GLU F O     1 
ATOM   776  C  CB    . GLU A 1 99  ? 77.052  3.960   175.547 1.00 21.73  ?  98   GLU F CB    1 
ATOM   777  C  CG    . GLU A 1 99  ? 78.334  3.883   174.747 1.00 20.44  ?  98   GLU F CG    1 
ATOM   778  C  CD    . GLU A 1 99  ? 78.111  3.412   173.334 1.00 27.28  ?  98   GLU F CD    1 
ATOM   779  O  OE1   . GLU A 1 99  ? 76.997  2.911   173.028 1.00 27.91  ?  98   GLU F OE1   1 
ATOM   780  O  OE2   . GLU A 1 99  ? 79.050  3.553   172.523 1.00 29.91  ?  98   GLU F OE2   1 
ATOM   781  N  N     . PRO A 1 100 ? 78.910  5.781   178.087 1.00 21.37  ?  99   PRO F N     1 
ATOM   782  C  CA    . PRO A 1 100 ? 79.678  7.034   178.161 1.00 25.11  ?  99   PRO F CA    1 
ATOM   783  C  C     . PRO A 1 100 ? 80.524  7.214   176.910 1.00 25.15  ?  99   PRO F C     1 
ATOM   784  O  O     . PRO A 1 100 ? 81.059  6.251   176.358 1.00 25.02  ?  99   PRO F O     1 
ATOM   785  C  CB    . PRO A 1 100 ? 80.553  6.848   179.410 1.00 30.16  ?  99   PRO F CB    1 
ATOM   786  C  CG    . PRO A 1 100 ? 79.957  5.673   180.153 1.00 32.56  ?  99   PRO F CG    1 
ATOM   787  C  CD    . PRO A 1 100 ? 79.362  4.795   179.088 1.00 22.89  ?  99   PRO F CD    1 
ATOM   788  N  N     . LEU A 1 101 ? 80.622  8.459   176.435 1.00 21.89  ?  100  LEU F N     1 
ATOM   789  C  CA    . LEU A 1 101 ? 81.437  8.727   175.258 1.00 26.69  ?  100  LEU F CA    1 
ATOM   790  C  C     . LEU A 1 101 ? 82.667  9.550   175.574 1.00 27.34  ?  100  LEU F C     1 
ATOM   791  O  O     . LEU A 1 101 ? 83.578  9.618   174.746 1.00 27.11  ?  100  LEU F O     1 
ATOM   792  C  CB    . LEU A 1 101 ? 80.621  9.459   174.187 1.00 28.58  ?  100  LEU F CB    1 
ATOM   793  C  CG    . LEU A 1 101 ? 79.305  8.763   173.841 1.00 29.72  ?  100  LEU F CG    1 
ATOM   794  C  CD1   . LEU A 1 101 ? 78.447  9.696   172.980 1.00 39.81  ?  100  LEU F CD1   1 
ATOM   795  C  CD2   . LEU A 1 101 ? 79.553  7.426   173.138 1.00 27.29  ?  100  LEU F CD2   1 
ATOM   796  N  N     . SER A 1 102 ? 82.693  10.173  176.739 1.00 21.84  ?  101  SER F N     1 
ATOM   797  C  CA    . SER A 1 102 ? 83.786  10.992  177.253 1.00 26.57  ?  101  SER F CA    1 
ATOM   798  C  C     . SER A 1 102 ? 83.377  11.306  178.684 1.00 23.23  ?  101  SER F C     1 
ATOM   799  O  O     . SER A 1 102 ? 82.336  10.833  179.149 1.00 21.56  ?  101  SER F O     1 
ATOM   800  C  CB    . SER A 1 102 ? 84.002  12.246  176.404 1.00 27.01  ?  101  SER F CB    1 
ATOM   801  O  OG    . SER A 1 102 ? 82.846  13.064  176.426 1.00 27.78  ?  101  SER F OG    1 
ATOM   802  N  N     . LEU A 1 103 ? 84.183  12.107  179.384 1.00 24.51  ?  102  LEU F N     1 
ATOM   803  C  CA    . LEU A 1 103 ? 83.860  12.419  180.775 1.00 20.43  ?  102  LEU F CA    1 
ATOM   804  C  C     . LEU A 1 103 ? 82.438  12.953  180.918 1.00 20.81  ?  102  LEU F C     1 
ATOM   805  O  O     . LEU A 1 103 ? 81.701  12.552  181.825 1.00 24.41  ?  102  LEU F O     1 
ATOM   806  C  CB    . LEU A 1 103 ? 84.844  13.451  181.333 1.00 19.06  ?  102  LEU F CB    1 
ATOM   807  C  CG    . LEU A 1 103 ? 86.260  12.946  181.644 1.00 23.89  ?  102  LEU F CG    1 
ATOM   808  C  CD1   . LEU A 1 103 ? 87.094  14.088  182.210 1.00 28.33  ?  102  LEU F CD1   1 
ATOM   809  C  CD2   . LEU A 1 103 ? 86.214  11.757  182.617 1.00 25.96  ?  102  LEU F CD2   1 
ATOM   810  N  N     . ASP A 1 104 ? 82.040  13.872  180.042 1.00 19.22  ?  103  ASP F N     1 
ATOM   811  C  CA    . ASP A 1 104 ? 80.871  14.693  180.312 1.00 21.11  ?  103  ASP F CA    1 
ATOM   812  C  C     . ASP A 1 104 ? 79.636  14.305  179.509 1.00 24.71  ?  103  ASP F C     1 
ATOM   813  O  O     . ASP A 1 104 ? 78.672  15.085  179.486 1.00 20.87  ?  103  ASP F O     1 
ATOM   814  C  CB    . ASP A 1 104 ? 81.207  16.164  180.070 1.00 18.24  ?  103  ASP F CB    1 
ATOM   815  C  CG    . ASP A 1 104 ? 80.979  16.594  178.635 1.00 25.85  ?  103  ASP F CG    1 
ATOM   816  O  OD1   . ASP A 1 104 ? 81.140  15.794  177.686 1.00 21.37  ?  103  ASP F OD1   1 
ATOM   817  O  OD2   . ASP A 1 104 ? 80.621  17.763  178.447 1.00 22.70  ?  103  ASP F OD2   1 
ATOM   818  N  N     . GLU A 1 105 ? 79.631  13.151  178.834 1.00 22.32  ?  104  GLU F N     1 
ATOM   819  C  CA    . GLU A 1 105 ? 78.453  12.821  178.044 1.00 20.08  ?  104  GLU F CA    1 
ATOM   820  C  C     . GLU A 1 105 ? 78.242  11.314  177.983 1.00 20.96  ?  104  GLU F C     1 
ATOM   821  O  O     . GLU A 1 105 ? 79.161  10.516  178.206 1.00 18.87  ?  104  GLU F O     1 
ATOM   822  C  CB    . GLU A 1 105 ? 78.514  13.403  176.619 1.00 22.69  ?  104  GLU F CB    1 
ATOM   823  C  CG    . GLU A 1 105 ? 79.493  12.754  175.670 1.00 29.95  ?  104  GLU F CG    1 
ATOM   824  C  CD    . GLU A 1 105 ? 79.621  13.523  174.346 1.00 32.97  ?  104  GLU F CD    1 
ATOM   825  O  OE1   . GLU A 1 105 ? 79.235  12.990  173.285 1.00 31.64  ?  104  GLU F OE1   1 
ATOM   826  O  OE2   . GLU A 1 105 ? 80.085  14.681  174.368 1.00 40.58  ?  104  GLU F OE2   1 
ATOM   827  N  N     . ALA A 1 106 ? 77.011  10.939  177.647 1.00 19.05  ?  105  ALA F N     1 
ATOM   828  C  CA    . ALA A 1 106 ? 76.670  9.522   177.542 1.00 16.39  ?  105  ALA F CA    1 
ATOM   829  C  C     . ALA A 1 106 ? 75.388  9.373   176.739 1.00 18.44  ?  105  ALA F C     1 
ATOM   830  O  O     . ALA A 1 106 ? 74.534  10.262  176.746 1.00 21.17  ?  105  ALA F O     1 
ATOM   831  C  CB    . ALA A 1 106 ? 76.488  8.888   178.926 1.00 21.93  ?  105  ALA F CB    1 
ATOM   832  N  N     . TYR A 1 107 ? 75.267  8.238   176.049 1.00 20.13  ?  106  TYR F N     1 
ATOM   833  C  CA    . TYR A 1 107 ? 73.998  7.774   175.524 1.00 21.19  ?  106  TYR F CA    1 
ATOM   834  C  C     . TYR A 1 107 ? 73.301  6.947   176.586 1.00 22.34  ?  106  TYR F C     1 
ATOM   835  O  O     . TYR A 1 107 ? 73.940  6.143   177.276 1.00 24.15  ?  106  TYR F O     1 
ATOM   836  C  CB    . TYR A 1 107 ? 74.174  6.890   174.291 1.00 20.68  ?  106  TYR F CB    1 
ATOM   837  C  CG    . TYR A 1 107 ? 74.558  7.610   173.032 1.00 20.94  ?  106  TYR F CG    1 
ATOM   838  C  CD1   . TYR A 1 107 ? 73.731  8.609   172.486 1.00 19.43  ?  106  TYR F CD1   1 
ATOM   839  C  CD2   . TYR A 1 107 ? 75.733  7.281   172.367 1.00 24.58  ?  106  TYR F CD2   1 
ATOM   840  C  CE1   . TYR A 1 107 ? 74.100  9.266   171.314 1.00 21.17  ?  106  TYR F CE1   1 
ATOM   841  C  CE2   . TYR A 1 107 ? 76.093  7.926   171.198 1.00 26.62  ?  106  TYR F CE2   1 
ATOM   842  C  CZ    . TYR A 1 107 ? 75.276  8.915   170.688 1.00 28.12  ?  106  TYR F CZ    1 
ATOM   843  O  OH    . TYR A 1 107 ? 75.628  9.546   169.528 1.00 24.56  ?  106  TYR F OH    1 
ATOM   844  N  N     . LEU A 1 108 ? 71.982  7.103   176.660 1.00 21.24  ?  107  LEU F N     1 
ATOM   845  C  CA    . LEU A 1 108 ? 71.114  6.268   177.471 1.00 25.03  ?  107  LEU F CA    1 
ATOM   846  C  C     . LEU A 1 108 ? 70.064  5.644   176.565 1.00 25.36  ?  107  LEU F C     1 
ATOM   847  O  O     . LEU A 1 108 ? 69.496  6.329   175.713 1.00 25.86  ?  107  LEU F O     1 
ATOM   848  C  CB    . LEU A 1 108 ? 70.428  7.087   178.567 1.00 26.44  ?  107  LEU F CB    1 
ATOM   849  C  CG    . LEU A 1 108 ? 71.176  7.356   179.874 1.00 38.26  ?  107  LEU F CG    1 
ATOM   850  C  CD1   . LEU A 1 108 ? 72.439  8.128   179.668 1.00 40.52  ?  107  LEU F CD1   1 
ATOM   851  C  CD2   . LEU A 1 108 ? 70.250  8.097   180.829 1.00 41.17  ?  107  LEU F CD2   1 
ATOM   852  N  N     . ASP A 1 109 ? 69.830  4.345   176.708 1.00 22.62  ?  108  ASP F N     1 
ATOM   853  C  CA    . ASP A 1 109 ? 68.689  3.717   176.051 1.00 27.62  ?  108  ASP F CA    1 
ATOM   854  C  C     . ASP A 1 109 ? 67.604  3.527   177.104 1.00 35.19  ?  108  ASP F C     1 
ATOM   855  O  O     . ASP A 1 109 ? 67.721  2.664   177.982 1.00 28.51  ?  108  ASP F O     1 
ATOM   856  C  CB    . ASP A 1 109 ? 69.082  2.395   175.388 1.00 24.95  ?  108  ASP F CB    1 
ATOM   857  C  CG    . ASP A 1 109 ? 67.975  1.832   174.503 1.00 33.95  ?  108  ASP F CG    1 
ATOM   858  O  OD1   . ASP A 1 109 ? 66.799  1.974   174.876 1.00 30.75  ?  108  ASP F OD1   1 
ATOM   859  O  OD2   . ASP A 1 109 ? 68.279  1.238   173.437 1.00 34.90  ?  108  ASP F OD2   1 
ATOM   860  N  N     . VAL A 1 110 ? 66.545  4.326   177.009 1.00 27.50  ?  109  VAL F N     1 
ATOM   861  C  CA    . VAL A 1 110 ? 65.435  4.268   177.946 1.00 28.21  ?  109  VAL F CA    1 
ATOM   862  C  C     . VAL A 1 110 ? 64.182  3.700   177.281 1.00 34.46  ?  109  VAL F C     1 
ATOM   863  O  O     . VAL A 1 110 ? 63.076  3.920   177.764 1.00 34.83  ?  109  VAL F O     1 
ATOM   864  C  CB    . VAL A 1 110 ? 65.158  5.642   178.587 1.00 36.37  ?  109  VAL F CB    1 
ATOM   865  C  CG1   . VAL A 1 110 ? 66.357  6.098   179.406 1.00 32.91  ?  109  VAL F CG1   1 
ATOM   866  C  CG2   . VAL A 1 110 ? 64.818  6.702   177.537 1.00 36.35  ?  109  VAL F CG2   1 
ATOM   867  N  N     . THR A 1 111 ? 64.352  2.966   176.177 1.00 33.99  ?  110  THR F N     1 
ATOM   868  C  CA    . THR A 1 111 ? 63.225  2.302   175.520 1.00 38.85  ?  110  THR F CA    1 
ATOM   869  C  C     . THR A 1 111 ? 62.399  1.483   176.504 1.00 40.12  ?  110  THR F C     1 
ATOM   870  O  O     . THR A 1 111 ? 61.166  1.560   176.511 1.00 40.37  ?  110  THR F O     1 
ATOM   871  C  CB    . THR A 1 111 ? 63.729  1.397   174.396 1.00 37.38  ?  110  THR F CB    1 
ATOM   872  O  OG1   . THR A 1 111 ? 64.593  2.137   173.524 1.00 33.65  ?  110  THR F OG1   1 
ATOM   873  C  CG2   . THR A 1 111 ? 62.556  0.820   173.595 1.00 40.71  ?  110  THR F CG2   1 
ATOM   874  N  N     . ASP A 1 112 ? 63.069  0.691   177.342 1.00 37.76  ?  111  ASP F N     1 
ATOM   875  C  CA    . ASP A 1 112 ? 62.421  -0.212  178.283 1.00 59.63  ?  111  ASP F CA    1 
ATOM   876  C  C     . ASP A 1 112 ? 62.330  0.378   179.682 1.00 61.78  ?  111  ASP F C     1 
ATOM   877  O  O     . ASP A 1 112 ? 62.151  -0.366  180.652 1.00 57.66  ?  111  ASP F O     1 
ATOM   878  C  CB    . ASP A 1 112 ? 63.155  -1.554  178.333 1.00 62.14  ?  111  ASP F CB    1 
ATOM   879  C  CG    . ASP A 1 112 ? 63.185  -2.254  176.994 1.00 65.03  ?  111  ASP F CG    1 
ATOM   880  O  OD1   . ASP A 1 112 ? 62.203  -2.115  176.233 1.00 64.66  ?  111  ASP F OD1   1 
ATOM   881  O  OD2   . ASP A 1 112 ? 64.194  -2.937  176.704 1.00 62.41  ?  111  ASP F OD2   1 
ATOM   882  N  N     . SER A 1 113 ? 62.459  1.693   179.812 1.00 52.96  ?  112  SER F N     1 
ATOM   883  C  CA    . SER A 1 113 ? 62.330  2.319   181.115 1.00 46.95  ?  112  SER F CA    1 
ATOM   884  C  C     . SER A 1 113 ? 60.864  2.526   181.463 1.00 51.61  ?  112  SER F C     1 
ATOM   885  O  O     . SER A 1 113 ? 60.046  2.864   180.602 1.00 58.90  ?  112  SER F O     1 
ATOM   886  C  CB    . SER A 1 113 ? 63.062  3.657   181.148 1.00 55.68  ?  112  SER F CB    1 
ATOM   887  O  OG    . SER A 1 113 ? 62.978  4.224   182.442 1.00 52.45  ?  112  SER F OG    1 
ATOM   888  N  N     . VAL A 1 114 ? 60.539  2.312   182.742 1.00 47.46  ?  113  VAL F N     1 
ATOM   889  C  CA    . VAL A 1 114 ? 59.224  2.624   183.286 1.00 54.56  ?  113  VAL F CA    1 
ATOM   890  C  C     . VAL A 1 114 ? 59.228  3.912   184.104 1.00 56.01  ?  113  VAL F C     1 
ATOM   891  O  O     . VAL A 1 114 ? 58.175  4.326   184.605 1.00 57.12  ?  113  VAL F O     1 
ATOM   892  C  CB    . VAL A 1 114 ? 58.698  1.444   184.129 1.00 64.36  ?  113  VAL F CB    1 
ATOM   893  C  CG1   . VAL A 1 114 ? 59.336  1.446   185.511 1.00 58.34  ?  113  VAL F CG1   1 
ATOM   894  C  CG2   . VAL A 1 114 ? 57.164  1.457   184.208 1.00 72.38  ?  113  VAL F CG2   1 
ATOM   895  N  N     . HIS A 1 115 ? 60.382  4.560   184.253 1.00 45.80  ?  114  HIS F N     1 
ATOM   896  C  CA    . HIS A 1 115 ? 60.434  5.848   184.929 1.00 40.04  ?  114  HIS F CA    1 
ATOM   897  C  C     . HIS A 1 115 ? 59.634  6.891   184.155 1.00 47.90  ?  114  HIS F C     1 
ATOM   898  O  O     . HIS A 1 115 ? 59.493  6.814   182.931 1.00 45.42  ?  114  HIS F O     1 
ATOM   899  C  CB    . HIS A 1 115 ? 61.880  6.335   185.068 1.00 40.70  ?  114  HIS F CB    1 
ATOM   900  C  CG    . HIS A 1 115 ? 62.699  5.557   186.048 1.00 55.93  ?  114  HIS F CG    1 
ATOM   901  N  ND1   . HIS A 1 115 ? 63.364  4.396   185.708 1.00 56.37  ?  114  HIS F ND1   1 
ATOM   902  C  CD2   . HIS A 1 115 ? 62.980  5.783   187.353 1.00 62.50  ?  114  HIS F CD2   1 
ATOM   903  C  CE1   . HIS A 1 115 ? 64.010  3.936   186.764 1.00 53.68  ?  114  HIS F CE1   1 
ATOM   904  N  NE2   . HIS A 1 115 ? 63.792  4.758   187.776 1.00 67.23  ?  114  HIS F NE2   1 
ATOM   905  N  N     . CYS A 1 116 ? 59.116  7.876   184.893 1.00 44.75  ?  115  CYS F N     1 
ATOM   906  C  CA    . CYS A 1 116 ? 58.450  9.049   184.319 1.00 47.34  ?  115  CYS F CA    1 
ATOM   907  C  C     . CYS A 1 116 ? 57.407  8.660   183.271 1.00 51.11  ?  115  CYS F C     1 
ATOM   908  O  O     . CYS A 1 116 ? 57.285  9.293   182.219 1.00 52.20  ?  115  CYS F O     1 
ATOM   909  C  CB    . CYS A 1 116 ? 59.475  10.021  183.727 1.00 52.97  ?  115  CYS F CB    1 
ATOM   910  S  SG    . CYS A 1 116 ? 60.733  10.609  184.892 1.00 51.80  ?  115  CYS F SG    1 
ATOM   911  N  N     . HIS A 1 117 ? 56.645  7.604   183.567 1.00 53.92  ?  116  HIS F N     1 
ATOM   912  C  CA    . HIS A 1 117 ? 55.580  7.109   182.687 1.00 59.91  ?  116  HIS F CA    1 
ATOM   913  C  C     . HIS A 1 117 ? 56.103  6.785   181.292 1.00 62.42  ?  116  HIS F C     1 
ATOM   914  O  O     . HIS A 1 117 ? 55.406  6.970   180.292 1.00 65.56  ?  116  HIS F O     1 
ATOM   915  C  CB    . HIS A 1 117 ? 54.422  8.102   182.599 1.00 61.85  ?  116  HIS F CB    1 
ATOM   916  C  CG    . HIS A 1 117 ? 54.042  8.698   183.914 1.00 69.74  ?  116  HIS F CG    1 
ATOM   917  N  ND1   . HIS A 1 117 ? 53.028  8.192   184.701 1.00 72.82  ?  116  HIS F ND1   1 
ATOM   918  C  CD2   . HIS A 1 117 ? 54.551  9.755   184.586 1.00 69.98  ?  116  HIS F CD2   1 
ATOM   919  C  CE1   . HIS A 1 117 ? 52.924  8.921   185.799 1.00 74.72  ?  116  HIS F CE1   1 
ATOM   920  N  NE2   . HIS A 1 117 ? 53.836  9.876   185.753 1.00 74.73  ?  116  HIS F NE2   1 
ATOM   921  N  N     . GLY A 1 118 ? 57.340  6.300   181.222 1.00 57.87  ?  117  GLY F N     1 
ATOM   922  C  CA    . GLY A 1 118 ? 57.939  5.969   179.946 1.00 52.22  ?  117  GLY F CA    1 
ATOM   923  C  C     . GLY A 1 118 ? 58.321  7.151   179.085 1.00 51.62  ?  117  GLY F C     1 
ATOM   924  O  O     . GLY A 1 118 ? 58.720  6.957   177.932 1.00 49.15  ?  117  GLY F O     1 
ATOM   925  N  N     . SER A 1 119 ? 58.217  8.370   179.601 1.00 44.39  ?  118  SER F N     1 
ATOM   926  C  CA    . SER A 1 119 ? 58.534  9.557   178.817 1.00 42.33  ?  118  SER F CA    1 
ATOM   927  C  C     . SER A 1 119 ? 60.038  9.809   178.842 1.00 37.39  ?  118  SER F C     1 
ATOM   928  O  O     . SER A 1 119 ? 60.594  10.165  179.887 1.00 35.12  ?  118  SER F O     1 
ATOM   929  C  CB    . SER A 1 119 ? 57.794  10.766  179.365 1.00 42.37  ?  118  SER F CB    1 
ATOM   930  O  OG    . SER A 1 119 ? 58.356  11.938  178.818 1.00 39.38  ?  118  SER F OG    1 
ATOM   931  N  N     . ALA A 1 120 ? 60.696  9.666   177.690 1.00 31.64  ?  119  ALA F N     1 
ATOM   932  C  CA    . ALA A 1 120 ? 62.121  9.988   177.636 1.00 31.42  ?  119  ALA F CA    1 
ATOM   933  C  C     . ALA A 1 120 ? 62.345  11.487  177.784 1.00 36.11  ?  119  ALA F C     1 
ATOM   934  O  O     . ALA A 1 120 ? 63.384  11.914  178.301 1.00 32.48  ?  119  ALA F O     1 
ATOM   935  C  CB    . ALA A 1 120 ? 62.741  9.476   176.334 1.00 29.84  ?  119  ALA F CB    1 
ATOM   936  N  N     . THR A 1 121 ? 61.370  12.295  177.358 1.00 33.17  ?  120  THR F N     1 
ATOM   937  C  CA    . THR A 1 121 ? 61.458  13.740  177.558 1.00 32.64  ?  120  THR F CA    1 
ATOM   938  C  C     . THR A 1 121 ? 61.557  14.075  179.041 1.00 37.94  ?  120  THR F C     1 
ATOM   939  O  O     . THR A 1 121 ? 62.399  14.887  179.456 1.00 33.08  ?  120  THR F O     1 
ATOM   940  C  CB    . THR A 1 121 ? 60.234  14.421  176.933 1.00 33.55  ?  120  THR F CB    1 
ATOM   941  O  OG1   . THR A 1 121 ? 60.224  14.172  175.520 1.00 40.45  ?  120  THR F OG1   1 
ATOM   942  C  CG2   . THR A 1 121 ? 60.256  15.924  177.183 1.00 36.65  ?  120  THR F CG2   1 
ATOM   943  N  N     . LEU A 1 122 ? 60.708  13.443  179.858 1.00 33.39  ?  121  LEU F N     1 
ATOM   944  C  CA    . LEU A 1 122 ? 60.689  13.715  181.290 1.00 37.44  ?  121  LEU F CA    1 
ATOM   945  C  C     . LEU A 1 122 ? 61.878  13.091  182.000 1.00 36.66  ?  121  LEU F C     1 
ATOM   946  O  O     . LEU A 1 122 ? 62.397  13.676  182.957 1.00 38.58  ?  121  LEU F O     1 
ATOM   947  C  CB    . LEU A 1 122 ? 59.391  13.200  181.914 1.00 41.58  ?  121  LEU F CB    1 
ATOM   948  C  CG    . LEU A 1 122 ? 58.158  14.078  181.709 1.00 47.07  ?  121  LEU F CG    1 
ATOM   949  C  CD1   . LEU A 1 122 ? 57.031  13.553  182.584 1.00 47.53  ?  121  LEU F CD1   1 
ATOM   950  C  CD2   . LEU A 1 122 ? 58.447  15.536  182.017 1.00 45.42  ?  121  LEU F CD2   1 
ATOM   951  N  N     . ILE A 1 123 ? 62.300  11.897  181.568 1.00 36.00  ?  122  ILE F N     1 
ATOM   952  C  CA    . ILE A 1 123 ? 63.523  11.313  182.110 1.00 31.09  ?  122  ILE F CA    1 
ATOM   953  C  C     . ILE A 1 123 ? 64.701  12.251  181.881 1.00 29.64  ?  122  ILE F C     1 
ATOM   954  O  O     . ILE A 1 123 ? 65.505  12.490  182.792 1.00 33.61  ?  122  ILE F O     1 
ATOM   955  C  CB    . ILE A 1 123 ? 63.781  9.916   181.502 1.00 30.18  ?  122  ILE F CB    1 
ATOM   956  C  CG1   . ILE A 1 123 ? 62.714  8.920   181.974 1.00 35.16  ?  122  ILE F CG1   1 
ATOM   957  C  CG2   . ILE A 1 123 ? 65.199  9.437   181.838 1.00 27.30  ?  122  ILE F CG2   1 
ATOM   958  C  CD1   . ILE A 1 123 ? 62.783  7.572   181.280 1.00 35.26  ?  122  ILE F CD1   1 
ATOM   959  N  N     . ALA A 1 124 ? 64.827  12.796  180.663 1.00 26.24  ?  123  ALA F N     1 
ATOM   960  C  CA    . ALA A 1 124 ? 65.920  13.725  180.378 1.00 30.51  ?  123  ALA F CA    1 
ATOM   961  C  C     . ALA A 1 124 ? 65.842  14.949  181.273 1.00 30.98  ?  123  ALA F C     1 
ATOM   962  O  O     . ALA A 1 124 ? 66.858  15.394  181.824 1.00 29.89  ?  123  ALA F O     1 
ATOM   963  C  CB    . ALA A 1 124 ? 65.898  14.144  178.908 1.00 29.91  ?  123  ALA F CB    1 
ATOM   964  N  N     . GLN A 1 125 ? 64.636  15.505  181.437 1.00 30.24  ?  124  GLN F N     1 
ATOM   965  C  CA    . GLN A 1 125 ? 64.474  16.680  182.285 1.00 29.55  ?  124  GLN F CA    1 
ATOM   966  C  C     . GLN A 1 125 ? 64.822  16.355  183.732 1.00 34.82  ?  124  GLN F C     1 
ATOM   967  O  O     . GLN A 1 125 ? 65.486  17.143  184.414 1.00 35.34  ?  124  GLN F O     1 
ATOM   968  C  CB    . GLN A 1 125 ? 63.038  17.211  182.177 1.00 33.35  ?  124  GLN F CB    1 
ATOM   969  C  CG    . GLN A 1 125 ? 62.844  18.602  182.755 1.00 57.09  ?  124  GLN F CG    1 
ATOM   970  C  CD    . GLN A 1 125 ? 63.220  19.702  181.772 1.00 71.82  ?  124  GLN F CD    1 
ATOM   971  O  OE1   . GLN A 1 125 ? 62.900  19.626  180.584 1.00 74.21  ?  124  GLN F OE1   1 
ATOM   972  N  NE2   . GLN A 1 125 ? 63.902  20.731  182.265 1.00 78.06  ?  124  GLN F NE2   1 
ATOM   973  N  N     . GLU A 1 126 ? 64.401  15.183  184.211 1.00 30.25  ?  125  GLU F N     1 
ATOM   974  C  CA    . GLU A 1 126 ? 64.686  14.813  185.591 1.00 35.37  ?  125  GLU F CA    1 
ATOM   975  C  C     . GLU A 1 126 ? 66.181  14.606  185.808 1.00 35.58  ?  125  GLU F C     1 
ATOM   976  O  O     . GLU A 1 126 ? 66.733  15.024  186.836 1.00 34.08  ?  125  GLU F O     1 
ATOM   977  C  CB    . GLU A 1 126 ? 63.910  13.554  185.952 1.00 39.60  ?  125  GLU F CB    1 
ATOM   978  C  CG    . GLU A 1 126 ? 63.306  13.576  187.332 1.00 55.44  ?  125  GLU F CG    1 
ATOM   979  C  CD    . GLU A 1 126 ? 62.391  12.394  187.566 1.00 59.25  ?  125  GLU F CD    1 
ATOM   980  O  OE1   . GLU A 1 126 ? 61.160  12.555  187.408 1.00 59.47  ?  125  GLU F OE1   1 
ATOM   981  O  OE2   . GLU A 1 126 ? 62.911  11.301  187.885 1.00 48.86  ?  125  GLU F OE2   1 
ATOM   982  N  N     . ILE A 1 127 ? 66.848  13.958  184.850 1.00 32.84  ?  126  ILE F N     1 
ATOM   983  C  CA    . ILE A 1 127 ? 68.299  13.791  184.920 1.00 32.72  ?  126  ILE F CA    1 
ATOM   984  C  C     . ILE A 1 127 ? 68.984  15.151  184.973 1.00 25.63  ?  126  ILE F C     1 
ATOM   985  O  O     . ILE A 1 127 ? 69.874  15.384  185.797 1.00 28.64  ?  126  ILE F O     1 
ATOM   986  C  CB    . ILE A 1 127 ? 68.801  12.956  183.729 1.00 27.03  ?  126  ILE F CB    1 
ATOM   987  C  CG1   . ILE A 1 127 ? 68.365  11.498  183.892 1.00 31.79  ?  126  ILE F CG1   1 
ATOM   988  C  CG2   . ILE A 1 127 ? 70.331  13.051  183.586 1.00 24.96  ?  126  ILE F CG2   1 
ATOM   989  C  CD1   . ILE A 1 127 ? 68.617  10.646  182.680 1.00 32.43  ?  126  ILE F CD1   1 
ATOM   990  N  N     . ARG A 1 128 ? 68.581  16.067  184.091 1.00 28.14  ?  127  ARG F N     1 
ATOM   991  C  CA    . ARG A 1 128 ? 69.232  17.374  184.058 1.00 32.04  ?  127  ARG F CA    1 
ATOM   992  C  C     . ARG A 1 128 ? 69.002  18.128  185.364 1.00 34.76  ?  127  ARG F C     1 
ATOM   993  O  O     . ARG A 1 128 ? 69.923  18.770  185.893 1.00 32.89  ?  127  ARG F O     1 
ATOM   994  C  CB    . ARG A 1 128 ? 68.731  18.187  182.863 1.00 26.92  ?  127  ARG F CB    1 
ATOM   995  C  CG    . ARG A 1 128 ? 69.212  17.659  181.504 1.00 27.99  ?  127  ARG F CG    1 
ATOM   996  C  CD    . ARG A 1 128 ? 68.571  18.389  180.341 1.00 29.48  ?  127  ARG F CD    1 
ATOM   997  N  NE    . ARG A 1 128 ? 68.593  19.826  180.579 1.00 32.64  ?  127  ARG F NE    1 
ATOM   998  C  CZ    . ARG A 1 128 ? 67.519  20.582  180.767 1.00 43.67  ?  127  ARG F CZ    1 
ATOM   999  N  NH1   . ARG A 1 128 ? 67.667  21.877  181.000 1.00 37.24  ?  127  ARG F NH1   1 
ATOM   1000 N  NH2   . ARG A 1 128 ? 66.305  20.054  180.712 1.00 46.43  ?  127  ARG F NH2   1 
ATOM   1001 N  N     . GLN A 1 129 ? 67.786  18.046  185.910 1.00 33.90  ?  128  GLN F N     1 
ATOM   1002 C  CA    . GLN A 1 129 ? 67.501  18.732  187.166 1.00 34.57  ?  128  GLN F CA    1 
ATOM   1003 C  C     . GLN A 1 129 ? 68.284  18.114  188.315 1.00 37.60  ?  128  GLN F C     1 
ATOM   1004 O  O     . GLN A 1 129 ? 68.832  18.833  189.161 1.00 36.64  ?  128  GLN F O     1 
ATOM   1005 C  CB    . GLN A 1 129 ? 66.003  18.691  187.460 1.00 35.40  ?  128  GLN F CB    1 
ATOM   1006 C  CG    . GLN A 1 129 ? 65.618  19.404  188.742 1.00 41.53  ?  128  GLN F CG    1 
ATOM   1007 C  CD    . GLN A 1 129 ? 65.887  20.895  188.672 1.00 47.93  ?  128  GLN F CD    1 
ATOM   1008 O  OE1   . GLN A 1 129 ? 65.575  21.544  187.672 1.00 51.92  ?  128  GLN F OE1   1 
ATOM   1009 N  NE2   . GLN A 1 129 ? 66.479  21.445  189.730 1.00 53.79  ?  128  GLN F NE2   1 
ATOM   1010 N  N     . THR A 1 130 ? 68.338  16.779  188.366 1.00 33.37  ?  129  THR F N     1 
ATOM   1011 C  CA    . THR A 1 130 ? 69.109  16.112  189.409 1.00 31.98  ?  129  THR F CA    1 
ATOM   1012 C  C     . THR A 1 130 ? 70.579  16.494  189.329 1.00 29.99  ?  129  THR F C     1 
ATOM   1013 O  O     . THR A 1 130 ? 71.222  16.741  190.355 1.00 39.19  ?  129  THR F O     1 
ATOM   1014 C  CB    . THR A 1 130 ? 68.958  14.599  189.297 1.00 32.28  ?  129  THR F CB    1 
ATOM   1015 O  OG1   . THR A 1 130 ? 67.572  14.251  189.403 1.00 37.99  ?  129  THR F OG1   1 
ATOM   1016 C  CG2   . THR A 1 130 ? 69.742  13.923  190.401 1.00 31.30  ?  129  THR F CG2   1 
ATOM   1017 N  N     . ILE A 1 131 ? 71.129  16.539  188.113 1.00 28.47  ?  130  ILE F N     1 
ATOM   1018 C  CA    . ILE A 1 131 ? 72.528  16.916  187.941 1.00 29.32  ?  130  ILE F CA    1 
ATOM   1019 C  C     . ILE A 1 131 ? 72.763  18.312  188.501 1.00 36.77  ?  130  ILE F C     1 
ATOM   1020 O  O     . ILE A 1 131 ? 73.721  18.555  189.250 1.00 31.24  ?  130  ILE F O     1 
ATOM   1021 C  CB    . ILE A 1 131 ? 72.920  16.815  186.458 1.00 27.90  ?  130  ILE F CB    1 
ATOM   1022 C  CG1   . ILE A 1 131 ? 73.068  15.332  186.079 1.00 22.97  ?  130  ILE F CG1   1 
ATOM   1023 C  CG2   . ILE A 1 131 ? 74.199  17.625  186.162 1.00 28.60  ?  130  ILE F CG2   1 
ATOM   1024 C  CD1   . ILE A 1 131 ? 73.317  15.077  184.599 1.00 29.66  ?  130  ILE F CD1   1 
ATOM   1025 N  N     . PHE A 1 132 ? 71.865  19.240  188.182 1.00 30.75  ?  131  PHE F N     1 
ATOM   1026 C  CA    . PHE A 1 132 ? 71.986  20.586  188.734 1.00 30.69  ?  131  PHE F CA    1 
ATOM   1027 C  C     . PHE A 1 132 ? 71.827  20.573  190.246 1.00 35.69  ?  131  PHE F C     1 
ATOM   1028 O  O     . PHE A 1 132 ? 72.574  21.252  190.960 1.00 36.93  ?  131  PHE F O     1 
ATOM   1029 C  CB    . PHE A 1 132 ? 70.951  21.514  188.104 1.00 29.81  ?  131  PHE F CB    1 
ATOM   1030 C  CG    . PHE A 1 132 ? 71.032  22.921  188.618 1.00 36.49  ?  131  PHE F CG    1 
ATOM   1031 C  CD1   . PHE A 1 132 ? 72.167  23.673  188.401 1.00 36.51  ?  131  PHE F CD1   1 
ATOM   1032 C  CD2   . PHE A 1 132 ? 69.989  23.480  189.337 1.00 44.13  ?  131  PHE F CD2   1 
ATOM   1033 C  CE1   . PHE A 1 132 ? 72.254  24.975  188.871 1.00 38.22  ?  131  PHE F CE1   1 
ATOM   1034 C  CE2   . PHE A 1 132 ? 70.072  24.775  189.812 1.00 52.37  ?  131  PHE F CE2   1 
ATOM   1035 C  CZ    . PHE A 1 132 ? 71.205  25.521  189.578 1.00 42.68  ?  131  PHE F CZ    1 
ATOM   1036 N  N     . ASN A 1 133 ? 70.860  19.800  190.754 1.00 37.15  ?  132  ASN F N     1 
ATOM   1037 C  CA    . ASN A 1 133 ? 70.592  19.788  192.188 1.00 38.05  ?  132  ASN F CA    1 
ATOM   1038 C  C     . ASN A 1 133 ? 71.774  19.235  192.974 1.00 37.56  ?  132  ASN F C     1 
ATOM   1039 O  O     . ASN A 1 133 ? 72.089  19.739  194.059 1.00 38.30  ?  132  ASN F O     1 
ATOM   1040 C  CB    . ASN A 1 133 ? 69.332  18.969  192.492 1.00 43.40  ?  132  ASN F CB    1 
ATOM   1041 C  CG    . ASN A 1 133 ? 68.042  19.672  192.080 1.00 40.91  ?  132  ASN F CG    1 
ATOM   1042 O  OD1   . ASN A 1 133 ? 68.018  20.873  191.829 1.00 44.55  ?  132  ASN F OD1   1 
ATOM   1043 N  ND2   . ASN A 1 133 ? 66.957  18.910  192.021 1.00 43.90  ?  132  ASN F ND2   1 
ATOM   1044 N  N     . GLU A 1 134 ? 72.440  18.199  192.454 1.00 33.72  ?  133  GLU F N     1 
ATOM   1045 C  CA    . GLU A 1 134 ? 73.466  17.511  193.226 1.00 34.99  ?  133  GLU F CA    1 
ATOM   1046 C  C     . GLU A 1 134 ? 74.884  17.955  192.897 1.00 33.44  ?  133  GLU F C     1 
ATOM   1047 O  O     . GLU A 1 134 ? 75.776  17.774  193.730 1.00 41.05  ?  133  GLU F O     1 
ATOM   1048 C  CB    . GLU A 1 134 ? 73.356  15.991  193.031 1.00 29.40  ?  133  GLU F CB    1 
ATOM   1049 C  CG    . GLU A 1 134 ? 72.056  15.411  193.541 1.00 37.07  ?  133  GLU F CG    1 
ATOM   1050 C  CD    . GLU A 1 134 ? 72.011  13.885  193.489 1.00 38.69  ?  133  GLU F CD    1 
ATOM   1051 O  OE1   . GLU A 1 134 ? 73.017  13.247  193.084 1.00 33.99  ?  133  GLU F OE1   1 
ATOM   1052 O  OE2   . GLU A 1 134 ? 70.955  13.321  193.843 1.00 41.31  ?  133  GLU F OE2   1 
ATOM   1053 N  N     . LEU A 1 135 ? 75.127  18.494  191.708 1.00 29.47  ?  134  LEU F N     1 
ATOM   1054 C  CA    . LEU A 1 135 ? 76.461  18.941  191.338 1.00 28.88  ?  134  LEU F CA    1 
ATOM   1055 C  C     . LEU A 1 135 ? 76.570  20.447  191.146 1.00 29.75  ?  134  LEU F C     1 
ATOM   1056 O  O     . LEU A 1 135 ? 77.689  20.953  191.039 1.00 31.36  ?  134  LEU F O     1 
ATOM   1057 C  CB    . LEU A 1 135 ? 76.926  18.252  190.046 1.00 34.09  ?  134  LEU F CB    1 
ATOM   1058 C  CG    . LEU A 1 135 ? 77.289  16.763  190.094 1.00 34.73  ?  134  LEU F CG    1 
ATOM   1059 C  CD1   . LEU A 1 135 ? 76.080  15.893  189.802 1.00 32.84  ?  134  LEU F CD1   1 
ATOM   1060 C  CD2   . LEU A 1 135 ? 78.386  16.498  189.095 1.00 35.08  ?  134  LEU F CD2   1 
ATOM   1061 N  N     . GLN A 1 136 ? 75.453  21.168  191.101 1.00 31.54  ?  135  GLN F N     1 
ATOM   1062 C  CA    . GLN A 1 136 ? 75.453  22.607  190.793 1.00 38.47  ?  135  GLN F CA    1 
ATOM   1063 C  C     . GLN A 1 136 ? 76.160  22.881  189.466 1.00 36.52  ?  135  GLN F C     1 
ATOM   1064 O  O     . GLN A 1 136 ? 76.923  23.843  189.315 1.00 35.21  ?  135  GLN F O     1 
ATOM   1065 C  CB    . GLN A 1 136 ? 76.072  23.422  191.929 1.00 43.42  ?  135  GLN F CB    1 
ATOM   1066 C  CG    . GLN A 1 136 ? 75.414  23.188  193.280 1.00 57.80  ?  135  GLN F CG    1 
ATOM   1067 C  CD    . GLN A 1 136 ? 76.433  22.983  194.382 1.00 75.45  ?  135  GLN F CD    1 
ATOM   1068 O  OE1   . GLN A 1 136 ? 77.182  23.899  194.731 1.00 81.00  ?  135  GLN F OE1   1 
ATOM   1069 N  NE2   . GLN A 1 136 ? 76.482  21.769  194.924 1.00 76.77  ?  135  GLN F NE2   1 
ATOM   1070 N  N     . LEU A 1 137 ? 75.916  22.000  188.501 1.00 31.51  ?  136  LEU F N     1 
ATOM   1071 C  CA    . LEU A 1 137 ? 76.349  22.156  187.122 1.00 27.14  ?  136  LEU F CA    1 
ATOM   1072 C  C     . LEU A 1 137 ? 75.133  21.895  186.247 1.00 31.42  ?  136  LEU F C     1 
ATOM   1073 O  O     . LEU A 1 137 ? 74.247  21.124  186.624 1.00 31.32  ?  136  LEU F O     1 
ATOM   1074 C  CB    . LEU A 1 137 ? 77.486  21.161  186.763 1.00 29.05  ?  136  LEU F CB    1 
ATOM   1075 C  CG    . LEU A 1 137 ? 78.731  21.139  187.651 1.00 31.40  ?  136  LEU F CG    1 
ATOM   1076 C  CD1   . LEU A 1 137 ? 79.610  19.920  187.350 1.00 27.50  ?  136  LEU F CD1   1 
ATOM   1077 C  CD2   . LEU A 1 137 ? 79.511  22.414  187.448 1.00 26.26  ?  136  LEU F CD2   1 
ATOM   1078 N  N     . THR A 1 138 ? 75.066  22.539  185.087 1.00 29.57  ?  137  THR F N     1 
ATOM   1079 C  CA    . THR A 1 138 ? 73.933  22.285  184.206 1.00 31.62  ?  137  THR F CA    1 
ATOM   1080 C  C     . THR A 1 138 ? 74.335  21.352  183.077 1.00 29.81  ?  137  THR F C     1 
ATOM   1081 O  O     . THR A 1 138 ? 75.506  21.248  182.705 1.00 23.98  ?  137  THR F O     1 
ATOM   1082 C  CB    . THR A 1 138 ? 73.344  23.573  183.611 1.00 28.42  ?  137  THR F CB    1 
ATOM   1083 O  OG1   . THR A 1 138 ? 74.291  24.203  182.739 1.00 28.52  ?  137  THR F OG1   1 
ATOM   1084 C  CG2   . THR A 1 138 ? 72.921  24.525  184.713 1.00 30.27  ?  137  THR F CG2   1 
ATOM   1085 N  N     . ALA A 1 139 ? 73.326  20.682  182.524 1.00 26.12  ?  138  ALA F N     1 
ATOM   1086 C  CA    . ALA A 1 139 ? 73.519  19.792  181.396 1.00 24.02  ?  138  ALA F CA    1 
ATOM   1087 C  C     . ALA A 1 139 ? 72.411  20.028  180.387 1.00 26.22  ?  138  ALA F C     1 
ATOM   1088 O  O     . ALA A 1 139 ? 71.333  20.538  180.711 1.00 28.51  ?  138  ALA F O     1 
ATOM   1089 C  CB    . ALA A 1 139 ? 73.545  18.306  181.824 1.00 23.78  ?  138  ALA F CB    1 
ATOM   1090 N  N     . SER A 1 140 ? 72.701  19.680  179.145 1.00 24.14  ?  139  SER F N     1 
ATOM   1091 C  CA    . SER A 1 140 ? 71.705  19.682  178.092 1.00 20.61  ?  139  SER F CA    1 
ATOM   1092 C  C     . SER A 1 140 ? 71.474  18.251  177.626 1.00 24.97  ?  139  SER F C     1 
ATOM   1093 O  O     . SER A 1 140 ? 72.256  17.350  177.923 1.00 23.82  ?  139  SER F O     1 
ATOM   1094 C  CB    . SER A 1 140 ? 72.152  20.572  176.934 1.00 24.22  ?  139  SER F CB    1 
ATOM   1095 O  OG    . SER A 1 140 ? 72.278  21.934  177.371 1.00 22.55  ?  139  SER F OG    1 
ATOM   1096 N  N     . ALA A 1 141 ? 70.375  18.034  176.908 1.00 22.29  ?  140  ALA F N     1 
ATOM   1097 C  CA    . ALA A 1 141 ? 70.067  16.674  176.501 1.00 22.25  ?  140  ALA F CA    1 
ATOM   1098 C  C     . ALA A 1 141 ? 69.362  16.670  175.154 1.00 27.67  ?  140  ALA F C     1 
ATOM   1099 O  O     . ALA A 1 141 ? 68.698  17.638  174.774 1.00 24.54  ?  140  ALA F O     1 
ATOM   1100 C  CB    . ALA A 1 141 ? 69.205  15.952  177.549 1.00 20.84  ?  140  ALA F CB    1 
ATOM   1101 N  N     . GLY A 1 142 ? 69.523  15.569  174.439 1.00 25.59  ?  141  GLY F N     1 
ATOM   1102 C  CA    . GLY A 1 142 ? 68.813  15.359  173.188 1.00 22.13  ?  141  GLY F CA    1 
ATOM   1103 C  C     . GLY A 1 142 ? 68.115  14.021  173.249 1.00 23.97  ?  141  GLY F C     1 
ATOM   1104 O  O     . GLY A 1 142 ? 68.650  13.058  173.800 1.00 24.31  ?  141  GLY F O     1 
ATOM   1105 N  N     . VAL A 1 143 ? 66.904  13.971  172.688 1.00 20.94  ?  142  VAL F N     1 
ATOM   1106 C  CA    . VAL A 1 143 ? 66.087  12.750  172.677 1.00 25.87  ?  142  VAL F CA    1 
ATOM   1107 C  C     . VAL A 1 143 ? 65.708  12.445  171.236 1.00 25.93  ?  142  VAL F C     1 
ATOM   1108 O  O     . VAL A 1 143 ? 65.192  13.321  170.538 1.00 25.65  ?  142  VAL F O     1 
ATOM   1109 C  CB    . VAL A 1 143 ? 64.816  12.908  173.534 1.00 26.62  ?  142  VAL F CB    1 
ATOM   1110 C  CG1   . VAL A 1 143 ? 64.008  11.613  173.558 1.00 26.78  ?  142  VAL F CG1   1 
ATOM   1111 C  CG2   . VAL A 1 143 ? 65.167  13.363  174.948 1.00 28.02  ?  142  VAL F CG2   1 
ATOM   1112 N  N     . ALA A 1 144 ? 65.940  11.209  170.797 1.00 23.94  ?  143  ALA F N     1 
ATOM   1113 C  CA    . ALA A 1 144 ? 65.676  10.845  169.409 1.00 24.49  ?  143  ALA F CA    1 
ATOM   1114 C  C     . ALA A 1 144 ? 65.559  9.328   169.321 1.00 26.63  ?  143  ALA F C     1 
ATOM   1115 O  O     . ALA A 1 144 ? 65.833  8.621   170.295 1.00 26.71  ?  143  ALA F O     1 
ATOM   1116 C  CB    . ALA A 1 144 ? 66.781  11.375  168.481 1.00 23.12  ?  143  ALA F CB    1 
ATOM   1117 N  N     . PRO A 1 145 ? 65.136  8.795   168.167 1.00 25.35  ?  144  PRO F N     1 
ATOM   1118 C  CA    . PRO A 1 145 ? 64.972  7.331   168.044 1.00 24.15  ?  144  PRO F CA    1 
ATOM   1119 C  C     . PRO A 1 145 ? 66.276  6.574   167.823 1.00 25.20  ?  144  PRO F C     1 
ATOM   1120 O  O     . PRO A 1 145 ? 66.267  5.330   167.884 1.00 26.71  ?  144  PRO F O     1 
ATOM   1121 C  CB    . PRO A 1 145 ? 64.044  7.185   166.823 1.00 25.36  ?  144  PRO F CB    1 
ATOM   1122 C  CG    . PRO A 1 145 ? 63.372  8.539   166.665 1.00 30.92  ?  144  PRO F CG    1 
ATOM   1123 C  CD    . PRO A 1 145 ? 64.464  9.500   167.060 1.00 28.14  ?  144  PRO F CD    1 
ATOM   1124 N  N     . VAL A 1 146 ? 67.375  7.265   167.521 1.00 24.65  ?  145  VAL F N     1 
ATOM   1125 C  CA    . VAL A 1 146 ? 68.671  6.644   167.249 1.00 21.44  ?  145  VAL F CA    1 
ATOM   1126 C  C     . VAL A 1 146 ? 69.766  7.532   167.839 1.00 21.62  ?  145  VAL F C     1 
ATOM   1127 O  O     . VAL A 1 146 ? 69.551  8.710   168.149 1.00 23.20  ?  145  VAL F O     1 
ATOM   1128 C  CB    . VAL A 1 146 ? 68.930  6.447   165.737 1.00 23.25  ?  145  VAL F CB    1 
ATOM   1129 C  CG1   . VAL A 1 146 ? 67.815  5.623   165.056 1.00 25.85  ?  145  VAL F CG1   1 
ATOM   1130 C  CG2   . VAL A 1 146 ? 69.086  7.834   165.044 1.00 26.97  ?  145  VAL F CG2   1 
ATOM   1131 N  N     . LYS A 1 147 ? 70.972  6.963   167.954 1.00 22.50  ?  146  LYS F N     1 
ATOM   1132 C  CA    . LYS A 1 147 ? 72.084  7.667   168.605 1.00 20.90  ?  146  LYS F CA    1 
ATOM   1133 C  C     . LYS A 1 147 ? 72.402  9.013   167.964 1.00 20.94  ?  146  LYS F C     1 
ATOM   1134 O  O     . LYS A 1 147 ? 72.460  10.037  168.652 1.00 20.69  ?  146  LYS F O     1 
ATOM   1135 C  CB    . LYS A 1 147 ? 73.344  6.806   168.582 1.00 22.78  ?  146  LYS F CB    1 
ATOM   1136 C  CG    . LYS A 1 147 ? 73.376  5.724   169.601 1.00 20.38  ?  146  LYS F CG    1 
ATOM   1137 C  CD    . LYS A 1 147 ? 74.709  4.958   169.406 1.00 20.37  ?  146  LYS F CD    1 
ATOM   1138 C  CE    . LYS A 1 147 ? 75.006  4.033   170.570 1.00 25.92  ?  146  LYS F CE    1 
ATOM   1139 N  NZ    . LYS A 1 147 ? 76.349  3.436   170.334 1.00 29.31  ?  146  LYS F NZ    1 
ATOM   1140 N  N     . PHE A 1 148 ? 72.728  9.027   166.669 1.00 23.00  ?  147  PHE F N     1 
ATOM   1141 C  CA    . PHE A 1 148 ? 73.348  10.243  166.153 1.00 19.79  ?  147  PHE F CA    1 
ATOM   1142 C  C     . PHE A 1 148 ? 72.376  11.404  166.211 1.00 24.91  ?  147  PHE F C     1 
ATOM   1143 O  O     . PHE A 1 148 ? 72.789  12.526  166.502 1.00 21.38  ?  147  PHE F O     1 
ATOM   1144 C  CB    . PHE A 1 148 ? 73.914  10.043  164.740 1.00 19.69  ?  147  PHE F CB    1 
ATOM   1145 C  CG    . PHE A 1 148 ? 72.919  10.211  163.621 1.00 28.21  ?  147  PHE F CG    1 
ATOM   1146 C  CD1   . PHE A 1 148 ? 72.016  9.204   163.299 1.00 23.06  ?  147  PHE F CD1   1 
ATOM   1147 C  CD2   . PHE A 1 148 ? 72.920  11.369  162.854 1.00 24.55  ?  147  PHE F CD2   1 
ATOM   1148 C  CE1   . PHE A 1 148 ? 71.137  9.354   162.258 1.00 27.38  ?  147  PHE F CE1   1 
ATOM   1149 C  CE2   . PHE A 1 148 ? 72.045  11.528  161.814 1.00 24.02  ?  147  PHE F CE2   1 
ATOM   1150 C  CZ    . PHE A 1 148 ? 71.142  10.532  161.507 1.00 26.78  ?  147  PHE F CZ    1 
ATOM   1151 N  N     . LEU A 1 149 ? 71.076  11.142  166.045 1.00 23.31  ?  148  LEU F N     1 
ATOM   1152 C  CA    . LEU A 1 149 ? 70.122  12.239  166.133 1.00 20.68  ?  148  LEU F CA    1 
ATOM   1153 C  C     . LEU A 1 149 ? 69.967  12.732  167.562 1.00 23.74  ?  148  LEU F C     1 
ATOM   1154 O  O     . LEU A 1 149 ? 69.762  13.932  167.779 1.00 23.21  ?  148  LEU F O     1 
ATOM   1155 C  CB    . LEU A 1 149 ? 68.766  11.812  165.565 1.00 20.49  ?  148  LEU F CB    1 
ATOM   1156 C  CG    . LEU A 1 149 ? 68.695  11.668  164.041 1.00 26.16  ?  148  LEU F CG    1 
ATOM   1157 C  CD1   . LEU A 1 149 ? 67.340  11.120  163.587 1.00 25.26  ?  148  LEU F CD1   1 
ATOM   1158 C  CD2   . LEU A 1 149 ? 68.970  13.019  163.371 1.00 24.29  ?  148  LEU F CD2   1 
ATOM   1159 N  N     . ALA A 1 150 ? 70.047  11.831  168.544 1.00 22.83  ?  149  ALA F N     1 
ATOM   1160 C  CA    . ALA A 1 150 ? 70.020  12.261  169.939 1.00 20.86  ?  149  ALA F CA    1 
ATOM   1161 C  C     . ALA A 1 150 ? 71.221  13.141  170.253 1.00 22.61  ?  149  ALA F C     1 
ATOM   1162 O  O     . ALA A 1 150 ? 71.095  14.146  170.961 1.00 22.35  ?  149  ALA F O     1 
ATOM   1163 C  CB    . ALA A 1 150 ? 69.995  11.043  170.870 1.00 21.42  ?  149  ALA F CB    1 
ATOM   1164 N  N     . LYS A 1 151 ? 72.392  12.779  169.730 1.00 20.30  ?  150  LYS F N     1 
ATOM   1165 C  CA    . LYS A 1 151 ? 73.598  13.564  169.992 1.00 19.10  ?  150  LYS F CA    1 
ATOM   1166 C  C     . LYS A 1 151 ? 73.528  14.920  169.307 1.00 24.13  ?  150  LYS F C     1 
ATOM   1167 O  O     . LYS A 1 151 ? 73.885  15.944  169.904 1.00 21.94  ?  150  LYS F O     1 
ATOM   1168 C  CB    . LYS A 1 151 ? 74.836  12.786  169.536 1.00 20.53  ?  150  LYS F CB    1 
ATOM   1169 C  CG    . LYS A 1 151 ? 76.142  13.559  169.668 1.00 24.19  ?  150  LYS F CG    1 
ATOM   1170 C  CD    . LYS A 1 151 ? 77.330  12.612  169.726 1.00 24.93  ?  150  LYS F CD    1 
ATOM   1171 C  CE    . LYS A 1 151 ? 78.657  13.388  169.720 1.00 35.77  ?  150  LYS F CE    1 
ATOM   1172 N  NZ    . LYS A 1 151 ? 78.910  14.036  171.028 1.00 36.17  ?  150  LYS F NZ    1 
ATOM   1173 N  N     . ILE A 1 152 ? 73.057  14.963  168.058 1.00 20.30  ?  151  ILE F N     1 
ATOM   1174 C  CA    . ILE A 1 152 ? 72.827  16.267  167.430 1.00 20.27  ?  151  ILE F CA    1 
ATOM   1175 C  C     . ILE A 1 152 ? 71.828  17.084  168.248 1.00 23.49  ?  151  ILE F C     1 
ATOM   1176 O  O     . ILE A 1 152 ? 72.025  18.285  168.485 1.00 23.38  ?  151  ILE F O     1 
ATOM   1177 C  CB    . ILE A 1 152 ? 72.355  16.082  165.971 1.00 21.42  ?  151  ILE F CB    1 
ATOM   1178 C  CG1   . ILE A 1 152 ? 73.488  15.479  165.126 1.00 25.56  ?  151  ILE F CG1   1 
ATOM   1179 C  CG2   . ILE A 1 152 ? 71.875  17.420  165.386 1.00 25.45  ?  151  ILE F CG2   1 
ATOM   1180 C  CD1   . ILE A 1 152 ? 73.046  14.959  163.756 1.00 22.12  ?  151  ILE F CD1   1 
ATOM   1181 N  N     . ALA A 1 153 ? 70.728  16.453  168.669 1.00 22.45  ?  152  ALA F N     1 
ATOM   1182 C  CA    . ALA A 1 153 ? 69.670  17.165  169.370 1.00 27.11  ?  152  ALA F CA    1 
ATOM   1183 C  C     . ALA A 1 153 ? 70.160  17.820  170.657 1.00 27.01  ?  152  ALA F C     1 
ATOM   1184 O  O     . ALA A 1 153 ? 69.649  18.882  171.033 1.00 26.05  ?  152  ALA F O     1 
ATOM   1185 C  CB    . ALA A 1 153 ? 68.500  16.211  169.658 1.00 23.18  ?  152  ALA F CB    1 
ATOM   1186 N  N     . SER A 1 154 ? 71.145  17.222  171.342 1.00 21.55  ?  153  SER F N     1 
ATOM   1187 C  CA    . SER A 1 154 ? 71.564  17.773  172.625 1.00 20.34  ?  153  SER F CA    1 
ATOM   1188 C  C     . SER A 1 154 ? 72.287  19.105  172.458 1.00 24.67  ?  153  SER F C     1 
ATOM   1189 O  O     . SER A 1 154 ? 72.330  19.890  173.406 1.00 27.84  ?  153  SER F O     1 
ATOM   1190 C  CB    . SER A 1 154 ? 72.452  16.786  173.401 1.00 22.61  ?  153  SER F CB    1 
ATOM   1191 O  OG    . SER A 1 154 ? 73.718  16.610  172.798 1.00 25.25  ?  153  SER F OG    1 
ATOM   1192 N  N     . ASP A 1 155 ? 72.813  19.385  171.264 1.00 26.27  ?  154  ASP F N     1 
ATOM   1193 C  CA    . ASP A 1 155 ? 73.407  20.687  170.972 1.00 34.65  ?  154  ASP F CA    1 
ATOM   1194 C  C     . ASP A 1 155 ? 72.388  21.775  170.646 1.00 44.65  ?  154  ASP F C     1 
ATOM   1195 O  O     . ASP A 1 155 ? 72.739  22.958  170.693 1.00 46.33  ?  154  ASP F O     1 
ATOM   1196 C  CB    . ASP A 1 155 ? 74.366  20.578  169.788 1.00 32.47  ?  154  ASP F CB    1 
ATOM   1197 C  CG    . ASP A 1 155 ? 75.730  20.123  170.186 1.00 42.06  ?  154  ASP F CG    1 
ATOM   1198 O  OD1   . ASP A 1 155 ? 76.018  20.099  171.400 1.00 55.43  ?  154  ASP F OD1   1 
ATOM   1199 O  OD2   . ASP A 1 155 ? 76.522  19.796  169.280 1.00 53.51  ?  154  ASP F OD2   1 
ATOM   1200 N  N     . MET A 1 156 ? 71.144  21.416  170.313 1.00 34.53  ?  155  MET F N     1 
ATOM   1201 C  CA    . MET A 1 156 ? 70.233  22.380  169.699 1.00 36.84  ?  155  MET F CA    1 
ATOM   1202 C  C     . MET A 1 156 ? 69.732  23.427  170.688 1.00 37.64  ?  155  MET F C     1 
ATOM   1203 O  O     . MET A 1 156 ? 69.466  24.571  170.302 1.00 38.84  ?  155  MET F O     1 
ATOM   1204 C  CB    . MET A 1 156 ? 69.048  21.646  169.076 1.00 43.10  ?  155  MET F CB    1 
ATOM   1205 C  CG    . MET A 1 156 ? 68.950  21.817  167.584 1.00 51.20  ?  155  MET F CG    1 
ATOM   1206 S  SD    . MET A 1 156 ? 68.895  20.237  166.736 1.00 51.08  ?  155  MET F SD    1 
ATOM   1207 C  CE    . MET A 1 156 ? 70.059  20.647  165.424 1.00 65.00  ?  155  MET F CE    1 
ATOM   1208 N  N     . ASN A 1 157 ? 69.593  23.058  171.953 1.00 31.45  ?  156  ASN F N     1 
ATOM   1209 C  CA    . ASN A 1 157 ? 69.022  23.911  172.980 1.00 34.99  ?  156  ASN F CA    1 
ATOM   1210 C  C     . ASN A 1 157 ? 69.988  24.094  174.145 1.00 32.50  ?  156  ASN F C     1 
ATOM   1211 O  O     . ASN A 1 157 ? 69.555  24.255  175.284 1.00 38.38  ?  156  ASN F O     1 
ATOM   1212 C  CB    . ASN A 1 157 ? 67.699  23.323  173.466 1.00 44.09  ?  156  ASN F CB    1 
ATOM   1213 C  CG    . ASN A 1 157 ? 66.561  24.329  173.476 1.00 45.30  ?  156  ASN F CG    1 
ATOM   1214 O  OD1   . ASN A 1 157 ? 66.623  25.397  172.841 1.00 39.26  ?  156  ASN F OD1   1 
ATOM   1215 N  ND2   . ASN A 1 157 ? 65.497  23.982  174.199 1.00 41.01  ?  156  ASN F ND2   1 
ATOM   1216 N  N     . LYS A 1 158 ? 71.299  24.070  173.880 1.00 28.74  ?  157  LYS F N     1 
ATOM   1217 C  CA    . LYS A 1 158 ? 72.294  24.332  174.927 1.00 27.87  ?  157  LYS F CA    1 
ATOM   1218 C  C     . LYS A 1 158 ? 72.462  25.834  175.119 1.00 24.61  ?  157  LYS F C     1 
ATOM   1219 O  O     . LYS A 1 158 ? 72.268  26.579  174.173 1.00 29.18  ?  157  LYS F O     1 
ATOM   1220 C  CB    A LYS A 1 158 ? 73.621  23.610  174.640 0.50 29.21  ?  157  LYS F CB    1 
ATOM   1221 C  CB    B LYS A 1 158 ? 73.673  23.791  174.527 0.50 29.43  ?  157  LYS F CB    1 
ATOM   1222 C  CG    A LYS A 1 158 ? 74.522  24.153  173.563 0.50 32.19  ?  157  LYS F CG    1 
ATOM   1223 C  CG    B LYS A 1 158 ? 73.923  22.328  174.629 0.50 32.85  ?  157  LYS F CG    1 
ATOM   1224 C  CD    A LYS A 1 158 ? 75.709  23.191  173.430 0.50 24.60  ?  157  LYS F CD    1 
ATOM   1225 C  CD    B LYS A 1 158 ? 75.401  22.066  174.368 0.50 28.91  ?  157  LYS F CD    1 
ATOM   1226 C  CE    A LYS A 1 158 ? 76.785  23.709  172.483 0.50 34.87  ?  157  LYS F CE    1 
ATOM   1227 C  CE    B LYS A 1 158 ? 75.871  20.809  175.057 0.50 34.23  ?  157  LYS F CE    1 
ATOM   1228 N  NZ    A LYS A 1 158 ? 76.303  23.839  171.083 0.50 29.74  ?  157  LYS F NZ    1 
ATOM   1229 N  NZ    B LYS A 1 158 ? 76.030  20.978  176.513 0.50 16.71  ?  157  LYS F NZ    1 
ATOM   1230 N  N     . PRO A 1 159 ? 72.816  26.284  176.339 1.00 25.29  ?  158  PRO F N     1 
ATOM   1231 C  CA    . PRO A 1 159 ? 73.000  25.504  177.567 1.00 27.61  ?  158  PRO F CA    1 
ATOM   1232 C  C     . PRO A 1 159 ? 71.710  25.291  178.334 1.00 26.44  ?  158  PRO F C     1 
ATOM   1233 O  O     . PRO A 1 159 ? 70.725  26.013  178.115 1.00 26.15  ?  158  PRO F O     1 
ATOM   1234 C  CB    . PRO A 1 159 ? 73.946  26.378  178.388 1.00 27.89  ?  158  PRO F CB    1 
ATOM   1235 C  CG    . PRO A 1 159 ? 73.547  27.761  178.013 1.00 26.14  ?  158  PRO F CG    1 
ATOM   1236 C  CD    . PRO A 1 159 ? 73.148  27.706  176.552 1.00 24.06  ?  158  PRO F CD    1 
ATOM   1237 N  N     . ASN A 1 160 ? 71.735  24.308  179.229 1.00 27.99  ?  159  ASN F N     1 
ATOM   1238 C  CA    . ASN A 1 160 ? 70.661  24.069  180.181 1.00 29.70  ?  159  ASN F CA    1 
ATOM   1239 C  C     . ASN A 1 160 ? 69.320  23.927  179.468 1.00 33.22  ?  159  ASN F C     1 
ATOM   1240 O  O     . ASN A 1 160 ? 68.305  24.488  179.877 1.00 30.26  ?  159  ASN F O     1 
ATOM   1241 C  CB    . ASN A 1 160 ? 70.619  25.178  181.233 1.00 34.76  ?  159  ASN F CB    1 
ATOM   1242 C  CG    . ASN A 1 160 ? 69.818  24.782  182.464 1.00 38.30  ?  159  ASN F CG    1 
ATOM   1243 O  OD1   . ASN A 1 160 ? 69.412  23.634  182.602 1.00 32.56  ?  159  ASN F OD1   1 
ATOM   1244 N  ND2   . ASN A 1 160 ? 69.590  25.734  183.363 1.00 41.01  ?  159  ASN F ND2   1 
ATOM   1245 N  N     . GLY A 1 161 ? 69.314  23.139  178.394 1.00 29.00  ?  160  GLY F N     1 
ATOM   1246 C  CA    . GLY A 1 161 ? 68.095  22.930  177.642 1.00 30.32  ?  160  GLY F CA    1 
ATOM   1247 C  C     . GLY A 1 161 ? 68.092  21.551  177.024 1.00 34.20  ?  160  GLY F C     1 
ATOM   1248 O  O     . GLY A 1 161 ? 69.066  20.805  177.117 1.00 25.32  ?  160  GLY F O     1 
ATOM   1249 N  N     . GLN A 1 162 ? 66.993  21.217  176.365 1.00 31.88  ?  161  GLN F N     1 
ATOM   1250 C  CA    . GLN A 1 162 ? 66.937  19.929  175.696 1.00 27.00  ?  161  GLN F CA    1 
ATOM   1251 C  C     . GLN A 1 162 ? 66.084  20.049  174.443 1.00 28.18  ?  161  GLN F C     1 
ATOM   1252 O  O     . GLN A 1 162 ? 65.384  21.046  174.224 1.00 31.23  ?  161  GLN F O     1 
ATOM   1253 C  CB    . GLN A 1 162 ? 66.425  18.833  176.644 1.00 27.02  ?  161  GLN F CB    1 
ATOM   1254 C  CG    . GLN A 1 162 ? 65.058  19.112  177.274 1.00 32.59  ?  161  GLN F CG    1 
ATOM   1255 C  CD    . GLN A 1 162 ? 64.629  17.981  178.199 1.00 35.01  ?  161  GLN F CD    1 
ATOM   1256 O  OE1   . GLN A 1 162 ? 65.259  17.734  179.222 1.00 32.73  ?  161  GLN F OE1   1 
ATOM   1257 N  NE2   . GLN A 1 162 ? 63.565  17.279  177.829 1.00 36.95  ?  161  GLN F NE2   1 
ATOM   1258 N  N     . PHE A 1 163 ? 66.167  19.024  173.603 1.00 24.46  ?  162  PHE F N     1 
ATOM   1259 C  CA    . PHE A 1 163 ? 65.472  19.024  172.325 1.00 24.00  ?  162  PHE F CA    1 
ATOM   1260 C  C     . PHE A 1 163 ? 65.083  17.592  171.995 1.00 28.06  ?  162  PHE F C     1 
ATOM   1261 O  O     . PHE A 1 163 ? 65.907  16.684  172.141 1.00 27.51  ?  162  PHE F O     1 
ATOM   1262 C  CB    . PHE A 1 163 ? 66.358  19.599  171.218 1.00 27.12  ?  162  PHE F CB    1 
ATOM   1263 C  CG    . PHE A 1 163 ? 65.623  19.851  169.935 1.00 33.95  ?  162  PHE F CG    1 
ATOM   1264 C  CD1   . PHE A 1 163 ? 64.735  20.917  169.834 1.00 39.84  ?  162  PHE F CD1   1 
ATOM   1265 C  CD2   . PHE A 1 163 ? 65.821  19.044  168.829 1.00 36.95  ?  162  PHE F CD2   1 
ATOM   1266 C  CE1   . PHE A 1 163 ? 64.043  21.147  168.662 1.00 47.53  ?  162  PHE F CE1   1 
ATOM   1267 C  CE2   . PHE A 1 163 ? 65.123  19.277  167.648 1.00 37.62  ?  162  PHE F CE2   1 
ATOM   1268 C  CZ    . PHE A 1 163 ? 64.242  20.328  167.569 1.00 44.30  ?  162  PHE F CZ    1 
ATOM   1269 N  N     . VAL A 1 164 ? 63.851  17.402  171.533 1.00 26.68  ?  163  VAL F N     1 
ATOM   1270 C  CA    . VAL A 1 164 ? 63.292  16.081  171.263 1.00 27.96  ?  163  VAL F CA    1 
ATOM   1271 C  C     . VAL A 1 164 ? 62.945  15.968  169.785 1.00 32.78  ?  163  VAL F C     1 
ATOM   1272 O  O     . VAL A 1 164 ? 62.233  16.820  169.246 1.00 30.62  ?  163  VAL F O     1 
ATOM   1273 C  CB    . VAL A 1 164 ? 62.039  15.819  172.111 1.00 28.95  ?  163  VAL F CB    1 
ATOM   1274 C  CG1   . VAL A 1 164 ? 61.521  14.401  171.844 1.00 29.98  ?  163  VAL F CG1   1 
ATOM   1275 C  CG2   . VAL A 1 164 ? 62.335  16.047  173.590 1.00 34.14  ?  163  VAL F CG2   1 
ATOM   1276 N  N     . ILE A 1 165 ? 63.395  14.890  169.146 1.00 28.23  ?  164  ILE F N     1 
ATOM   1277 C  CA    . ILE A 1 165 ? 63.036  14.580  167.766 1.00 26.27  ?  164  ILE F CA    1 
ATOM   1278 C  C     . ILE A 1 165 ? 62.225  13.289  167.777 1.00 32.68  ?  164  ILE F C     1 
ATOM   1279 O  O     . ILE A 1 165 ? 62.736  12.240  168.181 1.00 27.70  ?  164  ILE F O     1 
ATOM   1280 C  CB    . ILE A 1 165 ? 64.281  14.447  166.875 1.00 25.32  ?  164  ILE F CB    1 
ATOM   1281 C  CG1   . ILE A 1 165 ? 65.117  15.722  166.903 1.00 27.17  ?  164  ILE F CG1   1 
ATOM   1282 C  CG2   . ILE A 1 165 ? 63.897  14.141  165.435 1.00 28.26  ?  164  ILE F CG2   1 
ATOM   1283 C  CD1   . ILE A 1 165 ? 66.524  15.535  166.309 1.00 26.04  ?  164  ILE F CD1   1 
ATOM   1284 N  N     . THR A 1 166 ? 60.936  13.366  167.345 1.00 30.18  ?  165  THR F N     1 
ATOM   1285 C  CA    . THR A 1 166 ? 60.110  12.165  167.216 1.00 26.22  ?  165  THR F CA    1 
ATOM   1286 C  C     . THR A 1 166 ? 60.294  11.536  165.844 1.00 27.73  ?  165  THR F C     1 
ATOM   1287 O  O     . THR A 1 166 ? 60.743  12.197  164.904 1.00 28.41  ?  165  THR F O     1 
ATOM   1288 C  CB    . THR A 1 166 ? 58.630  12.518  167.396 1.00 30.25  ?  165  THR F CB    1 
ATOM   1289 O  OG1   . THR A 1 166 ? 58.238  13.412  166.350 1.00 33.89  ?  165  THR F OG1   1 
ATOM   1290 C  CG2   . THR A 1 166 ? 58.387  13.188  168.743 1.00 31.18  ?  165  THR F CG2   1 
ATOM   1291 N  N     . PRO A 1 167 ? 59.906  10.261  165.668 1.00 33.41  ?  166  PRO F N     1 
ATOM   1292 C  CA    . PRO A 1 167 ? 60.012  9.676   164.325 1.00 27.27  ?  166  PRO F CA    1 
ATOM   1293 C  C     . PRO A 1 167 ? 59.254  10.449  163.270 1.00 26.56  ?  166  PRO F C     1 
ATOM   1294 O  O     . PRO A 1 167 ? 59.705  10.520  162.118 1.00 29.94  ?  166  PRO F O     1 
ATOM   1295 C  CB    . PRO A 1 167 ? 59.446  8.258   164.517 1.00 34.27  ?  166  PRO F CB    1 
ATOM   1296 C  CG    . PRO A 1 167 ? 59.732  7.953   165.960 1.00 37.48  ?  166  PRO F CG    1 
ATOM   1297 C  CD    . PRO A 1 167 ? 59.554  9.249   166.684 1.00 32.56  ?  166  PRO F CD    1 
ATOM   1298 N  N     . ALA A 1 168 ? 58.097  11.022  163.622 1.00 32.12  ?  167  ALA F N     1 
ATOM   1299 C  CA    . ALA A 1 168 ? 57.351  11.824  162.656 1.00 32.83  ?  167  ALA F CA    1 
ATOM   1300 C  C     . ALA A 1 168 ? 58.152  13.039  162.198 1.00 32.26  ?  167  ALA F C     1 
ATOM   1301 O  O     . ALA A 1 168 ? 58.039  13.459  161.039 1.00 34.39  ?  167  ALA F O     1 
ATOM   1302 C  CB    . ALA A 1 168 ? 56.012  12.259  163.254 1.00 38.12  ?  167  ALA F CB    1 
ATOM   1303 N  N     . GLU A 1 169 ? 58.988  13.588  163.074 1.00 29.27  ?  168  GLU F N     1 
ATOM   1304 C  CA    . GLU A 1 169 ? 59.781  14.779  162.777 1.00 31.94  ?  168  GLU F CA    1 
ATOM   1305 C  C     . GLU A 1 169 ? 61.115  14.496  162.087 1.00 29.14  ?  168  GLU F C     1 
ATOM   1306 O  O     . GLU A 1 169 ? 61.781  15.449  161.661 1.00 28.36  ?  168  GLU F O     1 
ATOM   1307 C  CB    . GLU A 1 169 ? 60.064  15.541  164.070 1.00 34.57  ?  168  GLU F CB    1 
ATOM   1308 C  CG    . GLU A 1 169 ? 58.839  16.132  164.712 1.00 40.19  ?  168  GLU F CG    1 
ATOM   1309 C  CD    . GLU A 1 169 ? 59.122  16.612  166.115 1.00 56.06  ?  168  GLU F CD    1 
ATOM   1310 O  OE1   . GLU A 1 169 ? 59.947  15.979  166.801 1.00 51.84  ?  168  GLU F OE1   1 
ATOM   1311 O  OE2   . GLU A 1 169 ? 58.525  17.622  166.534 1.00 60.42  ?  168  GLU F OE2   1 
ATOM   1312 N  N     . VAL A 1 170 ? 61.522  13.228  161.968 1.00 25.95  ?  169  VAL F N     1 
ATOM   1313 C  CA    . VAL A 1 170 ? 62.859  12.918  161.443 1.00 26.54  ?  169  VAL F CA    1 
ATOM   1314 C  C     . VAL A 1 170 ? 63.032  13.347  159.999 1.00 25.11  ?  169  VAL F C     1 
ATOM   1315 O  O     . VAL A 1 170 ? 64.080  13.946  159.672 1.00 30.38  ?  169  VAL F O     1 
ATOM   1316 C  CB    . VAL A 1 170 ? 63.178  11.430  161.658 1.00 27.10  ?  169  VAL F CB    1 
ATOM   1317 C  CG1   . VAL A 1 170 ? 64.389  11.024  160.834 1.00 25.74  ?  169  VAL F CG1   1 
ATOM   1318 C  CG2   . VAL A 1 170 ? 63.427  11.135  163.141 1.00 23.54  ?  169  VAL F CG2   1 
ATOM   1319 N  N     . PRO A 1 171 ? 62.111  13.081  159.068 1.00 27.82  ?  170  PRO F N     1 
ATOM   1320 C  CA    . PRO A 1 171 ? 62.333  13.522  157.676 1.00 27.50  ?  170  PRO F CA    1 
ATOM   1321 C  C     . PRO A 1 171 ? 62.565  15.017  157.510 1.00 26.89  ?  170  PRO F C     1 
ATOM   1322 O  O     . PRO A 1 171 ? 63.493  15.424  156.795 1.00 29.13  ?  170  PRO F O     1 
ATOM   1323 C  CB    . PRO A 1 171 ? 61.048  13.087  156.977 1.00 28.01  ?  170  PRO F CB    1 
ATOM   1324 C  CG    . PRO A 1 171 ? 60.708  11.835  157.686 1.00 31.28  ?  170  PRO F CG    1 
ATOM   1325 C  CD    . PRO A 1 171 ? 60.981  12.128  159.141 1.00 32.68  ?  170  PRO F CD    1 
ATOM   1326 N  N     . ALA A 1 172 ? 61.716  15.845  158.113 1.00 29.96  ?  171  ALA F N     1 
ATOM   1327 C  CA    . ALA A 1 172 ? 61.902  17.287  157.993 1.00 30.88  ?  171  ALA F CA    1 
ATOM   1328 C  C     . ALA A 1 172 ? 63.220  17.703  158.619 1.00 30.92  ?  171  ALA F C     1 
ATOM   1329 O  O     . ALA A 1 172 ? 63.913  18.586  158.095 1.00 32.83  ?  171  ALA F O     1 
ATOM   1330 C  CB    . ALA A 1 172 ? 60.733  18.024  158.643 1.00 33.92  ?  171  ALA F CB    1 
ATOM   1331 N  N     . PHE A 1 173 ? 63.602  17.047  159.718 1.00 29.29  ?  172  PHE F N     1 
ATOM   1332 C  CA    . PHE A 1 173 ? 64.848  17.402  160.384 1.00 33.96  ?  172  PHE F CA    1 
ATOM   1333 C  C     . PHE A 1 173 ? 66.049  17.100  159.497 1.00 34.15  ?  172  PHE F C     1 
ATOM   1334 O  O     . PHE A 1 173 ? 66.959  17.926  159.375 1.00 29.78  ?  172  PHE F O     1 
ATOM   1335 C  CB    . PHE A 1 173 ? 64.966  16.669  161.724 1.00 30.62  ?  172  PHE F CB    1 
ATOM   1336 C  CG    . PHE A 1 173 ? 66.137  17.118  162.550 1.00 30.02  ?  172  PHE F CG    1 
ATOM   1337 C  CD1   . PHE A 1 173 ? 66.074  18.308  163.284 1.00 36.06  ?  172  PHE F CD1   1 
ATOM   1338 C  CD2   . PHE A 1 173 ? 67.316  16.385  162.566 1.00 28.33  ?  172  PHE F CD2   1 
ATOM   1339 C  CE1   . PHE A 1 173 ? 67.174  18.738  164.037 1.00 36.97  ?  172  PHE F CE1   1 
ATOM   1340 C  CE2   . PHE A 1 173 ? 68.414  16.814  163.315 1.00 28.81  ?  172  PHE F CE2   1 
ATOM   1341 C  CZ    . PHE A 1 173 ? 68.341  17.987  164.046 1.00 28.38  ?  172  PHE F CZ    1 
ATOM   1342 N  N     . LEU A 1 174 ? 66.054  15.932  158.851 1.00 29.55  ?  173  LEU F N     1 
ATOM   1343 C  CA    . LEU A 1 174 ? 67.170  15.519  158.001 1.00 26.08  ?  173  LEU F CA    1 
ATOM   1344 C  C     . LEU A 1 174 ? 67.340  16.398  156.768 1.00 29.02  ?  173  LEU F C     1 
ATOM   1345 O  O     . LEU A 1 174 ? 68.457  16.527  156.261 1.00 28.25  ?  173  LEU F O     1 
ATOM   1346 C  CB    . LEU A 1 174 ? 66.955  14.080  157.523 1.00 24.71  ?  173  LEU F CB    1 
ATOM   1347 C  CG    . LEU A 1 174 ? 67.066  12.972  158.542 1.00 28.55  ?  173  LEU F CG    1 
ATOM   1348 C  CD1   . LEU A 1 174 ? 66.438  11.727  157.899 1.00 27.90  ?  173  LEU F CD1   1 
ATOM   1349 C  CD2   . LEU A 1 174 ? 68.547  12.742  158.954 1.00 23.68  ?  173  LEU F CD2   1 
ATOM   1350 N  N     . GLN A 1 175 ? 66.248  16.947  156.230 1.00 33.06  ?  174  GLN F N     1 
ATOM   1351 C  CA    . GLN A 1 175 ? 66.281  17.465  154.862 1.00 33.36  ?  174  GLN F CA    1 
ATOM   1352 C  C     . GLN A 1 175 ? 67.352  18.534  154.684 1.00 32.40  ?  174  GLN F C     1 
ATOM   1353 O  O     . GLN A 1 175 ? 68.067  18.544  153.675 1.00 36.10  ?  174  GLN F O     1 
ATOM   1354 C  CB    . GLN A 1 175 ? 64.910  18.018  154.469 1.00 35.80  ?  174  GLN F CB    1 
ATOM   1355 C  CG    . GLN A 1 175 ? 64.802  18.363  152.982 1.00 34.71  ?  174  GLN F CG    1 
ATOM   1356 C  CD    . GLN A 1 175 ? 64.906  17.140  152.082 1.00 41.14  ?  174  GLN F CD    1 
ATOM   1357 O  OE1   . GLN A 1 175 ? 64.496  16.039  152.459 1.00 40.26  ?  174  GLN F OE1   1 
ATOM   1358 N  NE2   . GLN A 1 175 ? 65.454  17.330  150.883 1.00 43.94  ?  174  GLN F NE2   1 
ATOM   1359 N  N     . THR A 1 176 ? 67.464  19.456  155.640 1.00 30.81  ?  175  THR F N     1 
ATOM   1360 C  CA    . THR A 1 176 ? 68.446  20.536  155.573 1.00 30.10  ?  175  THR F CA    1 
ATOM   1361 C  C     . THR A 1 176 ? 69.550  20.374  156.608 1.00 27.81  ?  175  THR F C     1 
ATOM   1362 O  O     . THR A 1 176 ? 70.328  21.303  156.821 1.00 29.05  ?  175  THR F O     1 
ATOM   1363 C  CB    . THR A 1 176 ? 67.782  21.906  155.739 1.00 40.93  ?  175  THR F CB    1 
ATOM   1364 O  OG1   . THR A 1 176 ? 67.293  22.041  157.081 1.00 43.45  ?  175  THR F OG1   1 
ATOM   1365 C  CG2   . THR A 1 176 ? 66.638  22.099  154.736 1.00 42.11  ?  175  THR F CG2   1 
ATOM   1366 N  N     . LEU A 1 177 ? 69.629  19.219  157.251 1.00 26.12  ?  176  LEU F N     1 
ATOM   1367 C  CA    . LEU A 1 177 ? 70.662  18.964  158.239 1.00 27.19  ?  176  LEU F CA    1 
ATOM   1368 C  C     . LEU A 1 177 ? 72.034  18.923  157.579 1.00 30.25  ?  176  LEU F C     1 
ATOM   1369 O  O     . LEU A 1 177 ? 72.279  18.051  156.729 1.00 29.26  ?  176  LEU F O     1 
ATOM   1370 C  CB    . LEU A 1 177 ? 70.367  17.642  158.947 1.00 27.93  ?  176  LEU F CB    1 
ATOM   1371 C  CG    . LEU A 1 177 ? 71.458  17.081  159.858 1.00 32.91  ?  176  LEU F CG    1 
ATOM   1372 C  CD1   . LEU A 1 177 ? 71.708  18.022  161.016 1.00 34.42  ?  176  LEU F CD1   1 
ATOM   1373 C  CD2   . LEU A 1 177 ? 71.070  15.691  160.356 1.00 30.42  ?  176  LEU F CD2   1 
ATOM   1374 N  N     . PRO A 1 178 ? 72.951  19.820  157.935 1.00 29.27  ?  177  PRO F N     1 
ATOM   1375 C  CA    . PRO A 1 178 ? 74.295  19.777  157.348 1.00 23.89  ?  177  PRO F CA    1 
ATOM   1376 C  C     . PRO A 1 178 ? 74.991  18.470  157.670 1.00 26.07  ?  177  PRO F C     1 
ATOM   1377 O  O     . PRO A 1 178 ? 74.925  17.974  158.793 1.00 28.05  ?  177  PRO F O     1 
ATOM   1378 C  CB    . PRO A 1 178 ? 75.015  20.959  158.009 1.00 30.70  ?  177  PRO F CB    1 
ATOM   1379 C  CG    . PRO A 1 178 ? 73.923  21.851  158.505 1.00 31.84  ?  177  PRO F CG    1 
ATOM   1380 C  CD    . PRO A 1 178 ? 72.774  20.974  158.846 1.00 26.08  ?  177  PRO F CD    1 
ATOM   1381 N  N     . LEU A 1 179 ? 75.682  17.926  156.671 1.00 26.47  ?  178  LEU F N     1 
ATOM   1382 C  CA    . LEU A 1 179 ? 76.410  16.677  156.875 1.00 26.34  ?  178  LEU F CA    1 
ATOM   1383 C  C     . LEU A 1 179 ? 77.448  16.809  157.980 1.00 23.20  ?  178  LEU F C     1 
ATOM   1384 O  O     . LEU A 1 179 ? 77.661  15.870  158.760 1.00 25.89  ?  178  LEU F O     1 
ATOM   1385 C  CB    . LEU A 1 179 ? 77.059  16.254  155.561 1.00 27.97  ?  178  LEU F CB    1 
ATOM   1386 C  CG    . LEU A 1 179 ? 75.963  15.936  154.537 1.00 24.91  ?  178  LEU F CG    1 
ATOM   1387 C  CD1   . LEU A 1 179 ? 76.568  15.791  153.155 1.00 29.19  ?  178  LEU F CD1   1 
ATOM   1388 C  CD2   . LEU A 1 179 ? 75.218  14.657  154.949 1.00 25.20  ?  178  LEU F CD2   1 
ATOM   1389 N  N     . ALA A 1 180 ? 78.089  17.980  158.085 1.00 24.57  ?  179  ALA F N     1 
ATOM   1390 C  CA    . ALA A 1 180 ? 79.138  18.161  159.084 1.00 28.69  ?  179  ALA F CA    1 
ATOM   1391 C  C     . ALA A 1 180 ? 78.608  18.021  160.505 1.00 25.88  ?  179  ALA F C     1 
ATOM   1392 O  O     . ALA A 1 180 ? 79.391  17.789  161.429 1.00 29.58  ?  179  ALA F O     1 
ATOM   1393 C  CB    . ALA A 1 180 ? 79.806  19.534  158.890 1.00 33.56  ?  179  ALA F CB    1 
ATOM   1394 N  N     . LYS A 1 181 ? 77.292  18.136  160.701 1.00 25.95  ?  180  LYS F N     1 
ATOM   1395 C  CA    . LYS A 1 181 ? 76.712  17.935  162.025 1.00 23.08  ?  180  LYS F CA    1 
ATOM   1396 C  C     . LYS A 1 181 ? 76.714  16.473  162.441 1.00 23.37  ?  180  LYS F C     1 
ATOM   1397 O  O     . LYS A 1 181 ? 76.621  16.179  163.637 1.00 28.57  ?  180  LYS F O     1 
ATOM   1398 C  CB    . LYS A 1 181 ? 75.276  18.484  162.061 1.00 26.77  ?  180  LYS F CB    1 
ATOM   1399 C  CG    . LYS A 1 181 ? 75.174  20.016  162.081 1.00 37.17  ?  180  LYS F CG    1 
ATOM   1400 C  CD    . LYS A 1 181 ? 75.795  20.598  163.352 1.00 48.11  ?  180  LYS F CD    1 
ATOM   1401 C  CE    . LYS A 1 181 ? 75.360  22.049  163.593 1.00 58.90  ?  180  LYS F CE    1 
ATOM   1402 N  NZ    . LYS A 1 181 ? 74.365  22.172  164.711 1.00 62.09  ?  180  LYS F NZ    1 
ATOM   1403 N  N     . ILE A 1 182 ? 76.819  15.553  161.493 1.00 26.72  ?  181  ILE F N     1 
ATOM   1404 C  CA    . ILE A 1 182 ? 76.873  14.131  161.850 1.00 22.69  ?  181  ILE F CA    1 
ATOM   1405 C  C     . ILE A 1 182 ? 78.198  13.844  162.544 1.00 21.51  ?  181  ILE F C     1 
ATOM   1406 O  O     . ILE A 1 182 ? 79.257  14.176  161.994 1.00 23.68  ?  181  ILE F O     1 
ATOM   1407 C  CB    . ILE A 1 182 ? 76.724  13.267  160.602 1.00 23.43  ?  181  ILE F CB    1 
ATOM   1408 C  CG1   . ILE A 1 182 ? 75.380  13.552  159.913 1.00 30.85  ?  181  ILE F CG1   1 
ATOM   1409 C  CG2   . ILE A 1 182 ? 76.818  11.800  160.976 1.00 23.76  ?  181  ILE F CG2   1 
ATOM   1410 C  CD1   . ILE A 1 182 ? 75.328  13.017  158.512 1.00 26.95  ?  181  ILE F CD1   1 
ATOM   1411 N  N     . PRO A 1 183 ? 78.194  13.236  163.732 1.00 25.65  ?  182  PRO F N     1 
ATOM   1412 C  CA    . PRO A 1 183 ? 79.458  12.838  164.364 1.00 29.88  ?  182  PRO F CA    1 
ATOM   1413 C  C     . PRO A 1 183 ? 80.183  11.830  163.487 1.00 22.45  ?  182  PRO F C     1 
ATOM   1414 O  O     . PRO A 1 183 ? 79.598  10.830  163.053 1.00 28.12  ?  182  PRO F O     1 
ATOM   1415 C  CB    . PRO A 1 183 ? 79.006  12.215  165.692 1.00 35.12  ?  182  PRO F CB    1 
ATOM   1416 C  CG    . PRO A 1 183 ? 77.613  12.772  165.928 1.00 31.85  ?  182  PRO F CG    1 
ATOM   1417 C  CD    . PRO A 1 183 ? 77.022  12.921  164.571 1.00 29.65  ?  182  PRO F CD    1 
ATOM   1418 N  N     . GLY A 1 184 ? 81.462  12.093  163.230 1.00 21.09  ?  183  GLY F N     1 
ATOM   1419 C  CA    . GLY A 1 184 ? 82.257  11.306  162.317 1.00 28.01  ?  183  GLY F CA    1 
ATOM   1420 C  C     . GLY A 1 184 ? 82.464  11.958  160.967 1.00 27.27  ?  183  GLY F C     1 
ATOM   1421 O  O     . GLY A 1 184 ? 83.382  11.569  160.236 1.00 25.93  ?  183  GLY F O     1 
ATOM   1422 N  N     . VAL A 1 185 ? 81.626  12.926  160.617 1.00 26.00  ?  184  VAL F N     1 
ATOM   1423 C  CA    . VAL A 1 185 ? 81.817  13.745  159.431 1.00 24.91  ?  184  VAL F CA    1 
ATOM   1424 C  C     . VAL A 1 185 ? 82.538  14.997  159.912 1.00 22.63  ?  184  VAL F C     1 
ATOM   1425 O  O     . VAL A 1 185 ? 81.924  15.890  160.497 1.00 25.94  ?  184  VAL F O     1 
ATOM   1426 C  CB    . VAL A 1 185 ? 80.488  14.065  158.745 1.00 24.69  ?  184  VAL F CB    1 
ATOM   1427 C  CG1   . VAL A 1 185 ? 80.706  14.973  157.538 1.00 27.94  ?  184  VAL F CG1   1 
ATOM   1428 C  CG2   . VAL A 1 185 ? 79.774  12.756  158.351 1.00 27.12  ?  184  VAL F CG2   1 
ATOM   1429 N  N     . GLY A 1 186 ? 83.854  15.051  159.692 1.00 23.15  ?  185  GLY F N     1 
ATOM   1430 C  CA    . GLY A 1 186 ? 84.666  16.171  160.115 1.00 28.97  ?  185  GLY F CA    1 
ATOM   1431 C  C     . GLY A 1 186 ? 84.955  17.132  158.980 1.00 24.59  ?  185  GLY F C     1 
ATOM   1432 O  O     . GLY A 1 186 ? 84.338  17.092  157.914 1.00 27.44  ?  185  GLY F O     1 
ATOM   1433 N  N     . LYS A 1 187 ? 85.936  18.014  159.225 1.00 29.02  ?  186  LYS F N     1 
ATOM   1434 C  CA    . LYS A 1 187 ? 86.229  19.098  158.291 1.00 30.25  ?  186  LYS F CA    1 
ATOM   1435 C  C     . LYS A 1 187 ? 86.634  18.565  156.927 1.00 30.66  ?  186  LYS F C     1 
ATOM   1436 O  O     . LYS A 1 187 ? 86.177  19.063  155.893 1.00 30.77  ?  186  LYS F O     1 
ATOM   1437 C  CB    . LYS A 1 187 ? 87.355  19.983  158.840 1.00 40.49  ?  186  LYS F CB    1 
ATOM   1438 C  CG    . LYS A 1 187 ? 87.041  20.680  160.143 1.00 62.88  ?  186  LYS F CG    1 
ATOM   1439 C  CD    . LYS A 1 187 ? 86.793  22.167  159.929 1.00 76.70  ?  186  LYS F CD    1 
ATOM   1440 C  CE    . LYS A 1 187 ? 85.455  22.580  160.521 1.00 78.35  ?  186  LYS F CE    1 
ATOM   1441 N  NZ    . LYS A 1 187 ? 85.269  22.011  161.888 1.00 75.28  ?  186  LYS F NZ    1 
ATOM   1442 N  N     . VAL A 1 188 ? 87.528  17.577  156.911 1.00 26.72  ?  187  VAL F N     1 
ATOM   1443 C  CA    . VAL A 1 188 ? 88.038  17.033  155.657 1.00 34.88  ?  187  VAL F CA    1 
ATOM   1444 C  C     . VAL A 1 188 ? 86.912  16.381  154.869 1.00 34.13  ?  187  VAL F C     1 
ATOM   1445 O  O     . VAL A 1 188 ? 86.761  16.615  153.664 1.00 32.59  ?  187  VAL F O     1 
ATOM   1446 C  CB    . VAL A 1 188 ? 89.185  16.042  155.927 1.00 35.73  ?  187  VAL F CB    1 
ATOM   1447 C  CG1   . VAL A 1 188 ? 89.661  15.416  154.626 1.00 43.36  ?  187  VAL F CG1   1 
ATOM   1448 C  CG2   . VAL A 1 188 ? 90.338  16.743  156.631 1.00 33.98  ?  187  VAL F CG2   1 
ATOM   1449 N  N     . SER A 1 189 ? 86.094  15.562  155.541 1.00 24.94  ?  188  SER F N     1 
ATOM   1450 C  CA    . SER A 1 189 ? 84.998  14.901  154.847 1.00 25.54  ?  188  SER F CA    1 
ATOM   1451 C  C     . SER A 1 189 ? 83.964  15.908  154.366 1.00 30.42  ?  188  SER F C     1 
ATOM   1452 O  O     . SER A 1 189 ? 83.448  15.787  153.250 1.00 32.18  ?  188  SER F O     1 
ATOM   1453 C  CB    . SER A 1 189 ? 84.350  13.851  155.748 1.00 24.12  ?  188  SER F CB    1 
ATOM   1454 O  OG    . SER A 1 189 ? 85.338  12.933  156.219 1.00 30.42  ?  188  SER F OG    1 
ATOM   1455 N  N     . ALA A 1 190 ? 83.642  16.905  155.189 1.00 26.41  ?  189  ALA F N     1 
ATOM   1456 C  CA    . ALA A 1 190 ? 82.620  17.864  154.777 1.00 34.47  ?  189  ALA F CA    1 
ATOM   1457 C  C     . ALA A 1 190 ? 83.075  18.667  153.571 1.00 37.44  ?  189  ALA F C     1 
ATOM   1458 O  O     . ALA A 1 190 ? 82.254  19.024  152.711 1.00 34.16  ?  189  ALA F O     1 
ATOM   1459 C  CB    . ALA A 1 190 ? 82.262  18.797  155.933 1.00 25.37  ?  189  ALA F CB    1 
ATOM   1460 N  N     . ALA A 1 191 ? 84.378  18.951  153.492 1.00 34.62  ?  190  ALA F N     1 
ATOM   1461 C  CA    . ALA A 1 191 ? 84.936  19.658  152.347 1.00 35.39  ?  190  ALA F CA    1 
ATOM   1462 C  C     . ALA A 1 191 ? 84.887  18.799  151.093 1.00 36.23  ?  190  ALA F C     1 
ATOM   1463 O  O     . ALA A 1 191 ? 84.534  19.290  150.015 1.00 37.43  ?  190  ALA F O     1 
ATOM   1464 C  CB    . ALA A 1 191 ? 86.371  20.087  152.651 1.00 35.06  ?  190  ALA F CB    1 
ATOM   1465 N  N     . LYS A 1 192 ? 85.225  17.512  151.208 1.00 36.64  ?  191  LYS F N     1 
ATOM   1466 C  CA    . LYS A 1 192 ? 85.143  16.633  150.044 1.00 37.76  ?  191  LYS F CA    1 
ATOM   1467 C  C     . LYS A 1 192 ? 83.698  16.453  149.602 1.00 41.27  ?  191  LYS F C     1 
ATOM   1468 O  O     . LYS A 1 192 ? 83.410  16.383  148.400 1.00 42.58  ?  191  LYS F O     1 
ATOM   1469 C  CB    . LYS A 1 192 ? 85.781  15.270  150.342 1.00 44.30  ?  191  LYS F CB    1 
ATOM   1470 C  CG    . LYS A 1 192 ? 87.218  15.340  150.864 1.00 54.98  ?  191  LYS F CG    1 
ATOM   1471 C  CD    . LYS A 1 192 ? 87.997  16.513  150.263 1.00 58.80  ?  191  LYS F CD    1 
ATOM   1472 C  CE    . LYS A 1 192 ? 89.243  16.847  151.079 1.00 51.86  ?  191  LYS F CE    1 
ATOM   1473 N  NZ    . LYS A 1 192 ? 90.325  15.828  150.876 1.00 51.58  ?  191  LYS F NZ    1 
ATOM   1474 N  N     . LEU A 1 193 ? 82.776  16.362  150.561 1.00 27.57  ?  192  LEU F N     1 
ATOM   1475 C  CA    . LEU A 1 193 ? 81.363  16.246  150.217 1.00 26.22  ?  192  LEU F CA    1 
ATOM   1476 C  C     . LEU A 1 193 ? 80.851  17.548  149.601 1.00 34.67  ?  192  LEU F C     1 
ATOM   1477 O  O     . LEU A 1 193 ? 80.119  17.539  148.604 1.00 35.45  ?  192  LEU F O     1 
ATOM   1478 C  CB    . LEU A 1 193 ? 80.566  15.870  151.463 1.00 25.09  ?  192  LEU F CB    1 
ATOM   1479 C  CG    . LEU A 1 193 ? 80.805  14.422  151.950 1.00 28.57  ?  192  LEU F CG    1 
ATOM   1480 C  CD1   . LEU A 1 193 ? 80.379  14.228  153.402 1.00 29.84  ?  192  LEU F CD1   1 
ATOM   1481 C  CD2   . LEU A 1 193 ? 80.109  13.417  151.043 1.00 33.81  ?  192  LEU F CD2   1 
ATOM   1482 N  N     . GLU A 1 194 ? 81.240  18.681  150.182 1.00 30.65  ?  193  GLU F N     1 
ATOM   1483 C  CA    . GLU A 1 194 ? 80.836  19.968  149.621 1.00 34.30  ?  193  GLU F CA    1 
ATOM   1484 C  C     . GLU A 1 194 ? 81.307  20.119  148.179 1.00 44.50  ?  193  GLU F C     1 
ATOM   1485 O  O     . GLU A 1 194 ? 80.576  20.644  147.330 1.00 43.45  ?  193  GLU F O     1 
ATOM   1486 C  CB    . GLU A 1 194 ? 81.382  21.107  150.486 1.00 33.61  ?  193  GLU F CB    1 
ATOM   1487 C  CG    . GLU A 1 194 ? 80.965  22.510  150.021 1.00 50.43  ?  193  GLU F CG    1 
ATOM   1488 C  CD    . GLU A 1 194 ? 79.604  22.910  150.559 1.00 71.06  ?  193  GLU F CD    1 
ATOM   1489 O  OE1   . GLU A 1 194 ? 79.186  22.343  151.592 1.00 75.55  ?  193  GLU F OE1   1 
ATOM   1490 O  OE2   . GLU A 1 194 ? 78.954  23.789  149.952 1.00 81.08  ?  193  GLU F OE2   1 
ATOM   1491 N  N     . ALA A 1 195 ? 82.520  19.656  147.877 1.00 42.03  ?  194  ALA F N     1 
ATOM   1492 C  CA    . ALA A 1 195 ? 83.061  19.824  146.536 1.00 47.34  ?  194  ALA F CA    1 
ATOM   1493 C  C     . ALA A 1 195 ? 82.348  18.967  145.500 1.00 49.59  ?  194  ALA F C     1 
ATOM   1494 O  O     . ALA A 1 195 ? 82.453  19.258  144.306 1.00 61.95  ?  194  ALA F O     1 
ATOM   1495 C  CB    . ALA A 1 195 ? 84.556  19.516  146.520 1.00 40.88  ?  194  ALA F CB    1 
ATOM   1496 N  N     . MET A 1 196 ? 81.634  17.920  145.907 1.00 37.57  ?  195  MET F N     1 
ATOM   1497 C  CA    . MET A 1 196 ? 80.786  17.205  144.965 1.00 43.34  ?  195  MET F CA    1 
ATOM   1498 C  C     . MET A 1 196 ? 79.326  17.626  145.077 1.00 44.89  ?  195  MET F C     1 
ATOM   1499 O  O     . MET A 1 196 ? 78.439  16.888  144.635 1.00 46.77  ?  195  MET F O     1 
ATOM   1500 C  CB    . MET A 1 196 ? 80.929  15.690  145.131 1.00 46.60  ?  195  MET F CB    1 
ATOM   1501 C  CG    . MET A 1 196 ? 81.031  15.192  146.550 1.00 52.39  ?  195  MET F CG    1 
ATOM   1502 S  SD    . MET A 1 196 ? 81.335  13.411  146.588 1.00 53.23  ?  195  MET F SD    1 
ATOM   1503 C  CE    . MET A 1 196 ? 82.864  13.331  145.652 1.00 59.43  ?  195  MET F CE    1 
ATOM   1504 N  N     . GLY A 1 197 ? 79.065  18.804  145.648 1.00 38.93  ?  196  GLY F N     1 
ATOM   1505 C  CA    . GLY A 1 197 ? 77.709  19.300  145.766 1.00 45.27  ?  196  GLY F CA    1 
ATOM   1506 C  C     . GLY A 1 197 ? 76.865  18.658  146.842 1.00 40.59  ?  196  GLY F C     1 
ATOM   1507 O  O     . GLY A 1 197 ? 75.636  18.712  146.757 1.00 41.88  ?  196  GLY F O     1 
ATOM   1508 N  N     . LEU A 1 198 ? 77.473  18.059  147.864 1.00 34.88  ?  197  LEU F N     1 
ATOM   1509 C  CA    . LEU A 1 198 ? 76.726  17.408  148.939 1.00 36.95  ?  197  LEU F CA    1 
ATOM   1510 C  C     . LEU A 1 198 ? 76.979  18.167  150.234 1.00 39.60  ?  197  LEU F C     1 
ATOM   1511 O  O     . LEU A 1 198 ? 78.072  18.084  150.802 1.00 35.76  ?  197  LEU F O     1 
ATOM   1512 C  CB    . LEU A 1 198 ? 77.128  15.940  149.081 1.00 30.99  ?  197  LEU F CB    1 
ATOM   1513 C  CG    . LEU A 1 198 ? 76.984  15.101  147.808 1.00 34.87  ?  197  LEU F CG    1 
ATOM   1514 C  CD1   . LEU A 1 198 ? 77.473  13.688  148.030 1.00 41.13  ?  197  LEU F CD1   1 
ATOM   1515 C  CD2   . LEU A 1 198 ? 75.543  15.113  147.297 1.00 34.59  ?  197  LEU F CD2   1 
ATOM   1516 N  N     . ARG A 1 199 ? 75.963  18.867  150.718 1.00 34.81  ?  198  ARG F N     1 
ATOM   1517 C  CA    . ARG A 1 199 ? 76.074  19.659  151.931 1.00 30.00  ?  198  ARG F CA    1 
ATOM   1518 C  C     . ARG A 1 199 ? 75.163  19.180  153.041 1.00 27.09  ?  198  ARG F C     1 
ATOM   1519 O  O     . ARG A 1 199 ? 75.544  19.269  154.209 1.00 29.97  ?  198  ARG F O     1 
ATOM   1520 C  CB    . ARG A 1 199 ? 75.759  21.142  151.638 1.00 27.65  ?  198  ARG F CB    1 
ATOM   1521 C  CG    . ARG A 1 199 ? 76.014  22.066  152.824 1.00 29.58  ?  198  ARG F CG    1 
ATOM   1522 C  CD    . ARG A 1 199 ? 75.603  23.553  152.541 1.00 32.85  ?  198  ARG F CD    1 
ATOM   1523 N  NE    . ARG A 1 199 ? 74.148  23.673  152.424 1.00 36.93  ?  198  ARG F NE    1 
ATOM   1524 C  CZ    . ARG A 1 199 ? 73.334  23.845  153.462 1.00 37.10  ?  198  ARG F CZ    1 
ATOM   1525 N  NH1   . ARG A 1 199 ? 73.836  23.934  154.689 1.00 38.68  ?  198  ARG F NH1   1 
ATOM   1526 N  NH2   . ARG A 1 199 ? 72.021  23.928  153.276 1.00 42.32  ?  198  ARG F NH2   1 
ATOM   1527 N  N     . THR A 1 200 ? 73.986  18.656  152.706 1.00 27.96  ?  199  THR F N     1 
ATOM   1528 C  CA    . THR A 1 200 ? 72.966  18.283  153.673 1.00 31.18  ?  199  THR F CA    1 
ATOM   1529 C  C     . THR A 1 200 ? 72.620  16.813  153.511 1.00 26.38  ?  199  THR F C     1 
ATOM   1530 O  O     . THR A 1 200 ? 72.942  16.189  152.498 1.00 27.30  ?  199  THR F O     1 
ATOM   1531 C  CB    . THR A 1 200 ? 71.686  19.108  153.498 1.00 30.03  ?  199  THR F CB    1 
ATOM   1532 O  OG1   . THR A 1 200 ? 71.057  18.748  152.264 1.00 32.87  ?  199  THR F OG1   1 
ATOM   1533 C  CG2   . THR A 1 200 ? 71.997  20.606  153.483 1.00 33.97  ?  199  THR F CG2   1 
ATOM   1534 N  N     . CYS A 1 201 ? 71.897  16.283  154.500 1.00 24.60  ?  200  CYS F N     1 
ATOM   1535 C  CA    . CYS A 1 201 ? 71.392  14.917  154.365 1.00 26.67  ?  200  CYS F CA    1 
ATOM   1536 C  C     . CYS A 1 201 ? 70.400  14.820  153.224 1.00 27.69  ?  200  CYS F C     1 
ATOM   1537 O  O     . CYS A 1 201 ? 70.339  13.791  152.549 1.00 28.61  ?  200  CYS F O     1 
ATOM   1538 C  CB    . CYS A 1 201 ? 70.744  14.456  155.657 1.00 25.91  ?  200  CYS F CB    1 
ATOM   1539 S  SG    . CYS A 1 201 ? 71.945  14.285  156.978 1.00 29.67  ?  200  CYS F SG    1 
ATOM   1540 N  N     . GLY A 1 202 ? 69.632  15.890  152.986 1.00 31.51  ?  201  GLY F N     1 
ATOM   1541 C  CA    . GLY A 1 202 ? 68.747  15.916  151.837 1.00 34.55  ?  201  GLY F CA    1 
ATOM   1542 C  C     . GLY A 1 202 ? 69.478  15.715  150.525 1.00 31.34  ?  201  GLY F C     1 
ATOM   1543 O  O     . GLY A 1 202 ? 68.978  15.033  149.625 1.00 38.48  ?  201  GLY F O     1 
ATOM   1544 N  N     . ASP A 1 203 ? 70.671  16.298  150.400 1.00 32.15  ?  202  ASP F N     1 
ATOM   1545 C  CA    . ASP A 1 203 ? 71.488  16.097  149.204 1.00 38.44  ?  202  ASP F CA    1 
ATOM   1546 C  C     . ASP A 1 203 ? 71.911  14.640  149.063 1.00 41.55  ?  202  ASP F C     1 
ATOM   1547 O  O     . ASP A 1 203 ? 71.852  14.065  147.969 1.00 43.47  ?  202  ASP F O     1 
ATOM   1548 C  CB    . ASP A 1 203 ? 72.737  16.984  149.245 1.00 35.05  ?  202  ASP F CB    1 
ATOM   1549 C  CG    . ASP A 1 203 ? 72.425  18.472  149.343 1.00 39.90  ?  202  ASP F CG    1 
ATOM   1550 O  OD1   . ASP A 1 203 ? 71.340  18.910  148.902 1.00 37.47  ?  202  ASP F OD1   1 
ATOM   1551 O  OD2   . ASP A 1 203 ? 73.305  19.212  149.842 1.00 38.59  ?  202  ASP F OD2   1 
ATOM   1552 N  N     . VAL A 1 204 ? 72.380  14.037  150.157 1.00 31.59  ?  203  VAL F N     1 
ATOM   1553 C  CA    . VAL A 1 204 ? 72.850  12.657  150.092 1.00 26.10  ?  203  VAL F CA    1 
ATOM   1554 C  C     . VAL A 1 204 ? 71.696  11.713  149.797 1.00 34.61  ?  203  VAL F C     1 
ATOM   1555 O  O     . VAL A 1 204 ? 71.891  10.657  149.181 1.00 39.93  ?  203  VAL F O     1 
ATOM   1556 C  CB    . VAL A 1 204 ? 73.594  12.297  151.392 1.00 24.86  ?  203  VAL F CB    1 
ATOM   1557 C  CG1   . VAL A 1 204 ? 73.896  10.798  151.468 1.00 30.15  ?  203  VAL F CG1   1 
ATOM   1558 C  CG2   . VAL A 1 204 ? 74.884  13.070  151.452 1.00 24.76  ?  203  VAL F CG2   1 
ATOM   1559 N  N     . GLN A 1 205 ? 70.476  12.071  150.210 1.00 32.16  ?  204  GLN F N     1 
ATOM   1560 C  CA    . GLN A 1 205 ? 69.328  11.221  149.901 1.00 34.64  ?  204  GLN F CA    1 
ATOM   1561 C  C     . GLN A 1 205 ? 69.124  11.080  148.403 1.00 41.27  ?  204  GLN F C     1 
ATOM   1562 O  O     . GLN A 1 205 ? 68.589  10.065  147.944 1.00 43.57  ?  204  GLN F O     1 
ATOM   1563 C  CB    . GLN A 1 205 ? 68.069  11.779  150.546 1.00 33.13  ?  204  GLN F CB    1 
ATOM   1564 C  CG    . GLN A 1 205 ? 68.028  11.602  152.043 1.00 33.46  ?  204  GLN F CG    1 
ATOM   1565 C  CD    . GLN A 1 205 ? 66.913  12.396  152.675 1.00 35.23  ?  204  GLN F CD    1 
ATOM   1566 O  OE1   . GLN A 1 205 ? 66.016  12.881  151.984 1.00 40.45  ?  204  GLN F OE1   1 
ATOM   1567 N  NE2   . GLN A 1 205 ? 66.956  12.528  153.993 1.00 32.15  ?  204  GLN F NE2   1 
ATOM   1568 N  N     . LYS A 1 206 ? 69.535  12.077  147.629 1.00 43.04  ?  205  LYS F N     1 
ATOM   1569 C  CA    . LYS A 1 206 ? 69.467  12.018  146.175 1.00 50.86  ?  205  LYS F CA    1 
ATOM   1570 C  C     . LYS A 1 206 ? 70.620  11.232  145.558 1.00 54.30  ?  205  LYS F C     1 
ATOM   1571 O  O     . LYS A 1 206 ? 70.778  11.262  144.332 1.00 55.58  ?  205  LYS F O     1 
ATOM   1572 C  CB    . LYS A 1 206 ? 69.445  13.434  145.590 1.00 50.66  ?  205  LYS F CB    1 
ATOM   1573 C  CG    . LYS A 1 206 ? 68.260  14.284  146.021 1.00 52.97  ?  205  LYS F CG    1 
ATOM   1574 C  CD    . LYS A 1 206 ? 68.541  15.751  145.756 1.00 61.52  ?  205  LYS F CD    1 
ATOM   1575 C  CE    . LYS A 1 206 ? 67.480  16.655  146.365 1.00 66.02  ?  205  LYS F CE    1 
ATOM   1576 N  NZ    . LYS A 1 206 ? 67.820  18.104  146.201 1.00 67.46  ?  205  LYS F NZ    1 
ATOM   1577 N  N     . CYS A 1 207 ? 71.426  10.540  146.361 1.00 45.75  ?  206  CYS F N     1 
ATOM   1578 C  CA    . CYS A 1 207 ? 72.584  9.810   145.867 1.00 44.23  ?  206  CYS F CA    1 
ATOM   1579 C  C     . CYS A 1 207 ? 72.342  8.306   145.890 1.00 37.30  ?  206  CYS F C     1 
ATOM   1580 O  O     . CYS A 1 207 ? 71.531  7.788   146.662 1.00 49.70  ?  206  CYS F O     1 
ATOM   1581 C  CB    . CYS A 1 207 ? 73.837  10.117  146.692 1.00 40.67  ?  206  CYS F CB    1 
ATOM   1582 S  SG    . CYS A 1 207 ? 74.473  11.762  146.462 1.00 46.01  ?  206  CYS F SG    1 
ATOM   1583 N  N     . ASP A 1 208 ? 73.100  7.620   145.036 1.00 33.59  ?  207  ASP F N     1 
ATOM   1584 C  CA    . ASP A 1 208 ? 73.085  6.167   144.923 1.00 35.40  ?  207  ASP F CA    1 
ATOM   1585 C  C     . ASP A 1 208 ? 74.044  5.582   145.947 1.00 31.45  ?  207  ASP F C     1 
ATOM   1586 O  O     . ASP A 1 208 ? 75.191  6.025   146.054 1.00 34.02  ?  207  ASP F O     1 
ATOM   1587 C  CB    . ASP A 1 208 ? 73.495  5.757   143.503 1.00 41.97  ?  207  ASP F CB    1 
ATOM   1588 C  CG    . ASP A 1 208 ? 73.360  4.274   143.240 1.00 68.32  ?  207  ASP F CG    1 
ATOM   1589 O  OD1   . ASP A 1 208 ? 73.805  3.455   144.070 1.00 71.31  ?  207  ASP F OD1   1 
ATOM   1590 O  OD2   . ASP A 1 208 ? 72.809  3.923   142.175 1.00 81.75  ?  207  ASP F OD2   1 
ATOM   1591 N  N     . LEU A 1 209 ? 73.583  4.566   146.682 1.00 39.51  ?  208  LEU F N     1 
ATOM   1592 C  CA    . LEU A 1 209 ? 74.474  3.885   147.615 1.00 31.12  ?  208  LEU F CA    1 
ATOM   1593 C  C     . LEU A 1 209 ? 75.723  3.371   146.910 1.00 31.07  ?  208  LEU F C     1 
ATOM   1594 O  O     . LEU A 1 209 ? 76.831  3.475   147.451 1.00 35.89  ?  208  LEU F O     1 
ATOM   1595 C  CB    . LEU A 1 209 ? 73.738  2.741   148.319 1.00 26.98  ?  208  LEU F CB    1 
ATOM   1596 C  CG    . LEU A 1 209 ? 74.572  1.825   149.224 1.00 30.38  ?  208  LEU F CG    1 
ATOM   1597 C  CD1   . LEU A 1 209 ? 75.160  2.589   150.407 1.00 31.72  ?  208  LEU F CD1   1 
ATOM   1598 C  CD2   . LEU A 1 209 ? 73.726  0.612   149.698 1.00 27.26  ?  208  LEU F CD2   1 
ATOM   1599 N  N     . VAL A 1 210 ? 75.572  2.819   145.700 1.00 35.89  ?  209  VAL F N     1 
ATOM   1600 C  CA    . VAL A 1 210 ? 76.731  2.244   145.015 1.00 40.61  ?  209  VAL F CA    1 
ATOM   1601 C  C     . VAL A 1 210 ? 77.792  3.311   144.777 1.00 40.85  ?  209  VAL F C     1 
ATOM   1602 O  O     . VAL A 1 210 ? 78.986  3.080   145.003 1.00 42.35  ?  209  VAL F O     1 
ATOM   1603 C  CB    . VAL A 1 210 ? 76.319  1.564   143.697 1.00 41.49  ?  209  VAL F CB    1 
ATOM   1604 C  CG1   . VAL A 1 210 ? 77.545  1.020   142.993 1.00 42.40  ?  209  VAL F CG1   1 
ATOM   1605 C  CG2   . VAL A 1 210 ? 75.328  0.431   143.954 1.00 35.75  ?  209  VAL F CG2   1 
ATOM   1606 N  N     . MET A 1 211 ? 77.378  4.497   144.333 1.00 42.15  ?  210  MET F N     1 
ATOM   1607 C  CA    . MET A 1 211 ? 78.347  5.561   144.094 1.00 45.63  ?  210  MET F CA    1 
ATOM   1608 C  C     . MET A 1 211 ? 79.068  5.936   145.383 1.00 46.22  ?  210  MET F C     1 
ATOM   1609 O  O     . MET A 1 211 ? 80.297  6.068   145.406 1.00 44.08  ?  210  MET F O     1 
ATOM   1610 C  CB    . MET A 1 211 ? 77.651  6.774   143.477 1.00 50.72  ?  210  MET F CB    1 
ATOM   1611 C  CG    . MET A 1 211 ? 78.572  7.961   143.212 1.00 58.89  ?  210  MET F CG    1 
ATOM   1612 S  SD    . MET A 1 211 ? 78.838  9.007   144.662 1.00 56.56  ?  210  MET F SD    1 
ATOM   1613 C  CE    . MET A 1 211 ? 77.210  9.719   144.891 1.00 58.36  ?  210  MET F CE    1 
ATOM   1614 N  N     . LEU A 1 212 ? 78.315  6.097   146.474 1.00 40.55  ?  211  LEU F N     1 
ATOM   1615 C  CA    . LEU A 1 212 ? 78.934  6.447   147.748 1.00 36.49  ?  211  LEU F CA    1 
ATOM   1616 C  C     . LEU A 1 212 ? 79.901  5.366   148.213 1.00 41.68  ?  211  LEU F C     1 
ATOM   1617 O  O     . LEU A 1 212 ? 80.952  5.670   148.791 1.00 48.33  ?  211  LEU F O     1 
ATOM   1618 C  CB    . LEU A 1 212 ? 77.859  6.705   148.803 1.00 33.07  ?  211  LEU F CB    1 
ATOM   1619 C  CG    . LEU A 1 212 ? 76.976  7.932   148.561 1.00 36.29  ?  211  LEU F CG    1 
ATOM   1620 C  CD1   . LEU A 1 212 ? 75.763  7.908   149.483 1.00 34.62  ?  211  LEU F CD1   1 
ATOM   1621 C  CD2   . LEU A 1 212 ? 77.765  9.224   148.730 1.00 35.21  ?  211  LEU F CD2   1 
ATOM   1622 N  N     . LEU A 1 213 ? 79.561  4.097   147.975 1.00 37.92  ?  212  LEU F N     1 
ATOM   1623 C  CA    . LEU A 1 213 ? 80.448  3.006   148.367 1.00 41.00  ?  212  LEU F CA    1 
ATOM   1624 C  C     . LEU A 1 213 ? 81.754  3.038   147.583 1.00 42.77  ?  212  LEU F C     1 
ATOM   1625 O  O     . LEU A 1 213 ? 82.827  2.812   148.152 1.00 46.92  ?  212  LEU F O     1 
ATOM   1626 C  CB    . LEU A 1 213 ? 79.739  1.661   148.189 1.00 34.96  ?  212  LEU F CB    1 
ATOM   1627 C  CG    . LEU A 1 213 ? 78.733  1.287   149.280 1.00 37.28  ?  212  LEU F CG    1 
ATOM   1628 C  CD1   . LEU A 1 213 ? 77.960  0.043   148.884 1.00 37.90  ?  212  LEU F CD1   1 
ATOM   1629 C  CD2   . LEU A 1 213 ? 79.461  1.063   150.598 1.00 44.57  ?  212  LEU F CD2   1 
ATOM   1630 N  N     . LYS A 1 214 ? 81.689  3.303   146.277 1.00 46.04  ?  213  LYS F N     1 
ATOM   1631 C  CA    . LYS A 1 214 ? 82.922  3.412   145.501 1.00 53.61  ?  213  LYS F CA    1 
ATOM   1632 C  C     . LYS A 1 214 ? 83.719  4.645   145.904 1.00 50.58  ?  213  LYS F C     1 
ATOM   1633 O  O     . LYS A 1 214 ? 84.952  4.598   145.986 1.00 57.41  ?  213  LYS F O     1 
ATOM   1634 C  CB    . LYS A 1 214 ? 82.611  3.455   144.006 1.00 59.68  ?  213  LYS F CB    1 
ATOM   1635 C  CG    . LYS A 1 214 ? 82.228  2.121   143.405 1.00 61.77  ?  213  LYS F CG    1 
ATOM   1636 C  CD    . LYS A 1 214 ? 82.397  2.133   141.894 1.00 67.49  ?  213  LYS F CD    1 
ATOM   1637 C  CE    . LYS A 1 214 ? 83.860  2.321   141.497 1.00 73.08  ?  213  LYS F CE    1 
ATOM   1638 N  NZ    . LYS A 1 214 ? 84.738  1.190   141.923 1.00 70.52  ?  213  LYS F NZ    1 
ATOM   1639 N  N     . ARG A 1 215 ? 83.028  5.750   146.172 1.00 49.01  ?  214  ARG F N     1 
ATOM   1640 C  CA    . ARG A 1 215 ? 83.675  7.032   146.424 1.00 49.59  ?  214  ARG F CA    1 
ATOM   1641 C  C     . ARG A 1 215 ? 84.208  7.168   147.848 1.00 49.14  ?  214  ARG F C     1 
ATOM   1642 O  O     . ARG A 1 215 ? 85.113  7.977   148.078 1.00 51.65  ?  214  ARG F O     1 
ATOM   1643 C  CB    . ARG A 1 215 ? 82.683  8.161   146.114 1.00 55.79  ?  214  ARG F CB    1 
ATOM   1644 C  CG    . ARG A 1 215 ? 83.212  9.578   146.264 1.00 63.98  ?  214  ARG F CG    1 
ATOM   1645 C  CD    . ARG A 1 215 ? 84.190  9.958   145.167 1.00 73.00  ?  214  ARG F CD    1 
ATOM   1646 N  NE    . ARG A 1 215 ? 85.570  9.940   145.640 1.00 76.26  ?  214  ARG F NE    1 
ATOM   1647 C  CZ    . ARG A 1 215 ? 86.592  10.456  144.969 1.00 79.03  ?  214  ARG F CZ    1 
ATOM   1648 N  NH1   . ARG A 1 215 ? 86.388  11.039  143.794 1.00 79.85  ?  214  ARG F NH1   1 
ATOM   1649 N  NH2   . ARG A 1 215 ? 87.818  10.393  145.475 1.00 79.24  ?  214  ARG F NH2   1 
ATOM   1650 N  N     . PHE A 1 216 ? 83.690  6.390   148.805 1.00 41.70  ?  215  PHE F N     1 
ATOM   1651 C  CA    . PHE A 1 216 ? 84.093  6.552   150.196 1.00 37.66  ?  215  PHE F CA    1 
ATOM   1652 C  C     . PHE A 1 216 ? 84.283  5.245   150.950 1.00 40.09  ?  215  PHE F C     1 
ATOM   1653 O  O     . PHE A 1 216 ? 84.643  5.291   152.130 1.00 42.27  ?  215  PHE F O     1 
ATOM   1654 C  CB    . PHE A 1 216 ? 83.065  7.398   150.966 1.00 40.12  ?  215  PHE F CB    1 
ATOM   1655 C  CG    . PHE A 1 216 ? 82.918  8.798   150.456 1.00 36.37  ?  215  PHE F CG    1 
ATOM   1656 C  CD1   . PHE A 1 216 ? 83.882  9.752   150.724 1.00 51.27  ?  215  PHE F CD1   1 
ATOM   1657 C  CD2   . PHE A 1 216 ? 81.801  9.166   149.725 1.00 37.57  ?  215  PHE F CD2   1 
ATOM   1658 C  CE1   . PHE A 1 216 ? 83.745  11.043  150.262 1.00 51.03  ?  215  PHE F CE1   1 
ATOM   1659 C  CE2   . PHE A 1 216 ? 81.659  10.466  149.261 1.00 49.82  ?  215  PHE F CE2   1 
ATOM   1660 C  CZ    . PHE A 1 216 ? 82.629  11.400  149.531 1.00 54.04  ?  215  PHE F CZ    1 
ATOM   1661 N  N     . GLY A 1 217 ? 84.037  4.092   150.333 1.00 37.82  ?  216  GLY F N     1 
ATOM   1662 C  CA    . GLY A 1 217 ? 84.123  2.858   151.088 1.00 39.67  ?  216  GLY F CA    1 
ATOM   1663 C  C     . GLY A 1 217 ? 83.038  2.778   152.149 1.00 45.47  ?  216  GLY F C     1 
ATOM   1664 O  O     . GLY A 1 217 ? 81.926  3.296   151.986 1.00 43.63  ?  216  GLY F O     1 
ATOM   1665 N  N     . LYS A 1 218 ? 83.382  2.131   153.268 1.00 38.64  ?  217  LYS F N     1 
ATOM   1666 C  CA    . LYS A 1 218 ? 82.409  1.911   154.333 1.00 39.22  ?  217  LYS F CA    1 
ATOM   1667 C  C     . LYS A 1 218 ? 81.829  3.223   154.844 1.00 36.27  ?  217  LYS F C     1 
ATOM   1668 O  O     . LYS A 1 218 ? 80.656  3.278   155.223 1.00 33.04  ?  217  LYS F O     1 
ATOM   1669 C  CB    . LYS A 1 218 ? 83.052  1.125   155.475 1.00 48.58  ?  217  LYS F CB    1 
ATOM   1670 C  CG    . LYS A 1 218 ? 83.681  -0.195  155.020 1.00 58.15  ?  217  LYS F CG    1 
ATOM   1671 C  CD    . LYS A 1 218 ? 84.113  -1.063  156.197 1.00 55.25  ?  217  LYS F CD    1 
ATOM   1672 C  CE    . LYS A 1 218 ? 84.846  -2.308  155.724 1.00 61.66  ?  217  LYS F CE    1 
ATOM   1673 N  NZ    . LYS A 1 218 ? 86.100  -1.969  154.991 1.00 69.27  ?  217  LYS F NZ    1 
ATOM   1674 N  N     . PHE A 1 219 ? 82.638  4.288   154.866 1.00 36.19  ?  218  PHE F N     1 
ATOM   1675 C  CA    . PHE A 1 219 ? 82.140  5.615   155.222 1.00 33.07  ?  218  PHE F CA    1 
ATOM   1676 C  C     . PHE A 1 219 ? 80.967  6.025   154.339 1.00 29.00  ?  218  PHE F C     1 
ATOM   1677 O  O     . PHE A 1 219 ? 80.042  6.714   154.791 1.00 30.27  ?  218  PHE F O     1 
ATOM   1678 C  CB    . PHE A 1 219 ? 83.286  6.627   155.103 1.00 27.78  ?  218  PHE F CB    1 
ATOM   1679 C  CG    . PHE A 1 219 ? 82.918  8.038   155.462 1.00 33.43  ?  218  PHE F CG    1 
ATOM   1680 C  CD1   . PHE A 1 219 ? 82.781  8.417   156.785 1.00 48.45  ?  218  PHE F CD1   1 
ATOM   1681 C  CD2   . PHE A 1 219 ? 82.774  9.000   154.480 1.00 35.59  ?  218  PHE F CD2   1 
ATOM   1682 C  CE1   . PHE A 1 219 ? 82.474  9.727   157.120 1.00 44.87  ?  218  PHE F CE1   1 
ATOM   1683 C  CE2   . PHE A 1 219 ? 82.462  10.319  154.808 1.00 39.59  ?  218  PHE F CE2   1 
ATOM   1684 C  CZ    . PHE A 1 219 ? 82.313  10.678  156.129 1.00 38.07  ?  218  PHE F CZ    1 
ATOM   1685 N  N     . GLY A 1 220 ? 81.005  5.634   153.064 1.00 26.25  ?  219  GLY F N     1 
ATOM   1686 C  CA    . GLY A 1 220 ? 79.916  5.959   152.159 1.00 30.34  ?  219  GLY F CA    1 
ATOM   1687 C  C     . GLY A 1 220 ? 78.605  5.288   152.525 1.00 29.85  ?  219  GLY F C     1 
ATOM   1688 O  O     . GLY A 1 220 ? 77.535  5.874   152.342 1.00 30.65  ?  219  GLY F O     1 
ATOM   1689 N  N     . ARG A 1 221 ? 78.664  4.064   153.050 1.00 28.32  ?  220  ARG F N     1 
ATOM   1690 C  CA    . ARG A 1 221 ? 77.452  3.430   153.557 1.00 26.70  ?  220  ARG F CA    1 
ATOM   1691 C  C     . ARG A 1 221 ? 76.943  4.139   154.805 1.00 26.28  ?  220  ARG F C     1 
ATOM   1692 O  O     . ARG A 1 221 ? 75.737  4.327   154.974 1.00 23.63  ?  220  ARG F O     1 
ATOM   1693 C  CB    . ARG A 1 221 ? 77.714  1.953   153.860 1.00 26.75  ?  220  ARG F CB    1 
ATOM   1694 C  CG    . ARG A 1 221 ? 76.515  1.261   154.533 1.00 26.13  ?  220  ARG F CG    1 
ATOM   1695 C  CD    . ARG A 1 221 ? 76.770  -0.228  154.797 1.00 25.90  ?  220  ARG F CD    1 
ATOM   1696 N  NE    . ARG A 1 221 ? 76.969  -0.972  153.556 1.00 25.34  ?  220  ARG F NE    1 
ATOM   1697 C  CZ    . ARG A 1 221 ? 75.977  -1.378  152.770 1.00 24.45  ?  220  ARG F CZ    1 
ATOM   1698 N  NH1   . ARG A 1 221 ? 74.718  -1.092  153.088 1.00 29.52  ?  220  ARG F NH1   1 
ATOM   1699 N  NH2   . ARG A 1 221 ? 76.246  -2.034  151.652 1.00 26.13  ?  220  ARG F NH2   1 
ATOM   1700 N  N     . ILE A 1 222 ? 77.848  4.554   155.692 1.00 25.16  ?  221  ILE F N     1 
ATOM   1701 C  CA    . ILE A 1 222 ? 77.408  5.276   156.884 1.00 24.64  ?  221  ILE F CA    1 
ATOM   1702 C  C     . ILE A 1 222 ? 76.750  6.605   156.491 1.00 23.46  ?  221  ILE F C     1 
ATOM   1703 O  O     . ILE A 1 222 ? 75.693  6.964   157.019 1.00 25.75  ?  221  ILE F O     1 
ATOM   1704 C  CB    . ILE A 1 222 ? 78.586  5.466   157.863 1.00 28.03  ?  221  ILE F CB    1 
ATOM   1705 C  CG1   . ILE A 1 222 ? 78.813  4.210   158.721 1.00 36.53  ?  221  ILE F CG1   1 
ATOM   1706 C  CG2   . ILE A 1 222 ? 78.313  6.578   158.836 1.00 30.25  ?  221  ILE F CG2   1 
ATOM   1707 C  CD1   . ILE A 1 222 ? 79.116  2.940   157.987 1.00 55.71  ?  221  ILE F CD1   1 
ATOM   1708 N  N     . LEU A 1 223 ? 77.329  7.323   155.527 1.00 24.38  ?  222  LEU F N     1 
ATOM   1709 C  CA    . LEU A 1 223 ? 76.709  8.563   155.050 1.00 24.94  ?  222  LEU F CA    1 
ATOM   1710 C  C     . LEU A 1 223 ? 75.324  8.296   154.477 1.00 25.51  ?  222  LEU F C     1 
ATOM   1711 O  O     . LEU A 1 223 ? 74.356  9.015   154.761 1.00 26.63  ?  222  LEU F O     1 
ATOM   1712 C  CB    . LEU A 1 223 ? 77.582  9.215   153.980 1.00 27.81  ?  222  LEU F CB    1 
ATOM   1713 C  CG    . LEU A 1 223 ? 78.717  10.145  154.351 1.00 43.11  ?  222  LEU F CG    1 
ATOM   1714 C  CD1   . LEU A 1 223 ? 79.502  10.427  153.085 1.00 38.92  ?  222  LEU F CD1   1 
ATOM   1715 C  CD2   . LEU A 1 223 ? 78.135  11.414  154.941 1.00 33.83  ?  222  LEU F CD2   1 
ATOM   1716 N  N     . TRP A 1 224 ? 75.222  7.275   153.633 1.00 28.12  ?  223  TRP F N     1 
ATOM   1717 C  CA    . TRP A 1 224 ? 73.936  6.918   153.057 1.00 28.37  ?  223  TRP F CA    1 
ATOM   1718 C  C     . TRP A 1 224 ? 72.913  6.616   154.150 1.00 29.91  ?  223  TRP F C     1 
ATOM   1719 O  O     . TRP A 1 224 ? 71.780  7.114   154.116 1.00 27.77  ?  223  TRP F O     1 
ATOM   1720 C  CB    . TRP A 1 224 ? 74.127  5.716   152.126 1.00 29.58  ?  223  TRP F CB    1 
ATOM   1721 C  CG    . TRP A 1 224 ? 72.895  5.340   151.413 1.00 30.54  ?  223  TRP F CG    1 
ATOM   1722 C  CD1   . TRP A 1 224 ? 72.431  5.867   150.240 1.00 32.81  ?  223  TRP F CD1   1 
ATOM   1723 C  CD2   . TRP A 1 224 ? 71.936  4.369   151.827 1.00 32.02  ?  223  TRP F CD2   1 
ATOM   1724 N  NE1   . TRP A 1 224 ? 71.242  5.275   149.895 1.00 33.31  ?  223  TRP F NE1   1 
ATOM   1725 C  CE2   . TRP A 1 224 ? 70.915  4.347   150.849 1.00 33.83  ?  223  TRP F CE2   1 
ATOM   1726 C  CE3   . TRP A 1 224 ? 71.843  3.504   152.925 1.00 30.69  ?  223  TRP F CE3   1 
ATOM   1727 C  CZ2   . TRP A 1 224 ? 69.812  3.496   150.938 1.00 37.24  ?  223  TRP F CZ2   1 
ATOM   1728 C  CZ3   . TRP A 1 224 ? 70.739  2.667   153.015 1.00 33.19  ?  223  TRP F CZ3   1 
ATOM   1729 C  CH2   . TRP A 1 224 ? 69.740  2.671   152.026 1.00 34.63  ?  223  TRP F CH2   1 
ATOM   1730 N  N     . GLU A 1 225 ? 73.306  5.811   155.145 1.00 27.99  ?  224  GLU F N     1 
ATOM   1731 C  CA    . GLU A 1 225 ? 72.392  5.447   156.222 1.00 23.62  ?  224  GLU F CA    1 
ATOM   1732 C  C     . GLU A 1 225 ? 71.966  6.668   157.024 1.00 25.54  ?  224  GLU F C     1 
ATOM   1733 O  O     . GLU A 1 225 ? 70.769  6.936   157.176 1.00 25.77  ?  224  GLU F O     1 
ATOM   1734 C  CB    . GLU A 1 225 ? 73.049  4.429   157.143 1.00 24.86  ?  224  GLU F CB    1 
ATOM   1735 C  CG    . GLU A 1 225 ? 73.178  3.045   156.545 1.00 24.80  ?  224  GLU F CG    1 
ATOM   1736 C  CD    . GLU A 1 225 ? 73.907  2.092   157.481 1.00 38.38  ?  224  GLU F CD    1 
ATOM   1737 O  OE1   . GLU A 1 225 ? 74.236  2.508   158.612 1.00 36.95  ?  224  GLU F OE1   1 
ATOM   1738 O  OE2   . GLU A 1 225 ? 74.166  0.940   157.087 1.00 37.37  ?  224  GLU F OE2   1 
ATOM   1739 N  N     . ARG A 1 226 ? 72.944  7.423   157.540 1.00 26.51  ?  225  ARG F N     1 
ATOM   1740 C  CA    . ARG A 1 226 ? 72.646  8.543   158.425 1.00 24.68  ?  225  ARG F CA    1 
ATOM   1741 C  C     . ARG A 1 226 ? 71.792  9.595   157.730 1.00 24.84  ?  225  ARG F C     1 
ATOM   1742 O  O     . ARG A 1 226 ? 70.948  10.227  158.368 1.00 31.35  ?  225  ARG F O     1 
ATOM   1743 C  CB    . ARG A 1 226 ? 73.940  9.182   158.924 1.00 23.22  ?  225  ARG F CB    1 
ATOM   1744 C  CG    . ARG A 1 226 ? 74.844  8.223   159.699 1.00 22.96  ?  225  ARG F CG    1 
ATOM   1745 C  CD    . ARG A 1 226 ? 74.226  7.737   160.982 1.00 25.30  ?  225  ARG F CD    1 
ATOM   1746 N  NE    . ARG A 1 226 ? 75.188  6.835   161.604 1.00 27.71  ?  225  ARG F NE    1 
ATOM   1747 C  CZ    . ARG A 1 226 ? 75.211  5.536   161.368 1.00 26.85  ?  225  ARG F CZ    1 
ATOM   1748 N  NH1   . ARG A 1 226 ? 74.293  5.000   160.566 1.00 23.68  ?  225  ARG F NH1   1 
ATOM   1749 N  NH2   . ARG A 1 226 ? 76.141  4.769   161.930 1.00 32.78  ?  225  ARG F NH2   1 
ATOM   1750 N  N     . SER A 1 227 ? 71.974  9.769   156.428 1.00 25.11  ?  226  SER F N     1 
ATOM   1751 C  CA    . SER A 1 227 ? 71.206  10.786  155.732 1.00 29.05  ?  226  SER F CA    1 
ATOM   1752 C  C     . SER A 1 227 ? 69.743  10.424  155.589 1.00 33.24  ?  226  SER F C     1 
ATOM   1753 O  O     . SER A 1 227 ? 68.956  11.287  155.207 1.00 40.33  ?  226  SER F O     1 
ATOM   1754 C  CB    . SER A 1 227 ? 71.798  11.059  154.358 1.00 24.88  ?  226  SER F CB    1 
ATOM   1755 O  OG    . SER A 1 227 ? 73.110  11.557  154.516 1.00 32.00  ?  226  SER F OG    1 
ATOM   1756 N  N     . GLN A 1 228 ? 69.344  9.187   155.877 1.00 32.82  ?  227  GLN F N     1 
ATOM   1757 C  CA    . GLN A 1 228 ? 67.917  8.925   155.976 1.00 39.01  ?  227  GLN F CA    1 
ATOM   1758 C  C     . GLN A 1 228 ? 67.506  8.511   157.376 1.00 28.65  ?  227  GLN F C     1 
ATOM   1759 O  O     . GLN A 1 228 ? 66.439  7.915   157.552 1.00 33.10  ?  227  GLN F O     1 
ATOM   1760 C  CB    . GLN A 1 228 ? 67.475  7.892   154.957 1.00 46.19  ?  227  GLN F CB    1 
ATOM   1761 C  CG    . GLN A 1 228 ? 68.389  6.767   154.800 1.00 38.07  ?  227  GLN F CG    1 
ATOM   1762 C  CD    . GLN A 1 228 ? 68.470  6.388   153.368 1.00 48.45  ?  227  GLN F CD    1 
ATOM   1763 O  OE1   . GLN A 1 228 ? 67.610  6.759   152.560 1.00 60.03  ?  227  GLN F OE1   1 
ATOM   1764 N  NE2   . GLN A 1 228 ? 69.517  5.680   153.021 1.00 45.77  ?  227  GLN F NE2   1 
ATOM   1765 N  N     . GLY A 1 229 ? 68.311  8.870   158.372 1.00 28.15  ?  228  GLY F N     1 
ATOM   1766 C  CA    . GLY A 1 229 ? 67.976  8.654   159.756 1.00 28.04  ?  228  GLY F CA    1 
ATOM   1767 C  C     . GLY A 1 229 ? 68.239  7.253   160.247 1.00 29.31  ?  228  GLY F C     1 
ATOM   1768 O  O     . GLY A 1 229 ? 67.823  6.928   161.361 1.00 26.42  ?  228  GLY F O     1 
ATOM   1769 N  N     . ILE A 1 230 ? 68.919  6.425   159.458 1.00 29.41  ?  229  ILE F N     1 
ATOM   1770 C  CA    . ILE A 1 230 ? 69.208  5.042   159.848 1.00 24.11  ?  229  ILE F CA    1 
ATOM   1771 C  C     . ILE A 1 230 ? 70.451  5.029   160.718 1.00 22.30  ?  229  ILE F C     1 
ATOM   1772 O  O     . ILE A 1 230 ? 71.504  5.558   160.329 1.00 26.16  ?  229  ILE F O     1 
ATOM   1773 C  CB    . ILE A 1 230 ? 69.417  4.153   158.618 1.00 23.93  ?  229  ILE F CB    1 
ATOM   1774 C  CG1   . ILE A 1 230 ? 68.130  4.055   157.802 1.00 30.15  ?  229  ILE F CG1   1 
ATOM   1775 C  CG2   . ILE A 1 230 ? 69.910  2.752   159.066 1.00 23.08  ?  229  ILE F CG2   1 
ATOM   1776 C  CD1   . ILE A 1 230 ? 68.317  3.353   156.475 1.00 32.77  ?  229  ILE F CD1   1 
ATOM   1777 N  N     . ASP A 1 231 ? 70.331  4.427   161.900 1.00 19.78  ?  230  ASP F N     1 
ATOM   1778 C  CA    . ASP A 1 231 ? 71.469  4.312   162.808 1.00 22.25  ?  230  ASP F CA    1 
ATOM   1779 C  C     . ASP A 1 231 ? 71.109  3.229   163.821 1.00 19.08  ?  230  ASP F C     1 
ATOM   1780 O  O     . ASP A 1 231 ? 70.541  3.515   164.876 1.00 22.92  ?  230  ASP F O     1 
ATOM   1781 C  CB    . ASP A 1 231 ? 71.775  5.633   163.489 1.00 23.57  ?  230  ASP F CB    1 
ATOM   1782 C  CG    . ASP A 1 231 ? 72.928  5.534   164.466 1.00 30.79  ?  230  ASP F CG    1 
ATOM   1783 O  OD1   . ASP A 1 231 ? 73.544  4.437   164.597 1.00 23.63  ?  230  ASP F OD1   1 
ATOM   1784 O  OD2   . ASP A 1 231 ? 73.221  6.562   165.100 1.00 24.14  ?  230  ASP F OD2   1 
ATOM   1785 N  N     . GLU A 1 232 ? 71.457  1.984   163.477 1.00 22.75  ?  231  GLU F N     1 
ATOM   1786 C  CA    . GLU A 1 232 ? 71.114  0.829   164.286 1.00 21.74  ?  231  GLU F CA    1 
ATOM   1787 C  C     . GLU A 1 232 ? 72.104  0.563   165.400 1.00 31.28  ?  231  GLU F C     1 
ATOM   1788 O  O     . GLU A 1 232 ? 71.976  -0.459  166.085 1.00 28.90  ?  231  GLU F O     1 
ATOM   1789 C  CB    . GLU A 1 232 ? 71.022  -0.430  163.407 1.00 27.30  ?  231  GLU F CB    1 
ATOM   1790 C  CG    . GLU A 1 232 ? 70.312  -0.231  162.094 1.00 40.83  ?  231  GLU F CG    1 
ATOM   1791 C  CD    . GLU A 1 232 ? 68.833  -0.427  162.192 1.00 58.44  ?  231  GLU F CD    1 
ATOM   1792 O  OE1   . GLU A 1 232 ? 68.231  -0.788  161.155 1.00 61.47  ?  231  GLU F OE1   1 
ATOM   1793 O  OE2   . GLU A 1 232 ? 68.276  -0.221  163.289 1.00 66.58  ?  231  GLU F OE2   1 
ATOM   1794 N  N     . ARG A 1 233 ? 73.109  1.416   165.574 1.00 23.82  ?  232  ARG F N     1 
ATOM   1795 C  CA    . ARG A 1 233 ? 74.101  1.157   166.609 1.00 29.20  ?  232  ARG F CA    1 
ATOM   1796 C  C     . ARG A 1 233 ? 73.423  1.090   167.969 1.00 26.43  ?  232  ARG F C     1 
ATOM   1797 O  O     . ARG A 1 233 ? 72.737  2.024   168.383 1.00 26.42  ?  232  ARG F O     1 
ATOM   1798 C  CB    . ARG A 1 233 ? 75.191  2.231   166.589 1.00 20.35  ?  232  ARG F CB    1 
ATOM   1799 C  CG    . ARG A 1 233 ? 75.978  2.263   165.267 1.00 23.98  ?  232  ARG F CG    1 
ATOM   1800 C  CD    . ARG A 1 233 ? 76.938  3.445   165.247 1.00 27.30  ?  232  ARG F CD    1 
ATOM   1801 N  NE    . ARG A 1 233 ? 76.183  4.696   165.395 1.00 23.67  ?  232  ARG F NE    1 
ATOM   1802 C  CZ    . ARG A 1 233 ? 76.654  5.792   165.981 1.00 28.52  ?  232  ARG F CZ    1 
ATOM   1803 N  NH1   . ARG A 1 233 ? 77.895  5.818   166.464 1.00 26.60  ?  232  ARG F NH1   1 
ATOM   1804 N  NH2   . ARG A 1 233 ? 75.883  6.866   166.083 1.00 22.83  ?  232  ARG F NH2   1 
ATOM   1805 N  N     . ASP A 1 234 ? 73.578  -0.040  168.646 1.00 21.72  ?  233  ASP F N     1 
ATOM   1806 C  CA    . ASP A 1 234 ? 72.995  -0.220  169.964 1.00 18.58  ?  233  ASP F CA    1 
ATOM   1807 C  C     . ASP A 1 234 ? 73.826  0.506   171.019 1.00 24.57  ?  233  ASP F C     1 
ATOM   1808 O  O     . ASP A 1 234 ? 75.050  0.603   170.915 1.00 28.19  ?  233  ASP F O     1 
ATOM   1809 C  CB    . ASP A 1 234 ? 72.929  -1.712  170.306 1.00 26.04  ?  233  ASP F CB    1 
ATOM   1810 C  CG    . ASP A 1 234 ? 71.800  -2.060  171.263 1.00 43.85  ?  233  ASP F CG    1 
ATOM   1811 O  OD1   . ASP A 1 234 ? 70.836  -1.280  171.407 1.00 40.21  ?  233  ASP F OD1   1 
ATOM   1812 O  OD2   . ASP A 1 234 ? 71.864  -3.158  171.858 1.00 62.42  ?  233  ASP F OD2   1 
ATOM   1813 N  N     . VAL A 1 235 ? 73.140  1.022   172.040 1.00 22.32  ?  234  VAL F N     1 
ATOM   1814 C  CA    . VAL A 1 235 ? 73.826  1.563   173.206 1.00 21.86  ?  234  VAL F CA    1 
ATOM   1815 C  C     . VAL A 1 235 ? 74.559  0.426   173.892 1.00 31.70  ?  234  VAL F C     1 
ATOM   1816 O  O     . VAL A 1 235 ? 73.965  -0.611  174.205 1.00 26.15  ?  234  VAL F O     1 
ATOM   1817 C  CB    . VAL A 1 235 ? 72.824  2.239   174.156 1.00 23.93  ?  234  VAL F CB    1 
ATOM   1818 C  CG1   . VAL A 1 235 ? 73.474  2.582   175.482 1.00 22.59  ?  234  VAL F CG1   1 
ATOM   1819 C  CG2   . VAL A 1 235 ? 72.246  3.522   173.517 1.00 20.16  ?  234  VAL F CG2   1 
ATOM   1820 N  N     . ASN A 1 236 ? 75.857  0.606   174.115 1.00 20.83  ?  235  ASN F N     1 
ATOM   1821 C  CA    . ASN A 1 236 ? 76.726  -0.478  174.575 1.00 24.92  ?  235  ASN F CA    1 
ATOM   1822 C  C     . ASN A 1 236 ? 77.368  -0.046  175.885 1.00 21.26  ?  235  ASN F C     1 
ATOM   1823 O  O     . ASN A 1 236 ? 78.135  0.920   175.916 1.00 23.36  ?  235  ASN F O     1 
ATOM   1824 C  CB    . ASN A 1 236 ? 77.769  -0.813  173.508 1.00 28.45  ?  235  ASN F CB    1 
ATOM   1825 C  CG    . ASN A 1 236 ? 78.721  -1.930  173.939 1.00 34.84  ?  235  ASN F CG    1 
ATOM   1826 O  OD1   . ASN A 1 236 ? 78.618  -2.459  175.040 1.00 33.91  ?  235  ASN F OD1   1 
ATOM   1827 N  ND2   . ASN A 1 236 ? 79.644  -2.286  173.060 1.00 38.15  ?  235  ASN F ND2   1 
ATOM   1828 N  N     . SER A 1 237 ? 77.043  -0.748  176.968 1.00 21.33  ?  236  SER F N     1 
ATOM   1829 C  CA    . SER A 1 237 ? 77.514  -0.393  178.296 1.00 20.03  ?  236  SER F CA    1 
ATOM   1830 C  C     . SER A 1 237 ? 78.772  -1.137  178.694 1.00 27.73  ?  236  SER F C     1 
ATOM   1831 O  O     . SER A 1 237 ? 79.173  -1.053  179.855 1.00 27.75  ?  236  SER F O     1 
ATOM   1832 C  CB    . SER A 1 237 ? 76.411  -0.644  179.334 1.00 28.64  ?  236  SER F CB    1 
ATOM   1833 O  OG    . SER A 1 237 ? 76.125  -2.035  179.460 1.00 31.10  ?  236  SER F OG    1 
ATOM   1834 N  N     . GLU A 1 238 ? 79.416  -1.835  177.759 1.00 26.16  ?  237  GLU F N     1 
ATOM   1835 C  CA    . GLU A 1 238 ? 80.511  -2.743  178.092 1.00 30.05  ?  237  GLU F CA    1 
ATOM   1836 C  C     . GLU A 1 238 ? 81.819  -2.390  177.392 1.00 30.72  ?  237  GLU F C     1 
ATOM   1837 O  O     . GLU A 1 238 ? 82.733  -3.221  177.351 1.00 26.12  ?  237  GLU F O     1 
ATOM   1838 C  CB    . GLU A 1 238 ? 80.111  -4.188  177.768 1.00 32.34  ?  237  GLU F CB    1 
ATOM   1839 C  CG    . GLU A 1 238 ? 78.908  -4.684  178.580 1.00 35.85  ?  237  GLU F CG    1 
ATOM   1840 C  CD    . GLU A 1 238 ? 78.474  -6.095  178.208 1.00 57.28  ?  237  GLU F CD    1 
ATOM   1841 O  OE1   . GLU A 1 238 ? 79.338  -6.920  177.842 1.00 50.49  ?  237  GLU F OE1   1 
ATOM   1842 O  OE2   . GLU A 1 238 ? 77.258  -6.375  178.278 1.00 70.10  ?  237  GLU F OE2   1 
ATOM   1843 N  N     . ARG A 1 239 ? 81.944  -1.178  176.850 1.00 22.22  ?  238  ARG F N     1 
ATOM   1844 C  CA    . ARG A 1 239 ? 83.187  -0.783  176.202 1.00 24.48  ?  238  ARG F CA    1 
ATOM   1845 C  C     . ARG A 1 239 ? 84.291  -0.607  177.229 1.00 26.18  ?  238  ARG F C     1 
ATOM   1846 O  O     . ARG A 1 239 ? 84.045  -0.182  178.363 1.00 28.22  ?  238  ARG F O     1 
ATOM   1847 C  CB    . ARG A 1 239 ? 82.986  0.516   175.416 1.00 27.57  ?  238  ARG F CB    1 
ATOM   1848 C  CG    . ARG A 1 239 ? 81.957  0.359   174.316 1.00 29.54  ?  238  ARG F CG    1 
ATOM   1849 C  CD    . ARG A 1 239 ? 81.686  1.699   173.641 1.00 31.38  ?  238  ARG F CD    1 
ATOM   1850 N  NE    . ARG A 1 239 ? 82.825  2.120   172.836 1.00 31.73  ?  238  ARG F NE    1 
ATOM   1851 C  CZ    . ARG A 1 239 ? 82.906  3.305   172.241 1.00 47.19  ?  238  ARG F CZ    1 
ATOM   1852 N  NH1   . ARG A 1 239 ? 81.908  4.175   172.375 1.00 38.40  ?  238  ARG F NH1   1 
ATOM   1853 N  NH2   . ARG A 1 239 ? 83.975  3.619   171.518 1.00 42.51  ?  238  ARG F NH2   1 
ATOM   1854 N  N     . LEU A 1 240 ? 85.524  -0.949  176.827 1.00 25.43  ?  239  LEU F N     1 
ATOM   1855 C  CA    . LEU A 1 240 ? 86.702  -0.832  177.675 1.00 21.95  ?  239  LEU F CA    1 
ATOM   1856 C  C     . LEU A 1 240 ? 87.810  -0.076  176.953 1.00 19.31  ?  239  LEU F C     1 
ATOM   1857 O  O     . LEU A 1 240 ? 87.965  -0.191  175.739 1.00 26.38  ?  239  LEU F O     1 
ATOM   1858 C  CB    . LEU A 1 240 ? 87.262  -2.204  178.075 1.00 32.15  ?  239  LEU F CB    1 
ATOM   1859 C  CG    . LEU A 1 240 ? 86.524  -3.095  179.078 1.00 41.02  ?  239  LEU F CG    1 
ATOM   1860 C  CD1   . LEU A 1 240 ? 85.872  -2.261  180.164 1.00 32.60  ?  239  LEU F CD1   1 
ATOM   1861 C  CD2   . LEU A 1 240 ? 85.534  -4.008  178.387 1.00 53.24  ?  239  LEU F CD2   1 
ATOM   1862 N  N     . ARG A 1 241 ? 88.586  0.675   177.728 1.00 21.46  ?  240  ARG F N     1 
ATOM   1863 C  CA    . ARG A 1 241 ? 89.738  1.407   177.196 1.00 26.85  ?  240  ARG F CA    1 
ATOM   1864 C  C     . ARG A 1 241 ? 90.769  0.447   176.607 1.00 30.09  ?  240  ARG F C     1 
ATOM   1865 O  O     . ARG A 1 241 ? 90.985  -0.650  177.127 1.00 28.48  ?  240  ARG F O     1 
ATOM   1866 C  CB    . ARG A 1 241 ? 90.379  2.249   178.296 1.00 29.52  ?  240  ARG F CB    1 
ATOM   1867 C  CG    . ARG A 1 241 ? 91.614  3.012   177.822 1.00 33.74  ?  240  ARG F CG    1 
ATOM   1868 C  CD    . ARG A 1 241 ? 92.099  4.070   178.795 1.00 41.54  ?  240  ARG F CD    1 
ATOM   1869 N  NE    . ARG A 1 241 ? 92.343  3.560   180.138 1.00 47.85  ?  240  ARG F NE    1 
ATOM   1870 C  CZ    . ARG A 1 241 ? 93.111  4.181   181.026 1.00 45.95  ?  240  ARG F CZ    1 
ATOM   1871 N  NH1   . ARG A 1 241 ? 93.716  5.311   180.695 1.00 47.09  ?  240  ARG F NH1   1 
ATOM   1872 N  NH2   . ARG A 1 241 ? 93.287  3.674   182.236 1.00 43.39  ?  240  ARG F NH2   1 
ATOM   1873 N  N     . LYS A 1 242 ? 91.399  0.856   175.501 1.00 25.68  ?  241  LYS F N     1 
ATOM   1874 C  CA    . LYS A 1 242 ? 92.314  -0.010  174.763 1.00 23.13  ?  241  LYS F CA    1 
ATOM   1875 C  C     . LYS A 1 242 ? 93.757  0.466   174.753 1.00 28.41  ?  241  LYS F C     1 
ATOM   1876 O  O     . LYS A 1 242 ? 94.634  -0.305  174.354 1.00 27.96  ?  241  LYS F O     1 
ATOM   1877 C  CB    . LYS A 1 242 ? 91.848  -0.168  173.312 1.00 23.04  ?  241  LYS F CB    1 
ATOM   1878 C  CG    . LYS A 1 242 ? 90.545  -0.904  173.204 1.00 30.94  ?  241  LYS F CG    1 
ATOM   1879 C  CD    . LYS A 1 242 ? 90.053  -0.990  171.781 1.00 34.54  ?  241  LYS F CD    1 
ATOM   1880 C  CE    . LYS A 1 242 ? 88.683  -1.685  171.765 1.00 37.66  ?  241  LYS F CE    1 
ATOM   1881 N  NZ    . LYS A 1 242 ? 88.109  -1.791  170.408 1.00 46.17  ?  241  LYS F NZ    1 
ATOM   1882 N  N     . SER A 1 243 ? 94.028  1.696   175.176 1.00 22.29  ?  242  SER F N     1 
ATOM   1883 C  CA    . SER A 1 243 ? 95.355  2.289   175.059 1.00 19.43  ?  242  SER F CA    1 
ATOM   1884 C  C     . SER A 1 243 ? 95.529  3.306   176.174 1.00 26.24  ?  242  SER F C     1 
ATOM   1885 O  O     . SER A 1 243 ? 94.556  3.786   176.756 1.00 25.12  ?  242  SER F O     1 
ATOM   1886 C  CB    . SER A 1 243 ? 95.568  2.968   173.696 1.00 25.08  ?  242  SER F CB    1 
ATOM   1887 O  OG    . SER A 1 243 ? 94.706  4.098   173.537 1.00 25.04  ?  242  SER F OG    1 
ATOM   1888 N  N     . VAL A 1 244 ? 96.790  3.613   176.479 1.00 22.13  ?  243  VAL F N     1 
ATOM   1889 C  CA    . VAL A 1 244 ? 97.150  4.633   177.455 1.00 27.30  ?  243  VAL F CA    1 
ATOM   1890 C  C     . VAL A 1 244 ? 98.307  5.410   176.853 1.00 29.66  ?  243  VAL F C     1 
ATOM   1891 O  O     . VAL A 1 244 ? 99.302  4.808   176.439 1.00 26.75  ?  243  VAL F O     1 
ATOM   1892 C  CB    . VAL A 1 244 ? 97.557  4.045   178.815 1.00 24.07  ?  243  VAL F CB    1 
ATOM   1893 C  CG1   . VAL A 1 244 ? 97.836  5.163   179.800 1.00 23.91  ?  243  VAL F CG1   1 
ATOM   1894 C  CG2   . VAL A 1 244 ? 96.498  3.090   179.353 1.00 26.76  ?  243  VAL F CG2   1 
ATOM   1895 N  N     . GLY A 1 245 ? 98.183  6.728   176.780 1.00 24.13  ?  244  GLY F N     1 
ATOM   1896 C  CA    . GLY A 1 245 ? 99.242  7.552   176.230 1.00 25.35  ?  244  GLY F CA    1 
ATOM   1897 C  C     . GLY A 1 245 ? 99.592  8.705   177.148 1.00 32.02  ?  244  GLY F C     1 
ATOM   1898 O  O     . GLY A 1 245 ? 98.747  9.217   177.880 1.00 25.11  ?  244  GLY F O     1 
ATOM   1899 N  N     . VAL A 1 246 ? 100.870 9.099   177.107 1.00 25.69  ?  245  VAL F N     1 
ATOM   1900 C  CA    . VAL A 1 246 ? 101.387 10.249  177.853 1.00 19.61  ?  245  VAL F CA    1 
ATOM   1901 C  C     . VAL A 1 246 ? 102.314 11.023  176.933 1.00 22.88  ?  245  VAL F C     1 
ATOM   1902 O  O     . VAL A 1 246 ? 103.343 10.494  176.499 1.00 25.57  ?  245  VAL F O     1 
ATOM   1903 C  CB    . VAL A 1 246 ? 102.143 9.850   179.130 1.00 23.54  ?  245  VAL F CB    1 
ATOM   1904 C  CG1   . VAL A 1 246 ? 102.522 11.093  179.896 1.00 32.76  ?  245  VAL F CG1   1 
ATOM   1905 C  CG2   . VAL A 1 246 ? 101.276 8.917   180.007 1.00 27.61  ?  245  VAL F CG2   1 
ATOM   1906 N  N     . GLU A 1 247 ? 101.975 12.279  176.651 1.00 24.37  ?  246  GLU F N     1 
ATOM   1907 C  CA    . GLU A 1 247 ? 102.774 13.070  175.733 1.00 21.47  ?  246  GLU F CA    1 
ATOM   1908 C  C     . GLU A 1 247 ? 102.762 14.516  176.186 1.00 24.03  ?  246  GLU F C     1 
ATOM   1909 O  O     . GLU A 1 247 ? 101.839 14.954  176.882 1.00 21.79  ?  246  GLU F O     1 
ATOM   1910 C  CB    . GLU A 1 247 ? 102.263 12.944  174.293 1.00 24.27  ?  246  GLU F CB    1 
ATOM   1911 C  CG    . GLU A 1 247 ? 100.896 13.570  174.004 1.00 27.50  ?  246  GLU F CG    1 
ATOM   1912 C  CD    . GLU A 1 247 ? 100.196 12.919  172.826 1.00 33.62  ?  246  GLU F CD    1 
ATOM   1913 O  OE1   . GLU A 1 247 ? 100.297 11.685  172.680 1.00 35.40  ?  246  GLU F OE1   1 
ATOM   1914 O  OE2   . GLU A 1 247 ? 99.517  13.631  172.053 1.00 33.37  ?  246  GLU F OE2   1 
ATOM   1915 N  N     . ARG A 1 248 ? 103.811 15.243  175.784 1.00 26.33  ?  247  ARG F N     1 
ATOM   1916 C  CA    . ARG A 1 248 ? 104.001 16.639  176.146 1.00 33.12  ?  247  ARG F CA    1 
ATOM   1917 C  C     . ARG A 1 248 ? 104.556 17.414  174.965 1.00 25.00  ?  247  ARG F C     1 
ATOM   1918 O  O     . ARG A 1 248 ? 105.512 16.981  174.317 1.00 27.11  ?  247  ARG F O     1 
ATOM   1919 C  CB    . ARG A 1 248 ? 104.964 16.797  177.342 1.00 38.59  ?  247  ARG F CB    1 
ATOM   1920 C  CG    . ARG A 1 248 ? 104.339 17.476  178.556 1.00 56.15  ?  247  ARG F CG    1 
ATOM   1921 C  CD    . ARG A 1 248 ? 103.056 16.766  178.830 1.00 53.04  ?  247  ARG F CD    1 
ATOM   1922 N  NE    . ARG A 1 248 ? 102.153 17.302  179.841 1.00 48.21  ?  247  ARG F NE    1 
ATOM   1923 C  CZ    . ARG A 1 248 ? 101.001 16.698  180.119 1.00 52.06  ?  247  ARG F CZ    1 
ATOM   1924 N  NH1   . ARG A 1 248 ? 100.676 15.605  179.433 1.00 38.45  ?  247  ARG F NH1   1 
ATOM   1925 N  NH2   . ARG A 1 248 ? 100.175 17.164  181.050 1.00 52.46  ?  247  ARG F NH2   1 
ATOM   1926 N  N     . THR A 1 249 ? 103.980 18.585  174.722 1.00 23.39  ?  248  THR F N     1 
ATOM   1927 C  CA    . THR A 1 249 ? 104.545 19.574  173.816 1.00 26.10  ?  248  THR F CA    1 
ATOM   1928 C  C     . THR A 1 249 ? 105.356 20.569  174.641 1.00 24.38  ?  248  THR F C     1 
ATOM   1929 O  O     . THR A 1 249 ? 104.861 21.096  175.648 1.00 28.54  ?  248  THR F O     1 
ATOM   1930 C  CB    . THR A 1 249 ? 103.447 20.304  173.039 1.00 29.57  ?  248  THR F CB    1 
ATOM   1931 O  OG1   . THR A 1 249 ? 102.735 19.384  172.197 1.00 25.69  ?  248  THR F OG1   1 
ATOM   1932 C  CG2   . THR A 1 249 ? 104.041 21.417  172.175 1.00 25.32  ?  248  THR F CG2   1 
ATOM   1933 N  N     . MET A 1 250 ? 106.602 20.787  174.244 1.00 32.00  ?  249  MET F N     1 
ATOM   1934 C  CA    . MET A 1 250 ? 107.513 21.655  174.978 1.00 29.61  ?  249  MET F CA    1 
ATOM   1935 C  C     . MET A 1 250 ? 107.305 23.118  174.593 1.00 36.18  ?  249  MET F C     1 
ATOM   1936 O  O     . MET A 1 250 ? 106.826 23.441  173.497 1.00 28.41  ?  249  MET F O     1 
ATOM   1937 C  CB    . MET A 1 250 ? 108.965 21.255  174.722 1.00 30.44  ?  249  MET F CB    1 
ATOM   1938 C  CG    . MET A 1 250 ? 109.518 20.266  175.719 1.00 47.76  ?  249  MET F CG    1 
ATOM   1939 S  SD    . MET A 1 250 ? 108.641 18.709  175.651 1.00 53.73  ?  249  MET F SD    1 
ATOM   1940 C  CE    . MET A 1 250 ? 108.902 18.311  173.923 1.00 30.18  ?  249  MET F CE    1 
ATOM   1941 N  N     . ALA A 1 251 ? 107.666 24.012  175.524 1.00 30.66  ?  250  ALA F N     1 
ATOM   1942 C  CA    . ALA A 1 251 ? 107.483 25.439  175.269 1.00 35.63  ?  250  ALA F CA    1 
ATOM   1943 C  C     . ALA A 1 251 ? 108.370 25.910  174.131 1.00 34.83  ?  250  ALA F C     1 
ATOM   1944 O  O     . ALA A 1 251 ? 108.001 26.832  173.394 1.00 37.97  ?  250  ALA F O     1 
ATOM   1945 C  CB    . ALA A 1 251 ? 107.760 26.250  176.535 1.00 36.62  ?  250  ALA F CB    1 
ATOM   1946 N  N     . GLU A 1 252 ? 109.543 25.304  173.988 1.00 34.87  ?  251  GLU F N     1 
ATOM   1947 C  CA    . GLU A 1 252 ? 110.458 25.527  172.878 1.00 33.83  ?  251  GLU F CA    1 
ATOM   1948 C  C     . GLU A 1 252 ? 110.764 24.181  172.241 1.00 29.83  ?  251  GLU F C     1 
ATOM   1949 O  O     . GLU A 1 252 ? 110.806 23.166  172.932 1.00 32.37  ?  251  GLU F O     1 
ATOM   1950 C  CB    . GLU A 1 252 ? 111.790 26.147  173.349 1.00 35.08  ?  251  GLU F CB    1 
ATOM   1951 C  CG    . GLU A 1 252 ? 111.660 27.354  174.256 1.00 56.38  ?  251  GLU F CG    1 
ATOM   1952 C  CD    . GLU A 1 252 ? 111.253 28.607  173.509 1.00 69.00  ?  251  GLU F CD    1 
ATOM   1953 O  OE1   . GLU A 1 252 ? 110.890 29.598  174.175 1.00 82.84  ?  251  GLU F OE1   1 
ATOM   1954 O  OE2   . GLU A 1 252 ? 111.301 28.607  172.261 1.00 69.85  ?  251  GLU F OE2   1 
ATOM   1955 N  N     . ASP A 1 253 ? 111.016 24.172  170.934 1.00 32.92  ?  252  ASP F N     1 
ATOM   1956 C  CA    . ASP A 1 253 ? 111.440 22.929  170.301 1.00 31.61  ?  252  ASP F CA    1 
ATOM   1957 C  C     . ASP A 1 253 ? 112.762 22.465  170.897 1.00 46.60  ?  252  ASP F C     1 
ATOM   1958 O  O     . ASP A 1 253 ? 113.602 23.271  171.306 1.00 39.76  ?  252  ASP F O     1 
ATOM   1959 C  CB    . ASP A 1 253 ? 111.619 23.103  168.788 1.00 31.75  ?  252  ASP F CB    1 
ATOM   1960 C  CG    . ASP A 1 253 ? 110.359 23.573  168.070 1.00 45.92  ?  252  ASP F CG    1 
ATOM   1961 O  OD1   . ASP A 1 253 ? 109.227 23.472  168.608 1.00 40.18  ?  252  ASP F OD1   1 
ATOM   1962 O  OD2   . ASP A 1 253 ? 110.524 24.040  166.923 1.00 45.31  ?  252  ASP F OD2   1 
ATOM   1963 N  N     . ILE A 1 254 ? 112.949 21.147  170.938 1.00 35.73  ?  253  ILE F N     1 
ATOM   1964 C  CA    . ILE A 1 254 ? 114.228 20.570  171.323 1.00 33.85  ?  253  ILE F CA    1 
ATOM   1965 C  C     . ILE A 1 254 ? 114.954 20.169  170.053 1.00 32.95  ?  253  ILE F C     1 
ATOM   1966 O  O     . ILE A 1 254 ? 114.335 19.872  169.023 1.00 35.28  ?  253  ILE F O     1 
ATOM   1967 C  CB    . ILE A 1 254 ? 114.074 19.374  172.282 1.00 34.93  ?  253  ILE F CB    1 
ATOM   1968 C  CG1   . ILE A 1 254 ? 113.382 18.214  171.570 1.00 34.19  ?  253  ILE F CG1   1 
ATOM   1969 C  CG2   . ILE A 1 254 ? 113.301 19.797  173.540 1.00 41.35  ?  253  ILE F CG2   1 
ATOM   1970 C  CD1   . ILE A 1 254 ? 113.257 16.972  172.427 1.00 35.96  ?  253  ILE F CD1   1 
ATOM   1971 N  N     . HIS A 1 255 ? 116.284 20.195  170.118 1.00 34.56  ?  254  HIS F N     1 
ATOM   1972 C  CA    . HIS A 1 255 ? 117.114 19.888  168.967 1.00 37.76  ?  254  HIS F CA    1 
ATOM   1973 C  C     . HIS A 1 255 ? 118.185 18.862  169.272 1.00 41.76  ?  254  HIS F C     1 
ATOM   1974 O  O     . HIS A 1 255 ? 118.967 18.523  168.376 1.00 37.95  ?  254  HIS F O     1 
ATOM   1975 C  CB    . HIS A 1 255 ? 117.779 21.165  168.427 1.00 38.50  ?  254  HIS F CB    1 
ATOM   1976 C  CG    . HIS A 1 255 ? 116.815 22.120  167.801 1.00 40.95  ?  254  HIS F CG    1 
ATOM   1977 N  ND1   . HIS A 1 255 ? 116.129 23.067  168.531 1.00 40.63  ?  254  HIS F ND1   1 
ATOM   1978 C  CD2   . HIS A 1 255 ? 116.406 22.262  166.518 1.00 44.31  ?  254  HIS F CD2   1 
ATOM   1979 C  CE1   . HIS A 1 255 ? 115.350 23.761  167.722 1.00 41.36  ?  254  HIS F CE1   1 
ATOM   1980 N  NE2   . HIS A 1 255 ? 115.500 23.294  166.495 1.00 49.64  ?  254  HIS F NE2   1 
ATOM   1981 N  N     . HIS A 1 256 ? 118.240 18.354  170.501 1.00 35.78  ?  255  HIS F N     1 
ATOM   1982 C  CA    . HIS A 1 256 ? 119.320 17.491  170.946 1.00 40.26  ?  255  HIS F CA    1 
ATOM   1983 C  C     . HIS A 1 256 ? 118.731 16.250  171.588 1.00 36.15  ?  255  HIS F C     1 
ATOM   1984 O  O     . HIS A 1 256 ? 117.759 16.336  172.344 1.00 35.90  ?  255  HIS F O     1 
ATOM   1985 C  CB    . HIS A 1 256 ? 120.232 18.214  171.939 1.00 38.47  ?  255  HIS F CB    1 
ATOM   1986 C  CG    . HIS A 1 256 ? 120.831 19.468  171.388 1.00 40.97  ?  255  HIS F CG    1 
ATOM   1987 N  ND1   . HIS A 1 256 ? 121.759 19.463  170.368 1.00 41.89  ?  255  HIS F ND1   1 
ATOM   1988 C  CD2   . HIS A 1 256 ? 120.615 20.768  171.695 1.00 45.73  ?  255  HIS F CD2   1 
ATOM   1989 C  CE1   . HIS A 1 256 ? 122.098 20.707  170.080 1.00 46.77  ?  255  HIS F CE1   1 
ATOM   1990 N  NE2   . HIS A 1 256 ? 121.423 21.518  170.874 1.00 47.91  ?  255  HIS F NE2   1 
ATOM   1991 N  N     . TRP A 1 257 ? 119.340 15.101  171.287 1.00 38.47  ?  256  TRP F N     1 
ATOM   1992 C  CA    . TRP A 1 257 ? 118.868 13.848  171.862 1.00 33.92  ?  256  TRP F CA    1 
ATOM   1993 C  C     . TRP A 1 257 ? 118.858 13.896  173.387 1.00 33.33  ?  256  TRP F C     1 
ATOM   1994 O  O     . TRP A 1 257 ? 117.965 13.332  174.021 1.00 31.77  ?  256  TRP F O     1 
ATOM   1995 C  CB    . TRP A 1 257 ? 119.729 12.684  171.382 1.00 34.79  ?  256  TRP F CB    1 
ATOM   1996 C  CG    . TRP A 1 257 ? 119.466 11.481  172.215 1.00 33.76  ?  256  TRP F CG    1 
ATOM   1997 C  CD1   . TRP A 1 257 ? 120.320 10.880  173.096 1.00 35.63  ?  256  TRP F CD1   1 
ATOM   1998 C  CD2   . TRP A 1 257 ? 118.225 10.772  172.310 1.00 31.93  ?  256  TRP F CD2   1 
ATOM   1999 N  NE1   . TRP A 1 257 ? 119.699 9.812   173.703 1.00 33.21  ?  256  TRP F NE1   1 
ATOM   2000 C  CE2   . TRP A 1 257 ? 118.412 9.724   173.234 1.00 34.90  ?  256  TRP F CE2   1 
ATOM   2001 C  CE3   . TRP A 1 257 ? 116.986 10.901  171.672 1.00 30.66  ?  256  TRP F CE3   1 
ATOM   2002 C  CZ2   . TRP A 1 257 ? 117.404 8.817   173.548 1.00 33.47  ?  256  TRP F CZ2   1 
ATOM   2003 C  CZ3   . TRP A 1 257 ? 115.982 9.999   171.983 1.00 35.34  ?  256  TRP F CZ3   1 
ATOM   2004 C  CH2   . TRP A 1 257 ? 116.197 8.973   172.915 1.00 28.91  ?  256  TRP F CH2   1 
ATOM   2005 N  N     . SER A 1 258 ? 119.855 14.544  173.999 1.00 34.71  ?  257  SER F N     1 
ATOM   2006 C  CA    . SER A 1 258 ? 119.866 14.643  175.456 1.00 35.62  ?  257  SER F CA    1 
ATOM   2007 C  C     . SER A 1 258 ? 118.565 15.251  175.978 1.00 32.73  ?  257  SER F C     1 
ATOM   2008 O  O     . SER A 1 258 ? 118.054 14.841  177.027 1.00 31.68  ?  257  SER F O     1 
ATOM   2009 C  CB    . SER A 1 258 ? 121.066 15.473  175.915 1.00 37.75  ?  257  SER F CB    1 
ATOM   2010 O  OG    . SER A 1 258 ? 121.051 16.757  175.304 1.00 40.06  ?  257  SER F OG    1 
ATOM   2011 N  N     . GLU A 1 259 ? 118.028 16.244  175.266 1.00 32.62  ?  258  GLU F N     1 
ATOM   2012 C  CA    . GLU A 1 259 ? 116.780 16.867  175.695 1.00 31.18  ?  258  GLU F CA    1 
ATOM   2013 C  C     . GLU A 1 259 ? 115.606 15.910  175.546 1.00 36.26  ?  258  GLU F C     1 
ATOM   2014 O  O     . GLU A 1 259 ? 114.699 15.889  176.389 1.00 32.86  ?  258  GLU F O     1 
ATOM   2015 C  CB    . GLU A 1 259 ? 116.527 18.138  174.893 1.00 31.71  ?  258  GLU F CB    1 
ATOM   2016 C  CG    . GLU A 1 259 ? 117.684 19.102  174.913 1.00 34.79  ?  258  GLU F CG    1 
ATOM   2017 C  CD    . GLU A 1 259 ? 117.433 20.274  173.998 1.00 48.81  ?  258  GLU F CD    1 
ATOM   2018 O  OE1   . GLU A 1 259 ? 117.207 21.390  174.511 1.00 62.61  ?  258  GLU F OE1   1 
ATOM   2019 O  OE2   . GLU A 1 259 ? 117.426 20.067  172.766 1.00 45.93  ?  258  GLU F OE2   1 
ATOM   2020 N  N     . CYS A 1 260 ? 115.601 15.125  174.470 1.00 29.34  ?  259  CYS F N     1 
ATOM   2021 C  CA    . CYS A 1 260 ? 114.533 14.152  174.261 1.00 27.80  ?  259  CYS F CA    1 
ATOM   2022 C  C     . CYS A 1 260 ? 114.544 13.096  175.354 1.00 27.17  ?  259  CYS F C     1 
ATOM   2023 O  O     . CYS A 1 260 ? 113.511 12.794  175.962 1.00 26.17  ?  259  CYS F O     1 
ATOM   2024 C  CB    . CYS A 1 260 ? 114.688 13.500  172.883 1.00 29.89  ?  259  CYS F CB    1 
ATOM   2025 S  SG    . CYS A 1 260 ? 113.270 12.473  172.390 1.00 31.92  ?  259  CYS F SG    1 
ATOM   2026 N  N     . GLU A 1 261 ? 115.716 12.516  175.610 1.00 28.32  ?  260  GLU F N     1 
ATOM   2027 C  CA    . GLU A 1 261 ? 115.839 11.521  176.664 1.00 28.01  ?  260  GLU F CA    1 
ATOM   2028 C  C     . GLU A 1 261 ? 115.392 12.090  178.000 1.00 27.40  ?  260  GLU F C     1 
ATOM   2029 O  O     . GLU A 1 261 ? 114.715 11.411  178.775 1.00 29.06  ?  260  GLU F O     1 
ATOM   2030 C  CB    . GLU A 1 261 ? 117.296 11.045  176.736 1.00 29.69  ?  260  GLU F CB    1 
ATOM   2031 C  CG    . GLU A 1 261 ? 117.498 9.626   177.240 1.00 30.40  ?  260  GLU F CG    1 
ATOM   2032 C  CD    . GLU A 1 261 ? 117.338 9.493   178.735 1.00 48.48  ?  260  GLU F CD    1 
ATOM   2033 O  OE1   . GLU A 1 261 ? 116.744 8.492   179.179 1.00 62.04  ?  260  GLU F OE1   1 
ATOM   2034 O  OE2   . GLU A 1 261 ? 117.802 10.387  179.471 1.00 54.71  ?  260  GLU F OE2   1 
ATOM   2035 N  N     . ALA A 1 262 ? 115.727 13.357  178.271 1.00 31.71  ?  261  ALA F N     1 
ATOM   2036 C  CA    . ALA A 1 262 ? 115.340 13.966  179.542 1.00 31.30  ?  261  ALA F CA    1 
ATOM   2037 C  C     . ALA A 1 262 ? 113.823 14.085  179.665 1.00 29.46  ?  261  ALA F C     1 
ATOM   2038 O  O     . ALA A 1 262 ? 113.259 13.890  180.749 1.00 30.02  ?  261  ALA F O     1 
ATOM   2039 C  CB    . ALA A 1 262 ? 116.001 15.339  179.686 1.00 34.43  ?  261  ALA F CB    1 
ATOM   2040 N  N     . ILE A 1 263 ? 113.148 14.411  178.563 1.00 26.34  ?  262  ILE F N     1 
ATOM   2041 C  CA    . ILE A 1 263 ? 111.689 14.505  178.581 1.00 24.84  ?  262  ILE F CA    1 
ATOM   2042 C  C     . ILE A 1 263 ? 111.072 13.138  178.845 1.00 28.61  ?  262  ILE F C     1 
ATOM   2043 O  O     . ILE A 1 263 ? 110.147 12.995  179.655 1.00 25.46  ?  262  ILE F O     1 
ATOM   2044 C  CB    . ILE A 1 263 ? 111.182 15.103  177.259 1.00 23.68  ?  262  ILE F CB    1 
ATOM   2045 C  CG1   . ILE A 1 263 ? 111.572 16.577  177.162 1.00 30.69  ?  262  ILE F CG1   1 
ATOM   2046 C  CG2   . ILE A 1 263 ? 109.680 14.936  177.168 1.00 23.33  ?  262  ILE F CG2   1 
ATOM   2047 C  CD1   . ILE A 1 263 ? 111.774 17.042  175.762 1.00 36.07  ?  262  ILE F CD1   1 
ATOM   2048 N  N     . ILE A 1 264 ? 111.573 12.112  178.154 1.00 27.42  ?  263  ILE F N     1 
ATOM   2049 C  CA    . ILE A 1 264 ? 111.085 10.752  178.373 1.00 22.33  ?  263  ILE F CA    1 
ATOM   2050 C  C     . ILE A 1 264 ? 111.240 10.334  179.836 1.00 23.16  ?  263  ILE F C     1 
ATOM   2051 O  O     . ILE A 1 264 ? 110.370 9.659   180.398 1.00 24.17  ?  263  ILE F O     1 
ATOM   2052 C  CB    . ILE A 1 264 ? 111.817 9.788   177.427 1.00 26.33  ?  263  ILE F CB    1 
ATOM   2053 C  CG1   . ILE A 1 264 ? 111.408 10.070  175.987 1.00 24.83  ?  263  ILE F CG1   1 
ATOM   2054 C  CG2   . ILE A 1 264 ? 111.537 8.344   177.797 1.00 26.14  ?  263  ILE F CG2   1 
ATOM   2055 C  CD1   . ILE A 1 264 ? 112.260 9.312   175.003 1.00 29.80  ?  263  ILE F CD1   1 
ATOM   2056 N  N     . GLU A 1 265 ? 112.357 10.700  180.472 1.00 27.94  ?  264  GLU F N     1 
ATOM   2057 C  CA    . GLU A 1 265 ? 112.518 10.374  181.885 1.00 28.56  ?  264  GLU F CA    1 
ATOM   2058 C  C     . GLU A 1 265 ? 111.406 10.968  182.731 1.00 28.18  ?  264  GLU F C     1 
ATOM   2059 O  O     . GLU A 1 265 ? 111.055 10.410  183.777 1.00 28.72  ?  264  GLU F O     1 
ATOM   2060 C  CB    . GLU A 1 265 ? 113.873 10.868  182.392 1.00 27.04  ?  264  GLU F CB    1 
ATOM   2061 C  CG    . GLU A 1 265 ? 115.054 10.118  181.822 1.00 33.40  ?  264  GLU F CG    1 
ATOM   2062 C  CD    . GLU A 1 265 ? 115.188 8.715   182.401 1.00 35.67  ?  264  GLU F CD    1 
ATOM   2063 O  OE1   . GLU A 1 265 ? 114.444 8.377   183.344 1.00 39.23  ?  264  GLU F OE1   1 
ATOM   2064 O  OE2   . GLU A 1 265 ? 116.040 7.949   181.908 1.00 43.93  ?  264  GLU F OE2   1 
ATOM   2065 N  N     . ARG A 1 266 ? 110.857 12.114  182.312 1.00 26.30  ?  265  ARG F N     1 
ATOM   2066 C  CA    . ARG A 1 266 ? 109.733 12.695  183.041 1.00 28.12  ?  265  ARG F CA    1 
ATOM   2067 C  C     . ARG A 1 266 ? 108.415 12.023  182.683 1.00 31.07  ?  265  ARG F C     1 
ATOM   2068 O  O     . ARG A 1 266 ? 107.556 11.821  183.556 1.00 32.48  ?  265  ARG F O     1 
ATOM   2069 C  CB    . ARG A 1 266 ? 109.650 14.194  182.770 1.00 30.09  ?  265  ARG F CB    1 
ATOM   2070 C  CG    . ARG A 1 266 ? 110.910 14.951  183.128 1.00 32.46  ?  265  ARG F CG    1 
ATOM   2071 C  CD    . ARG A 1 266 ? 110.722 16.441  182.813 1.00 42.64  ?  265  ARG F CD    1 
ATOM   2072 N  NE    . ARG A 1 266 ? 111.858 17.248  183.249 1.00 47.09  ?  265  ARG F NE    1 
ATOM   2073 C  CZ    . ARG A 1 266 ? 112.149 18.447  182.756 1.00 52.11  ?  265  ARG F CZ    1 
ATOM   2074 N  NH1   . ARG A 1 266 ? 111.384 18.970  181.806 1.00 48.37  ?  265  ARG F NH1   1 
ATOM   2075 N  NH2   . ARG A 1 266 ? 113.202 19.118  183.207 1.00 53.06  ?  265  ARG F NH2   1 
ATOM   2076 N  N     . LEU A 1 267 ? 108.240 11.668  181.410 1.00 28.33  ?  266  LEU F N     1 
ATOM   2077 C  CA    . LEU A 1 267 ? 106.978 11.077  180.982 1.00 28.06  ?  266  LEU F CA    1 
ATOM   2078 C  C     . LEU A 1 267 ? 106.817 9.674   181.541 1.00 25.59  ?  266  LEU F C     1 
ATOM   2079 O  O     . LEU A 1 267 ? 105.709 9.275   181.917 1.00 25.44  ?  266  LEU F O     1 
ATOM   2080 C  CB    . LEU A 1 267 ? 106.899 11.043  179.457 1.00 24.67  ?  266  LEU F CB    1 
ATOM   2081 C  CG    . LEU A 1 267 ? 106.937 12.361  178.686 1.00 31.37  ?  266  LEU F CG    1 
ATOM   2082 C  CD1   . LEU A 1 267 ? 106.986 12.041  177.209 1.00 24.78  ?  266  LEU F CD1   1 
ATOM   2083 C  CD2   . LEU A 1 267 ? 105.732 13.230  179.006 1.00 33.56  ?  266  LEU F CD2   1 
ATOM   2084 N  N     . TYR A 1 268 ? 107.911 8.917   181.607 1.00 23.88  ?  267  TYR F N     1 
ATOM   2085 C  CA    . TYR A 1 268 ? 107.781 7.494   181.905 1.00 25.18  ?  267  TYR F CA    1 
ATOM   2086 C  C     . TYR A 1 268 ? 107.113 7.218   183.248 1.00 26.38  ?  267  TYR F C     1 
ATOM   2087 O  O     . TYR A 1 268 ? 106.192 6.383   183.288 1.00 27.46  ?  267  TYR F O     1 
ATOM   2088 C  CB    . TYR A 1 268 ? 109.146 6.806   181.832 1.00 24.19  ?  267  TYR F CB    1 
ATOM   2089 C  CG    . TYR A 1 268 ? 108.975 5.346   182.158 1.00 24.95  ?  267  TYR F CG    1 
ATOM   2090 C  CD1   . TYR A 1 268 ? 108.515 4.462   181.197 1.00 23.06  ?  267  TYR F CD1   1 
ATOM   2091 C  CD2   . TYR A 1 268 ? 109.185 4.870   183.447 1.00 26.55  ?  267  TYR F CD2   1 
ATOM   2092 C  CE1   . TYR A 1 268 ? 108.321 3.132   181.495 1.00 26.11  ?  267  TYR F CE1   1 
ATOM   2093 C  CE2   . TYR A 1 268 ? 108.978 3.545   183.749 1.00 31.39  ?  267  TYR F CE2   1 
ATOM   2094 C  CZ    . TYR A 1 268 ? 108.554 2.684   182.759 1.00 28.72  ?  267  TYR F CZ    1 
ATOM   2095 O  OH    . TYR A 1 268 ? 108.352 1.359   183.046 1.00 30.81  ?  267  TYR F OH    1 
ATOM   2096 N  N     . PRO A 1 269 ? 107.519 7.837   184.370 1.00 31.79  ?  268  PRO F N     1 
ATOM   2097 C  CA    . PRO A 1 269 ? 106.829 7.545   185.639 1.00 34.80  ?  268  PRO F CA    1 
ATOM   2098 C  C     . PRO A 1 269 ? 105.347 7.845   185.573 1.00 28.08  ?  268  PRO F C     1 
ATOM   2099 O  O     . PRO A 1 269 ? 104.543 7.170   186.233 1.00 29.48  ?  268  PRO F O     1 
ATOM   2100 C  CB    . PRO A 1 269 ? 107.537 8.459   186.652 1.00 37.53  ?  268  PRO F CB    1 
ATOM   2101 C  CG    . PRO A 1 269 ? 108.794 8.868   186.017 1.00 35.68  ?  268  PRO F CG    1 
ATOM   2102 C  CD    . PRO A 1 269 ? 108.565 8.857   184.547 1.00 27.75  ?  268  PRO F CD    1 
ATOM   2103 N  N     . GLU A 1 270 ? 104.960 8.834   184.769 1.00 26.71  ?  269  GLU F N     1 
ATOM   2104 C  CA    . GLU A 1 270 ? 103.541 9.143   184.637 1.00 27.04  ?  269  GLU F CA    1 
ATOM   2105 C  C     . GLU A 1 270 ? 102.808 8.040   183.887 1.00 21.58  ?  269  GLU F C     1 
ATOM   2106 O  O     . GLU A 1 270 ? 101.696 7.658   184.270 1.00 24.92  ?  269  GLU F O     1 
ATOM   2107 C  CB    . GLU A 1 270 ? 103.365 10.483  183.929 1.00 28.60  ?  269  GLU F CB    1 
ATOM   2108 C  CG    . GLU A 1 270 ? 103.857 11.634  184.766 1.00 41.04  ?  269  GLU F CG    1 
ATOM   2109 C  CD    . GLU A 1 270 ? 103.183 11.657  186.121 1.00 54.29  ?  269  GLU F CD    1 
ATOM   2110 O  OE1   . GLU A 1 270 ? 102.033 12.128  186.182 1.00 48.59  ?  269  GLU F OE1   1 
ATOM   2111 O  OE2   . GLU A 1 270 ? 103.786 11.174  187.111 1.00 61.14  ?  269  GLU F OE2   1 
ATOM   2112 N  N     . LEU A 1 271 ? 103.401 7.537   182.798 1.00 24.23  ?  270  LEU F N     1 
ATOM   2113 C  CA    . LEU A 1 271 ? 102.792 6.414   182.091 1.00 23.84  ?  270  LEU F CA    1 
ATOM   2114 C  C     . LEU A 1 271 ? 102.680 5.201   183.001 1.00 23.96  ?  270  LEU F C     1 
ATOM   2115 O  O     . LEU A 1 271 ? 101.647 4.522   183.027 1.00 23.46  ?  270  LEU F O     1 
ATOM   2116 C  CB    . LEU A 1 271 ? 103.606 6.067   180.843 1.00 26.07  ?  270  LEU F CB    1 
ATOM   2117 C  CG    . LEU A 1 271 ? 103.133 4.844   180.045 1.00 26.97  ?  270  LEU F CG    1 
ATOM   2118 C  CD1   . LEU A 1 271 ? 101.678 4.990   179.606 1.00 29.56  ?  270  LEU F CD1   1 
ATOM   2119 C  CD2   . LEU A 1 271 ? 104.026 4.591   178.837 1.00 27.27  ?  270  LEU F CD2   1 
ATOM   2120 N  N     . GLU A 1 272 ? 103.748 4.902   183.739 1.00 23.28  ?  271  GLU F N     1 
ATOM   2121 C  CA    . GLU A 1 272 ? 103.722 3.770   184.658 1.00 25.79  ?  271  GLU F CA    1 
ATOM   2122 C  C     . GLU A 1 272 ? 102.594 3.906   185.671 1.00 27.45  ?  271  GLU F C     1 
ATOM   2123 O  O     . GLU A 1 272 ? 101.869 2.940   185.947 1.00 26.94  ?  271  GLU F O     1 
ATOM   2124 C  CB    . GLU A 1 272 ? 105.065 3.668   185.365 1.00 26.39  ?  271  GLU F CB    1 
ATOM   2125 C  CG    . GLU A 1 272 ? 105.173 2.487   186.285 1.00 32.69  ?  271  GLU F CG    1 
ATOM   2126 C  CD    . GLU A 1 272 ? 106.477 2.504   187.022 1.00 55.20  ?  271  GLU F CD    1 
ATOM   2127 O  OE1   . GLU A 1 272 ? 106.911 3.608   187.423 1.00 65.12  ?  271  GLU F OE1   1 
ATOM   2128 O  OE2   . GLU A 1 272 ? 107.073 1.425   187.184 1.00 56.86  ?  271  GLU F OE2   1 
ATOM   2129 N  N     . ARG A 1 273 ? 102.428 5.107   186.231 1.00 23.94  ?  272  ARG F N     1 
ATOM   2130 C  CA    . ARG A 1 273 ? 101.428 5.317   187.265 1.00 25.19  ?  272  ARG F CA    1 
ATOM   2131 C  C     . ARG A 1 273 ? 100.028 5.096   186.720 1.00 28.61  ?  272  ARG F C     1 
ATOM   2132 O  O     . ARG A 1 273 ? 99.182  4.484   187.380 1.00 26.75  ?  272  ARG F O     1 
ATOM   2133 C  CB    . ARG A 1 273 ? 101.563 6.733   187.836 1.00 27.39  ?  272  ARG F CB    1 
ATOM   2134 C  CG    . ARG A 1 273 ? 100.354 7.195   188.653 1.00 29.40  ?  272  ARG F CG    1 
ATOM   2135 C  CD    . ARG A 1 273 ? 100.491 8.661   189.102 1.00 30.51  ?  272  ARG F CD    1 
ATOM   2136 N  NE    . ARG A 1 273 ? 99.264  9.145   189.740 1.00 32.97  ?  272  ARG F NE    1 
ATOM   2137 C  CZ    . ARG A 1 273 ? 98.282  9.779   189.097 1.00 33.26  ?  272  ARG F CZ    1 
ATOM   2138 N  NH1   . ARG A 1 273 ? 98.394  10.017  187.801 1.00 29.14  ?  272  ARG F NH1   1 
ATOM   2139 N  NH2   . ARG A 1 273 ? 97.192  10.187  189.748 1.00 35.43  ?  272  ARG F NH2   1 
ATOM   2140 N  N     . ARG A 1 274 ? 99.762  5.598   185.515 1.00 22.50  ?  273  ARG F N     1 
ATOM   2141 C  CA    . ARG A 1 274 ? 98.424  5.484   184.956 1.00 22.67  ?  273  ARG F CA    1 
ATOM   2142 C  C     . ARG A 1 274 ? 98.125  4.063   184.503 1.00 26.88  ?  273  ARG F C     1 
ATOM   2143 O  O     . ARG A 1 274 ? 96.997  3.582   184.677 1.00 23.24  ?  273  ARG F O     1 
ATOM   2144 C  CB    . ARG A 1 274 ? 98.264  6.494   183.826 1.00 24.64  ?  273  ARG F CB    1 
ATOM   2145 C  CG    . ARG A 1 274 ? 98.104  7.898   184.401 1.00 29.02  ?  273  ARG F CG    1 
ATOM   2146 C  CD    . ARG A 1 274 ? 98.320  8.964   183.383 1.00 28.48  ?  273  ARG F CD    1 
ATOM   2147 N  NE    . ARG A 1 274 ? 97.656  8.618   182.141 1.00 36.82  ?  273  ARG F NE    1 
ATOM   2148 C  CZ    . ARG A 1 274 ? 97.654  9.389   181.062 1.00 37.01  ?  273  ARG F CZ    1 
ATOM   2149 N  NH1   . ARG A 1 274 ? 98.277  10.574  181.093 1.00 23.26  ?  273  ARG F NH1   1 
ATOM   2150 N  NH2   . ARG A 1 274 ? 97.031  8.961   179.962 1.00 30.31  ?  273  ARG F NH2   1 
ATOM   2151 N  N     . LEU A 1 275 ? 99.128  3.360   183.962 1.00 26.33  ?  274  LEU F N     1 
ATOM   2152 C  CA    . LEU A 1 275 ? 98.939  1.962   183.600 1.00 26.22  ?  274  LEU F CA    1 
ATOM   2153 C  C     . LEU A 1 275 ? 98.684  1.119   184.841 1.00 21.59  ?  274  LEU F C     1 
ATOM   2154 O  O     . LEU A 1 275 ? 97.778  0.282   184.859 1.00 28.45  ?  274  LEU F O     1 
ATOM   2155 C  CB    . LEU A 1 275 ? 100.161 1.433   182.843 1.00 27.36  ?  274  LEU F CB    1 
ATOM   2156 C  CG    . LEU A 1 275 ? 100.092 -0.054  182.488 1.00 28.18  ?  274  LEU F CG    1 
ATOM   2157 C  CD1   . LEU A 1 275 ? 98.930  -0.331  181.539 1.00 25.51  ?  274  LEU F CD1   1 
ATOM   2158 C  CD2   . LEU A 1 275 ? 101.428 -0.496  181.900 1.00 28.29  ?  274  LEU F CD2   1 
ATOM   2159 N  N     . ALA A 1 276 ? 99.469  1.350   185.900 1.00 30.07  ?  275  ALA F N     1 
ATOM   2160 C  CA    . ALA A 1 276 ? 99.345  0.552   187.121 1.00 35.88  ?  275  ALA F CA    1 
ATOM   2161 C  C     . ALA A 1 276 ? 97.960  0.680   187.744 1.00 40.42  ?  275  ALA F C     1 
ATOM   2162 O  O     . ALA A 1 276 ? 97.490  -0.256  188.401 1.00 35.83  ?  275  ALA F O     1 
ATOM   2163 C  CB    . ALA A 1 276 ? 100.422 0.963   188.127 1.00 30.59  ?  275  ALA F CB    1 
ATOM   2164 N  N     . LYS A 1 277 ? 97.294  1.822   187.551 1.00 31.59  ?  276  LYS F N     1 
ATOM   2165 C  CA    . LYS A 1 277 ? 95.941  1.982   188.073 1.00 34.92  ?  276  LYS F CA    1 
ATOM   2166 C  C     . LYS A 1 277 ? 94.984  0.948   187.493 1.00 40.73  ?  276  LYS F C     1 
ATOM   2167 O  O     . LYS A 1 277 ? 94.064  0.494   188.181 1.00 39.31  ?  276  LYS F O     1 
ATOM   2168 C  CB    . LYS A 1 277 ? 95.426  3.384   187.778 1.00 31.56  ?  276  LYS F CB    1 
ATOM   2169 C  CG    . LYS A 1 277 ? 96.050  4.452   188.629 1.00 37.89  ?  276  LYS F CG    1 
ATOM   2170 C  CD    . LYS A 1 277 ? 95.334  5.753   188.373 1.00 42.73  ?  276  LYS F CD    1 
ATOM   2171 C  CE    . LYS A 1 277 ? 95.802  6.835   189.305 1.00 47.54  ?  276  LYS F CE    1 
ATOM   2172 N  NZ    . LYS A 1 277 ? 94.976  8.047   189.067 1.00 39.82  ?  276  LYS F NZ    1 
ATOM   2173 N  N     . VAL A 1 278 ? 95.170  0.579   186.230 1.00 30.88  ?  277  VAL F N     1 
ATOM   2174 C  CA    . VAL A 1 278 ? 94.267  -0.345  185.555 1.00 33.36  ?  277  VAL F CA    1 
ATOM   2175 C  C     . VAL A 1 278 ? 94.896  -1.725  185.359 1.00 38.99  ?  277  VAL F C     1 
ATOM   2176 O  O     . VAL A 1 278 ? 94.160  -2.708  185.172 1.00 41.14  ?  277  VAL F O     1 
ATOM   2177 C  CB    . VAL A 1 278 ? 93.800  0.254   184.207 1.00 42.83  ?  277  VAL F CB    1 
ATOM   2178 C  CG1   . VAL A 1 278 ? 93.034  -0.740  183.353 1.00 50.44  ?  277  VAL F CG1   1 
ATOM   2179 C  CG2   . VAL A 1 278 ? 92.926  1.455   184.472 1.00 50.51  ?  277  VAL F CG2   1 
ATOM   2180 N  N     . LYS A 1 279 ? 96.213  -1.841  185.474 1.00 35.57  ?  278  LYS F N     1 
ATOM   2181 C  CA    . LYS A 1 279 ? 96.921  -3.094  185.207 1.00 30.54  ?  278  LYS F CA    1 
ATOM   2182 C  C     . LYS A 1 279 ? 98.125  -3.155  186.132 1.00 35.92  ?  278  LYS F C     1 
ATOM   2183 O  O     . LYS A 1 279 ? 99.259  -2.858  185.734 1.00 33.08  ?  278  LYS F O     1 
ATOM   2184 C  CB    . LYS A 1 279 ? 97.342  -3.169  183.739 1.00 39.64  ?  278  LYS F CB    1 
ATOM   2185 C  CG    . LYS A 1 279 ? 96.675  -4.279  182.954 1.00 54.67  ?  278  LYS F CG    1 
ATOM   2186 C  CD    . LYS A 1 279 ? 97.390  -5.549  183.237 1.00 52.07  ?  278  LYS F CD    1 
ATOM   2187 C  CE    . LYS A 1 279 ? 96.676  -6.762  182.724 1.00 54.74  ?  278  LYS F CE    1 
ATOM   2188 N  NZ    . LYS A 1 279 ? 97.449  -7.909  183.233 1.00 44.46  ?  278  LYS F NZ    1 
ATOM   2189 N  N     . PRO A 1 280 ? 97.910  -3.527  187.395 1.00 36.88  ?  279  PRO F N     1 
ATOM   2190 C  CA    . PRO A 1 280 ? 98.983  -3.409  188.400 1.00 40.19  ?  279  PRO F CA    1 
ATOM   2191 C  C     . PRO A 1 280 ? 100.277 -4.109  188.039 1.00 40.12  ?  279  PRO F C     1 
ATOM   2192 O  O     . PRO A 1 280 ? 101.345 -3.684  188.504 1.00 41.29  ?  279  PRO F O     1 
ATOM   2193 C  CB    . PRO A 1 280 ? 98.347  -4.038  189.646 1.00 44.09  ?  279  PRO F CB    1 
ATOM   2194 C  CG    . PRO A 1 280 ? 96.890  -3.772  189.478 1.00 50.49  ?  279  PRO F CG    1 
ATOM   2195 C  CD    . PRO A 1 280 ? 96.620  -3.898  188.004 1.00 43.54  ?  279  PRO F CD    1 
ATOM   2196 N  N     . ASP A 1 281 ? 100.225 -5.171  187.242 1.00 29.97  ?  280  ASP F N     1 
ATOM   2197 C  CA    . ASP A 1 281 ? 101.434 -5.910  186.914 1.00 38.24  ?  280  ASP F CA    1 
ATOM   2198 C  C     . ASP A 1 281 ? 102.143 -5.365  185.680 1.00 30.69  ?  280  ASP F C     1 
ATOM   2199 O  O     . ASP A 1 281 ? 103.164 -5.930  185.277 1.00 31.95  ?  280  ASP F O     1 
ATOM   2200 C  CB    . ASP A 1 281 ? 101.119 -7.407  186.740 1.00 52.40  ?  280  ASP F CB    1 
ATOM   2201 C  CG    . ASP A 1 281 ? 99.974  -7.670  185.769 1.00 49.17  ?  280  ASP F CG    1 
ATOM   2202 O  OD1   . ASP A 1 281 ? 99.601  -6.754  185.029 1.00 37.38  ?  280  ASP F OD1   1 
ATOM   2203 O  OD2   . ASP A 1 281 ? 99.461  -8.807  185.732 1.00 46.97  ?  280  ASP F OD2   1 
ATOM   2204 N  N     . LEU A 1 282 ? 101.631 -4.273  185.090 1.00 31.28  ?  281  LEU F N     1 
ATOM   2205 C  CA    . LEU A 1 282 ? 102.193 -3.563  183.937 1.00 25.19  ?  281  LEU F CA    1 
ATOM   2206 C  C     . LEU A 1 282 ? 102.219 -4.402  182.667 1.00 30.03  ?  281  LEU F C     1 
ATOM   2207 O  O     . LEU A 1 282 ? 102.907 -4.035  181.700 1.00 28.07  ?  281  LEU F O     1 
ATOM   2208 C  CB    . LEU A 1 282 ? 103.604 -3.036  184.228 1.00 29.58  ?  281  LEU F CB    1 
ATOM   2209 C  CG    . LEU A 1 282 ? 103.697 -2.190  185.501 1.00 33.35  ?  281  LEU F CG    1 
ATOM   2210 C  CD1   . LEU A 1 282 ? 105.116 -1.658  185.691 1.00 32.28  ?  281  LEU F CD1   1 
ATOM   2211 C  CD2   . LEU A 1 282 ? 102.670 -1.061  185.478 1.00 35.30  ?  281  LEU F CD2   1 
ATOM   2212 N  N     . LEU A 1 283 ? 101.499 -5.520  182.625 1.00 30.93  ?  282  LEU F N     1 
ATOM   2213 C  CA    . LEU A 1 283 ? 101.498 -6.362  181.435 1.00 31.25  ?  282  LEU F CA    1 
ATOM   2214 C  C     . LEU A 1 283 ? 100.652 -5.716  180.351 1.00 30.51  ?  282  LEU F C     1 
ATOM   2215 O  O     . LEU A 1 283 ? 99.538  -5.259  180.617 1.00 33.48  ?  282  LEU F O     1 
ATOM   2216 C  CB    . LEU A 1 283 ? 100.968 -7.759  181.760 1.00 36.49  ?  282  LEU F CB    1 
ATOM   2217 C  CG    . LEU A 1 283 ? 101.802 -8.539  182.768 1.00 38.89  ?  282  LEU F CG    1 
ATOM   2218 C  CD1   . LEU A 1 283 ? 101.196 -9.919  183.000 1.00 40.06  ?  282  LEU F CD1   1 
ATOM   2219 C  CD2   . LEU A 1 283 ? 103.250 -8.667  182.298 1.00 35.15  ?  282  LEU F CD2   1 
ATOM   2220 N  N     . ILE A 1 284 ? 101.174 -5.706  179.122 1.00 31.40  ?  283  ILE F N     1 
ATOM   2221 C  CA    . ILE A 1 284 ? 100.602 -4.959  178.009 1.00 34.23  ?  283  ILE F CA    1 
ATOM   2222 C  C     . ILE A 1 284 ? 100.782 -5.760  176.727 1.00 34.90  ?  283  ILE F C     1 
ATOM   2223 O  O     . ILE A 1 284 ? 101.472 -6.779  176.690 1.00 29.83  ?  283  ILE F O     1 
ATOM   2224 C  CB    . ILE A 1 284 ? 101.261 -3.574  177.851 1.00 30.15  ?  283  ILE F CB    1 
ATOM   2225 C  CG1   . ILE A 1 284 ? 102.781 -3.741  177.737 1.00 23.92  ?  283  ILE F CG1   1 
ATOM   2226 C  CG2   . ILE A 1 284 ? 100.876 -2.664  179.015 1.00 31.08  ?  283  ILE F CG2   1 
ATOM   2227 C  CD1   . ILE A 1 284 ? 103.521 -2.451  177.278 1.00 24.24  ?  283  ILE F CD1   1 
ATOM   2228 N  N     . ALA A 1 285 ? 100.172 -5.266  175.654 1.00 26.46  ?  284  ALA F N     1 
ATOM   2229 C  CA    . ALA A 1 285 ? 100.327 -5.887  174.342 1.00 27.16  ?  284  ALA F CA    1 
ATOM   2230 C  C     . ALA A 1 285 ? 101.399 -5.217  173.490 1.00 29.06  ?  284  ALA F C     1 
ATOM   2231 O  O     . ALA A 1 285 ? 102.158 -5.903  172.793 1.00 30.48  ?  284  ALA F O     1 
ATOM   2232 C  CB    . ALA A 1 285 ? 98.980  -5.884  173.608 1.00 26.75  ?  284  ALA F CB    1 
ATOM   2233 N  N     . ARG A 1 286 ? 101.481 -3.888  173.517 1.00 26.47  ?  285  ARG F N     1 
ATOM   2234 C  CA    . ARG A 1 286 ? 102.456 -3.147  172.720 1.00 25.11  ?  285  ARG F CA    1 
ATOM   2235 C  C     . ARG A 1 286 ? 102.879 -1.910  173.501 1.00 27.74  ?  285  ARG F C     1 
ATOM   2236 O  O     . ARG A 1 286 ? 102.142 -1.435  174.363 1.00 25.10  ?  285  ARG F O     1 
ATOM   2237 C  CB    . ARG A 1 286 ? 101.864 -2.728  171.364 1.00 29.17  ?  285  ARG F CB    1 
ATOM   2238 C  CG    . ARG A 1 286 ? 101.122 -3.847  170.627 1.00 28.15  ?  285  ARG F CG    1 
ATOM   2239 C  CD    . ARG A 1 286 ? 100.318 -3.353  169.440 1.00 30.01  ?  285  ARG F CD    1 
ATOM   2240 N  NE    . ARG A 1 286 ? 101.141 -2.695  168.424 1.00 32.96  ?  285  ARG F NE    1 
ATOM   2241 C  CZ    . ARG A 1 286 ? 101.767 -3.323  167.429 1.00 49.45  ?  285  ARG F CZ    1 
ATOM   2242 N  NH1   . ARG A 1 286 ? 101.689 -4.641  167.305 1.00 47.66  ?  285  ARG F NH1   1 
ATOM   2243 N  NH2   . ARG A 1 286 ? 102.483 -2.633  166.551 1.00 49.10  ?  285  ARG F NH2   1 
ATOM   2244 N  N     . GLN A 1 287 ? 104.069 -1.387  173.191 1.00 24.44  ?  286  GLN F N     1 
ATOM   2245 C  CA    . GLN A 1 287 ? 104.451 -0.062  173.665 1.00 23.21  ?  286  GLN F CA    1 
ATOM   2246 C  C     . GLN A 1 287 ? 105.222 0.657   172.567 1.00 25.56  ?  286  GLN F C     1 
ATOM   2247 O  O     . GLN A 1 287 ? 105.763 0.033   171.647 1.00 26.96  ?  286  GLN F O     1 
ATOM   2248 C  CB    . GLN A 1 287 ? 105.267 -0.125  174.972 1.00 25.64  ?  286  GLN F CB    1 
ATOM   2249 C  CG    . GLN A 1 287 ? 106.648 -0.785  174.878 1.00 23.86  ?  286  GLN F CG    1 
ATOM   2250 C  CD    . GLN A 1 287 ? 107.411 -0.609  176.178 1.00 24.30  ?  286  GLN F CD    1 
ATOM   2251 O  OE1   . GLN A 1 287 ? 106.800 -0.424  177.234 1.00 27.51  ?  286  GLN F OE1   1 
ATOM   2252 N  NE2   . GLN A 1 287 ? 108.734 -0.659  176.116 1.00 25.22  ?  286  GLN F NE2   1 
ATOM   2253 N  N     . GLY A 1 288 ? 105.273 1.983   172.662 1.00 22.52  ?  287  GLY F N     1 
ATOM   2254 C  CA    . GLY A 1 288 ? 105.921 2.735   171.609 1.00 22.95  ?  287  GLY F CA    1 
ATOM   2255 C  C     . GLY A 1 288 ? 105.990 4.217   171.917 1.00 24.79  ?  287  GLY F C     1 
ATOM   2256 O  O     . GLY A 1 288 ? 105.662 4.670   173.017 1.00 22.05  ?  287  GLY F O     1 
ATOM   2257 N  N     . VAL A 1 289 ? 106.451 4.972   170.922 1.00 22.85  ?  288  VAL F N     1 
ATOM   2258 C  CA    . VAL A 1 289 ? 106.772 6.374   171.126 1.00 24.19  ?  288  VAL F CA    1 
ATOM   2259 C  C     . VAL A 1 289 ? 106.159 7.210   170.017 1.00 27.60  ?  288  VAL F C     1 
ATOM   2260 O  O     . VAL A 1 289 ? 105.739 6.703   168.978 1.00 24.05  ?  288  VAL F O     1 
ATOM   2261 C  CB    . VAL A 1 289 ? 108.295 6.613   171.187 1.00 21.50  ?  288  VAL F CB    1 
ATOM   2262 C  CG1   . VAL A 1 289 ? 108.920 5.725   172.266 1.00 24.10  ?  288  VAL F CG1   1 
ATOM   2263 C  CG2   . VAL A 1 289 ? 108.923 6.347   169.819 1.00 24.58  ?  288  VAL F CG2   1 
ATOM   2264 N  N     . LYS A 1 290 ? 106.128 8.514   170.259 1.00 26.01  ?  289  LYS F N     1 
ATOM   2265 C  CA    . LYS A 1 290 ? 105.631 9.484   169.295 1.00 21.76  ?  289  LYS F CA    1 
ATOM   2266 C  C     . LYS A 1 290 ? 106.557 10.691  169.287 1.00 22.54  ?  289  LYS F C     1 
ATOM   2267 O  O     . LYS A 1 290 ? 107.004 11.140  170.348 1.00 25.46  ?  289  LYS F O     1 
ATOM   2268 C  CB    . LYS A 1 290 ? 104.185 9.885   169.636 1.00 20.49  ?  289  LYS F CB    1 
ATOM   2269 C  CG    . LYS A 1 290 ? 103.629 10.943  168.709 1.00 25.92  ?  289  LYS F CG    1 
ATOM   2270 C  CD    . LYS A 1 290 ? 102.105 10.912  168.667 1.00 36.42  ?  289  LYS F CD    1 
ATOM   2271 C  CE    . LYS A 1 290 ? 101.498 11.415  169.940 1.00 47.28  ?  289  LYS F CE    1 
ATOM   2272 N  NZ    . LYS A 1 290 ? 99.984  11.309  169.957 1.00 39.53  ?  289  LYS F NZ    1 
ATOM   2273 N  N     . LEU A 1 291 ? 106.887 11.183  168.092 1.00 24.16  ?  290  LEU F N     1 
ATOM   2274 C  CA    . LEU A 1 291 ? 107.542 12.477  167.932 1.00 25.03  ?  290  LEU F CA    1 
ATOM   2275 C  C     . LEU A 1 291 ? 106.717 13.330  166.990 1.00 23.84  ?  290  LEU F C     1 
ATOM   2276 O  O     . LEU A 1 291 ? 106.242 12.843  165.962 1.00 26.78  ?  290  LEU F O     1 
ATOM   2277 C  CB    . LEU A 1 291 ? 108.973 12.361  167.362 1.00 27.33  ?  290  LEU F CB    1 
ATOM   2278 C  CG    . LEU A 1 291 ? 109.919 11.460  168.147 1.00 27.75  ?  290  LEU F CG    1 
ATOM   2279 C  CD1   . LEU A 1 291 ? 111.252 11.446  167.410 1.00 31.10  ?  290  LEU F CD1   1 
ATOM   2280 C  CD2   . LEU A 1 291 ? 110.077 11.960  169.577 1.00 29.91  ?  290  LEU F CD2   1 
ATOM   2281 N  N     . LYS A 1 292 ? 106.569 14.605  167.337 1.00 27.53  ?  291  LYS F N     1 
ATOM   2282 C  CA    . LYS A 1 292 ? 105.983 15.592  166.438 1.00 28.26  ?  291  LYS F CA    1 
ATOM   2283 C  C     . LYS A 1 292 ? 107.043 16.641  166.149 1.00 27.19  ?  291  LYS F C     1 
ATOM   2284 O  O     . LYS A 1 292 ? 107.697 17.142  167.068 1.00 30.41  ?  291  LYS F O     1 
ATOM   2285 C  CB    . LYS A 1 292 ? 104.738 16.242  167.026 1.00 25.61  ?  291  LYS F CB    1 
ATOM   2286 C  CG    . LYS A 1 292 ? 104.016 17.142  166.028 1.00 27.78  ?  291  LYS F CG    1 
ATOM   2287 C  CD    . LYS A 1 292 ? 102.870 17.860  166.664 1.00 35.30  ?  291  LYS F CD    1 
ATOM   2288 C  CE    . LYS A 1 292 ? 101.679 16.944  166.925 1.00 35.16  ?  291  LYS F CE    1 
ATOM   2289 N  NZ    . LYS A 1 292 ? 100.708 17.646  167.815 1.00 33.08  ?  291  LYS F NZ    1 
ATOM   2290 N  N     . PHE A 1 293 ? 107.188 16.992  164.884 1.00 32.15  ?  292  PHE F N     1 
ATOM   2291 C  CA    . PHE A 1 293 ? 108.254 17.885  164.466 1.00 31.06  ?  292  PHE F CA    1 
ATOM   2292 C  C     . PHE A 1 293 ? 107.761 19.327  164.338 1.00 35.16  ?  292  PHE F C     1 
ATOM   2293 O  O     . PHE A 1 293 ? 106.562 19.616  164.355 1.00 34.95  ?  292  PHE F O     1 
ATOM   2294 C  CB    . PHE A 1 293 ? 108.856 17.367  163.158 1.00 33.98  ?  292  PHE F CB    1 
ATOM   2295 C  CG    . PHE A 1 293 ? 109.342 15.947  163.263 1.00 33.98  ?  292  PHE F CG    1 
ATOM   2296 C  CD1   . PHE A 1 293 ? 110.447 15.645  164.047 1.00 31.08  ?  292  PHE F CD1   1 
ATOM   2297 C  CD2   . PHE A 1 293 ? 108.689 14.914  162.607 1.00 41.87  ?  292  PHE F CD2   1 
ATOM   2298 C  CE1   . PHE A 1 293 ? 110.898 14.328  164.170 1.00 37.50  ?  292  PHE F CE1   1 
ATOM   2299 C  CE2   . PHE A 1 293 ? 109.137 13.605  162.720 1.00 35.93  ?  292  PHE F CE2   1 
ATOM   2300 C  CZ    . PHE A 1 293 ? 110.241 13.310  163.499 1.00 31.71  ?  292  PHE F CZ    1 
ATOM   2301 N  N     . ASP A 1 294 ? 108.727 20.239  164.181 1.00 40.67  ?  293  ASP F N     1 
ATOM   2302 C  CA    . ASP A 1 294 ? 108.438 21.671  164.174 1.00 41.74  ?  293  ASP F CA    1 
ATOM   2303 C  C     . ASP A 1 294 ? 107.548 22.094  163.013 1.00 45.93  ?  293  ASP F C     1 
ATOM   2304 O  O     . ASP A 1 294 ? 106.978 23.192  163.060 1.00 38.36  ?  293  ASP F O     1 
ATOM   2305 C  CB    . ASP A 1 294 ? 109.747 22.474  164.153 1.00 42.51  ?  293  ASP F CB    1 
ATOM   2306 C  CG    . ASP A 1 294 ? 110.692 22.066  163.018 1.00 47.31  ?  293  ASP F CG    1 
ATOM   2307 O  OD1   . ASP A 1 294 ? 110.273 21.368  162.074 1.00 36.32  ?  293  ASP F OD1   1 
ATOM   2308 O  OD2   . ASP A 1 294 ? 111.873 22.471  163.068 1.00 42.73  ?  293  ASP F OD2   1 
ATOM   2309 N  N     . ASP A 1 295 ? 107.434 21.272  161.969 1.00 39.60  ?  294  ASP F N     1 
ATOM   2310 C  CA    . ASP A 1 295 ? 106.503 21.511  160.871 1.00 37.00  ?  294  ASP F CA    1 
ATOM   2311 C  C     . ASP A 1 295 ? 105.217 20.706  161.005 1.00 32.91  ?  294  ASP F C     1 
ATOM   2312 O  O     . ASP A 1 295 ? 104.434 20.639  160.050 1.00 37.92  ?  294  ASP F O     1 
ATOM   2313 C  CB    . ASP A 1 295 ? 107.169 21.183  159.541 1.00 40.55  ?  294  ASP F CB    1 
ATOM   2314 C  CG    . ASP A 1 295 ? 107.514 19.727  159.425 1.00 41.82  ?  294  ASP F CG    1 
ATOM   2315 O  OD1   . ASP A 1 295 ? 107.383 18.995  160.425 1.00 37.58  ?  294  ASP F OD1   1 
ATOM   2316 O  OD2   . ASP A 1 295 ? 107.913 19.273  158.336 1.00 52.49  ?  294  ASP F OD2   1 
ATOM   2317 N  N     . PHE A 1 296 ? 105.013 20.057  162.144 1.00 30.65  ?  295  PHE F N     1 
ATOM   2318 C  CA    . PHE A 1 296 ? 103.792 19.383  162.570 1.00 32.28  ?  295  PHE F CA    1 
ATOM   2319 C  C     . PHE A 1 296 ? 103.555 18.014  161.946 1.00 35.53  ?  295  PHE F C     1 
ATOM   2320 O  O     . PHE A 1 296 ? 102.508 17.422  162.230 1.00 35.99  ?  295  PHE F O     1 
ATOM   2321 C  CB    . PHE A 1 296 ? 102.547 20.253  162.354 1.00 31.52  ?  295  PHE F CB    1 
ATOM   2322 C  CG    . PHE A 1 296 ? 102.238 21.097  163.533 1.00 31.69  ?  295  PHE F CG    1 
ATOM   2323 C  CD1   . PHE A 1 296 ? 103.070 22.158  163.862 1.00 48.55  ?  295  PHE F CD1   1 
ATOM   2324 C  CD2   . PHE A 1 296 ? 101.159 20.817  164.335 1.00 44.24  ?  295  PHE F CD2   1 
ATOM   2325 C  CE1   . PHE A 1 296 ? 102.816 22.919  164.973 1.00 59.46  ?  295  PHE F CE1   1 
ATOM   2326 C  CE2   . PHE A 1 296 ? 100.888 21.585  165.439 1.00 53.38  ?  295  PHE F CE2   1 
ATOM   2327 C  CZ    . PHE A 1 296 ? 101.710 22.637  165.761 1.00 58.59  ?  295  PHE F CZ    1 
ATOM   2328 N  N     . GLN A 1 297 ? 104.463 17.477  161.136 1.00 39.29  ?  296  GLN F N     1 
ATOM   2329 C  CA    . GLN A 1 297 ? 104.354 16.062  160.810 1.00 35.56  ?  296  GLN F CA    1 
ATOM   2330 C  C     . GLN A 1 297 ? 104.682 15.245  162.055 1.00 31.41  ?  296  GLN F C     1 
ATOM   2331 O  O     . GLN A 1 297 ? 105.482 15.652  162.903 1.00 32.31  ?  296  GLN F O     1 
ATOM   2332 C  CB    . GLN A 1 297 ? 105.277 15.687  159.650 1.00 37.67  ?  296  GLN F CB    1 
ATOM   2333 C  CG    . GLN A 1 297 ? 105.326 14.207  159.219 1.00 30.99  ?  296  GLN F CG    1 
ATOM   2334 C  CD    . GLN A 1 297 ? 106.475 13.930  158.230 1.00 49.05  ?  296  GLN F CD    1 
ATOM   2335 O  OE1   . GLN A 1 297 ? 107.600 14.384  158.437 1.00 61.65  ?  296  GLN F OE1   1 
ATOM   2336 N  NE2   . GLN A 1 297 ? 106.186 13.208  157.147 1.00 36.07  ?  296  GLN F NE2   1 
ATOM   2337 N  N     . GLN A 1 298 ? 104.026 14.110  162.182 1.00 32.09  ?  297  GLN F N     1 
ATOM   2338 C  CA    . GLN A 1 298 ? 104.137 13.294  163.378 1.00 29.45  ?  297  GLN F CA    1 
ATOM   2339 C  C     . GLN A 1 298 ? 104.395 11.858  162.965 1.00 32.57  ?  297  GLN F C     1 
ATOM   2340 O  O     . GLN A 1 298 ? 103.927 11.411  161.915 1.00 30.01  ?  297  GLN F O     1 
ATOM   2341 C  CB    . GLN A 1 298 ? 102.859 13.424  164.218 1.00 42.54  ?  297  GLN F CB    1 
ATOM   2342 C  CG    . GLN A 1 298 ? 102.512 12.275  165.120 1.00 53.57  ?  297  GLN F CG    1 
ATOM   2343 C  CD    . GLN A 1 298 ? 101.113 12.436  165.689 1.00 47.69  ?  297  GLN F CD    1 
ATOM   2344 O  OE1   . GLN A 1 298 ? 100.787 13.471  166.269 1.00 49.66  ?  297  GLN F OE1   1 
ATOM   2345 N  NE2   . GLN A 1 298 ? 100.273 11.433  165.488 1.00 41.44  ?  297  GLN F NE2   1 
ATOM   2346 N  N     . THR A 1 299 ? 105.170 11.145  163.787 1.00 28.29  ?  298  THR F N     1 
ATOM   2347 C  CA    . THR A 1 299 ? 105.441 9.742   163.546 1.00 23.71  ?  298  THR F CA    1 
ATOM   2348 C  C     . THR A 1 299 ? 105.257 8.977   164.847 1.00 24.59  ?  298  THR F C     1 
ATOM   2349 O  O     . THR A 1 299 ? 105.543 9.481   165.943 1.00 30.27  ?  298  THR F O     1 
ATOM   2350 C  CB    . THR A 1 299 ? 106.878 9.538   162.967 1.00 28.81  ?  298  THR F CB    1 
ATOM   2351 O  OG1   . THR A 1 299 ? 107.102 8.156   162.656 1.00 32.81  ?  298  THR F OG1   1 
ATOM   2352 C  CG2   . THR A 1 299 ? 107.936 10.025  163.946 1.00 31.69  ?  298  THR F CG2   1 
ATOM   2353 N  N     . THR A 1 300 ? 104.766 7.759   164.722 1.00 24.92  ?  299  THR F N     1 
ATOM   2354 C  CA    . THR A 1 300 ? 104.666 6.858   165.861 1.00 25.04  ?  299  THR F CA    1 
ATOM   2355 C  C     . THR A 1 300 ? 105.386 5.569   165.501 1.00 32.65  ?  299  THR F C     1 
ATOM   2356 O  O     . THR A 1 300 ? 105.326 5.119   164.354 1.00 32.52  ?  299  THR F O     1 
ATOM   2357 C  CB    . THR A 1 300 ? 103.195 6.556   166.258 1.00 30.90  ?  299  THR F CB    1 
ATOM   2358 O  OG1   . THR A 1 300 ? 102.480 5.953   165.162 1.00 28.30  ?  299  THR F OG1   1 
ATOM   2359 C  CG2   . THR A 1 300 ? 102.480 7.830   166.693 1.00 24.37  ?  299  THR F CG2   1 
ATOM   2360 N  N     . GLN A 1 301 ? 106.083 4.975   166.466 1.00 27.24  ?  300  GLN F N     1 
ATOM   2361 C  CA    . GLN A 1 301 ? 106.596 3.637   166.218 1.00 24.45  ?  300  GLN F CA    1 
ATOM   2362 C  C     . GLN A 1 301 ? 106.464 2.835   167.494 1.00 24.13  ?  300  GLN F C     1 
ATOM   2363 O  O     . GLN A 1 301 ? 106.917 3.244   168.572 1.00 27.25  ?  300  GLN F O     1 
ATOM   2364 C  CB    . GLN A 1 301 ? 108.016 3.634   165.636 1.00 39.07  ?  300  GLN F CB    1 
ATOM   2365 C  CG    . GLN A 1 301 ? 109.181 3.857   166.508 1.00 55.91  ?  300  GLN F CG    1 
ATOM   2366 C  CD    . GLN A 1 301 ? 110.479 3.623   165.725 1.00 65.44  ?  300  GLN F CD    1 
ATOM   2367 O  OE1   . GLN A 1 301 ? 111.177 4.569   165.357 1.00 66.23  ?  300  GLN F OE1   1 
ATOM   2368 N  NE2   . GLN A 1 301 ? 110.783 2.359   165.442 1.00 63.38  ?  300  GLN F NE2   1 
ATOM   2369 N  N     . GLU A 1 302 ? 105.730 1.752   167.358 1.00 21.90  ?  301  GLU F N     1 
ATOM   2370 C  CA    . GLU A 1 302 ? 105.257 0.910   168.439 1.00 24.03  ?  301  GLU F CA    1 
ATOM   2371 C  C     . GLU A 1 302 ? 105.487 -0.526  168.012 1.00 30.57  ?  301  GLU F C     1 
ATOM   2372 O  O     . GLU A 1 302 ? 105.652 -0.812  166.823 1.00 34.04  ?  301  GLU F O     1 
ATOM   2373 C  CB    . GLU A 1 302 ? 103.772 1.147   168.717 1.00 30.28  ?  301  GLU F CB    1 
ATOM   2374 C  CG    . GLU A 1 302 ? 103.466 2.590   169.084 1.00 28.89  ?  301  GLU F CG    1 
ATOM   2375 C  CD    . GLU A 1 302 ? 102.050 3.017   168.716 1.00 41.48  ?  301  GLU F CD    1 
ATOM   2376 O  OE1   . GLU A 1 302 ? 101.772 4.232   168.786 1.00 41.75  ?  301  GLU F OE1   1 
ATOM   2377 O  OE2   . GLU A 1 302 ? 101.232 2.145   168.357 1.00 42.76  ?  301  GLU F OE2   1 
ATOM   2378 N  N     . HIS A 1 303 ? 105.483 -1.434  168.985 1.00 27.63  ?  302  HIS F N     1 
ATOM   2379 C  CA    . HIS A 1 303 ? 105.734 -2.829  168.659 1.00 27.36  ?  302  HIS F CA    1 
ATOM   2380 C  C     . HIS A 1 303 ? 105.213 -3.708  169.786 1.00 26.74  ?  302  HIS F C     1 
ATOM   2381 O  O     . HIS A 1 303 ? 105.119 -3.276  170.938 1.00 24.87  ?  302  HIS F O     1 
ATOM   2382 C  CB    . HIS A 1 303 ? 107.236 -3.084  168.440 1.00 26.45  ?  302  HIS F CB    1 
ATOM   2383 C  CG    . HIS A 1 303 ? 108.087 -2.560  169.553 1.00 27.15  ?  302  HIS F CG    1 
ATOM   2384 N  ND1   . HIS A 1 303 ? 108.807 -1.388  169.449 1.00 35.57  ?  302  HIS F ND1   1 
ATOM   2385 C  CD2   . HIS A 1 303 ? 108.285 -3.014  170.813 1.00 30.16  ?  302  HIS F CD2   1 
ATOM   2386 C  CE1   . HIS A 1 303 ? 109.433 -1.158  170.589 1.00 40.44  ?  302  HIS F CE1   1 
ATOM   2387 N  NE2   . HIS A 1 303 ? 109.137 -2.131  171.434 1.00 34.20  ?  302  HIS F NE2   1 
ATOM   2388 N  N     . VAL A 1 304 ? 104.875 -4.947  169.438 1.00 28.70  ?  303  VAL F N     1 
ATOM   2389 C  CA    . VAL A 1 304 ? 104.618 -5.996  170.425 1.00 31.58  ?  303  VAL F CA    1 
ATOM   2390 C  C     . VAL A 1 304 ? 105.663 -5.953  171.531 1.00 28.63  ?  303  VAL F C     1 
ATOM   2391 O  O     . VAL A 1 304 ? 106.869 -5.930  171.258 1.00 28.85  ?  303  VAL F O     1 
ATOM   2392 C  CB    . VAL A 1 304 ? 104.594 -7.375  169.749 1.00 34.53  ?  303  VAL F CB    1 
ATOM   2393 C  CG1   . VAL A 1 304 ? 104.527 -8.467  170.792 1.00 41.47  ?  303  VAL F CG1   1 
ATOM   2394 C  CG2   . VAL A 1 304 ? 103.398 -7.452  168.817 1.00 31.59  ?  303  VAL F CG2   1 
ATOM   2395 N  N     . TRP A 1 305 ? 105.200 -5.938  172.787 1.00 25.84  ?  304  TRP F N     1 
ATOM   2396 C  CA    . TRP A 1 305 ? 106.064 -5.868  173.961 1.00 29.47  ?  304  TRP F CA    1 
ATOM   2397 C  C     . TRP A 1 305 ? 105.232 -6.276  175.171 1.00 27.04  ?  304  TRP F C     1 
ATOM   2398 O  O     . TRP A 1 305 ? 104.076 -5.854  175.306 1.00 27.31  ?  304  TRP F O     1 
ATOM   2399 C  CB    . TRP A 1 305 ? 106.649 -4.467  174.141 1.00 30.65  ?  304  TRP F CB    1 
ATOM   2400 C  CG    . TRP A 1 305 ? 107.751 -4.441  175.152 1.00 28.85  ?  304  TRP F CG    1 
ATOM   2401 C  CD1   . TRP A 1 305 ? 107.629 -4.219  176.495 1.00 28.57  ?  304  TRP F CD1   1 
ATOM   2402 C  CD2   . TRP A 1 305 ? 109.139 -4.657  174.903 1.00 29.41  ?  304  TRP F CD2   1 
ATOM   2403 N  NE1   . TRP A 1 305 ? 108.867 -4.284  177.103 1.00 27.13  ?  304  TRP F NE1   1 
ATOM   2404 C  CE2   . TRP A 1 305 ? 109.810 -4.549  176.143 1.00 31.03  ?  304  TRP F CE2   1 
ATOM   2405 C  CE3   . TRP A 1 305 ? 109.888 -4.921  173.749 1.00 30.25  ?  304  TRP F CE3   1 
ATOM   2406 C  CZ2   . TRP A 1 305 ? 111.192 -4.699  176.258 1.00 31.14  ?  304  TRP F CZ2   1 
ATOM   2407 C  CZ3   . TRP A 1 305 ? 111.268 -5.078  173.869 1.00 33.98  ?  304  TRP F CZ3   1 
ATOM   2408 C  CH2   . TRP A 1 305 ? 111.900 -4.967  175.113 1.00 33.48  ?  304  TRP F CH2   1 
ATOM   2409 N  N     . PRO A 1 306 ? 105.758 -7.103  176.051 1.00 29.76  ?  305  PRO F N     1 
ATOM   2410 C  CA    . PRO A 1 306 ? 104.891 -7.752  177.038 1.00 26.87  ?  305  PRO F CA    1 
ATOM   2411 C  C     . PRO A 1 306 ? 104.667 -6.979  178.323 1.00 26.36  ?  305  PRO F C     1 
ATOM   2412 O  O     . PRO A 1 306 ? 103.739 -7.300  179.069 1.00 27.67  ?  305  PRO F O     1 
ATOM   2413 C  CB    . PRO A 1 306 ? 105.643 -9.062  177.324 1.00 29.97  ?  305  PRO F CB    1 
ATOM   2414 C  CG    . PRO A 1 306 ? 107.085 -8.689  177.142 1.00 37.82  ?  305  PRO F CG    1 
ATOM   2415 C  CD    . PRO A 1 306 ? 107.094 -7.726  175.980 1.00 29.60  ?  305  PRO F CD    1 
ATOM   2416 N  N     . ARG A 1 307 ? 105.506 -5.987  178.618 1.00 33.44  ?  306  ARG F N     1 
ATOM   2417 C  CA    . ARG A 1 307 ? 105.467 -5.347  179.928 1.00 29.48  ?  306  ARG F CA    1 
ATOM   2418 C  C     . ARG A 1 307 ? 106.144 -3.993  179.830 1.00 29.16  ?  306  ARG F C     1 
ATOM   2419 O  O     . ARG A 1 307 ? 107.225 -3.886  179.246 1.00 32.31  ?  306  ARG F O     1 
ATOM   2420 C  CB    . ARG A 1 307 ? 106.167 -6.219  180.981 1.00 29.82  ?  306  ARG F CB    1 
ATOM   2421 C  CG    . ARG A 1 307 ? 106.119 -5.684  182.395 1.00 30.79  ?  306  ARG F CG    1 
ATOM   2422 C  CD    . ARG A 1 307 ? 106.873 -6.619  183.371 1.00 36.08  ?  306  ARG F CD    1 
ATOM   2423 N  NE    . ARG A 1 307 ? 106.577 -6.256  184.756 1.00 46.16  ?  306  ARG F NE    1 
ATOM   2424 C  CZ    . ARG A 1 307 ? 107.230 -5.324  185.451 1.00 42.30  ?  306  ARG F CZ    1 
ATOM   2425 N  NH1   . ARG A 1 307 ? 108.238 -4.663  184.899 1.00 39.64  ?  306  ARG F NH1   1 
ATOM   2426 N  NH2   . ARG A 1 307 ? 106.875 -5.043  186.700 1.00 37.33  ?  306  ARG F NH2   1 
ATOM   2427 N  N     . LEU A 1 308 ? 105.515 -2.980  180.413 1.00 30.59  ?  307  LEU F N     1 
ATOM   2428 C  CA    . LEU A 1 308 ? 106.005 -1.617  180.284 1.00 27.25  ?  307  LEU F CA    1 
ATOM   2429 C  C     . LEU A 1 308 ? 107.483 -1.554  180.641 1.00 24.95  ?  307  LEU F C     1 
ATOM   2430 O  O     . LEU A 1 308 ? 107.917 -2.109  181.654 1.00 28.30  ?  307  LEU F O     1 
ATOM   2431 C  CB    . LEU A 1 308 ? 105.183 -0.693  181.180 1.00 25.61  ?  307  LEU F CB    1 
ATOM   2432 C  CG    . LEU A 1 308 ? 105.577 0.776   181.031 1.00 26.40  ?  307  LEU F CG    1 
ATOM   2433 C  CD1   . LEU A 1 308 ? 105.237 1.298   179.647 1.00 25.25  ?  307  LEU F CD1   1 
ATOM   2434 C  CD2   . LEU A 1 308 ? 104.930 1.597   182.131 1.00 28.40  ?  307  LEU F CD2   1 
ATOM   2435 N  N     . ASN A 1 309 ? 108.274 -0.924  179.779 1.00 25.31  ?  308  ASN F N     1 
ATOM   2436 C  CA    . ASN A 1 309 ? 109.717 -0.936  179.980 1.00 25.46  ?  308  ASN F CA    1 
ATOM   2437 C  C     . ASN A 1 309 ? 110.332 0.373   179.503 1.00 25.06  ?  308  ASN F C     1 
ATOM   2438 O  O     . ASN A 1 309 ? 110.250 0.702   178.318 1.00 26.21  ?  308  ASN F O     1 
ATOM   2439 C  CB    . ASN A 1 309 ? 110.344 -2.134  179.256 1.00 29.65  ?  308  ASN F CB    1 
ATOM   2440 C  CG    . ASN A 1 309 ? 111.854 -2.191  179.408 1.00 27.95  ?  308  ASN F CG    1 
ATOM   2441 O  OD1   . ASN A 1 309 ? 112.578 -1.453  178.740 1.00 29.57  ?  308  ASN F OD1   1 
ATOM   2442 N  ND2   . ASN A 1 309 ? 112.339 -3.082  180.274 1.00 29.25  ?  308  ASN F ND2   1 
ATOM   2443 N  N     . LYS A 1 310 ? 110.995 1.095   180.418 1.00 27.48  ?  309  LYS F N     1 
ATOM   2444 C  CA    . LYS A 1 310 ? 111.481 2.440   180.088 1.00 25.75  ?  309  LYS F CA    1 
ATOM   2445 C  C     . LYS A 1 310 ? 112.610 2.394   179.069 1.00 25.99  ?  309  LYS F C     1 
ATOM   2446 O  O     . LYS A 1 310 ? 112.608 3.141   178.087 1.00 27.11  ?  309  LYS F O     1 
ATOM   2447 C  CB    . LYS A 1 310 ? 111.959 3.160   181.355 1.00 29.89  ?  309  LYS F CB    1 
ATOM   2448 C  CG    . LYS A 1 310 ? 112.261 4.630   181.108 1.00 27.32  ?  309  LYS F CG    1 
ATOM   2449 C  CD    . LYS A 1 310 ? 113.434 5.129   181.918 1.00 50.15  ?  309  LYS F CD    1 
ATOM   2450 C  CE    . LYS A 1 310 ? 113.174 5.064   183.391 1.00 52.66  ?  309  LYS F CE    1 
ATOM   2451 N  NZ    . LYS A 1 310 ? 114.376 5.558   184.096 1.00 36.79  ?  309  LYS F NZ    1 
ATOM   2452 N  N     . ALA A 1 311 ? 113.602 1.523   179.291 1.00 27.41  ?  310  ALA F N     1 
ATOM   2453 C  CA    . ALA A 1 311 ? 114.775 1.503   178.423 1.00 28.43  ?  310  ALA F CA    1 
ATOM   2454 C  C     . ALA A 1 311 ? 114.392 1.210   176.978 1.00 27.96  ?  310  ALA F C     1 
ATOM   2455 O  O     . ALA A 1 311 ? 114.956 1.796   176.044 1.00 28.20  ?  310  ALA F O     1 
ATOM   2456 C  CB    . ALA A 1 311 ? 115.784 0.472   178.935 1.00 30.08  ?  310  ALA F CB    1 
ATOM   2457 N  N     . ASP A 1 312 ? 113.421 0.318   176.770 1.00 33.08  ?  311  ASP F N     1 
ATOM   2458 C  CA    . ASP A 1 312 ? 113.004 0.024   175.404 1.00 35.77  ?  311  ASP F CA    1 
ATOM   2459 C  C     . ASP A 1 312 ? 112.303 1.228   174.773 1.00 25.75  ?  311  ASP F C     1 
ATOM   2460 O  O     . ASP A 1 312 ? 112.468 1.496   173.576 1.00 25.79  ?  311  ASP F O     1 
ATOM   2461 C  CB    . ASP A 1 312 ? 112.106 -1.219  175.379 1.00 26.88  ?  311  ASP F CB    1 
ATOM   2462 C  CG    . ASP A 1 312 ? 111.549 -1.490  174.000 1.00 27.42  ?  311  ASP F CG    1 
ATOM   2463 O  OD1   . ASP A 1 312 ? 112.325 -1.937  173.134 1.00 33.18  ?  311  ASP F OD1   1 
ATOM   2464 O  OD2   . ASP A 1 312 ? 110.340 -1.230  173.777 1.00 31.37  ?  311  ASP F OD2   1 
ATOM   2465 N  N     . LEU A 1 313 ? 111.536 1.981   175.562 1.00 24.73  ?  312  LEU F N     1 
ATOM   2466 C  CA    . LEU A 1 313 ? 110.938 3.204   175.031 1.00 23.66  ?  312  LEU F CA    1 
ATOM   2467 C  C     . LEU A 1 313 ? 112.009 4.230   174.688 1.00 27.13  ?  312  LEU F C     1 
ATOM   2468 O  O     . LEU A 1 313 ? 111.946 4.871   173.632 1.00 28.07  ?  312  LEU F O     1 
ATOM   2469 C  CB    . LEU A 1 313 ? 109.927 3.768   176.032 1.00 25.11  ?  312  LEU F CB    1 
ATOM   2470 C  CG    . LEU A 1 313 ? 108.687 2.899   176.269 1.00 26.32  ?  312  LEU F CG    1 
ATOM   2471 C  CD1   . LEU A 1 313 ? 107.888 3.336   177.504 1.00 22.65  ?  312  LEU F CD1   1 
ATOM   2472 C  CD2   . LEU A 1 313 ? 107.788 2.876   175.047 1.00 30.60  ?  312  LEU F CD2   1 
ATOM   2473 N  N     . ILE A 1 314 ? 113.026 4.372   175.544 1.00 25.26  ?  313  ILE F N     1 
ATOM   2474 C  CA    . ILE A 1 314 ? 114.135 5.272   175.215 1.00 26.60  ?  313  ILE F CA    1 
ATOM   2475 C  C     . ILE A 1 314 ? 114.846 4.802   173.949 1.00 29.83  ?  313  ILE F C     1 
ATOM   2476 O  O     . ILE A 1 314 ? 115.128 5.593   173.039 1.00 28.46  ?  313  ILE F O     1 
ATOM   2477 C  CB    . ILE A 1 314 ? 115.117 5.370   176.393 1.00 28.29  ?  313  ILE F CB    1 
ATOM   2478 C  CG1   . ILE A 1 314 ? 114.471 6.026   177.619 1.00 31.23  ?  313  ILE F CG1   1 
ATOM   2479 C  CG2   . ILE A 1 314 ? 116.401 6.099   175.957 1.00 29.17  ?  313  ILE F CG2   1 
ATOM   2480 C  CD1   . ILE A 1 314 ? 115.286 5.765   178.891 1.00 33.27  ?  313  ILE F CD1   1 
ATOM   2481 N  N     . ALA A 1 315 ? 115.169 3.506   173.887 1.00 30.00  ?  314  ALA F N     1 
ATOM   2482 C  CA    . ALA A 1 315 ? 115.837 2.955   172.711 1.00 31.48  ?  314  ALA F CA    1 
ATOM   2483 C  C     . ALA A 1 315 ? 115.028 3.199   171.449 1.00 27.95  ?  314  ALA F C     1 
ATOM   2484 O  O     . ALA A 1 315 ? 115.586 3.501   170.384 1.00 33.35  ?  314  ALA F O     1 
ATOM   2485 C  CB    . ALA A 1 315 ? 116.070 1.457   172.893 1.00 35.28  ?  314  ALA F CB    1 
ATOM   2486 N  N     . THR A 1 316 ? 113.715 3.033   171.540 1.00 26.62  ?  315  THR F N     1 
ATOM   2487 C  CA    . THR A 1 316 ? 112.853 3.226   170.379 1.00 28.44  ?  315  THR F CA    1 
ATOM   2488 C  C     . THR A 1 316 ? 112.807 4.689   169.977 1.00 30.98  ?  315  THR F C     1 
ATOM   2489 O  O     . THR A 1 316 ? 112.932 5.021   168.795 1.00 29.52  ?  315  THR F O     1 
ATOM   2490 C  CB    . THR A 1 316 ? 111.462 2.691   170.695 1.00 33.12  ?  315  THR F CB    1 
ATOM   2491 O  OG1   . THR A 1 316 ? 111.573 1.300   171.033 1.00 35.93  ?  315  THR F OG1   1 
ATOM   2492 C  CG2   . THR A 1 316 ? 110.534 2.849   169.503 1.00 28.57  ?  315  THR F CG2   1 
ATOM   2493 N  N     . ALA A 1 317 ? 112.694 5.585   170.957 1.00 25.54  ?  316  ALA F N     1 
ATOM   2494 C  CA    . ALA A 1 317 ? 112.758 7.009   170.641 1.00 29.15  ?  316  ALA F CA    1 
ATOM   2495 C  C     . ALA A 1 317 ? 114.096 7.388   170.003 1.00 27.46  ?  316  ALA F C     1 
ATOM   2496 O  O     . ALA A 1 317 ? 114.139 8.235   169.100 1.00 28.62  ?  316  ALA F O     1 
ATOM   2497 C  CB    . ALA A 1 317 ? 112.494 7.820   171.910 1.00 27.58  ?  316  ALA F CB    1 
ATOM   2498 N  N     . ARG A 1 318 ? 115.195 6.756   170.432 1.00 29.42  ?  317  ARG F N     1 
ATOM   2499 C  CA    . ARG A 1 318 ? 116.494 7.065   169.843 1.00 36.87  ?  317  ARG F CA    1 
ATOM   2500 C  C     . ARG A 1 318 ? 116.527 6.707   168.361 1.00 35.34  ?  317  ARG F C     1 
ATOM   2501 O  O     . ARG A 1 318 ? 116.990 7.500   167.534 1.00 32.93  ?  317  ARG F O     1 
ATOM   2502 C  CB    . ARG A 1 318 ? 117.608 6.334   170.595 1.00 31.15  ?  317  ARG F CB    1 
ATOM   2503 C  CG    . ARG A 1 318 ? 119.005 6.629   170.025 1.00 33.13  ?  317  ARG F CG    1 
ATOM   2504 C  CD    . ARG A 1 318 ? 119.357 8.093   170.207 1.00 45.34  ?  317  ARG F CD    1 
ATOM   2505 N  NE    . ARG A 1 318 ? 120.453 8.506   169.333 1.00 58.98  ?  317  ARG F NE    1 
ATOM   2506 C  CZ    . ARG A 1 318 ? 121.725 8.605   169.710 1.00 58.94  ?  317  ARG F CZ    1 
ATOM   2507 N  NH1   . ARG A 1 318 ? 122.074 8.321   170.959 1.00 49.32  ?  317  ARG F NH1   1 
ATOM   2508 N  NH2   . ARG A 1 318 ? 122.650 8.985   168.834 1.00 55.56  ?  317  ARG F NH2   1 
ATOM   2509 N  N     . LYS A 1 319 ? 116.031 5.515   168.009 1.00 30.41  ?  318  LYS F N     1 
ATOM   2510 C  CA    . LYS A 1 319 ? 115.936 5.116   166.603 1.00 31.02  ?  318  LYS F CA    1 
ATOM   2511 C  C     . LYS A 1 319 ? 115.076 6.088   165.800 1.00 37.34  ?  318  LYS F C     1 
ATOM   2512 O  O     . LYS A 1 319 ? 115.459 6.513   164.700 1.00 37.99  ?  318  LYS F O     1 
ATOM   2513 C  CB    . LYS A 1 319 ? 115.359 3.703   166.492 1.00 31.84  ?  318  LYS F CB    1 
ATOM   2514 C  CG    . LYS A 1 319 ? 116.332 2.584   166.828 1.00 50.73  ?  318  LYS F CG    1 
ATOM   2515 C  CD    . LYS A 1 319 ? 115.716 1.191   166.633 1.00 60.73  ?  318  LYS F CD    1 
ATOM   2516 C  CE    . LYS A 1 319 ? 115.497 0.837   165.156 1.00 68.32  ?  318  LYS F CE    1 
ATOM   2517 N  NZ    . LYS A 1 319 ? 114.298 1.477   164.532 1.00 69.53  ?  318  LYS F NZ    1 
ATOM   2518 N  N     . THR A 1 320 ? 113.888 6.426   166.321 1.00 34.49  ?  319  THR F N     1 
ATOM   2519 C  CA    . THR A 1 320 ? 113.021 7.374   165.627 1.00 36.18  ?  319  THR F CA    1 
ATOM   2520 C  C     . THR A 1 320 ? 113.698 8.727   165.486 1.00 29.60  ?  319  THR F C     1 
ATOM   2521 O  O     . THR A 1 320 ? 113.610 9.373   164.433 1.00 31.40  ?  319  THR F O     1 
ATOM   2522 C  CB    . THR A 1 320 ? 111.698 7.542   166.382 1.00 34.36  ?  319  THR F CB    1 
ATOM   2523 O  OG1   . THR A 1 320 ? 111.196 6.266   166.783 1.00 32.48  ?  319  THR F OG1   1 
ATOM   2524 C  CG2   . THR A 1 320 ? 110.685 8.212   165.508 1.00 27.93  ?  319  THR F CG2   1 
ATOM   2525 N  N     . TRP A 1 321 ? 114.339 9.189   166.560 1.00 30.06  ?  320  TRP F N     1 
ATOM   2526 C  CA    . TRP A 1 321 ? 115.070 10.450  166.511 1.00 32.82  ?  320  TRP F CA    1 
ATOM   2527 C  C     . TRP A 1 321 ? 116.126 10.418  165.418 1.00 32.69  ?  320  TRP F C     1 
ATOM   2528 O  O     . TRP A 1 321 ? 116.154 11.291  164.538 1.00 33.53  ?  320  TRP F O     1 
ATOM   2529 C  CB    . TRP A 1 321 ? 115.708 10.723  167.872 1.00 33.05  ?  320  TRP F CB    1 
ATOM   2530 C  CG    . TRP A 1 321 ? 116.480 12.005  167.972 1.00 34.01  ?  320  TRP F CG    1 
ATOM   2531 C  CD1   . TRP A 1 321 ? 117.781 12.210  167.630 1.00 35.59  ?  320  TRP F CD1   1 
ATOM   2532 C  CD2   . TRP A 1 321 ? 115.999 13.242  168.491 1.00 38.08  ?  320  TRP F CD2   1 
ATOM   2533 N  NE1   . TRP A 1 321 ? 118.140 13.513  167.892 1.00 35.73  ?  320  TRP F NE1   1 
ATOM   2534 C  CE2   . TRP A 1 321 ? 117.058 14.165  168.424 1.00 36.78  ?  320  TRP F CE2   1 
ATOM   2535 C  CE3   . TRP A 1 321 ? 114.771 13.660  169.006 1.00 33.31  ?  320  TRP F CE3   1 
ATOM   2536 C  CZ2   . TRP A 1 321 ? 116.922 15.490  168.838 1.00 33.48  ?  320  TRP F CZ2   1 
ATOM   2537 C  CZ3   . TRP A 1 321 ? 114.636 14.983  169.418 1.00 32.81  ?  320  TRP F CZ3   1 
ATOM   2538 C  CH2   . TRP A 1 321 ? 115.711 15.875  169.344 1.00 31.92  ?  320  TRP F CH2   1 
ATOM   2539 N  N     . ASP A 1 322 ? 116.994 9.406   165.451 1.00 35.86  ?  321  ASP F N     1 
ATOM   2540 C  CA    . ASP A 1 322 ? 118.066 9.316   164.462 1.00 36.94  ?  321  ASP F CA    1 
ATOM   2541 C  C     . ASP A 1 322 ? 117.515 9.158   163.052 1.00 38.29  ?  321  ASP F C     1 
ATOM   2542 O  O     . ASP A 1 322 ? 118.017 9.782   162.114 1.00 38.72  ?  321  ASP F O     1 
ATOM   2543 C  CB    . ASP A 1 322 ? 119.002 8.151   164.794 1.00 36.06  ?  321  ASP F CB    1 
ATOM   2544 C  CG    . ASP A 1 322 ? 119.826 8.412   166.027 1.00 39.38  ?  321  ASP F CG    1 
ATOM   2545 O  OD1   . ASP A 1 322 ? 119.980 9.600   166.384 1.00 42.80  ?  321  ASP F OD1   1 
ATOM   2546 O  OD2   . ASP A 1 322 ? 120.315 7.442   166.641 1.00 41.99  ?  321  ASP F OD2   1 
ATOM   2547 N  N     . GLU A 1 323 ? 116.462 8.357   162.883 1.00 45.99  ?  322  GLU F N     1 
ATOM   2548 C  CA    . GLU A 1 323 ? 116.054 7.954   161.538 1.00 46.18  ?  322  GLU F CA    1 
ATOM   2549 C  C     . GLU A 1 323 ? 115.087 8.919   160.859 1.00 47.60  ?  322  GLU F C     1 
ATOM   2550 O  O     . GLU A 1 323 ? 115.109 9.026   159.628 1.00 48.67  ?  322  GLU F O     1 
ATOM   2551 C  CB    . GLU A 1 323 ? 115.436 6.552   161.568 1.00 40.73  ?  322  GLU F CB    1 
ATOM   2552 C  CG    . GLU A 1 323 ? 116.474 5.469   161.838 1.00 47.60  ?  322  GLU F CG    1 
ATOM   2553 C  CD    . GLU A 1 323 ? 115.876 4.107   162.123 1.00 64.03  ?  322  GLU F CD    1 
ATOM   2554 O  OE1   . GLU A 1 323 ? 114.635 3.995   162.197 1.00 68.61  ?  322  GLU F OE1   1 
ATOM   2555 O  OE2   . GLU A 1 323 ? 116.657 3.144   162.286 1.00 66.86  ?  322  GLU F OE2   1 
ATOM   2556 N  N     . ARG A 1 324 ? 114.247 9.634   161.604 1.00 37.51  ?  323  ARG F N     1 
ATOM   2557 C  CA    . ARG A 1 324 ? 113.176 10.397  160.987 1.00 40.28  ?  323  ARG F CA    1 
ATOM   2558 C  C     . ARG A 1 324 ? 113.203 11.887  161.310 1.00 42.98  ?  323  ARG F C     1 
ATOM   2559 O  O     . ARG A 1 324 ? 112.382 12.631  160.762 1.00 58.24  ?  323  ARG F O     1 
ATOM   2560 C  CB    . ARG A 1 324 ? 111.818 9.799   161.391 1.00 47.51  ?  323  ARG F CB    1 
ATOM   2561 C  CG    . ARG A 1 324 ? 111.215 8.824   160.367 1.00 48.79  ?  323  ARG F CG    1 
ATOM   2562 C  CD    . ARG A 1 324 ? 110.320 9.569   159.378 1.00 46.50  ?  323  ARG F CD    1 
ATOM   2563 N  NE    . ARG A 1 324 ? 108.901 9.197   159.467 1.00 54.49  ?  323  ARG F NE    1 
ATOM   2564 C  CZ    . ARG A 1 324 ? 107.896 10.007  159.131 1.00 64.19  ?  323  ARG F CZ    1 
ATOM   2565 N  NH1   . ARG A 1 324 ? 108.144 11.236  158.700 1.00 71.30  ?  323  ARG F NH1   1 
ATOM   2566 N  NH2   . ARG A 1 324 ? 106.637 9.599   159.238 1.00 84.82  ?  323  ARG F NH2   1 
ATOM   2567 N  N     . ARG A 1 325 ? 114.120 12.358  162.162 1.00 37.66  ?  324  ARG F N     1 
ATOM   2568 C  CA    . ARG A 1 325 ? 114.053 13.764  162.563 1.00 42.71  ?  324  ARG F CA    1 
ATOM   2569 C  C     . ARG A 1 325 ? 114.535 14.704  161.455 1.00 49.70  ?  324  ARG F C     1 
ATOM   2570 O  O     . ARG A 1 325 ? 113.967 15.787  161.264 1.00 47.49  ?  324  ARG F O     1 
ATOM   2571 C  CB    . ARG A 1 325 ? 114.860 13.988  163.837 1.00 43.59  ?  324  ARG F CB    1 
ATOM   2572 C  CG    . ARG A 1 325 ? 114.765 15.412  164.356 1.00 45.99  ?  324  ARG F CG    1 
ATOM   2573 C  CD    . ARG A 1 325 ? 115.451 15.530  165.699 1.00 54.99  ?  324  ARG F CD    1 
ATOM   2574 N  NE    . ARG A 1 325 ? 116.735 16.225  165.619 1.00 58.54  ?  324  ARG F NE    1 
ATOM   2575 C  CZ    . ARG A 1 325 ? 117.870 15.677  165.205 1.00 63.33  ?  324  ARG F CZ    1 
ATOM   2576 N  NH1   . ARG A 1 325 ? 117.908 14.407  164.812 1.00 66.49  ?  324  ARG F NH1   1 
ATOM   2577 N  NH2   . ARG A 1 325 ? 118.975 16.411  165.183 1.00 57.06  ?  324  ARG F NH2   1 
ATOM   2578 N  N     . GLY A 1 326 ? 115.592 14.328  160.742 1.00 50.51  ?  325  GLY F N     1 
ATOM   2579 C  CA    . GLY A 1 326 ? 116.067 15.150  159.632 1.00 48.71  ?  325  GLY F CA    1 
ATOM   2580 C  C     . GLY A 1 326 ? 116.431 16.567  160.017 1.00 52.88  ?  325  GLY F C     1 
ATOM   2581 O  O     . GLY A 1 326 ? 116.116 17.513  159.283 1.00 49.45  ?  325  GLY F O     1 
ATOM   2582 N  N     . GLY A 1 327 ? 117.080 16.741  161.160 1.00 39.45  ?  326  GLY F N     1 
ATOM   2583 C  CA    . GLY A 1 327 ? 117.494 18.055  161.606 1.00 51.58  ?  326  GLY F CA    1 
ATOM   2584 C  C     . GLY A 1 327 ? 116.394 19.023  162.007 1.00 50.68  ?  326  GLY F C     1 
ATOM   2585 O  O     . GLY A 1 327 ? 116.684 20.177  162.339 1.00 47.17  ?  326  GLY F O     1 
ATOM   2586 N  N     . ARG A 1 328 ? 115.139 18.582  161.999 1.00 46.77  ?  327  ARG F N     1 
ATOM   2587 C  CA    . ARG A 1 328 ? 114.034 19.434  162.410 1.00 40.01  ?  327  ARG F CA    1 
ATOM   2588 C  C     . ARG A 1 328 ? 113.953 19.544  163.928 1.00 39.94  ?  327  ARG F C     1 
ATOM   2589 O  O     . ARG A 1 328 ? 114.380 18.650  164.657 1.00 38.62  ?  327  ARG F O     1 
ATOM   2590 C  CB    . ARG A 1 328 ? 112.715 18.889  161.881 1.00 39.01  ?  327  ARG F CB    1 
ATOM   2591 C  CG    . ARG A 1 328 ? 112.481 19.111  160.413 1.00 41.42  ?  327  ARG F CG    1 
ATOM   2592 C  CD    . ARG A 1 328 ? 111.254 18.325  160.000 1.00 45.17  ?  327  ARG F CD    1 
ATOM   2593 N  NE    . ARG A 1 328 ? 111.504 16.893  160.147 1.00 54.37  ?  327  ARG F NE    1 
ATOM   2594 C  CZ    . ARG A 1 328 ? 110.592 15.948  159.952 1.00 40.94  ?  327  ARG F CZ    1 
ATOM   2595 N  NH1   . ARG A 1 328 ? 109.365 16.279  159.613 1.00 51.05  ?  327  ARG F NH1   1 
ATOM   2596 N  NH2   . ARG A 1 328 ? 110.904 14.674  160.105 1.00 38.82  ?  327  ARG F NH2   1 
ATOM   2597 N  N     . GLY A 1 329 ? 113.401 20.657  164.406 1.00 39.40  ?  328  GLY F N     1 
ATOM   2598 C  CA    . GLY A 1 329 ? 113.058 20.730  165.814 1.00 38.50  ?  328  GLY F CA    1 
ATOM   2599 C  C     . GLY A 1 329 ? 111.951 19.748  166.154 1.00 32.12  ?  328  GLY F C     1 
ATOM   2600 O  O     . GLY A 1 329 ? 111.142 19.377  165.308 1.00 34.55  ?  328  GLY F O     1 
ATOM   2601 N  N     . VAL A 1 330 ? 111.915 19.316  167.408 1.00 35.19  ?  329  VAL F N     1 
ATOM   2602 C  CA    . VAL A 1 330 ? 110.850 18.443  167.893 1.00 28.61  ?  329  VAL F CA    1 
ATOM   2603 C  C     . VAL A 1 330 ? 110.033 19.223  168.908 1.00 34.85  ?  329  VAL F C     1 
ATOM   2604 O  O     . VAL A 1 330 ? 110.577 19.712  169.907 1.00 31.04  ?  329  VAL F O     1 
ATOM   2605 C  CB    . VAL A 1 330 ? 111.413 17.156  168.509 1.00 28.20  ?  329  VAL F CB    1 
ATOM   2606 C  CG1   . VAL A 1 330 ? 110.321 16.420  169.296 1.00 26.36  ?  329  VAL F CG1   1 
ATOM   2607 C  CG2   . VAL A 1 330 ? 111.991 16.258  167.423 1.00 34.79  ?  329  VAL F CG2   1 
ATOM   2608 N  N     . ARG A 1 331 ? 108.721 19.337  168.665 1.00 29.27  ?  330  ARG F N     1 
ATOM   2609 C  CA    . ARG A 1 331 ? 107.869 20.049  169.603 1.00 28.42  ?  330  ARG F CA    1 
ATOM   2610 C  C     . ARG A 1 331 ? 107.170 19.127  170.591 1.00 29.15  ?  330  ARG F C     1 
ATOM   2611 O  O     . ARG A 1 331 ? 106.786 19.594  171.672 1.00 29.37  ?  330  ARG F O     1 
ATOM   2612 C  CB    . ARG A 1 331 ? 106.815 20.885  168.861 1.00 25.69  ?  330  ARG F CB    1 
ATOM   2613 C  CG    . ARG A 1 331 ? 105.954 20.086  167.903 1.00 32.19  ?  330  ARG F CG    1 
ATOM   2614 C  CD    . ARG A 1 331 ? 104.963 20.989  167.164 1.00 29.42  ?  330  ARG F CD    1 
ATOM   2615 N  NE    . ARG A 1 331 ? 103.988 21.603  168.066 1.00 29.10  ?  330  ARG F NE    1 
ATOM   2616 C  CZ    . ARG A 1 331 ? 103.886 22.910  168.304 1.00 40.03  ?  330  ARG F CZ    1 
ATOM   2617 N  NH1   . ARG A 1 331 ? 102.947 23.353  169.131 1.00 31.68  ?  330  ARG F NH1   1 
ATOM   2618 N  NH2   . ARG A 1 331 ? 104.716 23.778  167.719 1.00 30.30  ?  330  ARG F NH2   1 
ATOM   2619 N  N     . LEU A 1 332 ? 107.039 17.832  170.278 1.00 26.51  ?  331  LEU F N     1 
ATOM   2620 C  CA    . LEU A 1 332 ? 106.329 16.909  171.162 1.00 22.90  ?  331  LEU F CA    1 
ATOM   2621 C  C     . LEU A 1 332 ? 107.025 15.560  171.232 1.00 23.19  ?  331  LEU F C     1 
ATOM   2622 O  O     . LEU A 1 332 ? 107.462 15.023  170.213 1.00 27.08  ?  331  LEU F O     1 
ATOM   2623 C  CB    . LEU A 1 332 ? 104.881 16.688  170.691 1.00 24.60  ?  331  LEU F CB    1 
ATOM   2624 C  CG    . LEU A 1 332 ? 104.028 15.576  171.346 1.00 26.60  ?  331  LEU F CG    1 
ATOM   2625 C  CD1   . LEU A 1 332 ? 102.574 15.925  171.158 1.00 29.42  ?  331  LEU F CD1   1 
ATOM   2626 C  CD2   . LEU A 1 332 ? 104.288 14.169  170.771 1.00 23.40  ?  331  LEU F CD2   1 
ATOM   2627 N  N     . VAL A 1 333 ? 107.077 15.006  172.444 1.00 22.81  ?  332  VAL F N     1 
ATOM   2628 C  CA    . VAL A 1 333 ? 107.501 13.637  172.699 1.00 28.03  ?  332  VAL F CA    1 
ATOM   2629 C  C     . VAL A 1 333 ? 106.366 12.936  173.426 1.00 22.21  ?  332  VAL F C     1 
ATOM   2630 O  O     . VAL A 1 333 ? 105.770 13.498  174.353 1.00 24.17  ?  332  VAL F O     1 
ATOM   2631 C  CB    . VAL A 1 333 ? 108.800 13.586  173.537 1.00 25.49  ?  332  VAL F CB    1 
ATOM   2632 C  CG1   . VAL A 1 333 ? 109.259 12.134  173.756 1.00 27.61  ?  332  VAL F CG1   1 
ATOM   2633 C  CG2   . VAL A 1 333 ? 109.893 14.390  172.869 1.00 24.50  ?  332  VAL F CG2   1 
ATOM   2634 N  N     . GLY A 1 334 ? 106.062 11.705  173.022 1.00 21.80  ?  333  GLY F N     1 
ATOM   2635 C  CA    . GLY A 1 334 ? 105.051 10.936  173.716 1.00 21.55  ?  333  GLY F CA    1 
ATOM   2636 C  C     . GLY A 1 334 ? 105.425 9.474   173.843 1.00 21.85  ?  333  GLY F C     1 
ATOM   2637 O  O     . GLY A 1 334 ? 106.180 8.927   173.041 1.00 24.10  ?  333  GLY F O     1 
ATOM   2638 N  N     . LEU A 1 335 ? 104.857 8.849   174.870 1.00 22.28  ?  334  LEU F N     1 
ATOM   2639 C  CA    . LEU A 1 335 ? 104.921 7.409   175.091 1.00 24.62  ?  334  LEU F CA    1 
ATOM   2640 C  C     . LEU A 1 335 ? 103.528 6.795   174.958 1.00 28.17  ?  334  LEU F C     1 
ATOM   2641 O  O     . LEU A 1 335 ? 102.505 7.460   175.154 1.00 23.71  ?  334  LEU F O     1 
ATOM   2642 C  CB    . LEU A 1 335 ? 105.504 7.101   176.477 1.00 24.06  ?  334  LEU F CB    1 
ATOM   2643 C  CG    . LEU A 1 335 ? 106.823 7.813   176.806 1.00 25.16  ?  334  LEU F CG    1 
ATOM   2644 C  CD1   . LEU A 1 335 ? 107.268 7.477   178.241 1.00 23.20  ?  334  LEU F CD1   1 
ATOM   2645 C  CD2   . LEU A 1 335 ? 107.924 7.452   175.811 1.00 24.21  ?  334  LEU F CD2   1 
ATOM   2646 N  N     . HIS A 1 336 ? 103.484 5.499   174.653 1.00 24.94  ?  335  HIS F N     1 
ATOM   2647 C  CA    . HIS A 1 336 ? 102.210 4.861   174.342 1.00 24.72  ?  335  HIS F CA    1 
ATOM   2648 C  C     . HIS A 1 336 ? 102.243 3.386   174.716 1.00 25.97  ?  335  HIS F C     1 
ATOM   2649 O  O     . HIS A 1 336 ? 103.268 2.723   174.539 1.00 23.79  ?  335  HIS F O     1 
ATOM   2650 C  CB    . HIS A 1 336 ? 101.901 5.006   172.852 1.00 25.10  ?  335  HIS F CB    1 
ATOM   2651 C  CG    . HIS A 1 336 ? 100.480 4.714   172.488 1.00 27.71  ?  335  HIS F CG    1 
ATOM   2652 N  ND1   . HIS A 1 336 ? 100.089 3.517   171.929 1.00 29.57  ?  335  HIS F ND1   1 
ATOM   2653 C  CD2   . HIS A 1 336 ? 99.361  5.477   172.567 1.00 30.16  ?  335  HIS F CD2   1 
ATOM   2654 C  CE1   . HIS A 1 336 ? 98.787  3.546   171.699 1.00 29.98  ?  335  HIS F CE1   1 
ATOM   2655 N  NE2   . HIS A 1 336 ? 98.325  4.731   172.061 1.00 27.27  ?  335  HIS F NE2   1 
ATOM   2656 N  N     . VAL A 1 337 ? 101.121 2.873   175.226 1.00 23.72  ?  336  VAL F N     1 
ATOM   2657 C  CA    . VAL A 1 337 ? 100.939 1.429   175.332 1.00 28.42  ?  336  VAL F CA    1 
ATOM   2658 C  C     . VAL A 1 337 ? 99.591  1.039   174.746 1.00 28.83  ?  336  VAL F C     1 
ATOM   2659 O  O     . VAL A 1 337 ? 98.608  1.790   174.800 1.00 23.79  ?  336  VAL F O     1 
ATOM   2660 C  CB    . VAL A 1 337 ? 101.067 0.871   176.772 1.00 30.34  ?  336  VAL F CB    1 
ATOM   2661 C  CG1   . VAL A 1 337 ? 102.416 1.240   177.400 1.00 24.83  ?  336  VAL F CG1   1 
ATOM   2662 C  CG2   . VAL A 1 337 ? 99.894  1.283   177.641 1.00 29.08  ?  336  VAL F CG2   1 
ATOM   2663 N  N     . THR A 1 338 ? 99.558  -0.158  174.184 1.00 25.38  ?  337  THR F N     1 
ATOM   2664 C  CA    . THR A 1 338 ? 98.325  -0.825  173.795 1.00 19.98  ?  337  THR F CA    1 
ATOM   2665 C  C     . THR A 1 338 ? 98.035  -1.906  174.828 1.00 30.50  ?  337  THR F C     1 
ATOM   2666 O  O     . THR A 1 338 ? 98.921  -2.699  175.161 1.00 27.92  ?  337  THR F O     1 
ATOM   2667 C  CB    . THR A 1 338 ? 98.448  -1.442  172.407 1.00 28.30  ?  337  THR F CB    1 
ATOM   2668 O  OG1   . THR A 1 338 ? 98.848  -0.444  171.474 1.00 31.15  ?  337  THR F OG1   1 
ATOM   2669 C  CG2   . THR A 1 338 ? 97.121  -2.063  171.973 1.00 26.61  ?  337  THR F CG2   1 
ATOM   2670 N  N     . LEU A 1 339 ? 96.807  -1.930  175.340 1.00 25.94  ?  338  LEU F N     1 
ATOM   2671 C  CA    . LEU A 1 339 ? 96.466  -2.856  176.410 1.00 26.95  ?  338  LEU F CA    1 
ATOM   2672 C  C     . LEU A 1 339 ? 96.112  -4.232  175.849 1.00 28.17  ?  338  LEU F C     1 
ATOM   2673 O  O     . LEU A 1 339 ? 95.640  -4.360  174.714 1.00 28.97  ?  338  LEU F O     1 
ATOM   2674 C  CB    . LEU A 1 339 ? 95.298  -2.300  177.232 1.00 27.84  ?  338  LEU F CB    1 
ATOM   2675 C  CG    . LEU A 1 339 ? 95.526  -0.931  177.875 1.00 27.19  ?  338  LEU F CG    1 
ATOM   2676 C  CD1   . LEU A 1 339 ? 94.252  -0.461  178.595 1.00 31.53  ?  338  LEU F CD1   1 
ATOM   2677 C  CD2   . LEU A 1 339 ? 96.697  -0.966  178.842 1.00 29.88  ?  338  LEU F CD2   1 
ATOM   2678 N  N     . LEU A 1 340 ? 96.354  -5.268  176.659 1.00 29.47  ?  339  LEU F N     1 
ATOM   2679 C  CA    . LEU A 1 340 ? 95.927  -6.613  176.298 1.00 39.88  ?  339  LEU F CA    1 
ATOM   2680 C  C     . LEU A 1 340 ? 94.429  -6.629  176.021 1.00 37.23  ?  339  LEU F C     1 
ATOM   2681 O  O     . LEU A 1 340 ? 93.659  -5.878  176.624 1.00 41.07  ?  339  LEU F O     1 
ATOM   2682 C  CB    . LEU A 1 340 ? 96.270  -7.602  177.415 1.00 37.47  ?  339  LEU F CB    1 
ATOM   2683 C  CG    . LEU A 1 340 ? 97.773  -7.831  177.633 1.00 40.29  ?  339  LEU F CG    1 
ATOM   2684 C  CD1   . LEU A 1 340 ? 98.020  -8.571  178.934 1.00 50.36  ?  339  LEU F CD1   1 
ATOM   2685 C  CD2   . LEU A 1 340 ? 98.357  -8.600  176.461 1.00 34.24  ?  339  LEU F CD2   1 
ATOM   2686 N  N     . ASP A 1 341 ? 94.018  -7.522  175.114 1.00 40.18  ?  340  ASP F N     1 
ATOM   2687 C  CA    . ASP A 1 341 ? 92.675  -7.449  174.534 1.00 48.52  ?  340  ASP F CA    1 
ATOM   2688 C  C     . ASP A 1 341 ? 91.533  -7.476  175.542 1.00 64.44  ?  340  ASP F C     1 
ATOM   2689 O  O     . ASP A 1 341 ? 90.644  -6.610  175.454 1.00 75.52  ?  340  ASP F O     1 
ATOM   2690 C  CB    . ASP A 1 341 ? 92.493  -8.574  173.511 1.00 49.95  ?  340  ASP F CB    1 
ATOM   2691 C  CG    . ASP A 1 341 ? 93.025  -8.205  172.137 1.00 65.15  ?  340  ASP F CG    1 
ATOM   2692 O  OD1   . ASP A 1 341 ? 93.183  -6.994  171.858 1.00 71.46  ?  340  ASP F OD1   1 
ATOM   2693 O  OD2   . ASP A 1 341 ? 93.279  -9.126  171.332 1.00 70.72  ?  340  ASP F OD2   1 
ATOM   2694 N  N     . PRO A 1 342 ? 91.465  -8.416  176.493 1.00 60.92  ?  341  PRO F N     1 
ATOM   2695 C  CA    . PRO A 1 342 ? 90.169  -8.610  177.151 1.00 61.57  ?  341  PRO F CA    1 
ATOM   2696 C  C     . PRO A 1 342 ? 89.957  -7.706  178.356 1.00 65.08  ?  341  PRO F C     1 
ATOM   2697 O  O     . PRO A 1 342 ? 88.959  -6.985  178.374 1.00 67.58  ?  341  PRO F O     1 
ATOM   2698 C  CB    . PRO A 1 342 ? 90.219  -10.087 177.581 1.00 54.52  ?  341  PRO F CB    1 
ATOM   2699 C  CG    . PRO A 1 342 ? 91.713  -10.509 177.401 1.00 65.35  ?  341  PRO F CG    1 
ATOM   2700 C  CD    . PRO A 1 342 ? 92.492  -9.269  177.102 1.00 61.31  ?  341  PRO F CD    1 
ATOM   2701 N  N     . GLY B 1 1   ? 120.335 5.634   95.112  1.00 86.14  ?  0    GLY A N     1 
ATOM   2702 C  CA    . GLY B 1 1   ? 119.174 5.432   95.959  1.00 86.47  ?  0    GLY A CA    1 
ATOM   2703 C  C     . GLY B 1 1   ? 119.142 6.315   97.196  1.00 81.59  ?  0    GLY A C     1 
ATOM   2704 O  O     . GLY B 1 1   ? 119.502 5.881   98.293  1.00 74.22  ?  0    GLY A O     1 
ATOM   2705 N  N     . SER B 1 2   ? 118.711 7.560   97.018  1.00 75.18  ?  1    SER A N     1 
ATOM   2706 C  CA    . SER B 1 2   ? 118.547 8.498   98.119  1.00 69.37  ?  1    SER A CA    1 
ATOM   2707 C  C     . SER B 1 2   ? 117.083 8.573   98.530  1.00 60.48  ?  1    SER A C     1 
ATOM   2708 O  O     . SER B 1 2   ? 116.184 8.563   97.682  1.00 65.21  ?  1    SER A O     1 
ATOM   2709 C  CB    . SER B 1 2   ? 119.047 9.896   97.740  1.00 71.08  ?  1    SER A CB    1 
ATOM   2710 O  OG    . SER B 1 2   ? 120.462 9.954   97.697  1.00 72.59  ?  1    SER A OG    1 
ATOM   2711 N  N     . ARG B 1 3   ? 116.851 8.651   99.837  1.00 41.03  ?  2    ARG A N     1 
ATOM   2712 C  CA    . ARG B 1 3   ? 115.506 8.849   100.348 1.00 30.05  ?  2    ARG A CA    1 
ATOM   2713 C  C     . ARG B 1 3   ? 115.047 10.285  100.112 1.00 33.67  ?  2    ARG A C     1 
ATOM   2714 O  O     . ARG B 1 3   ? 115.845 11.189  99.850  1.00 33.30  ?  2    ARG A O     1 
ATOM   2715 C  CB    . ARG B 1 3   ? 115.445 8.521   101.840 1.00 29.95  ?  2    ARG A CB    1 
ATOM   2716 C  CG    . ARG B 1 3   ? 115.405 7.030   102.127 1.00 45.49  ?  2    ARG A CG    1 
ATOM   2717 C  CD    . ARG B 1 3   ? 115.423 6.792   103.615 1.00 43.74  ?  2    ARG A CD    1 
ATOM   2718 N  NE    . ARG B 1 3   ? 116.688 7.228   104.196 1.00 34.69  ?  2    ARG A NE    1 
ATOM   2719 C  CZ    . ARG B 1 3   ? 116.812 7.749   105.413 1.00 31.68  ?  2    ARG A CZ    1 
ATOM   2720 N  NH1   . ARG B 1 3   ? 115.751 7.895   106.194 1.00 30.69  ?  2    ARG A NH1   1 
ATOM   2721 N  NH2   . ARG B 1 3   ? 118.008 8.109   105.853 1.00 32.78  ?  2    ARG A NH2   1 
ATOM   2722 N  N     . LYS B 1 4   ? 113.737 10.491  100.237 1.00 32.33  ?  3    LYS A N     1 
ATOM   2723 C  CA    . LYS B 1 4   ? 113.118 11.814  100.197 1.00 29.67  ?  3    LYS A CA    1 
ATOM   2724 C  C     . LYS B 1 4   ? 112.356 12.022  101.502 1.00 28.62  ?  3    LYS A C     1 
ATOM   2725 O  O     . LYS B 1 4   ? 111.295 11.423  101.708 1.00 30.23  ?  3    LYS A O     1 
ATOM   2726 C  CB    . LYS B 1 4   ? 112.189 11.941  98.993  1.00 34.97  ?  3    LYS A CB    1 
ATOM   2727 C  CG    . LYS B 1 4   ? 112.933 11.928  97.664  1.00 37.88  ?  3    LYS A CG    1 
ATOM   2728 C  CD    . LYS B 1 4   ? 111.980 11.960  96.485  1.00 51.67  ?  3    LYS A CD    1 
ATOM   2729 C  CE    . LYS B 1 4   ? 112.133 10.710  95.625  1.00 57.55  ?  3    LYS A CE    1 
ATOM   2730 N  NZ    . LYS B 1 4   ? 111.345 10.794  94.372  1.00 56.60  ?  3    LYS A NZ    1 
ATOM   2731 N  N     . ILE B 1 5   ? 112.895 12.863  102.382 1.00 25.56  ?  4    ILE A N     1 
ATOM   2732 C  CA    . ILE B 1 5   ? 112.318 13.106  103.699 1.00 23.99  ?  4    ILE A CA    1 
ATOM   2733 C  C     . ILE B 1 5   ? 111.750 14.517  103.721 1.00 25.06  ?  4    ILE A C     1 
ATOM   2734 O  O     . ILE B 1 5   ? 112.422 15.480  103.311 1.00 26.27  ?  4    ILE A O     1 
ATOM   2735 C  CB    . ILE B 1 5   ? 113.355 12.914  104.819 1.00 23.47  ?  4    ILE A CB    1 
ATOM   2736 C  CG1   . ILE B 1 5   ? 114.062 11.568  104.666 1.00 25.27  ?  4    ILE A CG1   1 
ATOM   2737 C  CG2   . ILE B 1 5   ? 112.692 12.997  106.188 1.00 22.83  ?  4    ILE A CG2   1 
ATOM   2738 C  CD1   . ILE B 1 5   ? 113.103 10.385  104.652 1.00 27.40  ?  4    ILE A CD1   1 
ATOM   2739 N  N     . ILE B 1 6   ? 110.512 14.646  104.185 1.00 27.68  ?  5    ILE A N     1 
ATOM   2740 C  CA    . ILE B 1 6   ? 109.910 15.950  104.447 1.00 23.63  ?  5    ILE A CA    1 
ATOM   2741 C  C     . ILE B 1 6   ? 109.743 16.097  105.949 1.00 25.89  ?  5    ILE A C     1 
ATOM   2742 O  O     . ILE B 1 6   ? 109.352 15.147  106.636 1.00 25.89  ?  5    ILE A O     1 
ATOM   2743 C  CB    . ILE B 1 6   ? 108.554 16.103  103.736 1.00 23.50  ?  5    ILE A CB    1 
ATOM   2744 C  CG1   . ILE B 1 6   ? 108.710 15.845  102.238 1.00 28.74  ?  5    ILE A CG1   1 
ATOM   2745 C  CG2   . ILE B 1 6   ? 107.988 17.499  103.964 1.00 25.27  ?  5    ILE A CG2   1 
ATOM   2746 C  CD1   . ILE B 1 6   ? 107.404 15.926  101.461 1.00 32.33  ?  5    ILE A CD1   1 
ATOM   2747 N  N     . HIS B 1 7   ? 110.055 17.284  106.466 1.00 21.81  ?  6    HIS A N     1 
ATOM   2748 C  CA    . HIS B 1 7   ? 109.706 17.637  107.833 1.00 22.79  ?  6    HIS A CA    1 
ATOM   2749 C  C     . HIS B 1 7   ? 108.731 18.795  107.736 1.00 27.21  ?  6    HIS A C     1 
ATOM   2750 O  O     . HIS B 1 7   ? 109.053 19.817  107.126 1.00 23.06  ?  6    HIS A O     1 
ATOM   2751 C  CB    . HIS B 1 7   ? 110.936 18.037  108.651 1.00 23.49  ?  6    HIS A CB    1 
ATOM   2752 C  CG    . HIS B 1 7   ? 110.624 18.409  110.068 1.00 23.24  ?  6    HIS A CG    1 
ATOM   2753 N  ND1   . HIS B 1 7   ? 110.585 19.718  110.502 1.00 23.12  ?  6    HIS A ND1   1 
ATOM   2754 C  CD2   . HIS B 1 7   ? 110.342 17.645  111.152 1.00 25.70  ?  6    HIS A CD2   1 
ATOM   2755 C  CE1   . HIS B 1 7   ? 110.295 19.744  111.793 1.00 26.04  ?  6    HIS A CE1   1 
ATOM   2756 N  NE2   . HIS B 1 7   ? 110.139 18.500  112.211 1.00 26.72  ?  6    HIS A NE2   1 
ATOM   2757 N  N     . VAL B 1 8   ? 107.534 18.624  108.287 1.00 26.15  ?  7    VAL A N     1 
ATOM   2758 C  CA    . VAL B 1 8   ? 106.507 19.660  108.264 1.00 21.99  ?  7    VAL A CA    1 
ATOM   2759 C  C     . VAL B 1 8   ? 106.342 20.183  109.679 1.00 23.73  ?  7    VAL A C     1 
ATOM   2760 O  O     . VAL B 1 8   ? 106.263 19.394  110.627 1.00 26.34  ?  7    VAL A O     1 
ATOM   2761 C  CB    . VAL B 1 8   ? 105.172 19.128  107.717 1.00 27.68  ?  7    VAL A CB    1 
ATOM   2762 C  CG1   . VAL B 1 8   ? 104.148 20.255  107.651 1.00 23.87  ?  7    VAL A CG1   1 
ATOM   2763 C  CG2   . VAL B 1 8   ? 105.372 18.485  106.345 1.00 30.17  ?  7    VAL A CG2   1 
ATOM   2764 N  N     . ASP B 1 9   ? 106.274 21.508  109.826 1.00 22.24  ?  8    ASP A N     1 
ATOM   2765 C  CA    . ASP B 1 9   ? 106.215 22.121  111.149 1.00 23.72  ?  8    ASP A CA    1 
ATOM   2766 C  C     . ASP B 1 9   ? 105.290 23.331  111.106 1.00 27.00  ?  8    ASP A C     1 
ATOM   2767 O  O     . ASP B 1 9   ? 105.469 24.218  110.270 1.00 31.33  ?  8    ASP A O     1 
ATOM   2768 C  CB    . ASP B 1 9   ? 107.601 22.557  111.635 1.00 25.22  ?  8    ASP A CB    1 
ATOM   2769 C  CG    . ASP B 1 9   ? 107.537 23.304  112.969 1.00 31.63  ?  8    ASP A CG    1 
ATOM   2770 O  OD1   . ASP B 1 9   ? 107.342 22.633  113.991 1.00 32.64  ?  8    ASP A OD1   1 
ATOM   2771 O  OD2   . ASP B 1 9   ? 107.656 24.556  112.996 1.00 38.76  ?  8    ASP A OD2   1 
ATOM   2772 N  N     . MET B 1 10  ? 104.317 23.372  112.011 1.00 27.64  ?  9    MET A N     1 
ATOM   2773 C  CA    . MET B 1 10  ? 103.394 24.498  112.042 1.00 23.61  ?  9    MET A CA    1 
ATOM   2774 C  C     . MET B 1 10  ? 104.118 25.751  112.528 1.00 22.64  ?  9    MET A C     1 
ATOM   2775 O  O     . MET B 1 10  ? 105.016 25.684  113.367 1.00 24.93  ?  9    MET A O     1 
ATOM   2776 C  CB    . MET B 1 10  ? 102.203 24.188  112.953 1.00 28.45  ?  9    MET A CB    1 
ATOM   2777 C  CG    . MET B 1 10  ? 101.408 22.932  112.580 1.00 23.85  ?  9    MET A CG    1 
ATOM   2778 S  SD    . MET B 1 10  ? 100.656 23.089  110.942 1.00 28.32  ?  9    MET A SD    1 
ATOM   2779 C  CE    . MET B 1 10  ? 99.418  24.342  111.261 1.00 28.55  ?  9    MET A CE    1 
ATOM   2780 N  N     . ASP B 1 11  ? 103.697 26.912  112.012 1.00 22.76  ?  10   ASP A N     1 
ATOM   2781 C  CA    . ASP B 1 11  ? 104.289 28.198  112.376 1.00 25.82  ?  10   ASP A CA    1 
ATOM   2782 C  C     . ASP B 1 11  ? 103.618 28.754  113.629 1.00 24.30  ?  10   ASP A C     1 
ATOM   2783 O  O     . ASP B 1 11  ? 102.390 28.863  113.672 1.00 26.94  ?  10   ASP A O     1 
ATOM   2784 C  CB    . ASP B 1 11  ? 104.130 29.216  111.237 1.00 23.13  ?  10   ASP A CB    1 
ATOM   2785 C  CG    . ASP B 1 11  ? 104.825 28.794  109.965 1.00 33.55  ?  10   ASP A CG    1 
ATOM   2786 O  OD1   . ASP B 1 11  ? 105.941 28.242  110.037 1.00 28.78  ?  10   ASP A OD1   1 
ATOM   2787 O  OD2   . ASP B 1 11  ? 104.245 29.014  108.879 1.00 26.82  ?  10   ASP A OD2   1 
ATOM   2788 N  N     . CYS B 1 12  ? 104.421 29.088  114.643 1.00 27.14  ?  11   CYS A N     1 
ATOM   2789 C  CA    . CYS B 1 12  ? 103.938 29.694  115.894 1.00 27.70  ?  11   CYS A CA    1 
ATOM   2790 C  C     . CYS B 1 12  ? 102.676 28.999  116.410 1.00 25.37  ?  11   CYS A C     1 
ATOM   2791 O  O     . CYS B 1 12  ? 101.680 29.634  116.754 1.00 28.58  ?  11   CYS A O     1 
ATOM   2792 C  CB    . CYS B 1 12  ? 103.696 31.188  115.716 1.00 36.17  ?  11   CYS A CB    1 
ATOM   2793 S  SG    . CYS B 1 12  ? 105.187 32.108  115.326 1.00 37.53  ?  11   CYS A SG    1 
ATOM   2794 N  N     . PHE B 1 13  ? 102.753 27.668  116.507 1.00 24.72  ?  12   PHE A N     1 
ATOM   2795 C  CA    . PHE B 1 13  ? 101.550 26.832  116.505 1.00 28.01  ?  12   PHE A CA    1 
ATOM   2796 C  C     . PHE B 1 13  ? 100.465 27.314  117.476 1.00 24.34  ?  12   PHE A C     1 
ATOM   2797 O  O     . PHE B 1 13  ? 99.357  27.641  117.044 1.00 27.13  ?  12   PHE A O     1 
ATOM   2798 C  CB    . PHE B 1 13  ? 101.926 25.375  116.785 1.00 24.48  ?  12   PHE A CB    1 
ATOM   2799 C  CG    . PHE B 1 13  ? 100.758 24.417  116.717 1.00 24.83  ?  12   PHE A CG    1 
ATOM   2800 C  CD1   . PHE B 1 13  ? 99.845  24.483  115.675 1.00 24.19  ?  12   PHE A CD1   1 
ATOM   2801 C  CD2   . PHE B 1 13  ? 100.595 23.441  117.688 1.00 27.71  ?  12   PHE A CD2   1 
ATOM   2802 C  CE1   . PHE B 1 13  ? 98.777  23.608  115.615 1.00 30.10  ?  12   PHE A CE1   1 
ATOM   2803 C  CE2   . PHE B 1 13  ? 99.535  22.545  117.629 1.00 26.48  ?  12   PHE A CE2   1 
ATOM   2804 C  CZ    . PHE B 1 13  ? 98.626  22.633  116.589 1.00 26.42  ?  12   PHE A CZ    1 
ATOM   2805 N  N     . PHE B 1 14  ? 100.737 27.326  118.792 1.00 28.75  ?  13   PHE A N     1 
ATOM   2806 C  CA    . PHE B 1 14  ? 99.673  27.698  119.733 1.00 27.22  ?  13   PHE A CA    1 
ATOM   2807 C  C     . PHE B 1 14  ? 99.169  29.109  119.456 1.00 29.21  ?  13   PHE A C     1 
ATOM   2808 O  O     . PHE B 1 14  ? 97.963  29.372  119.521 1.00 31.25  ?  13   PHE A O     1 
ATOM   2809 C  CB    . PHE B 1 14  ? 100.136 27.625  121.193 1.00 23.07  ?  13   PHE A CB    1 
ATOM   2810 C  CG    . PHE B 1 14  ? 100.396 26.235  121.706 1.00 26.07  ?  13   PHE A CG    1 
ATOM   2811 C  CD1   . PHE B 1 14  ? 100.278 25.124  120.878 1.00 29.59  ?  13   PHE A CD1   1 
ATOM   2812 C  CD2   . PHE B 1 14  ? 100.742 26.042  123.035 1.00 28.40  ?  13   PHE A CD2   1 
ATOM   2813 C  CE1   . PHE B 1 14  ? 100.528 23.847  121.364 1.00 28.64  ?  13   PHE A CE1   1 
ATOM   2814 C  CE2   . PHE B 1 14  ? 100.981 24.763  123.529 1.00 27.02  ?  13   PHE A CE2   1 
ATOM   2815 C  CZ    . PHE B 1 14  ? 100.873 23.672  122.690 1.00 30.14  ?  13   PHE A CZ    1 
ATOM   2816 N  N     . ALA B 1 15  ? 100.084 30.031  119.153 1.00 27.96  ?  14   ALA A N     1 
ATOM   2817 C  CA    . ALA B 1 15  ? 99.686  31.417  118.907 1.00 31.32  ?  14   ALA A CA    1 
ATOM   2818 C  C     . ALA B 1 15  ? 98.878  31.551  117.623 1.00 36.83  ?  14   ALA A C     1 
ATOM   2819 O  O     . ALA B 1 15  ? 97.956  32.373  117.554 1.00 33.83  ?  14   ALA A O     1 
ATOM   2820 C  CB    . ALA B 1 15  ? 100.916 32.326  118.850 1.00 28.56  ?  14   ALA A CB    1 
ATOM   2821 N  N     . ALA B 1 16  ? 99.212  30.756  116.600 1.00 31.88  ?  15   ALA A N     1 
ATOM   2822 C  CA    . ALA B 1 16  ? 98.483  30.825  115.338 1.00 27.10  ?  15   ALA A CA    1 
ATOM   2823 C  C     . ALA B 1 16  ? 97.043  30.372  115.518 1.00 27.35  ?  15   ALA A C     1 
ATOM   2824 O  O     . ALA B 1 16  ? 96.119  30.976  114.959 1.00 30.52  ?  15   ALA A O     1 
ATOM   2825 C  CB    . ALA B 1 16  ? 99.185  29.967  114.278 1.00 24.49  ?  15   ALA A CB    1 
ATOM   2826 N  N     . VAL B 1 17  ? 96.837  29.291  116.269 1.00 32.75  ?  16   VAL A N     1 
ATOM   2827 C  CA    . VAL B 1 17  ? 95.480  28.835  116.550 1.00 32.65  ?  16   VAL A CA    1 
ATOM   2828 C  C     . VAL B 1 17  ? 94.699  29.942  117.239 1.00 34.66  ?  16   VAL A C     1 
ATOM   2829 O  O     . VAL B 1 17  ? 93.557  30.243  116.874 1.00 36.68  ?  16   VAL A O     1 
ATOM   2830 C  CB    . VAL B 1 17  ? 95.509  27.548  117.395 1.00 30.29  ?  16   VAL A CB    1 
ATOM   2831 C  CG1   . VAL B 1 17  ? 94.120  27.240  117.950 1.00 35.60  ?  16   VAL A CG1   1 
ATOM   2832 C  CG2   . VAL B 1 17  ? 96.042  26.373  116.563 1.00 25.57  ?  16   VAL A CG2   1 
ATOM   2833 N  N     . GLU B 1 18  ? 95.315  30.585  118.232 1.00 31.23  ?  17   GLU A N     1 
ATOM   2834 C  CA    . GLU B 1 18  ? 94.610  31.631  118.962 1.00 37.34  ?  17   GLU A CA    1 
ATOM   2835 C  C     . GLU B 1 18  ? 94.313  32.825  118.071 1.00 36.35  ?  17   GLU A C     1 
ATOM   2836 O  O     . GLU B 1 18  ? 93.211  33.380  118.129 1.00 40.20  ?  17   GLU A O     1 
ATOM   2837 C  CB    . GLU B 1 18  ? 95.413  32.061  120.186 1.00 39.07  ?  17   GLU A CB    1 
ATOM   2838 C  CG    . GLU B 1 18  ? 95.680  30.929  121.166 1.00 36.96  ?  17   GLU A CG    1 
ATOM   2839 C  CD    . GLU B 1 18  ? 94.422  30.393  121.845 1.00 46.07  ?  17   GLU A CD    1 
ATOM   2840 O  OE1   . GLU B 1 18  ? 93.339  30.999  121.709 1.00 47.25  ?  17   GLU A OE1   1 
ATOM   2841 O  OE2   . GLU B 1 18  ? 94.523  29.350  122.524 1.00 42.77  ?  17   GLU A OE2   1 
ATOM   2842 N  N     . MET B 1 19  ? 95.274  33.238  117.236 1.00 31.90  ?  18   MET A N     1 
ATOM   2843 C  CA    . MET B 1 19  ? 95.020  34.382  116.362 1.00 38.32  ?  18   MET A CA    1 
ATOM   2844 C  C     . MET B 1 19  ? 93.955  34.056  115.320 1.00 42.07  ?  18   MET A C     1 
ATOM   2845 O  O     . MET B 1 19  ? 93.148  34.923  114.957 1.00 41.88  ?  18   MET A O     1 
ATOM   2846 C  CB    . MET B 1 19  ? 96.307  34.835  115.674 1.00 33.06  ?  18   MET A CB    1 
ATOM   2847 C  CG    . MET B 1 19  ? 97.308  35.528  116.578 1.00 35.58  ?  18   MET A CG    1 
ATOM   2848 S  SD    . MET B 1 19  ? 98.743  36.063  115.627 1.00 36.71  ?  18   MET A SD    1 
ATOM   2849 C  CE    . MET B 1 19  ? 99.488  34.488  115.197 1.00 33.03  ?  18   MET A CE    1 
ATOM   2850 N  N     . ARG B 1 20  ? 93.939  32.817  114.824 1.00 42.36  ?  19   ARG A N     1 
ATOM   2851 C  CA    . ARG B 1 20  ? 92.895  32.416  113.883 1.00 39.68  ?  19   ARG A CA    1 
ATOM   2852 C  C     . ARG B 1 20  ? 91.515  32.528  114.518 1.00 39.86  ?  19   ARG A C     1 
ATOM   2853 O  O     . ARG B 1 20  ? 90.590  33.098  113.930 1.00 47.27  ?  19   ARG A O     1 
ATOM   2854 C  CB    . ARG B 1 20  ? 93.139  30.988  113.397 1.00 41.85  ?  19   ARG A CB    1 
ATOM   2855 C  CG    . ARG B 1 20  ? 91.954  30.383  112.668 1.00 38.92  ?  19   ARG A CG    1 
ATOM   2856 C  CD    . ARG B 1 20  ? 92.089  28.874  112.557 1.00 43.32  ?  19   ARG A CD    1 
ATOM   2857 N  NE    . ARG B 1 20  ? 91.754  28.205  113.813 1.00 40.75  ?  19   ARG A NE    1 
ATOM   2858 C  CZ    . ARG B 1 20  ? 91.901  26.900  114.033 1.00 38.41  ?  19   ARG A CZ    1 
ATOM   2859 N  NH1   . ARG B 1 20  ? 92.388  26.109  113.083 1.00 35.99  ?  19   ARG A NH1   1 
ATOM   2860 N  NH2   . ARG B 1 20  ? 91.563  26.387  115.210 1.00 36.01  ?  19   ARG A NH2   1 
ATOM   2861 N  N     . ASP B 1 21  ? 91.363  31.996  115.727 1.00 39.56  ?  20   ASP A N     1 
ATOM   2862 C  CA    . ASP B 1 21  ? 90.067  31.959  116.385 1.00 45.46  ?  20   ASP A CA    1 
ATOM   2863 C  C     . ASP B 1 21  ? 89.672  33.291  117.011 1.00 52.78  ?  20   ASP A C     1 
ATOM   2864 O  O     . ASP B 1 21  ? 88.508  33.453  117.388 1.00 55.33  ?  20   ASP A O     1 
ATOM   2865 C  CB    . ASP B 1 21  ? 90.067  30.850  117.438 1.00 43.70  ?  20   ASP A CB    1 
ATOM   2866 C  CG    . ASP B 1 21  ? 90.303  29.475  116.823 1.00 49.47  ?  20   ASP A CG    1 
ATOM   2867 O  OD1   . ASP B 1 21  ? 90.116  29.341  115.590 1.00 48.73  ?  20   ASP A OD1   1 
ATOM   2868 O  OD2   . ASP B 1 21  ? 90.664  28.536  117.565 1.00 43.73  ?  20   ASP A OD2   1 
ATOM   2869 N  N     . ASN B 1 22  ? 90.599  34.240  117.130 1.00 45.26  ?  21   ASN A N     1 
ATOM   2870 C  CA    . ASN B 1 22  ? 90.279  35.590  117.597 1.00 46.23  ?  21   ASN A CA    1 
ATOM   2871 C  C     . ASN B 1 22  ? 91.139  36.566  116.810 1.00 47.43  ?  21   ASN A C     1 
ATOM   2872 O  O     . ASN B 1 22  ? 92.272  36.876  117.201 1.00 40.51  ?  21   ASN A O     1 
ATOM   2873 C  CB    . ASN B 1 22  ? 90.499  35.730  119.103 1.00 45.34  ?  21   ASN A CB    1 
ATOM   2874 C  CG    . ASN B 1 22  ? 90.058  37.089  119.645 1.00 52.37  ?  21   ASN A CG    1 
ATOM   2875 O  OD1   . ASN B 1 22  ? 89.889  38.055  118.899 1.00 52.50  ?  21   ASN A OD1   1 
ATOM   2876 N  ND2   . ASN B 1 22  ? 89.901  37.168  120.962 1.00 56.22  ?  21   ASN A ND2   1 
ATOM   2877 N  N     . PRO B 1 23  ? 90.627  37.071  115.683 1.00 49.98  ?  22   PRO A N     1 
ATOM   2878 C  CA    . PRO B 1 23  ? 91.445  37.936  114.812 1.00 55.06  ?  22   PRO A CA    1 
ATOM   2879 C  C     . PRO B 1 23  ? 91.926  39.215  115.473 1.00 49.81  ?  22   PRO A C     1 
ATOM   2880 O  O     . PRO B 1 23  ? 92.836  39.862  114.942 1.00 52.11  ?  22   PRO A O     1 
ATOM   2881 C  CB    . PRO B 1 23  ? 90.501  38.242  113.640 1.00 59.43  ?  22   PRO A CB    1 
ATOM   2882 C  CG    . PRO B 1 23  ? 89.553  37.093  113.617 1.00 58.18  ?  22   PRO A CG    1 
ATOM   2883 C  CD    . PRO B 1 23  ? 89.351  36.695  115.051 1.00 50.57  ?  22   PRO A CD    1 
ATOM   2884 N  N     . ALA B 1 24  ? 91.346  39.610  116.606 1.00 50.69  ?  23   ALA A N     1 
ATOM   2885 C  CA    . ALA B 1 24  ? 91.818  40.802  117.299 1.00 48.65  ?  23   ALA A CA    1 
ATOM   2886 C  C     . ALA B 1 24  ? 93.221  40.638  117.874 1.00 53.82  ?  23   ALA A C     1 
ATOM   2887 O  O     . ALA B 1 24  ? 93.784  41.622  118.368 1.00 45.43  ?  23   ALA A O     1 
ATOM   2888 C  CB    . ALA B 1 24  ? 90.850  41.174  118.416 1.00 46.13  ?  23   ALA A CB    1 
ATOM   2889 N  N     . LEU B 1 25  ? 93.796  39.431  117.829 1.00 40.52  ?  24   LEU A N     1 
ATOM   2890 C  CA    . LEU B 1 25  ? 95.148  39.197  118.317 1.00 45.83  ?  24   LEU A CA    1 
ATOM   2891 C  C     . LEU B 1 25  ? 96.194  39.187  117.208 1.00 48.62  ?  24   LEU A C     1 
ATOM   2892 O  O     . LEU B 1 25  ? 97.378  38.991  117.501 1.00 48.81  ?  24   LEU A O     1 
ATOM   2893 C  CB    . LEU B 1 25  ? 95.216  37.876  119.091 1.00 40.73  ?  24   LEU A CB    1 
ATOM   2894 C  CG    . LEU B 1 25  ? 94.599  37.746  120.494 1.00 49.96  ?  24   LEU A CG    1 
ATOM   2895 C  CD1   . LEU B 1 25  ? 94.887  38.934  121.403 1.00 44.05  ?  24   LEU A CD1   1 
ATOM   2896 C  CD2   . LEU B 1 25  ? 93.133  37.554  120.399 1.00 56.77  ?  24   LEU A CD2   1 
ATOM   2897 N  N     . ARG B 1 26  ? 95.789  39.414  115.953 1.00 43.18  ?  25   ARG A N     1 
ATOM   2898 C  CA    . ARG B 1 26  ? 96.698  39.316  114.807 1.00 48.06  ?  25   ARG A CA    1 
ATOM   2899 C  C     . ARG B 1 26  ? 97.936  40.193  114.956 1.00 44.84  ?  25   ARG A C     1 
ATOM   2900 O  O     . ARG B 1 26  ? 99.068  39.719  114.804 1.00 40.53  ?  25   ARG A O     1 
ATOM   2901 C  CB    . ARG B 1 26  ? 95.964  39.710  113.523 1.00 60.44  ?  25   ARG A CB    1 
ATOM   2902 C  CG    . ARG B 1 26  ? 95.199  38.601  112.871 1.00 68.62  ?  25   ARG A CG    1 
ATOM   2903 C  CD    . ARG B 1 26  ? 96.143  37.538  112.363 1.00 70.44  ?  25   ARG A CD    1 
ATOM   2904 N  NE    . ARG B 1 26  ? 95.427  36.300  112.092 1.00 72.31  ?  25   ARG A NE    1 
ATOM   2905 C  CZ    . ARG B 1 26  ? 96.016  35.140  111.839 1.00 63.10  ?  25   ARG A CZ    1 
ATOM   2906 N  NH1   . ARG B 1 26  ? 97.341  35.061  111.821 1.00 61.56  ?  25   ARG A NH1   1 
ATOM   2907 N  NH2   . ARG B 1 26  ? 95.280  34.062  111.607 1.00 64.73  ?  25   ARG A NH2   1 
ATOM   2908 N  N     . ASP B 1 27  ? 97.735  41.488  115.197 1.00 42.88  ?  26   ASP A N     1 
ATOM   2909 C  CA    . ASP B 1 27  ? 98.787  42.486  115.056 1.00 48.37  ?  26   ASP A CA    1 
ATOM   2910 C  C     . ASP B 1 27  ? 99.373  42.942  116.380 1.00 49.78  ?  26   ASP A C     1 
ATOM   2911 O  O     . ASP B 1 27  ? 100.226 43.836  116.383 1.00 56.46  ?  26   ASP A O     1 
ATOM   2912 C  CB    . ASP B 1 27  ? 98.254  43.707  114.300 1.00 65.64  ?  26   ASP A CB    1 
ATOM   2913 C  CG    . ASP B 1 27  ? 97.651  43.344  112.962 1.00 82.75  ?  26   ASP A CG    1 
ATOM   2914 O  OD1   . ASP B 1 27  ? 96.475  42.928  112.935 1.00 90.04  ?  26   ASP A OD1   1 
ATOM   2915 O  OD2   . ASP B 1 27  ? 98.349  43.481  111.937 1.00 90.38  ?  26   ASP A OD2   1 
ATOM   2916 N  N     . ILE B 1 28  ? 98.939  42.367  117.496 1.00 41.86  ?  27   ILE A N     1 
ATOM   2917 C  CA    . ILE B 1 28  ? 99.436  42.772  118.808 1.00 37.65  ?  27   ILE A CA    1 
ATOM   2918 C  C     . ILE B 1 28  ? 100.299 41.649  119.371 1.00 36.12  ?  27   ILE A C     1 
ATOM   2919 O  O     . ILE B 1 28  ? 100.113 40.487  118.989 1.00 38.53  ?  27   ILE A O     1 
ATOM   2920 C  CB    . ILE B 1 28  ? 98.279  43.124  119.756 1.00 41.93  ?  27   ILE A CB    1 
ATOM   2921 C  CG1   . ILE B 1 28  ? 97.336  41.936  119.925 1.00 47.37  ?  27   ILE A CG1   1 
ATOM   2922 C  CG2   . ILE B 1 28  ? 97.531  44.337  119.234 1.00 41.18  ?  27   ILE A CG2   1 
ATOM   2923 C  CD1   . ILE B 1 28  ? 96.379  42.102  121.065 1.00 46.80  ?  27   ILE A CD1   1 
ATOM   2924 N  N     . PRO B 1 29  ? 101.233 41.938  120.279 1.00 40.06  ?  28   PRO A N     1 
ATOM   2925 C  CA    . PRO B 1 29  ? 102.072 40.871  120.850 1.00 31.28  ?  28   PRO A CA    1 
ATOM   2926 C  C     . PRO B 1 29  ? 101.264 39.996  121.798 1.00 29.34  ?  28   PRO A C     1 
ATOM   2927 O  O     . PRO B 1 29  ? 100.671 40.479  122.769 1.00 35.60  ?  28   PRO A O     1 
ATOM   2928 C  CB    . PRO B 1 29  ? 103.180 41.636  121.591 1.00 37.83  ?  28   PRO A CB    1 
ATOM   2929 C  CG    . PRO B 1 29  ? 102.912 43.108  121.382 1.00 41.86  ?  28   PRO A CG    1 
ATOM   2930 C  CD    . PRO B 1 29  ? 101.518 43.255  120.877 1.00 36.71  ?  28   PRO A CD    1 
ATOM   2931 N  N     . ILE B 1 30  ? 101.243 38.695  121.513 1.00 34.38  ?  29   ILE A N     1 
ATOM   2932 C  CA    . ILE B 1 30  ? 100.570 37.726  122.365 1.00 31.89  ?  29   ILE A CA    1 
ATOM   2933 C  C     . ILE B 1 30  ? 101.530 36.583  122.662 1.00 31.82  ?  29   ILE A C     1 
ATOM   2934 O  O     . ILE B 1 30  ? 102.465 36.303  121.908 1.00 35.00  ?  29   ILE A O     1 
ATOM   2935 C  CB    . ILE B 1 30  ? 99.270  37.160  121.747 1.00 31.82  ?  29   ILE A CB    1 
ATOM   2936 C  CG1   . ILE B 1 30  ? 99.586  36.122  120.668 1.00 35.02  ?  29   ILE A CG1   1 
ATOM   2937 C  CG2   . ILE B 1 30  ? 98.396  38.277  121.192 1.00 28.84  ?  29   ILE A CG2   1 
ATOM   2938 C  CD1   . ILE B 1 30  ? 98.360  35.329  120.194 1.00 37.09  ?  29   ILE A CD1   1 
ATOM   2939 N  N     . ALA B 1 31  ? 101.273 35.918  123.782 1.00 28.53  ?  30   ALA A N     1 
ATOM   2940 C  CA    . ALA B 1 31  ? 101.968 34.690  124.121 1.00 24.35  ?  30   ALA A CA    1 
ATOM   2941 C  C     . ALA B 1 31  ? 100.999 33.765  124.841 1.00 28.36  ?  30   ALA A C     1 
ATOM   2942 O  O     . ALA B 1 31  ? 100.055 34.214  125.495 1.00 29.54  ?  30   ALA A O     1 
ATOM   2943 C  CB    . ALA B 1 31  ? 103.194 34.958  125.000 1.00 32.55  ?  30   ALA A CB    1 
ATOM   2944 N  N     . ILE B 1 32  ? 101.237 32.467  124.706 1.00 24.70  ?  31   ILE A N     1 
ATOM   2945 C  CA    . ILE B 1 32  ? 100.594 31.465  125.541 1.00 25.69  ?  31   ILE A CA    1 
ATOM   2946 C  C     . ILE B 1 32  ? 101.588 31.110  126.635 1.00 27.62  ?  31   ILE A C     1 
ATOM   2947 O  O     . ILE B 1 32  ? 102.743 30.772  126.344 1.00 28.76  ?  31   ILE A O     1 
ATOM   2948 C  CB    . ILE B 1 32  ? 100.192 30.215  124.734 1.00 27.75  ?  31   ILE A CB    1 
ATOM   2949 C  CG1   . ILE B 1 32  ? 99.021  30.508  123.786 1.00 38.55  ?  31   ILE A CG1   1 
ATOM   2950 C  CG2   . ILE B 1 32  ? 99.759  29.134  125.678 1.00 28.85  ?  31   ILE A CG2   1 
ATOM   2951 C  CD1   . ILE B 1 32  ? 99.345  31.357  122.566 1.00 32.66  ?  31   ILE A CD1   1 
ATOM   2952 N  N     . GLY B 1 33  ? 101.156 31.215  127.885 1.00 26.27  ?  32   GLY A N     1 
ATOM   2953 C  CA    . GLY B 1 33  ? 101.995 30.806  128.996 1.00 32.50  ?  32   GLY A CA    1 
ATOM   2954 C  C     . GLY B 1 33  ? 101.286 31.091  130.298 1.00 35.47  ?  32   GLY A C     1 
ATOM   2955 O  O     . GLY B 1 33  ? 100.175 31.625  130.321 1.00 34.06  ?  32   GLY A O     1 
ATOM   2956 N  N     . GLY B 1 34  ? 101.943 30.721  131.393 1.00 33.95  ?  33   GLY A N     1 
ATOM   2957 C  CA    . GLY B 1 34  ? 101.403 30.976  132.715 1.00 32.57  ?  33   GLY A CA    1 
ATOM   2958 C  C     . GLY B 1 34  ? 101.797 32.348  133.240 1.00 29.17  ?  33   GLY A C     1 
ATOM   2959 O  O     . GLY B 1 34  ? 102.821 32.906  132.865 1.00 33.27  ?  33   GLY A O     1 
ATOM   2960 N  N     . SER B 1 35  ? 100.982 32.876  134.147 1.00 30.25  ?  34   SER A N     1 
ATOM   2961 C  CA    . SER B 1 35  ? 101.229 34.211  134.669 1.00 35.02  ?  34   SER A CA    1 
ATOM   2962 C  C     . SER B 1 35  ? 102.486 34.236  135.526 1.00 39.82  ?  34   SER A C     1 
ATOM   2963 O  O     . SER B 1 35  ? 102.969 33.209  136.013 1.00 34.89  ?  34   SER A O     1 
ATOM   2964 C  CB    . SER B 1 35  ? 100.053 34.696  135.514 1.00 34.32  ?  34   SER A CB    1 
ATOM   2965 O  OG    . SER B 1 35  ? 100.009 33.968  136.734 1.00 32.65  ?  34   SER A OG    1 
ATOM   2966 N  N     . ARG B 1 36  ? 103.010 35.442  135.723 1.00 38.93  ?  35   ARG A N     1 
ATOM   2967 C  CA    . ARG B 1 36  ? 104.122 35.600  136.648 1.00 39.84  ?  35   ARG A CA    1 
ATOM   2968 C  C     . ARG B 1 36  ? 103.749 35.089  138.032 1.00 35.60  ?  35   ARG A C     1 
ATOM   2969 O  O     . ARG B 1 36  ? 104.536 34.391  138.684 1.00 38.75  ?  35   ARG A O     1 
ATOM   2970 C  CB    . ARG B 1 36  ? 104.542 37.068  136.709 1.00 40.55  ?  35   ARG A CB    1 
ATOM   2971 C  CG    . ARG B 1 36  ? 105.646 37.337  137.699 1.00 56.56  ?  35   ARG A CG    1 
ATOM   2972 C  CD    . ARG B 1 36  ? 106.575 38.401  137.169 1.00 71.36  ?  35   ARG A CD    1 
ATOM   2973 N  NE    . ARG B 1 36  ? 107.802 38.496  137.950 1.00 82.93  ?  35   ARG A NE    1 
ATOM   2974 C  CZ    . ARG B 1 36  ? 108.107 39.527  138.729 1.00 90.76  ?  35   ARG A CZ    1 
ATOM   2975 N  NH1   . ARG B 1 36  ? 107.275 40.556  138.824 1.00 90.63  ?  35   ARG A NH1   1 
ATOM   2976 N  NH2   . ARG B 1 36  ? 109.247 39.534  139.408 1.00 97.15  ?  35   ARG A NH2   1 
ATOM   2977 N  N     . GLU B 1 37  ? 102.536 35.409  138.487 1.00 39.94  ?  36   GLU A N     1 
ATOM   2978 C  CA    . GLU B 1 37  ? 102.129 35.031  139.834 1.00 40.10  ?  36   GLU A CA    1 
ATOM   2979 C  C     . GLU B 1 37  ? 102.086 33.524  139.995 1.00 35.31  ?  36   GLU A C     1 
ATOM   2980 O  O     . GLU B 1 37  ? 102.300 33.012  141.099 1.00 40.59  ?  36   GLU A O     1 
ATOM   2981 C  CB    . GLU B 1 37  ? 100.765 35.630  140.159 1.00 43.15  ?  36   GLU A CB    1 
ATOM   2982 C  CG    . GLU B 1 37  ? 100.762 37.145  140.249 1.00 52.44  ?  36   GLU A CG    1 
ATOM   2983 C  CD    . GLU B 1 37  ? 100.472 37.835  138.924 1.00 60.68  ?  36   GLU A CD    1 
ATOM   2984 O  OE1   . GLU B 1 37  ? 100.767 37.259  137.854 1.00 50.86  ?  36   GLU A OE1   1 
ATOM   2985 O  OE2   . GLU B 1 37  ? 99.940  38.966  138.960 1.00 69.40  ?  36   GLU A OE2   1 
ATOM   2986 N  N     . ARG B 1 38  ? 101.803 32.805  138.915 1.00 30.04  ?  37   ARG A N     1 
ATOM   2987 C  CA    . ARG B 1 38  ? 101.811 31.348  138.915 1.00 31.37  ?  37   ARG A CA    1 
ATOM   2988 C  C     . ARG B 1 38  ? 103.186 30.784  138.597 1.00 34.60  ?  37   ARG A C     1 
ATOM   2989 O  O     . ARG B 1 38  ? 103.304 29.577  138.353 1.00 34.72  ?  37   ARG A O     1 
ATOM   2990 C  CB    . ARG B 1 38  ? 100.769 30.817  137.925 1.00 35.57  ?  37   ARG A CB    1 
ATOM   2991 C  CG    . ARG B 1 38  ? 99.352  30.934  138.459 1.00 44.71  ?  37   ARG A CG    1 
ATOM   2992 C  CD    . ARG B 1 38  ? 98.312  30.224  137.597 1.00 59.03  ?  37   ARG A CD    1 
ATOM   2993 N  NE    . ARG B 1 38  ? 98.715  28.886  137.157 1.00 69.36  ?  37   ARG A NE    1 
ATOM   2994 C  CZ    . ARG B 1 38  ? 98.901  27.839  137.959 1.00 61.29  ?  37   ARG A CZ    1 
ATOM   2995 N  NH1   . ARG B 1 38  ? 98.746  27.958  139.273 1.00 61.40  ?  37   ARG A NH1   1 
ATOM   2996 N  NH2   . ARG B 1 38  ? 99.260  26.667  137.442 1.00 45.95  ?  37   ARG A NH2   1 
ATOM   2997 N  N     . ARG B 1 39  ? 104.218 31.632  138.604 1.00 31.23  ?  38   ARG A N     1 
ATOM   2998 C  CA    . ARG B 1 39  ? 105.601 31.222  138.357 1.00 26.41  ?  38   ARG A CA    1 
ATOM   2999 C  C     . ARG B 1 39  ? 105.741 30.543  136.997 1.00 34.16  ?  38   ARG A C     1 
ATOM   3000 O  O     . ARG B 1 39  ? 106.455 29.557  136.838 1.00 31.06  ?  38   ARG A O     1 
ATOM   3001 C  CB    . ARG B 1 39  ? 106.113 30.356  139.513 1.00 26.02  ?  38   ARG A CB    1 
ATOM   3002 C  CG    . ARG B 1 39  ? 105.901 31.103  140.831 1.00 29.04  ?  38   ARG A CG    1 
ATOM   3003 C  CD    . ARG B 1 39  ? 106.906 30.768  141.912 1.00 32.85  ?  38   ARG A CD    1 
ATOM   3004 N  NE    . ARG B 1 39  ? 106.561 29.515  142.551 1.00 35.52  ?  38   ARG A NE    1 
ATOM   3005 C  CZ    . ARG B 1 39  ? 107.172 29.039  143.626 1.00 37.50  ?  38   ARG A CZ    1 
ATOM   3006 N  NH1   . ARG B 1 39  ? 108.164 29.720  144.184 1.00 36.62  ?  38   ARG A NH1   1 
ATOM   3007 N  NH2   . ARG B 1 39  ? 106.782 27.888  144.143 1.00 28.94  ?  38   ARG A NH2   1 
ATOM   3008 N  N     . GLY B 1 40  ? 105.092 31.130  135.979 1.00 30.17  ?  39   GLY A N     1 
ATOM   3009 C  CA    . GLY B 1 40  ? 104.998 30.489  134.683 1.00 33.72  ?  39   GLY A CA    1 
ATOM   3010 C  C     . GLY B 1 40  ? 106.105 30.861  133.715 1.00 25.87  ?  39   GLY A C     1 
ATOM   3011 O  O     . GLY B 1 40  ? 106.967 31.703  133.987 1.00 27.64  ?  39   GLY A O     1 
ATOM   3012 N  N     . VAL B 1 41  ? 106.090 30.177  132.570 1.00 24.58  ?  40   VAL A N     1 
ATOM   3013 C  CA    . VAL B 1 41  ? 106.959 30.479  131.441 1.00 28.33  ?  40   VAL A CA    1 
ATOM   3014 C  C     . VAL B 1 41  ? 106.108 30.620  130.182 1.00 24.76  ?  40   VAL A C     1 
ATOM   3015 O  O     . VAL B 1 41  ? 104.918 30.298  130.158 1.00 32.18  ?  40   VAL A O     1 
ATOM   3016 C  CB    . VAL B 1 41  ? 108.049 29.411  131.214 1.00 27.52  ?  40   VAL A CB    1 
ATOM   3017 C  CG1   . VAL B 1 41  ? 108.986 29.296  132.423 1.00 27.10  ?  40   VAL A CG1   1 
ATOM   3018 C  CG2   . VAL B 1 41  ? 107.400 28.091  130.916 1.00 28.58  ?  40   VAL A CG2   1 
ATOM   3019 N  N     . ILE B 1 42  ? 106.755 31.101  129.126 1.00 26.65  ?  41   ILE A N     1 
ATOM   3020 C  CA    . ILE B 1 42  ? 106.143 31.251  127.808 1.00 23.90  ?  41   ILE A CA    1 
ATOM   3021 C  C     . ILE B 1 42  ? 106.202 29.919  127.077 1.00 25.70  ?  41   ILE A C     1 
ATOM   3022 O  O     . ILE B 1 42  ? 107.283 29.338  126.929 1.00 27.65  ?  41   ILE A O     1 
ATOM   3023 C  CB    . ILE B 1 42  ? 106.879 32.331  127.000 1.00 26.81  ?  41   ILE A CB    1 
ATOM   3024 C  CG1   . ILE B 1 42  ? 106.898 33.656  127.768 1.00 28.72  ?  41   ILE A CG1   1 
ATOM   3025 C  CG2   . ILE B 1 42  ? 106.294 32.453  125.590 1.00 25.06  ?  41   ILE A CG2   1 
ATOM   3026 C  CD1   . ILE B 1 42  ? 105.522 34.155  128.200 1.00 30.39  ?  41   ILE A CD1   1 
ATOM   3027 N  N     . SER B 1 43  ? 105.043 29.441  126.594 1.00 24.11  ?  42   SER A N     1 
ATOM   3028 C  CA    . SER B 1 43  ? 105.032 28.272  125.717 1.00 19.77  ?  42   SER A CA    1 
ATOM   3029 C  C     . SER B 1 43  ? 105.422 28.666  124.302 1.00 24.09  ?  42   SER A C     1 
ATOM   3030 O  O     . SER B 1 43  ? 106.222 27.986  123.655 1.00 25.81  ?  42   SER A O     1 
ATOM   3031 C  CB    . SER B 1 43  ? 103.651 27.613  125.716 1.00 25.92  ?  42   SER A CB    1 
ATOM   3032 O  OG    . SER B 1 43  ? 103.491 26.717  126.813 1.00 29.56  ?  42   SER A OG    1 
ATOM   3033 N  N     . THR B 1 44  ? 104.887 29.781  123.822 1.00 25.39  ?  43   THR A N     1 
ATOM   3034 C  CA    . THR B 1 44  ? 105.278 30.319  122.530 1.00 25.24  ?  43   THR A CA    1 
ATOM   3035 C  C     . THR B 1 44  ? 104.680 31.709  122.413 1.00 26.45  ?  43   THR A C     1 
ATOM   3036 O  O     . THR B 1 44  ? 103.860 32.125  123.234 1.00 25.05  ?  43   THR A O     1 
ATOM   3037 C  CB    . THR B 1 44  ? 104.823 29.441  121.362 1.00 29.93  ?  43   THR A CB    1 
ATOM   3038 O  OG1   . THR B 1 44  ? 105.436 29.910  120.158 1.00 28.55  ?  43   THR A OG1   1 
ATOM   3039 C  CG2   . THR B 1 44  ? 103.309 29.495  121.193 1.00 30.57  ?  43   THR A CG2   1 
ATOM   3040 N  N     . ALA B 1 45  ? 105.080 32.408  121.354 1.00 26.51  ?  44   ALA A N     1 
ATOM   3041 C  CA    . ALA B 1 45  ? 104.679 33.782  121.138 1.00 26.64  ?  44   ALA A CA    1 
ATOM   3042 C  C     . ALA B 1 45  ? 104.547 34.021  119.643 1.00 28.13  ?  44   ALA A C     1 
ATOM   3043 O  O     . ALA B 1 45  ? 105.178 33.331  118.834 1.00 31.89  ?  44   ALA A O     1 
ATOM   3044 C  CB    . ALA B 1 45  ? 105.689 34.752  121.755 1.00 31.48  ?  44   ALA A CB    1 
ATOM   3045 N  N     . ASN B 1 46  ? 103.705 34.985  119.282 1.00 29.19  ?  45   ASN A N     1 
ATOM   3046 C  CA    . ASN B 1 46  ? 103.544 35.333  117.880 1.00 30.98  ?  45   ASN A CA    1 
ATOM   3047 C  C     . ASN B 1 46  ? 104.641 36.313  117.460 1.00 31.28  ?  45   ASN A C     1 
ATOM   3048 O  O     . ASN B 1 46  ? 105.421 36.798  118.282 1.00 29.70  ?  45   ASN A O     1 
ATOM   3049 C  CB    . ASN B 1 46  ? 102.135 35.889  117.619 1.00 28.89  ?  45   ASN A CB    1 
ATOM   3050 C  CG    . ASN B 1 46  ? 101.899 37.305  118.193 1.00 33.05  ?  45   ASN A CG    1 
ATOM   3051 O  OD1   . ASN B 1 46  ? 102.685 37.839  118.983 1.00 30.61  ?  45   ASN A OD1   1 
ATOM   3052 N  ND2   . ASN B 1 46  ? 100.780 37.898  117.800 1.00 30.83  ?  45   ASN A ND2   1 
ATOM   3053 N  N     . TYR B 1 47  ? 104.720 36.586  116.159 1.00 32.72  ?  46   TYR A N     1 
ATOM   3054 C  CA    . TYR B 1 47  ? 105.830 37.398  115.665 1.00 31.54  ?  46   TYR A CA    1 
ATOM   3055 C  C     . TYR B 1 47  ? 105.847 38.809  116.238 1.00 29.75  ?  46   TYR A C     1 
ATOM   3056 O  O     . TYR B 1 47  ? 106.950 39.308  116.527 1.00 33.17  ?  46   TYR A O     1 
ATOM   3057 C  CB    . TYR B 1 47  ? 105.836 37.402  114.128 1.00 30.57  ?  46   TYR A CB    1 
ATOM   3058 C  CG    . TYR B 1 47  ? 106.500 36.147  113.586 1.00 35.20  ?  46   TYR A CG    1 
ATOM   3059 C  CD1   . TYR B 1 47  ? 107.879 35.975  113.688 1.00 30.53  ?  46   TYR A CD1   1 
ATOM   3060 C  CD2   . TYR B 1 47  ? 105.753 35.126  113.010 1.00 31.06  ?  46   TYR A CD2   1 
ATOM   3061 C  CE1   . TYR B 1 47  ? 108.501 34.832  113.226 1.00 31.71  ?  46   TYR A CE1   1 
ATOM   3062 C  CE2   . TYR B 1 47  ? 106.376 33.961  112.540 1.00 30.86  ?  46   TYR A CE2   1 
ATOM   3063 C  CZ    . TYR B 1 47  ? 107.750 33.830  112.651 1.00 35.66  ?  46   TYR A CZ    1 
ATOM   3064 O  OH    . TYR B 1 47  ? 108.387 32.699  112.195 1.00 32.33  ?  46   TYR A OH    1 
ATOM   3065 N  N     . PRO B 1 48  ? 104.712 39.502  116.422 1.00 31.98  ?  47   PRO A N     1 
ATOM   3066 C  CA    . PRO B 1 48  ? 104.769 40.801  117.113 1.00 35.70  ?  47   PRO A CA    1 
ATOM   3067 C  C     . PRO B 1 48  ? 105.433 40.733  118.476 1.00 38.89  ?  47   PRO A C     1 
ATOM   3068 O  O     . PRO B 1 48  ? 106.136 41.674  118.864 1.00 34.31  ?  47   PRO A O     1 
ATOM   3069 C  CB    . PRO B 1 48  ? 103.293 41.196  117.208 1.00 33.58  ?  47   PRO A CB    1 
ATOM   3070 C  CG    . PRO B 1 48  ? 102.700 40.628  115.976 1.00 35.64  ?  47   PRO A CG    1 
ATOM   3071 C  CD    . PRO B 1 48  ? 103.393 39.290  115.795 1.00 39.78  ?  47   PRO A CD    1 
ATOM   3072 N  N     . ALA B 1 49  ? 105.252 39.632  119.209 1.00 32.22  ?  48   ALA A N     1 
ATOM   3073 C  CA    . ALA B 1 49  ? 105.901 39.510  120.508 1.00 31.50  ?  48   ALA A CA    1 
ATOM   3074 C  C     . ALA B 1 49  ? 107.360 39.106  120.358 1.00 31.47  ?  48   ALA A C     1 
ATOM   3075 O  O     . ALA B 1 49  ? 108.215 39.556  121.126 1.00 29.35  ?  48   ALA A O     1 
ATOM   3076 C  CB    . ALA B 1 49  ? 105.156 38.496  121.380 1.00 32.01  ?  48   ALA A CB    1 
ATOM   3077 N  N     . ARG B 1 50  ? 107.664 38.270  119.365 1.00 28.94  ?  49   ARG A N     1 
ATOM   3078 C  CA    . ARG B 1 50  ? 109.040 37.831  119.169 1.00 27.88  ?  49   ARG A CA    1 
ATOM   3079 C  C     . ARG B 1 50  ? 109.965 38.991  118.832 1.00 27.75  ?  49   ARG A C     1 
ATOM   3080 O  O     . ARG B 1 50  ? 111.146 38.964  119.195 1.00 35.49  ?  49   ARG A O     1 
ATOM   3081 C  CB    . ARG B 1 50  ? 109.092 36.772  118.072 1.00 26.60  ?  49   ARG A CB    1 
ATOM   3082 C  CG    . ARG B 1 50  ? 108.395 35.508  118.471 1.00 25.18  ?  49   ARG A CG    1 
ATOM   3083 C  CD    . ARG B 1 50  ? 108.417 34.447  117.384 1.00 27.27  ?  49   ARG A CD    1 
ATOM   3084 N  NE    . ARG B 1 50  ? 107.737 33.243  117.858 1.00 31.66  ?  49   ARG A NE    1 
ATOM   3085 C  CZ    . ARG B 1 50  ? 107.855 32.046  117.298 1.00 46.01  ?  49   ARG A CZ    1 
ATOM   3086 N  NH1   . ARG B 1 50  ? 108.636 31.880  116.234 1.00 49.75  ?  49   ARG A NH1   1 
ATOM   3087 N  NH2   . ARG B 1 50  ? 107.186 31.015  117.802 1.00 45.80  ?  49   ARG A NH2   1 
ATOM   3088 N  N     . LYS B 1 51  ? 109.460 40.031  118.165 1.00 29.80  ?  50   LYS A N     1 
ATOM   3089 C  CA    . LYS B 1 51  ? 110.373 41.111  117.808 1.00 33.08  ?  50   LYS A CA    1 
ATOM   3090 C  C     . LYS B 1 51  ? 110.867 41.862  119.038 1.00 28.03  ?  50   LYS A C     1 
ATOM   3091 O  O     . LYS B 1 51  ? 111.908 42.520  118.966 1.00 36.47  ?  50   LYS A O     1 
ATOM   3092 C  CB    . LYS B 1 51  ? 109.725 42.053  116.791 1.00 44.60  ?  50   LYS A CB    1 
ATOM   3093 C  CG    . LYS B 1 51  ? 108.953 43.202  117.338 1.00 51.81  ?  50   LYS A CG    1 
ATOM   3094 C  CD    . LYS B 1 51  ? 108.851 44.294  116.277 1.00 39.35  ?  50   LYS A CD    1 
ATOM   3095 C  CE    . LYS B 1 51  ? 108.018 45.450  116.770 1.00 53.66  ?  50   LYS A CE    1 
ATOM   3096 N  NZ    . LYS B 1 51  ? 106.587 45.074  116.823 1.00 66.18  ?  50   LYS A NZ    1 
ATOM   3097 N  N     . PHE B 1 52  ? 110.160 41.759  120.167 1.00 33.15  ?  51   PHE A N     1 
ATOM   3098 C  CA    . PHE B 1 52  ? 110.631 42.293  121.444 1.00 35.79  ?  51   PHE A CA    1 
ATOM   3099 C  C     . PHE B 1 52  ? 111.573 41.336  122.171 1.00 40.60  ?  51   PHE A C     1 
ATOM   3100 O  O     . PHE B 1 52  ? 112.090 41.681  123.241 1.00 40.32  ?  51   PHE A O     1 
ATOM   3101 C  CB    . PHE B 1 52  ? 109.447 42.616  122.365 1.00 32.72  ?  51   PHE A CB    1 
ATOM   3102 C  CG    . PHE B 1 52  ? 108.571 43.726  121.869 1.00 31.87  ?  51   PHE A CG    1 
ATOM   3103 C  CD1   . PHE B 1 52  ? 107.517 43.462  121.008 1.00 35.77  ?  51   PHE A CD1   1 
ATOM   3104 C  CD2   . PHE B 1 52  ? 108.790 45.032  122.271 1.00 30.75  ?  51   PHE A CD2   1 
ATOM   3105 C  CE1   . PHE B 1 52  ? 106.710 44.483  120.551 1.00 34.18  ?  51   PHE A CE1   1 
ATOM   3106 C  CE2   . PHE B 1 52  ? 107.982 46.058  121.814 1.00 40.04  ?  51   PHE A CE2   1 
ATOM   3107 C  CZ    . PHE B 1 52  ? 106.944 45.783  120.956 1.00 39.86  ?  51   PHE A CZ    1 
ATOM   3108 N  N     . GLY B 1 53  ? 111.790 40.141  121.638 1.00 40.83  ?  52   GLY A N     1 
ATOM   3109 C  CA    . GLY B 1 53  ? 112.659 39.171  122.268 1.00 37.11  ?  52   GLY A CA    1 
ATOM   3110 C  C     . GLY B 1 53  ? 111.957 38.049  123.003 1.00 36.19  ?  52   GLY A C     1 
ATOM   3111 O  O     . GLY B 1 53  ? 112.641 37.204  123.586 1.00 34.01  ?  52   GLY A O     1 
ATOM   3112 N  N     . VAL B 1 54  ? 110.622 38.020  123.008 1.00 33.53  ?  53   VAL A N     1 
ATOM   3113 C  CA    . VAL B 1 54  ? 109.896 36.967  123.714 1.00 29.26  ?  53   VAL A CA    1 
ATOM   3114 C  C     . VAL B 1 54  ? 110.102 35.651  122.981 1.00 32.91  ?  53   VAL A C     1 
ATOM   3115 O  O     . VAL B 1 54  ? 109.981 35.582  121.750 1.00 28.86  ?  53   VAL A O     1 
ATOM   3116 C  CB    . VAL B 1 54  ? 108.401 37.313  123.832 1.00 26.69  ?  53   VAL A CB    1 
ATOM   3117 C  CG1   . VAL B 1 54  ? 107.645 36.208  124.583 1.00 28.20  ?  53   VAL A CG1   1 
ATOM   3118 C  CG2   . VAL B 1 54  ? 108.219 38.653  124.531 1.00 28.96  ?  53   VAL A CG2   1 
ATOM   3119 N  N     . ARG B 1 55  ? 110.427 34.603  123.735 1.00 30.68  ?  54   ARG A N     1 
ATOM   3120 C  CA    . ARG B 1 55  ? 110.774 33.296  123.191 1.00 32.46  ?  54   ARG A CA    1 
ATOM   3121 C  C     . ARG B 1 55  ? 110.099 32.221  124.031 1.00 30.58  ?  54   ARG A C     1 
ATOM   3122 O  O     . ARG B 1 55  ? 109.808 32.439  125.209 1.00 27.10  ?  54   ARG A O     1 
ATOM   3123 C  CB    . ARG B 1 55  ? 112.299 33.063  123.217 1.00 33.54  ?  54   ARG A CB    1 
ATOM   3124 C  CG    . ARG B 1 55  ? 113.111 34.055  122.428 1.00 44.09  ?  54   ARG A CG    1 
ATOM   3125 C  CD    . ARG B 1 55  ? 112.857 33.867  120.942 1.00 51.66  ?  54   ARG A CD    1 
ATOM   3126 N  NE    . ARG B 1 55  ? 113.708 34.722  120.124 1.00 57.55  ?  54   ARG A NE    1 
ATOM   3127 C  CZ    . ARG B 1 55  ? 113.348 35.920  119.674 1.00 61.06  ?  54   ARG A CZ    1 
ATOM   3128 N  NH1   . ARG B 1 55  ? 112.147 36.405  119.964 1.00 38.62  ?  54   ARG A NH1   1 
ATOM   3129 N  NH2   . ARG B 1 55  ? 114.191 36.631  118.934 1.00 76.53  ?  54   ARG A NH2   1 
ATOM   3130 N  N     . SER B 1 56  ? 109.875 31.049  123.420 1.00 28.10  ?  55   SER A N     1 
ATOM   3131 C  CA    . SER B 1 56  ? 109.507 29.869  124.191 1.00 21.98  ?  55   SER A CA    1 
ATOM   3132 C  C     . SER B 1 56  ? 110.507 29.629  125.310 1.00 25.80  ?  55   SER A C     1 
ATOM   3133 O  O     . SER B 1 56  ? 111.709 29.878  125.162 1.00 28.90  ?  55   SER A O     1 
ATOM   3134 C  CB    . SER B 1 56  ? 109.435 28.643  123.290 1.00 27.63  ?  55   SER A CB    1 
ATOM   3135 O  OG    . SER B 1 56  ? 108.378 28.782  122.366 1.00 27.06  ?  55   SER A OG    1 
ATOM   3136 N  N     . ALA B 1 57  ? 109.983 29.177  126.446 1.00 24.33  ?  56   ALA A N     1 
ATOM   3137 C  CA    . ALA B 1 57  ? 110.686 28.762  127.661 1.00 32.29  ?  56   ALA A CA    1 
ATOM   3138 C  C     . ALA B 1 57  ? 111.154 29.962  128.474 1.00 33.22  ?  56   ALA A C     1 
ATOM   3139 O  O     . ALA B 1 57  ? 111.736 29.779  129.550 1.00 33.22  ?  56   ALA A O     1 
ATOM   3140 C  CB    . ALA B 1 57  ? 111.877 27.823  127.382 1.00 24.70  ?  56   ALA A CB    1 
ATOM   3141 N  N     . MET B 1 58  ? 110.883 31.173  128.029 1.00 26.07  ?  57   MET A N     1 
ATOM   3142 C  CA    . MET B 1 58  ? 111.284 32.347  128.785 1.00 29.05  ?  57   MET A CA    1 
ATOM   3143 C  C     . MET B 1 58  ? 110.369 32.516  129.992 1.00 27.39  ?  57   MET A C     1 
ATOM   3144 O  O     . MET B 1 58  ? 109.143 32.396  129.857 1.00 27.48  ?  57   MET A O     1 
ATOM   3145 C  CB    . MET B 1 58  ? 111.224 33.580  127.883 1.00 26.94  ?  57   MET A CB    1 
ATOM   3146 C  CG    . MET B 1 58  ? 111.468 34.890  128.583 1.00 30.61  ?  57   MET A CG    1 
ATOM   3147 S  SD    . MET B 1 58  ? 111.433 36.267  127.396 1.00 35.43  ?  57   MET A SD    1 
ATOM   3148 C  CE    . MET B 1 58  ? 112.982 35.983  126.538 1.00 30.40  ?  57   MET A CE    1 
ATOM   3149 N  N     . PRO B 1 59  ? 110.913 32.765  131.183 1.00 28.42  ?  58   PRO A N     1 
ATOM   3150 C  CA    . PRO B 1 59  ? 110.059 33.083  132.328 1.00 24.54  ?  58   PRO A CA    1 
ATOM   3151 C  C     . PRO B 1 59  ? 109.138 34.245  131.994 1.00 30.61  ?  58   PRO A C     1 
ATOM   3152 O  O     . PRO B 1 59  ? 109.560 35.235  131.399 1.00 34.36  ?  58   PRO A O     1 
ATOM   3153 C  CB    . PRO B 1 59  ? 111.069 33.454  133.422 1.00 33.33  ?  58   PRO A CB    1 
ATOM   3154 C  CG    . PRO B 1 59  ? 112.302 32.671  133.047 1.00 34.79  ?  58   PRO A CG    1 
ATOM   3155 C  CD    . PRO B 1 59  ? 112.341 32.754  131.547 1.00 35.15  ?  58   PRO A CD    1 
ATOM   3156 N  N     . THR B 1 60  ? 107.859 34.105  132.358 1.00 24.84  ?  59   THR A N     1 
ATOM   3157 C  CA    . THR B 1 60  ? 106.876 35.119  131.977 1.00 30.46  ?  59   THR A CA    1 
ATOM   3158 C  C     . THR B 1 60  ? 107.233 36.494  132.538 1.00 36.66  ?  59   THR A C     1 
ATOM   3159 O  O     . THR B 1 60  ? 106.916 37.518  131.919 1.00 34.90  ?  59   THR A O     1 
ATOM   3160 C  CB    . THR B 1 60  ? 105.484 34.687  132.433 1.00 30.15  ?  59   THR A CB    1 
ATOM   3161 O  OG1   . THR B 1 60  ? 105.145 33.455  131.785 1.00 30.69  ?  59   THR A OG1   1 
ATOM   3162 C  CG2   . THR B 1 60  ? 104.418 35.743  132.087 1.00 28.04  ?  59   THR A CG2   1 
ATOM   3163 N  N     . GLY B 1 61  ? 107.906 36.536  133.692 1.00 42.75  ?  60   GLY A N     1 
ATOM   3164 C  CA    . GLY B 1 61  ? 108.360 37.810  134.232 1.00 38.09  ?  60   GLY A CA    1 
ATOM   3165 C  C     . GLY B 1 61  ? 109.373 38.503  133.340 1.00 37.13  ?  60   GLY A C     1 
ATOM   3166 O  O     . GLY B 1 61  ? 109.390 39.734  133.239 1.00 36.36  ?  60   GLY A O     1 
ATOM   3167 N  N     . MET B 1 62  ? 110.233 37.727  132.680 1.00 36.26  ?  61   MET A N     1 
ATOM   3168 C  CA    . MET B 1 62  ? 111.169 38.325  131.733 1.00 41.01  ?  61   MET A CA    1 
ATOM   3169 C  C     . MET B 1 62  ? 110.461 38.747  130.452 1.00 40.76  ?  61   MET A C     1 
ATOM   3170 O  O     . MET B 1 62  ? 110.760 39.811  129.895 1.00 37.79  ?  61   MET A O     1 
ATOM   3171 C  CB    . MET B 1 62  ? 112.301 37.350  131.425 1.00 39.43  ?  61   MET A CB    1 
ATOM   3172 C  CG    . MET B 1 62  ? 113.269 37.822  130.353 1.00 39.58  ?  61   MET A CG    1 
ATOM   3173 S  SD    . MET B 1 62  ? 114.553 36.584  130.028 1.00 54.98  ?  61   MET A SD    1 
ATOM   3174 C  CE    . MET B 1 62  ? 116.033 37.493  130.439 1.00 69.91  ?  61   MET A CE    1 
ATOM   3175 N  N     . ALA B 1 63  ? 109.502 37.943  129.983 1.00 31.80  ?  62   ALA A N     1 
ATOM   3176 C  CA    . ALA B 1 63  ? 108.756 38.311  128.779 1.00 25.50  ?  62   ALA A CA    1 
ATOM   3177 C  C     . ALA B 1 63  ? 107.978 39.611  128.970 1.00 32.57  ?  62   ALA A C     1 
ATOM   3178 O  O     . ALA B 1 63  ? 107.866 40.418  128.037 1.00 33.06  ?  62   ALA A O     1 
ATOM   3179 C  CB    . ALA B 1 63  ? 107.817 37.170  128.369 1.00 26.25  ?  62   ALA A CB    1 
ATOM   3180 N  N     . LEU B 1 64  ? 107.444 39.844  130.171 1.00 39.53  ?  63   LEU A N     1 
ATOM   3181 C  CA    . LEU B 1 64  ? 106.684 41.071  130.403 1.00 40.38  ?  63   LEU A CA    1 
ATOM   3182 C  C     . LEU B 1 64  ? 107.592 42.287  130.496 1.00 38.79  ?  63   LEU A C     1 
ATOM   3183 O  O     . LEU B 1 64  ? 107.167 43.402  130.163 1.00 36.81  ?  63   LEU A O     1 
ATOM   3184 C  CB    . LEU B 1 64  ? 105.835 40.941  131.668 1.00 37.13  ?  63   LEU A CB    1 
ATOM   3185 C  CG    . LEU B 1 64  ? 104.633 40.016  131.481 1.00 42.60  ?  63   LEU A CG    1 
ATOM   3186 C  CD1   . LEU B 1 64  ? 103.925 39.739  132.796 1.00 42.65  ?  63   LEU A CD1   1 
ATOM   3187 C  CD2   . LEU B 1 64  ? 103.678 40.627  130.455 1.00 43.87  ?  63   LEU A CD2   1 
ATOM   3188 N  N     . LYS B 1 65  ? 108.835 42.106  130.944 1.00 36.06  ?  64   LYS A N     1 
ATOM   3189 C  CA    . LYS B 1 65  ? 109.753 43.238  130.976 1.00 46.97  ?  64   LYS A CA    1 
ATOM   3190 C  C     . LYS B 1 65  ? 110.225 43.587  129.571 1.00 47.12  ?  64   LYS A C     1 
ATOM   3191 O  O     . LYS B 1 65  ? 110.398 44.766  129.244 1.00 40.11  ?  64   LYS A O     1 
ATOM   3192 C  CB    . LYS B 1 65  ? 110.940 42.941  131.894 1.00 44.38  ?  64   LYS A CB    1 
ATOM   3193 N  N     . LEU B 1 66  ? 110.422 42.576  128.721 1.00 41.56  ?  65   LEU A N     1 
ATOM   3194 C  CA    . LEU B 1 66  ? 110.824 42.834  127.340 1.00 39.90  ?  65   LEU A CA    1 
ATOM   3195 C  C     . LEU B 1 66  ? 109.681 43.421  126.526 1.00 37.87  ?  65   LEU A C     1 
ATOM   3196 O  O     . LEU B 1 66  ? 109.916 44.210  125.601 1.00 36.73  ?  65   LEU A O     1 
ATOM   3197 C  CB    . LEU B 1 66  ? 111.317 41.542  126.680 1.00 42.93  ?  65   LEU A CB    1 
ATOM   3198 C  CG    . LEU B 1 66  ? 112.800 41.163  126.728 1.00 41.00  ?  65   LEU A CG    1 
ATOM   3199 C  CD1   . LEU B 1 66  ? 113.427 41.550  128.050 1.00 48.52  ?  65   LEU A CD1   1 
ATOM   3200 C  CD2   . LEU B 1 66  ? 112.968 39.658  126.474 1.00 32.04  ?  65   LEU A CD2   1 
ATOM   3201 N  N     . CYS B 1 67  ? 108.447 43.057  126.861 1.00 37.82  ?  66   CYS A N     1 
ATOM   3202 C  CA    . CYS B 1 67  ? 107.274 43.379  126.049 1.00 34.89  ?  66   CYS A CA    1 
ATOM   3203 C  C     . CYS B 1 67  ? 106.134 43.754  126.984 1.00 38.30  ?  66   CYS A C     1 
ATOM   3204 O  O     . CYS B 1 67  ? 105.226 42.954  127.242 1.00 34.10  ?  66   CYS A O     1 
ATOM   3205 C  CB    . CYS B 1 67  ? 106.899 42.202  125.148 1.00 36.78  ?  66   CYS A CB    1 
ATOM   3206 S  SG    . CYS B 1 67  ? 105.470 42.495  124.114 1.00 39.64  ?  66   CYS A SG    1 
ATOM   3207 N  N     . PRO B 1 68  ? 106.149 44.980  127.514 1.00 39.69  ?  67   PRO A N     1 
ATOM   3208 C  CA    . PRO B 1 68  ? 105.142 45.357  128.521 1.00 37.06  ?  67   PRO A CA    1 
ATOM   3209 C  C     . PRO B 1 68  ? 103.707 45.242  128.038 1.00 40.33  ?  67   PRO A C     1 
ATOM   3210 O  O     . PRO B 1 68  ? 102.806 45.062  128.865 1.00 41.85  ?  67   PRO A O     1 
ATOM   3211 C  CB    . PRO B 1 68  ? 105.504 46.815  128.848 1.00 41.76  ?  67   PRO A CB    1 
ATOM   3212 C  CG    . PRO B 1 68  ? 106.938 46.945  128.480 1.00 49.24  ?  67   PRO A CG    1 
ATOM   3213 C  CD    . PRO B 1 68  ? 107.125 46.061  127.277 1.00 48.63  ?  67   PRO A CD    1 
ATOM   3214 N  N     . HIS B 1 69  ? 103.459 45.335  126.734 1.00 39.10  ?  68   HIS A N     1 
ATOM   3215 C  CA    . HIS B 1 69  ? 102.106 45.247  126.200 1.00 33.89  ?  68   HIS A CA    1 
ATOM   3216 C  C     . HIS B 1 69  ? 101.693 43.815  125.873 1.00 32.54  ?  68   HIS A C     1 
ATOM   3217 O  O     . HIS B 1 69  ? 100.653 43.613  125.235 1.00 40.24  ?  68   HIS A O     1 
ATOM   3218 C  CB    . HIS B 1 69  ? 101.979 46.128  124.957 1.00 44.47  ?  68   HIS A CB    1 
ATOM   3219 C  CG    . HIS B 1 69  ? 102.186 47.586  125.236 1.00 55.59  ?  68   HIS A CG    1 
ATOM   3220 N  ND1   . HIS B 1 69  ? 101.146 48.448  125.510 1.00 68.44  ?  68   HIS A ND1   1 
ATOM   3221 C  CD2   . HIS B 1 69  ? 103.317 48.328  125.308 1.00 63.08  ?  68   HIS A CD2   1 
ATOM   3222 C  CE1   . HIS B 1 69  ? 101.625 49.661  125.725 1.00 66.73  ?  68   HIS A CE1   1 
ATOM   3223 N  NE2   . HIS B 1 69  ? 102.940 49.614  125.608 1.00 64.05  ?  68   HIS A NE2   1 
ATOM   3224 N  N     . LEU B 1 70  ? 102.480 42.830  126.297 1.00 31.45  ?  69   LEU A N     1 
ATOM   3225 C  CA    . LEU B 1 70  ? 102.197 41.437  125.971 1.00 30.47  ?  69   LEU A CA    1 
ATOM   3226 C  C     . LEU B 1 70  ? 100.823 41.023  126.486 1.00 37.97  ?  69   LEU A C     1 
ATOM   3227 O  O     . LEU B 1 70  ? 100.462 41.301  127.635 1.00 37.70  ?  69   LEU A O     1 
ATOM   3228 C  CB    . LEU B 1 70  ? 103.277 40.538  126.567 1.00 28.41  ?  69   LEU A CB    1 
ATOM   3229 C  CG    . LEU B 1 70  ? 103.258 39.053  126.186 1.00 27.13  ?  69   LEU A CG    1 
ATOM   3230 C  CD1   . LEU B 1 70  ? 103.522 38.917  124.689 1.00 27.66  ?  69   LEU A CD1   1 
ATOM   3231 C  CD2   . LEU B 1 70  ? 104.283 38.315  127.009 1.00 28.78  ?  69   LEU A CD2   1 
ATOM   3232 N  N     . THR B 1 71  ? 100.049 40.384  125.618 1.00 35.87  ?  70   THR A N     1 
ATOM   3233 C  CA    . THR B 1 71  ? 98.776  39.785  125.988 1.00 33.06  ?  70   THR A CA    1 
ATOM   3234 C  C     . THR B 1 71  ? 99.022  38.310  126.257 1.00 33.52  ?  70   THR A C     1 
ATOM   3235 O  O     . THR B 1 71  ? 99.503  37.595  125.375 1.00 33.44  ?  70   THR A O     1 
ATOM   3236 C  CB    . THR B 1 71  ? 97.748  39.961  124.876 1.00 40.59  ?  70   THR A CB    1 
ATOM   3237 O  OG1   . THR B 1 71  ? 97.487  41.358  124.700 1.00 42.14  ?  70   THR A OG1   1 
ATOM   3238 C  CG2   . THR B 1 71  ? 96.457  39.228  125.228 1.00 41.25  ?  70   THR A CG2   1 
ATOM   3239 N  N     . LEU B 1 72  ? 98.715  37.863  127.470 1.00 33.13  ?  71   LEU A N     1 
ATOM   3240 C  CA    . LEU B 1 72  ? 99.069  36.522  127.915 1.00 30.97  ?  71   LEU A CA    1 
ATOM   3241 C  C     . LEU B 1 72  ? 97.831  35.628  127.887 1.00 31.74  ?  71   LEU A C     1 
ATOM   3242 O  O     . LEU B 1 72  ? 96.820  35.938  128.529 1.00 34.80  ?  71   LEU A O     1 
ATOM   3243 C  CB    . LEU B 1 72  ? 99.673  36.580  129.317 1.00 39.62  ?  71   LEU A CB    1 
ATOM   3244 C  CG    . LEU B 1 72  ? 100.353 35.318  129.837 1.00 41.08  ?  71   LEU A CG    1 
ATOM   3245 C  CD1   . LEU B 1 72  ? 101.485 34.927  128.914 1.00 31.22  ?  71   LEU A CD1   1 
ATOM   3246 C  CD2   . LEU B 1 72  ? 100.864 35.565  131.248 1.00 44.85  ?  71   LEU A CD2   1 
ATOM   3247 N  N     . LEU B 1 73  ? 97.916  34.511  127.145 1.00 35.97  ?  72   LEU A N     1 
ATOM   3248 C  CA    . LEU B 1 73  ? 96.792  33.598  126.989 1.00 40.31  ?  72   LEU A CA    1 
ATOM   3249 C  C     . LEU B 1 73  ? 97.054  32.281  127.718 1.00 40.58  ?  72   LEU A C     1 
ATOM   3250 O  O     . LEU B 1 73  ? 98.203  31.830  127.806 1.00 36.19  ?  72   LEU A O     1 
ATOM   3251 C  CB    . LEU B 1 73  ? 96.510  33.306  125.510 1.00 43.42  ?  72   LEU A CB    1 
ATOM   3252 C  CG    . LEU B 1 73  ? 95.740  34.346  124.684 1.00 53.87  ?  72   LEU A CG    1 
ATOM   3253 C  CD1   . LEU B 1 73  ? 96.461  35.677  124.614 1.00 56.11  ?  72   LEU A CD1   1 
ATOM   3254 C  CD2   . LEU B 1 73  ? 95.486  33.819  123.283 1.00 55.56  ?  72   LEU A CD2   1 
ATOM   3255 N  N     . PRO B 1 74  ? 96.006  31.640  128.256 1.00 40.50  ?  73   PRO A N     1 
ATOM   3256 C  CA    . PRO B 1 74  ? 96.215  30.403  129.026 1.00 41.91  ?  73   PRO A CA    1 
ATOM   3257 C  C     . PRO B 1 74  ? 96.441  29.174  128.171 1.00 38.47  ?  73   PRO A C     1 
ATOM   3258 O  O     . PRO B 1 74  ? 97.003  28.190  128.669 1.00 40.92  ?  73   PRO A O     1 
ATOM   3259 C  CB    . PRO B 1 74  ? 94.915  30.271  129.834 1.00 34.56  ?  73   PRO A CB    1 
ATOM   3260 C  CG    . PRO B 1 74  ? 93.889  30.899  128.947 1.00 45.69  ?  73   PRO A CG    1 
ATOM   3261 C  CD    . PRO B 1 74  ? 94.590  32.053  128.256 1.00 48.11  ?  73   PRO A CD    1 
ATOM   3262 N  N     . GLY B 1 75  ? 96.017  29.187  126.913 1.00 32.94  ?  74   GLY A N     1 
ATOM   3263 C  CA    . GLY B 1 75  ? 96.177  28.021  126.071 1.00 38.89  ?  74   GLY A CA    1 
ATOM   3264 C  C     . GLY B 1 75  ? 94.943  27.142  126.080 1.00 44.29  ?  74   GLY A C     1 
ATOM   3265 O  O     . GLY B 1 75  ? 94.328  26.942  127.130 1.00 42.21  ?  74   GLY A O     1 
ATOM   3266 N  N     . ARG B 1 76  ? 94.570  26.614  124.919 1.00 37.28  ?  75   ARG A N     1 
ATOM   3267 C  CA    . ARG B 1 76  ? 93.392  25.762  124.769 1.00 39.99  ?  75   ARG A CA    1 
ATOM   3268 C  C     . ARG B 1 76  ? 93.861  24.443  124.160 1.00 35.07  ?  75   ARG A C     1 
ATOM   3269 O  O     . ARG B 1 76  ? 93.852  24.278  122.938 1.00 36.83  ?  75   ARG A O     1 
ATOM   3270 C  CB    . ARG B 1 76  ? 92.329  26.461  123.913 1.00 42.86  ?  75   ARG A CB    1 
ATOM   3271 C  CG    . ARG B 1 76  ? 91.980  27.856  124.422 1.00 48.66  ?  75   ARG A CG    1 
ATOM   3272 C  CD    . ARG B 1 76  ? 90.842  28.523  123.649 1.00 43.05  ?  75   ARG A CD    1 
ATOM   3273 N  NE    . ARG B 1 76  ? 91.209  28.821  122.268 1.00 46.56  ?  75   ARG A NE    1 
ATOM   3274 C  CZ    . ARG B 1 76  ? 90.623  28.288  121.202 1.00 46.37  ?  75   ARG A CZ    1 
ATOM   3275 N  NH1   . ARG B 1 76  ? 89.622  27.430  121.349 1.00 40.06  ?  75   ARG A NH1   1 
ATOM   3276 N  NH2   . ARG B 1 76  ? 91.035  28.624  119.988 1.00 51.13  ?  75   ARG A NH2   1 
ATOM   3277 N  N     . PHE B 1 77  ? 94.272  23.504  125.020 1.00 39.82  ?  76   PHE A N     1 
ATOM   3278 C  CA    . PHE B 1 77  ? 94.898  22.274  124.534 1.00 39.55  ?  76   PHE A CA    1 
ATOM   3279 C  C     . PHE B 1 77  ? 93.997  21.523  123.558 1.00 39.85  ?  76   PHE A C     1 
ATOM   3280 O  O     . PHE B 1 77  ? 94.482  20.943  122.579 1.00 39.22  ?  76   PHE A O     1 
ATOM   3281 C  CB    . PHE B 1 77  ? 95.279  21.364  125.702 1.00 44.30  ?  76   PHE A CB    1 
ATOM   3282 C  CG    . PHE B 1 77  ? 95.720  19.983  125.271 1.00 61.98  ?  76   PHE A CG    1 
ATOM   3283 C  CD1   . PHE B 1 77  ? 97.034  19.745  124.898 1.00 64.33  ?  76   PHE A CD1   1 
ATOM   3284 C  CD2   . PHE B 1 77  ? 94.814  18.929  125.221 1.00 64.54  ?  76   PHE A CD2   1 
ATOM   3285 C  CE1   . PHE B 1 77  ? 97.438  18.483  124.491 1.00 61.35  ?  76   PHE A CE1   1 
ATOM   3286 C  CE2   . PHE B 1 77  ? 95.212  17.667  124.812 1.00 61.02  ?  76   PHE A CE2   1 
ATOM   3287 C  CZ    . PHE B 1 77  ? 96.525  17.444  124.450 1.00 61.10  ?  76   PHE A CZ    1 
ATOM   3288 N  N     . ASP B 1 78  ? 92.686  21.499  123.810 1.00 36.73  ?  77   ASP A N     1 
ATOM   3289 C  CA    . ASP B 1 78  ? 91.822  20.735  122.919 1.00 42.66  ?  77   ASP A CA    1 
ATOM   3290 C  C     . ASP B 1 78  ? 91.743  21.372  121.537 1.00 38.71  ?  77   ASP A C     1 
ATOM   3291 O  O     . ASP B 1 78  ? 91.576  20.660  120.539 1.00 36.47  ?  77   ASP A O     1 
ATOM   3292 C  CB    . ASP B 1 78  ? 90.434  20.564  123.536 1.00 47.70  ?  77   ASP A CB    1 
ATOM   3293 C  CG    . ASP B 1 78  ? 90.411  19.486  124.602 1.00 60.50  ?  77   ASP A CG    1 
ATOM   3294 O  OD1   . ASP B 1 78  ? 91.031  18.422  124.388 1.00 65.58  ?  77   ASP A OD1   1 
ATOM   3295 O  OD2   . ASP B 1 78  ? 89.787  19.704  125.660 1.00 71.89  ?  77   ASP A OD2   1 
ATOM   3296 N  N     . ALA B 1 79  ? 91.888  22.697  121.449 1.00 37.25  ?  78   ALA A N     1 
ATOM   3297 C  CA    . ALA B 1 79  ? 91.999  23.327  120.136 1.00 42.17  ?  78   ALA A CA    1 
ATOM   3298 C  C     . ALA B 1 79  ? 93.297  22.925  119.445 1.00 37.99  ?  78   ALA A C     1 
ATOM   3299 O  O     . ALA B 1 79  ? 93.319  22.708  118.227 1.00 33.47  ?  78   ALA A O     1 
ATOM   3300 C  CB    . ALA B 1 79  ? 91.904  24.849  120.262 1.00 39.21  ?  78   ALA A CB    1 
ATOM   3301 N  N     . TYR B 1 80  ? 94.385  22.803  120.212 1.00 30.80  ?  79   TYR A N     1 
ATOM   3302 C  CA    . TYR B 1 80  ? 95.664  22.435  119.616 1.00 28.04  ?  79   TYR A CA    1 
ATOM   3303 C  C     . TYR B 1 80  ? 95.677  20.966  119.219 1.00 30.87  ?  79   TYR A C     1 
ATOM   3304 O  O     . TYR B 1 80  ? 96.250  20.598  118.185 1.00 34.20  ?  79   TYR A O     1 
ATOM   3305 C  CB    . TYR B 1 80  ? 96.806  22.746  120.589 1.00 31.44  ?  79   TYR A CB    1 
ATOM   3306 C  CG    . TYR B 1 80  ? 96.758  24.138  121.197 1.00 31.59  ?  79   TYR A CG    1 
ATOM   3307 C  CD1   . TYR B 1 80  ? 96.207  25.213  120.509 1.00 31.85  ?  79   TYR A CD1   1 
ATOM   3308 C  CD2   . TYR B 1 80  ? 97.258  24.368  122.478 1.00 37.38  ?  79   TYR A CD2   1 
ATOM   3309 C  CE1   . TYR B 1 80  ? 96.166  26.496  121.088 1.00 27.98  ?  79   TYR A CE1   1 
ATOM   3310 C  CE2   . TYR B 1 80  ? 97.223  25.626  123.056 1.00 32.77  ?  79   TYR A CE2   1 
ATOM   3311 C  CZ    . TYR B 1 80  ? 96.674  26.686  122.364 1.00 34.32  ?  79   TYR A CZ    1 
ATOM   3312 O  OH    . TYR B 1 80  ? 96.645  27.935  122.964 1.00 31.84  ?  79   TYR A OH    1 
ATOM   3313 N  N     . LYS B 1 81  ? 95.040  20.110  120.020 1.00 31.08  ?  80   LYS A N     1 
ATOM   3314 C  CA    . LYS B 1 81  ? 94.973  18.695  119.666 1.00 36.46  ?  80   LYS A CA    1 
ATOM   3315 C  C     . LYS B 1 81  ? 94.123  18.486  118.418 1.00 33.57  ?  80   LYS A C     1 
ATOM   3316 O  O     . LYS B 1 81  ? 94.454  17.650  117.568 1.00 33.99  ?  80   LYS A O     1 
ATOM   3317 C  CB    . LYS B 1 81  ? 94.423  17.882  120.840 1.00 33.54  ?  80   LYS A CB    1 
ATOM   3318 C  CG    . LYS B 1 81  ? 94.381  16.376  120.590 1.00 41.18  ?  80   LYS A CG    1 
ATOM   3319 C  CD    . LYS B 1 81  ? 95.786  15.794  120.392 1.00 41.54  ?  80   LYS A CD    1 
ATOM   3320 C  CE    . LYS B 1 81  ? 95.754  14.274  120.182 1.00 43.71  ?  80   LYS A CE    1 
ATOM   3321 N  NZ    . LYS B 1 81  ? 97.123  13.689  120.003 1.00 41.02  ?  80   LYS A NZ    1 
ATOM   3322 N  N     . GLU B 1 82  ? 93.032  19.248  118.285 1.00 35.71  ?  81   GLU A N     1 
ATOM   3323 C  CA    . GLU B 1 82  ? 92.179  19.136  117.104 1.00 42.38  ?  81   GLU A CA    1 
ATOM   3324 C  C     . GLU B 1 82  ? 92.947  19.486  115.834 1.00 39.24  ?  81   GLU A C     1 
ATOM   3325 O  O     . GLU B 1 82  ? 92.889  18.753  114.838 1.00 38.11  ?  81   GLU A O     1 
ATOM   3326 C  CB    . GLU B 1 82  ? 90.947  20.033  117.266 1.00 43.28  ?  81   GLU A CB    1 
ATOM   3327 C  CG    . GLU B 1 82  ? 90.384  20.612  115.971 1.00 56.61  ?  81   GLU A CG    1 
ATOM   3328 C  CD    . GLU B 1 82  ? 89.948  19.550  114.970 1.00 72.26  ?  81   GLU A CD    1 
ATOM   3329 O  OE1   . GLU B 1 82  ? 89.950  19.845  113.756 1.00 77.48  ?  81   GLU A OE1   1 
ATOM   3330 O  OE2   . GLU B 1 82  ? 89.613  18.423  115.393 1.00 77.19  ?  81   GLU A OE2   1 
ATOM   3331 N  N     . ALA B 1 83  ? 93.668  20.611  115.847 1.00 31.96  ?  82   ALA A N     1 
ATOM   3332 C  CA    . ALA B 1 83  ? 94.469  20.985  114.684 1.00 32.16  ?  82   ALA A CA    1 
ATOM   3333 C  C     . ALA B 1 83  ? 95.546  19.941  114.407 1.00 33.14  ?  82   ALA A C     1 
ATOM   3334 O  O     . ALA B 1 83  ? 95.818  19.609  113.246 1.00 36.28  ?  82   ALA A O     1 
ATOM   3335 C  CB    . ALA B 1 83  ? 95.096  22.367  114.893 1.00 31.83  ?  82   ALA A CB    1 
ATOM   3336 N  N     . SER B 1 84  ? 96.162  19.407  115.462 1.00 33.06  ?  83   SER A N     1 
ATOM   3337 C  CA    . SER B 1 84  ? 97.194  18.392  115.274 1.00 29.78  ?  83   SER A CA    1 
ATOM   3338 C  C     . SER B 1 84  ? 96.625  17.125  114.641 1.00 32.95  ?  83   SER A C     1 
ATOM   3339 O  O     . SER B 1 84  ? 97.266  16.518  113.772 1.00 29.60  ?  83   SER A O     1 
ATOM   3340 C  CB    . SER B 1 84  ? 97.859  18.066  116.606 1.00 29.09  ?  83   SER A CB    1 
ATOM   3341 O  OG    . SER B 1 84  ? 98.737  16.951  116.458 1.00 29.16  ?  83   SER A OG    1 
ATOM   3342 N  N     . ASN B 1 85  ? 95.424  16.705  115.065 1.00 29.76  ?  84   ASN A N     1 
ATOM   3343 C  CA    . ASN B 1 85  ? 94.803  15.532  114.448 1.00 36.87  ?  84   ASN A CA    1 
ATOM   3344 C  C     . ASN B 1 85  ? 94.532  15.785  112.976 1.00 37.62  ?  84   ASN A C     1 
ATOM   3345 O  O     . ASN B 1 85  ? 94.741  14.904  112.130 1.00 31.38  ?  84   ASN A O     1 
ATOM   3346 C  CB    . ASN B 1 85  ? 93.490  15.168  115.150 1.00 35.61  ?  84   ASN A CB    1 
ATOM   3347 C  CG    . ASN B 1 85  ? 93.695  14.647  116.554 1.00 38.42  ?  84   ASN A CG    1 
ATOM   3348 O  OD1   . ASN B 1 85  ? 94.761  14.129  116.893 1.00 36.98  ?  84   ASN A OD1   1 
ATOM   3349 N  ND2   . ASN B 1 85  ? 92.660  14.769  117.382 1.00 34.80  ?  84   ASN A ND2   1 
ATOM   3350 N  N     . HIS B 1 86  ? 94.067  16.992  112.656 1.00 31.47  ?  85   HIS A N     1 
ATOM   3351 C  CA    . HIS B 1 86  ? 93.750  17.338  111.278 1.00 34.38  ?  85   HIS A CA    1 
ATOM   3352 C  C     . HIS B 1 86  ? 94.996  17.306  110.392 1.00 32.65  ?  85   HIS A C     1 
ATOM   3353 O  O     . HIS B 1 86  ? 94.957  16.761  109.282 1.00 33.97  ?  85   HIS A O     1 
ATOM   3354 C  CB    . HIS B 1 86  ? 93.082  18.714  111.245 1.00 38.80  ?  85   HIS A CB    1 
ATOM   3355 C  CG    . HIS B 1 86  ? 92.354  19.008  109.972 1.00 43.25  ?  85   HIS A CG    1 
ATOM   3356 N  ND1   . HIS B 1 86  ? 91.368  19.970  109.884 1.00 42.68  ?  85   HIS A ND1   1 
ATOM   3357 C  CD2   . HIS B 1 86  ? 92.475  18.478  108.732 1.00 43.00  ?  85   HIS A CD2   1 
ATOM   3358 C  CE1   . HIS B 1 86  ? 90.910  20.014  108.647 1.00 42.42  ?  85   HIS A CE1   1 
ATOM   3359 N  NE2   . HIS B 1 86  ? 91.566  19.119  107.928 1.00 39.15  ?  85   HIS A NE2   1 
ATOM   3360 N  N     . ILE B 1 87  ? 96.119  17.869  110.859 1.00 31.83  ?  86   ILE A N     1 
ATOM   3361 C  CA    . ILE B 1 87  ? 97.285  17.885  109.973 1.00 25.95  ?  86   ILE A CA    1 
ATOM   3362 C  C     . ILE B 1 87  ? 97.838  16.474  109.791 1.00 26.87  ?  86   ILE A C     1 
ATOM   3363 O  O     . ILE B 1 87  ? 98.323  16.133  108.709 1.00 31.06  ?  86   ILE A O     1 
ATOM   3364 C  CB    . ILE B 1 87  ? 98.382  18.869  110.445 1.00 30.36  ?  86   ILE A CB    1 
ATOM   3365 C  CG1   . ILE B 1 87  ? 99.041  18.435  111.748 1.00 35.85  ?  86   ILE A CG1   1 
ATOM   3366 C  CG2   . ILE B 1 87  ? 97.840  20.297  110.584 1.00 26.98  ?  86   ILE A CG2   1 
ATOM   3367 C  CD1   . ILE B 1 87  ? 100.245 19.304  112.107 1.00 29.07  ?  86   ILE A CD1   1 
ATOM   3368 N  N     . ARG B 1 88  ? 97.768  15.631  110.827 1.00 29.25  ?  87   ARG A N     1 
ATOM   3369 C  CA    . ARG B 1 88  ? 98.224  14.250  110.677 1.00 29.65  ?  87   ARG A CA    1 
ATOM   3370 C  C     . ARG B 1 88  ? 97.349  13.501  109.685 1.00 36.27  ?  87   ARG A C     1 
ATOM   3371 O  O     . ARG B 1 88  ? 97.842  12.660  108.924 1.00 32.39  ?  87   ARG A O     1 
ATOM   3372 C  CB    . ARG B 1 88  ? 98.231  13.530  112.032 1.00 26.25  ?  87   ARG A CB    1 
ATOM   3373 C  CG    . ARG B 1 88  ? 99.299  14.080  112.967 1.00 27.89  ?  87   ARG A CG    1 
ATOM   3374 C  CD    . ARG B 1 88  ? 99.294  13.443  114.342 1.00 26.97  ?  87   ARG A CD    1 
ATOM   3375 N  NE    . ARG B 1 88  ? 100.292 14.080  115.206 1.00 29.39  ?  87   ARG A NE    1 
ATOM   3376 C  CZ    . ARG B 1 88  ? 100.543 13.704  116.456 1.00 32.94  ?  87   ARG A CZ    1 
ATOM   3377 N  NH1   . ARG B 1 88  ? 99.864  12.699  116.985 1.00 31.37  ?  87   ARG A NH1   1 
ATOM   3378 N  NH2   . ARG B 1 88  ? 101.467 14.326  117.181 1.00 28.31  ?  87   ARG A NH2   1 
ATOM   3379 N  N     . GLU B 1 89  ? 96.047  13.791  109.683 1.00 28.02  ?  88   GLU A N     1 
ATOM   3380 C  CA    . GLU B 1 89  ? 95.164  13.179  108.696 1.00 29.13  ?  88   GLU A CA    1 
ATOM   3381 C  C     . GLU B 1 89  ? 95.486  13.666  107.288 1.00 29.39  ?  88   GLU A C     1 
ATOM   3382 O  O     . GLU B 1 89  ? 95.361  12.902  106.324 1.00 32.98  ?  88   GLU A O     1 
ATOM   3383 C  CB    . GLU B 1 89  ? 93.702  13.466  109.048 1.00 30.15  ?  88   GLU A CB    1 
ATOM   3384 C  CG    . GLU B 1 89  ? 92.704  12.804  108.092 1.00 40.12  ?  88   GLU A CG    1 
ATOM   3385 C  CD    . GLU B 1 89  ? 92.467  13.623  106.824 1.00 43.20  ?  88   GLU A CD    1 
ATOM   3386 O  OE1   . GLU B 1 89  ? 92.473  14.869  106.918 1.00 45.11  ?  88   GLU A OE1   1 
ATOM   3387 O  OE2   . GLU B 1 89  ? 92.290  13.023  105.737 1.00 44.82  ?  88   GLU A OE2   1 
ATOM   3388 N  N     . ILE B 1 90  ? 95.887  14.928  107.151 1.00 33.69  ?  89   ILE A N     1 
ATOM   3389 C  CA    . ILE B 1 90  ? 96.313  15.439  105.854 1.00 33.48  ?  89   ILE A CA    1 
ATOM   3390 C  C     . ILE B 1 90  ? 97.585  14.736  105.397 1.00 30.56  ?  89   ILE A C     1 
ATOM   3391 O  O     . ILE B 1 90  ? 97.705  14.332  104.232 1.00 34.30  ?  89   ILE A O     1 
ATOM   3392 C  CB    . ILE B 1 90  ? 96.496  16.964  105.937 1.00 32.17  ?  89   ILE A CB    1 
ATOM   3393 C  CG1   . ILE B 1 90  ? 95.134  17.664  105.902 1.00 29.58  ?  89   ILE A CG1   1 
ATOM   3394 C  CG2   . ILE B 1 90  ? 97.413  17.475  104.834 1.00 31.37  ?  89   ILE A CG2   1 
ATOM   3395 C  CD1   . ILE B 1 90  ? 95.217  19.118  106.346 1.00 30.62  ?  89   ILE A CD1   1 
ATOM   3396 N  N     . PHE B 1 91  ? 98.559  14.587  106.301 1.00 26.88  ?  90   PHE A N     1 
ATOM   3397 C  CA    . PHE B 1 91  ? 99.764  13.838  105.956 1.00 34.94  ?  90   PHE A CA    1 
ATOM   3398 C  C     . PHE B 1 91  ? 99.413  12.458  105.414 1.00 30.67  ?  90   PHE A C     1 
ATOM   3399 O  O     . PHE B 1 91  ? 100.033 11.980  104.457 1.00 29.26  ?  90   PHE A O     1 
ATOM   3400 C  CB    . PHE B 1 91  ? 100.675 13.685  107.173 1.00 29.47  ?  90   PHE A CB    1 
ATOM   3401 C  CG    . PHE B 1 91  ? 101.120 14.983  107.793 1.00 26.24  ?  90   PHE A CG    1 
ATOM   3402 C  CD1   . PHE B 1 91  ? 101.170 16.163  107.061 1.00 24.68  ?  90   PHE A CD1   1 
ATOM   3403 C  CD2   . PHE B 1 91  ? 101.507 15.004  109.125 1.00 26.04  ?  90   PHE A CD2   1 
ATOM   3404 C  CE1   . PHE B 1 91  ? 101.603 17.330  107.654 1.00 24.45  ?  90   PHE A CE1   1 
ATOM   3405 C  CE2   . PHE B 1 91  ? 101.928 16.166  109.726 1.00 24.52  ?  90   PHE A CE2   1 
ATOM   3406 C  CZ    . PHE B 1 91  ? 101.973 17.342  108.990 1.00 27.29  ?  90   PHE A CZ    1 
ATOM   3407 N  N     . SER B 1 92  ? 98.400  11.814  106.005 1.00 29.03  ?  91   SER A N     1 
ATOM   3408 C  CA    . SER B 1 92  ? 98.057  10.441  105.649 1.00 32.55  ?  91   SER A CA    1 
ATOM   3409 C  C     . SER B 1 92  ? 97.465  10.334  104.254 1.00 33.14  ?  91   SER A C     1 
ATOM   3410 O  O     . SER B 1 92  ? 97.391  9.229   103.707 1.00 31.90  ?  91   SER A O     1 
ATOM   3411 C  CB    . SER B 1 92  ? 97.076  9.861   106.671 1.00 41.11  ?  91   SER A CB    1 
ATOM   3412 O  OG    . SER B 1 92  ? 95.757  10.332  106.436 1.00 34.60  ?  91   SER A OG    1 
ATOM   3413 N  N     . ARG B 1 93  ? 97.034  11.448  103.665 1.00 37.55  ?  92   ARG A N     1 
ATOM   3414 C  CA    . ARG B 1 93  ? 96.588  11.394  102.281 1.00 39.71  ?  92   ARG A CA    1 
ATOM   3415 C  C     . ARG B 1 93  ? 97.752  11.208  101.320 1.00 38.01  ?  92   ARG A C     1 
ATOM   3416 O  O     . ARG B 1 93  ? 97.532  10.817  100.168 1.00 38.35  ?  92   ARG A O     1 
ATOM   3417 C  CB    . ARG B 1 93  ? 95.818  12.667  101.923 1.00 38.21  ?  92   ARG A CB    1 
ATOM   3418 C  CG    . ARG B 1 93  ? 94.727  13.032  102.912 1.00 39.54  ?  92   ARG A CG    1 
ATOM   3419 C  CD    . ARG B 1 93  ? 94.176  14.416  102.594 1.00 42.46  ?  92   ARG A CD    1 
ATOM   3420 N  NE    . ARG B 1 93  ? 93.206  14.868  103.586 1.00 41.98  ?  92   ARG A NE    1 
ATOM   3421 C  CZ    . ARG B 1 93  ? 92.645  16.072  103.570 1.00 37.85  ?  92   ARG A CZ    1 
ATOM   3422 N  NH1   . ARG B 1 93  ? 92.968  16.928  102.615 1.00 35.81  ?  92   ARG A NH1   1 
ATOM   3423 N  NH2   . ARG B 1 93  ? 91.773  16.424  104.511 1.00 36.81  ?  92   ARG A NH2   1 
ATOM   3424 N  N     . TYR B 1 94  ? 98.978  11.495  101.761 1.00 31.07  ?  93   TYR A N     1 
ATOM   3425 C  CA    . TYR B 1 94  ? 100.149 11.440  100.896 1.00 36.15  ?  93   TYR A CA    1 
ATOM   3426 C  C     . TYR B 1 94  ? 101.013 10.211  101.123 1.00 38.81  ?  93   TYR A C     1 
ATOM   3427 O  O     . TYR B 1 94  ? 101.601 9.697   100.167 1.00 39.95  ?  93   TYR A O     1 
ATOM   3428 C  CB    . TYR B 1 94  ? 100.987 12.712  101.079 1.00 34.76  ?  93   TYR A CB    1 
ATOM   3429 C  CG    . TYR B 1 94  ? 100.292 13.893  100.459 1.00 33.70  ?  93   TYR A CG    1 
ATOM   3430 C  CD1   . TYR B 1 94  ? 99.312  14.593  101.152 1.00 35.51  ?  93   TYR A CD1   1 
ATOM   3431 C  CD2   . TYR B 1 94  ? 100.571 14.272  99.154  1.00 36.66  ?  93   TYR A CD2   1 
ATOM   3432 C  CE1   . TYR B 1 94  ? 98.650  15.651  100.565 1.00 36.82  ?  93   TYR A CE1   1 
ATOM   3433 C  CE2   . TYR B 1 94  ? 99.917  15.340  98.565  1.00 39.08  ?  93   TYR A CE2   1 
ATOM   3434 C  CZ    . TYR B 1 94  ? 98.959  16.020  99.275  1.00 39.47  ?  93   TYR A CZ    1 
ATOM   3435 O  OH    . TYR B 1 94  ? 98.306  17.072  98.682  1.00 47.16  ?  93   TYR A OH    1 
ATOM   3436 N  N     . THR B 1 95  ? 101.091 9.715   102.353 1.00 36.86  ?  94   THR A N     1 
ATOM   3437 C  CA    . THR B 1 95  ? 101.888 8.533   102.631 1.00 37.26  ?  94   THR A CA    1 
ATOM   3438 C  C     . THR B 1 95  ? 101.454 7.970   103.974 1.00 36.87  ?  94   THR A C     1 
ATOM   3439 O  O     . THR B 1 95  ? 100.910 8.685   104.816 1.00 37.36  ?  94   THR A O     1 
ATOM   3440 C  CB    . THR B 1 95  ? 103.391 8.853   102.614 1.00 35.25  ?  94   THR A CB    1 
ATOM   3441 O  OG1   . THR B 1 95  ? 104.140 7.661   102.876 1.00 38.93  ?  94   THR A OG1   1 
ATOM   3442 C  CG2   . THR B 1 95  ? 103.747 9.927   103.646 1.00 32.89  ?  94   THR A CG2   1 
ATOM   3443 N  N     . SER B 1 96  ? 101.673 6.672   104.158 1.00 32.27  ?  95   SER A N     1 
ATOM   3444 C  CA    . SER B 1 96  ? 101.501 6.099   105.487 1.00 31.32  ?  95   SER A CA    1 
ATOM   3445 C  C     . SER B 1 96  ? 102.756 6.216   106.335 1.00 32.15  ?  95   SER A C     1 
ATOM   3446 O  O     . SER B 1 96  ? 102.709 5.931   107.541 1.00 34.69  ?  95   SER A O     1 
ATOM   3447 C  CB    . SER B 1 96  ? 101.093 4.632   105.387 1.00 35.88  ?  95   SER A CB    1 
ATOM   3448 O  OG    . SER B 1 96  ? 102.115 3.887   104.753 1.00 40.08  ?  95   SER A OG    1 
ATOM   3449 N  N     . ARG B 1 97  ? 103.867 6.657   105.742 1.00 30.25  ?  96   ARG A N     1 
ATOM   3450 C  CA    . ARG B 1 97  ? 105.149 6.725   106.442 1.00 27.39  ?  96   ARG A CA    1 
ATOM   3451 C  C     . ARG B 1 97  ? 105.264 8.084   107.123 1.00 32.07  ?  96   ARG A C     1 
ATOM   3452 O  O     . ARG B 1 97  ? 105.906 9.013   106.634 1.00 30.73  ?  96   ARG A O     1 
ATOM   3453 C  CB    . ARG B 1 97  ? 106.287 6.465   105.471 1.00 33.25  ?  96   ARG A CB    1 
ATOM   3454 C  CG    . ARG B 1 97  ? 106.073 5.137   104.752 1.00 35.27  ?  96   ARG A CG    1 
ATOM   3455 C  CD    . ARG B 1 97  ? 107.356 4.419   104.499 1.00 35.13  ?  96   ARG A CD    1 
ATOM   3456 N  NE    . ARG B 1 97  ? 108.286 4.530   105.613 1.00 31.31  ?  96   ARG A NE    1 
ATOM   3457 C  CZ    . ARG B 1 97  ? 109.597 4.377   105.472 1.00 34.89  ?  96   ARG A CZ    1 
ATOM   3458 N  NH1   . ARG B 1 97  ? 110.093 4.112   104.262 1.00 34.73  ?  96   ARG A NH1   1 
ATOM   3459 N  NH2   . ARG B 1 97  ? 110.406 4.494   106.523 1.00 32.53  ?  96   ARG A NH2   1 
ATOM   3460 N  N     . ILE B 1 98  ? 104.645 8.174   108.298 1.00 28.40  ?  97   ILE A N     1 
ATOM   3461 C  CA    . ILE B 1 98  ? 104.539 9.418   109.049 1.00 27.82  ?  97   ILE A CA    1 
ATOM   3462 C  C     . ILE B 1 98  ? 105.062 9.168   110.453 1.00 30.41  ?  97   ILE A C     1 
ATOM   3463 O  O     . ILE B 1 98  ? 104.590 8.254   111.138 1.00 29.90  ?  97   ILE A O     1 
ATOM   3464 C  CB    . ILE B 1 98  ? 103.086 9.920   109.123 1.00 28.11  ?  97   ILE A CB    1 
ATOM   3465 C  CG1   . ILE B 1 98  ? 102.498 10.106  107.726 1.00 32.23  ?  97   ILE A CG1   1 
ATOM   3466 C  CG2   . ILE B 1 98  ? 102.998 11.188  109.974 1.00 24.78  ?  97   ILE A CG2   1 
ATOM   3467 C  CD1   . ILE B 1 98  ? 100.985 10.064  107.725 1.00 33.98  ?  97   ILE A CD1   1 
ATOM   3468 N  N     . GLU B 1 99  ? 106.021 9.980   110.888 1.00 25.66  ?  98   GLU A N     1 
ATOM   3469 C  CA    . GLU B 1 99  ? 106.524 9.919   112.259 1.00 24.08  ?  98   GLU A CA    1 
ATOM   3470 C  C     . GLU B 1 99  ? 106.278 11.264  112.933 1.00 29.50  ?  98   GLU A C     1 
ATOM   3471 O  O     . GLU B 1 99  ? 107.117 12.178  112.840 1.00 26.06  ?  98   GLU A O     1 
ATOM   3472 C  CB    . GLU B 1 99  ? 108.007 9.551   112.296 1.00 25.13  ?  98   GLU A CB    1 
ATOM   3473 C  CG    . GLU B 1 99  ? 108.574 9.474   113.721 1.00 25.08  ?  98   GLU A CG    1 
ATOM   3474 C  CD    . GLU B 1 99  ? 110.020 9.026   113.761 1.00 29.18  ?  98   GLU A CD    1 
ATOM   3475 O  OE1   . GLU B 1 99  ? 110.553 8.585   112.709 1.00 27.94  ?  98   GLU A OE1   1 
ATOM   3476 O  OE2   . GLU B 1 99  ? 110.627 9.136   114.848 1.00 30.34  ?  98   GLU A OE2   1 
ATOM   3477 N  N     . PRO B 1 100 ? 105.156 11.430  113.636 1.00 27.94  ?  99   PRO A N     1 
ATOM   3478 C  CA    . PRO B 1 100 ? 104.975 12.649  114.432 1.00 26.33  ?  99   PRO A CA    1 
ATOM   3479 C  C     . PRO B 1 100 ? 106.056 12.763  115.497 1.00 30.71  ?  99   PRO A C     1 
ATOM   3480 O  O     . PRO B 1 100 ? 106.442 11.776  116.136 1.00 31.25  ?  99   PRO A O     1 
ATOM   3481 C  CB    . PRO B 1 100 ? 103.585 12.473  115.058 1.00 28.48  ?  99   PRO A CB    1 
ATOM   3482 C  CG    . PRO B 1 100 ? 102.907 11.432  114.231 1.00 33.03  ?  99   PRO A CG    1 
ATOM   3483 C  CD    . PRO B 1 100 ? 104.011 10.513  113.775 1.00 28.28  ?  99   PRO A CD    1 
ATOM   3484 N  N     . LEU B 1 101 ? 106.548 13.985  115.675 1.00 25.43  ?  100  LEU A N     1 
ATOM   3485 C  CA    . LEU B 1 101 ? 107.540 14.298  116.693 1.00 27.76  ?  100  LEU A CA    1 
ATOM   3486 C  C     . LEU B 1 101 ? 106.965 15.085  117.858 1.00 28.92  ?  100  LEU A C     1 
ATOM   3487 O  O     . LEU B 1 101 ? 107.556 15.083  118.942 1.00 33.08  ?  100  LEU A O     1 
ATOM   3488 C  CB    . LEU B 1 101 ? 108.697 15.100  116.078 1.00 29.10  ?  100  LEU A CB    1 
ATOM   3489 C  CG    . LEU B 1 101 ? 109.420 14.449  114.895 1.00 36.86  ?  100  LEU A CG    1 
ATOM   3490 C  CD1   . LEU B 1 101 ? 110.574 15.334  114.440 1.00 38.50  ?  100  LEU A CD1   1 
ATOM   3491 C  CD2   . LEU B 1 101 ? 109.905 13.041  115.250 1.00 30.67  ?  100  LEU A CD2   1 
ATOM   3492 N  N     . SER B 1 102 ? 105.825 15.732  117.660 1.00 28.30  ?  101  SER A N     1 
ATOM   3493 C  CA    . SER B 1 102 ? 105.117 16.522  118.659 1.00 27.26  ?  101  SER A CA    1 
ATOM   3494 C  C     . SER B 1 102 ? 103.775 16.848  118.028 1.00 24.30  ?  101  SER A C     1 
ATOM   3495 O  O     . SER B 1 102 ? 103.493 16.428  116.903 1.00 28.33  ?  101  SER A O     1 
ATOM   3496 C  CB    . SER B 1 102 ? 105.880 17.797  119.034 1.00 32.11  ?  101  SER A CB    1 
ATOM   3497 O  OG    . SER B 1 102 ? 105.878 18.691  117.934 1.00 41.23  ?  101  SER A OG    1 
ATOM   3498 N  N     . LEU B 1 103 ? 102.957 17.631  118.730 1.00 26.08  ?  102  LEU A N     1 
ATOM   3499 C  CA    . LEU B 1 103 ? 101.644 17.947  118.174 1.00 29.97  ?  102  LEU A CA    1 
ATOM   3500 C  C     . LEU B 1 103 ? 101.753 18.540  116.773 1.00 28.08  ?  102  LEU A C     1 
ATOM   3501 O  O     . LEU B 1 103 ? 100.984 18.169  115.878 1.00 24.63  ?  102  LEU A O     1 
ATOM   3502 C  CB    . LEU B 1 103 ? 100.881 18.910  119.086 1.00 32.81  ?  102  LEU A CB    1 
ATOM   3503 C  CG    . LEU B 1 103 ? 100.274 18.347  120.367 1.00 32.16  ?  102  LEU A CG    1 
ATOM   3504 C  CD1   . LEU B 1 103 ? 99.504  19.451  121.064 1.00 32.08  ?  102  LEU A CD1   1 
ATOM   3505 C  CD2   . LEU B 1 103 ? 99.383  17.145  120.088 1.00 31.26  ?  102  LEU A CD2   1 
ATOM   3506 N  N     . ASP B 1 104 ? 102.706 19.452  116.556 1.00 27.76  ?  103  ASP A N     1 
ATOM   3507 C  CA    . ASP B 1 104 ? 102.673 20.297  115.366 1.00 27.41  ?  103  ASP A CA    1 
ATOM   3508 C  C     . ASP B 1 104 ? 103.704 19.930  114.308 1.00 28.66  ?  103  ASP A C     1 
ATOM   3509 O  O     . ASP B 1 104 ? 103.944 20.732  113.401 1.00 26.84  ?  103  ASP A O     1 
ATOM   3510 C  CB    . ASP B 1 104 ? 102.826 21.776  115.759 1.00 27.02  ?  103  ASP A CB    1 
ATOM   3511 C  CG    . ASP B 1 104 ? 104.289 22.242  115.842 1.00 29.62  ?  103  ASP A CG    1 
ATOM   3512 O  OD1   . ASP B 1 104 ? 105.176 21.456  116.238 1.00 27.58  ?  103  ASP A OD1   1 
ATOM   3513 O  OD2   . ASP B 1 104 ? 104.543 23.422  115.517 1.00 25.89  ?  103  ASP A OD2   1 
ATOM   3514 N  N     . GLU B 1 105 ? 104.313 18.745  114.371 1.00 25.95  ?  104  GLU A N     1 
ATOM   3515 C  CA    . GLU B 1 105 ? 105.349 18.456  113.388 1.00 26.11  ?  104  GLU A CA    1 
ATOM   3516 C  C     . GLU B 1 105 ? 105.455 16.956  113.167 1.00 25.12  ?  104  GLU A C     1 
ATOM   3517 O  O     . GLU B 1 105 ? 105.079 16.156  114.024 1.00 23.24  ?  104  GLU A O     1 
ATOM   3518 C  CB    . GLU B 1 105 ? 106.701 19.024  113.810 1.00 28.33  ?  104  GLU A CB    1 
ATOM   3519 C  CG    . GLU B 1 105 ? 107.324 18.323  114.982 1.00 30.47  ?  104  GLU A CG    1 
ATOM   3520 C  CD    . GLU B 1 105 ? 108.606 19.014  115.446 1.00 41.83  ?  104  GLU A CD    1 
ATOM   3521 O  OE1   . GLU B 1 105 ? 109.686 18.742  114.882 1.00 32.70  ?  104  GLU A OE1   1 
ATOM   3522 O  OE2   . GLU B 1 105 ? 108.523 19.842  116.369 1.00 55.46  ?  104  GLU A OE2   1 
ATOM   3523 N  N     . ALA B 1 106 ? 105.976 16.593  112.000 1.00 22.85  ?  105  ALA A N     1 
ATOM   3524 C  CA    . ALA B 1 106 ? 106.157 15.193  111.634 1.00 21.91  ?  105  ALA A CA    1 
ATOM   3525 C  C     . ALA B 1 106 ? 107.218 15.086  110.549 1.00 26.40  ?  105  ALA A C     1 
ATOM   3526 O  O     . ALA B 1 106 ? 107.388 15.997  109.739 1.00 23.41  ?  105  ALA A O     1 
ATOM   3527 C  CB    . ALA B 1 106 ? 104.848 14.567  111.132 1.00 22.50  ?  105  ALA A CB    1 
ATOM   3528 N  N     . TYR B 1 107 ? 107.913 13.949  110.531 1.00 24.20  ?  106  TYR A N     1 
ATOM   3529 C  CA    . TYR B 1 107 ? 108.634 13.502  109.345 1.00 22.08  ?  106  TYR A CA    1 
ATOM   3530 C  C     . TYR B 1 107 ? 107.709 12.679  108.476 1.00 25.03  ?  106  TYR A C     1 
ATOM   3531 O  O     . TYR B 1 107 ? 106.944 11.850  108.982 1.00 24.87  ?  106  TYR A O     1 
ATOM   3532 C  CB    . TYR B 1 107 ? 109.834 12.621  109.701 1.00 23.67  ?  106  TYR A CB    1 
ATOM   3533 C  CG    . TYR B 1 107 ? 110.997 13.325  110.344 1.00 25.05  ?  106  TYR A CG    1 
ATOM   3534 C  CD1   . TYR B 1 107 ? 111.647 14.364  109.694 1.00 23.35  ?  106  TYR A CD1   1 
ATOM   3535 C  CD2   . TYR B 1 107 ? 111.480 12.912  111.585 1.00 25.24  ?  106  TYR A CD2   1 
ATOM   3536 C  CE1   . TYR B 1 107 ? 112.728 15.000  110.287 1.00 26.21  ?  106  TYR A CE1   1 
ATOM   3537 C  CE2   . TYR B 1 107 ? 112.558 13.541  112.183 1.00 25.57  ?  106  TYR A CE2   1 
ATOM   3538 C  CZ    . TYR B 1 107 ? 113.176 14.581  111.524 1.00 27.31  ?  106  TYR A CZ    1 
ATOM   3539 O  OH    . TYR B 1 107 ? 114.247 15.210  112.094 1.00 29.80  ?  106  TYR A OH    1 
ATOM   3540 N  N     . LEU B 1 108 ? 107.839 12.865  107.163 1.00 24.08  ?  107  LEU A N     1 
ATOM   3541 C  CA    . LEU B 1 108 ? 107.217 12.025  106.152 1.00 26.65  ?  107  LEU A CA    1 
ATOM   3542 C  C     . LEU B 1 108 ? 108.308 11.443  105.268 1.00 29.51  ?  107  LEU A C     1 
ATOM   3543 O  O     . LEU B 1 108 ? 109.229 12.157  104.865 1.00 27.71  ?  107  LEU A O     1 
ATOM   3544 C  CB    . LEU B 1 108 ? 106.245 12.824  105.271 1.00 26.93  ?  107  LEU A CB    1 
ATOM   3545 C  CG    . LEU B 1 108 ? 105.132 13.697  105.847 1.00 42.12  ?  107  LEU A CG    1 
ATOM   3546 C  CD1   . LEU B 1 108 ? 104.031 13.817  104.816 1.00 38.60  ?  107  LEU A CD1   1 
ATOM   3547 C  CD2   . LEU B 1 108 ? 104.584 13.165  107.153 1.00 48.41  ?  107  LEU A CD2   1 
ATOM   3548 N  N     . ASP B 1 109 ? 108.213 10.144  104.957 1.00 26.42  ?  108  ASP A N     1 
ATOM   3549 C  CA    . ASP B 1 109 ? 109.094 9.540   103.968 1.00 25.73  ?  108  ASP A CA    1 
ATOM   3550 C  C     . ASP B 1 109 ? 108.286 9.355   102.688 1.00 35.63  ?  108  ASP A C     1 
ATOM   3551 O  O     . ASP B 1 109 ? 107.404 8.487   102.622 1.00 32.83  ?  108  ASP A O     1 
ATOM   3552 C  CB    . ASP B 1 109 ? 109.672 8.210   104.473 1.00 26.11  ?  108  ASP A CB    1 
ATOM   3553 C  CG    . ASP B 1 109 ? 110.718 7.617   103.516 1.00 32.04  ?  108  ASP A CG    1 
ATOM   3554 O  OD1   . ASP B 1 109 ? 110.553 7.761   102.293 1.00 31.81  ?  108  ASP A OD1   1 
ATOM   3555 O  OD2   . ASP B 1 109 ? 111.712 7.018   103.982 1.00 34.52  ?  108  ASP A OD2   1 
ATOM   3556 N  N     . VAL B 1 110 ? 108.598 10.159  101.667 1.00 26.80  ?  109  VAL A N     1 
ATOM   3557 C  CA    . VAL B 1 110 ? 107.884 10.076  100.397 1.00 28.77  ?  109  VAL A CA    1 
ATOM   3558 C  C     . VAL B 1 110 ? 108.799 9.525   99.309  1.00 35.06  ?  109  VAL A C     1 
ATOM   3559 O  O     . VAL B 1 110 ? 108.602 9.804   98.122  1.00 38.60  ?  109  VAL A O     1 
ATOM   3560 C  CB    . VAL B 1 110 ? 107.286 11.442  99.999  1.00 29.18  ?  109  VAL A CB    1 
ATOM   3561 C  CG1   . VAL B 1 110 ? 106.283 11.890  101.040 1.00 30.66  ?  109  VAL A CG1   1 
ATOM   3562 C  CG2   . VAL B 1 110 ? 108.369 12.503  99.805  1.00 29.45  ?  109  VAL A CG2   1 
ATOM   3563 N  N     . THR B 1 111 ? 109.784 8.707   99.699  1.00 30.42  ?  110  THR A N     1 
ATOM   3564 C  CA    . THR B 1 111 ? 110.682 8.104   98.713  1.00 29.96  ?  110  THR A CA    1 
ATOM   3565 C  C     . THR B 1 111 ? 109.907 7.327   97.655  1.00 33.48  ?  110  THR A C     1 
ATOM   3566 O  O     . THR B 1 111 ? 110.240 7.384   96.465  1.00 39.34  ?  110  THR A O     1 
ATOM   3567 C  CB    . THR B 1 111 ? 111.691 7.175   99.396  1.00 34.75  ?  110  THR A CB    1 
ATOM   3568 O  OG1   . THR B 1 111 ? 112.413 7.895   100.399 1.00 33.60  ?  110  THR A OG1   1 
ATOM   3569 C  CG2   . THR B 1 111 ? 112.685 6.601   98.378  1.00 39.62  ?  110  THR A CG2   1 
ATOM   3570 N  N     . ASP B 1 112 ? 108.867 6.602   98.062  1.00 36.86  ?  111  ASP A N     1 
ATOM   3571 C  CA    . ASP B 1 112 ? 108.136 5.728   97.149  1.00 55.74  ?  111  ASP A CA    1 
ATOM   3572 C  C     . ASP B 1 112 ? 106.780 6.301   96.743  1.00 63.47  ?  111  ASP A C     1 
ATOM   3573 O  O     . ASP B 1 112 ? 105.879 5.550   96.353  1.00 60.08  ?  111  ASP A O     1 
ATOM   3574 C  CB    . ASP B 1 112 ? 107.971 4.339   97.770  1.00 63.64  ?  111  ASP A CB    1 
ATOM   3575 C  CG    . ASP B 1 112 ? 109.274 3.555   97.800  1.00 71.62  ?  111  ASP A CG    1 
ATOM   3576 O  OD1   . ASP B 1 112 ? 109.923 3.428   96.737  1.00 73.94  ?  111  ASP A OD1   1 
ATOM   3577 O  OD2   . ASP B 1 112 ? 109.652 3.074   98.891  1.00 73.63  ?  111  ASP A OD2   1 
ATOM   3578 N  N     . SER B 1 113 ? 106.624 7.620   96.793  1.00 58.71  ?  112  SER A N     1 
ATOM   3579 C  CA    . SER B 1 113 ? 105.341 8.254   96.532  1.00 58.28  ?  112  SER A CA    1 
ATOM   3580 C  C     . SER B 1 113 ? 105.107 8.470   95.040  1.00 54.57  ?  112  SER A C     1 
ATOM   3581 O  O     . SER B 1 113 ? 106.014 8.875   94.306  1.00 53.89  ?  112  SER A O     1 
ATOM   3582 C  CB    . SER B 1 113 ? 105.254 9.594   97.261  1.00 56.54  ?  112  SER A CB    1 
ATOM   3583 O  OG    . SER B 1 113 ? 104.101 10.308  96.858  1.00 48.10  ?  112  SER A OG    1 
ATOM   3584 N  N     . VAL B 1 114 ? 103.871 8.212   94.604  1.00 42.04  ?  113  VAL A N     1 
ATOM   3585 C  CA    . VAL B 1 114 ? 103.451 8.503   93.237  1.00 51.13  ?  113  VAL A CA    1 
ATOM   3586 C  C     . VAL B 1 114 ? 102.718 9.832   93.125  1.00 46.23  ?  113  VAL A C     1 
ATOM   3587 O  O     . VAL B 1 114 ? 102.287 10.201  92.025  1.00 51.85  ?  113  VAL A O     1 
ATOM   3588 C  CB    . VAL B 1 114 ? 102.574 7.370   92.661  1.00 56.55  ?  113  VAL A CB    1 
ATOM   3589 C  CG1   . VAL B 1 114 ? 103.396 6.101   92.459  1.00 57.14  ?  113  VAL A CG1   1 
ATOM   3590 C  CG2   . VAL B 1 114 ? 101.390 7.100   93.572  1.00 61.10  ?  113  VAL A CG2   1 
ATOM   3591 N  N     . HIS B 1 115 ? 102.561 10.562  94.226  1.00 38.60  ?  114  HIS A N     1 
ATOM   3592 C  CA    . HIS B 1 115 ? 101.967 11.888  94.164  1.00 38.92  ?  114  HIS A CA    1 
ATOM   3593 C  C     . HIS B 1 115 ? 102.933 12.871  93.516  1.00 42.84  ?  114  HIS A C     1 
ATOM   3594 O  O     . HIS B 1 115 ? 104.154 12.763  93.667  1.00 35.13  ?  114  HIS A O     1 
ATOM   3595 C  CB    . HIS B 1 115 ? 101.609 12.390  95.566  1.00 40.84  ?  114  HIS A CB    1 
ATOM   3596 C  CG    . HIS B 1 115 ? 100.496 11.635  96.222  1.00 54.84  ?  114  HIS A CG    1 
ATOM   3597 N  ND1   . HIS B 1 115 ? 100.688 10.431  96.866  1.00 60.83  ?  114  HIS A ND1   1 
ATOM   3598 C  CD2   . HIS B 1 115 ? 99.178  11.922  96.345  1.00 59.69  ?  114  HIS A CD2   1 
ATOM   3599 C  CE1   . HIS B 1 115 ? 99.536  10.004  97.349  1.00 64.87  ?  114  HIS A CE1   1 
ATOM   3600 N  NE2   . HIS B 1 115 ? 98.603  10.891  97.048  1.00 66.14  ?  114  HIS A NE2   1 
ATOM   3601 N  N     . CYS B 1 116 ? 102.368 13.849  92.803  1.00 39.93  ?  115  CYS A N     1 
ATOM   3602 C  CA    . CYS B 1 116 ? 103.142 14.944  92.219  1.00 35.68  ?  115  CYS A CA    1 
ATOM   3603 C  C     . CYS B 1 116 ? 104.343 14.422  91.433  1.00 37.46  ?  115  CYS A C     1 
ATOM   3604 O  O     . CYS B 1 116 ? 105.447 14.966  91.510  1.00 41.57  ?  115  CYS A O     1 
ATOM   3605 C  CB    . CYS B 1 116 ? 103.587 15.929  93.304  1.00 39.72  ?  115  CYS A CB    1 
ATOM   3606 S  SG    . CYS B 1 116 ? 102.240 16.521  94.361  1.00 44.06  ?  115  CYS A SG    1 
ATOM   3607 N  N     . HIS B 1 117 ? 104.128 13.331  90.695  1.00 40.18  ?  116  HIS A N     1 
ATOM   3608 C  CA    . HIS B 1 117 ? 105.183 12.674  89.919  1.00 37.66  ?  116  HIS A CA    1 
ATOM   3609 C  C     . HIS B 1 117 ? 106.430 12.415  90.761  1.00 40.66  ?  116  HIS A C     1 
ATOM   3610 O  O     . HIS B 1 117 ? 107.557 12.472  90.261  1.00 44.37  ?  116  HIS A O     1 
ATOM   3611 C  CB    . HIS B 1 117 ? 105.521 13.488  88.667  1.00 52.82  ?  116  HIS A CB    1 
ATOM   3612 C  CG    . HIS B 1 117 ? 104.332 13.771  87.804  1.00 56.04  ?  116  HIS A CG    1 
ATOM   3613 N  ND1   . HIS B 1 117 ? 104.025 13.021  86.688  1.00 63.81  ?  116  HIS A ND1   1 
ATOM   3614 C  CD2   . HIS B 1 117 ? 103.356 14.704  87.910  1.00 47.85  ?  116  HIS A CD2   1 
ATOM   3615 C  CE1   . HIS B 1 117 ? 102.918 13.488  86.139  1.00 58.71  ?  116  HIS A CE1   1 
ATOM   3616 N  NE2   . HIS B 1 117 ? 102.492 14.508  86.861  1.00 56.01  ?  116  HIS A NE2   1 
ATOM   3617 N  N     . GLY B 1 118 ? 106.232 12.127  92.049  1.00 34.67  ?  117  GLY A N     1 
ATOM   3618 C  CA    . GLY B 1 118 ? 107.330 11.812  92.935  1.00 39.05  ?  117  GLY A CA    1 
ATOM   3619 C  C     . GLY B 1 118 ? 108.166 12.986  93.383  1.00 44.67  ?  117  GLY A C     1 
ATOM   3620 O  O     . GLY B 1 118 ? 109.239 12.773  93.954  1.00 40.84  ?  117  GLY A O     1 
ATOM   3621 N  N     . SER B 1 119 ? 107.718 14.220  93.150  1.00 46.92  ?  118  SER A N     1 
ATOM   3622 C  CA    . SER B 1 119 ? 108.469 15.399  93.583  1.00 36.29  ?  118  SER A CA    1 
ATOM   3623 C  C     . SER B 1 119 ? 108.177 15.672  95.050  1.00 34.99  ?  118  SER A C     1 
ATOM   3624 O  O     . SER B 1 119 ? 107.060 16.057  95.408  1.00 34.77  ?  118  SER A O     1 
ATOM   3625 C  CB    . SER B 1 119 ? 108.114 16.618  92.736  1.00 31.86  ?  118  SER A CB    1 
ATOM   3626 O  OG    . SER B 1 119 ? 108.502 17.805  93.417  1.00 35.27  ?  118  SER A OG    1 
ATOM   3627 N  N     . ALA B 1 120 ? 109.182 15.482  95.909  1.00 29.58  ?  119  ALA A N     1 
ATOM   3628 C  CA    . ALA B 1 120 ? 109.011 15.842  97.307  1.00 29.88  ?  119  ALA A CA    1 
ATOM   3629 C  C     . ALA B 1 120 ? 108.817 17.345  97.468  1.00 31.15  ?  119  ALA A C     1 
ATOM   3630 O  O     . ALA B 1 120 ? 108.170 17.783  98.421  1.00 28.99  ?  119  ALA A O     1 
ATOM   3631 C  CB    . ALA B 1 120 ? 110.209 15.366  98.123  1.00 30.50  ?  119  ALA A CB    1 
ATOM   3632 N  N     . THR B 1 121 ? 109.354 18.141  96.544  1.00 30.45  ?  120  THR A N     1 
ATOM   3633 C  CA    . THR B 1 121 ? 109.132 19.585  96.597  1.00 33.33  ?  120  THR A CA    1 
ATOM   3634 C  C     . THR B 1 121 ? 107.658 19.914  96.419  1.00 33.91  ?  120  THR A C     1 
ATOM   3635 O  O     . THR B 1 121 ? 107.086 20.705  97.180  1.00 32.18  ?  120  THR A O     1 
ATOM   3636 C  CB    . THR B 1 121 ? 109.953 20.307  95.523  1.00 34.94  ?  120  THR A CB    1 
ATOM   3637 O  OG1   . THR B 1 121 ? 111.347 20.089  95.747  1.00 35.58  ?  120  THR A OG1   1 
ATOM   3638 C  CG2   . THR B 1 121 ? 109.672 21.818  95.564  1.00 34.62  ?  120  THR A CG2   1 
ATOM   3639 N  N     . LEU B 1 122 ? 107.027 19.327  95.402  1.00 30.04  ?  121  LEU A N     1 
ATOM   3640 C  CA    . LEU B 1 122 ? 105.626 19.646  95.153  1.00 32.10  ?  121  LEU A CA    1 
ATOM   3641 C  C     . LEU B 1 122 ? 104.721 19.017  96.203  1.00 34.44  ?  121  LEU A C     1 
ATOM   3642 O  O     . LEU B 1 122 ? 103.702 19.610  96.571  1.00 33.46  ?  121  LEU A O     1 
ATOM   3643 C  CB    . LEU B 1 122 ? 105.226 19.203  93.748  1.00 31.78  ?  121  LEU A CB    1 
ATOM   3644 C  CG    . LEU B 1 122 ? 105.904 19.977  92.613  1.00 40.01  ?  121  LEU A CG    1 
ATOM   3645 C  CD1   . LEU B 1 122 ? 105.605 19.319  91.293  1.00 38.67  ?  121  LEU A CD1   1 
ATOM   3646 C  CD2   . LEU B 1 122 ? 105.474 21.454  92.577  1.00 36.39  ?  121  LEU A CD2   1 
ATOM   3647 N  N     . ILE B 1 123 ? 105.073 17.826  96.698  1.00 29.89  ?  122  ILE A N     1 
ATOM   3648 C  CA    . ILE B 1 123 ? 104.308 17.226  97.788  1.00 28.14  ?  122  ILE A CA    1 
ATOM   3649 C  C     . ILE B 1 123 ? 104.317 18.143  99.006  1.00 35.49  ?  122  ILE A C     1 
ATOM   3650 O  O     . ILE B 1 123 ? 103.281 18.377  99.643  1.00 28.99  ?  122  ILE A O     1 
ATOM   3651 C  CB    . ILE B 1 123 ? 104.861 15.828  98.133  1.00 28.02  ?  122  ILE A CB    1 
ATOM   3652 C  CG1   . ILE B 1 123 ? 104.564 14.834  97.000  1.00 31.59  ?  122  ILE A CG1   1 
ATOM   3653 C  CG2   . ILE B 1 123 ? 104.288 15.352  99.469  1.00 30.65  ?  122  ILE A CG2   1 
ATOM   3654 C  CD1   . ILE B 1 123 ? 105.352 13.511  97.103  1.00 31.94  ?  122  ILE A CD1   1 
ATOM   3655 N  N     . ALA B 1 124 ? 105.489 18.685  99.350  1.00 29.70  ?  123  ALA A N     1 
ATOM   3656 C  CA    . ALA B 1 124 ? 105.553 19.553  100.520 1.00 28.28  ?  123  ALA A CA    1 
ATOM   3657 C  C     . ALA B 1 124 ? 104.731 20.824  100.307 1.00 25.82  ?  123  ALA A C     1 
ATOM   3658 O  O     . ALA B 1 124 ? 104.058 21.296  101.232 1.00 32.61  ?  123  ALA A O     1 
ATOM   3659 C  CB    . ALA B 1 124 ? 107.012 19.878  100.860 1.00 26.91  ?  123  ALA A CB    1 
ATOM   3660 N  N     . GLN B 1 125 ? 104.734 21.370  99.086  1.00 28.95  ?  124  GLN A N     1 
ATOM   3661 C  CA    . GLN B 1 125 ? 103.895 22.538  98.809  1.00 32.47  ?  124  GLN A CA    1 
ATOM   3662 C  C     . GLN B 1 125 ? 102.412 22.197  98.913  1.00 32.14  ?  124  GLN A C     1 
ATOM   3663 O  O     . GLN B 1 125 ? 101.625 22.985  99.453  1.00 33.56  ?  124  GLN A O     1 
ATOM   3664 C  CB    . GLN B 1 125 ? 104.203 23.118  97.425  1.00 37.48  ?  124  GLN A CB    1 
ATOM   3665 C  CG    . GLN B 1 125 ? 105.475 23.952  97.338  1.00 62.15  ?  124  GLN A CG    1 
ATOM   3666 C  CD    . GLN B 1 125 ? 105.352 25.322  98.002  1.00 74.21  ?  124  GLN A CD    1 
ATOM   3667 O  OE1   . GLN B 1 125 ? 104.352 25.629  98.656  1.00 82.76  ?  124  GLN A OE1   1 
ATOM   3668 N  NE2   . GLN B 1 125 ? 106.377 26.153  97.827  1.00 73.03  ?  124  GLN A NE2   1 
ATOM   3669 N  N     . GLU B 1 126 ? 102.008 21.031  98.395  1.00 32.97  ?  125  GLU A N     1 
ATOM   3670 C  CA    . GLU B 1 126 ? 100.597 20.660  98.448  1.00 34.47  ?  125  GLU A CA    1 
ATOM   3671 C  C     . GLU B 1 126 ? 100.140 20.469  99.885  1.00 29.90  ?  125  GLU A C     1 
ATOM   3672 O  O     . GLU B 1 126 ? 99.022  20.856  100.248 1.00 33.72  ?  125  GLU A O     1 
ATOM   3673 C  CB    . GLU B 1 126 ? 100.330 19.383  97.639  1.00 29.82  ?  125  GLU A CB    1 
ATOM   3674 C  CG    . GLU B 1 126 ? 100.333 19.574  96.143  1.00 36.58  ?  125  GLU A CG    1 
ATOM   3675 C  CD    . GLU B 1 126 ? 99.563  18.489  95.410  1.00 46.47  ?  125  GLU A CD    1 
ATOM   3676 O  OE1   . GLU B 1 126 ? 98.955  17.612  96.067  1.00 46.13  ?  125  GLU A OE1   1 
ATOM   3677 O  OE2   . GLU B 1 126 ? 99.568  18.516  94.168  1.00 50.88  ?  125  GLU A OE2   1 
ATOM   3678 N  N     . ILE B 1 127 ? 100.991 19.873  100.720 1.00 27.51  ?  126  ILE A N     1 
ATOM   3679 C  CA    . ILE B 1 127 ? 100.626 19.672  102.116 1.00 28.76  ?  126  ILE A CA    1 
ATOM   3680 C  C     . ILE B 1 127 ? 100.451 21.014  102.807 1.00 28.91  ?  126  ILE A C     1 
ATOM   3681 O  O     . ILE B 1 127 ? 99.451  21.255  103.493 1.00 31.10  ?  126  ILE A O     1 
ATOM   3682 C  CB    . ILE B 1 127 ? 101.676 18.803  102.824 1.00 29.22  ?  126  ILE A CB    1 
ATOM   3683 C  CG1   . ILE B 1 127 ? 101.627 17.381  102.263 1.00 30.51  ?  126  ILE A CG1   1 
ATOM   3684 C  CG2   . ILE B 1 127 ? 101.443 18.821  104.320 1.00 28.21  ?  126  ILE A CG2   1 
ATOM   3685 C  CD1   . ILE B 1 127 ? 102.768 16.504  102.736 1.00 27.83  ?  126  ILE A CD1   1 
ATOM   3686 N  N     . ARG B 1 128 ? 101.423 21.907  102.632 1.00 30.01  ?  127  ARG A N     1 
ATOM   3687 C  CA    . ARG B 1 128 ? 101.330 23.229  103.245 1.00 27.26  ?  127  ARG A CA    1 
ATOM   3688 C  C     . ARG B 1 128 ? 100.079 23.964  102.780 1.00 32.77  ?  127  ARG A C     1 
ATOM   3689 O  O     . ARG B 1 128 ? 99.371  24.581  103.588 1.00 28.87  ?  127  ARG A O     1 
ATOM   3690 C  CB    . ARG B 1 128 ? 102.578 24.049  102.920 1.00 29.73  ?  127  ARG A CB    1 
ATOM   3691 C  CG    . ARG B 1 128 ? 103.861 23.514  103.562 1.00 26.39  ?  127  ARG A CG    1 
ATOM   3692 C  CD    . ARG B 1 128 ? 104.949 24.586  103.656 1.00 34.64  ?  127  ARG A CD    1 
ATOM   3693 N  NE    . ARG B 1 128 ? 105.275 25.234  102.389 1.00 45.58  ?  127  ARG A NE    1 
ATOM   3694 C  CZ    . ARG B 1 128 ? 104.945 26.480  102.056 1.00 41.06  ?  127  ARG A CZ    1 
ATOM   3695 N  NH1   . ARG B 1 128 ? 104.260 27.256  102.881 1.00 40.15  ?  127  ARG A NH1   1 
ATOM   3696 N  NH2   . ARG B 1 128 ? 105.307 26.956  100.880 1.00 45.94  ?  127  ARG A NH2   1 
ATOM   3697 N  N     . GLN B 1 129 ? 99.798  23.916  101.478 1.00 28.47  ?  128  GLN A N     1 
ATOM   3698 C  CA    . GLN B 1 129 ? 98.609  24.582  100.949 1.00 28.29  ?  128  GLN A CA    1 
ATOM   3699 C  C     . GLN B 1 129 ? 97.326  23.937  101.465 1.00 38.14  ?  128  GLN A C     1 
ATOM   3700 O  O     . GLN B 1 129 ? 96.349  24.635  101.769 1.00 32.93  ?  128  GLN A O     1 
ATOM   3701 C  CB    . GLN B 1 129 ? 98.631  24.551  99.421  1.00 31.39  ?  128  GLN A CB    1 
ATOM   3702 C  CG    . GLN B 1 129 ? 97.459  25.290  98.765  1.00 40.30  ?  128  GLN A CG    1 
ATOM   3703 C  CD    . GLN B 1 129 ? 97.497  26.800  98.997  1.00 44.38  ?  128  GLN A CD    1 
ATOM   3704 O  OE1   . GLN B 1 129 ? 96.572  27.374  99.576  1.00 49.35  ?  128  GLN A OE1   1 
ATOM   3705 N  NE2   . GLN B 1 129 ? 98.564  27.446  98.538  1.00 36.36  ?  128  GLN A NE2   1 
ATOM   3706 N  N     . THR B 1 130 ? 97.289  22.604  101.542 1.00 28.60  ?  129  THR A N     1 
ATOM   3707 C  CA    . THR B 1 130 ? 96.110  21.945  102.102 1.00 33.53  ?  129  THR A CA    1 
ATOM   3708 C  C     . THR B 1 130 ? 95.901  22.333  103.565 1.00 36.81  ?  129  THR A C     1 
ATOM   3709 O  O     . THR B 1 130 ? 94.771  22.605  103.988 1.00 37.65  ?  129  THR A O     1 
ATOM   3710 C  CB    . THR B 1 130 ? 96.226  20.424  101.977 1.00 33.70  ?  129  THR A CB    1 
ATOM   3711 O  OG1   . THR B 1 130 ? 96.406  20.070  100.602 1.00 38.96  ?  129  THR A OG1   1 
ATOM   3712 C  CG2   . THR B 1 130 ? 94.962  19.756  102.510 1.00 33.06  ?  129  THR A CG2   1 
ATOM   3713 N  N     . ILE B 1 131 ? 96.977  22.362  104.355 1.00 34.57  ?  130  ILE A N     1 
ATOM   3714 C  CA    . ILE B 1 131 ? 96.840  22.754  105.757 1.00 26.99  ?  130  ILE A CA    1 
ATOM   3715 C  C     . ILE B 1 131 ? 96.248  24.153  105.859 1.00 30.15  ?  130  ILE A C     1 
ATOM   3716 O  O     . ILE B 1 131 ? 95.337  24.402  106.660 1.00 33.56  ?  130  ILE A O     1 
ATOM   3717 C  CB    . ILE B 1 131 ? 98.198  22.660  106.472 1.00 25.86  ?  130  ILE A CB    1 
ATOM   3718 C  CG1   . ILE B 1 131 ? 98.588  21.186  106.643 1.00 31.32  ?  130  ILE A CG1   1 
ATOM   3719 C  CG2   . ILE B 1 131 ? 98.159  23.406  107.801 1.00 26.76  ?  130  ILE A CG2   1 
ATOM   3720 C  CD1   . ILE B 1 131 ? 100.034 21.001  107.086 1.00 35.42  ?  130  ILE A CD1   1 
ATOM   3721 N  N     . PHE B 1 132 ? 96.728  25.076  105.027 1.00 30.39  ?  131  PHE A N     1 
ATOM   3722 C  CA    . PHE B 1 132 ? 96.220  26.445  105.078 1.00 35.84  ?  131  PHE A CA    1 
ATOM   3723 C  C     . PHE B 1 132 ? 94.771  26.516  104.620 1.00 33.84  ?  131  PHE A C     1 
ATOM   3724 O  O     . PHE B 1 132 ? 93.967  27.244  105.210 1.00 34.57  ?  131  PHE A O     1 
ATOM   3725 C  CB    . PHE B 1 132 ? 97.088  27.364  104.226 1.00 36.94  ?  131  PHE A CB    1 
ATOM   3726 C  CG    . PHE B 1 132 ? 96.620  28.791  104.211 1.00 37.40  ?  131  PHE A CG    1 
ATOM   3727 C  CD1   . PHE B 1 132 ? 96.646  29.549  105.369 1.00 31.81  ?  131  PHE A CD1   1 
ATOM   3728 C  CD2   . PHE B 1 132 ? 96.160  29.375  103.042 1.00 37.27  ?  131  PHE A CD2   1 
ATOM   3729 C  CE1   . PHE B 1 132 ? 96.221  30.869  105.365 1.00 42.49  ?  131  PHE A CE1   1 
ATOM   3730 C  CE2   . PHE B 1 132 ? 95.737  30.693  103.031 1.00 45.73  ?  131  PHE A CE2   1 
ATOM   3731 C  CZ    . PHE B 1 132 ? 95.760  31.436  104.195 1.00 40.65  ?  131  PHE A CZ    1 
ATOM   3732 N  N     . ASN B 1 133 ? 94.421  25.778  103.565 1.00 33.15  ?  132  ASN A N     1 
ATOM   3733 C  CA    . ASN B 1 133 ? 93.044  25.812  103.076 1.00 35.82  ?  132  ASN A CA    1 
ATOM   3734 C  C     . ASN B 1 133 ? 92.072  25.215  104.093 1.00 40.65  ?  132  ASN A C     1 
ATOM   3735 O  O     . ASN B 1 133 ? 90.946  25.703  104.238 1.00 42.96  ?  132  ASN A O     1 
ATOM   3736 C  CB    . ASN B 1 133 ? 92.927  25.065  101.743 1.00 35.05  ?  132  ASN A CB    1 
ATOM   3737 C  CG    . ASN B 1 133 ? 93.560  25.821  100.578 1.00 42.85  ?  132  ASN A CG    1 
ATOM   3738 O  OD1   . ASN B 1 133 ? 93.771  27.029  100.640 1.00 44.09  ?  132  ASN A OD1   1 
ATOM   3739 N  ND2   . ASN B 1 133 ? 93.848  25.101  99.498  1.00 42.24  ?  132  ASN A ND2   1 
ATOM   3740 N  N     . GLU B 1 134 ? 92.479  24.163  104.807 1.00 34.69  ?  133  GLU A N     1 
ATOM   3741 C  CA    . GLU B 1 134 ? 91.538  23.443  105.660 1.00 32.45  ?  133  GLU A CA    1 
ATOM   3742 C  C     . GLU B 1 134 ? 91.568  23.896  107.113 1.00 36.44  ?  133  GLU A C     1 
ATOM   3743 O  O     . GLU B 1 134 ? 90.542  23.806  107.797 1.00 42.95  ?  133  GLU A O     1 
ATOM   3744 C  CB    . GLU B 1 134 ? 91.796  21.930  105.582 1.00 34.43  ?  133  GLU A CB    1 
ATOM   3745 C  CG    . GLU B 1 134 ? 91.524  21.369  104.189 1.00 33.97  ?  133  GLU A CG    1 
ATOM   3746 C  CD    . GLU B 1 134 ? 91.522  19.858  104.116 1.00 42.73  ?  133  GLU A CD    1 
ATOM   3747 O  OE1   . GLU B 1 134 ? 91.533  19.191  105.175 1.00 35.16  ?  133  GLU A OE1   1 
ATOM   3748 O  OE2   . GLU B 1 134 ? 91.489  19.335  102.982 1.00 38.92  ?  133  GLU A OE2   1 
ATOM   3749 N  N     . LEU B 1 135 ? 92.709  24.385  107.604 1.00 32.17  ?  134  LEU A N     1 
ATOM   3750 C  CA    . LEU B 1 135 ? 92.821  24.833  108.983 1.00 29.35  ?  134  LEU A CA    1 
ATOM   3751 C  C     . LEU B 1 135 ? 93.005  26.334  109.128 1.00 29.39  ?  134  LEU A C     1 
ATOM   3752 O  O     . LEU B 1 135 ? 92.939  26.832  110.258 1.00 32.03  ?  134  LEU A O     1 
ATOM   3753 C  CB    . LEU B 1 135 ? 93.998  24.144  109.691 1.00 28.49  ?  134  LEU A CB    1 
ATOM   3754 C  CG    . LEU B 1 135 ? 93.932  22.624  109.882 1.00 35.91  ?  134  LEU A CG    1 
ATOM   3755 C  CD1   . LEU B 1 135 ? 94.446  21.896  108.661 1.00 34.34  ?  134  LEU A CD1   1 
ATOM   3756 C  CD2   . LEU B 1 135 ? 94.715  22.207  111.118 1.00 38.75  ?  134  LEU A CD2   1 
ATOM   3757 N  N     . GLN B 1 136 ? 93.263  27.057  108.033 1.00 30.60  ?  135  GLN A N     1 
ATOM   3758 C  CA    . GLN B 1 136 ? 93.572  28.488  108.085 1.00 37.52  ?  135  GLN A CA    1 
ATOM   3759 C  C     . GLN B 1 136 ? 94.779  28.752  108.982 1.00 42.16  ?  135  GLN A C     1 
ATOM   3760 O  O     . GLN B 1 136 ? 94.833  29.741  109.717 1.00 31.17  ?  135  GLN A O     1 
ATOM   3761 C  CB    . GLN B 1 136 ? 92.360  29.304  108.539 1.00 47.58  ?  135  GLN A CB    1 
ATOM   3762 C  CG    . GLN B 1 136 ? 91.124  29.098  107.679 1.00 55.81  ?  135  GLN A CG    1 
ATOM   3763 C  CD    . GLN B 1 136 ? 90.221  30.319  107.676 1.00 77.75  ?  135  GLN A CD    1 
ATOM   3764 O  OE1   . GLN B 1 136 ? 90.650  31.423  107.326 1.00 77.77  ?  135  GLN A OE1   1 
ATOM   3765 N  NE2   . GLN B 1 136 ? 88.969  30.132  108.078 1.00 85.01  ?  135  GLN A NE2   1 
ATOM   3766 N  N     . LEU B 1 137 ? 95.743  27.836  108.934 1.00 37.82  ?  136  LEU A N     1 
ATOM   3767 C  CA    . LEU B 1 137 ? 97.013  27.948  109.632 1.00 29.25  ?  136  LEU A CA    1 
ATOM   3768 C  C     . LEU B 1 137 ? 98.122  27.669  108.631 1.00 32.63  ?  136  LEU A C     1 
ATOM   3769 O  O     . LEU B 1 137 ? 97.948  26.873  107.703 1.00 34.31  ?  136  LEU A O     1 
ATOM   3770 C  CB    . LEU B 1 137 ? 97.117  26.942  110.800 1.00 30.28  ?  136  LEU A CB    1 
ATOM   3771 C  CG    . LEU B 1 137 ? 96.039  26.958  111.880 1.00 31.32  ?  136  LEU A CG    1 
ATOM   3772 C  CD1   . LEU B 1 137 ? 96.185  25.760  112.793 1.00 28.04  ?  136  LEU A CD1   1 
ATOM   3773 C  CD2   . LEU B 1 137 ? 96.088  28.268  112.672 1.00 32.04  ?  136  LEU A CD2   1 
ATOM   3774 N  N     . THR B 1 138 ? 99.275  28.294  108.832 1.00 27.78  ?  137  THR A N     1 
ATOM   3775 C  CA    . THR B 1 138 ? 100.387 28.066  107.924 1.00 32.08  ?  137  THR A CA    1 
ATOM   3776 C  C     . THR B 1 138 ? 101.414 27.128  108.544 1.00 29.63  ?  137  THR A C     1 
ATOM   3777 O  O     . THR B 1 138 ? 101.565 27.037  109.767 1.00 28.62  ?  137  THR A O     1 
ATOM   3778 C  CB    . THR B 1 138 ? 101.067 29.374  107.502 1.00 36.78  ?  137  THR A CB    1 
ATOM   3779 O  OG1   . THR B 1 138 ? 101.701 29.988  108.629 1.00 30.69  ?  137  THR A OG1   1 
ATOM   3780 C  CG2   . THR B 1 138 ? 100.050 30.326  106.879 1.00 32.64  ?  137  THR A CG2   1 
ATOM   3781 N  N     . ALA B 1 139 ? 102.107 26.417  107.669 1.00 27.67  ?  138  ALA A N     1 
ATOM   3782 C  CA    . ALA B 1 139 ? 103.169 25.504  108.043 1.00 24.83  ?  138  ALA A CA    1 
ATOM   3783 C  C     . ALA B 1 139 ? 104.389 25.808  107.189 1.00 27.42  ?  138  ALA A C     1 
ATOM   3784 O  O     . ALA B 1 139 ? 104.275 26.364  106.092 1.00 27.28  ?  138  ALA A O     1 
ATOM   3785 C  CB    . ALA B 1 139 ? 102.737 24.037  107.843 1.00 25.20  ?  138  ALA A CB    1 
ATOM   3786 N  N     . SER B 1 140 ? 105.561 25.471  107.715 1.00 25.84  ?  139  SER A N     1 
ATOM   3787 C  CA    . SER B 1 140 ? 106.783 25.463  106.927 1.00 22.84  ?  139  SER A CA    1 
ATOM   3788 C  C     . SER B 1 140 ? 107.228 24.019  106.738 1.00 24.71  ?  139  SER A C     1 
ATOM   3789 O  O     . SER B 1 140 ? 106.765 23.115  107.436 1.00 25.92  ?  139  SER A O     1 
ATOM   3790 C  CB    . SER B 1 140 ? 107.879 26.294  107.597 1.00 26.07  ?  139  SER A CB    1 
ATOM   3791 O  OG    . SER B 1 140 ? 107.434 27.643  107.724 1.00 25.08  ?  139  SER A OG    1 
ATOM   3792 N  N     . ALA B 1 141 ? 108.111 23.797  105.768 1.00 22.24  ?  140  ALA A N     1 
ATOM   3793 C  CA    . ALA B 1 141 ? 108.529 22.432  105.473 1.00 22.16  ?  140  ALA A CA    1 
ATOM   3794 C  C     . ALA B 1 141 ? 109.971 22.413  104.990 1.00 28.05  ?  140  ALA A C     1 
ATOM   3795 O  O     . ALA B 1 141 ? 110.470 23.382  104.412 1.00 26.63  ?  140  ALA A O     1 
ATOM   3796 C  CB    . ALA B 1 141 ? 107.612 21.785  104.423 1.00 25.41  ?  140  ALA A CB    1 
ATOM   3797 N  N     . GLY B 1 142 ? 110.627 21.292  105.226 1.00 26.00  ?  141  GLY A N     1 
ATOM   3798 C  CA    . GLY B 1 142 ? 111.975 21.076  104.732 1.00 22.91  ?  141  GLY A CA    1 
ATOM   3799 C  C     . GLY B 1 142 ? 112.048 19.741  104.026 1.00 30.49  ?  141  GLY A C     1 
ATOM   3800 O  O     . GLY B 1 142 ? 111.398 18.776  104.430 1.00 25.40  ?  141  GLY A O     1 
ATOM   3801 N  N     . VAL B 1 143 ? 112.842 19.696  102.963 1.00 23.07  ?  142  VAL A N     1 
ATOM   3802 C  CA    . VAL B 1 143 ? 112.987 18.494  102.148 1.00 23.65  ?  142  VAL A CA    1 
ATOM   3803 C  C     . VAL B 1 143 ? 114.467 18.165  102.051 1.00 24.14  ?  142  VAL A C     1 
ATOM   3804 O  O     . VAL B 1 143 ? 115.265 19.029  101.678 1.00 28.69  ?  142  VAL A O     1 
ATOM   3805 C  CB    . VAL B 1 143 ? 112.397 18.705  100.740 1.00 28.76  ?  142  VAL A CB    1 
ATOM   3806 C  CG1   . VAL B 1 143 ? 112.546 17.429  99.896  1.00 28.45  ?  142  VAL A CG1   1 
ATOM   3807 C  CG2   . VAL B 1 143 ? 110.937 19.156  100.834 1.00 26.20  ?  142  VAL A CG2   1 
ATOM   3808 N  N     . ALA B 1 144 ? 114.841 16.927  102.367 1.00 24.35  ?  143  ALA A N     1 
ATOM   3809 C  CA    . ALA B 1 144 ? 116.256 16.575  102.393 1.00 25.43  ?  143  ALA A CA    1 
ATOM   3810 C  C     . ALA B 1 144 ? 116.386 15.056  102.278 1.00 28.79  ?  143  ALA A C     1 
ATOM   3811 O  O     . ALA B 1 144 ? 115.388 14.329  102.384 1.00 28.05  ?  143  ALA A O     1 
ATOM   3812 C  CB    . ALA B 1 144 ? 116.928 17.096  103.673 1.00 25.97  ?  143  ALA A CB    1 
ATOM   3813 N  N     . PRO B 1 145 ? 117.601 14.544  102.023 1.00 27.71  ?  144  PRO A N     1 
ATOM   3814 C  CA    . PRO B 1 145 ? 117.774 13.087  101.892 1.00 27.17  ?  144  PRO A CA    1 
ATOM   3815 C  C     . PRO B 1 145 ? 117.773 12.335  103.210 1.00 26.57  ?  144  PRO A C     1 
ATOM   3816 O  O     . PRO B 1 145 ? 117.712 11.098  103.185 1.00 26.42  ?  144  PRO A O     1 
ATOM   3817 C  CB    . PRO B 1 145 ? 119.143 12.951  101.197 1.00 27.67  ?  144  PRO A CB    1 
ATOM   3818 C  CG    . PRO B 1 145 ? 119.461 14.317  100.662 1.00 28.39  ?  144  PRO A CG    1 
ATOM   3819 C  CD    . PRO B 1 145 ? 118.816 15.267  101.603 1.00 28.33  ?  144  PRO A CD    1 
ATOM   3820 N  N     . VAL B 1 146 ? 117.861 13.025  104.348 1.00 24.16  ?  145  VAL A N     1 
ATOM   3821 C  CA    . VAL B 1 146 ? 117.904 12.411  105.669 1.00 23.72  ?  145  VAL A CA    1 
ATOM   3822 C  C     . VAL B 1 146 ? 117.119 13.282  106.645 1.00 25.93  ?  145  VAL A C     1 
ATOM   3823 O  O     . VAL B 1 146 ? 116.857 14.465  106.389 1.00 23.75  ?  145  VAL A O     1 
ATOM   3824 C  CB    . VAL B 1 146 ? 119.356 12.203  106.187 1.00 25.16  ?  145  VAL A CB    1 
ATOM   3825 C  CG1   . VAL B 1 146 ? 120.219 11.391  105.188 1.00 24.92  ?  145  VAL A CG1   1 
ATOM   3826 C  CG2   . VAL B 1 146 ? 119.999 13.541  106.475 1.00 27.17  ?  145  VAL A CG2   1 
ATOM   3827 N  N     . LYS B 1 147 ? 116.780 12.684  107.798 1.00 24.90  ?  146  LYS A N     1 
ATOM   3828 C  CA    . LYS B 1 147 ? 115.925 13.344  108.786 1.00 23.35  ?  146  LYS A CA    1 
ATOM   3829 C  C     . LYS B 1 147 ? 116.483 14.684  109.243 1.00 22.81  ?  146  LYS A C     1 
ATOM   3830 O  O     . LYS B 1 147 ? 115.780 15.699  109.196 1.00 22.12  ?  146  LYS A O     1 
ATOM   3831 C  CB    . LYS B 1 147 ? 115.720 12.456  110.009 1.00 23.38  ?  146  LYS A CB    1 
ATOM   3832 C  CG    . LYS B 1 147 ? 114.651 11.400  109.837 1.00 23.07  ?  146  LYS A CG    1 
ATOM   3833 C  CD    . LYS B 1 147 ? 114.481 10.645  111.160 1.00 22.70  ?  146  LYS A CD    1 
ATOM   3834 C  CE    . LYS B 1 147 ? 113.281 9.729   111.096 1.00 22.84  ?  146  LYS A CE    1 
ATOM   3835 N  NZ    . LYS B 1 147 ? 113.115 9.039   112.431 1.00 25.97  ?  146  LYS A NZ    1 
ATOM   3836 N  N     . PHE B 1 148 ? 117.719 14.704  109.771 1.00 21.46  ?  147  PHE A N     1 
ATOM   3837 C  CA    . PHE B 1 148 ? 118.125 15.907  110.508 1.00 21.56  ?  147  PHE A CA    1 
ATOM   3838 C  C     . PHE B 1 148 ? 118.238 17.109  109.578 1.00 22.92  ?  147  PHE A C     1 
ATOM   3839 O  O     . PHE B 1 148 ? 117.918 18.245  109.974 1.00 20.83  ?  147  PHE A O     1 
ATOM   3840 C  CB    . PHE B 1 148 ? 119.424 15.657  111.295 1.00 21.23  ?  147  PHE A CB    1 
ATOM   3841 C  CG    . PHE B 1 148 ? 120.703 15.845  110.513 1.00 23.56  ?  147  PHE A CG    1 
ATOM   3842 C  CD1   . PHE B 1 148 ? 121.193 14.845  109.691 1.00 25.03  ?  147  PHE A CD1   1 
ATOM   3843 C  CD2   . PHE B 1 148 ? 121.454 17.008  110.662 1.00 25.54  ?  147  PHE A CD2   1 
ATOM   3844 C  CE1   . PHE B 1 148 ? 122.389 15.005  108.995 1.00 24.54  ?  147  PHE A CE1   1 
ATOM   3845 C  CE2   . PHE B 1 148 ? 122.647 17.187  109.970 1.00 23.13  ?  147  PHE A CE2   1 
ATOM   3846 C  CZ    . PHE B 1 148 ? 123.122 16.185  109.132 1.00 22.96  ?  147  PHE A CZ    1 
ATOM   3847 N  N     . LEU B 1 149 ? 118.620 16.882  108.328 1.00 23.08  ?  148  LEU A N     1 
ATOM   3848 C  CA    . LEU B 1 149 ? 118.670 17.998  107.384 1.00 21.87  ?  148  LEU A CA    1 
ATOM   3849 C  C     . LEU B 1 149 ? 117.276 18.451  106.954 1.00 25.90  ?  148  LEU A C     1 
ATOM   3850 O  O     . LEU B 1 149 ? 117.070 19.638  106.671 1.00 24.31  ?  148  LEU A O     1 
ATOM   3851 C  CB    . LEU B 1 149 ? 119.498 17.610  106.162 1.00 22.64  ?  148  LEU A CB    1 
ATOM   3852 C  CG    . LEU B 1 149 ? 120.990 17.436  106.401 1.00 24.33  ?  148  LEU A CG    1 
ATOM   3853 C  CD1   . LEU B 1 149 ? 121.680 16.954  105.108 1.00 27.76  ?  148  LEU A CD1   1 
ATOM   3854 C  CD2   . LEU B 1 149 ? 121.609 18.742  106.897 1.00 23.73  ?  148  LEU A CD2   1 
ATOM   3855 N  N     . ALA B 1 150 ? 116.306 17.543  106.876 1.00 24.05  ?  149  ALA A N     1 
ATOM   3856 C  CA    . ALA B 1 150 ? 114.956 17.996  106.548 1.00 21.58  ?  149  ALA A CA    1 
ATOM   3857 C  C     . ALA B 1 150 ? 114.404 18.861  107.663 1.00 25.73  ?  149  ALA A C     1 
ATOM   3858 O  O     . ALA B 1 150 ? 113.736 19.869  107.405 1.00 25.86  ?  149  ALA A O     1 
ATOM   3859 C  CB    . ALA B 1 150 ? 114.028 16.810  106.293 1.00 21.80  ?  149  ALA A CB    1 
ATOM   3860 N  N     . LYS B 1 151 ? 114.694 18.491  108.914 1.00 22.69  ?  150  LYS A N     1 
ATOM   3861 C  CA    . LYS B 1 151 ? 114.236 19.298  110.040 1.00 21.39  ?  150  LYS A CA    1 
ATOM   3862 C  C     . LYS B 1 151 ? 114.906 20.663  110.060 1.00 26.19  ?  150  LYS A C     1 
ATOM   3863 O  O     . LYS B 1 151 ? 114.237 21.682  110.277 1.00 25.92  ?  150  LYS A O     1 
ATOM   3864 C  CB    . LYS B 1 151 ? 114.480 18.560  111.355 1.00 24.57  ?  150  LYS A CB    1 
ATOM   3865 C  CG    . LYS B 1 151 ? 114.131 19.421  112.540 1.00 27.96  ?  150  LYS A CG    1 
ATOM   3866 C  CD    . LYS B 1 151 ? 113.623 18.635  113.731 1.00 34.24  ?  150  LYS A CD    1 
ATOM   3867 C  CE    . LYS B 1 151 ? 113.162 19.623  114.799 1.00 41.19  ?  150  LYS A CE    1 
ATOM   3868 N  NZ    . LYS B 1 151 ? 112.364 18.982  115.866 1.00 53.27  ?  150  LYS A NZ    1 
ATOM   3869 N  N     . ILE B 1 152 ? 116.225 20.714  109.844 1.00 22.89  ?  151  ILE A N     1 
ATOM   3870 C  CA    . ILE B 1 152 ? 116.893 22.016  109.739 1.00 22.84  ?  151  ILE A CA    1 
ATOM   3871 C  C     . ILE B 1 152 ? 116.289 22.830  108.604 1.00 24.52  ?  151  ILE A C     1 
ATOM   3872 O  O     . ILE B 1 152 ? 116.038 24.039  108.745 1.00 24.02  ?  151  ILE A O     1 
ATOM   3873 C  CB    . ILE B 1 152 ? 118.408 21.833  109.550 1.00 25.74  ?  151  ILE A CB    1 
ATOM   3874 C  CG1   . ILE B 1 152 ? 119.037 21.284  110.825 1.00 22.23  ?  151  ILE A CG1   1 
ATOM   3875 C  CG2   . ILE B 1 152 ? 119.074 23.151  109.161 1.00 26.22  ?  151  ILE A CG2   1 
ATOM   3876 C  CD1   . ILE B 1 152 ? 120.462 20.826  110.631 1.00 26.85  ?  151  ILE A CD1   1 
ATOM   3877 N  N     . ALA B 1 153 ? 116.052 22.187  107.456 1.00 22.65  ?  152  ALA A N     1 
ATOM   3878 C  CA    . ALA B 1 153 ? 115.540 22.922  106.303 1.00 23.27  ?  152  ALA A CA    1 
ATOM   3879 C  C     . ALA B 1 153 ? 114.159 23.510  106.571 1.00 26.60  ?  152  ALA A C     1 
ATOM   3880 O  O     . ALA B 1 153 ? 113.817 24.559  106.010 1.00 25.76  ?  152  ALA A O     1 
ATOM   3881 C  CB    . ALA B 1 153 ? 115.502 22.010  105.076 1.00 23.21  ?  152  ALA A CB    1 
ATOM   3882 N  N     . SER B 1 154 ? 113.343 22.873  107.425 1.00 21.10  ?  153  SER A N     1 
ATOM   3883 C  CA    . SER B 1 154 ? 112.014 23.437  107.645 1.00 21.20  ?  153  SER A CA    1 
ATOM   3884 C  C     . SER B 1 154 ? 112.073 24.793  108.342 1.00 28.01  ?  153  SER A C     1 
ATOM   3885 O  O     . SER B 1 154 ? 111.110 25.564  108.256 1.00 27.14  ?  153  SER A O     1 
ATOM   3886 C  CB    . SER B 1 154 ? 111.129 22.481  108.447 1.00 24.71  ?  153  SER A CB    1 
ATOM   3887 O  OG    . SER B 1 154 ? 111.592 22.357  109.771 1.00 30.25  ?  153  SER A OG    1 
ATOM   3888 N  N     . ASP B 1 155 ? 113.182 25.114  108.994 1.00 27.02  ?  154  ASP A N     1 
ATOM   3889 C  CA    . ASP B 1 155 ? 113.293 26.390  109.686 1.00 33.73  ?  154  ASP A CA    1 
ATOM   3890 C  C     . ASP B 1 155 ? 113.838 27.509  108.805 1.00 39.02  ?  154  ASP A C     1 
ATOM   3891 O  O     . ASP B 1 155 ? 113.800 28.674  109.214 1.00 39.42  ?  154  ASP A O     1 
ATOM   3892 C  CB    . ASP B 1 155 ? 114.181 26.244  110.930 1.00 31.81  ?  154  ASP A CB    1 
ATOM   3893 C  CG    . ASP B 1 155 ? 113.379 26.153  112.221 1.00 43.04  ?  154  ASP A CG    1 
ATOM   3894 O  OD1   . ASP B 1 155 ? 112.177 25.819  112.181 1.00 38.30  ?  154  ASP A OD1   1 
ATOM   3895 O  OD2   . ASP B 1 155 ? 113.959 26.424  113.289 1.00 70.83  ?  154  ASP A OD2   1 
ATOM   3896 N  N     . MET B 1 156 ? 114.315 27.204  107.600 1.00 29.19  ?  155  MET A N     1 
ATOM   3897 C  CA    . MET B 1 156 ? 115.117 28.186  106.878 1.00 36.79  ?  155  MET A CA    1 
ATOM   3898 C  C     . MET B 1 156 ? 114.300 29.193  106.076 1.00 37.43  ?  155  MET A C     1 
ATOM   3899 O  O     . MET B 1 156 ? 114.806 30.286  105.800 1.00 38.55  ?  155  MET A O     1 
ATOM   3900 C  CB    . MET B 1 156 ? 116.103 27.466  105.973 1.00 39.41  ?  155  MET A CB    1 
ATOM   3901 C  CG    . MET B 1 156 ? 117.147 26.737  106.771 1.00 43.64  ?  155  MET A CG    1 
ATOM   3902 S  SD    . MET B 1 156 ? 118.324 25.953  105.688 1.00 49.49  ?  155  MET A SD    1 
ATOM   3903 C  CE    . MET B 1 156 ? 118.971 27.412  104.871 1.00 41.43  ?  155  MET A CE    1 
ATOM   3904 N  N     . ASN B 1 157 ? 113.066 28.861  105.691 1.00 32.48  ?  156  ASN A N     1 
ATOM   3905 C  CA    . ASN B 1 157 ? 112.133 29.810  105.088 1.00 26.70  ?  156  ASN A CA    1 
ATOM   3906 C  C     . ASN B 1 157 ? 110.850 29.914  105.900 1.00 29.12  ?  156  ASN A C     1 
ATOM   3907 O  O     . ASN B 1 157 ? 109.771 30.130  105.349 1.00 39.41  ?  156  ASN A O     1 
ATOM   3908 C  CB    . ASN B 1 157 ? 111.804 29.435  103.645 1.00 28.55  ?  156  ASN A CB    1 
ATOM   3909 C  CG    . ASN B 1 157 ? 112.745 30.067  102.660 1.00 39.14  ?  156  ASN A CG    1 
ATOM   3910 O  OD1   . ASN B 1 157 ? 113.164 31.210  102.841 1.00 36.23  ?  156  ASN A OD1   1 
ATOM   3911 N  ND2   . ASN B 1 157 ? 113.085 29.336  101.604 1.00 38.38  ?  156  ASN A ND2   1 
ATOM   3912 N  N     . LYS B 1 158 ? 110.953 29.750  107.208 1.00 24.44  ?  157  LYS A N     1 
ATOM   3913 C  CA    . LYS B 1 158 ? 109.811 29.902  108.088 1.00 24.95  ?  157  LYS A CA    1 
ATOM   3914 C  C     . LYS B 1 158 ? 109.584 31.398  108.323 1.00 24.89  ?  157  LYS A C     1 
ATOM   3915 O  O     . LYS B 1 158 ? 110.540 32.148  108.402 1.00 28.32  ?  157  LYS A O     1 
ATOM   3916 C  CB    . LYS B 1 158 ? 110.091 29.151  109.395 1.00 27.10  ?  157  LYS A CB    1 
ATOM   3917 C  CG    . LYS B 1 158 ? 109.019 29.205  110.446 1.00 40.95  ?  157  LYS A CG    1 
ATOM   3918 C  CD    . LYS B 1 158 ? 109.451 28.413  111.689 1.00 41.59  ?  157  LYS A CD    1 
ATOM   3919 C  CE    . LYS B 1 158 ? 109.077 26.940  111.580 1.00 36.15  ?  157  LYS A CE    1 
ATOM   3920 N  NZ    . LYS B 1 158 ? 107.594 26.691  111.558 1.00 27.17  ?  157  LYS A NZ    1 
ATOM   3921 N  N     . PRO B 1 159 ? 108.326 31.849  108.426 1.00 24.37  ?  158  PRO A N     1 
ATOM   3922 C  CA    . PRO B 1 159 ? 107.066 31.118  108.348 1.00 26.19  ?  158  PRO A CA    1 
ATOM   3923 C  C     . PRO B 1 159 ? 106.548 31.006  106.925 1.00 27.58  ?  158  PRO A C     1 
ATOM   3924 O  O     . PRO B 1 159 ? 106.971 31.762  106.037 1.00 27.83  ?  158  PRO A O     1 
ATOM   3925 C  CB    . PRO B 1 159 ? 106.127 31.974  109.189 1.00 27.18  ?  158  PRO A CB    1 
ATOM   3926 C  CG    . PRO B 1 159 ? 106.590 33.367  108.881 1.00 25.91  ?  158  PRO A CG    1 
ATOM   3927 C  CD    . PRO B 1 159 ? 108.103 33.263  108.790 1.00 27.14  ?  158  PRO A CD    1 
ATOM   3928 N  N     . ASN B 1 160 ? 105.644 30.050  106.731 1.00 27.43  ?  159  ASN A N     1 
ATOM   3929 C  CA    . ASN B 1 160 ? 104.913 29.896  105.486 1.00 29.32  ?  159  ASN A CA    1 
ATOM   3930 C  C     . ASN B 1 160 ? 105.862 29.766  104.298 1.00 32.55  ?  159  ASN A C     1 
ATOM   3931 O  O     . ASN B 1 160 ? 105.727 30.447  103.283 1.00 27.29  ?  159  ASN A O     1 
ATOM   3932 C  CB    . ASN B 1 160 ? 103.940 31.057  105.292 1.00 27.79  ?  159  ASN A CB    1 
ATOM   3933 C  CG    . ASN B 1 160 ? 102.883 30.745  104.264 1.00 35.18  ?  159  ASN A CG    1 
ATOM   3934 O  OD1   . ASN B 1 160 ? 102.801 29.613  103.773 1.00 33.39  ?  159  ASN A OD1   1 
ATOM   3935 N  ND2   . ASN B 1 160 ? 102.063 31.741  103.927 1.00 35.08  ?  159  ASN A ND2   1 
ATOM   3936 N  N     . GLY B 1 161 ? 106.842 28.879  104.435 1.00 28.95  ?  160  GLY A N     1 
ATOM   3937 C  CA    . GLY B 1 161 ? 107.768 28.673  103.339 1.00 28.16  ?  160  GLY A CA    1 
ATOM   3938 C  C     . GLY B 1 161 ? 108.408 27.311  103.469 1.00 32.13  ?  160  GLY A C     1 
ATOM   3939 O  O     . GLY B 1 161 ? 108.190 26.585  104.441 1.00 28.15  ?  160  GLY A O     1 
ATOM   3940 N  N     . GLN B 1 162 ? 109.220 26.969  102.481 1.00 26.60  ?  161  GLN A N     1 
ATOM   3941 C  CA    . GLN B 1 162 ? 109.912 25.694  102.555 1.00 29.08  ?  161  GLN A CA    1 
ATOM   3942 C  C     . GLN B 1 162 ? 111.286 25.831  101.922 1.00 31.26  ?  161  GLN A C     1 
ATOM   3943 O  O     . GLN B 1 162 ? 111.603 26.834  101.271 1.00 27.45  ?  161  GLN A O     1 
ATOM   3944 C  CB    . GLN B 1 162 ? 109.094 24.591  101.879 1.00 24.14  ?  161  GLN A CB    1 
ATOM   3945 C  CG    . GLN B 1 162 ? 108.805 24.879  100.414 1.00 33.69  ?  161  GLN A CG    1 
ATOM   3946 C  CD    . GLN B 1 162 ? 107.947 23.808  99.792  1.00 32.07  ?  161  GLN A CD    1 
ATOM   3947 O  OE1   . GLN B 1 162 ? 106.808 23.592  100.206 1.00 30.36  ?  161  GLN A OE1   1 
ATOM   3948 N  NE2   . GLN B 1 162 ? 108.494 23.115  98.805  1.00 31.41  ?  161  GLN A NE2   1 
ATOM   3949 N  N     . PHE B 1 163 ? 112.104 24.804  102.134 1.00 25.15  ?  162  PHE A N     1 
ATOM   3950 C  CA    . PHE B 1 163 ? 113.472 24.801  101.649 1.00 27.53  ?  162  PHE A CA    1 
ATOM   3951 C  C     . PHE B 1 163 ? 113.890 23.368  101.358 1.00 28.67  ?  162  PHE A C     1 
ATOM   3952 O  O     . PHE B 1 163 ? 113.616 22.458  102.150 1.00 24.64  ?  162  PHE A O     1 
ATOM   3953 C  CB    . PHE B 1 163 ? 114.415 25.437  102.672 1.00 27.84  ?  162  PHE A CB    1 
ATOM   3954 C  CG    . PHE B 1 163 ? 115.810 25.654  102.151 1.00 34.14  ?  162  PHE A CG    1 
ATOM   3955 C  CD1   . PHE B 1 163 ? 116.121 26.787  101.424 1.00 34.49  ?  162  PHE A CD1   1 
ATOM   3956 C  CD2   . PHE B 1 163 ? 116.810 24.726  102.399 1.00 35.44  ?  162  PHE A CD2   1 
ATOM   3957 C  CE1   . PHE B 1 163 ? 117.401 26.992  100.944 1.00 41.70  ?  162  PHE A CE1   1 
ATOM   3958 C  CE2   . PHE B 1 163 ? 118.097 24.921  101.915 1.00 36.75  ?  162  PHE A CE2   1 
ATOM   3959 C  CZ    . PHE B 1 163 ? 118.391 26.061  101.187 1.00 36.79  ?  162  PHE A CZ    1 
ATOM   3960 N  N     . VAL B 1 164 ? 114.571 23.174  100.230 1.00 28.95  ?  163  VAL A N     1 
ATOM   3961 C  CA    . VAL B 1 164 ? 114.917 21.842  99.743  1.00 30.73  ?  163  VAL A CA    1 
ATOM   3962 C  C     . VAL B 1 164 ? 116.433 21.731  99.659  1.00 33.59  ?  163  VAL A C     1 
ATOM   3963 O  O     . VAL B 1 164 ? 117.100 22.629  99.131  1.00 31.02  ?  163  VAL A O     1 
ATOM   3964 C  CB    . VAL B 1 164 ? 114.260 21.561  98.376  1.00 30.35  ?  163  VAL A CB    1 
ATOM   3965 C  CG1   . VAL B 1 164 ? 114.638 20.174  97.846  1.00 34.13  ?  163  VAL A CG1   1 
ATOM   3966 C  CG2   . VAL B 1 164 ? 112.748 21.705  98.483  1.00 27.27  ?  163  VAL A CG2   1 
ATOM   3967 N  N     . ILE B 1 165 ? 116.971 20.628  100.174 1.00 25.32  ?  164  ILE A N     1 
ATOM   3968 C  CA    . ILE B 1 165 ? 118.389 20.310  100.078 1.00 26.97  ?  164  ILE A CA    1 
ATOM   3969 C  C     . ILE B 1 165 ? 118.519 19.034  99.255  1.00 34.64  ?  164  ILE A C     1 
ATOM   3970 O  O     . ILE B 1 165 ? 118.028 17.974  99.663  1.00 28.76  ?  164  ILE A O     1 
ATOM   3971 C  CB    . ILE B 1 165 ? 119.031 20.117  101.460 1.00 27.37  ?  164  ILE A CB    1 
ATOM   3972 C  CG1   . ILE B 1 165 ? 118.906 21.382  102.311 1.00 26.36  ?  164  ILE A CG1   1 
ATOM   3973 C  CG2   . ILE B 1 165 ? 120.486 19.695  101.311 1.00 27.83  ?  164  ILE A CG2   1 
ATOM   3974 C  CD1   . ILE B 1 165 ? 119.194 21.129  103.809 1.00 28.18  ?  164  ILE A CD1   1 
ATOM   3975 N  N     . THR B 1 166 ? 119.177 19.129  98.106  1.00 37.18  ?  165  THR A N     1 
ATOM   3976 C  CA    . THR B 1 166 ? 119.426 17.937  97.312  1.00 31.64  ?  165  THR A CA    1 
ATOM   3977 C  C     . THR B 1 166 ? 120.699 17.244  97.780  1.00 32.89  ?  165  THR A C     1 
ATOM   3978 O  O     . THR B 1 166 ? 121.545 17.850  98.444  1.00 31.20  ?  165  THR A O     1 
ATOM   3979 C  CB    . THR B 1 166 ? 119.545 18.298  95.832  1.00 32.19  ?  165  THR A CB    1 
ATOM   3980 O  OG1   . THR B 1 166 ? 120.740 19.063  95.630  1.00 33.71  ?  165  THR A OG1   1 
ATOM   3981 C  CG2   . THR B 1 166 ? 118.341 19.123  95.393  1.00 37.69  ?  165  THR A CG2   1 
ATOM   3982 N  N     . PRO B 1 167 ? 120.867 15.965  97.449  1.00 35.43  ?  166  PRO A N     1 
ATOM   3983 C  CA    . PRO B 1 167 ? 122.140 15.299  97.785  1.00 33.57  ?  166  PRO A CA    1 
ATOM   3984 C  C     . PRO B 1 167 ? 123.366 16.035  97.264  1.00 31.91  ?  166  PRO A C     1 
ATOM   3985 O  O     . PRO B 1 167 ? 124.391 16.081  97.956  1.00 34.45  ?  166  PRO A O     1 
ATOM   3986 C  CB    . PRO B 1 167 ? 121.980 13.910  97.149  1.00 33.12  ?  166  PRO A CB    1 
ATOM   3987 C  CG    . PRO B 1 167 ? 120.506 13.672  97.165  1.00 39.73  ?  166  PRO A CG    1 
ATOM   3988 C  CD    . PRO B 1 167 ? 119.871 15.018  96.908  1.00 37.46  ?  166  PRO A CD    1 
ATOM   3989 N  N     . ALA B 1 168 ? 123.284 16.634  96.069  1.00 29.75  ?  167  ALA A N     1 
ATOM   3990 C  CA    . ALA B 1 168 ? 124.419 17.380  95.531  1.00 29.43  ?  167  ALA A CA    1 
ATOM   3991 C  C     . ALA B 1 168 ? 124.773 18.595  96.386  1.00 32.29  ?  167  ALA A C     1 
ATOM   3992 O  O     . ALA B 1 168 ? 125.936 19.020  96.403  1.00 34.52  ?  167  ALA A O     1 
ATOM   3993 C  CB    . ALA B 1 168 ? 124.127 17.827  94.097  1.00 34.84  ?  167  ALA A CB    1 
ATOM   3994 N  N     . GLU B 1 169 ? 123.795 19.177  97.076  1.00 35.41  ?  168  GLU A N     1 
ATOM   3995 C  CA    . GLU B 1 169 ? 124.019 20.390  97.855  1.00 29.06  ?  168  GLU A CA    1 
ATOM   3996 C  C     . GLU B 1 169 ? 124.439 20.114  99.295  1.00 30.74  ?  168  GLU A C     1 
ATOM   3997 O  O     . GLU B 1 169 ? 124.792 21.058  100.011 1.00 29.35  ?  168  GLU A O     1 
ATOM   3998 C  CB    . GLU B 1 169 ? 122.746 21.252  97.862  1.00 31.00  ?  168  GLU A CB    1 
ATOM   3999 C  CG    . GLU B 1 169 ? 122.365 21.807  96.488  1.00 32.17  ?  168  GLU A CG    1 
ATOM   4000 C  CD    . GLU B 1 169 ? 120.910 22.263  96.387  1.00 42.83  ?  168  GLU A CD    1 
ATOM   4001 O  OE1   . GLU B 1 169 ? 120.088 21.917  97.260  1.00 36.64  ?  168  GLU A OE1   1 
ATOM   4002 O  OE2   . GLU B 1 169 ? 120.581 22.958  95.406  1.00 51.17  ?  168  GLU A OE2   1 
ATOM   4003 N  N     . VAL B 1 170 ? 124.403 18.860  99.745  1.00 25.75  ?  169  VAL A N     1 
ATOM   4004 C  CA    . VAL B 1 170 ? 124.666 18.582  101.159 1.00 26.64  ?  169  VAL A CA    1 
ATOM   4005 C  C     . VAL B 1 170 ? 126.071 18.997  101.582 1.00 26.62  ?  169  VAL A C     1 
ATOM   4006 O  O     . VAL B 1 170 ? 126.207 19.641  102.632 1.00 29.37  ?  169  VAL A O     1 
ATOM   4007 C  CB    . VAL B 1 170 ? 124.361 17.101  101.476 1.00 29.51  ?  169  VAL A CB    1 
ATOM   4008 C  CG1   . VAL B 1 170 ? 124.903 16.731  102.855 1.00 26.49  ?  169  VAL A CG1   1 
ATOM   4009 C  CG2   . VAL B 1 170 ? 122.858 16.845  101.413 1.00 28.31  ?  169  VAL A CG2   1 
ATOM   4010 N  N     . PRO B 1 171 ? 127.139 18.683  100.838 1.00 28.28  ?  170  PRO A N     1 
ATOM   4011 C  CA    . PRO B 1 171 ? 128.478 19.078  101.319 1.00 28.33  ?  170  PRO A CA    1 
ATOM   4012 C  C     . PRO B 1 171 ? 128.626 20.575  101.549 1.00 30.13  ?  170  PRO A C     1 
ATOM   4013 O  O     . PRO B 1 171 ? 129.098 20.993  102.618 1.00 29.67  ?  170  PRO A O     1 
ATOM   4014 C  CB    . PRO B 1 171 ? 129.403 18.583  100.206 1.00 31.82  ?  170  PRO A CB    1 
ATOM   4015 C  CG    . PRO B 1 171 ? 128.675 17.426  99.604  1.00 34.97  ?  170  PRO A CG    1 
ATOM   4016 C  CD    . PRO B 1 171 ? 127.230 17.820  99.641  1.00 35.16  ?  170  PRO A CD    1 
ATOM   4017 N  N     . ALA B 1 172 ? 128.231 21.394  100.571 1.00 27.03  ?  171  ALA A N     1 
ATOM   4018 C  CA    . ALA B 1 172 ? 128.290 22.843  100.759 1.00 26.41  ?  171  ALA A CA    1 
ATOM   4019 C  C     . ALA B 1 172 ? 127.424 23.278  101.929 1.00 29.72  ?  171  ALA A C     1 
ATOM   4020 O  O     . ALA B 1 172 ? 127.809 24.171  102.699 1.00 31.16  ?  171  ALA A O     1 
ATOM   4021 C  CB    . ALA B 1 172 ? 127.856 23.567  99.480  1.00 27.17  ?  171  ALA A CB    1 
ATOM   4022 N  N     . PHE B 1 173 ? 126.245 22.664  102.075 1.00 27.53  ?  172  PHE A N     1 
ATOM   4023 C  CA    . PHE B 1 173 ? 125.351 23.043  103.160 1.00 26.59  ?  172  PHE A CA    1 
ATOM   4024 C  C     . PHE B 1 173 ? 125.978 22.742  104.513 1.00 31.47  ?  172  PHE A C     1 
ATOM   4025 O  O     . PHE B 1 173 ? 125.832 23.521  105.459 1.00 30.21  ?  172  PHE A O     1 
ATOM   4026 C  CB    . PHE B 1 173 ? 124.007 22.324  103.023 1.00 23.82  ?  172  PHE A CB    1 
ATOM   4027 C  CG    . PHE B 1 173 ? 122.999 22.739  104.058 1.00 27.65  ?  172  PHE A CG    1 
ATOM   4028 C  CD1   . PHE B 1 173 ? 122.170 23.824  103.828 1.00 37.79  ?  172  PHE A CD1   1 
ATOM   4029 C  CD2   . PHE B 1 173 ? 122.900 22.071  105.266 1.00 28.39  ?  172  PHE A CD2   1 
ATOM   4030 C  CE1   . PHE B 1 173 ? 121.249 24.230  104.775 1.00 37.32  ?  172  PHE A CE1   1 
ATOM   4031 C  CE2   . PHE B 1 173 ? 121.974 22.476  106.225 1.00 23.84  ?  172  PHE A CE2   1 
ATOM   4032 C  CZ    . PHE B 1 173 ? 121.150 23.555  105.974 1.00 31.47  ?  172  PHE A CZ    1 
ATOM   4033 N  N     . LEU B 1 174 ? 126.683 21.615  104.621 1.00 25.47  ?  173  LEU A N     1 
ATOM   4034 C  CA    . LEU B 1 174 ? 127.273 21.223  105.899 1.00 26.22  ?  173  LEU A CA    1 
ATOM   4035 C  C     . LEU B 1 174 ? 128.455 22.103  106.293 1.00 26.56  ?  173  LEU A C     1 
ATOM   4036 O  O     . LEU B 1 174 ? 128.703 22.294  107.484 1.00 26.30  ?  173  LEU A O     1 
ATOM   4037 C  CB    . LEU B 1 174 ? 127.741 19.771  105.835 1.00 25.39  ?  173  LEU A CB    1 
ATOM   4038 C  CG    . LEU B 1 174 ? 126.682 18.687  105.637 1.00 25.53  ?  173  LEU A CG    1 
ATOM   4039 C  CD1   . LEU B 1 174 ? 127.379 17.424  105.202 1.00 24.60  ?  173  LEU A CD1   1 
ATOM   4040 C  CD2   . LEU B 1 174 ? 125.896 18.460  106.917 1.00 27.36  ?  173  LEU A CD2   1 
ATOM   4041 N  N     . GLN B 1 175 ? 129.207 22.615  105.317 1.00 25.94  ?  174  GLN A N     1 
ATOM   4042 C  CA    . GLN B 1 175 ? 130.532 23.159  105.612 1.00 33.83  ?  174  GLN A CA    1 
ATOM   4043 C  C     . GLN B 1 175 ? 130.495 24.221  106.709 1.00 31.89  ?  174  GLN A C     1 
ATOM   4044 O  O     . GLN B 1 175 ? 131.367 24.243  107.586 1.00 29.51  ?  174  GLN A O     1 
ATOM   4045 C  CB    . GLN B 1 175 ? 131.160 23.740  104.343 1.00 32.09  ?  174  GLN A CB    1 
ATOM   4046 C  CG    . GLN B 1 175 ? 132.650 24.037  104.490 1.00 36.28  ?  174  GLN A CG    1 
ATOM   4047 C  CD    . GLN B 1 175 ? 133.462 22.801  104.840 1.00 45.69  ?  174  GLN A CD    1 
ATOM   4048 O  OE1   . GLN B 1 175 ? 133.124 21.686  104.434 1.00 47.19  ?  174  GLN A OE1   1 
ATOM   4049 N  NE2   . GLN B 1 175 ? 134.542 22.993  105.591 1.00 44.37  ?  174  GLN A NE2   1 
ATOM   4050 N  N     . THR B 1 176 ? 129.502 25.112  106.680 1.00 28.74  ?  175  THR A N     1 
ATOM   4051 C  CA    . THR B 1 176 ? 129.420 26.171  107.685 1.00 30.77  ?  175  THR A CA    1 
ATOM   4052 C  C     . THR B 1 176 ? 128.166 26.039  108.544 1.00 31.05  ?  175  THR A C     1 
ATOM   4053 O  O     . THR B 1 176 ? 127.774 26.993  109.231 1.00 29.56  ?  175  THR A O     1 
ATOM   4054 C  CB    . THR B 1 176 ? 129.504 27.562  107.039 1.00 35.73  ?  175  THR A CB    1 
ATOM   4055 O  OG1   . THR B 1 176 ? 128.466 27.715  106.064 1.00 37.67  ?  175  THR A OG1   1 
ATOM   4056 C  CG2   . THR B 1 176 ? 130.861 27.753  106.360 1.00 33.25  ?  175  THR A CG2   1 
ATOM   4057 N  N     . LEU B 1 177 ? 127.564 24.859  108.561 1.00 24.51  ?  176  LEU A N     1 
ATOM   4058 C  CA    . LEU B 1 177 ? 126.367 24.642  109.356 1.00 24.93  ?  176  LEU A CA    1 
ATOM   4059 C  C     . LEU B 1 177 ? 126.754 24.621  110.828 1.00 26.22  ?  176  LEU A C     1 
ATOM   4060 O  O     . LEU B 1 177 ? 127.580 23.796  111.233 1.00 24.87  ?  176  LEU A O     1 
ATOM   4061 C  CB    . LEU B 1 177 ? 125.680 23.333  108.950 1.00 24.72  ?  176  LEU A CB    1 
ATOM   4062 C  CG    . LEU B 1 177 ? 124.536 22.802  109.833 1.00 26.72  ?  176  LEU A CG    1 
ATOM   4063 C  CD1   . LEU B 1 177 ? 123.368 23.749  109.820 1.00 28.05  ?  176  LEU A CD1   1 
ATOM   4064 C  CD2   . LEU B 1 177 ? 124.104 21.402  109.384 1.00 25.93  ?  176  LEU A CD2   1 
ATOM   4065 N  N     . PRO B 1 178 ? 126.227 25.519  111.647 1.00 25.41  ?  177  PRO A N     1 
ATOM   4066 C  CA    . PRO B 1 178 ? 126.566 25.488  113.075 1.00 22.81  ?  177  PRO A CA    1 
ATOM   4067 C  C     . PRO B 1 178 ? 126.086 24.189  113.708 1.00 26.29  ?  177  PRO A C     1 
ATOM   4068 O  O     . PRO B 1 178 ? 124.962 23.738  113.465 1.00 23.22  ?  177  PRO A O     1 
ATOM   4069 C  CB    . PRO B 1 178 ? 125.828 26.706  113.643 1.00 25.48  ?  177  PRO A CB    1 
ATOM   4070 C  CG    . PRO B 1 178 ? 125.619 27.609  112.466 1.00 24.88  ?  177  PRO A CG    1 
ATOM   4071 C  CD    . PRO B 1 178 ? 125.407 26.686  111.289 1.00 25.53  ?  177  PRO A CD    1 
ATOM   4072 N  N     . LEU B 1 179 ? 126.958 23.587  114.522 1.00 27.20  ?  178  LEU A N     1 
ATOM   4073 C  CA    . LEU B 1 179 ? 126.603 22.341  115.198 1.00 31.18  ?  178  LEU A CA    1 
ATOM   4074 C  C     . LEU B 1 179 ? 125.336 22.502  116.027 1.00 28.40  ?  178  LEU A C     1 
ATOM   4075 O  O     . LEU B 1 179 ? 124.515 21.584  116.096 1.00 23.23  ?  178  LEU A O     1 
ATOM   4076 C  CB    . LEU B 1 179 ? 127.762 21.876  116.083 1.00 22.96  ?  178  LEU A CB    1 
ATOM   4077 C  CG    . LEU B 1 179 ? 129.050 21.554  115.321 1.00 24.53  ?  178  LEU A CG    1 
ATOM   4078 C  CD1   . LEU B 1 179 ? 130.219 21.386  116.279 1.00 26.04  ?  178  LEU A CD1   1 
ATOM   4079 C  CD2   . LEU B 1 179 ? 128.873 20.300  114.467 1.00 22.97  ?  178  LEU A CD2   1 
ATOM   4080 N  N     . ALA B 1 180 ? 125.148 23.676  116.645 1.00 23.13  ?  179  ALA A N     1 
ATOM   4081 C  CA    . ALA B 1 180 ? 123.967 23.906  117.470 1.00 26.86  ?  179  ALA A CA    1 
ATOM   4082 C  C     . ALA B 1 180 ? 122.669 23.790  116.681 1.00 27.63  ?  179  ALA A C     1 
ATOM   4083 O  O     . ALA B 1 180 ? 121.607 23.618  117.286 1.00 28.02  ?  179  ALA A O     1 
ATOM   4084 C  CB    . ALA B 1 180 ? 124.047 25.286  118.139 1.00 33.78  ?  179  ALA A CB    1 
ATOM   4085 N  N     . LYS B 1 181 ? 122.722 23.863  115.348 1.00 24.44  ?  180  LYS A N     1 
ATOM   4086 C  CA    . LYS B 1 181 ? 121.515 23.675  114.554 1.00 24.34  ?  180  LYS A CA    1 
ATOM   4087 C  C     . LYS B 1 181 ? 121.079 22.223  114.491 1.00 30.09  ?  180  LYS A C     1 
ATOM   4088 O  O     . LYS B 1 181 ? 119.918 21.959  114.156 1.00 27.64  ?  180  LYS A O     1 
ATOM   4089 C  CB    . LYS B 1 181 ? 121.711 24.178  113.124 1.00 26.80  ?  180  LYS A CB    1 
ATOM   4090 C  CG    . LYS B 1 181 ? 121.916 25.657  113.016 1.00 32.16  ?  180  LYS A CG    1 
ATOM   4091 C  CD    . LYS B 1 181 ? 120.663 26.412  113.399 1.00 40.10  ?  180  LYS A CD    1 
ATOM   4092 C  CE    . LYS B 1 181 ? 120.825 27.893  113.089 1.00 48.18  ?  180  LYS A CE    1 
ATOM   4093 N  NZ    . LYS B 1 181 ? 119.590 28.647  113.442 1.00 48.41  ?  180  LYS A NZ    1 
ATOM   4094 N  N     . ILE B 1 182 ? 121.977 21.289  114.790 1.00 25.89  ?  181  ILE A N     1 
ATOM   4095 C  CA    . ILE B 1 182 ? 121.649 19.866  114.741 1.00 29.12  ?  181  ILE A CA    1 
ATOM   4096 C  C     . ILE B 1 182 ? 120.714 19.550  115.899 1.00 28.42  ?  181  ILE A C     1 
ATOM   4097 O  O     . ILE B 1 182 ? 121.054 19.830  117.058 1.00 25.29  ?  181  ILE A O     1 
ATOM   4098 C  CB    . ILE B 1 182 ? 122.913 18.992  114.805 1.00 28.08  ?  181  ILE A CB    1 
ATOM   4099 C  CG1   . ILE B 1 182 ? 123.817 19.275  113.600 1.00 25.33  ?  181  ILE A CG1   1 
ATOM   4100 C  CG2   . ILE B 1 182 ? 122.527 17.499  114.904 1.00 24.40  ?  181  ILE A CG2   1 
ATOM   4101 C  CD1   . ILE B 1 182 ? 125.218 18.682  113.753 1.00 25.94  ?  181  ILE A CD1   1 
ATOM   4102 N  N     . PRO B 1 183 ? 119.535 18.987  115.642 1.00 25.63  ?  182  PRO A N     1 
ATOM   4103 C  CA    . PRO B 1 183 ? 118.661 18.602  116.751 1.00 25.97  ?  182  PRO A CA    1 
ATOM   4104 C  C     . PRO B 1 183 ? 119.391 17.619  117.649 1.00 30.11  ?  182  PRO A C     1 
ATOM   4105 O  O     . PRO B 1 183 ? 119.995 16.653  117.174 1.00 32.48  ?  182  PRO A O     1 
ATOM   4106 C  CB    . PRO B 1 183 ? 117.460 17.956  116.049 1.00 33.11  ?  182  PRO A CB    1 
ATOM   4107 C  CG    . PRO B 1 183 ? 117.462 18.603  114.670 1.00 35.77  ?  182  PRO A CG    1 
ATOM   4108 C  CD    . PRO B 1 183 ? 118.918 18.697  114.331 1.00 31.19  ?  182  PRO A CD    1 
ATOM   4109 N  N     . GLY B 1 184 ? 119.357 17.889  118.946 1.00 26.26  ?  183  GLY A N     1 
ATOM   4110 C  CA    . GLY B 1 184 ? 120.061 17.098  119.925 1.00 28.36  ?  183  GLY A CA    1 
ATOM   4111 C  C     . GLY B 1 184 ? 121.377 17.689  120.367 1.00 29.07  ?  183  GLY A C     1 
ATOM   4112 O  O     . GLY B 1 184 ? 121.919 17.259  121.392 1.00 30.90  ?  183  GLY A O     1 
ATOM   4113 N  N     . VAL B 1 185 ? 121.906 18.654  119.619 1.00 25.51  ?  184  VAL A N     1 
ATOM   4114 C  CA    . VAL B 1 185 ? 123.027 19.467  120.070 1.00 28.40  ?  184  VAL A CA    1 
ATOM   4115 C  C     . VAL B 1 185 ? 122.430 20.706  120.732 1.00 25.11  ?  184  VAL A C     1 
ATOM   4116 O  O     . VAL B 1 185 ? 122.030 21.658  120.059 1.00 26.98  ?  184  VAL A O     1 
ATOM   4117 C  CB    . VAL B 1 185 ? 123.968 19.823  118.919 1.00 29.09  ?  184  VAL A CB    1 
ATOM   4118 C  CG1   . VAL B 1 185 ? 125.159 20.631  119.437 1.00 26.21  ?  184  VAL A CG1   1 
ATOM   4119 C  CG2   . VAL B 1 185 ? 124.427 18.541  118.212 1.00 28.01  ?  184  VAL A CG2   1 
ATOM   4120 N  N     . GLY B 1 186 ? 122.341 20.685  122.060 1.00 24.96  ?  185  GLY A N     1 
ATOM   4121 C  CA    . GLY B 1 186 ? 121.782 21.782  122.816 1.00 25.03  ?  185  GLY A CA    1 
ATOM   4122 C  C     . GLY B 1 186 ? 122.839 22.724  123.355 1.00 29.59  ?  185  GLY A C     1 
ATOM   4123 O  O     . GLY B 1 186 ? 123.999 22.713  122.928 1.00 27.55  ?  185  GLY A O     1 
ATOM   4124 N  N     . LYS B 1 187 ? 122.433 23.528  124.347 1.00 27.20  ?  186  LYS A N     1 
ATOM   4125 C  CA    . LYS B 1 187 ? 123.295 24.590  124.859 1.00 36.96  ?  186  LYS A CA    1 
ATOM   4126 C  C     . LYS B 1 187 ? 124.548 24.026  125.519 1.00 31.80  ?  186  LYS A C     1 
ATOM   4127 O  O     . LYS B 1 187 ? 125.650 24.548  125.312 1.00 34.29  ?  186  LYS A O     1 
ATOM   4128 C  CB    . LYS B 1 187 ? 122.516 25.470  125.842 1.00 39.80  ?  186  LYS A CB    1 
ATOM   4129 C  CG    . LYS B 1 187 ? 123.278 26.687  126.358 1.00 56.20  ?  186  LYS A CG    1 
ATOM   4130 C  CD    . LYS B 1 187 ? 123.759 27.591  125.223 1.00 69.31  ?  186  LYS A CD    1 
ATOM   4131 C  CE    . LYS B 1 187 ? 124.567 28.777  125.757 1.00 68.08  ?  186  LYS A CE    1 
ATOM   4132 N  NZ    . LYS B 1 187 ? 125.709 28.349  126.623 1.00 63.64  ?  186  LYS A NZ    1 
ATOM   4133 N  N     . VAL B 1 188 ? 124.403 22.962  126.314 1.00 29.84  ?  187  VAL A N     1 
ATOM   4134 C  CA    . VAL B 1 188 ? 125.556 22.403  127.018 1.00 33.17  ?  187  VAL A CA    1 
ATOM   4135 C  C     . VAL B 1 188 ? 126.541 21.794  126.024 1.00 33.88  ?  187  VAL A C     1 
ATOM   4136 O  O     . VAL B 1 188 ? 127.749 22.057  126.077 1.00 30.47  ?  187  VAL A O     1 
ATOM   4137 C  CB    . VAL B 1 188 ? 125.095 21.376  128.071 1.00 35.98  ?  187  VAL A CB    1 
ATOM   4138 C  CG1   . VAL B 1 188 ? 126.281 20.587  128.624 1.00 32.04  ?  187  VAL A CG1   1 
ATOM   4139 C  CG2   . VAL B 1 188 ? 124.334 22.078  129.190 1.00 35.86  ?  187  VAL A CG2   1 
ATOM   4140 N  N     . SER B 1 189 ? 126.033 20.990  125.083 1.00 25.12  ?  188  SER A N     1 
ATOM   4141 C  CA    . SER B 1 189 ? 126.904 20.370  124.089 1.00 27.32  ?  188  SER A CA    1 
ATOM   4142 C  C     . SER B 1 189 ? 127.558 21.414  123.194 1.00 29.21  ?  188  SER A C     1 
ATOM   4143 O  O     . SER B 1 189 ? 128.762 21.337  122.922 1.00 29.89  ?  188  SER A O     1 
ATOM   4144 C  CB    . SER B 1 189 ? 126.112 19.378  123.239 1.00 33.46  ?  188  SER A CB    1 
ATOM   4145 O  OG    . SER B 1 189 ? 125.590 18.343  124.042 1.00 33.56  ?  188  SER A OG    1 
ATOM   4146 N  N     . ALA B 1 190 ? 126.780 22.390  122.713 1.00 27.78  ?  189  ALA A N     1 
ATOM   4147 C  CA    . ALA B 1 190 ? 127.343 23.412  121.832 1.00 29.05  ?  189  ALA A CA    1 
ATOM   4148 C  C     . ALA B 1 190 ? 128.475 24.167  122.517 1.00 33.55  ?  189  ALA A C     1 
ATOM   4149 O  O     . ALA B 1 190 ? 129.485 24.501  121.883 1.00 29.26  ?  189  ALA A O     1 
ATOM   4150 C  CB    . ALA B 1 190 ? 126.255 24.388  121.376 1.00 26.99  ?  189  ALA A CB    1 
ATOM   4151 N  N     . ALA B 1 191 ? 128.333 24.433  123.816 1.00 32.66  ?  190  ALA A N     1 
ATOM   4152 C  CA    . ALA B 1 191 ? 129.374 25.175  124.519 1.00 34.72  ?  190  ALA A CA    1 
ATOM   4153 C  C     . ALA B 1 191 ? 130.612 24.314  124.735 1.00 32.71  ?  190  ALA A C     1 
ATOM   4154 O  O     . ALA B 1 191 ? 131.743 24.801  124.616 1.00 31.05  ?  190  ALA A O     1 
ATOM   4155 C  CB    . ALA B 1 191 ? 128.833 25.709  125.846 1.00 28.37  ?  190  ALA A CB    1 
ATOM   4156 N  N     . LYS B 1 192 ? 130.423 23.029  125.049 1.00 32.49  ?  191  LYS A N     1 
ATOM   4157 C  CA    . LYS B 1 192 ? 131.560 22.122  125.176 1.00 30.96  ?  191  LYS A CA    1 
ATOM   4158 C  C     . LYS B 1 192 ? 132.315 22.009  123.856 1.00 30.92  ?  191  LYS A C     1 
ATOM   4159 O  O     . LYS B 1 192 ? 133.551 21.966  123.834 1.00 34.61  ?  191  LYS A O     1 
ATOM   4160 C  CB    . LYS B 1 192 ? 131.071 20.752  125.647 1.00 30.40  ?  191  LYS A CB    1 
ATOM   4161 C  CG    . LYS B 1 192 ? 132.147 19.703  125.775 1.00 42.20  ?  191  LYS A CG    1 
ATOM   4162 C  CD    . LYS B 1 192 ? 131.593 18.422  126.400 1.00 51.84  ?  191  LYS A CD    1 
ATOM   4163 C  CE    . LYS B 1 192 ? 132.665 17.342  126.492 1.00 56.26  ?  191  LYS A CE    1 
ATOM   4164 N  NZ    . LYS B 1 192 ? 132.073 15.981  126.630 1.00 62.18  ?  191  LYS A NZ    1 
ATOM   4165 N  N     . LEU B 1 193 ? 131.584 21.963  122.745 1.00 26.91  ?  192  LEU A N     1 
ATOM   4166 C  CA    . LEU B 1 193 ? 132.215 21.912  121.430 1.00 26.29  ?  192  LEU A CA    1 
ATOM   4167 C  C     . LEU B 1 193 ? 132.969 23.202  121.139 1.00 26.73  ?  192  LEU A C     1 
ATOM   4168 O  O     . LEU B 1 193 ? 134.125 23.178  120.697 1.00 30.40  ?  192  LEU A O     1 
ATOM   4169 C  CB    . LEU B 1 193 ? 131.145 21.647  120.369 1.00 28.12  ?  192  LEU A CB    1 
ATOM   4170 C  CG    . LEU B 1 193 ? 130.595 20.216  120.418 1.00 30.60  ?  192  LEU A CG    1 
ATOM   4171 C  CD1   . LEU B 1 193 ? 129.206 20.125  119.763 1.00 24.15  ?  192  LEU A CD1   1 
ATOM   4172 C  CD2   . LEU B 1 193 ? 131.590 19.261  119.736 1.00 29.13  ?  192  LEU A CD2   1 
ATOM   4173 N  N     . GLU B 1 194 ? 132.323 24.342  121.404 1.00 27.37  ?  193  GLU A N     1 
ATOM   4174 C  CA    . GLU B 1 194 ? 132.951 25.648  121.225 1.00 28.76  ?  193  GLU A CA    1 
ATOM   4175 C  C     . GLU B 1 194 ? 134.221 25.772  122.060 1.00 33.35  ?  193  GLU A C     1 
ATOM   4176 O  O     . GLU B 1 194 ? 135.227 26.324  121.596 1.00 37.52  ?  193  GLU A O     1 
ATOM   4177 C  CB    . GLU B 1 194 ? 131.948 26.741  121.604 1.00 40.69  ?  193  GLU A CB    1 
ATOM   4178 C  CG    . GLU B 1 194 ? 132.346 28.160  121.225 1.00 59.67  ?  193  GLU A CG    1 
ATOM   4179 C  CD    . GLU B 1 194 ? 132.095 28.459  119.761 1.00 76.90  ?  193  GLU A CD    1 
ATOM   4180 O  OE1   . GLU B 1 194 ? 133.043 28.328  118.961 1.00 81.41  ?  193  GLU A OE1   1 
ATOM   4181 O  OE2   . GLU B 1 194 ? 130.947 28.817  119.409 1.00 81.71  ?  193  GLU A OE2   1 
ATOM   4182 N  N     . ALA B 1 195 ? 134.198 25.252  123.292 1.00 42.27  ?  194  ALA A N     1 
ATOM   4183 C  CA    . ALA B 1 195 ? 135.372 25.336  124.162 1.00 45.45  ?  194  ALA A CA    1 
ATOM   4184 C  C     . ALA B 1 195 ? 136.572 24.607  123.574 1.00 41.73  ?  194  ALA A C     1 
ATOM   4185 O  O     . ALA B 1 195 ? 137.717 24.956  123.882 1.00 38.70  ?  194  ALA A O     1 
ATOM   4186 C  CB    . ALA B 1 195 ? 135.060 24.770  125.547 1.00 42.00  ?  194  ALA A CB    1 
ATOM   4187 N  N     . MET B 1 196 ? 136.344 23.597  122.735 1.00 36.57  ?  195  MET A N     1 
ATOM   4188 C  CA    . MET B 1 196 ? 137.443 22.909  122.077 1.00 40.74  ?  195  MET A CA    1 
ATOM   4189 C  C     . MET B 1 196 ? 137.583 23.315  120.613 1.00 35.73  ?  195  MET A C     1 
ATOM   4190 O  O     . MET B 1 196 ? 138.192 22.586  119.828 1.00 38.60  ?  195  MET A O     1 
ATOM   4191 C  CB    . MET B 1 196 ? 137.295 21.390  122.222 1.00 44.80  ?  195  MET A CB    1 
ATOM   4192 C  CG    . MET B 1 196 ? 136.052 20.781  121.641 1.00 43.38  ?  195  MET A CG    1 
ATOM   4193 S  SD    . MET B 1 196 ? 135.994 18.994  121.946 1.00 44.07  ?  195  MET A SD    1 
ATOM   4194 C  CE    . MET B 1 196 ? 135.695 18.945  123.701 1.00 42.43  ?  195  MET A CE    1 
ATOM   4195 N  N     . GLY B 1 197 ? 137.052 24.476  120.241 1.00 32.85  ?  196  GLY A N     1 
ATOM   4196 C  CA    . GLY B 1 197 ? 137.260 25.010  118.910 1.00 32.48  ?  196  GLY A CA    1 
ATOM   4197 C  C     . GLY B 1 197 ? 136.390 24.430  117.818 1.00 38.45  ?  196  GLY A C     1 
ATOM   4198 O  O     . GLY B 1 197 ? 136.744 24.543  116.640 1.00 36.52  ?  196  GLY A O     1 
ATOM   4199 N  N     . LEU B 1 198 ? 135.255 23.824  118.156 1.00 32.06  ?  197  LEU A N     1 
ATOM   4200 C  CA    . LEU B 1 198 ? 134.381 23.197  117.167 1.00 26.62  ?  197  LEU A CA    1 
ATOM   4201 C  C     . LEU B 1 198 ? 133.053 23.947  117.135 1.00 29.31  ?  197  LEU A C     1 
ATOM   4202 O  O     . LEU B 1 198 ? 132.277 23.889  118.094 1.00 31.14  ?  197  LEU A O     1 
ATOM   4203 C  CB    . LEU B 1 198 ? 134.172 21.717  117.488 1.00 26.39  ?  197  LEU A CB    1 
ATOM   4204 C  CG    . LEU B 1 198 ? 135.433 20.853  117.542 1.00 33.85  ?  197  LEU A CG    1 
ATOM   4205 C  CD1   . LEU B 1 198 ? 135.109 19.411  117.967 1.00 32.33  ?  197  LEU A CD1   1 
ATOM   4206 C  CD2   . LEU B 1 198 ? 136.155 20.870  116.191 1.00 30.24  ?  197  LEU A CD2   1 
ATOM   4207 N  N     . ARG B 1 199 ? 132.795 24.657  116.039 1.00 28.71  ?  198  ARG A N     1 
ATOM   4208 C  CA    . ARG B 1 199 ? 131.546 25.395  115.896 1.00 27.24  ?  198  ARG A CA    1 
ATOM   4209 C  C     . ARG B 1 199 ? 130.658 24.889  114.772 1.00 28.10  ?  198  ARG A C     1 
ATOM   4210 O  O     . ARG B 1 199 ? 129.432 24.981  114.883 1.00 25.73  ?  198  ARG A O     1 
ATOM   4211 C  CB    . ARG B 1 199 ? 131.820 26.897  115.658 1.00 25.57  ?  198  ARG A CB    1 
ATOM   4212 C  CG    . ARG B 1 199 ? 130.576 27.768  115.778 1.00 25.17  ?  198  ARG A CG    1 
ATOM   4213 C  CD    . ARG B 1 199 ? 130.900 29.248  115.511 1.00 26.63  ?  198  ARG A CD    1 
ATOM   4214 N  NE    . ARG B 1 199 ? 131.230 29.452  114.101 1.00 28.96  ?  198  ARG A NE    1 
ATOM   4215 C  CZ    . ARG B 1 199 ? 130.323 29.647  113.144 1.00 30.83  ?  198  ARG A CZ    1 
ATOM   4216 N  NH1   . ARG B 1 199 ? 129.031 29.690  113.455 1.00 28.10  ?  198  ARG A NH1   1 
ATOM   4217 N  NH2   . ARG B 1 199 ? 130.711 29.823  111.882 1.00 28.77  ?  198  ARG A NH2   1 
ATOM   4218 N  N     . THR B 1 200 ? 131.234 24.385  113.690 1.00 24.58  ?  199  THR A N     1 
ATOM   4219 C  CA    . THR B 1 200 ? 130.480 24.023  112.502 1.00 29.10  ?  199  THR A CA    1 
ATOM   4220 C  C     . THR B 1 200 ? 130.694 22.556  112.179 1.00 24.89  ?  199  THR A C     1 
ATOM   4221 O  O     . THR B 1 200 ? 131.655 21.936  112.637 1.00 24.44  ?  199  THR A O     1 
ATOM   4222 C  CB    . THR B 1 200 ? 130.921 24.831  111.289 1.00 25.22  ?  199  THR A CB    1 
ATOM   4223 O  OG1   . THR B 1 200 ? 132.300 24.529  111.040 1.00 27.36  ?  199  THR A OG1   1 
ATOM   4224 C  CG2   . THR B 1 200 ? 130.764 26.327  111.555 1.00 24.93  ?  199  THR A CG2   1 
ATOM   4225 N  N     . CYS B 1 201 ? 129.818 22.029  111.325 1.00 23.57  ?  200  CYS A N     1 
ATOM   4226 C  CA    . CYS B 1 201 ? 130.030 20.677  110.816 1.00 23.57  ?  200  CYS A CA    1 
ATOM   4227 C  C     . CYS B 1 201 ? 131.363 20.568  110.090 1.00 30.61  ?  200  CYS A C     1 
ATOM   4228 O  O     . CYS B 1 201 ? 132.028 19.529  110.152 1.00 26.31  ?  200  CYS A O     1 
ATOM   4229 C  CB    . CYS B 1 201 ? 128.885 20.265  109.893 1.00 25.61  ?  200  CYS A CB    1 
ATOM   4230 S  SG    . CYS B 1 201 ? 127.347 19.987  110.800 1.00 29.77  ?  200  CYS A SG    1 
ATOM   4231 N  N     . GLY B 1 202 ? 131.767 21.630  109.388 1.00 28.12  ?  201  GLY A N     1 
ATOM   4232 C  CA    . GLY B 1 202 ? 133.067 21.614  108.735 1.00 31.10  ?  201  GLY A CA    1 
ATOM   4233 C  C     . GLY B 1 202 ? 134.214 21.455  109.718 1.00 33.15  ?  201  GLY A C     1 
ATOM   4234 O  O     . GLY B 1 202 ? 135.203 20.776  109.427 1.00 32.06  ?  201  GLY A O     1 
ATOM   4235 N  N     . ASP B 1 203 ? 134.094 22.072  110.899 1.00 29.58  ?  202  ASP A N     1 
ATOM   4236 C  CA    . ASP B 1 203 ? 135.096 21.881  111.947 1.00 28.66  ?  202  ASP A CA    1 
ATOM   4237 C  C     . ASP B 1 203 ? 135.183 20.416  112.362 1.00 28.17  ?  202  ASP A C     1 
ATOM   4238 O  O     . ASP B 1 203 ? 136.278 19.855  112.481 1.00 32.50  ?  202  ASP A O     1 
ATOM   4239 C  CB    . ASP B 1 203 ? 134.768 22.744  113.167 1.00 28.80  ?  202  ASP A CB    1 
ATOM   4240 C  CG    . ASP B 1 203 ? 134.808 24.227  112.874 1.00 33.59  ?  202  ASP A CG    1 
ATOM   4241 O  OD1   . ASP B 1 203 ? 135.505 24.642  111.920 1.00 35.27  ?  202  ASP A OD1   1 
ATOM   4242 O  OD2   . ASP B 1 203 ? 134.153 24.986  113.620 1.00 30.36  ?  202  ASP A OD2   1 
ATOM   4243 N  N     . VAL B 1 204 ? 134.028 19.779  112.590 1.00 27.15  ?  203  VAL A N     1 
ATOM   4244 C  CA    . VAL B 1 204 ? 134.027 18.407  113.093 1.00 29.51  ?  203  VAL A CA    1 
ATOM   4245 C  C     . VAL B 1 204 ? 134.511 17.443  112.023 1.00 31.30  ?  203  VAL A C     1 
ATOM   4246 O  O     . VAL B 1 204 ? 135.104 16.403  112.336 1.00 29.25  ?  203  VAL A O     1 
ATOM   4247 C  CB    . VAL B 1 204 ? 132.624 18.034  113.616 1.00 24.86  ?  203  VAL A CB    1 
ATOM   4248 C  CG1   . VAL B 1 204 ? 132.538 16.556  113.925 1.00 24.92  ?  203  VAL A CG1   1 
ATOM   4249 C  CG2   . VAL B 1 204 ? 132.311 18.838  114.878 1.00 24.75  ?  203  VAL A CG2   1 
ATOM   4250 N  N     . GLN B 1 205 ? 134.285 17.764  110.751 1.00 29.55  ?  204  GLN A N     1 
ATOM   4251 C  CA    . GLN B 1 205 ? 134.811 16.914  109.687 1.00 29.95  ?  204  GLN A CA    1 
ATOM   4252 C  C     . GLN B 1 205 ? 136.331 16.785  109.767 1.00 34.81  ?  204  GLN A C     1 
ATOM   4253 O  O     . GLN B 1 205 ? 136.895 15.786  109.309 1.00 36.20  ?  204  GLN A O     1 
ATOM   4254 C  CB    . GLN B 1 205 ? 134.398 17.463  108.318 1.00 28.68  ?  204  GLN A CB    1 
ATOM   4255 C  CG    . GLN B 1 205 ? 132.911 17.387  108.014 1.00 26.53  ?  204  GLN A CG    1 
ATOM   4256 C  CD    . GLN B 1 205 ? 132.582 17.995  106.661 1.00 32.20  ?  204  GLN A CD    1 
ATOM   4257 O  OE1   . GLN B 1 205 ? 133.479 18.338  105.895 1.00 35.50  ?  204  GLN A OE1   1 
ATOM   4258 N  NE2   . GLN B 1 205 ? 131.299 18.145  106.369 1.00 30.31  ?  204  GLN A NE2   1 
ATOM   4259 N  N     . LYS B 1 206 ? 137.007 17.775  110.344 1.00 32.37  ?  205  LYS A N     1 
ATOM   4260 C  CA    . LYS B 1 206 ? 138.456 17.735  110.498 1.00 44.89  ?  205  LYS A CA    1 
ATOM   4261 C  C     . LYS B 1 206 ? 138.913 16.924  111.709 1.00 46.16  ?  205  LYS A C     1 
ATOM   4262 O  O     . LYS B 1 206 ? 140.123 16.842  111.952 1.00 44.18  ?  205  LYS A O     1 
ATOM   4263 C  CB    . LYS B 1 206 ? 139.006 19.159  110.606 1.00 47.99  ?  205  LYS A CB    1 
ATOM   4264 C  CG    . LYS B 1 206 ? 138.692 20.055  109.416 1.00 47.53  ?  205  LYS A CG    1 
ATOM   4265 C  CD    . LYS B 1 206 ? 139.218 21.450  109.666 1.00 49.62  ?  205  LYS A CD    1 
ATOM   4266 C  CE    . LYS B 1 206 ? 138.864 22.398  108.542 1.00 60.48  ?  205  LYS A CE    1 
ATOM   4267 N  NZ    . LYS B 1 206 ? 139.318 23.777  108.869 1.00 69.18  ?  205  LYS A NZ    1 
ATOM   4268 N  N     . CYS B 1 207 ? 137.988 16.328  112.461 1.00 40.99  ?  206  CYS A N     1 
ATOM   4269 C  CA    . CYS B 1 207 ? 138.291 15.625  113.702 1.00 40.44  ?  206  CYS A CA    1 
ATOM   4270 C  C     . CYS B 1 207 ? 138.331 14.118  113.500 1.00 37.70  ?  206  CYS A C     1 
ATOM   4271 O  O     . CYS B 1 207 ? 137.623 13.560  112.658 1.00 46.20  ?  206  CYS A O     1 
ATOM   4272 C  CB    . CYS B 1 207 ? 137.253 15.931  114.784 1.00 44.30  ?  206  CYS A CB    1 
ATOM   4273 S  SG    . CYS B 1 207 ? 137.282 17.607  115.424 1.00 43.73  ?  206  CYS A SG    1 
ATOM   4274 N  N     . ASP B 1 208 ? 139.133 13.461  114.330 1.00 36.23  ?  207  ASP A N     1 
ATOM   4275 C  CA    . ASP B 1 208 ? 139.206 12.006  114.348 1.00 42.27  ?  207  ASP A CA    1 
ATOM   4276 C  C     . ASP B 1 208 ? 137.996 11.419  115.080 1.00 36.15  ?  207  ASP A C     1 
ATOM   4277 O  O     . ASP B 1 208 ? 137.609 11.896  116.148 1.00 33.72  ?  207  ASP A O     1 
ATOM   4278 C  CB    . ASP B 1 208 ? 140.525 11.589  115.012 1.00 50.71  ?  207  ASP A CB    1 
ATOM   4279 C  CG    . ASP B 1 208 ? 140.481 10.203  115.622 1.00 69.69  ?  207  ASP A CG    1 
ATOM   4280 O  OD1   . ASP B 1 208 ? 139.978 9.261   114.972 1.00 68.19  ?  207  ASP A OD1   1 
ATOM   4281 O  OD2   . ASP B 1 208 ? 140.978 10.057  116.760 1.00 78.50  ?  207  ASP A OD2   1 
ATOM   4282 N  N     . LEU B 1 209 ? 137.382 10.386  114.491 1.00 33.57  ?  208  LEU A N     1 
ATOM   4283 C  CA    . LEU B 1 209 ? 136.241 9.751   115.149 1.00 29.13  ?  208  LEU A CA    1 
ATOM   4284 C  C     . LEU B 1 209 ? 136.623 9.221   116.526 1.00 29.92  ?  208  LEU A C     1 
ATOM   4285 O  O     . LEU B 1 209 ? 135.836 9.315   117.479 1.00 29.53  ?  208  LEU A O     1 
ATOM   4286 C  CB    . LEU B 1 209 ? 135.675 8.619   114.276 1.00 28.97  ?  208  LEU A CB    1 
ATOM   4287 C  CG    . LEU B 1 209 ? 134.673 7.701   114.981 1.00 32.07  ?  208  LEU A CG    1 
ATOM   4288 C  CD1   . LEU B 1 209 ? 133.431 8.467   115.405 1.00 30.80  ?  208  LEU A CD1   1 
ATOM   4289 C  CD2   . LEU B 1 209 ? 134.306 6.501   114.100 1.00 29.57  ?  208  LEU A CD2   1 
ATOM   4290 N  N     . VAL B 1 210 ? 137.828 8.658   116.653 1.00 34.55  ?  209  VAL A N     1 
ATOM   4291 C  CA    . VAL B 1 210 ? 138.253 8.098   117.935 1.00 34.45  ?  209  VAL A CA    1 
ATOM   4292 C  C     . VAL B 1 210 ? 138.291 9.185   119.000 1.00 32.07  ?  209  VAL A C     1 
ATOM   4293 O  O     . VAL B 1 210 ? 137.854 8.971   120.137 1.00 33.56  ?  209  VAL A O     1 
ATOM   4294 C  CB    . VAL B 1 210 ? 139.614 7.387   117.801 1.00 39.51  ?  209  VAL A CB    1 
ATOM   4295 C  CG1   . VAL B 1 210 ? 140.079 6.899   119.169 1.00 43.40  ?  209  VAL A CG1   1 
ATOM   4296 C  CG2   . VAL B 1 210 ? 139.524 6.198   116.816 1.00 35.05  ?  209  VAL A CG2   1 
ATOM   4297 N  N     . MET B 1 211 ? 138.781 10.377  118.641 1.00 31.93  ?  210  MET A N     1 
ATOM   4298 C  CA    . MET B 1 211 ? 138.793 11.484  119.594 1.00 35.86  ?  210  MET A CA    1 
ATOM   4299 C  C     . MET B 1 211 ? 137.381 11.837  120.038 1.00 37.72  ?  210  MET A C     1 
ATOM   4300 O  O     . MET B 1 211 ? 137.135 12.037  121.233 1.00 33.82  ?  210  MET A O     1 
ATOM   4301 C  CB    . MET B 1 211 ? 139.491 12.700  118.984 1.00 40.68  ?  210  MET A CB    1 
ATOM   4302 C  CG    . MET B 1 211 ? 139.604 13.900  119.925 1.00 54.90  ?  210  MET A CG    1 
ATOM   4303 S  SD    . MET B 1 211 ? 138.194 15.031  119.861 1.00 61.85  ?  210  MET A SD    1 
ATOM   4304 C  CE    . MET B 1 211 ? 138.374 15.697  118.205 1.00 59.32  ?  210  MET A CE    1 
ATOM   4305 N  N     . LEU B 1 212 ? 136.432 11.888  119.088 1.00 34.35  ?  211  LEU A N     1 
ATOM   4306 C  CA    . LEU B 1 212 ? 135.060 12.272  119.418 1.00 34.20  ?  211  LEU A CA    1 
ATOM   4307 C  C     . LEU B 1 212 ? 134.379 11.228  120.295 1.00 33.26  ?  211  LEU A C     1 
ATOM   4308 O  O     . LEU B 1 212 ? 133.651 11.581  121.232 1.00 34.56  ?  211  LEU A O     1 
ATOM   4309 C  CB    . LEU B 1 212 ? 134.257 12.517  118.133 1.00 28.26  ?  211  LEU A CB    1 
ATOM   4310 C  CG    . LEU B 1 212 ? 134.713 13.685  117.249 1.00 30.66  ?  211  LEU A CG    1 
ATOM   4311 C  CD1   . LEU B 1 212 ? 134.076 13.639  115.860 1.00 28.46  ?  211  LEU A CD1   1 
ATOM   4312 C  CD2   . LEU B 1 212 ? 134.383 15.015  117.915 1.00 30.95  ?  211  LEU A CD2   1 
ATOM   4313 N  N     . LEU B 1 213 ? 134.614 9.937   120.017 1.00 30.92  ?  212  LEU A N     1 
ATOM   4314 C  CA    . LEU B 1 213 ? 134.110 8.878   120.890 1.00 31.48  ?  212  LEU A CA    1 
ATOM   4315 C  C     . LEU B 1 213 ? 134.668 9.019   122.303 1.00 39.61  ?  212  LEU A C     1 
ATOM   4316 O  O     . LEU B 1 213 ? 133.940 8.855   123.289 1.00 38.10  ?  212  LEU A O     1 
ATOM   4317 C  CB    . LEU B 1 213 ? 134.465 7.500   120.314 1.00 32.03  ?  212  LEU A CB    1 
ATOM   4318 C  CG    . LEU B 1 213 ? 133.762 7.035   119.034 1.00 34.90  ?  212  LEU A CG    1 
ATOM   4319 C  CD1   . LEU B 1 213 ? 134.350 5.721   118.542 1.00 35.31  ?  212  LEU A CD1   1 
ATOM   4320 C  CD2   . LEU B 1 213 ? 132.275 6.879   119.272 1.00 39.10  ?  212  LEU A CD2   1 
ATOM   4321 N  N     . LYS B 1 214 ? 135.959 9.328   122.419 1.00 33.31  ?  213  LYS A N     1 
ATOM   4322 C  CA    . LYS B 1 214 ? 136.574 9.448   123.739 1.00 43.52  ?  213  LYS A CA    1 
ATOM   4323 C  C     . LYS B 1 214 ? 136.020 10.640  124.508 1.00 46.04  ?  213  LYS A C     1 
ATOM   4324 O  O     . LYS B 1 214 ? 135.748 10.541  125.711 1.00 49.90  ?  213  LYS A O     1 
ATOM   4325 C  CB    . LYS B 1 214 ? 138.090 9.572   123.608 1.00 50.39  ?  213  LYS A CB    1 
ATOM   4326 C  CG    . LYS B 1 214 ? 138.795 8.326   123.111 1.00 62.17  ?  213  LYS A CG    1 
ATOM   4327 C  CD    . LYS B 1 214 ? 140.246 8.313   123.579 1.00 73.87  ?  213  LYS A CD    1 
ATOM   4328 C  CE    . LYS B 1 214 ? 140.950 9.626   123.257 1.00 79.44  ?  213  LYS A CE    1 
ATOM   4329 N  NZ    . LYS B 1 214 ? 142.328 9.675   123.825 1.00 85.80  ?  213  LYS A NZ    1 
ATOM   4330 N  N     . ARG B 1 215 ? 135.867 11.779  123.835 1.00 40.31  ?  214  ARG A N     1 
ATOM   4331 C  CA    . ARG B 1 215 ? 135.413 12.994  124.505 1.00 42.48  ?  214  ARG A CA    1 
ATOM   4332 C  C     . ARG B 1 215 ? 133.909 13.002  124.749 1.00 47.65  ?  214  ARG A C     1 
ATOM   4333 O  O     . ARG B 1 215 ? 133.454 13.589  125.738 1.00 46.61  ?  214  ARG A O     1 
ATOM   4334 C  CB    . ARG B 1 215 ? 135.805 14.222  123.682 1.00 46.80  ?  214  ARG A CB    1 
ATOM   4335 C  CG    . ARG B 1 215 ? 136.965 15.017  124.248 1.00 64.77  ?  214  ARG A CG    1 
ATOM   4336 C  CD    . ARG B 1 215 ? 136.676 15.452  125.675 1.00 78.04  ?  214  ARG A CD    1 
ATOM   4337 N  NE    . ARG B 1 215 ? 137.142 16.809  125.940 1.00 89.82  ?  214  ARG A NE    1 
ATOM   4338 C  CZ    . ARG B 1 215 ? 137.218 17.347  127.153 1.00 99.61  ?  214  ARG A CZ    1 
ATOM   4339 N  NH1   . ARG B 1 215 ? 137.649 18.594  127.302 1.00 100.99 ?  214  ARG A NH1   1 
ATOM   4340 N  NH2   . ARG B 1 215 ? 136.860 16.639  128.218 1.00 104.56 ?  214  ARG A NH2   1 
ATOM   4341 N  N     . PHE B 1 216 ? 133.124 12.372  123.870 1.00 36.99  ?  215  PHE A N     1 
ATOM   4342 C  CA    . PHE B 1 216 ? 131.672 12.479  123.932 1.00 39.21  ?  215  PHE A CA    1 
ATOM   4343 C  C     . PHE B 1 216 ? 130.928 11.155  124.016 1.00 40.05  ?  215  PHE A C     1 
ATOM   4344 O  O     . PHE B 1 216 ? 129.703 11.178  124.175 1.00 37.90  ?  215  PHE A O     1 
ATOM   4345 C  CB    . PHE B 1 216 ? 131.136 13.254  122.713 1.00 29.38  ?  215  PHE A CB    1 
ATOM   4346 C  CG    . PHE B 1 216 ? 131.598 14.682  122.649 1.00 37.95  ?  215  PHE A CG    1 
ATOM   4347 C  CD1   . PHE B 1 216 ? 130.892 15.681  123.305 1.00 40.51  ?  215  PHE A CD1   1 
ATOM   4348 C  CD2   . PHE B 1 216 ? 132.731 15.029  121.930 1.00 38.02  ?  215  PHE A CD2   1 
ATOM   4349 C  CE1   . PHE B 1 216 ? 131.308 16.993  123.245 1.00 45.02  ?  215  PHE A CE1   1 
ATOM   4350 C  CE2   . PHE B 1 216 ? 133.153 16.347  121.867 1.00 46.48  ?  215  PHE A CE2   1 
ATOM   4351 C  CZ    . PHE B 1 216 ? 132.442 17.330  122.530 1.00 45.21  ?  215  PHE A CZ    1 
ATOM   4352 N  N     . GLY B 1 217 ? 131.603 10.012  123.907 1.00 45.60  ?  216  GLY A N     1 
ATOM   4353 C  CA    . GLY B 1 217 ? 130.860 8.764   123.924 1.00 43.75  ?  216  GLY A CA    1 
ATOM   4354 C  C     . GLY B 1 217 ? 130.032 8.581   122.662 1.00 47.67  ?  216  GLY A C     1 
ATOM   4355 O  O     . GLY B 1 217 ? 130.412 9.017   121.568 1.00 40.46  ?  216  GLY A O     1 
ATOM   4356 N  N     . LYS B 1 218 ? 128.868 7.932   122.821 1.00 40.17  ?  217  LYS A N     1 
ATOM   4357 C  CA    . LYS B 1 218 ? 127.986 7.687   121.676 1.00 42.25  ?  217  LYS A CA    1 
ATOM   4358 C  C     . LYS B 1 218 ? 127.643 8.979   120.948 1.00 38.83  ?  217  LYS A C     1 
ATOM   4359 O  O     . LYS B 1 218 ? 127.570 9.008   119.712 1.00 38.68  ?  217  LYS A O     1 
ATOM   4360 C  CB    . LYS B 1 218 ? 126.692 7.004   122.118 1.00 46.17  ?  217  LYS A CB    1 
ATOM   4361 C  CG    . LYS B 1 218 ? 125.646 7.002   121.001 1.00 53.01  ?  217  LYS A CG    1 
ATOM   4362 C  CD    . LYS B 1 218 ? 124.221 6.808   121.484 1.00 60.55  ?  217  LYS A CD    1 
ATOM   4363 C  CE    . LYS B 1 218 ? 123.898 5.342   121.662 1.00 69.29  ?  217  LYS A CE    1 
ATOM   4364 N  NZ    . LYS B 1 218 ? 122.460 5.065   121.399 1.00 72.51  ?  217  LYS A NZ    1 
ATOM   4365 N  N     . PHE B 1 219 ? 127.383 10.045  121.704 1.00 34.76  ?  218  PHE A N     1 
ATOM   4366 C  CA    . PHE B 1 219 ? 127.132 11.349  121.105 1.00 34.84  ?  218  PHE A CA    1 
ATOM   4367 C  C     . PHE B 1 219 ? 128.248 11.741  120.146 1.00 27.81  ?  218  PHE A C     1 
ATOM   4368 O  O     . PHE B 1 219 ? 128.000 12.418  119.143 1.00 28.29  ?  218  PHE A O     1 
ATOM   4369 C  CB    . PHE B 1 219 ? 126.973 12.389  122.219 1.00 33.46  ?  218  PHE A CB    1 
ATOM   4370 C  CG    . PHE B 1 219 ? 126.613 13.778  121.733 1.00 37.90  ?  218  PHE A CG    1 
ATOM   4371 C  CD1   . PHE B 1 219 ? 125.345 14.056  121.249 1.00 44.60  ?  218  PHE A CD1   1 
ATOM   4372 C  CD2   . PHE B 1 219 ? 127.536 14.811  121.804 1.00 37.47  ?  218  PHE A CD2   1 
ATOM   4373 C  CE1   . PHE B 1 219 ? 125.015 15.333  120.822 1.00 42.06  ?  218  PHE A CE1   1 
ATOM   4374 C  CE2   . PHE B 1 219 ? 127.209 16.093  121.377 1.00 43.17  ?  218  PHE A CE2   1 
ATOM   4375 C  CZ    . PHE B 1 219 ? 125.948 16.351  120.886 1.00 41.95  ?  218  PHE A CZ    1 
ATOM   4376 N  N     . GLY B 1 220 ? 129.483 11.331  120.439 1.00 29.01  ?  219  GLY A N     1 
ATOM   4377 C  CA    . GLY B 1 220 ? 130.583 11.649  119.552 1.00 28.30  ?  219  GLY A CA    1 
ATOM   4378 C  C     . GLY B 1 220 ? 130.446 10.981  118.199 1.00 25.72  ?  219  GLY A C     1 
ATOM   4379 O  O     . GLY B 1 220 ? 130.853 11.551  117.185 1.00 27.54  ?  219  GLY A O     1 
ATOM   4380 N  N     . ARG B 1 221 ? 129.872 9.771   118.164 1.00 25.83  ?  220  ARG A N     1 
ATOM   4381 C  CA    . ARG B 1 221 ? 129.617 9.118   116.884 1.00 25.58  ?  220  ARG A CA    1 
ATOM   4382 C  C     . ARG B 1 221 ? 128.526 9.843   116.113 1.00 24.62  ?  220  ARG A C     1 
ATOM   4383 O  O     . ARG B 1 221 ? 128.632 10.019  114.894 1.00 24.38  ?  220  ARG A O     1 
ATOM   4384 C  CB    . ARG B 1 221 ? 129.240 7.643   117.086 1.00 28.26  ?  220  ARG A CB    1 
ATOM   4385 C  CG    . ARG B 1 221 ? 128.871 6.936   115.778 1.00 26.04  ?  220  ARG A CG    1 
ATOM   4386 C  CD    . ARG B 1 221 ? 128.633 5.436   115.997 1.00 27.87  ?  220  ARG A CD    1 
ATOM   4387 N  NE    . ARG B 1 221 ? 129.828 4.761   116.506 1.00 30.44  ?  220  ARG A NE    1 
ATOM   4388 C  CZ    . ARG B 1 221 ? 130.854 4.410   115.739 1.00 30.05  ?  220  ARG A CZ    1 
ATOM   4389 N  NH1   . ARG B 1 221 ? 130.823 4.674   114.443 1.00 27.65  ?  220  ARG A NH1   1 
ATOM   4390 N  NH2   . ARG B 1 221 ? 131.908 3.799   116.263 1.00 29.16  ?  220  ARG A NH2   1 
ATOM   4391 N  N     . ILE B 1 222 ? 127.480 10.298  116.809 1.00 27.50  ?  221  ILE A N     1 
ATOM   4392 C  CA    . ILE B 1 222 ? 126.411 11.037  116.136 1.00 25.86  ?  221  ILE A CA    1 
ATOM   4393 C  C     . ILE B 1 222 ? 126.958 12.333  115.548 1.00 23.96  ?  221  ILE A C     1 
ATOM   4394 O  O     . ILE B 1 222 ? 126.688 12.666  114.391 1.00 24.07  ?  221  ILE A O     1 
ATOM   4395 C  CB    . ILE B 1 222 ? 125.239 11.304  117.101 1.00 39.34  ?  221  ILE A CB    1 
ATOM   4396 C  CG1   . ILE B 1 222 ? 124.699 9.996   117.697 1.00 35.18  ?  221  ILE A CG1   1 
ATOM   4397 C  CG2   . ILE B 1 222 ? 124.118 12.031  116.376 1.00 41.87  ?  221  ILE A CG2   1 
ATOM   4398 C  CD1   . ILE B 1 222 ? 124.020 9.092   116.700 1.00 38.55  ?  221  ILE A CD1   1 
ATOM   4399 N  N     . LEU B 1 223 ? 127.748 13.078  116.332 1.00 25.79  ?  222  LEU A N     1 
ATOM   4400 C  CA    . LEU B 1 223 ? 128.368 14.300  115.809 1.00 27.02  ?  222  LEU A CA    1 
ATOM   4401 C  C     . LEU B 1 223 ? 129.181 14.009  114.553 1.00 27.61  ?  222  LEU A C     1 
ATOM   4402 O  O     . LEU B 1 223 ? 129.090 14.738  113.555 1.00 25.33  ?  222  LEU A O     1 
ATOM   4403 C  CB    . LEU B 1 223 ? 129.267 14.938  116.866 1.00 32.41  ?  222  LEU A CB    1 
ATOM   4404 C  CG    . LEU B 1 223 ? 128.654 15.804  117.956 1.00 43.04  ?  222  LEU A CG    1 
ATOM   4405 C  CD1   . LEU B 1 223 ? 129.727 16.175  118.964 1.00 45.03  ?  222  LEU A CD1   1 
ATOM   4406 C  CD2   . LEU B 1 223 ? 128.051 17.046  117.327 1.00 30.58  ?  222  LEU A CD2   1 
ATOM   4407 N  N     . TRP B 1 224 ? 129.982 12.938  114.589 1.00 24.16  ?  223  TRP A N     1 
ATOM   4408 C  CA    . TRP B 1 224 ? 130.817 12.577  113.446 1.00 24.54  ?  223  TRP A CA    1 
ATOM   4409 C  C     . TRP B 1 224 ? 129.966 12.256  112.225 1.00 27.51  ?  223  TRP A C     1 
ATOM   4410 O  O     . TRP B 1 224 ? 130.268 12.700  111.111 1.00 26.33  ?  223  TRP A O     1 
ATOM   4411 C  CB    . TRP B 1 224 ? 131.712 11.386  113.815 1.00 27.40  ?  223  TRP A CB    1 
ATOM   4412 C  CG    . TRP B 1 224 ? 132.661 10.971  112.725 1.00 29.70  ?  223  TRP A CG    1 
ATOM   4413 C  CD1   . TRP B 1 224 ? 133.911 11.475  112.486 1.00 35.23  ?  223  TRP A CD1   1 
ATOM   4414 C  CD2   . TRP B 1 224 ? 132.432 9.976   111.726 1.00 26.07  ?  223  TRP A CD2   1 
ATOM   4415 N  NE1   . TRP B 1 224 ? 134.473 10.846  111.404 1.00 38.92  ?  223  TRP A NE1   1 
ATOM   4416 C  CE2   . TRP B 1 224 ? 133.589 9.919   110.920 1.00 37.33  ?  223  TRP A CE2   1 
ATOM   4417 C  CE3   . TRP B 1 224 ? 131.373 9.101   111.453 1.00 25.73  ?  223  TRP A CE3   1 
ATOM   4418 C  CZ2   . TRP B 1 224 ? 133.706 9.040   109.843 1.00 39.23  ?  223  TRP A CZ2   1 
ATOM   4419 C  CZ3   . TRP B 1 224 ? 131.487 8.236   110.379 1.00 27.38  ?  223  TRP A CZ3   1 
ATOM   4420 C  CH2   . TRP B 1 224 ? 132.647 8.210   109.588 1.00 34.86  ?  223  TRP A CH2   1 
ATOM   4421 N  N     . GLU B 1 225 ? 128.900 11.469  112.413 1.00 26.46  ?  224  GLU A N     1 
ATOM   4422 C  CA    . GLU B 1 225 ? 128.017 11.131  111.298 1.00 25.26  ?  224  GLU A CA    1 
ATOM   4423 C  C     . GLU B 1 225 ? 127.336 12.380  110.742 1.00 28.21  ?  224  GLU A C     1 
ATOM   4424 O  O     . GLU B 1 225 ? 127.458 12.701  109.550 1.00 27.37  ?  224  GLU A O     1 
ATOM   4425 C  CB    . GLU B 1 225 ? 126.967 10.102  111.746 1.00 23.38  ?  224  GLU A CB    1 
ATOM   4426 C  CG    . GLU B 1 225 ? 127.537 8.728   112.103 1.00 27.11  ?  224  GLU A CG    1 
ATOM   4427 C  CD    . GLU B 1 225 ? 126.473 7.735   112.555 1.00 35.61  ?  224  GLU A CD    1 
ATOM   4428 O  OE1   . GLU B 1 225 ? 125.274 8.092   112.590 1.00 36.06  ?  224  GLU A OE1   1 
ATOM   4429 O  OE2   . GLU B 1 225 ? 126.837 6.589   112.877 1.00 38.62  ?  224  GLU A OE2   1 
ATOM   4430 N  N     . ARG B 1 226 ? 126.601 13.095  111.596 1.00 27.51  ?  225  ARG A N     1 
ATOM   4431 C  CA    . ARG B 1 226 ? 125.812 14.230  111.122 1.00 22.42  ?  225  ARG A CA    1 
ATOM   4432 C  C     . ARG B 1 226 ? 126.683 15.289  110.460 1.00 26.82  ?  225  ARG A C     1 
ATOM   4433 O  O     . ARG B 1 226 ? 126.232 15.969  109.532 1.00 29.25  ?  225  ARG A O     1 
ATOM   4434 C  CB    . ARG B 1 226 ? 125.043 14.872  112.284 1.00 26.40  ?  225  ARG A CB    1 
ATOM   4435 C  CG    . ARG B 1 226 ? 124.166 13.941  113.095 1.00 27.65  ?  225  ARG A CG    1 
ATOM   4436 C  CD    . ARG B 1 226 ? 123.001 13.364  112.294 1.00 31.02  ?  225  ARG A CD    1 
ATOM   4437 N  NE    . ARG B 1 226 ? 122.233 12.430  113.124 1.00 28.38  ?  225  ARG A NE    1 
ATOM   4438 C  CZ    . ARG B 1 226 ? 122.462 11.121  113.171 1.00 33.15  ?  225  ARG A CZ    1 
ATOM   4439 N  NH1   . ARG B 1 226 ? 121.732 10.340  113.961 1.00 37.49  ?  225  ARG A NH1   1 
ATOM   4440 N  NH2   . ARG B 1 226 ? 123.413 10.585  112.414 1.00 30.02  ?  225  ARG A NH2   1 
ATOM   4441 N  N     . SER B 1 227 ? 127.922 15.464  110.929 1.00 24.96  ?  226  SER A N     1 
ATOM   4442 C  CA    . SER B 1 227 ? 128.772 16.501  110.344 1.00 26.46  ?  226  SER A CA    1 
ATOM   4443 C  C     . SER B 1 227 ? 129.142 16.178  108.908 1.00 32.46  ?  226  SER A C     1 
ATOM   4444 O  O     . SER B 1 227 ? 129.596 17.062  108.172 1.00 35.36  ?  226  SER A O     1 
ATOM   4445 C  CB    . SER B 1 227 ? 130.025 16.689  111.189 1.00 23.50  ?  226  SER A CB    1 
ATOM   4446 O  OG    . SER B 1 227 ? 129.646 17.264  112.421 1.00 34.74  ?  226  SER A OG    1 
ATOM   4447 N  N     . GLN B 1 228 ? 128.953 14.928  108.507 1.00 26.68  ?  227  GLN A N     1 
ATOM   4448 C  CA    . GLN B 1 228 ? 129.116 14.492  107.132 1.00 34.88  ?  227  GLN A CA    1 
ATOM   4449 C  C     . GLN B 1 228 ? 127.794 14.280  106.429 1.00 29.06  ?  227  GLN A C     1 
ATOM   4450 O  O     . GLN B 1 228 ? 127.783 13.832  105.280 1.00 33.44  ?  227  GLN A O     1 
ATOM   4451 C  CB    . GLN B 1 228 ? 129.896 13.195  107.085 1.00 37.57  ?  227  GLN A CB    1 
ATOM   4452 C  CG    . GLN B 1 228 ? 131.247 13.293  107.659 1.00 48.33  ?  227  GLN A CG    1 
ATOM   4453 C  CD    . GLN B 1 228 ? 131.835 11.936  107.775 1.00 48.40  ?  227  GLN A CD    1 
ATOM   4454 O  OE1   . GLN B 1 228 ? 132.393 11.410  106.811 1.00 52.61  ?  227  GLN A OE1   1 
ATOM   4455 N  NE2   . GLN B 1 228 ? 131.673 11.324  108.940 1.00 34.48  ?  227  GLN A NE2   1 
ATOM   4456 N  N     . GLY B 1 229 ? 126.681 14.569  107.085 1.00 29.54  ?  228  GLY A N     1 
ATOM   4457 C  CA    . GLY B 1 229 ? 125.412 14.335  106.446 1.00 27.73  ?  228  GLY A CA    1 
ATOM   4458 C  C     . GLY B 1 229 ? 124.917 12.917  106.531 1.00 25.32  ?  228  GLY A C     1 
ATOM   4459 O  O     . GLY B 1 229 ? 123.925 12.590  105.877 1.00 29.29  ?  228  GLY A O     1 
ATOM   4460 N  N     . ILE B 1 230 ? 125.569 12.069  107.320 1.00 27.94  ?  229  ILE A N     1 
ATOM   4461 C  CA    . ILE B 1 230 ? 125.100 10.703  107.533 1.00 29.35  ?  229  ILE A CA    1 
ATOM   4462 C  C     . ILE B 1 230 ? 124.032 10.706  108.617 1.00 24.75  ?  229  ILE A C     1 
ATOM   4463 O  O     . ILE B 1 230 ? 124.231 11.257  109.706 1.00 23.58  ?  229  ILE A O     1 
ATOM   4464 C  CB    . ILE B 1 230 ? 126.266 9.781   107.917 1.00 25.43  ?  229  ILE A CB    1 
ATOM   4465 C  CG1   . ILE B 1 230 ? 127.319 9.749   106.804 1.00 28.02  ?  229  ILE A CG1   1 
ATOM   4466 C  CG2   . ILE B 1 230 ? 125.746 8.396   108.308 1.00 28.15  ?  229  ILE A CG2   1 
ATOM   4467 C  CD1   . ILE B 1 230 ? 128.657 9.210   107.276 1.00 31.18  ?  229  ILE A CD1   1 
ATOM   4468 N  N     . ASP B 1 231 ? 122.891 10.085  108.316 1.00 23.91  ?  230  ASP A N     1 
ATOM   4469 C  CA    . ASP B 1 231 ? 121.777 10.022  109.259 1.00 22.50  ?  230  ASP A CA    1 
ATOM   4470 C  C     . ASP B 1 231 ? 120.862 8.923   108.724 1.00 22.58  ?  230  ASP A C     1 
ATOM   4471 O  O     . ASP B 1 231 ? 119.962 9.190   107.931 1.00 25.27  ?  230  ASP A O     1 
ATOM   4472 C  CB    . ASP B 1 231 ? 121.027 11.333  109.394 1.00 22.53  ?  230  ASP A CB    1 
ATOM   4473 C  CG    . ASP B 1 231 ? 119.857 11.242  110.383 1.00 29.14  ?  230  ASP A CG    1 
ATOM   4474 O  OD1   . ASP B 1 231 ? 119.603 10.143  110.945 1.00 25.65  ?  230  ASP A OD1   1 
ATOM   4475 O  OD2   . ASP B 1 231 ? 119.170 12.272  110.598 1.00 29.18  ?  230  ASP A OD2   1 
ATOM   4476 N  N     . GLU B 1 232 ? 121.121 7.693   109.156 1.00 25.48  ?  231  GLU A N     1 
ATOM   4477 C  CA    . GLU B 1 232 ? 120.398 6.563   108.592 1.00 24.14  ?  231  GLU A CA    1 
ATOM   4478 C  C     . GLU B 1 232 ? 119.125 6.229   109.359 1.00 31.02  ?  231  GLU A C     1 
ATOM   4479 O  O     . GLU B 1 232 ? 118.510 5.187   109.101 1.00 35.47  ?  231  GLU A O     1 
ATOM   4480 C  CB    . GLU B 1 232 ? 121.325 5.355   108.508 1.00 28.32  ?  231  GLU A CB    1 
ATOM   4481 C  CG    . GLU B 1 232 ? 122.367 5.523   107.420 1.00 31.15  ?  231  GLU A CG    1 
ATOM   4482 C  CD    . GLU B 1 232 ? 123.181 4.284   107.196 1.00 61.96  ?  231  GLU A CD    1 
ATOM   4483 O  OE1   . GLU B 1 232 ? 124.329 4.243   107.688 1.00 63.63  ?  231  GLU A OE1   1 
ATOM   4484 O  OE2   . GLU B 1 232 ? 122.667 3.349   106.538 1.00 75.42  ?  231  GLU A OE2   1 
ATOM   4485 N  N     . ARG B 1 233 ? 118.692 7.098   110.265 1.00 27.15  ?  232  ARG A N     1 
ATOM   4486 C  CA    . ARG B 1 233 ? 117.481 6.835   111.030 1.00 27.59  ?  232  ARG A CA    1 
ATOM   4487 C  C     . ARG B 1 233 ? 116.272 6.780   110.107 1.00 27.32  ?  232  ARG A C     1 
ATOM   4488 O  O     . ARG B 1 233 ? 116.003 7.720   109.356 1.00 27.64  ?  232  ARG A O     1 
ATOM   4489 C  CB    . ARG B 1 233 ? 117.288 7.909   112.107 1.00 27.37  ?  232  ARG A CB    1 
ATOM   4490 C  CG    . ARG B 1 233 ? 118.384 7.930   113.154 1.00 27.96  ?  232  ARG A CG    1 
ATOM   4491 C  CD    . ARG B 1 233 ? 118.199 9.119   114.076 1.00 33.26  ?  232  ARG A CD    1 
ATOM   4492 N  NE    . ARG B 1 233 ? 118.236 10.364  113.314 1.00 25.08  ?  232  ARG A NE    1 
ATOM   4493 C  CZ    . ARG B 1 233 ? 117.653 11.492  113.701 1.00 32.34  ?  232  ARG A CZ    1 
ATOM   4494 N  NH1   . ARG B 1 233 ? 116.967 11.545  114.844 1.00 29.24  ?  232  ARG A NH1   1 
ATOM   4495 N  NH2   . ARG B 1 233 ? 117.742 12.567  112.933 1.00 28.80  ?  232  ARG A NH2   1 
ATOM   4496 N  N     . ASP B 1 234 ? 115.550 5.662   110.153 1.00 24.20  ?  233  ASP A N     1 
ATOM   4497 C  CA    . ASP B 1 234 ? 114.384 5.464   109.308 1.00 26.78  ?  233  ASP A CA    1 
ATOM   4498 C  C     . ASP B 1 234 ? 113.167 6.164   109.892 1.00 25.06  ?  233  ASP A C     1 
ATOM   4499 O  O     . ASP B 1 234 ? 112.966 6.173   111.112 1.00 28.58  ?  233  ASP A O     1 
ATOM   4500 C  CB    . ASP B 1 234 ? 114.101 3.962   109.186 1.00 27.52  ?  233  ASP A CB    1 
ATOM   4501 C  CG    . ASP B 1 234 ? 113.328 3.594   107.927 1.00 42.31  ?  233  ASP A CG    1 
ATOM   4502 O  OD1   . ASP B 1 234 ? 113.400 4.341   106.930 1.00 34.91  ?  233  ASP A OD1   1 
ATOM   4503 O  OD2   . ASP B 1 234 ? 112.673 2.523   107.936 1.00 42.36  ?  233  ASP A OD2   1 
ATOM   4504 N  N     . VAL B 1 235 ? 112.325 6.722   109.015 1.00 21.81  ?  234  VAL A N     1 
ATOM   4505 C  CA    . VAL B 1 235 ? 111.037 7.242   109.461 1.00 19.16  ?  234  VAL A CA    1 
ATOM   4506 C  C     . VAL B 1 235 ? 110.212 6.097   110.022 1.00 30.77  ?  234  VAL A C     1 
ATOM   4507 O  O     . VAL B 1 235 ? 110.019 5.068   109.361 1.00 29.17  ?  234  VAL A O     1 
ATOM   4508 C  CB    . VAL B 1 235 ? 110.309 7.951   108.310 1.00 21.14  ?  234  VAL A CB    1 
ATOM   4509 C  CG1   . VAL B 1 235 ? 108.913 8.349   108.726 1.00 26.23  ?  234  VAL A CG1   1 
ATOM   4510 C  CG2   . VAL B 1 235 ? 111.099 9.179   107.870 1.00 20.99  ?  234  VAL A CG2   1 
ATOM   4511 N  N     . ASN B 1 236 ? 109.728 6.259   111.253 1.00 24.64  ?  235  ASN A N     1 
ATOM   4512 C  CA    . ASN B 1 236 ? 109.091 5.164   111.994 1.00 28.08  ?  235  ASN A CA    1 
ATOM   4513 C  C     . ASN B 1 236 ? 107.670 5.580   112.344 1.00 28.95  ?  235  ASN A C     1 
ATOM   4514 O  O     . ASN B 1 236 ? 107.463 6.474   113.173 1.00 28.41  ?  235  ASN A O     1 
ATOM   4515 C  CB    . ASN B 1 236 ? 109.900 4.814   113.252 1.00 28.11  ?  235  ASN A CB    1 
ATOM   4516 C  CG    . ASN B 1 236 ? 109.314 3.622   114.032 1.00 32.23  ?  235  ASN A CG    1 
ATOM   4517 O  OD1   . ASN B 1 236 ? 108.212 3.156   113.757 1.00 35.59  ?  235  ASN A OD1   1 
ATOM   4518 N  ND2   . ASN B 1 236 ? 110.058 3.149   115.019 1.00 33.19  ?  235  ASN A ND2   1 
ATOM   4519 N  N     . SER B 1 237 ? 106.687 4.935   111.722 1.00 24.12  ?  236  SER A N     1 
ATOM   4520 C  CA    . SER B 1 237 ? 105.293 5.276   111.960 1.00 22.74  ?  236  SER A CA    1 
ATOM   4521 C  C     . SER B 1 237 ? 104.674 4.478   113.102 1.00 28.11  ?  236  SER A C     1 
ATOM   4522 O  O     . SER B 1 237 ? 103.462 4.575   113.311 1.00 30.37  ?  236  SER A O     1 
ATOM   4523 C  CB    . SER B 1 237 ? 104.461 5.061   110.691 1.00 31.08  ?  236  SER A CB    1 
ATOM   4524 O  OG    . SER B 1 237 ? 104.344 3.669   110.400 1.00 35.82  ?  236  SER A OG    1 
ATOM   4525 N  N     . GLU B 1 238 ? 105.471 3.705   113.843 1.00 30.55  ?  237  GLU A N     1 
ATOM   4526 C  CA    . GLU B 1 238 ? 104.945 2.779   114.844 1.00 30.89  ?  237  GLU A CA    1 
ATOM   4527 C  C     . GLU B 1 238 ? 105.406 3.112   116.263 1.00 36.34  ?  237  GLU A C     1 
ATOM   4528 O  O     . GLU B 1 238 ? 105.362 2.244   117.140 1.00 29.85  ?  237  GLU A O     1 
ATOM   4529 C  CB    . GLU B 1 238 ? 105.335 1.338   114.482 1.00 29.46  ?  237  GLU A CB    1 
ATOM   4530 C  CG    . GLU B 1 238 ? 104.938 0.960   113.055 1.00 40.45  ?  237  GLU A CG    1 
ATOM   4531 C  CD    . GLU B 1 238 ? 105.435 -0.414  112.636 1.00 59.40  ?  237  GLU A CD    1 
ATOM   4532 O  OE1   . GLU B 1 238 ? 105.367 -1.353  113.460 1.00 58.15  ?  237  GLU A OE1   1 
ATOM   4533 O  OE2   . GLU B 1 238 ? 105.892 -0.550  111.478 1.00 64.32  ?  237  GLU A OE2   1 
ATOM   4534 N  N     . ARG B 1 239 ? 105.838 4.347   116.526 1.00 27.49  ?  238  ARG A N     1 
ATOM   4535 C  CA    . ARG B 1 239 ? 106.278 4.682   117.879 1.00 28.67  ?  238  ARG A CA    1 
ATOM   4536 C  C     . ARG B 1 239 ? 105.086 4.822   118.823 1.00 30.03  ?  238  ARG A C     1 
ATOM   4537 O  O     . ARG B 1 239 ? 104.023 5.315   118.438 1.00 29.34  ?  238  ARG A O     1 
ATOM   4538 C  CB    . ARG B 1 239 ? 107.097 5.975   117.865 1.00 23.46  ?  238  ARG A CB    1 
ATOM   4539 C  CG    . ARG B 1 239 ? 108.333 5.851   117.001 1.00 27.55  ?  238  ARG A CG    1 
ATOM   4540 C  CD    . ARG B 1 239 ? 109.049 7.189   116.930 1.00 28.68  ?  238  ARG A CD    1 
ATOM   4541 N  NE    . ARG B 1 239 ? 109.560 7.560   118.248 1.00 35.98  ?  238  ARG A NE    1 
ATOM   4542 C  CZ    . ARG B 1 239 ? 110.043 8.755   118.550 1.00 47.68  ?  238  ARG A CZ    1 
ATOM   4543 N  NH1   . ARG B 1 239 ? 110.077 9.705   117.622 1.00 46.81  ?  238  ARG A NH1   1 
ATOM   4544 N  NH2   . ARG B 1 239 ? 110.491 8.996   119.776 1.00 46.74  ?  238  ARG A NH2   1 
ATOM   4545 N  N     . LEU B 1 240 ? 105.266 4.379   120.072 1.00 30.13  ?  239  LEU A N     1 
ATOM   4546 C  CA    . LEU B 1 240 ? 104.235 4.494   121.096 1.00 31.37  ?  239  LEU A CA    1 
ATOM   4547 C  C     . LEU B 1 240 ? 104.801 5.204   122.320 1.00 30.96  ?  239  LEU A C     1 
ATOM   4548 O  O     . LEU B 1 240 ? 105.979 5.049   122.654 1.00 28.24  ?  239  LEU A O     1 
ATOM   4549 C  CB    . LEU B 1 240 ? 103.688 3.110   121.504 1.00 35.71  ?  239  LEU A CB    1 
ATOM   4550 C  CG    . LEU B 1 240 ? 103.076 2.229   120.405 1.00 43.63  ?  239  LEU A CG    1 
ATOM   4551 C  CD1   . LEU B 1 240 ? 103.075 0.776   120.833 1.00 47.81  ?  239  LEU A CD1   1 
ATOM   4552 C  CD2   . LEU B 1 240 ? 101.666 2.682   120.069 1.00 44.84  ?  239  LEU A CD2   1 
ATOM   4553 N  N     . ARG B 1 241 ? 103.954 5.979   122.986 1.00 32.98  ?  240  ARG A N     1 
ATOM   4554 C  CA    . ARG B 1 241 ? 104.345 6.617   124.237 1.00 30.63  ?  240  ARG A CA    1 
ATOM   4555 C  C     . ARG B 1 241 ? 104.787 5.570   125.262 1.00 28.58  ?  240  ARG A C     1 
ATOM   4556 O  O     . ARG B 1 241 ? 104.212 4.482   125.350 1.00 34.42  ?  240  ARG A O     1 
ATOM   4557 C  CB    . ARG B 1 241 ? 103.168 7.443   124.755 1.00 44.79  ?  240  ARG A CB    1 
ATOM   4558 C  CG    . ARG B 1 241 ? 103.077 7.575   126.246 1.00 58.71  ?  240  ARG A CG    1 
ATOM   4559 C  CD    . ARG B 1 241 ? 101.627 7.480   126.705 1.00 68.21  ?  240  ARG A CD    1 
ATOM   4560 N  NE    . ARG B 1 241 ? 100.786 8.572   126.212 1.00 69.80  ?  240  ARG A NE    1 
ATOM   4561 C  CZ    . ARG B 1 241 ? 100.725 9.775   126.775 1.00 65.72  ?  240  ARG A CZ    1 
ATOM   4562 N  NH1   . ARG B 1 241 ? 101.470 10.046  127.838 1.00 55.32  ?  240  ARG A NH1   1 
ATOM   4563 N  NH2   . ARG B 1 241 ? 99.927  10.709  126.274 1.00 69.18  ?  240  ARG A NH2   1 
ATOM   4564 N  N     . LYS B 1 242 ? 105.825 5.899   126.039 1.00 34.37  ?  241  LYS A N     1 
ATOM   4565 C  CA    . LYS B 1 242 ? 106.408 4.980   127.007 1.00 33.36  ?  241  LYS A CA    1 
ATOM   4566 C  C     . LYS B 1 242 ? 106.186 5.380   128.457 1.00 31.85  ?  241  LYS A C     1 
ATOM   4567 O  O     . LYS B 1 242 ? 106.520 4.599   129.352 1.00 31.66  ?  241  LYS A O     1 
ATOM   4568 C  CB    . LYS B 1 242 ? 107.921 4.845   126.772 1.00 38.28  ?  241  LYS A CB    1 
ATOM   4569 C  CG    . LYS B 1 242 ? 108.280 4.223   125.445 1.00 39.99  ?  241  LYS A CG    1 
ATOM   4570 C  CD    . LYS B 1 242 ? 109.774 4.233   125.235 1.00 45.86  ?  241  LYS A CD    1 
ATOM   4571 C  CE    . LYS B 1 242 ? 110.126 3.695   123.870 1.00 42.62  ?  241  LYS A CE    1 
ATOM   4572 N  NZ    . LYS B 1 242 ? 111.559 3.937   123.546 1.00 45.68  ?  241  LYS A NZ    1 
ATOM   4573 N  N     . SER B 1 243 ? 105.661 6.574   128.714 1.00 30.92  ?  242  SER A N     1 
ATOM   4574 C  CA    . SER B 1 243 ? 105.495 7.065   130.068 1.00 29.58  ?  242  SER A CA    1 
ATOM   4575 C  C     . SER B 1 243 ? 104.315 8.024   130.093 1.00 29.42  ?  242  SER A C     1 
ATOM   4576 O  O     . SER B 1 243 ? 103.872 8.523   129.057 1.00 30.10  ?  242  SER A O     1 
ATOM   4577 C  CB    . SER B 1 243 ? 106.772 7.753   130.584 1.00 28.31  ?  242  SER A CB    1 
ATOM   4578 O  OG    . SER B 1 243 ? 107.115 8.883   129.794 1.00 31.92  ?  242  SER A OG    1 
ATOM   4579 N  N     . VAL B 1 244 ? 103.788 8.246   131.291 1.00 28.69  ?  243  VAL A N     1 
ATOM   4580 C  CA    . VAL B 1 244 ? 102.702 9.196   131.524 1.00 33.81  ?  243  VAL A CA    1 
ATOM   4581 C  C     . VAL B 1 244 ? 102.975 9.858   132.860 1.00 29.06  ?  243  VAL A C     1 
ATOM   4582 O  O     . VAL B 1 244 ? 103.196 9.169   133.863 1.00 27.83  ?  243  VAL A O     1 
ATOM   4583 C  CB    . VAL B 1 244 ? 101.303 8.538   131.548 1.00 35.24  ?  243  VAL A CB    1 
ATOM   4584 C  CG1   . VAL B 1 244 ? 100.218 9.603   131.700 1.00 35.44  ?  243  VAL A CG1   1 
ATOM   4585 C  CG2   . VAL B 1 244 ? 101.051 7.691   130.313 1.00 35.28  ?  243  VAL A CG2   1 
ATOM   4586 N  N     . GLY B 1 245 ? 102.959 11.189  132.877 1.00 26.57  ?  244  GLY A N     1 
ATOM   4587 C  CA    . GLY B 1 245 ? 103.204 11.926  134.097 1.00 25.46  ?  244  GLY A CA    1 
ATOM   4588 C  C     . GLY B 1 245 ? 102.217 13.067  134.244 1.00 25.54  ?  244  GLY A C     1 
ATOM   4589 O  O     . GLY B 1 245 ? 101.635 13.549  133.270 1.00 28.04  ?  244  GLY A O     1 
ATOM   4590 N  N     . VAL B 1 246 ? 102.027 13.482  135.489 1.00 26.33  ?  245  VAL A N     1 
ATOM   4591 C  CA    . VAL B 1 246 ? 101.258 14.681  135.814 1.00 26.89  ?  245  VAL A CA    1 
ATOM   4592 C  C     . VAL B 1 246 ? 102.024 15.405  136.912 1.00 23.91  ?  245  VAL A C     1 
ATOM   4593 O  O     . VAL B 1 246 ? 102.408 14.788  137.913 1.00 27.96  ?  245  VAL A O     1 
ATOM   4594 C  CB    . VAL B 1 246 ? 99.817  14.359  136.270 1.00 28.19  ?  245  VAL A CB    1 
ATOM   4595 C  CG1   . VAL B 1 246 ? 99.061  15.630  136.588 1.00 31.68  ?  245  VAL A CG1   1 
ATOM   4596 C  CG2   . VAL B 1 246 ? 99.067  13.555  135.195 1.00 30.79  ?  245  VAL A CG2   1 
ATOM   4597 N  N     . GLU B 1 247 ? 102.285 16.697  136.715 1.00 23.65  ?  246  GLU A N     1 
ATOM   4598 C  CA    . GLU B 1 247 ? 103.004 17.465  137.731 1.00 22.84  ?  246  GLU A CA    1 
ATOM   4599 C  C     . GLU B 1 247 ? 102.507 18.903  137.753 1.00 23.40  ?  246  GLU A C     1 
ATOM   4600 O  O     . GLU B 1 247 ? 102.067 19.438  136.730 1.00 23.74  ?  246  GLU A O     1 
ATOM   4601 C  CB    . GLU B 1 247 ? 104.524 17.445  137.483 1.00 26.50  ?  246  GLU A CB    1 
ATOM   4602 C  CG    . GLU B 1 247 ? 104.956 18.060  136.164 1.00 29.31  ?  246  GLU A CG    1 
ATOM   4603 C  CD    . GLU B 1 247 ? 106.292 17.510  135.667 1.00 33.38  ?  246  GLU A CD    1 
ATOM   4604 O  OE1   . GLU B 1 247 ? 106.507 16.270  135.740 1.00 33.79  ?  246  GLU A OE1   1 
ATOM   4605 O  OE2   . GLU B 1 247 ? 107.119 18.319  135.199 1.00 28.93  ?  246  GLU A OE2   1 
ATOM   4606 N  N     . ARG B 1 248 ? 102.620 19.537  138.920 1.00 24.44  ?  247  ARG A N     1 
ATOM   4607 C  CA    . ARG B 1 248 ? 102.227 20.932  139.096 1.00 25.78  ?  247  ARG A CA    1 
ATOM   4608 C  C     . ARG B 1 248 ? 103.263 21.711  139.892 1.00 22.70  ?  247  ARG A C     1 
ATOM   4609 O  O     . ARG B 1 248 ? 103.727 21.254  140.941 1.00 23.25  ?  247  ARG A O     1 
ATOM   4610 C  CB    . ARG B 1 248 ? 100.887 21.061  139.822 1.00 33.28  ?  247  ARG A CB    1 
ATOM   4611 C  CG    . ARG B 1 248 ? 99.775  21.616  138.946 1.00 52.39  ?  247  ARG A CG    1 
ATOM   4612 C  CD    . ARG B 1 248 ? 99.508  20.674  137.802 1.00 54.40  ?  247  ARG A CD    1 
ATOM   4613 N  NE    . ARG B 1 248 ? 99.066  21.339  136.579 1.00 53.56  ?  247  ARG A NE    1 
ATOM   4614 C  CZ    . ARG B 1 248 ? 99.201  20.803  135.368 1.00 54.56  ?  247  ARG A CZ    1 
ATOM   4615 N  NH1   . ARG B 1 248 ? 99.784  19.624  135.235 1.00 50.76  ?  247  ARG A NH1   1 
ATOM   4616 N  NH2   . ARG B 1 248 ? 98.771  21.445  134.293 1.00 59.87  ?  247  ARG A NH2   1 
ATOM   4617 N  N     . THR B 1 249 ? 103.558 22.921  139.421 1.00 22.75  ?  248  THR A N     1 
ATOM   4618 C  CA    . THR B 1 249 ? 104.370 23.887  140.157 1.00 22.52  ?  248  THR A CA    1 
ATOM   4619 C  C     . THR B 1 249 ? 103.436 24.826  140.913 1.00 28.38  ?  248  THR A C     1 
ATOM   4620 O  O     . THR B 1 249 ? 102.540 25.430  140.312 1.00 26.43  ?  248  THR A O     1 
ATOM   4621 C  CB    . THR B 1 249 ? 105.278 24.678  139.207 1.00 26.76  ?  248  THR A CB    1 
ATOM   4622 O  OG1   . THR B 1 249 ? 106.272 23.812  138.645 1.00 23.57  ?  248  THR A OG1   1 
ATOM   4623 C  CG2   . THR B 1 249 ? 105.968 25.863  139.912 1.00 23.02  ?  248  THR A CG2   1 
ATOM   4624 N  N     . MET B 1 250 ? 103.637 24.933  142.228 1.00 26.88  ?  249  MET A N     1 
ATOM   4625 C  CA    . MET B 1 250 ? 102.791 25.771  143.070 1.00 32.45  ?  249  MET A CA    1 
ATOM   4626 C  C     . MET B 1 250 ? 103.253 27.227  143.040 1.00 27.92  ?  249  MET A C     1 
ATOM   4627 O  O     . MET B 1 250 ? 104.418 27.538  142.776 1.00 24.90  ?  249  MET A O     1 
ATOM   4628 C  CB    . MET B 1 250 ? 102.788 25.277  144.521 1.00 29.44  ?  249  MET A CB    1 
ATOM   4629 C  CG    . MET B 1 250 ? 101.804 24.173  144.797 1.00 46.65  ?  249  MET A CG    1 
ATOM   4630 S  SD    . MET B 1 250 ? 102.392 22.676  144.033 1.00 53.75  ?  249  MET A SD    1 
ATOM   4631 C  CE    . MET B 1 250 ? 103.944 22.456  144.884 1.00 46.56  ?  249  MET A CE    1 
ATOM   4632 N  N     . ALA B 1 251 ? 102.319 28.128  143.351 1.00 31.38  ?  250  ALA A N     1 
ATOM   4633 C  CA    . ALA B 1 251 ? 102.662 29.549  143.371 1.00 31.52  ?  250  ALA A CA    1 
ATOM   4634 C  C     . ALA B 1 251 ? 103.503 29.920  144.591 1.00 33.53  ?  250  ALA A C     1 
ATOM   4635 O  O     . ALA B 1 251 ? 104.283 30.879  144.534 1.00 29.00  ?  250  ALA A O     1 
ATOM   4636 C  CB    . ALA B 1 251 ? 101.390 30.390  143.304 1.00 32.08  ?  250  ALA A CB    1 
ATOM   4637 N  N     . GLU B 1 252 ? 103.365 29.181  145.692 1.00 27.38  ?  251  GLU A N     1 
ATOM   4638 C  CA    . GLU B 1 252 ? 104.202 29.329  146.877 1.00 30.68  ?  251  GLU A CA    1 
ATOM   4639 C  C     . GLU B 1 252 ? 104.854 27.989  147.160 1.00 25.93  ?  251  GLU A C     1 
ATOM   4640 O  O     . GLU B 1 252 ? 104.212 26.949  147.004 1.00 28.21  ?  251  GLU A O     1 
ATOM   4641 C  CB    . GLU B 1 252 ? 103.400 29.719  148.124 1.00 36.98  ?  251  GLU A CB    1 
ATOM   4642 C  CG    . GLU B 1 252 ? 103.158 31.185  148.321 1.00 65.73  ?  251  GLU A CG    1 
ATOM   4643 C  CD    . GLU B 1 252 ? 104.424 32.008  148.496 1.00 75.65  ?  251  GLU A CD    1 
ATOM   4644 O  OE1   . GLU B 1 252 ? 105.302 31.596  149.282 1.00 68.18  ?  251  GLU A OE1   1 
ATOM   4645 O  OE2   . GLU B 1 252 ? 104.527 33.067  147.836 1.00 84.01  ?  251  GLU A OE2   1 
ATOM   4646 N  N     . ASP B 1 253 ? 106.115 28.008  147.595 1.00 24.14  ?  252  ASP A N     1 
ATOM   4647 C  CA    . ASP B 1 253 ? 106.740 26.756  148.021 1.00 26.39  ?  252  ASP A CA    1 
ATOM   4648 C  C     . ASP B 1 253 ? 105.974 26.174  149.201 1.00 26.05  ?  252  ASP A C     1 
ATOM   4649 O  O     . ASP B 1 253 ? 105.462 26.907  150.048 1.00 24.53  ?  252  ASP A O     1 
ATOM   4650 C  CB    . ASP B 1 253 ? 108.199 26.973  148.427 1.00 25.01  ?  252  ASP A CB    1 
ATOM   4651 C  CG    . ASP B 1 253 ? 109.047 27.530  147.306 1.00 27.86  ?  252  ASP A CG    1 
ATOM   4652 O  OD1   . ASP B 1 253 ? 108.602 27.481  146.144 1.00 27.51  ?  252  ASP A OD1   1 
ATOM   4653 O  OD2   . ASP B 1 253 ? 110.160 28.031  147.597 1.00 28.92  ?  252  ASP A OD2   1 
ATOM   4654 N  N     . ILE B 1 254 ? 105.891 24.856  149.259 1.00 26.73  ?  253  ILE A N     1 
ATOM   4655 C  CA    . ILE B 1 254 ? 105.266 24.195  150.396 1.00 23.40  ?  253  ILE A CA    1 
ATOM   4656 C  C     . ILE B 1 254 ? 106.351 23.692  151.329 1.00 24.25  ?  253  ILE A C     1 
ATOM   4657 O  O     . ILE B 1 254 ? 107.469 23.377  150.907 1.00 26.61  ?  253  ILE A O     1 
ATOM   4658 C  CB    . ILE B 1 254 ? 104.334 23.050  149.942 1.00 22.83  ?  253  ILE A CB    1 
ATOM   4659 C  CG1   . ILE B 1 254 ? 105.115 21.994  149.155 1.00 22.67  ?  253  ILE A CG1   1 
ATOM   4660 C  CG2   . ILE B 1 254 ? 103.181 23.628  149.119 1.00 25.68  ?  253  ILE A CG2   1 
ATOM   4661 C  CD1   . ILE B 1 254 ? 104.325 20.700  148.924 1.00 27.55  ?  253  ILE A CD1   1 
ATOM   4662 N  N     . HIS B 1 255 ? 106.015 23.630  152.622 1.00 23.31  ?  254  HIS A N     1 
ATOM   4663 C  CA    . HIS B 1 255 ? 106.955 23.230  153.652 1.00 24.07  ?  254  HIS A CA    1 
ATOM   4664 C  C     . HIS B 1 255 ? 106.403 22.175  154.597 1.00 23.60  ?  254  HIS A C     1 
ATOM   4665 O  O     . HIS B 1 255 ? 107.085 21.824  155.564 1.00 23.80  ?  254  HIS A O     1 
ATOM   4666 C  CB    . HIS B 1 255 ? 107.402 24.455  154.466 1.00 28.46  ?  254  HIS A CB    1 
ATOM   4667 C  CG    . HIS B 1 255 ? 108.081 25.502  153.636 1.00 30.89  ?  254  HIS A CG    1 
ATOM   4668 N  ND1   . HIS B 1 255 ? 107.386 26.489  152.967 1.00 32.51  ?  254  HIS A ND1   1 
ATOM   4669 C  CD2   . HIS B 1 255 ? 109.389 25.688  153.333 1.00 31.04  ?  254  HIS A CD2   1 
ATOM   4670 C  CE1   . HIS B 1 255 ? 108.240 27.254  152.310 1.00 30.88  ?  254  HIS A CE1   1 
ATOM   4671 N  NE2   . HIS B 1 255 ? 109.461 26.785  152.508 1.00 33.70  ?  254  HIS A NE2   1 
ATOM   4672 N  N     . HIS B 1 256 ? 105.200 21.660  154.356 1.00 24.66  ?  255  HIS A N     1 
ATOM   4673 C  CA    . HIS B 1 256 ? 104.580 20.701  155.258 1.00 24.28  ?  255  HIS A CA    1 
ATOM   4674 C  C     . HIS B 1 256 ? 104.202 19.451  154.477 1.00 25.63  ?  255  HIS A C     1 
ATOM   4675 O  O     . HIS B 1 256 ? 103.671 19.541  153.364 1.00 24.94  ?  255  HIS A O     1 
ATOM   4676 C  CB    . HIS B 1 256 ? 103.345 21.291  155.936 1.00 25.42  ?  255  HIS A CB    1 
ATOM   4677 C  CG    . HIS B 1 256 ? 103.630 22.532  156.728 1.00 46.70  ?  255  HIS A CG    1 
ATOM   4678 N  ND1   . HIS B 1 256 ? 103.877 22.511  158.082 1.00 48.70  ?  255  HIS A ND1   1 
ATOM   4679 C  CD2   . HIS B 1 256 ? 103.719 23.830  156.350 1.00 44.70  ?  255  HIS A CD2   1 
ATOM   4680 C  CE1   . HIS B 1 256 ? 104.099 23.742  158.508 1.00 42.24  ?  255  HIS A CE1   1 
ATOM   4681 N  NE2   . HIS B 1 256 ? 104.010 24.561  157.475 1.00 44.52  ?  255  HIS A NE2   1 
ATOM   4682 N  N     . TRP B 1 257 ? 104.493 18.285  155.064 1.00 26.21  ?  256  TRP A N     1 
ATOM   4683 C  CA    . TRP B 1 257 ? 104.129 17.026  154.423 1.00 23.84  ?  256  TRP A CA    1 
ATOM   4684 C  C     . TRP B 1 257 ? 102.646 16.991  154.074 1.00 24.27  ?  256  TRP A C     1 
ATOM   4685 O  O     . TRP B 1 257 ? 102.265 16.493  153.009 1.00 26.03  ?  256  TRP A O     1 
ATOM   4686 C  CB    . TRP B 1 257 ? 104.485 15.836  155.325 1.00 23.96  ?  256  TRP A CB    1 
ATOM   4687 C  CG    . TRP B 1 257 ? 103.747 14.579  154.905 1.00 24.23  ?  256  TRP A CG    1 
ATOM   4688 C  CD1   . TRP B 1 257 ? 102.802 13.915  155.626 1.00 25.23  ?  256  TRP A CD1   1 
ATOM   4689 C  CD2   . TRP B 1 257 ? 103.856 13.887  153.651 1.00 23.70  ?  256  TRP A CD2   1 
ATOM   4690 N  NE1   . TRP B 1 257 ? 102.329 12.842  154.917 1.00 29.12  ?  256  TRP A NE1   1 
ATOM   4691 C  CE2   . TRP B 1 257 ? 102.948 12.803  153.697 1.00 28.01  ?  256  TRP A CE2   1 
ATOM   4692 C  CE3   . TRP B 1 257 ? 104.625 14.079  152.496 1.00 22.83  ?  256  TRP A CE3   1 
ATOM   4693 C  CZ2   . TRP B 1 257 ? 102.800 11.904  152.641 1.00 25.29  ?  256  TRP A CZ2   1 
ATOM   4694 C  CZ3   . TRP B 1 257 ? 104.481 13.188  151.445 1.00 26.28  ?  256  TRP A CZ3   1 
ATOM   4695 C  CH2   . TRP B 1 257 ? 103.567 12.113  151.521 1.00 27.30  ?  256  TRP A CH2   1 
ATOM   4696 N  N     . SER B 1 258 ? 101.794 17.531  154.949 1.00 25.24  ?  257  SER A N     1 
ATOM   4697 C  CA    . SER B 1 258 ? 100.353 17.471  154.685 1.00 26.10  ?  257  SER A CA    1 
ATOM   4698 C  C     . SER B 1 258 ? 99.996  18.169  153.374 1.00 26.89  ?  257  SER A C     1 
ATOM   4699 O  O     . SER B 1 258 ? 99.064  17.748  152.680 1.00 29.00  ?  257  SER A O     1 
ATOM   4700 C  CB    . SER B 1 258 ? 99.583  18.088  155.846 1.00 30.87  ?  257  SER A CB    1 
ATOM   4701 O  OG    . SER B 1 258 ? 99.916  19.450  155.997 1.00 33.98  ?  257  SER A OG    1 
ATOM   4702 N  N     . GLU B 1 259 ? 100.737 19.225  153.017 1.00 27.15  ?  258  GLU A N     1 
ATOM   4703 C  CA    . GLU B 1 259 ? 100.488 19.934  151.765 1.00 28.14  ?  258  GLU A CA    1 
ATOM   4704 C  C     . GLU B 1 259 ? 100.903 19.091  150.575 1.00 28.96  ?  258  GLU A C     1 
ATOM   4705 O  O     . GLU B 1 259 ? 100.239 19.092  149.534 1.00 25.51  ?  258  GLU A O     1 
ATOM   4706 C  CB    . GLU B 1 259 ? 101.253 21.259  151.753 1.00 28.36  ?  258  GLU A CB    1 
ATOM   4707 C  CG    . GLU B 1 259 ? 100.826 22.238  152.838 1.00 32.80  ?  258  GLU A CG    1 
ATOM   4708 C  CD    . GLU B 1 259 ? 101.745 23.441  152.929 1.00 38.65  ?  258  GLU A CD    1 
ATOM   4709 O  OE1   . GLU B 1 259 ? 102.981 23.257  153.024 1.00 32.19  ?  258  GLU A OE1   1 
ATOM   4710 O  OE2   . GLU B 1 259 ? 101.227 24.574  152.901 1.00 47.99  ?  258  GLU A OE2   1 
ATOM   4711 N  N     . CYS B 1 260 ? 102.016 18.374  150.710 1.00 23.93  ?  259  CYS A N     1 
ATOM   4712 C  CA    . CYS B 1 260 ? 102.455 17.482  149.648 1.00 24.39  ?  259  CYS A CA    1 
ATOM   4713 C  C     . CYS B 1 260 ? 101.418 16.391  149.413 1.00 23.99  ?  259  CYS A C     1 
ATOM   4714 O  O     . CYS B 1 260 ? 101.021 16.125  148.273 1.00 25.20  ?  259  CYS A O     1 
ATOM   4715 C  CB    . CYS B 1 260 ? 103.813 16.876  150.017 1.00 24.19  ?  259  CYS A CB    1 
ATOM   4716 S  SG    . CYS B 1 260 ? 104.537 15.864  148.700 1.00 25.57  ?  259  CYS A SG    1 
ATOM   4717 N  N     . GLU B 1 261 ? 100.963 15.757  150.499 1.00 24.10  ?  260  GLU A N     1 
ATOM   4718 C  CA    . GLU B 1 261 ? 99.971  14.695  150.386 1.00 27.60  ?  260  GLU A CA    1 
ATOM   4719 C  C     . GLU B 1 261 ? 98.705  15.221  149.726 1.00 25.99  ?  260  GLU A C     1 
ATOM   4720 O  O     . GLU B 1 261 ? 98.112  14.554  148.872 1.00 29.74  ?  260  GLU A O     1 
ATOM   4721 C  CB    . GLU B 1 261 ? 99.686  14.127  151.779 1.00 28.03  ?  260  GLU A CB    1 
ATOM   4722 C  CG    . GLU B 1 261 ? 99.127  12.723  151.831 1.00 47.88  ?  260  GLU A CG    1 
ATOM   4723 C  CD    . GLU B 1 261 ? 97.683  12.652  151.395 1.00 58.07  ?  260  GLU A CD    1 
ATOM   4724 O  OE1   . GLU B 1 261 ? 97.309  11.640  150.776 1.00 62.90  ?  260  GLU A OE1   1 
ATOM   4725 O  OE2   . GLU B 1 261 ? 96.921  13.606  151.666 1.00 58.48  ?  260  GLU A OE2   1 
ATOM   4726 N  N     . ALA B 1 262 ? 98.299  16.438  150.080 1.00 26.95  ?  261  ALA A N     1 
ATOM   4727 C  CA    . ALA B 1 262 ? 97.067  16.991  149.517 1.00 28.12  ?  261  ALA A CA    1 
ATOM   4728 C  C     . ALA B 1 262 ? 97.212  17.255  148.022 1.00 32.32  ?  261  ALA A C     1 
ATOM   4729 O  O     . ALA B 1 262 ? 96.257  17.070  147.260 1.00 31.29  ?  261  ALA A O     1 
ATOM   4730 C  CB    . ALA B 1 262 ? 96.681  18.270  150.255 1.00 31.63  ?  261  ALA A CB    1 
ATOM   4731 N  N     . ILE B 1 263 ? 98.402  17.681  147.581 1.00 30.36  ?  262  ILE A N     1 
ATOM   4732 C  CA    . ILE B 1 263 ? 98.631  17.870  146.151 1.00 25.97  ?  262  ILE A CA    1 
ATOM   4733 C  C     . ILE B 1 263 ? 98.605  16.532  145.425 1.00 29.04  ?  262  ILE A C     1 
ATOM   4734 O  O     . ILE B 1 263 ? 98.036  16.417  144.332 1.00 30.30  ?  262  ILE A O     1 
ATOM   4735 C  CB    . ILE B 1 263 ? 99.953  18.623  145.919 1.00 25.16  ?  262  ILE A CB    1 
ATOM   4736 C  CG1   . ILE B 1 263 ? 99.822  20.055  146.440 1.00 29.48  ?  262  ILE A CG1   1 
ATOM   4737 C  CG2   . ILE B 1 263 ? 100.347 18.577  144.442 1.00 25.22  ?  262  ILE A CG2   1 
ATOM   4738 C  CD1   . ILE B 1 263 ? 101.146 20.729  146.730 1.00 35.08  ?  262  ILE A CD1   1 
ATOM   4739 N  N     . ILE B 1 264 ? 99.195  15.494  146.024 1.00 25.45  ?  263  ILE A N     1 
ATOM   4740 C  CA    . ILE B 1 264 ? 99.156  14.169  145.406 1.00 24.79  ?  263  ILE A CA    1 
ATOM   4741 C  C     . ILE B 1 264 ? 97.719  13.707  145.231 1.00 28.00  ?  263  ILE A C     1 
ATOM   4742 O  O     . ILE B 1 264 ? 97.365  13.107  144.209 1.00 29.20  ?  263  ILE A O     1 
ATOM   4743 C  CB    . ILE B 1 264 ? 99.970  13.161  146.237 1.00 24.44  ?  263  ILE A CB    1 
ATOM   4744 C  CG1   . ILE B 1 264 ? 101.450 13.524  146.175 1.00 26.39  ?  263  ILE A CG1   1 
ATOM   4745 C  CG2   . ILE B 1 264 ? 99.758  11.725  145.731 1.00 25.71  ?  263  ILE A CG2   1 
ATOM   4746 C  CD1   . ILE B 1 264 ? 102.277 12.724  147.113 1.00 29.30  ?  263  ILE A CD1   1 
ATOM   4747 N  N     . GLU B 1 265 ? 96.867  13.982  146.225 1.00 29.55  ?  264  GLU A N     1 
ATOM   4748 C  CA    . GLU B 1 265 ? 95.461  13.594  146.128 1.00 30.29  ?  264  GLU A CA    1 
ATOM   4749 C  C     . GLU B 1 265 ? 94.775  14.280  144.961 1.00 32.43  ?  264  GLU A C     1 
ATOM   4750 O  O     . GLU B 1 265 ? 93.846  13.716  144.369 1.00 34.64  ?  264  GLU A O     1 
ATOM   4751 C  CB    . GLU B 1 265 ? 94.729  13.929  147.427 1.00 35.62  ?  264  GLU A CB    1 
ATOM   4752 C  CG    . GLU B 1 265 ? 95.151  13.090  148.614 1.00 38.03  ?  264  GLU A CG    1 
ATOM   4753 C  CD    . GLU B 1 265 ? 94.622  11.676  148.537 1.00 49.45  ?  264  GLU A CD    1 
ATOM   4754 O  OE1   . GLU B 1 265 ? 93.627  11.449  147.817 1.00 42.46  ?  264  GLU A OE1   1 
ATOM   4755 O  OE2   . GLU B 1 265 ? 95.198  10.790  149.199 1.00 57.21  ?  264  GLU A OE2   1 
ATOM   4756 N  N     . ARG B 1 266 ? 95.200  15.499  144.632 1.00 32.19  ?  265  ARG A N     1 
ATOM   4757 C  CA    . ARG B 1 266 ? 94.638  16.210  143.493 1.00 37.61  ?  265  ARG A CA    1 
ATOM   4758 C  C     . ARG B 1 266 ? 95.250  15.752  142.178 1.00 42.17  ?  265  ARG A C     1 
ATOM   4759 O  O     . ARG B 1 266 ? 94.565  15.760  141.149 1.00 40.96  ?  265  ARG A O     1 
ATOM   4760 C  CB    . ARG B 1 266 ? 94.825  17.720  143.664 1.00 35.53  ?  265  ARG A CB    1 
ATOM   4761 C  CG    . ARG B 1 266 ? 93.898  18.351  144.706 1.00 47.16  ?  265  ARG A CG    1 
ATOM   4762 C  CD    . ARG B 1 266 ? 93.987  19.866  144.659 1.00 58.78  ?  265  ARG A CD    1 
ATOM   4763 N  NE    . ARG B 1 266 ? 94.432  20.322  143.342 1.00 72.83  ?  265  ARG A NE    1 
ATOM   4764 C  CZ    . ARG B 1 266 ? 94.777  21.573  143.052 1.00 78.57  ?  265  ARG A CZ    1 
ATOM   4765 N  NH1   . ARG B 1 266 ? 94.724  22.515  143.986 1.00 73.93  ?  265  ARG A NH1   1 
ATOM   4766 N  NH2   . ARG B 1 266 ? 95.180  21.883  141.825 1.00 82.31  ?  265  ARG A NH2   1 
ATOM   4767 N  N     . LEU B 1 267 ? 96.520  15.344  142.184 1.00 27.06  ?  266  LEU A N     1 
ATOM   4768 C  CA    . LEU B 1 267 ? 97.151  14.889  140.947 1.00 26.70  ?  266  LEU A CA    1 
ATOM   4769 C  C     . LEU B 1 267 ? 96.717  13.481  140.551 1.00 33.63  ?  266  LEU A C     1 
ATOM   4770 O  O     . LEU B 1 267 ? 96.630  13.179  139.355 1.00 29.58  ?  266  LEU A O     1 
ATOM   4771 C  CB    . LEU B 1 267 ? 98.673  14.913  141.086 1.00 25.32  ?  266  LEU A CB    1 
ATOM   4772 C  CG    . LEU B 1 267 ? 99.393  16.249  141.296 1.00 30.92  ?  266  LEU A CG    1 
ATOM   4773 C  CD1   . LEU B 1 267 ? 100.833 16.001  141.720 1.00 29.09  ?  266  LEU A CD1   1 
ATOM   4774 C  CD2   . LEU B 1 267 ? 99.351  17.106  140.035 1.00 30.23  ?  266  LEU A CD2   1 
ATOM   4775 N  N     . TYR B 1 268 ? 96.469  12.606  141.521 1.00 28.52  ?  267  TYR A N     1 
ATOM   4776 C  CA    . TYR B 1 268 ? 96.243  11.202  141.191 1.00 33.63  ?  267  TYR A CA    1 
ATOM   4777 C  C     . TYR B 1 268 ? 95.062  10.987  140.253 1.00 34.46  ?  267  TYR A C     1 
ATOM   4778 O  O     . TYR B 1 268 ? 95.210  10.221  139.284 1.00 39.34  ?  267  TYR A O     1 
ATOM   4779 C  CB    . TYR B 1 268 ? 96.075  10.374  142.465 1.00 31.49  ?  267  TYR A CB    1 
ATOM   4780 C  CG    . TYR B 1 268 ? 95.916  8.908   142.148 1.00 32.31  ?  267  TYR A CG    1 
ATOM   4781 C  CD1   . TYR B 1 268 ? 97.024  8.124   141.866 1.00 30.42  ?  267  TYR A CD1   1 
ATOM   4782 C  CD2   . TYR B 1 268 ? 94.654  8.308   142.083 1.00 36.70  ?  267  TYR A CD2   1 
ATOM   4783 C  CE1   . TYR B 1 268 ? 96.896  6.779   141.563 1.00 30.27  ?  267  TYR A CE1   1 
ATOM   4784 C  CE2   . TYR B 1 268 ? 94.519  6.961   141.766 1.00 36.93  ?  267  TYR A CE2   1 
ATOM   4785 C  CZ    . TYR B 1 268 ? 95.648  6.208   141.512 1.00 37.15  ?  267  TYR A CZ    1 
ATOM   4786 O  OH    . TYR B 1 268 ? 95.544  4.870   141.207 1.00 41.75  ?  267  TYR A OH    1 
ATOM   4787 N  N     . PRO B 1 269 ? 93.885  11.590  140.470 1.00 39.38  ?  268  PRO A N     1 
ATOM   4788 C  CA    . PRO B 1 269 ? 92.766  11.319  139.549 1.00 47.43  ?  268  PRO A CA    1 
ATOM   4789 C  C     . PRO B 1 269 ? 93.102  11.652  138.112 1.00 41.31  ?  268  PRO A C     1 
ATOM   4790 O  O     . PRO B 1 269 ? 92.698  10.925  137.197 1.00 38.10  ?  268  PRO A O     1 
ATOM   4791 C  CB    . PRO B 1 269 ? 91.638  12.210  140.092 1.00 45.76  ?  268  PRO A CB    1 
ATOM   4792 C  CG    . PRO B 1 269 ? 91.983  12.442  141.514 1.00 43.62  ?  268  PRO A CG    1 
ATOM   4793 C  CD    . PRO B 1 269 ? 93.483  12.500  141.556 1.00 36.89  ?  268  PRO A CD    1 
ATOM   4794 N  N     . GLU B 1 270 ? 93.859  12.728  137.897 1.00 37.21  ?  269  GLU A N     1 
ATOM   4795 C  CA    . GLU B 1 270 ? 94.223  13.123  136.541 1.00 35.83  ?  269  GLU A CA    1 
ATOM   4796 C  C     . GLU B 1 270 ? 95.173  12.111  135.904 1.00 33.79  ?  269  GLU A C     1 
ATOM   4797 O  O     . GLU B 1 270 ? 95.034  11.785  134.720 1.00 34.56  ?  269  GLU A O     1 
ATOM   4798 C  CB    . GLU B 1 270 ? 94.844  14.523  136.562 1.00 35.33  ?  269  GLU A CB    1 
ATOM   4799 C  CG    . GLU B 1 270 ? 95.133  15.103  135.188 1.00 39.54  ?  269  GLU A CG    1 
ATOM   4800 C  CD    . GLU B 1 270 ? 93.881  15.222  134.330 1.00 57.22  ?  269  GLU A CD    1 
ATOM   4801 O  OE1   . GLU B 1 270 ? 93.984  15.079  133.091 1.00 60.36  ?  269  GLU A OE1   1 
ATOM   4802 O  OE2   . GLU B 1 270 ? 92.792  15.454  134.897 1.00 65.41  ?  269  GLU A OE2   1 
ATOM   4803 N  N     . LEU B 1 271 ? 96.159  11.619  136.666 1.00 32.38  ?  270  LEU A N     1 
ATOM   4804 C  CA    . LEU B 1 271 ? 97.054  10.595  136.133 1.00 30.09  ?  270  LEU A CA    1 
ATOM   4805 C  C     . LEU B 1 271 ? 96.281  9.328   135.779 1.00 31.15  ?  270  LEU A C     1 
ATOM   4806 O  O     . LEU B 1 271 ? 96.504  8.732   134.718 1.00 35.28  ?  270  LEU A O     1 
ATOM   4807 C  CB    . LEU B 1 271 ? 98.167  10.285  137.142 1.00 31.31  ?  270  LEU A CB    1 
ATOM   4808 C  CG    . LEU B 1 271 ? 99.157  9.180   136.755 1.00 32.37  ?  270  LEU A CG    1 
ATOM   4809 C  CD1   . LEU B 1 271 ? 99.781  9.474   135.402 1.00 34.41  ?  270  LEU A CD1   1 
ATOM   4810 C  CD2   . LEU B 1 271 ? 100.240 8.985   137.834 1.00 27.33  ?  270  LEU A CD2   1 
ATOM   4811 N  N     . GLU B 1 272 ? 95.363  8.904   136.654 1.00 32.12  ?  271  GLU A N     1 
ATOM   4812 C  CA    . GLU B 1 272 ? 94.563  7.711   136.366 1.00 33.65  ?  271  GLU A CA    1 
ATOM   4813 C  C     . GLU B 1 272 ? 93.733  7.901   135.103 1.00 37.81  ?  271  GLU A C     1 
ATOM   4814 O  O     . GLU B 1 272 ? 93.647  6.992   134.269 1.00 38.06  ?  271  GLU A O     1 
ATOM   4815 C  CB    . GLU B 1 272 ? 93.670  7.374   137.560 1.00 35.71  ?  271  GLU A CB    1 
ATOM   4816 C  CG    . GLU B 1 272 ? 92.822  6.106   137.401 1.00 38.12  ?  271  GLU A CG    1 
ATOM   4817 C  CD    . GLU B 1 272 ? 92.075  5.750   138.679 1.00 55.91  ?  271  GLU A CD    1 
ATOM   4818 O  OE1   . GLU B 1 272 ? 91.606  6.671   139.378 1.00 56.50  ?  271  GLU A OE1   1 
ATOM   4819 O  OE2   . GLU B 1 272 ? 91.960  4.546   138.988 1.00 69.55  ?  271  GLU A OE2   1 
ATOM   4820 N  N     . ARG B 1 273 ? 93.114  9.077   134.948 1.00 35.17  ?  272  ARG A N     1 
ATOM   4821 C  CA    . ARG B 1 273 ? 92.354  9.378   133.737 1.00 47.46  ?  272  ARG A CA    1 
ATOM   4822 C  C     . ARG B 1 273 ? 93.208  9.197   132.489 1.00 42.19  ?  272  ARG A C     1 
ATOM   4823 O  O     . ARG B 1 273 ? 92.801  8.532   131.524 1.00 37.82  ?  272  ARG A O     1 
ATOM   4824 C  CB    . ARG B 1 273 ? 91.821  10.814  133.795 1.00 51.29  ?  272  ARG A CB    1 
ATOM   4825 C  CG    . ARG B 1 273 ? 90.391  10.954  134.263 1.00 60.29  ?  272  ARG A CG    1 
ATOM   4826 C  CD    . ARG B 1 273 ? 89.898  12.386  134.095 1.00 64.38  ?  272  ARG A CD    1 
ATOM   4827 N  NE    . ARG B 1 273 ? 90.577  13.317  134.996 1.00 69.11  ?  272  ARG A NE    1 
ATOM   4828 C  CZ    . ARG B 1 273 ? 90.277  13.466  136.283 1.00 66.31  ?  272  ARG A CZ    1 
ATOM   4829 N  NH1   . ARG B 1 273 ? 89.313  12.735  136.832 1.00 66.58  ?  272  ARG A NH1   1 
ATOM   4830 N  NH2   . ARG B 1 273 ? 90.946  14.340  137.026 1.00 61.22  ?  272  ARG A NH2   1 
ATOM   4831 N  N     . ARG B 1 274 ? 94.396  9.808   132.488 1.00 37.33  ?  273  ARG A N     1 
ATOM   4832 C  CA    . ARG B 1 274 ? 95.229  9.805   131.292 1.00 41.06  ?  273  ARG A CA    1 
ATOM   4833 C  C     . ARG B 1 274 ? 95.818  8.429   131.039 1.00 39.32  ?  273  ARG A C     1 
ATOM   4834 O  O     . ARG B 1 274 ? 95.972  8.017   129.882 1.00 43.19  ?  273  ARG A O     1 
ATOM   4835 C  CB    . ARG B 1 274 ? 96.341  10.841  131.423 1.00 33.58  ?  273  ARG A CB    1 
ATOM   4836 C  CG    . ARG B 1 274 ? 95.851  12.247  131.634 1.00 32.48  ?  273  ARG A CG    1 
ATOM   4837 C  CD    . ARG B 1 274 ? 97.050  13.184  131.733 1.00 33.76  ?  273  ARG A CD    1 
ATOM   4838 N  NE    . ARG B 1 274 ? 96.672  14.544  132.090 1.00 43.89  ?  273  ARG A NE    1 
ATOM   4839 C  CZ    . ARG B 1 274 ? 97.530  15.559  132.143 1.00 44.41  ?  273  ARG A CZ    1 
ATOM   4840 N  NH1   . ARG B 1 274 ? 98.805  15.356  131.855 1.00 38.72  ?  273  ARG A NH1   1 
ATOM   4841 N  NH2   . ARG B 1 274 ? 97.109  16.773  132.469 1.00 41.98  ?  273  ARG A NH2   1 
ATOM   4842 N  N     . LEU B 1 275 ? 96.160  7.704   132.108 1.00 34.21  ?  274  LEU A N     1 
ATOM   4843 C  CA    . LEU B 1 275 ? 96.625  6.334   131.929 1.00 38.46  ?  274  LEU A CA    1 
ATOM   4844 C  C     . LEU B 1 275 ? 95.507  5.450   131.394 1.00 42.14  ?  274  LEU A C     1 
ATOM   4845 O  O     . LEU B 1 275 ? 95.745  4.569   130.553 1.00 40.23  ?  274  LEU A O     1 
ATOM   4846 C  CB    . LEU B 1 275 ? 97.165  5.786   133.251 1.00 34.52  ?  274  LEU A CB    1 
ATOM   4847 C  CG    . LEU B 1 275 ? 97.575  4.311   133.173 1.00 41.24  ?  274  LEU A CG    1 
ATOM   4848 C  CD1   . LEU B 1 275 ? 98.723  4.146   132.188 1.00 36.07  ?  274  LEU A CD1   1 
ATOM   4849 C  CD2   . LEU B 1 275 ? 97.936  3.749   134.550 1.00 36.78  ?  274  LEU A CD2   1 
ATOM   4850 N  N     . ALA B 1 276 ? 94.273  5.686   131.856 1.00 40.63  ?  275  ALA A N     1 
ATOM   4851 C  CA    . ALA B 1 276 ? 93.159  4.826   131.458 1.00 49.34  ?  275  ALA A CA    1 
ATOM   4852 C  C     . ALA B 1 276 ? 92.877  4.908   129.962 1.00 61.32  ?  275  ALA A C     1 
ATOM   4853 O  O     . ALA B 1 276 ? 92.434  3.921   129.362 1.00 59.87  ?  275  ALA A O     1 
ATOM   4854 C  CB    . ALA B 1 276 ? 91.900  5.184   132.248 1.00 47.08  ?  275  ALA A CB    1 
ATOM   4855 N  N     . LYS B 1 277 ? 93.129  6.062   129.342 1.00 58.37  ?  276  LYS A N     1 
ATOM   4856 C  CA    . LYS B 1 277 ? 92.847  6.197   127.919 1.00 59.65  ?  276  LYS A CA    1 
ATOM   4857 C  C     . LYS B 1 277 ? 93.775  5.343   127.067 1.00 61.25  ?  276  LYS A C     1 
ATOM   4858 O  O     . LYS B 1 277 ? 93.395  4.957   125.959 1.00 61.62  ?  276  LYS A O     1 
ATOM   4859 C  CB    . LYS B 1 277 ? 92.949  7.661   127.484 1.00 52.02  ?  276  LYS A CB    1 
ATOM   4860 C  CG    . LYS B 1 277 ? 92.205  8.645   128.384 1.00 60.89  ?  276  LYS A CG    1 
ATOM   4861 C  CD    . LYS B 1 277 ? 90.812  8.158   128.767 1.00 71.30  ?  276  LYS A CD    1 
ATOM   4862 C  CE    . LYS B 1 277 ? 89.860  8.158   127.580 1.00 79.24  ?  276  LYS A CE    1 
ATOM   4863 N  NZ    . LYS B 1 277 ? 88.535  7.574   127.939 1.00 90.47  ?  276  LYS A NZ    1 
ATOM   4864 N  N     . VAL B 1 278 ? 94.970  5.030   127.561 1.00 56.04  ?  277  VAL A N     1 
ATOM   4865 C  CA    . VAL B 1 278 ? 95.929  4.241   126.802 1.00 59.11  ?  277  VAL A CA    1 
ATOM   4866 C  C     . VAL B 1 278 ? 96.117  2.844   127.374 1.00 60.79  ?  277  VAL A C     1 
ATOM   4867 O  O     . VAL B 1 278 ? 96.669  1.978   126.678 1.00 63.97  ?  277  VAL A O     1 
ATOM   4868 C  CB    . VAL B 1 278 ? 97.289  4.962   126.702 1.00 59.44  ?  277  VAL A CB    1 
ATOM   4869 C  CG1   . VAL B 1 278 ? 97.113  6.313   126.043 1.00 65.19  ?  277  VAL A CG1   1 
ATOM   4870 C  CG2   . VAL B 1 278 ? 97.900  5.119   128.081 1.00 53.76  ?  277  VAL A CG2   1 
ATOM   4871 N  N     . LYS B 1 279 ? 95.671  2.591   128.602 1.00 51.51  ?  278  LYS A N     1 
ATOM   4872 C  CA    . LYS B 1 279 ? 95.838  1.290   129.249 1.00 47.59  ?  278  LYS A CA    1 
ATOM   4873 C  C     . LYS B 1 279 ? 94.684  1.097   130.217 1.00 47.31  ?  278  LYS A C     1 
ATOM   4874 O  O     . LYS B 1 279 ? 94.804  1.360   131.418 1.00 42.95  ?  278  LYS A O     1 
ATOM   4875 C  CB    . LYS B 1 279 ? 97.184  1.200   129.974 1.00 44.35  ?  278  LYS A CB    1 
ATOM   4876 C  CG    . LYS B 1 279 ? 97.624  -0.217  130.300 1.00 50.76  ?  278  LYS A CG    1 
ATOM   4877 C  CD    . LYS B 1 279 ? 97.991  -0.969  129.028 1.00 55.88  ?  278  LYS A CD    1 
ATOM   4878 C  CE    . LYS B 1 279 ? 98.505  -2.375  129.317 1.00 62.32  ?  278  LYS A CE    1 
ATOM   4879 N  NZ    . LYS B 1 279 ? 97.443  -3.250  129.864 1.00 66.68  ?  278  LYS A NZ    1 
ATOM   4880 N  N     . PRO B 1 280 ? 93.535  0.633   129.719 1.00 47.48  ?  279  PRO A N     1 
ATOM   4881 C  CA    . PRO B 1 280 ? 92.323  0.582   130.560 1.00 50.53  ?  279  PRO A CA    1 
ATOM   4882 C  C     . PRO B 1 280 ? 92.476  -0.188  131.866 1.00 55.29  ?  279  PRO A C     1 
ATOM   4883 O  O     . PRO B 1 280 ? 91.821  0.164   132.860 1.00 48.30  ?  279  PRO A O     1 
ATOM   4884 C  CB    . PRO B 1 280 ? 91.298  -0.088  129.633 1.00 53.37  ?  279  PRO A CB    1 
ATOM   4885 C  CG    . PRO B 1 280 ? 91.742  0.314   128.254 1.00 62.91  ?  279  PRO A CG    1 
ATOM   4886 C  CD    . PRO B 1 280 ? 93.250  0.339   128.304 1.00 54.88  ?  279  PRO A CD    1 
ATOM   4887 N  N     . ASP B 1 281 ? 93.310  -1.224  131.909 1.00 45.64  ?  280  ASP A N     1 
ATOM   4888 C  CA    . ASP B 1 281 ? 93.453  -2.019  133.120 1.00 49.46  ?  280  ASP A CA    1 
ATOM   4889 C  C     . ASP B 1 281 ? 94.540  -1.483  134.046 1.00 51.23  ?  280  ASP A C     1 
ATOM   4890 O  O     . ASP B 1 281 ? 94.847  -2.133  135.053 1.00 44.45  ?  280  ASP A O     1 
ATOM   4891 C  CB    . ASP B 1 281 ? 93.724  -3.486  132.762 1.00 49.54  ?  280  ASP A CB    1 
ATOM   4892 C  CG    . ASP B 1 281 ? 94.961  -3.660  131.897 1.00 64.16  ?  280  ASP A CG    1 
ATOM   4893 O  OD1   . ASP B 1 281 ? 95.718  -2.677  131.709 1.00 53.02  ?  280  ASP A OD1   1 
ATOM   4894 O  OD2   . ASP B 1 281 ? 95.181  -4.789  131.410 1.00 62.94  ?  280  ASP A OD2   1 
ATOM   4895 N  N     . LEU B 1 282 ? 95.125  -0.324  133.711 1.00 41.40  ?  281  LEU A N     1 
ATOM   4896 C  CA    . LEU B 1 282 ? 96.095  0.419   134.521 1.00 39.12  ?  281  LEU A CA    1 
ATOM   4897 C  C     . LEU B 1 282 ? 97.364  -0.374  134.824 1.00 38.96  ?  281  LEU A C     1 
ATOM   4898 O  O     . LEU B 1 282 ? 98.115  -0.007  135.728 1.00 37.04  ?  281  LEU A O     1 
ATOM   4899 C  CB    . LEU B 1 282 ? 95.470  0.914   135.833 1.00 42.70  ?  281  LEU A CB    1 
ATOM   4900 C  CG    . LEU B 1 282 ? 94.153  1.686   135.716 1.00 45.67  ?  281  LEU A CG    1 
ATOM   4901 C  CD1   . LEU B 1 282 ? 93.579  1.991   137.093 1.00 47.18  ?  281  LEU A CD1   1 
ATOM   4902 C  CD2   . LEU B 1 282 ? 94.367  2.966   134.934 1.00 45.28  ?  281  LEU A CD2   1 
ATOM   4903 N  N     . LEU B 1 283 ? 97.632  -1.455  134.098 1.00 43.90  ?  282  LEU A N     1 
ATOM   4904 C  CA    . LEU B 1 283 ? 98.830  -2.245  134.349 1.00 43.20  ?  282  LEU A CA    1 
ATOM   4905 C  C     . LEU B 1 283 ? 100.055 -1.521  133.792 1.00 44.18  ?  282  LEU A C     1 
ATOM   4906 O  O     . LEU B 1 283 ? 100.026 -1.006  132.668 1.00 43.61  ?  282  LEU A O     1 
ATOM   4907 C  CB    . LEU B 1 283 ? 98.681  -3.638  133.730 1.00 42.01  ?  282  LEU A CB    1 
ATOM   4908 C  CG    . LEU B 1 283 ? 97.481  -4.418  134.274 1.00 45.70  ?  282  LEU A CG    1 
ATOM   4909 C  CD1   . LEU B 1 283 ? 97.411  -5.817  133.663 1.00 46.38  ?  282  LEU A CD1   1 
ATOM   4910 C  CD2   . LEU B 1 283 ? 97.518  -4.493  135.805 1.00 43.02  ?  282  LEU A CD2   1 
ATOM   4911 N  N     . ILE B 1 284 ? 101.126 -1.466  134.590 1.00 36.94  ?  283  ILE A N     1 
ATOM   4912 C  CA    . ILE B 1 284 ? 102.312 -0.668  134.281 1.00 35.44  ?  283  ILE A CA    1 
ATOM   4913 C  C     . ILE B 1 284 ? 103.565 -1.460  134.643 1.00 35.45  ?  283  ILE A C     1 
ATOM   4914 O  O     . ILE B 1 284 ? 103.502 -2.556  135.204 1.00 36.50  ?  283  ILE A O     1 
ATOM   4915 C  CB    . ILE B 1 284 ? 102.307 0.691   135.019 1.00 40.01  ?  283  ILE A CB    1 
ATOM   4916 C  CG1   . ILE B 1 284 ? 102.101 0.486   136.524 1.00 33.16  ?  283  ILE A CG1   1 
ATOM   4917 C  CG2   . ILE B 1 284 ? 101.232 1.607   134.456 1.00 33.60  ?  283  ILE A CG2   1 
ATOM   4918 C  CD1   . ILE B 1 284 ? 102.227 1.787   137.353 1.00 31.40  ?  283  ILE A CD1   1 
ATOM   4919 N  N     . ALA B 1 285 ? 104.718 -0.897  134.292 1.00 34.44  ?  284  ALA A N     1 
ATOM   4920 C  CA    . ALA B 1 285 ? 106.024 -1.418  134.681 1.00 37.82  ?  284  ALA A CA    1 
ATOM   4921 C  C     . ALA B 1 285 ? 106.570 -0.770  135.943 1.00 37.94  ?  284  ALA A C     1 
ATOM   4922 O  O     . ALA B 1 285 ? 107.122 -1.471  136.796 1.00 32.95  ?  284  ALA A O     1 
ATOM   4923 C  CB    . ALA B 1 285 ? 107.043 -1.221  133.553 1.00 37.92  ?  284  ALA A CB    1 
ATOM   4924 N  N     . ARG B 1 286 ? 106.456 0.557   136.060 1.00 33.23  ?  285  ARG A N     1 
ATOM   4925 C  CA    . ARG B 1 286 ? 107.004 1.319   137.178 1.00 34.61  ?  285  ARG A CA    1 
ATOM   4926 C  C     . ARG B 1 286 ? 106.061 2.470   137.510 1.00 36.30  ?  285  ARG A C     1 
ATOM   4927 O  O     . ARG B 1 286 ? 105.300 2.936   136.663 1.00 29.06  ?  285  ARG A O     1 
ATOM   4928 C  CB    . ARG B 1 286 ? 108.400 1.894   136.853 1.00 29.03  ?  285  ARG A CB    1 
ATOM   4929 C  CG    . ARG B 1 286 ? 109.353 0.897   136.171 1.00 30.18  ?  285  ARG A CG    1 
ATOM   4930 C  CD    . ARG B 1 286 ? 110.672 1.555   135.748 1.00 36.14  ?  285  ARG A CD    1 
ATOM   4931 N  NE    . ARG B 1 286 ? 111.388 2.169   136.868 1.00 38.54  ?  285  ARG A NE    1 
ATOM   4932 C  CZ    . ARG B 1 286 ? 112.041 1.493   137.814 1.00 32.76  ?  285  ARG A CZ    1 
ATOM   4933 N  NH1   . ARG B 1 286 ? 112.070 0.165   137.799 1.00 32.73  ?  285  ARG A NH1   1 
ATOM   4934 N  NH2   . ARG B 1 286 ? 112.666 2.151   138.781 1.00 36.85  ?  285  ARG A NH2   1 
ATOM   4935 N  N     . GLN B 1 287 ? 106.131 2.955   138.750 1.00 29.37  ?  286  GLN A N     1 
ATOM   4936 C  CA    . GLN B 1 287 ? 105.503 4.239   139.054 1.00 28.16  ?  286  GLN A CA    1 
ATOM   4937 C  C     . GLN B 1 287 ? 106.318 4.936   140.126 1.00 30.08  ?  286  GLN A C     1 
ATOM   4938 O  O     . GLN B 1 287 ? 107.105 4.309   140.831 1.00 25.87  ?  286  GLN A O     1 
ATOM   4939 C  CB    . GLN B 1 287 ? 104.047 4.092   139.514 1.00 27.57  ?  286  GLN A CB    1 
ATOM   4940 C  CG    . GLN B 1 287 ? 103.897 3.440   140.902 1.00 27.83  ?  286  GLN A CG    1 
ATOM   4941 C  CD    . GLN B 1 287 ? 102.464 3.453   141.426 1.00 28.49  ?  286  GLN A CD    1 
ATOM   4942 O  OE1   . GLN B 1 287 ? 101.515 3.689   140.685 1.00 29.35  ?  286  GLN A OE1   1 
ATOM   4943 N  NE2   . GLN B 1 287 ? 102.310 3.199   142.721 1.00 29.97  ?  286  GLN A NE2   1 
ATOM   4944 N  N     . GLY B 1 288 ? 106.140 6.246   140.236 1.00 26.99  ?  287  GLY A N     1 
ATOM   4945 C  CA    . GLY B 1 288 ? 106.879 6.961   141.253 1.00 23.91  ?  287  GLY A CA    1 
ATOM   4946 C  C     . GLY B 1 288 ? 106.516 8.427   141.262 1.00 24.62  ?  287  GLY A C     1 
ATOM   4947 O  O     . GLY B 1 288 ? 105.510 8.841   140.690 1.00 25.83  ?  287  GLY A O     1 
ATOM   4948 N  N     . VAL B 1 289 ? 107.354 9.205   141.944 1.00 22.40  ?  288  VAL A N     1 
ATOM   4949 C  CA    . VAL B 1 289 ? 107.027 10.592  142.251 1.00 21.75  ?  288  VAL A CA    1 
ATOM   4950 C  C     . VAL B 1 289 ? 108.201 11.485  141.900 1.00 22.66  ?  288  VAL A C     1 
ATOM   4951 O  O     . VAL B 1 289 ? 109.340 11.040  141.704 1.00 21.15  ?  288  VAL A O     1 
ATOM   4952 C  CB    . VAL B 1 289 ? 106.636 10.783  143.734 1.00 24.66  ?  288  VAL A CB    1 
ATOM   4953 C  CG1   . VAL B 1 289 ? 105.472 9.847   144.096 1.00 24.55  ?  288  VAL A CG1   1 
ATOM   4954 C  CG2   . VAL B 1 289 ? 107.823 10.519  144.627 1.00 27.12  ?  288  VAL A CG2   1 
ATOM   4955 N  N     . LYS B 1 290 ? 107.907 12.772  141.826 1.00 20.78  ?  289  LYS A N     1 
ATOM   4956 C  CA    . LYS B 1 290 ? 108.917 13.788  141.587 1.00 20.35  ?  289  LYS A CA    1 
ATOM   4957 C  C     . LYS B 1 290 ? 108.706 14.934  142.560 1.00 21.25  ?  289  LYS A C     1 
ATOM   4958 O  O     . LYS B 1 290 ? 107.571 15.330  142.818 1.00 21.98  ?  289  LYS A O     1 
ATOM   4959 C  CB    . LYS B 1 290 ? 108.841 14.310  140.139 1.00 20.62  ?  289  LYS A CB    1 
ATOM   4960 C  CG    . LYS B 1 290 ? 109.721 15.512  139.912 1.00 23.42  ?  289  LYS A CG    1 
ATOM   4961 C  CD    . LYS B 1 290 ? 110.071 15.697  138.448 1.00 37.16  ?  289  LYS A CD    1 
ATOM   4962 C  CE    . LYS B 1 290 ? 108.967 16.331  137.653 1.00 42.31  ?  289  LYS A CE    1 
ATOM   4963 N  NZ    . LYS B 1 290 ? 109.312 16.366  136.187 1.00 36.74  ?  289  LYS A NZ    1 
ATOM   4964 N  N     . LEU B 1 291 ? 109.805 15.444  143.119 1.00 20.14  ?  290  LEU A N     1 
ATOM   4965 C  CA    . LEU B 1 291 ? 109.815 16.693  143.869 1.00 19.58  ?  290  LEU A CA    1 
ATOM   4966 C  C     . LEU B 1 291 ? 110.874 17.607  143.285 1.00 20.09  ?  290  LEU A C     1 
ATOM   4967 O  O     . LEU B 1 291 ? 111.991 17.167  142.997 1.00 21.83  ?  290  LEU A O     1 
ATOM   4968 C  CB    . LEU B 1 291 ? 110.127 16.480  145.349 1.00 21.25  ?  290  LEU A CB    1 
ATOM   4969 C  CG    . LEU B 1 291 ? 109.216 15.563  146.157 1.00 20.27  ?  290  LEU A CG    1 
ATOM   4970 C  CD1   . LEU B 1 291 ? 109.717 15.473  147.597 1.00 23.00  ?  290  LEU A CD1   1 
ATOM   4971 C  CD2   . LEU B 1 291 ? 107.782 16.083  146.141 1.00 20.52  ?  290  LEU A CD2   1 
ATOM   4972 N  N     . LYS B 1 292 ? 110.527 18.883  143.135 1.00 19.56  ?  291  LYS A N     1 
ATOM   4973 C  CA    . LYS B 1 292 ? 111.491 19.919  142.776 1.00 20.56  ?  291  LYS A CA    1 
ATOM   4974 C  C     . LYS B 1 292 ? 111.540 20.939  143.905 1.00 23.63  ?  291  LYS A C     1 
ATOM   4975 O  O     . LYS B 1 292 ? 110.493 21.354  144.407 1.00 19.89  ?  291  LYS A O     1 
ATOM   4976 C  CB    . LYS B 1 292 ? 111.119 20.604  141.459 1.00 19.90  ?  291  LYS A CB    1 
ATOM   4977 C  CG    . LYS B 1 292 ? 112.209 21.553  141.001 1.00 20.22  ?  291  LYS A CG    1 
ATOM   4978 C  CD    . LYS B 1 292 ? 111.788 22.384  139.787 1.00 32.22  ?  291  LYS A CD    1 
ATOM   4979 C  CE    . LYS B 1 292 ? 111.929 21.596  138.515 1.00 43.72  ?  291  LYS A CE    1 
ATOM   4980 N  NZ    . LYS B 1 292 ? 111.435 22.392  137.370 1.00 45.32  ?  291  LYS A NZ    1 
ATOM   4981 N  N     . PHE B 1 293 ? 112.748 21.340  144.308 1.00 22.45  ?  292  PHE A N     1 
ATOM   4982 C  CA    . PHE B 1 293 ? 112.924 22.144  145.508 1.00 20.19  ?  292  PHE A CA    1 
ATOM   4983 C  C     . PHE B 1 293 ? 113.143 23.608  145.150 1.00 22.68  ?  292  PHE A C     1 
ATOM   4984 O  O     . PHE B 1 293 ? 113.290 23.973  143.981 1.00 25.49  ?  292  PHE A O     1 
ATOM   4985 C  CB    . PHE B 1 293 ? 114.085 21.588  146.347 1.00 22.20  ?  292  PHE A CB    1 
ATOM   4986 C  CG    . PHE B 1 293 ? 113.975 20.114  146.587 1.00 22.59  ?  292  PHE A CG    1 
ATOM   4987 C  CD1   . PHE B 1 293 ? 113.040 19.623  147.482 1.00 28.52  ?  292  PHE A CD1   1 
ATOM   4988 C  CD2   . PHE B 1 293 ? 114.743 19.212  145.861 1.00 21.51  ?  292  PHE A CD2   1 
ATOM   4989 C  CE1   . PHE B 1 293 ? 112.887 18.258  147.673 1.00 28.27  ?  292  PHE A CE1   1 
ATOM   4990 C  CE2   . PHE B 1 293 ? 114.613 17.847  146.051 1.00 23.34  ?  292  PHE A CE2   1 
ATOM   4991 C  CZ    . PHE B 1 293 ? 113.679 17.365  146.963 1.00 23.17  ?  292  PHE A CZ    1 
ATOM   4992 N  N     . ASP B 1 294 ? 113.181 24.450  146.195 1.00 24.33  ?  293  ASP A N     1 
ATOM   4993 C  CA    . ASP B 1 294 ? 113.246 25.893  146.002 1.00 26.31  ?  293  ASP A CA    1 
ATOM   4994 C  C     . ASP B 1 294 ? 114.515 26.324  145.280 1.00 32.96  ?  293  ASP A C     1 
ATOM   4995 O  O     . ASP B 1 294 ? 114.531 27.398  144.673 1.00 27.85  ?  293  ASP A O     1 
ATOM   4996 C  CB    . ASP B 1 294 ? 113.114 26.619  147.355 1.00 23.40  ?  293  ASP A CB    1 
ATOM   4997 C  CG    . ASP B 1 294 ? 114.042 26.066  148.430 1.00 26.68  ?  293  ASP A CG    1 
ATOM   4998 O  OD1   . ASP B 1 294 ? 115.219 25.762  148.122 1.00 27.23  ?  293  ASP A OD1   1 
ATOM   4999 O  OD2   . ASP B 1 294 ? 113.592 25.974  149.598 1.00 30.93  ?  293  ASP A OD2   1 
ATOM   5000 N  N     . ASP B 1 295 ? 115.566 25.509  145.307 1.00 25.08  ?  294  ASP A N     1 
ATOM   5001 C  CA    . ASP B 1 295 ? 116.793 25.815  144.585 1.00 24.61  ?  294  ASP A CA    1 
ATOM   5002 C  C     . ASP B 1 295 ? 116.798 25.271  143.159 1.00 29.07  ?  294  ASP A C     1 
ATOM   5003 O  O     . ASP B 1 295 ? 117.848 25.288  142.505 1.00 26.81  ?  294  ASP A O     1 
ATOM   5004 C  CB    . ASP B 1 295 ? 118.007 25.270  145.356 1.00 30.82  ?  294  ASP A CB    1 
ATOM   5005 C  CG    . ASP B 1 295 ? 117.873 23.787  145.710 1.00 31.19  ?  294  ASP A CG    1 
ATOM   5006 O  OD1   . ASP B 1 295 ? 116.996 23.089  145.146 1.00 26.42  ?  294  ASP A OD1   1 
ATOM   5007 O  OD2   . ASP B 1 295 ? 118.646 23.319  146.573 1.00 29.03  ?  294  ASP A OD2   1 
ATOM   5008 N  N     . PHE B 1 296 ? 115.658 24.775  142.673 1.00 22.52  ?  295  PHE A N     1 
ATOM   5009 C  CA    . PHE B 1 296 ? 115.482 24.178  141.352 1.00 27.09  ?  295  PHE A CA    1 
ATOM   5010 C  C     . PHE B 1 296 ? 116.150 22.813  141.223 1.00 26.68  ?  295  PHE A C     1 
ATOM   5011 O  O     . PHE B 1 296 ? 116.081 22.222  140.147 1.00 28.63  ?  295  PHE A O     1 
ATOM   5012 C  CB    . PHE B 1 296 ? 115.972 25.098  140.216 1.00 31.10  ?  295  PHE A CB    1 
ATOM   5013 C  CG    . PHE B 1 296 ? 114.925 25.400  139.186 1.00 29.52  ?  295  PHE A CG    1 
ATOM   5014 C  CD1   . PHE B 1 296 ? 113.792 26.112  139.523 1.00 32.05  ?  295  PHE A CD1   1 
ATOM   5015 C  CD2   . PHE B 1 296 ? 115.073 24.957  137.876 1.00 40.96  ?  295  PHE A CD2   1 
ATOM   5016 C  CE1   . PHE B 1 296 ? 112.822 26.382  138.583 1.00 35.01  ?  295  PHE A CE1   1 
ATOM   5017 C  CE2   . PHE B 1 296 ? 114.104 25.229  136.924 1.00 42.13  ?  295  PHE A CE2   1 
ATOM   5018 C  CZ    . PHE B 1 296 ? 112.975 25.939  137.281 1.00 41.21  ?  295  PHE A CZ    1 
ATOM   5019 N  N     . GLN B 1 297 ? 116.784 22.286  142.270 1.00 29.81  ?  296  GLN A N     1 
ATOM   5020 C  CA    . GLN B 1 297 ? 117.159 20.882  142.238 1.00 24.14  ?  296  GLN A CA    1 
ATOM   5021 C  C     . GLN B 1 297 ? 115.896 20.033  142.216 1.00 26.42  ?  296  GLN A C     1 
ATOM   5022 O  O     . GLN B 1 297 ? 114.841 20.431  142.725 1.00 24.36  ?  296  GLN A O     1 
ATOM   5023 C  CB    . GLN B 1 297 ? 118.010 20.492  143.449 1.00 24.54  ?  296  GLN A CB    1 
ATOM   5024 C  CG    . GLN B 1 297 ? 119.290 21.321  143.611 1.00 32.96  ?  296  GLN A CG    1 
ATOM   5025 C  CD    . GLN B 1 297 ? 120.364 20.900  142.638 1.00 42.75  ?  296  GLN A CD    1 
ATOM   5026 O  OE1   . GLN B 1 297 ? 121.043 19.892  142.846 1.00 48.19  ?  296  GLN A OE1   1 
ATOM   5027 N  NE2   . GLN B 1 297 ? 120.513 21.656  141.556 1.00 41.40  ?  296  GLN A NE2   1 
ATOM   5028 N  N     . GLN B 1 298 ? 115.991 18.855  141.615 1.00 28.73  ?  297  GLN A N     1 
ATOM   5029 C  CA    . GLN B 1 298 ? 114.827 17.987  141.628 1.00 22.62  ?  297  GLN A CA    1 
ATOM   5030 C  C     . GLN B 1 298 ? 115.264 16.541  141.815 1.00 25.62  ?  297  GLN A C     1 
ATOM   5031 O  O     . GLN B 1 298 ? 116.417 16.172  141.574 1.00 24.68  ?  297  GLN A O     1 
ATOM   5032 C  CB    . GLN B 1 298 ? 113.968 18.160  140.367 1.00 28.92  ?  297  GLN A CB    1 
ATOM   5033 C  CG    . GLN B 1 298 ? 114.446 17.446  139.143 1.00 41.04  ?  297  GLN A CG    1 
ATOM   5034 C  CD    . GLN B 1 298 ? 113.470 17.600  137.990 1.00 43.06  ?  297  GLN A CD    1 
ATOM   5035 O  OE1   . GLN B 1 298 ? 112.798 18.626  137.866 1.00 42.22  ?  297  GLN A OE1   1 
ATOM   5036 N  NE2   . GLN B 1 298 ? 113.382 16.583  137.145 1.00 37.50  ?  297  GLN A NE2   1 
ATOM   5037 N  N     . THR B 1 299 ? 114.334 15.729  142.297 1.00 23.07  ?  298  THR A N     1 
ATOM   5038 C  CA    . THR B 1 299 ? 114.612 14.317  142.506 1.00 20.49  ?  298  THR A CA    1 
ATOM   5039 C  C     . THR B 1 299 ? 113.405 13.521  142.052 1.00 26.07  ?  298  THR A C     1 
ATOM   5040 O  O     . THR B 1 299 ? 112.273 14.016  142.070 1.00 22.18  ?  298  THR A O     1 
ATOM   5041 C  CB    . THR B 1 299 ? 114.963 14.019  143.978 1.00 22.92  ?  298  THR A CB    1 
ATOM   5042 O  OG1   . THR B 1 299 ? 115.452 12.677  144.100 1.00 27.07  ?  298  THR A OG1   1 
ATOM   5043 C  CG2   . THR B 1 299 ? 113.747 14.189  144.893 1.00 31.50  ?  298  THR A CG2   1 
ATOM   5044 N  N     . THR B 1 300 ? 113.666 12.291  141.606 1.00 22.87  ?  299  THR A N     1 
ATOM   5045 C  CA    . THR B 1 300 ? 112.616 11.365  141.228 1.00 21.03  ?  299  THR A CA    1 
ATOM   5046 C  C     . THR B 1 300 ? 112.839 10.074  142.009 1.00 21.66  ?  299  THR A C     1 
ATOM   5047 O  O     . THR B 1 300 ? 113.981 9.679   142.249 1.00 22.85  ?  299  THR A O     1 
ATOM   5048 C  CB    . THR B 1 300 ? 112.597 11.105  139.700 1.00 23.87  ?  299  THR A CB    1 
ATOM   5049 O  OG1   . THR B 1 300 ? 113.876 10.650  139.248 1.00 28.20  ?  299  THR A OG1   1 
ATOM   5050 C  CG2   . THR B 1 300 ? 112.241 12.390  138.913 1.00 21.98  ?  299  THR A CG2   1 
ATOM   5051 N  N     . GLN B 1 301 ? 111.757 9.462   142.471 1.00 23.18  ?  300  GLN A N     1 
ATOM   5052 C  CA    . GLN B 1 301 ? 111.831 8.169   143.157 1.00 22.31  ?  300  GLN A CA    1 
ATOM   5053 C  C     . GLN B 1 301 ? 110.764 7.277   142.552 1.00 24.52  ?  300  GLN A C     1 
ATOM   5054 O  O     . GLN B 1 301 ? 109.568 7.521   142.738 1.00 22.83  ?  300  GLN A O     1 
ATOM   5055 C  CB    . GLN B 1 301 ? 111.641 8.297   144.680 1.00 24.46  ?  300  GLN A CB    1 
ATOM   5056 C  CG    . GLN B 1 301 ? 111.779 6.952   145.410 1.00 25.39  ?  300  GLN A CG    1 
ATOM   5057 C  CD    . GLN B 1 301 ? 111.969 7.082   146.911 1.00 35.46  ?  300  GLN A CD    1 
ATOM   5058 O  OE1   . GLN B 1 301 ? 112.149 8.177   147.438 1.00 32.27  ?  300  GLN A OE1   1 
ATOM   5059 N  NE2   . GLN B 1 301 ? 111.941 5.947   147.609 1.00 32.53  ?  300  GLN A NE2   1 
ATOM   5060 N  N     . GLU B 1 302 ? 111.200 6.246   141.828 1.00 26.08  ?  301  GLU A N     1 
ATOM   5061 C  CA    . GLU B 1 302 ? 110.311 5.351   141.111 1.00 26.13  ?  301  GLU A CA    1 
ATOM   5062 C  C     . GLU B 1 302 ? 110.758 3.918   141.367 1.00 27.39  ?  301  GLU A C     1 
ATOM   5063 O  O     . GLU B 1 302 ? 111.925 3.659   141.674 1.00 26.50  ?  301  GLU A O     1 
ATOM   5064 C  CB    . GLU B 1 302 ? 110.319 5.652   139.598 1.00 26.81  ?  301  GLU A CB    1 
ATOM   5065 C  CG    . GLU B 1 302 ? 109.860 7.088   139.250 1.00 28.13  ?  301  GLU A CG    1 
ATOM   5066 C  CD    . GLU B 1 302 ? 110.621 7.702   138.070 1.00 38.87  ?  301  GLU A CD    1 
ATOM   5067 O  OE1   . GLU B 1 302 ? 111.623 7.102   137.622 1.00 37.32  ?  301  GLU A OE1   1 
ATOM   5068 O  OE2   . GLU B 1 302 ? 110.222 8.794   137.601 1.00 36.97  ?  301  GLU A OE2   1 
ATOM   5069 N  N     . HIS B 1 303 ? 109.827 2.987   141.216 1.00 26.37  ?  302  HIS A N     1 
ATOM   5070 C  CA    . HIS B 1 303 ? 110.139 1.582   141.462 1.00 27.62  ?  302  HIS A CA    1 
ATOM   5071 C  C     . HIS B 1 303 ? 109.268 0.672   140.602 1.00 33.91  ?  302  HIS A C     1 
ATOM   5072 O  O     . HIS B 1 303 ? 108.165 1.033   140.183 1.00 28.74  ?  302  HIS A O     1 
ATOM   5073 C  CB    . HIS B 1 303 ? 109.956 1.231   142.942 1.00 27.82  ?  302  HIS A CB    1 
ATOM   5074 C  CG    . HIS B 1 303 ? 108.608 1.596   143.479 1.00 39.22  ?  302  HIS A CG    1 
ATOM   5075 N  ND1   . HIS B 1 303 ? 108.399 2.702   144.276 1.00 46.02  ?  302  HIS A ND1   1 
ATOM   5076 C  CD2   . HIS B 1 303 ? 107.395 1.025   143.301 1.00 42.55  ?  302  HIS A CD2   1 
ATOM   5077 C  CE1   . HIS B 1 303 ? 107.117 2.785   144.580 1.00 48.37  ?  302  HIS A CE1   1 
ATOM   5078 N  NE2   . HIS B 1 303 ? 106.485 1.778   144.002 1.00 45.55  ?  302  HIS A NE2   1 
ATOM   5079 N  N     . VAL B 1 304 ? 109.786 -0.536  140.359 1.00 30.07  ?  303  VAL A N     1 
ATOM   5080 C  CA    . VAL B 1 304 ? 108.991 -1.586  139.737 1.00 31.55  ?  303  VAL A CA    1 
ATOM   5081 C  C     . VAL B 1 304 ? 107.643 -1.678  140.439 1.00 38.72  ?  303  VAL A C     1 
ATOM   5082 O  O     . VAL B 1 304 ? 107.569 -1.735  141.671 1.00 31.84  ?  303  VAL A O     1 
ATOM   5083 C  CB    . VAL B 1 304 ? 109.764 -2.917  139.800 1.00 39.29  ?  303  VAL A CB    1 
ATOM   5084 C  CG1   . VAL B 1 304 ? 108.823 -4.119  139.666 1.00 38.86  ?  303  VAL A CG1   1 
ATOM   5085 C  CG2   . VAL B 1 304 ? 110.849 -2.940  138.727 1.00 40.37  ?  303  VAL A CG2   1 
ATOM   5086 N  N     . TRP B 1 305 ? 106.564 -1.669  139.654 1.00 32.25  ?  304  TRP A N     1 
ATOM   5087 C  CA    . TRP B 1 305 ? 105.234 -1.725  140.250 1.00 32.63  ?  304  TRP A CA    1 
ATOM   5088 C  C     . TRP B 1 305 ? 104.254 -2.180  139.182 1.00 33.93  ?  304  TRP A C     1 
ATOM   5089 O  O     . TRP B 1 305 ? 104.360 -1.725  138.035 1.00 40.53  ?  304  TRP A O     1 
ATOM   5090 C  CB    . TRP B 1 305 ? 104.829 -0.366  140.842 1.00 31.11  ?  304  TRP A CB    1 
ATOM   5091 C  CG    . TRP B 1 305 ? 103.696 -0.492  141.809 1.00 33.96  ?  304  TRP A CG    1 
ATOM   5092 C  CD1   . TRP B 1 305 ? 102.382 -0.252  141.559 1.00 32.09  ?  304  TRP A CD1   1 
ATOM   5093 C  CD2   . TRP B 1 305 ? 103.773 -0.928  143.171 1.00 36.39  ?  304  TRP A CD2   1 
ATOM   5094 N  NE1   . TRP B 1 305 ? 101.630 -0.502  142.679 1.00 32.62  ?  304  TRP A NE1   1 
ATOM   5095 C  CE2   . TRP B 1 305 ? 102.460 -0.916  143.686 1.00 35.35  ?  304  TRP A CE2   1 
ATOM   5096 C  CE3   . TRP B 1 305 ? 104.824 -1.330  144.004 1.00 38.08  ?  304  TRP A CE3   1 
ATOM   5097 C  CZ2   . TRP B 1 305 ? 102.169 -1.284  144.998 1.00 38.58  ?  304  TRP A CZ2   1 
ATOM   5098 C  CZ3   . TRP B 1 305 ? 104.536 -1.692  145.306 1.00 35.84  ?  304  TRP A CZ3   1 
ATOM   5099 C  CH2   . TRP B 1 305 ? 103.216 -1.673  145.790 1.00 40.70  ?  304  TRP A CH2   1 
ATOM   5100 N  N     . PRO B 1 306 ? 103.315 -3.097  139.497 1.00 35.43  ?  305  PRO A N     1 
ATOM   5101 C  CA    . PRO B 1 306 ? 102.547 -3.750  138.426 1.00 39.01  ?  305  PRO A CA    1 
ATOM   5102 C  C     . PRO B 1 306 ? 101.304 -2.993  137.982 1.00 40.18  ?  305  PRO A C     1 
ATOM   5103 O  O     . PRO B 1 306 ? 100.797 -3.250  136.887 1.00 38.86  ?  305  PRO A O     1 
ATOM   5104 C  CB    . PRO B 1 306 ? 102.167 -5.101  139.051 1.00 41.07  ?  305  PRO A CB    1 
ATOM   5105 C  CG    . PRO B 1 306 ? 102.050 -4.799  140.512 1.00 40.08  ?  305  PRO A CG    1 
ATOM   5106 C  CD    . PRO B 1 306 ? 103.129 -3.770  140.799 1.00 36.00  ?  305  PRO A CD    1 
ATOM   5107 N  N     . ARG B 1 307 ? 100.790 -2.090  138.819 1.00 36.89  ?  306  ARG A N     1 
ATOM   5108 C  CA    . ARG B 1 307 ? 99.527  -1.427  138.514 1.00 36.94  ?  306  ARG A CA    1 
ATOM   5109 C  C     . ARG B 1 307 ? 99.473  -0.094  139.248 1.00 37.21  ?  306  ARG A C     1 
ATOM   5110 O  O     . ARG B 1 307 ? 99.877  -0.011  140.409 1.00 39.74  ?  306  ARG A O     1 
ATOM   5111 C  CB    . ARG B 1 307 ? 98.338  -2.316  138.909 1.00 45.65  ?  306  ARG A CB    1 
ATOM   5112 C  CG    . ARG B 1 307 ? 96.978  -1.676  138.733 1.00 52.17  ?  306  ARG A CG    1 
ATOM   5113 C  CD    . ARG B 1 307 ? 95.868  -2.644  139.122 1.00 65.22  ?  306  ARG A CD    1 
ATOM   5114 N  NE    . ARG B 1 307 ? 94.772  -1.954  139.798 1.00 80.49  ?  306  ARG A NE    1 
ATOM   5115 C  CZ    . ARG B 1 307 ? 93.718  -1.431  139.177 1.00 90.61  ?  306  ARG A CZ    1 
ATOM   5116 N  NH1   . ARG B 1 307 ? 93.612  -1.522  137.859 1.00 93.91  ?  306  ARG A NH1   1 
ATOM   5117 N  NH2   . ARG B 1 307 ? 92.768  -0.818  139.874 1.00 93.41  ?  306  ARG A NH2   1 
ATOM   5118 N  N     . LEU B 1 308 ? 98.969  0.938   138.569 1.00 35.09  ?  307  LEU A N     1 
ATOM   5119 C  CA    . LEU B 1 308 ? 98.860  2.262   139.175 1.00 34.64  ?  307  LEU A CA    1 
ATOM   5120 C  C     . LEU B 1 308 ? 98.162  2.179   140.524 1.00 33.01  ?  307  LEU A C     1 
ATOM   5121 O  O     . LEU B 1 308 ? 97.105  1.553   140.653 1.00 34.54  ?  307  LEU A O     1 
ATOM   5122 C  CB    . LEU B 1 308 ? 98.092  3.206   138.254 1.00 34.24  ?  307  LEU A CB    1 
ATOM   5123 C  CG    . LEU B 1 308 ? 97.894  4.599   138.852 1.00 31.61  ?  307  LEU A CG    1 
ATOM   5124 C  CD1   . LEU B 1 308 ? 99.239  5.328   138.927 1.00 32.25  ?  307  LEU A CD1   1 
ATOM   5125 C  CD2   . LEU B 1 308 ? 96.874  5.401   138.055 1.00 34.99  ?  307  LEU A CD2   1 
ATOM   5126 N  N     . ASN B 1 309 ? 98.756  2.821   141.530 1.00 31.68  ?  308  ASN A N     1 
ATOM   5127 C  CA    . ASN B 1 309 ? 98.281  2.664   142.901 1.00 34.05  ?  308  ASN A CA    1 
ATOM   5128 C  C     . ASN B 1 309 ? 98.566  3.936   143.685 1.00 34.29  ?  308  ASN A C     1 
ATOM   5129 O  O     . ASN B 1 309 ? 99.733  4.285   143.877 1.00 32.74  ?  308  ASN A O     1 
ATOM   5130 C  CB    . ASN B 1 309 ? 98.956  1.469   143.563 1.00 34.17  ?  308  ASN A CB    1 
ATOM   5131 C  CG    . ASN B 1 309 ? 98.358  1.146   144.902 1.00 35.21  ?  308  ASN A CG    1 
ATOM   5132 O  OD1   . ASN B 1 309 ? 98.687  1.773   145.906 1.00 38.31  ?  308  ASN A OD1   1 
ATOM   5133 N  ND2   . ASN B 1 309 ? 97.463  0.169   144.926 1.00 37.06  ?  308  ASN A ND2   1 
ATOM   5134 N  N     . LYS B 1 310 ? 97.509  4.601   144.164 1.00 35.84  ?  309  LYS A N     1 
ATOM   5135 C  CA    . LYS B 1 310 ? 97.695  5.866   144.879 1.00 31.65  ?  309  LYS A CA    1 
ATOM   5136 C  C     . LYS B 1 310 ? 98.382  5.659   146.224 1.00 31.74  ?  309  LYS A C     1 
ATOM   5137 O  O     . LYS B 1 310 ? 99.260  6.446   146.609 1.00 29.06  ?  309  LYS A O     1 
ATOM   5138 C  CB    . LYS B 1 310 ? 96.350  6.568   145.093 1.00 30.62  ?  309  LYS A CB    1 
ATOM   5139 C  CG    . LYS B 1 310 ? 96.510  7.895   145.861 1.00 34.86  ?  309  LYS A CG    1 
ATOM   5140 C  CD    . LYS B 1 310 ? 95.217  8.689   145.944 1.00 36.38  ?  309  LYS A CD    1 
ATOM   5141 C  CE    . LYS B 1 310 ? 94.211  8.011   146.864 1.00 46.40  ?  309  LYS A CE    1 
ATOM   5142 N  NZ    . LYS B 1 310 ? 93.120  8.951   147.208 1.00 49.80  ?  309  LYS A NZ    1 
ATOM   5143 N  N     . ALA B 1 311 ? 97.984  4.622   146.966 1.00 31.57  ?  310  ALA A N     1 
ATOM   5144 C  CA    . ALA B 1 311 ? 98.563  4.415   148.288 1.00 30.31  ?  310  ALA A CA    1 
ATOM   5145 C  C     . ALA B 1 311 ? 100.070 4.232   148.199 1.00 30.65  ?  310  ALA A C     1 
ATOM   5146 O  O     . ALA B 1 311 ? 100.816 4.754   149.035 1.00 31.30  ?  310  ALA A O     1 
ATOM   5147 C  CB    . ALA B 1 311 ? 97.909  3.216   148.975 1.00 31.96  ?  310  ALA A CB    1 
ATOM   5148 N  N     . ASP B 1 312 ? 100.542 3.526   147.167 1.00 29.33  ?  311  ASP A N     1 
ATOM   5149 C  CA    . ASP B 1 312 ? 101.981 3.353   147.017 1.00 28.59  ?  311  ASP A CA    1 
ATOM   5150 C  C     . ASP B 1 312 ? 102.646 4.657   146.590 1.00 28.97  ?  311  ASP A C     1 
ATOM   5151 O  O     . ASP B 1 312 ? 103.751 4.965   147.049 1.00 30.55  ?  311  ASP A O     1 
ATOM   5152 C  CB    . ASP B 1 312 ? 102.274 2.226   146.021 1.00 32.52  ?  311  ASP A CB    1 
ATOM   5153 C  CG    . ASP B 1 312 ? 103.762 2.076   145.717 1.00 41.78  ?  311  ASP A CG    1 
ATOM   5154 O  OD1   . ASP B 1 312 ? 104.527 1.660   146.623 1.00 35.81  ?  311  ASP A OD1   1 
ATOM   5155 O  OD2   . ASP B 1 312 ? 104.160 2.360   144.562 1.00 47.09  ?  311  ASP A OD2   1 
ATOM   5156 N  N     . LEU B 1 313 ? 101.976 5.446   145.746 1.00 26.81  ?  312  LEU A N     1 
ATOM   5157 C  CA    . LEU B 1 313 ? 102.526 6.752   145.381 1.00 25.58  ?  312  LEU A CA    1 
ATOM   5158 C  C     . LEU B 1 313 ? 102.701 7.638   146.605 1.00 25.76  ?  312  LEU A C     1 
ATOM   5159 O  O     . LEU B 1 313 ? 103.739 8.298   146.756 1.00 24.58  ?  312  LEU A O     1 
ATOM   5160 C  CB    . LEU B 1 313 ? 101.637 7.438   144.346 1.00 27.97  ?  312  LEU A CB    1 
ATOM   5161 C  CG    . LEU B 1 313 ? 101.694 6.804   142.951 1.00 32.76  ?  312  LEU A CG    1 
ATOM   5162 C  CD1   . LEU B 1 313 ? 100.673 7.448   142.025 1.00 27.44  ?  312  LEU A CD1   1 
ATOM   5163 C  CD2   . LEU B 1 313 ? 103.120 6.906   142.360 1.00 27.15  ?  312  LEU A CD2   1 
ATOM   5164 N  N     . ILE B 1 314 ? 101.704 7.658   147.494 1.00 25.65  ?  313  ILE A N     1 
ATOM   5165 C  CA    . ILE B 1 314 ? 101.789 8.496   148.694 1.00 26.38  ?  313  ILE A CA    1 
ATOM   5166 C  C     . ILE B 1 314 ? 102.883 7.988   149.624 1.00 28.99  ?  313  ILE A C     1 
ATOM   5167 O  O     . ILE B 1 314 ? 103.678 8.770   150.159 1.00 26.68  ?  313  ILE A O     1 
ATOM   5168 C  CB    . ILE B 1 314 ? 100.425 8.553   149.404 1.00 29.19  ?  313  ILE A CB    1 
ATOM   5169 C  CG1   . ILE B 1 314 ? 99.419  9.338   148.564 1.00 29.39  ?  313  ILE A CG1   1 
ATOM   5170 C  CG2   . ILE B 1 314 ? 100.545 9.130   150.837 1.00 26.32  ?  313  ILE A CG2   1 
ATOM   5171 C  CD1   . ILE B 1 314 ? 97.982  9.119   149.012 1.00 37.74  ?  313  ILE A CD1   1 
ATOM   5172 N  N     . ALA B 1 315 ? 102.949 6.669   149.822 1.00 25.88  ?  314  ALA A N     1 
ATOM   5173 C  CA    . ALA B 1 315 ? 104.006 6.104   150.660 1.00 25.88  ?  314  ALA A CA    1 
ATOM   5174 C  C     . ALA B 1 315 ? 105.387 6.423   150.099 1.00 30.54  ?  314  ALA A C     1 
ATOM   5175 O  O     . ALA B 1 315 ? 106.324 6.720   150.855 1.00 28.90  ?  314  ALA A O     1 
ATOM   5176 C  CB    . ALA B 1 315 ? 103.803 4.588   150.802 1.00 31.16  ?  314  ALA A CB    1 
ATOM   5177 N  N     . THR B 1 316 ? 105.534 6.375   148.772 1.00 24.89  ?  315  THR A N     1 
ATOM   5178 C  CA    . THR B 1 316 ? 106.813 6.697   148.152 1.00 23.88  ?  315  THR A CA    1 
ATOM   5179 C  C     . THR B 1 316 ? 107.149 8.169   148.330 1.00 27.04  ?  315  THR A C     1 
ATOM   5180 O  O     . THR B 1 316 ? 108.279 8.522   148.686 1.00 27.19  ?  315  THR A O     1 
ATOM   5181 C  CB    . THR B 1 316 ? 106.774 6.337   146.664 1.00 24.39  ?  315  THR A CB    1 
ATOM   5182 O  OG1   . THR B 1 316 ? 106.529 4.930   146.534 1.00 30.04  ?  315  THR A OG1   1 
ATOM   5183 C  CG2   . THR B 1 316 ? 108.091 6.667   145.983 1.00 24.20  ?  315  THR A CG2   1 
ATOM   5184 N  N     . ALA B 1 317 ? 106.174 9.045   148.086 1.00 23.87  ?  316  ALA A N     1 
ATOM   5185 C  CA    . ALA B 1 317 ? 106.426 10.471  148.259 1.00 23.63  ?  316  ALA A CA    1 
ATOM   5186 C  C     . ALA B 1 317 ? 106.778 10.814  149.699 1.00 24.33  ?  316  ALA A C     1 
ATOM   5187 O  O     . ALA B 1 317 ? 107.548 11.759  149.929 1.00 21.57  ?  316  ALA A O     1 
ATOM   5188 C  CB    . ALA B 1 317 ? 105.216 11.285  147.824 1.00 24.11  ?  316  ALA A CB    1 
ATOM   5189 N  N     . ARG B 1 318 ? 106.235 10.073  150.679 1.00 22.80  ?  317  ARG A N     1 
ATOM   5190 C  CA    . ARG B 1 318 ? 106.591 10.367  152.068 1.00 25.00  ?  317  ARG A CA    1 
ATOM   5191 C  C     . ARG B 1 318 ? 108.072 10.112  152.294 1.00 31.10  ?  317  ARG A C     1 
ATOM   5192 O  O     . ARG B 1 318 ? 108.757 10.892  152.978 1.00 25.66  ?  317  ARG A O     1 
ATOM   5193 C  CB    . ARG B 1 318 ? 105.753 9.535   153.051 1.00 25.06  ?  317  ARG A CB    1 
ATOM   5194 C  CG    . ARG B 1 318 ? 106.086 9.861   154.543 1.00 27.73  ?  317  ARG A CG    1 
ATOM   5195 C  CD    . ARG B 1 318 ? 105.256 9.074   155.567 1.00 32.79  ?  317  ARG A CD    1 
ATOM   5196 N  NE    . ARG B 1 318 ? 103.839 9.427   155.503 1.00 42.04  ?  317  ARG A NE    1 
ATOM   5197 C  CZ    . ARG B 1 318 ? 102.915 8.702   154.879 1.00 38.94  ?  317  ARG A CZ    1 
ATOM   5198 N  NH1   . ARG B 1 318 ? 103.247 7.566   154.279 1.00 41.18  ?  317  ARG A NH1   1 
ATOM   5199 N  NH2   . ARG B 1 318 ? 101.658 9.110   154.857 1.00 29.40  ?  317  ARG A NH2   1 
ATOM   5200 N  N     . LYS B 1 319 ? 108.582 9.024   151.711 1.00 26.38  ?  318  LYS A N     1 
ATOM   5201 C  CA    . LYS B 1 319 ? 110.004 8.720   151.792 1.00 30.18  ?  318  LYS A CA    1 
ATOM   5202 C  C     . LYS B 1 319 ? 110.827 9.774   151.080 1.00 28.44  ?  318  LYS A C     1 
ATOM   5203 O  O     . LYS B 1 319 ? 111.856 10.219  151.602 1.00 26.64  ?  318  LYS A O     1 
ATOM   5204 C  CB    . LYS B 1 319 ? 110.281 7.344   151.187 1.00 31.37  ?  318  LYS A CB    1 
ATOM   5205 C  CG    . LYS B 1 319 ? 109.789 6.194   152.042 1.00 37.60  ?  318  LYS A CG    1 
ATOM   5206 C  CD    . LYS B 1 319 ? 109.940 4.867   151.323 1.00 45.62  ?  318  LYS A CD    1 
ATOM   5207 C  CE    . LYS B 1 319 ? 109.340 3.742   152.159 1.00 61.28  ?  318  LYS A CE    1 
ATOM   5208 N  NZ    . LYS B 1 319 ? 109.306 2.448   151.421 1.00 65.84  ?  318  LYS A NZ    1 
ATOM   5209 N  N     . THR B 1 320 ? 110.400 10.168  149.872 1.00 22.73  ?  319  THR A N     1 
ATOM   5210 C  CA    . THR B 1 320 ? 111.114 11.206  149.138 1.00 21.09  ?  319  THR A CA    1 
ATOM   5211 C  C     . THR B 1 320 ? 111.145 12.500  149.941 1.00 21.99  ?  319  THR A C     1 
ATOM   5212 O  O     . THR B 1 320 ? 112.204 13.119  150.111 1.00 23.18  ?  319  THR A O     1 
ATOM   5213 C  CB    . THR B 1 320 ? 110.461 11.451  147.770 1.00 22.81  ?  319  THR A CB    1 
ATOM   5214 O  OG1   . THR B 1 320 ? 110.164 10.195  147.140 1.00 24.65  ?  319  THR A OG1   1 
ATOM   5215 C  CG2   . THR B 1 320 ? 111.432 12.252  146.880 1.00 24.31  ?  319  THR A CG2   1 
ATOM   5216 N  N     . TRP B 1 321 ? 109.979 12.917  150.440 1.00 21.62  ?  320  TRP A N     1 
ATOM   5217 C  CA    . TRP B 1 321 ? 109.879 14.118  151.266 1.00 20.98  ?  320  TRP A CA    1 
ATOM   5218 C  C     . TRP B 1 321 ? 110.775 14.026  152.495 1.00 24.19  ?  320  TRP A C     1 
ATOM   5219 O  O     . TRP B 1 321 ? 111.497 14.981  152.823 1.00 25.04  ?  320  TRP A O     1 
ATOM   5220 C  CB    . TRP B 1 321 ? 108.415 14.320  151.661 1.00 21.53  ?  320  TRP A CB    1 
ATOM   5221 C  CG    . TRP B 1 321 ? 108.159 15.515  152.524 1.00 21.45  ?  320  TRP A CG    1 
ATOM   5222 C  CD1   . TRP B 1 321 ? 108.241 15.572  153.877 1.00 22.00  ?  320  TRP A CD1   1 
ATOM   5223 C  CD2   . TRP B 1 321 ? 107.751 16.820  152.086 1.00 21.31  ?  320  TRP A CD2   1 
ATOM   5224 N  NE1   . TRP B 1 321 ? 107.921 16.839  154.321 1.00 26.26  ?  320  TRP A NE1   1 
ATOM   5225 C  CE2   . TRP B 1 321 ? 107.615 17.622  153.238 1.00 21.81  ?  320  TRP A CE2   1 
ATOM   5226 C  CE3   . TRP B 1 321 ? 107.489 17.384  150.831 1.00 22.92  ?  320  TRP A CE3   1 
ATOM   5227 C  CZ2   . TRP B 1 321 ? 107.221 18.958  153.177 1.00 21.99  ?  320  TRP A CZ2   1 
ATOM   5228 C  CZ3   . TRP B 1 321 ? 107.109 18.707  150.770 1.00 21.63  ?  320  TRP A CZ3   1 
ATOM   5229 C  CH2   . TRP B 1 321 ? 106.983 19.484  151.942 1.00 21.63  ?  320  TRP A CH2   1 
ATOM   5230 N  N     . ASP B 1 322 ? 110.764 12.877  153.170 1.00 23.17  ?  321  ASP A N     1 
ATOM   5231 C  CA    . ASP B 1 322 ? 111.459 12.742  154.446 1.00 24.80  ?  321  ASP A CA    1 
ATOM   5232 C  C     . ASP B 1 322 ? 112.967 12.630  154.254 1.00 31.17  ?  321  ASP A C     1 
ATOM   5233 O  O     . ASP B 1 322 ? 113.738 13.156  155.066 1.00 30.63  ?  321  ASP A O     1 
ATOM   5234 C  CB    . ASP B 1 322 ? 110.945 11.518  155.218 1.00 25.04  ?  321  ASP A CB    1 
ATOM   5235 C  CG    . ASP B 1 322 ? 109.541 11.715  155.796 1.00 27.79  ?  321  ASP A CG    1 
ATOM   5236 O  OD1   . ASP B 1 322 ? 109.053 12.867  155.840 1.00 34.16  ?  321  ASP A OD1   1 
ATOM   5237 O  OD2   . ASP B 1 322 ? 108.947 10.711  156.257 1.00 30.26  ?  321  ASP A OD2   1 
ATOM   5238 N  N     . GLU B 1 323 ? 113.403 11.975  153.177 1.00 22.24  ?  322  GLU A N     1 
ATOM   5239 C  CA    . GLU B 1 323 ? 114.802 11.599  153.025 1.00 25.26  ?  322  GLU A CA    1 
ATOM   5240 C  C     . GLU B 1 323 ? 115.595 12.508  152.101 1.00 26.76  ?  322  GLU A C     1 
ATOM   5241 O  O     . GLU B 1 323 ? 116.814 12.633  152.270 1.00 26.71  ?  322  GLU A O     1 
ATOM   5242 C  CB    . GLU B 1 323 ? 114.887 10.159  152.509 1.00 24.34  ?  322  GLU A CB    1 
ATOM   5243 C  CG    . GLU B 1 323 ? 114.279 9.166   153.506 1.00 25.22  ?  322  GLU A CG    1 
ATOM   5244 C  CD    . GLU B 1 323 ? 114.103 7.754   152.941 1.00 32.33  ?  322  GLU A CD    1 
ATOM   5245 O  OE1   . GLU B 1 323 ? 114.492 7.499   151.776 1.00 32.91  ?  322  GLU A OE1   1 
ATOM   5246 O  OE2   . GLU B 1 323 ? 113.558 6.903   153.676 1.00 37.36  ?  322  GLU A OE2   1 
ATOM   5247 N  N     . ARG B 1 324 ? 114.954 13.146  151.130 1.00 24.30  ?  323  ARG A N     1 
ATOM   5248 C  CA    . ARG B 1 324 ? 115.693 13.885  150.111 1.00 22.95  ?  323  ARG A CA    1 
ATOM   5249 C  C     . ARG B 1 324 ? 115.420 15.374  150.108 1.00 21.10  ?  323  ARG A C     1 
ATOM   5250 O  O     . ARG B 1 324 ? 116.181 16.118  149.483 1.00 23.73  ?  323  ARG A O     1 
ATOM   5251 C  CB    . ARG B 1 324 ? 115.372 13.329  148.718 1.00 22.64  ?  323  ARG A CB    1 
ATOM   5252 C  CG    . ARG B 1 324 ? 115.684 11.850  148.613 1.00 26.20  ?  323  ARG A CG    1 
ATOM   5253 C  CD    . ARG B 1 324 ? 115.532 11.399  147.196 1.00 29.43  ?  323  ARG A CD    1 
ATOM   5254 N  NE    . ARG B 1 324 ? 115.434 9.957   147.119 1.00 33.10  ?  323  ARG A NE    1 
ATOM   5255 C  CZ    . ARG B 1 324 ? 115.278 9.294   145.983 1.00 32.96  ?  323  ARG A CZ    1 
ATOM   5256 N  NH1   . ARG B 1 324 ? 115.220 9.968   144.847 1.00 25.16  ?  323  ARG A NH1   1 
ATOM   5257 N  NH2   . ARG B 1 324 ? 115.177 7.968   145.990 1.00 29.65  ?  323  ARG A NH2   1 
ATOM   5258 N  N     . ARG B 1 325 ? 114.373 15.822  150.797 1.00 24.67  ?  324  ARG A N     1 
ATOM   5259 C  CA    . ARG B 1 325 ? 114.046 17.238  150.796 1.00 24.97  ?  324  ARG A CA    1 
ATOM   5260 C  C     . ARG B 1 325 ? 115.108 18.059  151.511 1.00 26.73  ?  324  ARG A C     1 
ATOM   5261 O  O     . ARG B 1 325 ? 115.357 19.209  151.131 1.00 25.18  ?  324  ARG A O     1 
ATOM   5262 C  CB    . ARG B 1 325 ? 112.689 17.443  151.453 1.00 29.49  ?  324  ARG A CB    1 
ATOM   5263 C  CG    . ARG B 1 325 ? 112.168 18.830  151.389 1.00 24.60  ?  324  ARG A CG    1 
ATOM   5264 C  CD    . ARG B 1 325 ? 110.764 18.884  151.951 1.00 24.57  ?  324  ARG A CD    1 
ATOM   5265 N  NE    . ARG B 1 325 ? 110.682 18.513  153.367 1.00 26.51  ?  324  ARG A NE    1 
ATOM   5266 C  CZ    . ARG B 1 325 ? 110.664 19.370  154.379 1.00 36.05  ?  324  ARG A CZ    1 
ATOM   5267 N  NH1   . ARG B 1 325 ? 110.757 20.683  154.162 1.00 30.20  ?  324  ARG A NH1   1 
ATOM   5268 N  NH2   . ARG B 1 325 ? 110.561 18.906  155.621 1.00 36.02  ?  324  ARG A NH2   1 
ATOM   5269 N  N     . GLY B 1 326 ? 115.710 17.512  152.563 1.00 26.25  ?  325  GLY A N     1 
ATOM   5270 C  CA    . GLY B 1 326 ? 116.771 18.239  153.246 1.00 30.69  ?  325  GLY A CA    1 
ATOM   5271 C  C     . GLY B 1 326 ? 116.327 19.548  153.857 1.00 32.21  ?  325  GLY A C     1 
ATOM   5272 O  O     . GLY B 1 326 ? 117.114 20.497  153.910 1.00 36.47  ?  325  GLY A O     1 
ATOM   5273 N  N     . GLY B 1 327 ? 115.082 19.631  154.318 1.00 31.27  ?  326  GLY A N     1 
ATOM   5274 C  CA    . GLY B 1 327 ? 114.593 20.855  154.918 1.00 28.35  ?  326  GLY A CA    1 
ATOM   5275 C  C     . GLY B 1 327 ? 114.253 21.953  153.937 1.00 29.91  ?  326  GLY A C     1 
ATOM   5276 O  O     . GLY B 1 327 ? 113.885 23.055  154.368 1.00 36.27  ?  326  GLY A O     1 
ATOM   5277 N  N     . ARG B 1 328 ? 114.354 21.698  152.637 1.00 27.01  ?  327  ARG A N     1 
ATOM   5278 C  CA    . ARG B 1 328 ? 114.070 22.746  151.666 1.00 23.73  ?  327  ARG A CA    1 
ATOM   5279 C  C     . ARG B 1 328 ? 112.572 22.847  151.393 1.00 26.64  ?  327  ARG A C     1 
ATOM   5280 O  O     . ARG B 1 328 ? 111.804 21.908  151.633 1.00 24.39  ?  327  ARG A O     1 
ATOM   5281 C  CB    . ARG B 1 328 ? 114.804 22.487  150.353 1.00 25.27  ?  327  ARG A CB    1 
ATOM   5282 C  CG    . ARG B 1 328 ? 116.318 22.558  150.466 1.00 22.47  ?  327  ARG A CG    1 
ATOM   5283 C  CD    . ARG B 1 328 ? 116.948 22.096  149.157 1.00 21.70  ?  327  ARG A CD    1 
ATOM   5284 N  NE    . ARG B 1 328 ? 116.853 20.642  149.032 1.00 21.29  ?  327  ARG A NE    1 
ATOM   5285 C  CZ    . ARG B 1 328 ? 117.460 19.931  148.091 1.00 24.24  ?  327  ARG A CZ    1 
ATOM   5286 N  NH1   . ARG B 1 328 ? 118.200 20.540  147.170 1.00 22.88  ?  327  ARG A NH1   1 
ATOM   5287 N  NH2   . ARG B 1 328 ? 117.325 18.608  148.072 1.00 23.63  ?  327  ARG A NH2   1 
ATOM   5288 N  N     . GLY B 1 329 ? 112.161 24.014  150.895 1.00 21.86  ?  328  GLY A N     1 
ATOM   5289 C  CA    . GLY B 1 329 ? 110.819 24.157  150.367 1.00 25.31  ?  328  GLY A CA    1 
ATOM   5290 C  C     . GLY B 1 329 ? 110.673 23.431  149.042 1.00 29.24  ?  328  GLY A C     1 
ATOM   5291 O  O     . GLY B 1 329 ? 111.636 23.214  148.306 1.00 23.61  ?  328  GLY A O     1 
ATOM   5292 N  N     . VAL B 1 330 ? 109.443 23.042  148.721 1.00 22.29  ?  329  VAL A N     1 
ATOM   5293 C  CA    . VAL B 1 330 ? 109.164 22.286  147.506 1.00 20.54  ?  329  VAL A CA    1 
ATOM   5294 C  C     . VAL B 1 330 ? 108.304 23.150  146.590 1.00 20.82  ?  329  VAL A C     1 
ATOM   5295 O  O     . VAL B 1 330 ? 107.246 23.632  147.004 1.00 22.22  ?  329  VAL A O     1 
ATOM   5296 C  CB    . VAL B 1 330 ? 108.466 20.956  147.838 1.00 21.65  ?  329  VAL A CB    1 
ATOM   5297 C  CG1   . VAL B 1 330 ? 107.826 20.356  146.591 1.00 23.25  ?  329  VAL A CG1   1 
ATOM   5298 C  CG2   . VAL B 1 330 ? 109.482 19.978  148.459 1.00 23.08  ?  329  VAL A CG2   1 
ATOM   5299 N  N     . ARG B 1 331 ? 108.740 23.329  145.339 1.00 20.67  ?  330  ARG A N     1 
ATOM   5300 C  CA    . ARG B 1 331 ? 107.952 24.113  144.393 1.00 21.07  ?  330  ARG A CA    1 
ATOM   5301 C  C     . ARG B 1 331 ? 107.129 23.268  143.437 1.00 25.88  ?  330  ARG A C     1 
ATOM   5302 O  O     . ARG B 1 331 ? 106.174 23.787  142.847 1.00 24.65  ?  330  ARG A O     1 
ATOM   5303 C  CB    . ARG B 1 331 ? 108.856 25.049  143.571 1.00 22.10  ?  330  ARG A CB    1 
ATOM   5304 C  CG    . ARG B 1 331 ? 109.841 24.329  142.671 1.00 21.53  ?  330  ARG A CG    1 
ATOM   5305 C  CD    . ARG B 1 331 ? 110.701 25.328  141.892 1.00 26.12  ?  330  ARG A CD    1 
ATOM   5306 N  NE    . ARG B 1 331 ? 110.007 25.951  140.763 1.00 24.51  ?  330  ARG A NE    1 
ATOM   5307 C  CZ    . ARG B 1 331 ? 109.744 27.258  140.661 1.00 30.49  ?  330  ARG A CZ    1 
ATOM   5308 N  NH1   . ARG B 1 331 ? 110.111 28.100  141.623 1.00 26.32  ?  330  ARG A NH1   1 
ATOM   5309 N  NH2   . ARG B 1 331 ? 109.138 27.736  139.577 1.00 25.41  ?  330  ARG A NH2   1 
ATOM   5310 N  N     . LEU B 1 332 ? 107.459 21.987  143.267 1.00 21.86  ?  331  LEU A N     1 
ATOM   5311 C  CA    . LEU B 1 332 ? 106.714 21.145  142.347 1.00 20.60  ?  331  LEU A CA    1 
ATOM   5312 C  C     . LEU B 1 332 ? 106.523 19.768  142.966 1.00 20.40  ?  331  LEU A C     1 
ATOM   5313 O  O     . LEU B 1 332 ? 107.411 19.253  143.650 1.00 22.35  ?  331  LEU A O     1 
ATOM   5314 C  CB    . LEU B 1 332 ? 107.433 21.046  140.972 1.00 20.54  ?  331  LEU A CB    1 
ATOM   5315 C  CG    . LEU B 1 332 ? 106.942 19.983  139.958 1.00 20.69  ?  331  LEU A CG    1 
ATOM   5316 C  CD1   . LEU B 1 332 ? 107.187 20.394  138.507 1.00 23.33  ?  331  LEU A CD1   1 
ATOM   5317 C  CD2   . LEU B 1 332 ? 107.557 18.572  140.215 1.00 20.37  ?  331  LEU A CD2   1 
ATOM   5318 N  N     . VAL B 1 333 ? 105.371 19.170  142.706 1.00 20.77  ?  332  VAL A N     1 
ATOM   5319 C  CA    . VAL B 1 333 ? 105.133 17.763  143.009 1.00 20.79  ?  332  VAL A CA    1 
ATOM   5320 C  C     . VAL B 1 333 ? 104.644 17.095  141.730 1.00 21.93  ?  332  VAL A C     1 
ATOM   5321 O  O     . VAL B 1 333 ? 103.827 17.665  141.000 1.00 21.61  ?  332  VAL A O     1 
ATOM   5322 C  CB    . VAL B 1 333 ? 104.102 17.576  144.142 1.00 24.95  ?  332  VAL A CB    1 
ATOM   5323 C  CG1   . VAL B 1 333 ? 103.815 16.068  144.381 1.00 24.49  ?  332  VAL A CG1   1 
ATOM   5324 C  CG2   . VAL B 1 333 ? 104.573 18.280  145.411 1.00 22.15  ?  332  VAL A CG2   1 
ATOM   5325 N  N     . GLY B 1 334 ? 105.128 15.883  141.459 1.00 21.91  ?  333  GLY A N     1 
ATOM   5326 C  CA    . GLY B 1 334 ? 104.716 15.178  140.263 1.00 21.84  ?  333  GLY A CA    1 
ATOM   5327 C  C     . GLY B 1 334 ? 104.527 13.696  140.517 1.00 25.53  ?  333  GLY A C     1 
ATOM   5328 O  O     . GLY B 1 334 ? 105.121 13.118  141.423 1.00 22.00  ?  333  GLY A O     1 
ATOM   5329 N  N     . LEU B 1 335 ? 103.673 13.095  139.696 1.00 22.66  ?  334  LEU A N     1 
ATOM   5330 C  CA    . LEU B 1 335 ? 103.469 11.654  139.680 1.00 23.26  ?  334  LEU A CA    1 
ATOM   5331 C  C     . LEU B 1 335 ? 103.832 11.108  138.304 1.00 23.69  ?  334  LEU A C     1 
ATOM   5332 O  O     . LEU B 1 335 ? 103.733 11.807  137.289 1.00 26.94  ?  334  LEU A O     1 
ATOM   5333 C  CB    . LEU B 1 335 ? 102.014 11.293  140.014 1.00 24.96  ?  334  LEU A CB    1 
ATOM   5334 C  CG    . LEU B 1 335 ? 101.445 11.870  141.314 1.00 25.83  ?  334  LEU A CG    1 
ATOM   5335 C  CD1   . LEU B 1 335 ? 99.970  11.532  141.444 1.00 26.67  ?  334  LEU A CD1   1 
ATOM   5336 C  CD2   . LEU B 1 335 ? 102.213 11.353  142.518 1.00 26.58  ?  334  LEU A CD2   1 
ATOM   5337 N  N     . HIS B 1 336 ? 104.214 9.831   138.258 1.00 24.51  ?  335  HIS A N     1 
ATOM   5338 C  CA    . HIS B 1 336 ? 104.780 9.303   137.023 1.00 24.56  ?  335  HIS A CA    1 
ATOM   5339 C  C     . HIS B 1 336 ? 104.571 7.793   136.946 1.00 25.55  ?  335  HIS A C     1 
ATOM   5340 O  O     . HIS B 1 336 ? 104.661 7.098   137.960 1.00 25.56  ?  335  HIS A O     1 
ATOM   5341 C  CB    . HIS B 1 336 ? 106.268 9.647   136.959 1.00 24.97  ?  335  HIS A CB    1 
ATOM   5342 C  CG    . HIS B 1 336 ? 106.908 9.394   135.634 1.00 28.19  ?  335  HIS A CG    1 
ATOM   5343 N  ND1   . HIS B 1 336 ? 107.552 8.212   135.332 1.00 30.22  ?  335  HIS A ND1   1 
ATOM   5344 C  CD2   . HIS B 1 336 ? 107.044 10.187  134.544 1.00 29.92  ?  335  HIS A CD2   1 
ATOM   5345 C  CE1   . HIS B 1 336 ? 108.042 8.282   134.107 1.00 35.27  ?  335  HIS A CE1   1 
ATOM   5346 N  NE2   . HIS B 1 336 ? 107.746 9.468   133.607 1.00 31.00  ?  335  HIS A NE2   1 
ATOM   5347 N  N     . VAL B 1 337 ? 104.286 7.298   135.741 1.00 26.52  ?  336  VAL A N     1 
ATOM   5348 C  CA    . VAL B 1 337 ? 104.278 5.864   135.475 1.00 27.64  ?  336  VAL A CA    1 
ATOM   5349 C  C     . VAL B 1 337 ? 105.138 5.579   134.253 1.00 28.11  ?  336  VAL A C     1 
ATOM   5350 O  O     . VAL B 1 337 ? 105.270 6.408   133.345 1.00 27.96  ?  336  VAL A O     1 
ATOM   5351 C  CB    . VAL B 1 337 ? 102.859 5.284   135.259 1.00 33.01  ?  336  VAL A CB    1 
ATOM   5352 C  CG1   . VAL B 1 337 ? 101.965 5.554   136.471 1.00 28.68  ?  336  VAL A CG1   1 
ATOM   5353 C  CG2   . VAL B 1 337 ? 102.235 5.801   133.957 1.00 34.95  ?  336  VAL A CG2   1 
ATOM   5354 N  N     . THR B 1 338 ? 105.723 4.382   134.240 1.00 28.84  ?  337  THR A N     1 
ATOM   5355 C  CA    . THR B 1 338 ? 106.405 3.836   133.076 1.00 31.74  ?  337  THR A CA    1 
ATOM   5356 C  C     . THR B 1 338 ? 105.550 2.699   132.538 1.00 31.41  ?  337  THR A C     1 
ATOM   5357 O  O     . THR B 1 338 ? 105.141 1.821   133.303 1.00 33.32  ?  337  THR A O     1 
ATOM   5358 C  CB    . THR B 1 338 ? 107.802 3.322   133.439 1.00 29.59  ?  337  THR A CB    1 
ATOM   5359 O  OG1   . THR B 1 338 ? 108.575 4.389   134.011 1.00 28.18  ?  337  THR A OG1   1 
ATOM   5360 C  CG2   . THR B 1 338 ? 108.519 2.797   132.197 1.00 35.72  ?  337  THR A CG2   1 
ATOM   5361 N  N     . LEU B 1 339 ? 105.267 2.717   131.238 1.00 32.38  ?  338  LEU A N     1 
ATOM   5362 C  CA    . LEU B 1 339 ? 104.392 1.689   130.694 1.00 35.01  ?  338  LEU A CA    1 
ATOM   5363 C  C     . LEU B 1 339 ? 105.163 0.396   130.439 1.00 35.36  ?  338  LEU A C     1 
ATOM   5364 O  O     . LEU B 1 339 ? 106.394 0.378   130.365 1.00 37.90  ?  338  LEU A O     1 
ATOM   5365 C  CB    . LEU B 1 339 ? 103.728 2.169   129.401 1.00 35.92  ?  338  LEU A CB    1 
ATOM   5366 C  CG    . LEU B 1 339 ? 102.991 3.510   129.493 1.00 34.02  ?  338  LEU A CG    1 
ATOM   5367 C  CD1   . LEU B 1 339 ? 102.371 3.880   128.146 1.00 38.16  ?  338  LEU A CD1   1 
ATOM   5368 C  CD2   . LEU B 1 339 ? 101.936 3.489   130.596 1.00 39.15  ?  338  LEU A CD2   1 
ATOM   5369 N  N     . LEU B 1 340 ? 104.414 -0.700  130.326 1.00 36.99  ?  339  LEU A N     1 
ATOM   5370 C  CA    . LEU B 1 340 ? 104.961 -1.980  129.892 1.00 38.61  ?  339  LEU A CA    1 
ATOM   5371 C  C     . LEU B 1 340 ? 105.527 -1.874  128.470 1.00 39.43  ?  339  LEU A C     1 
ATOM   5372 O  O     . LEU B 1 340 ? 105.108 -1.040  127.673 1.00 41.78  ?  339  LEU A O     1 
ATOM   5373 C  CB    . LEU B 1 340 ? 103.872 -3.052  129.942 1.00 40.42  ?  339  LEU A CB    1 
ATOM   5374 C  CG    . LEU B 1 340 ? 103.241 -3.296  131.317 1.00 42.44  ?  339  LEU A CG    1 
ATOM   5375 C  CD1   . LEU B 1 340 ? 101.966 -4.109  131.212 1.00 43.02  ?  339  LEU A CD1   1 
ATOM   5376 C  CD2   . LEU B 1 340 ? 104.235 -3.988  132.220 1.00 40.25  ?  339  LEU A CD2   1 
ATOM   5377 N  N     . ASP B 1 341 ? 106.468 -2.781  128.143 1.00 52.15  ?  340  ASP A N     1 
ATOM   5378 C  CA    . ASP B 1 341 ? 107.164 -2.686  126.849 1.00 65.29  ?  340  ASP A CA    1 
ATOM   5379 C  C     . ASP B 1 341 ? 106.282 -3.050  125.660 1.00 71.92  ?  340  ASP A C     1 
ATOM   5380 O  O     . ASP B 1 341 ? 106.082 -2.193  124.777 1.00 73.46  ?  340  ASP A O     1 
ATOM   5381 C  CB    . ASP B 1 341 ? 108.433 -3.542  126.880 1.00 73.61  ?  340  ASP A CB    1 
ATOM   5382 C  CG    . ASP B 1 341 ? 109.267 -3.319  128.116 1.00 79.49  ?  340  ASP A CG    1 
ATOM   5383 O  OD1   . ASP B 1 341 ? 108.842 -2.528  128.985 1.00 86.16  ?  340  ASP A OD1   1 
ATOM   5384 O  OD2   . ASP B 1 341 ? 110.341 -3.950  128.225 1.00 73.92  ?  340  ASP A OD2   1 
ATOM   5385 N  N     . PRO B 1 342 ? 105.767 -4.289  125.523 1.00 91.70  ?  341  PRO A N     1 
ATOM   5386 C  CA    . PRO B 1 342 ? 105.169 -4.587  124.216 1.00 94.12  ?  341  PRO A CA    1 
ATOM   5387 C  C     . PRO B 1 342 ? 103.649 -4.444  124.186 1.00 97.63  ?  341  PRO A C     1 
ATOM   5388 O  O     . PRO B 1 342 ? 103.122 -3.828  123.259 1.00 98.99  ?  341  PRO A O     1 
ATOM   5389 C  CB    . PRO B 1 342 ? 105.576 -6.052  123.977 1.00 89.66  ?  341  PRO A CB    1 
ATOM   5390 C  CG    . PRO B 1 342 ? 106.097 -6.577  125.353 1.00 93.83  ?  341  PRO A CG    1 
ATOM   5391 C  CD    . PRO B 1 342 ? 105.792 -5.496  126.368 1.00 97.30  ?  341  PRO A CD    1 
ATOM   5392 O  "O5'" . DT  C 2 1   ? 97.306  37.432  167.065 1.00 76.65  ?  837  DT  G "O5'" 1 
ATOM   5393 C  "C5'" . DT  C 2 1   ? 96.760  36.376  166.279 1.00 72.58  ?  837  DT  G "C5'" 1 
ATOM   5394 C  "C4'" . DT  C 2 1   ? 97.062  35.024  166.906 1.00 67.36  ?  837  DT  G "C4'" 1 
ATOM   5395 O  "O4'" . DT  C 2 1   ? 96.225  34.009  166.300 1.00 56.59  ?  837  DT  G "O4'" 1 
ATOM   5396 C  "C3'" . DT  C 2 1   ? 98.504  34.541  166.741 1.00 69.16  ?  837  DT  G "C3'" 1 
ATOM   5397 O  "O3'" . DT  C 2 1   ? 98.967  33.984  167.959 1.00 60.47  ?  837  DT  G "O3'" 1 
ATOM   5398 C  "C2'" . DT  C 2 1   ? 98.402  33.489  165.639 1.00 68.55  ?  837  DT  G "C2'" 1 
ATOM   5399 C  "C1'" . DT  C 2 1   ? 97.018  32.923  165.890 1.00 68.87  ?  837  DT  G "C1'" 1 
ATOM   5400 N  N1    . DT  C 2 1   ? 96.395  32.320  164.686 1.00 83.00  ?  837  DT  G N1    1 
ATOM   5401 C  C2    . DT  C 2 1   ? 96.163  30.967  164.662 1.00 85.83  ?  837  DT  G C2    1 
ATOM   5402 O  O2    . DT  C 2 1   ? 96.434  30.228  165.589 1.00 80.12  ?  837  DT  G O2    1 
ATOM   5403 N  N3    . DT  C 2 1   ? 95.576  30.505  163.515 1.00 89.78  ?  837  DT  G N3    1 
ATOM   5404 C  C4    . DT  C 2 1   ? 95.214  31.248  162.407 1.00 93.12  ?  837  DT  G C4    1 
ATOM   5405 O  O4    . DT  C 2 1   ? 94.698  30.739  161.419 1.00 92.60  ?  837  DT  G O4    1 
ATOM   5406 C  C5    . DT  C 2 1   ? 95.491  32.665  162.494 1.00 97.09  ?  837  DT  G C5    1 
ATOM   5407 C  C7    . DT  C 2 1   ? 95.145  33.576  161.353 1.00 99.23  ?  837  DT  G C7    1 
ATOM   5408 C  C6    . DT  C 2 1   ? 96.060  33.127  163.619 1.00 92.26  ?  837  DT  G C6    1 
ATOM   5409 P  P     . DC  C 2 2   ? 100.507 33.556  168.127 1.00 50.90  ?  838  DC  G P     1 
ATOM   5410 O  OP1   . DC  C 2 2   ? 100.767 33.500  169.580 1.00 52.97  ?  838  DC  G OP1   1 
ATOM   5411 O  OP2   . DC  C 2 2   ? 101.384 34.375  167.267 1.00 45.74  ?  838  DC  G OP2   1 
ATOM   5412 O  "O5'" . DC  C 2 2   ? 100.547 32.081  167.531 1.00 47.26  ?  838  DC  G "O5'" 1 
ATOM   5413 C  "C5'" . DC  C 2 2   ? 100.000 31.025  168.285 1.00 50.52  ?  838  DC  G "C5'" 1 
ATOM   5414 C  "C4'" . DC  C 2 2   ? 100.138 29.718  167.546 1.00 50.70  ?  838  DC  G "C4'" 1 
ATOM   5415 O  "O4'" . DC  C 2 2   ? 99.350  29.773  166.339 1.00 51.88  ?  838  DC  G "O4'" 1 
ATOM   5416 C  "C3'" . DC  C 2 2   ? 101.560 29.352  167.099 1.00 45.41  ?  838  DC  G "C3'" 1 
ATOM   5417 O  "O3'" . DC  C 2 2   ? 101.761 27.965  167.322 1.00 34.81  ?  838  DC  G "O3'" 1 
ATOM   5418 C  "C2'" . DC  C 2 2   ? 101.523 29.666  165.594 1.00 44.22  ?  838  DC  G "C2'" 1 
ATOM   5419 C  "C1'" . DC  C 2 2   ? 100.102 29.228  165.291 1.00 53.67  ?  838  DC  G "C1'" 1 
ATOM   5420 N  N1    . DC  C 2 2   ? 99.526  29.714  163.993 1.00 71.49  ?  838  DC  G N1    1 
ATOM   5421 C  C2    . DC  C 2 2   ? 98.498  28.975  163.377 1.00 63.14  ?  838  DC  G C2    1 
ATOM   5422 O  O2    . DC  C 2 2   ? 98.101  27.931  163.909 1.00 52.29  ?  838  DC  G O2    1 
ATOM   5423 N  N3    . DC  C 2 2   ? 97.972  29.424  162.212 1.00 65.91  ?  838  DC  G N3    1 
ATOM   5424 C  C4    . DC  C 2 2   ? 98.423  30.554  161.668 1.00 70.13  ?  838  DC  G C4    1 
ATOM   5425 N  N4    . DC  C 2 2   ? 97.871  30.954  160.515 1.00 69.94  ?  838  DC  G N4    1 
ATOM   5426 C  C5    . DC  C 2 2   ? 99.462  31.324  162.280 1.00 68.06  ?  838  DC  G C5    1 
ATOM   5427 C  C6    . DC  C 2 2   ? 99.977  30.876  163.432 1.00 72.15  ?  838  DC  G C6    1 
ATOM   5428 P  P     . DT  C 2 3   ? 102.384 27.399  168.708 1.00 34.55  ?  839  DT  G P     1 
ATOM   5429 O  OP1   . DT  C 2 3   ? 102.620 28.486  169.688 1.00 43.15  ?  839  DT  G OP1   1 
ATOM   5430 O  OP2   . DT  C 2 3   ? 103.515 26.525  168.291 1.00 32.23  ?  839  DT  G OP2   1 
ATOM   5431 O  "O5'" . DT  C 2 3   ? 101.224 26.523  169.278 1.00 47.49  ?  839  DT  G "O5'" 1 
ATOM   5432 C  "C5'" . DT  C 2 3   ? 100.862 25.494  168.533 1.00 48.15  ?  839  DT  G "C5'" 1 
ATOM   5433 C  "C4'" . DT  C 2 3   ? 99.384  25.408  168.379 1.00 37.00  ?  839  DT  G "C4'" 1 
ATOM   5434 O  "O4'" . DT  C 2 3   ? 98.956  26.220  167.251 1.00 33.56  ?  839  DT  G "O4'" 1 
ATOM   5435 C  "C3'" . DT  C 2 3   ? 99.014  24.000  168.038 1.00 35.74  ?  839  DT  G "C3'" 1 
ATOM   5436 O  "O3'" . DT  C 2 3   ? 98.642  23.348  169.220 1.00 30.51  ?  839  DT  G "O3'" 1 
ATOM   5437 C  "C2'" . DT  C 2 3   ? 97.881  24.160  167.045 1.00 41.21  ?  839  DT  G "C2'" 1 
ATOM   5438 C  "C1'" . DT  C 2 3   ? 98.328  25.408  166.300 1.00 36.86  ?  839  DT  G "C1'" 1 
ATOM   5439 N  N1    . DT  C 2 3   ? 99.298  25.169  165.156 1.00 43.16  ?  839  DT  G N1    1 
ATOM   5440 C  C2    . DT  C 2 3   ? 98.897  24.429  164.065 1.00 47.03  ?  839  DT  G C2    1 
ATOM   5441 O  O2    . DT  C 2 3   ? 97.804  23.913  163.975 1.00 49.82  ?  839  DT  G O2    1 
ATOM   5442 N  N3    . DT  C 2 3   ? 99.841  24.298  163.079 1.00 50.88  ?  839  DT  G N3    1 
ATOM   5443 C  C4    . DT  C 2 3   ? 101.114 24.840  163.060 1.00 57.89  ?  839  DT  G C4    1 
ATOM   5444 O  O4    . DT  C 2 3   ? 101.889 24.663  162.127 1.00 51.36  ?  839  DT  G O4    1 
ATOM   5445 C  C5    . DT  C 2 3   ? 101.467 25.627  164.221 1.00 62.31  ?  839  DT  G C5    1 
ATOM   5446 C  C7    . DT  C 2 3   ? 102.827 26.264  164.322 1.00 67.73  ?  839  DT  G C7    1 
ATOM   5447 C  C6    . DT  C 2 3   ? 100.551 25.758  165.194 1.00 56.76  ?  839  DT  G C6    1 
ATOM   5448 P  P     . DA  C 2 4   ? 99.101  21.828  169.487 1.00 30.14  ?  840  DA  G P     1 
ATOM   5449 O  OP1   . DA  C 2 4   ? 100.575 21.768  169.511 1.00 29.65  ?  840  DA  G OP1   1 
ATOM   5450 O  OP2   . DA  C 2 4   ? 98.302  20.987  168.563 1.00 31.80  ?  840  DA  G OP2   1 
ATOM   5451 O  "O5'" . DA  C 2 4   ? 98.572  21.575  170.962 1.00 27.30  ?  840  DA  G "O5'" 1 
ATOM   5452 C  "C5'" . DA  C 2 4   ? 99.086  22.298  172.052 1.00 25.19  ?  840  DA  G "C5'" 1 
ATOM   5453 C  "C4'" . DA  C 2 4   ? 98.822  21.523  173.321 1.00 24.42  ?  840  DA  G "C4'" 1 
ATOM   5454 O  "O4'" . DA  C 2 4   ? 97.385  21.383  173.533 1.00 24.17  ?  840  DA  G "O4'" 1 
ATOM   5455 C  "C3'" . DA  C 2 4   ? 99.381  20.118  173.312 1.00 23.51  ?  840  DA  G "C3'" 1 
ATOM   5456 O  "O3'" . DA  C 2 4   ? 99.820  19.833  174.611 1.00 24.39  ?  840  DA  G "O3'" 1 
ATOM   5457 C  "C2'" . DA  C 2 4   ? 98.180  19.245  172.877 1.00 21.20  ?  840  DA  G "C2'" 1 
ATOM   5458 C  "C1'" . DA  C 2 4   ? 96.988  20.018  173.425 1.00 23.97  ?  840  DA  G "C1'" 1 
ATOM   5459 N  N9    . DA  C 2 4   ? 95.813  19.981  172.562 1.00 27.19  ?  840  DA  G N9    1 
ATOM   5460 C  C8    . DA  C 2 4   ? 95.787  20.068  171.197 1.00 23.79  ?  840  DA  G C8    1 
ATOM   5461 N  N7    . DA  C 2 4   ? 94.574  20.022  170.695 1.00 26.56  ?  840  DA  G N7    1 
ATOM   5462 C  C5    . DA  C 2 4   ? 93.757  19.933  171.804 1.00 22.40  ?  840  DA  G C5    1 
ATOM   5463 C  C6    . DA  C 2 4   ? 92.358  19.862  171.945 1.00 20.56  ?  840  DA  G C6    1 
ATOM   5464 N  N6    . DA  C 2 4   ? 91.507  19.896  170.909 1.00 19.69  ?  840  DA  G N6    1 
ATOM   5465 N  N1    . DA  C 2 4   ? 91.865  19.773  173.188 1.00 19.97  ?  840  DA  G N1    1 
ATOM   5466 C  C2    . DA  C 2 4   ? 92.707  19.759  174.217 1.00 23.77  ?  840  DA  G C2    1 
ATOM   5467 N  N3    . DA  C 2 4   ? 94.041  19.804  174.213 1.00 22.18  ?  840  DA  G N3    1 
ATOM   5468 C  C4    . DA  C 2 4   ? 94.503  19.900  172.959 1.00 22.17  ?  840  DA  G C4    1 
ATOM   5469 P  P     . DG  C 2 5   ? 100.543 18.460  174.959 1.00 25.19  ?  841  DG  G P     1 
ATOM   5470 O  OP1   . DG  C 2 5   ? 101.433 18.791  176.101 1.00 25.12  ?  841  DG  G OP1   1 
ATOM   5471 O  OP2   . DG  C 2 5   ? 101.029 17.874  173.689 1.00 23.27  ?  841  DG  G OP2   1 
ATOM   5472 O  "O5'" . DG  C 2 5   ? 99.359  17.546  175.460 1.00 23.80  ?  841  DG  G "O5'" 1 
ATOM   5473 C  "C5'" . DG  C 2 5   ? 98.758  17.782  176.694 1.00 23.84  ?  841  DG  G "C5'" 1 
ATOM   5474 C  "C4'" . DG  C 2 5   ? 97.722  16.722  176.921 1.00 23.05  ?  841  DG  G "C4'" 1 
ATOM   5475 O  "O4'" . DG  C 2 5   ? 96.614  16.946  176.009 1.00 25.25  ?  841  DG  G "O4'" 1 
ATOM   5476 C  "C3'" . DG  C 2 5   ? 98.232  15.297  176.642 1.00 24.79  ?  841  DG  G "C3'" 1 
ATOM   5477 O  "O3'" . DG  C 2 5   ? 97.752  14.453  177.655 1.00 24.97  ?  841  DG  G "O3'" 1 
ATOM   5478 C  "C2'" . DG  C 2 5   ? 97.616  14.965  175.280 1.00 24.78  ?  841  DG  G "C2'" 1 
ATOM   5479 C  "C1'" . DG  C 2 5   ? 96.295  15.716  175.381 1.00 20.78  ?  841  DG  G "C1'" 1 
ATOM   5480 N  N9    . DG  C 2 5   ? 95.641  15.969  174.106 1.00 20.36  ?  841  DG  G N9    1 
ATOM   5481 C  C8    . DG  C 2 5   ? 96.224  16.119  172.868 1.00 24.99  ?  841  DG  G C8    1 
ATOM   5482 N  N7    . DG  C 2 5   ? 95.354  16.353  171.912 1.00 22.31  ?  841  DG  G N7    1 
ATOM   5483 C  C5    . DG  C 2 5   ? 94.128  16.324  172.556 1.00 18.26  ?  841  DG  G C5    1 
ATOM   5484 C  C6    . DG  C 2 5   ? 92.822  16.495  172.036 1.00 21.50  ?  841  DG  G C6    1 
ATOM   5485 O  O6    . DG  C 2 5   ? 92.488  16.700  170.864 1.00 22.13  ?  841  DG  G O6    1 
ATOM   5486 N  N1    . DG  C 2 5   ? 91.858  16.390  173.032 1.00 18.28  ?  841  DG  G N1    1 
ATOM   5487 C  C2    . DG  C 2 5   ? 92.118  16.181  174.354 1.00 18.92  ?  841  DG  G C2    1 
ATOM   5488 N  N2    . DG  C 2 5   ? 91.066  16.135  175.160 1.00 20.47  ?  841  DG  G N2    1 
ATOM   5489 N  N3    . DG  C 2 5   ? 93.330  16.017  174.855 1.00 21.46  ?  841  DG  G N3    1 
ATOM   5490 C  C4    . DG  C 2 5   ? 94.282  16.111  173.901 1.00 18.19  ?  841  DG  G C4    1 
ATOM   5491 P  P     . DG  C 2 6   ? 98.226  12.928  177.796 1.00 23.52  ?  842  DG  G P     1 
ATOM   5492 O  OP1   . DG  C 2 6   ? 98.649  12.801  179.208 1.00 27.24  ?  842  DG  G OP1   1 
ATOM   5493 O  OP2   . DG  C 2 6   ? 99.094  12.513  176.709 1.00 23.89  ?  842  DG  G OP2   1 
ATOM   5494 O  "O5'" . DG  C 2 6   ? 96.856  12.142  177.579 1.00 23.23  ?  842  DG  G "O5'" 1 
ATOM   5495 C  "C5'" . DG  C 2 6   ? 95.933  12.091  178.622 1.00 23.92  ?  842  DG  G "C5'" 1 
ATOM   5496 C  "C4'" . DG  C 2 6   ? 94.538  11.779  178.107 1.00 24.71  ?  842  DG  G "C4'" 1 
ATOM   5497 O  "O4'" . DG  C 2 6   ? 94.159  12.773  177.147 1.00 27.43  ?  842  DG  G "O4'" 1 
ATOM   5498 C  "C3'" . DG  C 2 6   ? 94.377  10.467  177.350 1.00 25.77  ?  842  DG  G "C3'" 1 
ATOM   5499 O  "O3'" . DG  C 2 6   ? 94.187  9.434   178.252 1.00 21.61  ?  842  DG  G "O3'" 1 
ATOM   5500 C  "C2'" . DG  C 2 6   ? 93.072  10.733  176.595 1.00 32.97  ?  842  DG  G "C2'" 1 
ATOM   5501 C  "C1'" . DG  C 2 6   ? 93.168  12.226  176.302 1.00 29.05  ?  842  DG  G "C1'" 1 
ATOM   5502 N  N9    . DG  C 2 6   ? 93.480  12.524  174.906 1.00 25.57  ?  842  DG  G N9    1 
ATOM   5503 C  C8    . DG  C 2 6   ? 94.699  12.737  174.324 1.00 22.84  ?  842  DG  G C8    1 
ATOM   5504 N  N7    . DG  C 2 6   ? 94.621  12.976  173.035 1.00 24.36  ?  842  DG  G N7    1 
ATOM   5505 C  C5    . DG  C 2 6   ? 93.260  12.888  172.765 1.00 20.59  ?  842  DG  G C5    1 
ATOM   5506 C  C6    . DG  C 2 6   ? 92.536  13.078  171.548 1.00 16.99  ?  842  DG  G C6    1 
ATOM   5507 O  O6    . DG  C 2 6   ? 92.971  13.336  170.417 1.00 21.13  ?  842  DG  G O6    1 
ATOM   5508 N  N1    . DG  C 2 6   ? 91.175  12.897  171.733 1.00 17.35  ?  842  DG  G N1    1 
ATOM   5509 C  C2    . DG  C 2 6   ? 90.577  12.600  172.933 1.00 20.53  ?  842  DG  G C2    1 
ATOM   5510 N  N2    . DG  C 2 6   ? 89.242  12.453  172.922 1.00 21.74  ?  842  DG  G N2    1 
ATOM   5511 N  N3    . DG  C 2 6   ? 91.238  12.437  174.070 1.00 24.54  ?  842  DG  G N3    1 
ATOM   5512 C  C4    . DG  C 2 6   ? 92.561  12.615  173.910 1.00 21.30  ?  842  DG  G C4    1 
ATOM   5513 P  P     . DG  C 2 7   ? 94.473  7.915   177.830 1.00 24.44  ?  843  DG  G P     1 
ATOM   5514 O  OP1   . DG  C 2 7   ? 94.445  7.185   179.112 1.00 26.56  ?  843  DG  G OP1   1 
ATOM   5515 O  OP2   . DG  C 2 7   ? 95.649  7.829   176.947 1.00 26.07  ?  843  DG  G OP2   1 
ATOM   5516 O  "O5'" . DG  C 2 7   ? 93.171  7.525   177.027 1.00 26.51  ?  843  DG  G "O5'" 1 
ATOM   5517 C  "C5'" . DG  C 2 7   ? 93.249  6.888   175.788 1.00 28.81  ?  843  DG  G "C5'" 1 
ATOM   5518 C  "C4'" . DG  C 2 7   ? 92.036  7.283   174.993 1.00 26.46  ?  843  DG  G "C4'" 1 
ATOM   5519 O  "O4'" . DG  C 2 7   ? 92.264  8.593   174.430 1.00 25.89  ?  843  DG  G "O4'" 1 
ATOM   5520 C  "C3'" . DG  C 2 7   ? 91.722  6.416   173.802 1.00 20.46  ?  843  DG  G "C3'" 1 
ATOM   5521 O  "O3'" . DG  C 2 7   ? 90.996  5.288   174.239 1.00 23.18  ?  843  DG  G "O3'" 1 
ATOM   5522 C  "C2'" . DG  C 2 7   ? 90.834  7.371   172.983 1.00 19.34  ?  843  DG  G "C2'" 1 
ATOM   5523 C  "C1'" . DG  C 2 7   ? 91.476  8.745   173.269 1.00 20.95  ?  843  DG  G "C1'" 1 
ATOM   5524 N  N9    . DG  C 2 7   ? 92.320  9.239   172.185 1.00 20.93  ?  843  DG  G N9    1 
ATOM   5525 C  C8    . DG  C 2 7   ? 93.676  9.435   172.190 1.00 18.96  ?  843  DG  G C8    1 
ATOM   5526 N  N7    . DG  C 2 7   ? 94.135  9.892   171.061 1.00 20.37  ?  843  DG  G N7    1 
ATOM   5527 C  C5    . DG  C 2 7   ? 93.000  10.008  170.268 1.00 22.29  ?  843  DG  G C5    1 
ATOM   5528 C  C6    . DG  C 2 7   ? 92.859  10.471  168.938 1.00 20.21  ?  843  DG  G C6    1 
ATOM   5529 O  O6    . DG  C 2 7   ? 93.732  10.851  168.175 1.00 22.38  ?  843  DG  G O6    1 
ATOM   5530 N  N1    . DG  C 2 7   ? 91.528  10.437  168.521 1.00 20.90  ?  843  DG  G N1    1 
ATOM   5531 C  C2    . DG  C 2 7   ? 90.482  9.994   169.286 1.00 17.87  ?  843  DG  G C2    1 
ATOM   5532 N  N2    . DG  C 2 7   ? 89.265  10.021  168.721 1.00 18.52  ?  843  DG  G N2    1 
ATOM   5533 N  N3    . DG  C 2 7   ? 90.606  9.589   170.542 1.00 18.85  ?  843  DG  G N3    1 
ATOM   5534 C  C4    . DG  C 2 7   ? 91.890  9.621   170.950 1.00 19.21  ?  843  DG  G C4    1 
ATOM   5535 P  P     . DT  C 2 8   ? 90.876  3.973   173.320 1.00 24.27  ?  844  DT  G P     1 
ATOM   5536 O  OP1   . DT  C 2 8   ? 90.196  2.992   174.182 1.00 23.30  ?  844  DT  G OP1   1 
ATOM   5537 O  OP2   . DT  C 2 8   ? 92.189  3.720   172.672 1.00 24.36  ?  844  DT  G OP2   1 
ATOM   5538 O  "O5'" . DT  C 2 8   ? 89.874  4.383   172.153 1.00 23.02  ?  844  DT  G "O5'" 1 
ATOM   5539 C  "C5'" . DT  C 2 8   ? 88.537  4.790   172.471 1.00 21.95  ?  844  DT  G "C5'" 1 
ATOM   5540 C  "C4'" . DT  C 2 8   ? 87.706  4.862   171.213 1.00 22.13  ?  844  DT  G "C4'" 1 
ATOM   5541 O  "O4'" . DT  C 2 8   ? 88.159  5.991   170.398 1.00 25.56  ?  844  DT  G "O4'" 1 
ATOM   5542 C  "C3'" . DT  C 2 8   ? 87.804  3.610   170.342 1.00 32.16  ?  844  DT  G "C3'" 1 
ATOM   5543 O  "O3'" . DT  C 2 8   ? 86.537  3.132   169.986 1.00 31.96  ?  844  DT  G "O3'" 1 
ATOM   5544 C  "C2'" . DT  C 2 8   ? 88.581  4.039   169.115 1.00 35.76  ?  844  DT  G "C2'" 1 
ATOM   5545 C  "C1'" . DT  C 2 8   ? 88.434  5.552   169.081 1.00 34.39  ?  844  DT  G "C1'" 1 
ATOM   5546 N  N1    . DT  C 2 8   ? 89.676  6.150   168.646 1.00 26.62  ?  844  DT  G N1    1 
ATOM   5547 C  C2    . DT  C 2 8   ? 89.723  6.784   167.436 1.00 26.19  ?  844  DT  G C2    1 
ATOM   5548 O  O2    . DT  C 2 8   ? 88.736  6.936   166.717 1.00 23.81  ?  844  DT  G O2    1 
ATOM   5549 N  N3    . DT  C 2 8   ? 90.957  7.279   167.104 1.00 22.34  ?  844  DT  G N3    1 
ATOM   5550 C  C4    . DT  C 2 8   ? 92.137  7.166   167.834 1.00 19.28  ?  844  DT  G C4    1 
ATOM   5551 O  O4    . DT  C 2 8   ? 93.195  7.659   167.453 1.00 21.55  ?  844  DT  G O4    1 
ATOM   5552 C  C5    . DT  C 2 8   ? 92.019  6.454   169.085 1.00 22.09  ?  844  DT  G C5    1 
ATOM   5553 C  C7    . DT  C 2 8   ? 93.224  6.261   169.972 1.00 20.61  ?  844  DT  G C7    1 
ATOM   5554 C  C6    . DT  C 2 8   ? 90.808  5.974   169.419 1.00 26.40  ?  844  DT  G C6    1 
ATOM   5555 P  P     . DC  C 2 9   ? 86.423  1.713   169.226 1.00 40.19  ?  845  DC  G P     1 
ATOM   5556 O  OP1   . DC  C 2 9   ? 85.050  1.243   169.458 1.00 49.90  ?  845  DC  G OP1   1 
ATOM   5557 O  OP2   . DC  C 2 9   ? 87.616  0.904   169.569 1.00 39.04  ?  845  DC  G OP2   1 
ATOM   5558 O  "O5'" . DC  C 2 9   ? 86.584  2.056   167.673 1.00 34.25  ?  845  DC  G "O5'" 1 
ATOM   5559 C  "C5'" . DC  C 2 9   ? 85.671  2.923   167.041 1.00 34.32  ?  845  DC  G "C5'" 1 
ATOM   5560 C  "C4'" . DC  C 2 9   ? 86.153  3.261   165.638 1.00 34.56  ?  845  DC  G "C4'" 1 
ATOM   5561 O  "O4'" . DC  C 2 9   ? 87.366  4.036   165.712 1.00 25.59  ?  845  DC  G "O4'" 1 
ATOM   5562 C  "C3'" . DC  C 2 9   ? 86.469  2.040   164.763 1.00 33.40  ?  845  DC  G "C3'" 1 
ATOM   5563 O  "O3'" . DC  C 2 9   ? 85.579  2.010   163.684 1.00 37.94  ?  845  DC  G "O3'" 1 
ATOM   5564 C  "C2'" . DC  C 2 9   ? 87.911  2.246   164.292 1.00 28.79  ?  845  DC  G "C2'" 1 
ATOM   5565 C  "C1'" . DC  C 2 9   ? 88.188  3.720   164.605 1.00 26.35  ?  845  DC  G "C1'" 1 
ATOM   5566 N  N1    . DC  C 2 9   ? 89.619  3.968   164.996 1.00 26.10  ?  845  DC  G N1    1 
ATOM   5567 C  C2    . DC  C 2 9   ? 90.439  4.777   164.201 1.00 25.33  ?  845  DC  G C2    1 
ATOM   5568 O  O2    . DC  C 2 9   ? 89.965  5.298   163.185 1.00 30.37  ?  845  DC  G O2    1 
ATOM   5569 N  N3    . DC  C 2 9   ? 91.733  4.992   164.587 1.00 24.65  ?  845  DC  G N3    1 
ATOM   5570 C  C4    . DC  C 2 9   ? 92.198  4.413   165.699 1.00 22.77  ?  845  DC  G C4    1 
ATOM   5571 N  N4    . DC  C 2 9   ? 93.480  4.641   166.042 1.00 22.41  ?  845  DC  G N4    1 
ATOM   5572 C  C5    . DC  C 2 9   ? 91.380  3.577   166.505 1.00 25.68  ?  845  DC  G C5    1 
ATOM   5573 C  C6    . DC  C 2 9   ? 90.109  3.379   166.117 1.00 24.52  ?  845  DC  G C6    1 
ATOM   5574 P  P     . DC  C 2 10  ? 85.595  0.800   162.633 1.00 45.18  ?  846  DC  G P     1 
ATOM   5575 O  OP1   . DC  C 2 10  ? 84.202  0.728   162.160 1.00 45.52  ?  846  DC  G OP1   1 
ATOM   5576 O  OP2   . DC  C 2 10  ? 86.311  -0.395  163.158 1.00 39.01  ?  846  DC  G OP2   1 
ATOM   5577 O  "O5'" . DC  C 2 10  ? 86.492  1.356   161.448 1.00 37.97  ?  846  DC  G "O5'" 1 
ATOM   5578 C  "C5'" . DC  C 2 10  ? 86.061  2.492   160.733 1.00 34.02  ?  846  DC  G "C5'" 1 
ATOM   5579 C  "C4'" . DC  C 2 10  ? 87.099  2.868   159.713 1.00 34.13  ?  846  DC  G "C4'" 1 
ATOM   5580 O  "O4'" . DC  C 2 10  ? 88.310  3.262   160.396 1.00 36.23  ?  846  DC  G "O4'" 1 
ATOM   5581 C  "C3'" . DC  C 2 10  ? 87.483  1.727   158.770 1.00 36.64  ?  846  DC  G "C3'" 1 
ATOM   5582 O  "O3'" . DC  C 2 10  ? 87.291  2.142   157.444 1.00 38.98  ?  846  DC  G "O3'" 1 
ATOM   5583 C  "C2'" . DC  C 2 10  ? 88.957  1.440   159.086 1.00 34.93  ?  846  DC  G "C2'" 1 
ATOM   5584 C  "C1'" . DC  C 2 10  ? 89.428  2.741   159.717 1.00 33.46  ?  846  DC  G "C1'" 1 
ATOM   5585 N  N1    . DC  C 2 10  ? 90.540  2.569   160.721 1.00 28.33  ?  846  DC  G N1    1 
ATOM   5586 C  C2    . DC  C 2 10  ? 91.752  3.221   160.529 1.00 23.98  ?  846  DC  G C2    1 
ATOM   5587 O  O2    . DC  C 2 10  ? 91.906  3.920   159.519 1.00 30.32  ?  846  DC  G O2    1 
ATOM   5588 N  N3    . DC  C 2 10  ? 92.742  3.061   161.457 1.00 26.13  ?  846  DC  G N3    1 
ATOM   5589 C  C4    . DC  C 2 10  ? 92.535  2.303   162.532 1.00 20.95  ?  846  DC  G C4    1 
ATOM   5590 N  N4    . DC  C 2 10  ? 93.546  2.184   163.422 1.00 25.66  ?  846  DC  G N4    1 
ATOM   5591 C  C5    . DC  C 2 10  ? 91.303  1.629   162.742 1.00 26.45  ?  846  DC  G C5    1 
ATOM   5592 C  C6    . DC  C 2 10  ? 90.340  1.790   161.828 1.00 28.39  ?  846  DC  G C6    1 
ATOM   5593 P  P     . DT  C 2 11  ? 87.481  1.115   156.229 1.00 40.49  ?  847  DT  G P     1 
ATOM   5594 O  OP1   . DT  C 2 11  ? 86.539  1.556   155.181 1.00 42.64  ?  847  DT  G OP1   1 
ATOM   5595 O  OP2   . DT  C 2 11  ? 87.471  -0.271  156.748 1.00 46.61  ?  847  DT  G OP2   1 
ATOM   5596 O  "O5'" . DT  C 2 11  ? 88.967  1.388   155.732 1.00 37.76  ?  847  DT  G "O5'" 1 
ATOM   5597 C  "C5'" . DT  C 2 11  ? 89.323  2.671   155.262 1.00 34.54  ?  847  DT  G "C5'" 1 
ATOM   5598 C  "C4'" . DT  C 2 11  ? 90.801  2.716   154.973 1.00 36.72  ?  847  DT  G "C4'" 1 
ATOM   5599 O  "O4'" . DT  C 2 11  ? 91.531  2.610   156.212 1.00 43.44  ?  847  DT  G "O4'" 1 
ATOM   5600 C  "C3'" . DT  C 2 11  ? 91.302  1.574   154.082 1.00 41.54  ?  847  DT  G "C3'" 1 
ATOM   5601 O  "O3'" . DT  C 2 11  ? 91.830  2.105   152.889 1.00 52.57  ?  847  DT  G "O3'" 1 
ATOM   5602 C  "C2'" . DT  C 2 11  ? 92.380  0.864   154.920 1.00 41.81  ?  847  DT  G "C2'" 1 
ATOM   5603 C  "C1'" . DT  C 2 11  ? 92.722  1.908   155.975 1.00 39.18  ?  847  DT  G "C1'" 1 
ATOM   5604 N  N1    . DT  C 2 11  ? 93.171  1.345   157.268 1.00 35.38  ?  847  DT  G N1    1 
ATOM   5605 C  C2    . DT  C 2 11  ? 94.410  1.692   157.758 1.00 40.50  ?  847  DT  G C2    1 
ATOM   5606 O  O2    . DT  C 2 11  ? 95.184  2.421   157.162 1.00 40.73  ?  847  DT  G O2    1 
ATOM   5607 N  N3    . DT  C 2 11  ? 94.718  1.143   158.972 1.00 35.55  ?  847  DT  G N3    1 
ATOM   5608 C  C4    . DT  C 2 11  ? 93.927  0.302   159.731 1.00 32.63  ?  847  DT  G C4    1 
ATOM   5609 O  O4    . DT  C 2 11  ? 94.296  -0.132  160.820 1.00 35.37  ?  847  DT  G O4    1 
ATOM   5610 C  C5    . DT  C 2 11  ? 92.631  -0.010  159.164 1.00 29.43  ?  847  DT  G C5    1 
ATOM   5611 C  C7    . DT  C 2 11  ? 91.679  -0.913  159.892 1.00 35.88  ?  847  DT  G C7    1 
ATOM   5612 C  C6    . DT  C 2 11  ? 92.320  0.525   157.976 1.00 31.15  ?  847  DT  G C6    1 
ATOM   5613 P  P     . DA  C 2 12  ? 91.858  1.214   151.557 1.00 60.28  ?  848  DA  G P     1 
ATOM   5614 O  OP1   . DA  C 2 12  ? 91.214  2.012   150.490 1.00 64.33  ?  848  DA  G OP1   1 
ATOM   5615 O  OP2   . DA  C 2 12  ? 91.406  -0.156  151.907 1.00 54.68  ?  848  DA  G OP2   1 
ATOM   5616 O  "O5'" . DA  C 2 12  ? 93.400  1.059   151.225 1.00 48.97  ?  848  DA  G "O5'" 1 
ATOM   5617 C  "C5'" . DA  C 2 12  ? 94.357  1.953   151.757 1.00 42.76  ?  848  DA  G "C5'" 1 
ATOM   5618 C  "C4'" . DA  C 2 12  ? 95.642  1.203   151.990 1.00 42.95  ?  848  DA  G "C4'" 1 
ATOM   5619 O  "O4'" . DA  C 2 12  ? 95.743  0.866   153.402 1.00 50.34  ?  848  DA  G "O4'" 1 
ATOM   5620 C  "C3'" . DA  C 2 12  ? 95.704  -0.130  151.224 1.00 49.46  ?  848  DA  G "C3'" 1 
ATOM   5621 O  "O3'" . DA  C 2 12  ? 96.925  -0.268  150.525 1.00 53.34  ?  848  DA  G "O3'" 1 
ATOM   5622 C  "C2'" . DA  C 2 12  ? 95.561  -1.183  152.317 1.00 53.63  ?  848  DA  G "C2'" 1 
ATOM   5623 C  "C1'" . DA  C 2 12  ? 96.150  -0.474  153.520 1.00 52.51  ?  848  DA  G "C1'" 1 
ATOM   5624 N  N9    . DA  C 2 12  ? 95.682  -1.043  154.783 1.00 40.68  ?  848  DA  G N9    1 
ATOM   5625 C  C8    . DA  C 2 12  ? 94.522  -1.730  154.988 1.00 46.43  ?  848  DA  G C8    1 
ATOM   5626 N  N7    . DA  C 2 12  ? 94.374  -2.166  156.215 1.00 47.71  ?  848  DA  G N7    1 
ATOM   5627 C  C5    . DA  C 2 12  ? 95.533  -1.766  156.849 1.00 39.93  ?  848  DA  G C5    1 
ATOM   5628 C  C6    . DA  C 2 12  ? 95.993  -1.928  158.165 1.00 40.39  ?  848  DA  G C6    1 
ATOM   5629 N  N6    . DA  C 2 12  ? 95.299  -2.571  159.113 1.00 43.42  ?  848  DA  G N6    1 
ATOM   5630 N  N1    . DA  C 2 12  ? 97.200  -1.410  158.474 1.00 35.83  ?  848  DA  G N1    1 
ATOM   5631 C  C2    . DA  C 2 12  ? 97.884  -0.769  157.532 1.00 33.66  ?  848  DA  G C2    1 
ATOM   5632 N  N3    . DA  C 2 12  ? 97.554  -0.549  156.259 1.00 43.94  ?  848  DA  G N3    1 
ATOM   5633 C  C4    . DA  C 2 12  ? 96.356  -1.082  155.980 1.00 42.76  ?  848  DA  G C4    1 
ATOM   5634 P  P     . DG  C 2 13  ? 97.071  -1.377  149.358 1.00 49.67  ?  849  DG  G P     1 
ATOM   5635 O  OP1   . DG  C 2 13  ? 96.722  -0.736  148.073 1.00 45.85  ?  849  DG  G OP1   1 
ATOM   5636 O  OP2   . DG  C 2 13  ? 96.376  -2.619  149.762 1.00 61.08  ?  849  DG  G OP2   1 
ATOM   5637 O  "O5'" . DG  C 2 13  ? 98.615  -1.699  149.358 1.00 53.76  ?  849  DG  G "O5'" 1 
ATOM   5638 C  "C5'" . DG  C 2 13  ? 99.525  -0.746  149.860 1.00 55.21  ?  849  DG  G "C5'" 1 
ATOM   5639 C  "C4'" . DG  C 2 13  ? 100.690 -1.438  150.525 1.00 54.62  ?  849  DG  G "C4'" 1 
ATOM   5640 O  "O4'" . DG  C 2 13  ? 100.368 -1.731  151.909 1.00 57.25  ?  849  DG  G "O4'" 1 
ATOM   5641 C  "C3'" . DG  C 2 13  ? 101.087 -2.757  149.886 1.00 51.54  ?  849  DG  G "C3'" 1 
ATOM   5642 O  "O3'" . DG  C 2 13  ? 102.491 -2.847  149.864 1.00 54.55  ?  849  DG  G "O3'" 1 
ATOM   5643 C  "C2'" . DG  C 2 13  ? 100.450 -3.807  150.803 1.00 44.75  ?  849  DG  G "C2'" 1 
ATOM   5644 C  "C1'" . DG  C 2 13  ? 100.495 -3.117  152.160 1.00 51.26  ?  849  DG  G "C1'" 1 
ATOM   5645 N  N9    . DG  C 2 13  ? 99.414  -3.517  153.072 1.00 46.66  ?  849  DG  G N9    1 
ATOM   5646 C  C8    . DG  C 2 13  ? 98.078  -3.651  152.774 1.00 43.20  ?  849  DG  G C8    1 
ATOM   5647 N  N7    . DG  C 2 13  ? 97.350  -4.007  153.800 1.00 45.21  ?  849  DG  G N7    1 
ATOM   5648 C  C5    . DG  C 2 13  ? 98.261  -4.105  154.848 1.00 45.15  ?  849  DG  G C5    1 
ATOM   5649 C  C6    . DG  C 2 13  ? 98.062  -4.455  156.213 1.00 38.67  ?  849  DG  G C6    1 
ATOM   5650 O  O6    . DG  C 2 13  ? 97.007  -4.765  156.788 1.00 41.50  ?  849  DG  G O6    1 
ATOM   5651 N  N1    . DG  C 2 13  ? 99.254  -4.431  156.926 1.00 42.03  ?  849  DG  G N1    1 
ATOM   5652 C  C2    . DG  C 2 13  ? 100.476 -4.109  156.403 1.00 44.75  ?  849  DG  G C2    1 
ATOM   5653 N  N2    . DG  C 2 13  ? 101.508 -4.141  157.255 1.00 51.25  ?  849  DG  G N2    1 
ATOM   5654 N  N3    . DG  C 2 13  ? 100.681 -3.786  155.132 1.00 49.35  ?  849  DG  G N3    1 
ATOM   5655 C  C4    . DG  C 2 13  ? 99.532  -3.803  154.415 1.00 45.83  ?  849  DG  G C4    1 
ATOM   5656 P  P     . DG  C 2 14  ? 103.216 -4.038  149.081 1.00 56.36  ?  850  DG  G P     1 
ATOM   5657 O  OP1   . DG  C 2 14  ? 104.429 -3.455  148.456 1.00 57.18  ?  850  DG  G OP1   1 
ATOM   5658 O  OP2   . DG  C 2 14  ? 102.207 -4.723  148.247 1.00 64.30  ?  850  DG  G OP2   1 
ATOM   5659 O  "O5'" . DG  C 2 14  ? 103.667 -5.030  150.256 1.00 63.95  ?  850  DG  G "O5'" 1 
ATOM   5660 C  "C5'" . DG  C 2 14  ? 104.762 -4.668  151.102 1.00 62.58  ?  850  DG  G "C5'" 1 
ATOM   5661 C  "C4'" . DG  C 2 14  ? 104.886 -5.619  152.277 1.00 55.84  ?  850  DG  G "C4'" 1 
ATOM   5662 O  "O4'" . DG  C 2 14  ? 103.638 -5.644  153.004 1.00 60.10  ?  850  DG  G "O4'" 1 
ATOM   5663 C  "C3'" . DG  C 2 14  ? 105.207 -7.076  151.913 1.00 52.61  ?  850  DG  G "C3'" 1 
ATOM   5664 O  "O3'" . DG  C 2 14  ? 106.345 -7.524  152.659 1.00 50.49  ?  850  DG  G "O3'" 1 
ATOM   5665 C  "C2'" . DG  C 2 14  ? 103.935 -7.836  152.291 1.00 53.69  ?  850  DG  G "C2'" 1 
ATOM   5666 C  "C1'" . DG  C 2 14  ? 103.364 -6.963  153.391 1.00 60.71  ?  850  DG  G "C1'" 1 
ATOM   5667 N  N9    . DG  C 2 14  ? 101.925 -7.089  153.560 1.00 57.24  ?  850  DG  G N9    1 
ATOM   5668 C  C8    . DG  C 2 14  ? 100.956 -6.921  152.597 1.00 48.72  ?  850  DG  G C8    1 
ATOM   5669 N  N7    . DG  C 2 14  ? 99.743  -7.077  153.051 1.00 45.22  ?  850  DG  G N7    1 
ATOM   5670 C  C5    . DG  C 2 14  ? 99.922  -7.361  154.400 1.00 45.99  ?  850  DG  G C5    1 
ATOM   5671 C  C6    . DG  C 2 14  ? 98.970  -7.627  155.402 1.00 40.93  ?  850  DG  G C6    1 
ATOM   5672 O  O6    . DG  C 2 14  ? 97.748  -7.663  155.290 1.00 38.18  ?  850  DG  G O6    1 
ATOM   5673 N  N1    . DG  C 2 14  ? 99.569  -7.871  156.640 1.00 38.88  ?  850  DG  G N1    1 
ATOM   5674 C  C2    . DG  C 2 14  ? 100.921 -7.851  156.875 1.00 51.20  ?  850  DG  G C2    1 
ATOM   5675 N  N2    . DG  C 2 14  ? 101.310 -8.108  158.132 1.00 48.02  ?  850  DG  G N2    1 
ATOM   5676 N  N3    . DG  C 2 14  ? 101.832 -7.606  155.939 1.00 51.97  ?  850  DG  G N3    1 
ATOM   5677 C  C4    . DG  C 2 14  ? 101.258 -7.366  154.730 1.00 55.02  ?  850  DG  G C4    1 
ATOM   5678 P  P     . DA  C 2 15  ? 106.887 -9.031  152.523 1.00 61.90  ?  851  DA  G P     1 
ATOM   5679 O  OP1   . DA  C 2 15  ? 108.369 -8.974  152.505 1.00 73.41  ?  851  DA  G OP1   1 
ATOM   5680 O  OP2   . DA  C 2 15  ? 106.168 -9.712  151.425 1.00 67.03  ?  851  DA  G OP2   1 
ATOM   5681 O  "O5'" . DA  C 2 15  ? 106.466 -9.703  153.907 1.00 44.58  ?  851  DA  G "O5'" 1 
ATOM   5682 C  "C5'" . DA  C 2 15  ? 106.458 -8.923  155.096 1.00 39.19  ?  851  DA  G "C5'" 1 
ATOM   5683 C  "C4'" . DA  C 2 15  ? 106.112 -9.780  156.300 1.00 33.99  ?  851  DA  G "C4'" 1 
ATOM   5684 O  "O4'" . DA  C 2 15  ? 104.673 -9.795  156.489 1.00 39.85  ?  851  DA  G "O4'" 1 
ATOM   5685 C  "C3'" . DA  C 2 15  ? 106.520 -11.235 156.188 1.00 39.11  ?  851  DA  G "C3'" 1 
ATOM   5686 O  "O3'" . DA  C 2 15  ? 106.823 -11.733 157.468 1.00 37.55  ?  851  DA  G "O3'" 1 
ATOM   5687 C  "C2'" . DA  C 2 15  ? 105.273 -11.905 155.604 1.00 40.55  ?  851  DA  G "C2'" 1 
ATOM   5688 C  "C1'" . DA  C 2 15  ? 104.154 -11.095 156.250 1.00 43.33  ?  851  DA  G "C1'" 1 
ATOM   5689 N  N9    . DA  C 2 15  ? 102.971 -10.927 155.412 1.00 39.40  ?  851  DA  G N9    1 
ATOM   5690 C  C8    . DA  C 2 15  ? 102.938 -10.532 154.102 1.00 35.84  ?  851  DA  G C8    1 
ATOM   5691 N  N7    . DA  C 2 15  ? 101.721 -10.419 153.617 1.00 41.19  ?  851  DA  G N7    1 
ATOM   5692 C  C5    . DA  C 2 15  ? 100.903 -10.754 154.687 1.00 33.73  ?  851  DA  G C5    1 
ATOM   5693 C  C6    . DA  C 2 15  ? 99.499  -10.837 154.825 1.00 32.74  ?  851  DA  G C6    1 
ATOM   5694 N  N6    . DA  C 2 15  ? 98.651  -10.567 153.830 1.00 36.36  ?  851  DA  G N6    1 
ATOM   5695 N  N1    . DA  C 2 15  ? 99.005  -11.205 156.031 1.00 32.50  ?  851  DA  G N1    1 
ATOM   5696 C  C2    . DA  C 2 15  ? 99.860  -11.468 157.020 1.00 40.47  ?  851  DA  G C2    1 
ATOM   5697 N  N3    . DA  C 2 15  ? 101.197 -11.429 157.007 1.00 35.76  ?  851  DA  G N3    1 
ATOM   5698 C  C4    . DA  C 2 15  ? 101.656 -11.063 155.801 1.00 33.45  ?  851  DA  G C4    1 
ATOM   5699 P  P     . DC  C 2 16  ? 107.474 -13.189 157.617 1.00 40.86  ?  852  DC  G P     1 
ATOM   5700 O  OP1   . DC  C 2 16  ? 108.228 -13.195 158.891 1.00 53.49  ?  852  DC  G OP1   1 
ATOM   5701 O  OP2   . DC  C 2 16  ? 108.107 -13.592 156.353 1.00 42.12  ?  852  DC  G OP2   1 
ATOM   5702 O  "O5'" . DC  C 2 16  ? 106.209 -14.146 157.765 1.00 43.95  ?  852  DC  G "O5'" 1 
ATOM   5703 C  "C5'" . DC  C 2 16  ? 105.373 -14.018 158.878 1.00 43.56  ?  852  DC  G "C5'" 1 
ATOM   5704 C  "C4'" . DC  C 2 16  ? 104.117 -14.844 158.681 1.00 45.23  ?  852  DC  G "C4'" 1 
ATOM   5705 O  "O4'" . DC  C 2 16  ? 103.281 -14.231 157.674 1.00 46.75  ?  852  DC  G "O4'" 1 
ATOM   5706 C  "C3'" . DC  C 2 16  ? 104.351 -16.283 158.213 1.00 55.67  ?  852  DC  G "C3'" 1 
ATOM   5707 O  "O3'" . DC  C 2 16  ? 103.925 -17.182 159.236 1.00 59.86  ?  852  DC  G "O3'" 1 
ATOM   5708 C  "C2'" . DC  C 2 16  ? 103.501 -16.407 156.928 1.00 53.09  ?  852  DC  G "C2'" 1 
ATOM   5709 C  "C1'" . DC  C 2 16  ? 102.527 -15.250 157.091 1.00 47.66  ?  852  DC  G "C1'" 1 
ATOM   5710 N  N1    . DC  C 2 16  ? 101.912 -14.744 155.819 1.00 38.29  ?  852  DC  G N1    1 
ATOM   5711 C  C2    . DC  C 2 16  ? 100.527 -14.607 155.749 1.00 34.36  ?  852  DC  G C2    1 
ATOM   5712 O  O2    . DC  C 2 16  ? 99.851  -14.904 156.730 1.00 37.90  ?  852  DC  G O2    1 
ATOM   5713 N  N3    . DC  C 2 16  ? 99.966  -14.143 154.611 1.00 41.81  ?  852  DC  G N3    1 
ATOM   5714 C  C4    . DC  C 2 16  ? 100.727 -13.832 153.569 1.00 43.27  ?  852  DC  G C4    1 
ATOM   5715 N  N4    . DC  C 2 16  ? 100.115 -13.384 152.464 1.00 40.67  ?  852  DC  G N4    1 
ATOM   5716 C  C5    . DC  C 2 16  ? 102.150 -13.965 153.610 1.00 41.24  ?  852  DC  G C5    1 
ATOM   5717 C  C6    . DC  C 2 16  ? 102.695 -14.422 154.747 1.00 42.08  ?  852  DC  G C6    1 
ATOM   5718 P  P     . DC  C 2 17  ? 104.163 -18.763 159.099 1.00 65.46  ?  853  DC  G P     1 
ATOM   5719 O  OP1   . DC  C 2 17  ? 104.516 -19.260 160.449 1.00 71.25  ?  853  DC  G OP1   1 
ATOM   5720 O  OP2   . DC  C 2 17  ? 105.038 -19.037 157.937 1.00 64.72  ?  853  DC  G OP2   1 
ATOM   5721 O  "O5'" . DC  C 2 17  ? 102.717 -19.324 158.719 1.00 65.58  ?  853  DC  G "O5'" 1 
ATOM   5722 C  "C5'" . DC  C 2 17  ? 101.597 -19.006 159.529 1.00 59.38  ?  853  DC  G "C5'" 1 
ATOM   5723 C  "C4'" . DC  C 2 17  ? 100.322 -19.471 158.857 1.00 57.24  ?  853  DC  G "C4'" 1 
ATOM   5724 O  "O4'" . DC  C 2 17  ? 99.996  -18.569 157.773 1.00 51.20  ?  853  DC  G "O4'" 1 
ATOM   5725 C  "C3'" . DC  C 2 17  ? 100.405 -20.873 158.230 1.00 64.95  ?  853  DC  G "C3'" 1 
ATOM   5726 O  "O3'" . DC  C 2 17  ? 99.363  -21.698 158.719 1.00 75.62  ?  853  DC  G "O3'" 1 
ATOM   5727 C  "C2'" . DC  C 2 17  ? 100.254 -20.622 156.730 1.00 56.49  ?  853  DC  G "C2'" 1 
ATOM   5728 C  "C1'" . DC  C 2 17  ? 99.471  -19.323 156.717 1.00 55.32  ?  853  DC  G "C1'" 1 
ATOM   5729 N  N1    . DC  C 2 17  ? 99.627  -18.572 155.455 1.00 47.73  ?  853  DC  G N1    1 
ATOM   5730 C  C2    . DC  C 2 17  ? 98.494  -18.253 154.706 1.00 47.37  ?  853  DC  G C2    1 
ATOM   5731 O  O2    . DC  C 2 17  ? 97.382  -18.586 155.131 1.00 48.96  ?  853  DC  G O2    1 
ATOM   5732 N  N3    . DC  C 2 17  ? 98.648  -17.581 153.536 1.00 49.40  ?  853  DC  G N3    1 
ATOM   5733 C  C4    . DC  C 2 17  ? 99.870  -17.247 153.115 1.00 49.69  ?  853  DC  G C4    1 
ATOM   5734 N  N4    . DC  C 2 17  ? 99.975  -16.588 151.958 1.00 46.58  ?  853  DC  G N4    1 
ATOM   5735 C  C5    . DC  C 2 17  ? 101.038 -17.576 153.863 1.00 48.42  ?  853  DC  G C5    1 
ATOM   5736 C  C6    . DC  C 2 17  ? 100.873 -18.237 155.013 1.00 49.13  ?  853  DC  G C6    1 
ATOM   5737 P  P     . DC  C 2 18  ? 99.484  -23.295 158.588 1.00 80.67  ?  854  DC  G P     1 
ATOM   5738 O  OP1   . DC  C 2 18  ? 99.227  -23.846 159.934 1.00 92.44  ?  854  DC  G OP1   1 
ATOM   5739 O  OP2   . DC  C 2 18  ? 100.734 -23.619 157.861 1.00 71.32  ?  854  DC  G OP2   1 
ATOM   5740 O  "O5'" . DC  C 2 18  ? 98.290  -23.707 157.610 1.00 80.76  ?  854  DC  G "O5'" 1 
ATOM   5741 C  "C5'" . DC  C 2 18  ? 97.140  -22.887 157.486 1.00 77.32  ?  854  DC  G "C5'" 1 
ATOM   5742 C  "C4'" . DC  C 2 18  ? 96.388  -23.244 156.218 1.00 73.99  ?  854  DC  G "C4'" 1 
ATOM   5743 O  "O4'" . DC  C 2 18  ? 96.680  -22.263 155.190 1.00 66.76  ?  854  DC  G "O4'" 1 
ATOM   5744 C  "C3'" . DC  C 2 18  ? 96.750  -24.614 155.630 1.00 78.04  ?  854  DC  G "C3'" 1 
ATOM   5745 O  "O3'" . DC  C 2 18  ? 95.571  -25.356 155.350 1.00 86.73  ?  854  DC  G "O3'" 1 
ATOM   5746 C  "C2'" . DC  C 2 18  ? 97.526  -24.279 154.353 1.00 73.05  ?  854  DC  G "C2'" 1 
ATOM   5747 C  "C1'" . DC  C 2 18  ? 96.956  -22.917 153.976 1.00 71.44  ?  854  DC  G "C1'" 1 
ATOM   5748 N  N1    . DC  C 2 18  ? 97.911  -22.071 153.204 1.00 68.97  ?  854  DC  G N1    1 
ATOM   5749 C  C2    . DC  C 2 18  ? 97.458  -21.335 152.099 1.00 61.66  ?  854  DC  G C2    1 
ATOM   5750 O  O2    . DC  C 2 18  ? 96.269  -21.398 151.778 1.00 66.81  ?  854  DC  G O2    1 
ATOM   5751 N  N3    . DC  C 2 18  ? 98.343  -20.571 151.413 1.00 50.26  ?  854  DC  G N3    1 
ATOM   5752 C  C4    . DC  C 2 18  ? 99.623  -20.526 151.796 1.00 50.38  ?  854  DC  G C4    1 
ATOM   5753 N  N4    . DC  C 2 18  ? 100.463 -19.765 151.087 1.00 46.84  ?  854  DC  G N4    1 
ATOM   5754 C  C5    . DC  C 2 18  ? 100.102 -21.275 152.913 1.00 58.29  ?  854  DC  G C5    1 
ATOM   5755 C  C6    . DC  C 2 18  ? 99.220  -22.022 153.582 1.00 61.79  ?  854  DC  G C6    1 
ATOM   5756 P  P     . DT  D 3 3   ? 94.373  -27.113 142.641 1.00 108.68 ?  858  DT  H P     1 
ATOM   5757 O  OP1   . DT  D 3 3   ? 95.041  -27.616 143.861 1.00 112.94 ?  858  DT  H OP1   1 
ATOM   5758 O  OP2   . DT  D 3 3   ? 94.583  -27.793 141.346 1.00 115.02 ?  858  DT  H OP2   1 
ATOM   5759 O  "O5'" . DT  D 3 3   ? 94.741  -25.573 142.428 1.00 106.32 ?  858  DT  H "O5'" 1 
ATOM   5760 C  "C5'" . DT  D 3 3   ? 95.944  -25.054 142.964 1.00 102.06 ?  858  DT  H "C5'" 1 
ATOM   5761 C  "C4'" . DT  D 3 3   ? 96.469  -23.899 142.127 1.00 97.61  ?  858  DT  H "C4'" 1 
ATOM   5762 O  "O4'" . DT  D 3 3   ? 97.325  -23.085 142.964 1.00 91.96  ?  858  DT  H "O4'" 1 
ATOM   5763 C  "C3'" . DT  D 3 3   ? 97.386  -24.305 140.985 1.00 103.72 ?  858  DT  H "C3'" 1 
ATOM   5764 O  "O3'" . DT  D 3 3   ? 97.666  -23.168 140.169 1.00 107.63 ?  858  DT  H "O3'" 1 
ATOM   5765 C  "C2'" . DT  D 3 3   ? 98.621  -24.637 141.785 1.00 99.76  ?  858  DT  H "C2'" 1 
ATOM   5766 C  "C1'" . DT  D 3 3   ? 98.674  -23.368 142.626 1.00 92.15  ?  858  DT  H "C1'" 1 
ATOM   5767 N  N1    . DT  D 3 3   ? 99.465  -23.483 143.863 1.00 86.70  ?  858  DT  H N1    1 
ATOM   5768 C  C2    . DT  D 3 3   ? 100.561 -22.668 144.025 1.00 87.68  ?  858  DT  H C2    1 
ATOM   5769 O  O2    . DT  D 3 3   ? 100.915 -21.852 143.198 1.00 90.00  ?  858  DT  H O2    1 
ATOM   5770 N  N3    . DT  D 3 3   ? 101.232 -22.842 145.195 1.00 88.31  ?  858  DT  H N3    1 
ATOM   5771 C  C4    . DT  D 3 3   ? 100.925 -23.725 146.204 1.00 94.78  ?  858  DT  H C4    1 
ATOM   5772 O  O4    . DT  D 3 3   ? 101.587 -23.791 147.220 1.00 106.54 ?  858  DT  H O4    1 
ATOM   5773 C  C5    . DT  D 3 3   ? 99.764  -24.556 145.979 1.00 84.24  ?  858  DT  H C5    1 
ATOM   5774 C  C7    . DT  D 3 3   ? 99.340  -25.558 147.012 1.00 77.99  ?  858  DT  H C7    1 
ATOM   5775 C  C6    . DT  D 3 3   ? 99.094  -24.395 144.830 1.00 83.19  ?  858  DT  H C6    1 
ATOM   5776 P  P     . DA  D 3 4   ? 96.745  -22.767 138.917 1.00 110.62 ?  859  DA  H P     1 
ATOM   5777 O  OP1   . DA  D 3 4   ? 95.459  -23.488 139.042 1.00 123.41 ?  859  DA  H OP1   1 
ATOM   5778 O  OP2   . DA  D 3 4   ? 97.549  -22.912 137.685 1.00 107.97 ?  859  DA  H OP2   1 
ATOM   5779 O  "O5'" . DA  D 3 4   ? 96.471  -21.209 139.157 1.00 110.54 ?  859  DA  H "O5'" 1 
ATOM   5780 C  "C5'" . DA  D 3 4   ? 95.244  -20.804 139.730 1.00 112.60 ?  859  DA  H "C5'" 1 
ATOM   5781 C  "C4'" . DA  D 3 4   ? 95.430  -19.712 140.778 1.00 111.48 ?  859  DA  H "C4'" 1 
ATOM   5782 O  "O4'" . DA  D 3 4   ? 96.380  -20.100 141.784 1.00 108.03 ?  859  DA  H "O4'" 1 
ATOM   5783 C  "C3'" . DA  D 3 4   ? 95.933  -18.359 140.272 1.00 110.82 ?  859  DA  H "C3'" 1 
ATOM   5784 O  "O3'" . DA  D 3 4   ? 94.798  -17.511 139.994 1.00 107.44 ?  859  DA  H "O3'" 1 
ATOM   5785 C  "C2'" . DA  D 3 4   ? 96.811  -17.837 141.439 1.00 108.54 ?  859  DA  H "C2'" 1 
ATOM   5786 C  "C1'" . DA  D 3 4   ? 96.658  -18.930 142.501 1.00 103.90 ?  859  DA  H "C1'" 1 
ATOM   5787 N  N9    . DA  D 3 4   ? 97.834  -19.123 143.353 1.00 92.95  ?  859  DA  H N9    1 
ATOM   5788 C  C8    . DA  D 3 4   ? 99.071  -18.561 143.193 1.00 91.55  ?  859  DA  H C8    1 
ATOM   5789 N  N7    . DA  D 3 4   ? 99.931  -18.898 144.128 1.00 88.80  ?  859  DA  H N7    1 
ATOM   5790 C  C5    . DA  D 3 4   ? 99.204  -19.729 144.968 1.00 85.27  ?  859  DA  H C5    1 
ATOM   5791 C  C6    . DA  D 3 4   ? 99.544  -20.419 146.153 1.00 80.56  ?  859  DA  H C6    1 
ATOM   5792 N  N6    . DA  D 3 4   ? 100.762 -20.372 146.712 1.00 75.22  ?  859  DA  H N6    1 
ATOM   5793 N  N1    . DA  D 3 4   ? 98.582  -21.164 146.742 1.00 77.97  ?  859  DA  H N1    1 
ATOM   5794 C  C2    . DA  D 3 4   ? 97.367  -21.208 146.179 1.00 79.37  ?  859  DA  H C2    1 
ATOM   5795 N  N3    . DA  D 3 4   ? 96.931  -20.605 145.072 1.00 79.32  ?  859  DA  H N3    1 
ATOM   5796 C  C4    . DA  D 3 4   ? 97.908  -19.873 144.509 1.00 84.51  ?  859  DA  H C4    1 
ATOM   5797 P  P     . DG  D 3 5   ? 94.811  -15.924 140.268 1.00 94.49  ?  860  DG  H P     1 
ATOM   5798 O  OP1   . DG  D 3 5   ? 93.587  -15.419 139.611 1.00 91.83  ?  860  DG  H OP1   1 
ATOM   5799 O  OP2   . DG  D 3 5   ? 96.122  -15.333 139.911 1.00 102.09 ?  860  DG  H OP2   1 
ATOM   5800 O  "O5'" . DG  D 3 5   ? 94.547  -15.800 141.836 1.00 84.02  ?  860  DG  H "O5'" 1 
ATOM   5801 C  "C5'" . DG  D 3 5   ? 93.250  -16.073 142.329 1.00 80.72  ?  860  DG  H "C5'" 1 
ATOM   5802 C  "C4'" . DG  D 3 5   ? 93.274  -16.481 143.792 1.00 76.43  ?  860  DG  H "C4'" 1 
ATOM   5803 O  "O4'" . DG  D 3 5   ? 94.572  -16.994 144.176 1.00 70.45  ?  860  DG  H "O4'" 1 
ATOM   5804 C  "C3'" . DG  D 3 5   ? 92.981  -15.353 144.784 1.00 77.94  ?  860  DG  H "C3'" 1 
ATOM   5805 O  "O3'" . DG  D 3 5   ? 91.682  -15.493 145.295 1.00 83.29  ?  860  DG  H "O3'" 1 
ATOM   5806 C  "C2'" . DG  D 3 5   ? 94.018  -15.551 145.893 1.00 74.54  ?  860  DG  H "C2'" 1 
ATOM   5807 C  "C1'" . DG  D 3 5   ? 94.598  -16.920 145.571 1.00 68.35  ?  860  DG  H "C1'" 1 
ATOM   5808 N  N9    . DG  D 3 5   ? 95.949  -17.075 146.097 1.00 67.14  ?  860  DG  H N9    1 
ATOM   5809 C  C8    . DG  D 3 5   ? 97.096  -16.442 145.676 1.00 59.25  ?  860  DG  H C8    1 
ATOM   5810 N  N7    . DG  D 3 5   ? 98.145  -16.745 146.394 1.00 55.88  ?  860  DG  H N7    1 
ATOM   5811 C  C5    . DG  D 3 5   ? 97.652  -17.609 147.369 1.00 62.51  ?  860  DG  H C5    1 
ATOM   5812 C  C6    . DG  D 3 5   ? 98.315  -18.267 148.435 1.00 54.53  ?  860  DG  H C6    1 
ATOM   5813 O  O6    . DG  D 3 5   ? 99.508  -18.214 148.742 1.00 51.78  ?  860  DG  H O6    1 
ATOM   5814 N  N1    . DG  D 3 5   ? 97.439  -19.050 149.183 1.00 61.72  ?  860  DG  H N1    1 
ATOM   5815 C  C2    . DG  D 3 5   ? 96.096  -19.187 148.931 1.00 69.17  ?  860  DG  H C2    1 
ATOM   5816 N  N2    . DG  D 3 5   ? 95.413  -19.988 149.761 1.00 74.54  ?  860  DG  H N2    1 
ATOM   5817 N  N3    . DG  D 3 5   ? 95.464  -18.578 147.940 1.00 66.11  ?  860  DG  H N3    1 
ATOM   5818 C  C4    . DG  D 3 5   ? 96.301  -17.807 147.204 1.00 67.46  ?  860  DG  H C4    1 
ATOM   5819 P  P     . DG  D 3 6   ? 90.956  -14.285 146.044 1.00 89.65  ?  861  DG  H P     1 
ATOM   5820 O  OP1   . DG  D 3 6   ? 89.850  -13.860 145.162 1.00 94.17  ?  861  DG  H OP1   1 
ATOM   5821 O  OP2   . DG  D 3 6   ? 91.940  -13.275 146.512 1.00 85.61  ?  861  DG  H OP2   1 
ATOM   5822 O  "O5'" . DG  D 3 6   ? 90.352  -14.973 147.348 1.00 86.63  ?  861  DG  H "O5'" 1 
ATOM   5823 C  "C5'" . DG  D 3 6   ? 89.996  -16.340 147.305 1.00 78.71  ?  861  DG  H "C5'" 1 
ATOM   5824 C  "C4'" . DG  D 3 6   ? 90.158  -16.961 148.668 1.00 69.65  ?  861  DG  H "C4'" 1 
ATOM   5825 O  "O4'" . DG  D 3 6   ? 91.453  -17.585 148.747 1.00 72.87  ?  861  DG  H "O4'" 1 
ATOM   5826 C  "C3'" . DG  D 3 6   ? 90.136  -15.972 149.810 1.00 59.96  ?  861  DG  H "C3'" 1 
ATOM   5827 O  "O3'" . DG  D 3 6   ? 88.803  -15.754 150.228 1.00 59.74  ?  861  DG  H "O3'" 1 
ATOM   5828 C  "C2'" . DG  D 3 6   ? 90.932  -16.702 150.879 1.00 65.04  ?  861  DG  H "C2'" 1 
ATOM   5829 C  "C1'" . DG  D 3 6   ? 91.954  -17.472 150.063 1.00 71.04  ?  861  DG  H "C1'" 1 
ATOM   5830 N  N9    . DG  D 3 6   ? 93.265  -16.840 150.015 1.00 79.13  ?  861  DG  H N9    1 
ATOM   5831 C  C8    . DG  D 3 6   ? 93.706  -15.901 149.118 1.00 74.34  ?  861  DG  H C8    1 
ATOM   5832 N  N7    . DG  D 3 6   ? 94.941  -15.529 149.322 1.00 77.23  ?  861  DG  H N7    1 
ATOM   5833 C  C5    . DG  D 3 6   ? 95.338  -16.270 150.430 1.00 77.36  ?  861  DG  H C5    1 
ATOM   5834 C  C6    . DG  D 3 6   ? 96.573  -16.299 151.121 1.00 69.67  ?  861  DG  H C6    1 
ATOM   5835 O  O6    . DG  D 3 6   ? 97.604  -15.653 150.883 1.00 60.68  ?  861  DG  H O6    1 
ATOM   5836 N  N1    . DG  D 3 6   ? 96.540  -17.192 152.192 1.00 71.78  ?  861  DG  H N1    1 
ATOM   5837 C  C2    . DG  D 3 6   ? 95.454  -17.962 152.543 1.00 73.66  ?  861  DG  H C2    1 
ATOM   5838 N  N2    . DG  D 3 6   ? 95.605  -18.767 153.599 1.00 72.78  ?  861  DG  H N2    1 
ATOM   5839 N  N3    . DG  D 3 6   ? 94.302  -17.946 151.902 1.00 80.27  ?  861  DG  H N3    1 
ATOM   5840 C  C4    . DG  D 3 6   ? 94.315  -17.080 150.862 1.00 81.76  ?  861  DG  H C4    1 
ATOM   5841 P  P     . DG  D 3 7   ? 88.504  -14.774 151.462 1.00 67.61  ?  862  DG  H P     1 
ATOM   5842 O  OP1   . DG  D 3 7   ? 87.074  -14.408 151.423 1.00 77.22  ?  862  DG  H OP1   1 
ATOM   5843 O  OP2   . DG  D 3 7   ? 89.544  -13.721 151.464 1.00 74.05  ?  862  DG  H OP2   1 
ATOM   5844 O  "O5'" . DG  D 3 7   ? 88.747  -15.694 152.734 1.00 68.44  ?  862  DG  H "O5'" 1 
ATOM   5845 C  "C5'" . DG  D 3 7   ? 89.031  -15.103 153.962 1.00 68.09  ?  862  DG  H "C5'" 1 
ATOM   5846 C  "C4'" . DG  D 3 7   ? 90.078  -15.901 154.702 1.00 72.15  ?  862  DG  H "C4'" 1 
ATOM   5847 O  "O4'" . DG  D 3 7   ? 91.183  -16.191 153.823 1.00 75.79  ?  862  DG  H "O4'" 1 
ATOM   5848 C  "C3'" . DG  D 3 7   ? 90.678  -15.173 155.874 1.00 68.50  ?  862  DG  H "C3'" 1 
ATOM   5849 O  "O3'" . DG  D 3 7   ? 89.906  -15.449 157.012 1.00 62.61  ?  862  DG  H "O3'" 1 
ATOM   5850 C  "C2'" . DG  D 3 7   ? 92.086  -15.764 155.983 1.00 59.42  ?  862  DG  H "C2'" 1 
ATOM   5851 C  "C1'" . DG  D 3 7   ? 92.393  -16.210 154.550 1.00 71.05  ?  862  DG  H "C1'" 1 
ATOM   5852 N  N9    . DG  D 3 7   ? 93.361  -15.366 153.850 1.00 79.70  ?  862  DG  H N9    1 
ATOM   5853 C  C8    . DG  D 3 7   ? 93.158  -14.681 152.675 1.00 75.57  ?  862  DG  H C8    1 
ATOM   5854 N  N7    . DG  D 3 7   ? 94.205  -14.017 152.273 1.00 73.43  ?  862  DG  H N7    1 
ATOM   5855 C  C5    . DG  D 3 7   ? 95.170  -14.278 153.241 1.00 73.29  ?  862  DG  H C5    1 
ATOM   5856 C  C6    . DG  D 3 7   ? 96.513  -13.828 153.338 1.00 55.47  ?  862  DG  H C6    1 
ATOM   5857 O  O6    . DG  D 3 7   ? 97.129  -13.090 152.559 1.00 41.46  ?  862  DG  H O6    1 
ATOM   5858 N  N1    . DG  D 3 7   ? 97.145  -14.329 154.474 1.00 44.00  ?  862  DG  H N1    1 
ATOM   5859 C  C2    . DG  D 3 7   ? 96.554  -15.157 155.400 1.00 59.17  ?  862  DG  H C2    1 
ATOM   5860 N  N2    . DG  D 3 7   ? 97.319  -15.537 156.431 1.00 50.36  ?  862  DG  H N2    1 
ATOM   5861 N  N3    . DG  D 3 7   ? 95.298  -15.588 155.320 1.00 72.22  ?  862  DG  H N3    1 
ATOM   5862 C  C4    . DG  D 3 7   ? 94.669  -15.111 154.217 1.00 77.84  ?  862  DG  H C4    1 
ATOM   5863 P  P     . DT  D 3 8   ? 89.637  -14.288 158.075 1.00 71.81  ?  863  DT  H P     1 
ATOM   5864 O  OP1   . DT  D 3 8   ? 88.724  -14.803 159.115 1.00 84.10  ?  863  DT  H OP1   1 
ATOM   5865 O  OP2   . DT  D 3 8   ? 89.335  -13.051 157.324 1.00 68.43  ?  863  DT  H OP2   1 
ATOM   5866 O  "O5'" . DT  D 3 8   ? 91.050  -14.098 158.758 1.00 65.92  ?  863  DT  H "O5'" 1 
ATOM   5867 C  "C5'" . DT  D 3 8   ? 91.599  -15.146 159.508 1.00 64.08  ?  863  DT  H "C5'" 1 
ATOM   5868 C  "C4'" . DT  D 3 8   ? 92.922  -14.714 160.081 1.00 63.99  ?  863  DT  H "C4'" 1 
ATOM   5869 O  "O4'" . DT  D 3 8   ? 93.802  -14.378 158.988 1.00 56.06  ?  863  DT  H "O4'" 1 
ATOM   5870 C  "C3'" . DT  D 3 8   ? 92.848  -13.475 160.981 1.00 60.31  ?  863  DT  H "C3'" 1 
ATOM   5871 O  "O3'" . DT  D 3 8   ? 93.448  -13.757 162.222 1.00 64.33  ?  863  DT  H "O3'" 1 
ATOM   5872 C  "C2'" . DT  D 3 8   ? 93.605  -12.392 160.199 1.00 50.71  ?  863  DT  H "C2'" 1 
ATOM   5873 C  "C1'" . DT  D 3 8   ? 94.515  -13.220 159.314 1.00 56.84  ?  863  DT  H "C1'" 1 
ATOM   5874 N  N1    . DT  D 3 8   ? 94.883  -12.539 158.062 1.00 61.15  ?  863  DT  H N1    1 
ATOM   5875 C  C2    . DT  D 3 8   ? 96.211  -12.399 157.754 1.00 54.77  ?  863  DT  H C2    1 
ATOM   5876 O  O2    . DT  D 3 8   ? 97.103  -12.826 158.464 1.00 48.50  ?  863  DT  H O2    1 
ATOM   5877 N  N3    . DT  D 3 8   ? 96.459  -11.748 156.577 1.00 45.21  ?  863  DT  H N3    1 
ATOM   5878 C  C4    . DT  D 3 8   ? 95.525  -11.233 155.695 1.00 50.30  ?  863  DT  H C4    1 
ATOM   5879 O  O4    . DT  D 3 8   ? 95.845  -10.662 154.659 1.00 42.34  ?  863  DT  H O4    1 
ATOM   5880 C  C5    . DT  D 3 8   ? 94.144  -11.411 156.082 1.00 57.03  ?  863  DT  H C5    1 
ATOM   5881 C  C7    . DT  D 3 8   ? 93.044  -10.886 155.205 1.00 51.28  ?  863  DT  H C7    1 
ATOM   5882 C  C6    . DT  D 3 8   ? 93.891  -12.047 157.236 1.00 58.69  ?  863  DT  H C6    1 
ATOM   5883 P  P     . DC  D 3 9   ? 93.611  -12.605 163.334 1.00 69.28  ?  864  DC  H P     1 
ATOM   5884 O  OP1   . DC  D 3 9   ? 93.271  -13.246 164.624 1.00 78.82  ?  864  DC  H OP1   1 
ATOM   5885 O  OP2   . DC  D 3 9   ? 92.900  -11.366 162.920 1.00 72.31  ?  864  DC  H OP2   1 
ATOM   5886 O  "O5'" . DC  D 3 9   ? 95.187  -12.331 163.278 1.00 73.47  ?  864  DC  H "O5'" 1 
ATOM   5887 C  "C5'" . DC  D 3 9   ? 95.757  -11.269 164.056 1.00 71.30  ?  864  DC  H "C5'" 1 
ATOM   5888 C  "C4'" . DC  D 3 9   ? 97.282  -11.354 164.030 1.00 65.33  ?  864  DC  H "C4'" 1 
ATOM   5889 O  "O4'" . DC  D 3 9   ? 97.746  -11.473 162.672 1.00 63.11  ?  864  DC  H "O4'" 1 
ATOM   5890 C  "C3'" . DC  D 3 9   ? 97.960  -10.097 164.574 1.00 64.69  ?  864  DC  H "C3'" 1 
ATOM   5891 O  "O3'" . DC  D 3 9   ? 99.241  -10.405 165.080 1.00 69.54  ?  864  DC  H "O3'" 1 
ATOM   5892 C  "C2'" . DC  D 3 9   ? 98.044  -9.228  163.344 1.00 63.80  ?  864  DC  H "C2'" 1 
ATOM   5893 C  "C1'" . DC  D 3 9   ? 98.262  -10.235 162.214 1.00 57.36  ?  864  DC  H "C1'" 1 
ATOM   5894 N  N1    . DC  D 3 9   ? 97.562  -9.829  160.934 1.00 50.17  ?  864  DC  H N1    1 
ATOM   5895 C  C2    . DC  D 3 9   ? 98.319  -9.368  159.856 1.00 40.17  ?  864  DC  H C2    1 
ATOM   5896 O  O2    . DC  D 3 9   ? 99.541  -9.308  159.969 1.00 45.00  ?  864  DC  H O2    1 
ATOM   5897 N  N3    . DC  D 3 9   ? 97.688  -8.993  158.714 1.00 46.24  ?  864  DC  H N3    1 
ATOM   5898 C  C4    . DC  D 3 9   ? 96.367  -9.060  158.626 1.00 50.41  ?  864  DC  H C4    1 
ATOM   5899 N  N4    . DC  D 3 9   ? 95.795  -8.679  157.476 1.00 49.16  ?  864  DC  H N4    1 
ATOM   5900 C  C5    . DC  D 3 9   ? 95.568  -9.521  159.715 1.00 55.02  ?  864  DC  H C5    1 
ATOM   5901 C  C6    . DC  D 3 9   ? 96.200  -9.886  160.841 1.00 51.96  ?  864  DC  H C6    1 
ATOM   5902 P  P     . DC  D 3 10  ? 99.910  -9.442  166.184 1.00 78.75  ?  865  DC  H P     1 
ATOM   5903 O  OP1   . DC  D 3 10  ? 100.721 -10.265 167.112 1.00 75.84  ?  865  DC  H OP1   1 
ATOM   5904 O  OP2   . DC  D 3 10  ? 98.816  -8.598  166.681 1.00 74.04  ?  865  DC  H OP2   1 
ATOM   5905 O  "O5'" . DC  D 3 10  ? 100.880 -8.464  165.369 1.00 75.00  ?  865  DC  H "O5'" 1 
ATOM   5906 C  "C5'" . DC  D 3 10  ? 102.031 -8.968  164.751 1.00 67.59  ?  865  DC  H "C5'" 1 
ATOM   5907 C  "C4'" . DC  D 3 10  ? 102.599 -7.945  163.798 1.00 59.73  ?  865  DC  H "C4'" 1 
ATOM   5908 O  "O4'" . DC  D 3 10  ? 101.696 -7.784  162.683 1.00 48.02  ?  865  DC  H "O4'" 1 
ATOM   5909 C  "C3'" . DC  D 3 10  ? 102.794 -6.552  164.404 1.00 52.64  ?  865  DC  H "C3'" 1 
ATOM   5910 O  "O3'" . DC  D 3 10  ? 104.160 -6.179  164.309 1.00 44.47  ?  865  DC  H "O3'" 1 
ATOM   5911 C  "C2'" . DC  D 3 10  ? 101.884 -5.643  163.565 1.00 51.29  ?  865  DC  H "C2'" 1 
ATOM   5912 C  "C1'" . DC  D 3 10  ? 101.708 -6.446  162.284 1.00 45.82  ?  865  DC  H "C1'" 1 
ATOM   5913 N  N1    . DC  D 3 10  ? 100.423 -6.180  161.547 1.00 42.93  ?  865  DC  H N1    1 
ATOM   5914 C  C2    . DC  D 3 10  ? 100.449 -5.589  160.277 1.00 43.58  ?  865  DC  H C2    1 
ATOM   5915 O  O2    . DC  D 3 10  ? 101.536 -5.262  159.788 1.00 45.38  ?  865  DC  H O2    1 
ATOM   5916 N  N3    . DC  D 3 10  ? 99.270  -5.382  159.621 1.00 34.05  ?  865  DC  H N3    1 
ATOM   5917 C  C4    . DC  D 3 10  ? 98.122  -5.741  160.187 1.00 39.59  ?  865  DC  H C4    1 
ATOM   5918 N  N4    . DC  D 3 10  ? 96.985  -5.512  159.512 1.00 39.90  ?  865  DC  H N4    1 
ATOM   5919 C  C5    . DC  D 3 10  ? 98.082  -6.351  161.468 1.00 38.75  ?  865  DC  H C5    1 
ATOM   5920 C  C6    . DC  D 3 10  ? 99.245  -6.545  162.103 1.00 45.86  ?  865  DC  H C6    1 
ATOM   5921 P  P     . DT  D 3 11  ? 104.755 -5.043  165.276 1.00 66.07  ?  866  DT  H P     1 
ATOM   5922 O  OP1   . DT  D 3 11  ? 106.216 -5.268  165.371 1.00 69.02  ?  866  DT  H OP1   1 
ATOM   5923 O  OP2   . DT  D 3 11  ? 103.963 -5.024  166.518 1.00 59.92  ?  866  DT  H OP2   1 
ATOM   5924 O  "O5'" . DT  D 3 11  ? 104.484 -3.690  164.457 1.00 48.07  ?  866  DT  H "O5'" 1 
ATOM   5925 C  "C5'" . DT  D 3 11  ? 105.050 -3.547  163.164 1.00 47.09  ?  866  DT  H "C5'" 1 
ATOM   5926 C  "C4'" . DT  D 3 11  ? 104.374 -2.437  162.383 1.00 42.18  ?  866  DT  H "C4'" 1 
ATOM   5927 O  "O4'" . DT  D 3 11  ? 103.057 -2.839  161.995 1.00 43.12  ?  866  DT  H "O4'" 1 
ATOM   5928 C  "C3'" . DT  D 3 11  ? 104.190 -1.129  163.136 1.00 49.01  ?  866  DT  H "C3'" 1 
ATOM   5929 O  "O3'" . DT  D 3 11  ? 105.249 -0.262  162.791 1.00 36.46  ?  866  DT  H "O3'" 1 
ATOM   5930 C  "C2'" . DT  D 3 11  ? 102.815 -0.602  162.655 1.00 43.39  ?  866  DT  H "C2'" 1 
ATOM   5931 C  "C1'" . DT  D 3 11  ? 102.352 -1.680  161.660 1.00 41.38  ?  866  DT  H "C1'" 1 
ATOM   5932 N  N1    . DT  D 3 11  ? 100.910 -2.000  161.712 1.00 46.01  ?  866  DT  H N1    1 
ATOM   5933 C  C2    . DT  D 3 11  ? 100.098 -1.630  160.661 1.00 43.67  ?  866  DT  H C2    1 
ATOM   5934 O  O2    . DT  D 3 11  ? 100.503 -1.021  159.687 1.00 42.65  ?  866  DT  H O2    1 
ATOM   5935 N  N3    . DT  D 3 11  ? 98.787  -1.988  160.799 1.00 41.64  ?  866  DT  H N3    1 
ATOM   5936 C  C4    . DT  D 3 11  ? 98.215  -2.671  161.858 1.00 38.82  ?  866  DT  H C4    1 
ATOM   5937 O  O4    . DT  D 3 11  ? 97.027  -2.952  161.889 1.00 41.37  ?  866  DT  H O4    1 
ATOM   5938 C  C5    . DT  D 3 11  ? 99.119  -3.038  162.918 1.00 46.20  ?  866  DT  H C5    1 
ATOM   5939 C  C7    . DT  D 3 11  ? 98.607  -3.780  164.117 1.00 49.69  ?  866  DT  H C7    1 
ATOM   5940 C  C6    . DT  D 3 11  ? 100.410 -2.692  162.795 1.00 48.79  ?  866  DT  H C6    1 
ATOM   5941 P  P     . DA  D 3 12  ? 105.373 1.192   163.438 1.00 41.88  ?  867  DA  H P     1 
ATOM   5942 O  OP1   . DA  D 3 12  ? 106.799 1.559   163.341 1.00 37.18  ?  867  DA  H OP1   1 
ATOM   5943 O  OP2   . DA  D 3 12  ? 104.589 1.267   164.692 1.00 37.29  ?  867  DA  H OP2   1 
ATOM   5944 O  "O5'" . DA  D 3 12  ? 104.678 2.122   162.367 1.00 37.84  ?  867  DA  H "O5'" 1 
ATOM   5945 C  "C5'" . DA  D 3 12  ? 105.107 2.060   161.036 1.00 37.32  ?  867  DA  H "C5'" 1 
ATOM   5946 C  "C4'" . DA  D 3 12  ? 104.345 3.076   160.242 1.00 29.21  ?  867  DA  H "C4'" 1 
ATOM   5947 O  "O4'" . DA  D 3 12  ? 102.997 2.600   160.075 1.00 32.89  ?  867  DA  H "O4'" 1 
ATOM   5948 C  "C3'" . DA  D 3 12  ? 104.260 4.436   160.913 1.00 31.10  ?  867  DA  H "C3'" 1 
ATOM   5949 O  "O3'" . DA  D 3 12  ? 104.617 5.445   159.969 1.00 32.28  ?  867  DA  H "O3'" 1 
ATOM   5950 C  "C2'" . DA  D 3 12  ? 102.794 4.528   161.400 1.00 27.67  ?  867  DA  H "C2'" 1 
ATOM   5951 C  "C1'" . DA  D 3 12  ? 102.063 3.568   160.468 1.00 28.15  ?  867  DA  H "C1'" 1 
ATOM   5952 N  N9    . DA  D 3 12  ? 100.936 2.857   161.089 1.00 36.46  ?  867  DA  H N9    1 
ATOM   5953 C  C8    . DA  D 3 12  ? 100.902 2.289   162.336 1.00 36.50  ?  867  DA  H C8    1 
ATOM   5954 N  N7    . DA  D 3 12  ? 99.758  1.705   162.623 1.00 33.40  ?  867  DA  H N7    1 
ATOM   5955 C  C5    . DA  D 3 12  ? 98.995  1.875   161.479 1.00 34.62  ?  867  DA  H C5    1 
ATOM   5956 C  C6    . DA  D 3 12  ? 97.679  1.483   161.142 1.00 32.20  ?  867  DA  H C6    1 
ATOM   5957 N  N6    . DA  D 3 12  ? 96.877  0.801   161.968 1.00 28.16  ?  867  DA  H N6    1 
ATOM   5958 N  N1    . DA  D 3 12  ? 97.211  1.833   159.923 1.00 32.38  ?  867  DA  H N1    1 
ATOM   5959 C  C2    . DA  D 3 12  ? 98.017  2.524   159.098 1.00 29.16  ?  867  DA  H C2    1 
ATOM   5960 N  N3    . DA  D 3 12  ? 99.269  2.942   159.301 1.00 35.51  ?  867  DA  H N3    1 
ATOM   5961 C  C4    . DA  D 3 12  ? 99.706  2.581   160.519 1.00 34.37  ?  867  DA  H C4    1 
ATOM   5962 P  P     . DG  D 3 13  ? 104.517 7.003   160.339 1.00 33.95  ?  868  DG  H P     1 
ATOM   5963 O  OP1   . DG  D 3 13  ? 105.494 7.667   159.457 1.00 29.47  ?  868  DG  H OP1   1 
ATOM   5964 O  OP2   . DG  D 3 13  ? 104.483 7.233   161.805 1.00 42.54  ?  868  DG  H OP2   1 
ATOM   5965 O  "O5'" . DG  D 3 13  ? 103.072 7.389   159.800 1.00 37.61  ?  868  DG  H "O5'" 1 
ATOM   5966 C  "C5'" . DG  D 3 13  ? 102.660 6.903   158.532 1.00 33.97  ?  868  DG  H "C5'" 1 
ATOM   5967 C  "C4'" . DG  D 3 13  ? 101.216 7.278   158.285 1.00 31.06  ?  868  DG  H "C4'" 1 
ATOM   5968 O  "O4'" . DG  D 3 13  ? 100.360 6.368   158.991 1.00 33.46  ?  868  DG  H "O4'" 1 
ATOM   5969 C  "C3'" . DG  D 3 13  ? 100.831 8.678   158.753 1.00 28.72  ?  868  DG  H "C3'" 1 
ATOM   5970 O  "O3'" . DG  D 3 13  ? 100.351 9.406   157.640 1.00 33.01  ?  868  DG  H "O3'" 1 
ATOM   5971 C  "C2'" . DG  D 3 13  ? 99.734  8.447   159.813 1.00 28.92  ?  868  DG  H "C2'" 1 
ATOM   5972 C  "C1'" . DG  D 3 13  ? 99.234  7.064   159.447 1.00 31.53  ?  868  DG  H "C1'" 1 
ATOM   5973 N  N9    . DG  D 3 13  ? 98.667  6.289   160.555 1.00 32.46  ?  868  DG  H N9    1 
ATOM   5974 C  C8    . DG  D 3 13  ? 99.265  5.968   161.753 1.00 32.82  ?  868  DG  H C8    1 
ATOM   5975 N  N7    . DG  D 3 13  ? 98.512  5.225   162.527 1.00 29.53  ?  868  DG  H N7    1 
ATOM   5976 C  C5    . DG  D 3 13  ? 97.355  5.028   161.774 1.00 27.04  ?  868  DG  H C5    1 
ATOM   5977 C  C6    . DG  D 3 13  ? 96.179  4.309   162.073 1.00 30.25  ?  868  DG  H C6    1 
ATOM   5978 O  O6    . DG  D 3 13  ? 95.906  3.669   163.103 1.00 27.59  ?  868  DG  H O6    1 
ATOM   5979 N  N1    . DG  D 3 13  ? 95.255  4.380   161.028 1.00 24.78  ?  868  DG  H N1    1 
ATOM   5980 C  C2    . DG  D 3 13  ? 95.453  5.064   159.848 1.00 29.92  ?  868  DG  H C2    1 
ATOM   5981 N  N2    . DG  D 3 13  ? 94.459  5.028   158.951 1.00 29.61  ?  868  DG  H N2    1 
ATOM   5982 N  N3    . DG  D 3 13  ? 96.545  5.720   159.561 1.00 27.20  ?  868  DG  H N3    1 
ATOM   5983 C  C4    . DG  D 3 13  ? 97.450  5.667   160.561 1.00 31.68  ?  868  DG  H C4    1 
ATOM   5984 P  P     . DG  D 3 14  ? 100.117 10.982  157.733 1.00 33.04  ?  869  DG  H P     1 
ATOM   5985 O  OP1   . DG  D 3 14  ? 100.342 11.515  156.366 1.00 36.62  ?  869  DG  H OP1   1 
ATOM   5986 O  OP2   . DG  D 3 14  ? 100.853 11.532  158.883 1.00 44.40  ?  869  DG  H OP2   1 
ATOM   5987 O  "O5'" . DG  D 3 14  ? 98.573  11.094  158.043 1.00 31.11  ?  869  DG  H "O5'" 1 
ATOM   5988 C  "C5'" . DG  D 3 14  ? 97.655  10.568  157.095 1.00 30.86  ?  869  DG  H "C5'" 1 
ATOM   5989 C  "C4'" . DG  D 3 14  ? 96.260  10.549  157.668 1.00 33.31  ?  869  DG  H "C4'" 1 
ATOM   5990 O  "O4'" . DG  D 3 14  ? 96.139  9.459   158.625 1.00 33.53  ?  869  DG  H "O4'" 1 
ATOM   5991 C  "C3'" . DG  D 3 14  ? 95.861  11.827  158.428 1.00 35.17  ?  869  DG  H "C3'" 1 
ATOM   5992 O  "O3'" . DG  D 3 14  ? 94.577  12.208  158.051 1.00 35.42  ?  869  DG  H "O3'" 1 
ATOM   5993 C  "C2'" . DG  D 3 14  ? 95.872  11.379  159.881 1.00 34.02  ?  869  DG  H "C2'" 1 
ATOM   5994 C  "C1'" . DG  D 3 14  ? 95.410  9.946   159.718 1.00 29.16  ?  869  DG  H "C1'" 1 
ATOM   5995 N  N9    . DG  D 3 14  ? 95.640  9.140   160.911 1.00 24.16  ?  869  DG  H N9    1 
ATOM   5996 C  C8    . DG  D 3 14  ? 96.733  9.174   161.737 1.00 30.86  ?  869  DG  H C8    1 
ATOM   5997 N  N7    . DG  D 3 14  ? 96.623  8.373   162.765 1.00 33.78  ?  869  DG  H N7    1 
ATOM   5998 C  C5    . DG  D 3 14  ? 95.359  7.815   162.622 1.00 26.13  ?  869  DG  H C5    1 
ATOM   5999 C  C6    . DG  D 3 14  ? 94.682  6.887   163.437 1.00 26.47  ?  869  DG  H C6    1 
ATOM   6000 O  O6    . DG  D 3 14  ? 95.078  6.375   164.488 1.00 24.46  ?  869  DG  H O6    1 
ATOM   6001 N  N1    . DG  D 3 14  ? 93.412  6.583   162.936 1.00 25.06  ?  869  DG  H N1    1 
ATOM   6002 C  C2    . DG  D 3 14  ? 92.874  7.122   161.785 1.00 25.98  ?  869  DG  H C2    1 
ATOM   6003 N  N2    . DG  D 3 14  ? 91.640  6.723   161.454 1.00 23.62  ?  869  DG  H N2    1 
ATOM   6004 N  N3    . DG  D 3 14  ? 93.510  7.991   161.014 1.00 29.07  ?  869  DG  H N3    1 
ATOM   6005 C  C4    . DG  D 3 14  ? 94.740  8.292   161.496 1.00 23.44  ?  869  DG  H C4    1 
ATOM   6006 P  P     . DA  D 3 15  ? 94.114  13.739  158.066 1.00 37.59  ?  870  DA  H P     1 
ATOM   6007 O  OP1   . DA  D 3 15  ? 94.521  14.340  156.793 1.00 37.29  ?  870  DA  H OP1   1 
ATOM   6008 O  OP2   . DA  D 3 15  ? 94.524  14.380  159.340 1.00 43.34  ?  870  DA  H OP2   1 
ATOM   6009 O  "O5'" . DA  D 3 15  ? 92.520  13.602  158.080 1.00 30.76  ?  870  DA  H "O5'" 1 
ATOM   6010 C  "C5'" . DA  D 3 15  ? 91.897  12.568  157.353 1.00 26.48  ?  870  DA  H "C5'" 1 
ATOM   6011 C  "C4'" . DA  D 3 15  ? 90.609  12.145  158.065 1.00 23.80  ?  870  DA  H "C4'" 1 
ATOM   6012 O  "O4'" . DA  D 3 15  ? 90.926  11.176  159.104 1.00 26.11  ?  870  DA  H "O4'" 1 
ATOM   6013 C  "C3'" . DA  D 3 15  ? 89.872  13.286  158.748 1.00 27.01  ?  870  DA  H "C3'" 1 
ATOM   6014 O  "O3'" . DA  D 3 15  ? 88.469  13.205  158.472 1.00 24.34  ?  870  DA  H "O3'" 1 
ATOM   6015 C  "C2'" . DA  D 3 15  ? 90.187  13.088  160.236 1.00 25.32  ?  870  DA  H "C2'" 1 
ATOM   6016 C  "C1'" . DA  D 3 15  ? 90.369  11.579  160.336 1.00 20.89  ?  870  DA  H "C1'" 1 
ATOM   6017 N  N9    . DA  D 3 15  ? 91.294  11.176  161.407 1.00 24.05  ?  870  DA  H N9    1 
ATOM   6018 C  C8    . DA  D 3 15  ? 92.574  11.628  161.594 1.00 28.63  ?  870  DA  H C8    1 
ATOM   6019 N  N7    . DA  D 3 15  ? 93.172  11.106  162.646 1.00 21.65  ?  870  DA  H N7    1 
ATOM   6020 C  C5    . DA  D 3 15  ? 92.225  10.259  163.183 1.00 22.42  ?  870  DA  H C5    1 
ATOM   6021 C  C6    . DA  D 3 15  ? 92.250  9.422   164.308 1.00 23.94  ?  870  DA  H C6    1 
ATOM   6022 N  N6    . DA  D 3 15  ? 93.319  9.313   165.100 1.00 22.04  ?  870  DA  H N6    1 
ATOM   6023 N  N1    . DA  D 3 15  ? 91.143  8.698   164.582 1.00 22.51  ?  870  DA  H N1    1 
ATOM   6024 C  C2    . DA  D 3 15  ? 90.082  8.822   163.782 1.00 26.39  ?  870  DA  H C2    1 
ATOM   6025 N  N3    . DA  D 3 15  ? 89.934  9.590   162.698 1.00 24.09  ?  870  DA  H N3    1 
ATOM   6026 C  C4    . DA  D 3 15  ? 91.057  10.289  162.446 1.00 23.13  ?  870  DA  H C4    1 
ATOM   6027 P  P     . DC  D 3 16  ? 87.491  14.372  158.943 1.00 24.46  ?  871  DC  H P     1 
ATOM   6028 O  OP1   . DC  D 3 16  ? 86.275  14.284  158.106 1.00 27.35  ?  871  DC  H OP1   1 
ATOM   6029 O  OP2   . DC  D 3 16  ? 88.177  15.683  158.998 1.00 25.20  ?  871  DC  H OP2   1 
ATOM   6030 O  "O5'" . DC  D 3 16  ? 87.160  14.000  160.435 1.00 23.71  ?  871  DC  H "O5'" 1 
ATOM   6031 C  "C5'" . DC  D 3 16  ? 86.562  12.737  160.714 1.00 23.08  ?  871  DC  H "C5'" 1 
ATOM   6032 C  "C4'" . DC  D 3 16  ? 86.521  12.505  162.196 1.00 24.31  ?  871  DC  H "C4'" 1 
ATOM   6033 O  "O4'" . DC  D 3 16  ? 87.837  12.190  162.666 1.00 23.54  ?  871  DC  H "O4'" 1 
ATOM   6034 C  "C3'" . DC  D 3 16  ? 86.110  13.718  163.022 1.00 26.42  ?  871  DC  H "C3'" 1 
ATOM   6035 O  "O3'" . DC  D 3 16  ? 84.707  13.663  163.250 1.00 22.94  ?  871  DC  H "O3'" 1 
ATOM   6036 C  "C2'" . DC  D 3 16  ? 86.914  13.539  164.328 1.00 25.50  ?  871  DC  H "C2'" 1 
ATOM   6037 C  "C1'" . DC  D 3 16  ? 87.778  12.296  164.054 1.00 21.70  ?  871  DC  H "C1'" 1 
ATOM   6038 N  N1    . DC  D 3 16  ? 89.179  12.408  164.562 1.00 22.58  ?  871  DC  H N1    1 
ATOM   6039 C  C2    . DC  D 3 16  ? 89.579  11.642  165.654 1.00 24.66  ?  871  DC  H C2    1 
ATOM   6040 O  O2    . DC  D 3 16  ? 88.763  10.878  166.187 1.00 22.70  ?  871  DC  H O2    1 
ATOM   6041 N  N3    . DC  D 3 16  ? 90.852  11.780  166.116 1.00 20.48  ?  871  DC  H N3    1 
ATOM   6042 C  C4    . DC  D 3 16  ? 91.701  12.612  165.516 1.00 23.39  ?  871  DC  H C4    1 
ATOM   6043 N  N4    . DC  D 3 16  ? 92.959  12.705  166.012 1.00 22.05  ?  871  DC  H N4    1 
ATOM   6044 C  C5    . DC  D 3 16  ? 91.306  13.411  164.405 1.00 21.26  ?  871  DC  H C5    1 
ATOM   6045 C  C6    . DC  D 3 16  ? 90.042  13.280  163.965 1.00 22.31  ?  871  DC  H C6    1 
ATOM   6046 P  P     . DC  D 3 17  ? 83.948  14.784  164.091 1.00 21.53  ?  872  DC  H P     1 
ATOM   6047 O  OP1   . DC  D 3 17  ? 82.517  14.669  163.710 1.00 22.19  ?  872  DC  H OP1   1 
ATOM   6048 O  OP2   . DC  D 3 17  ? 84.592  16.102  163.864 1.00 22.66  ?  872  DC  H OP2   1 
ATOM   6049 O  "O5'" . DC  D 3 17  ? 84.114  14.351  165.622 1.00 22.95  ?  872  DC  H "O5'" 1 
ATOM   6050 C  "C5'" . DC  D 3 17  ? 83.570  13.131  166.073 1.00 19.95  ?  872  DC  H "C5'" 1 
ATOM   6051 C  "C4'" . DC  D 3 17  ? 84.012  12.816  167.486 1.00 25.27  ?  872  DC  H "C4'" 1 
ATOM   6052 O  "O4'" . DC  D 3 17  ? 85.410  12.413  167.475 1.00 27.03  ?  872  DC  H "O4'" 1 
ATOM   6053 C  "C3'" . DC  D 3 17  ? 83.994  13.992  168.444 1.00 25.02  ?  872  DC  H "C3'" 1 
ATOM   6054 O  "O3'" . DC  D 3 17  ? 82.691  14.189  168.998 1.00 26.85  ?  872  DC  H "O3'" 1 
ATOM   6055 C  "C2'" . DC  D 3 17  ? 84.967  13.536  169.526 1.00 33.57  ?  872  DC  H "C2'" 1 
ATOM   6056 C  "C1'" . DC  D 3 17  ? 85.934  12.638  168.769 1.00 28.47  ?  872  DC  H "C1'" 1 
ATOM   6057 N  N1    . DC  D 3 17  ? 87.281  13.187  168.660 1.00 22.20  ?  872  DC  H N1    1 
ATOM   6058 C  C2    . DC  D 3 17  ? 88.169  12.905  169.677 1.00 18.67  ?  872  DC  H C2    1 
ATOM   6059 O  O2    . DC  D 3 17  ? 87.752  12.227  170.636 1.00 19.28  ?  872  DC  H O2    1 
ATOM   6060 N  N3    . DC  D 3 17  ? 89.440  13.378  169.590 1.00 22.05  ?  872  DC  H N3    1 
ATOM   6061 C  C4    . DC  D 3 17  ? 89.816  14.109  168.523 1.00 21.98  ?  872  DC  H C4    1 
ATOM   6062 N  N4    . DC  D 3 17  ? 91.080  14.556  168.465 1.00 21.53  ?  872  DC  H N4    1 
ATOM   6063 C  C5    . DC  D 3 17  ? 88.895  14.421  167.467 1.00 24.77  ?  872  DC  H C5    1 
ATOM   6064 C  C6    . DC  D 3 17  ? 87.650  13.947  167.581 1.00 19.32  ?  872  DC  H C6    1 
ATOM   6065 P  P     A DC  D 3 18  ? 82.620  15.590  169.676 0.50 23.53  ?  873  DC  H P     1 
ATOM   6066 P  P     B DC  D 3 18  ? 82.369  15.595  169.704 0.50 26.63  ?  873  DC  H P     1 
ATOM   6067 O  OP1   A DC  D 3 18  ? 81.112  15.570  169.768 0.50 23.75  ?  873  DC  H OP1   1 
ATOM   6068 O  OP1   B DC  D 3 18  ? 80.920  15.655  169.962 0.50 24.30  ?  873  DC  H OP1   1 
ATOM   6069 O  OP2   A DC  D 3 18  ? 83.135  16.851  169.014 0.50 24.50  -1 873  DC  H OP2   1 
ATOM   6070 O  OP2   B DC  D 3 18  ? 83.054  16.645  168.916 0.50 26.67  ?  873  DC  H OP2   1 
ATOM   6071 O  "O5'" A DC  D 3 18  ? 83.268  15.467  171.195 0.50 24.20  ?  873  DC  H "O5'" 1 
ATOM   6072 O  "O5'" B DC  D 3 18  ? 83.151  15.517  171.096 0.50 25.97  ?  873  DC  H "O5'" 1 
ATOM   6073 C  "C5'" A DC  D 3 18  ? 82.675  14.628  172.155 0.50 22.02  ?  873  DC  H "C5'" 1 
ATOM   6074 C  "C5'" B DC  D 3 18  ? 82.802  14.545  172.057 0.50 20.27  ?  873  DC  H "C5'" 1 
ATOM   6075 C  "C4'" A DC  D 3 18  ? 83.543  14.803  173.414 0.50 25.93  ?  873  DC  H "C4'" 1 
ATOM   6076 C  "C4'" B DC  D 3 18  ? 83.735  14.630  173.246 0.50 26.79  ?  873  DC  H "C4'" 1 
ATOM   6077 O  "O4'" A DC  D 3 18  ? 84.718  14.380  173.119 0.50 33.24  ?  873  DC  H "O4'" 1 
ATOM   6078 O  "O4'" B DC  D 3 18  ? 85.066  14.185  172.851 0.50 16.44  ?  873  DC  H "O4'" 1 
ATOM   6079 C  "C3'" A DC  D 3 18  ? 83.731  16.393  173.704 0.50 24.81  ?  873  DC  H "C3'" 1 
ATOM   6080 C  "C3'" B DC  D 3 18  ? 83.966  16.035  173.775 0.50 23.15  ?  873  DC  H "C3'" 1 
ATOM   6081 O  "O3'" A DC  D 3 18  ? 82.515  17.099  174.252 0.50 33.14  ?  873  DC  H "O3'" 1 
ATOM   6082 O  "O3'" B DC  D 3 18  ? 82.878  16.464  174.632 0.50 18.15  ?  873  DC  H "O3'" 1 
ATOM   6083 C  "C2'" A DC  D 3 18  ? 84.841  16.476  174.359 0.50 26.07  ?  873  DC  H "C2'" 1 
ATOM   6084 C  "C2'" B DC  D 3 18  ? 85.284  15.856  174.533 0.50 22.53  ?  873  DC  H "C2'" 1 
ATOM   6085 C  "C1'" A DC  D 3 18  ? 85.717  15.323  173.836 0.50 26.44  ?  873  DC  H "C1'" 1 
ATOM   6086 C  "C1'" B DC  D 3 18  ? 86.045  14.882  173.619 0.50 16.27  ?  873  DC  H "C1'" 1 
ATOM   6087 N  N1    A DC  D 3 18  ? 86.677  15.736  172.948 0.50 22.00  ?  873  DC  H N1    1 
ATOM   6088 N  N1    B DC  D 3 18  ? 87.031  15.539  172.671 0.50 17.82  ?  873  DC  H N1    1 
ATOM   6089 C  C2    A DC  D 3 18  ? 87.942  15.928  173.325 0.50 16.16  ?  873  DC  H C2    1 
ATOM   6090 C  C2    B DC  D 3 18  ? 88.338  15.791  173.098 0.50 16.19  ?  873  DC  H C2    1 
ATOM   6091 O  O2    A DC  D 3 18  ? 88.270  15.738  174.451 0.50 20.21  ?  873  DC  H O2    1 
ATOM   6092 O  O2    B DC  D 3 18  ? 88.660  15.479  174.253 0.50 20.25  ?  873  DC  H O2    1 
ATOM   6093 N  N3    A DC  D 3 18  ? 88.855  16.323  172.448 0.50 22.46  ?  873  DC  H N3    1 
ATOM   6094 N  N3    B DC  D 3 18  ? 89.222  16.360  172.228 0.50 16.42  ?  873  DC  H N3    1 
ATOM   6095 C  C4    A DC  D 3 18  ? 88.564  16.550  171.173 0.50 23.08  ?  873  DC  H C4    1 
ATOM   6096 C  C4    B DC  D 3 18  ? 88.833  16.670  170.989 0.50 16.44  ?  873  DC  H C4    1 
ATOM   6097 N  N4    A DC  D 3 18  ? 89.598  16.992  170.244 0.50 20.42  ?  873  DC  H N4    1 
ATOM   6098 N  N4    B DC  D 3 18  ? 89.729  17.234  170.169 0.50 18.56  ?  873  DC  H N4    1 
ATOM   6099 C  C5    A DC  D 3 18  ? 87.241  16.370  170.750 0.50 16.40  ?  873  DC  H C5    1 
ATOM   6100 C  C5    B DC  D 3 18  ? 87.496  16.426  170.536 0.50 25.18  ?  873  DC  H C5    1 
ATOM   6101 C  C6    A DC  D 3 18  ? 86.307  15.945  171.687 0.50 23.73  ?  873  DC  H C6    1 
ATOM   6102 C  C6    B DC  D 3 18  ? 86.641  15.869  171.400 0.50 16.32  ?  873  DC  H C6    1 
ATOM   6103 P  P     B DT  D 3 19  ? 82.469  18.044  174.701 0.50 26.89  ?  874  DT  H P     1 
ATOM   6104 O  OP1   B DT  D 3 19  ? 81.173  18.160  175.402 0.50 22.16  ?  874  DT  H OP1   1 
ATOM   6105 O  OP2   B DT  D 3 19  ? 82.524  18.695  173.376 0.50 16.52  ?  874  DT  H OP2   1 
ATOM   6106 O  "O5'" B DT  D 3 19  ? 83.597  18.663  175.627 0.50 22.66  ?  874  DT  H "O5'" 1 
ATOM   6107 C  "C5'" B DT  D 3 19  ? 83.719  18.239  176.977 0.50 21.90  ?  874  DT  H "C5'" 1 
ATOM   6108 C  "C4'" B DT  D 3 19  ? 85.052  18.696  177.559 0.50 24.51  ?  874  DT  H "C4'" 1 
ATOM   6109 O  "O4'" B DT  D 3 19  ? 86.135  18.085  176.812 0.50 18.40  ?  874  DT  H "O4'" 1 
ATOM   6110 C  "C3'" B DT  D 3 19  ? 85.325  20.190  177.467 0.50 20.76  ?  874  DT  H "C3'" 1 
ATOM   6111 O  "O3'" B DT  D 3 19  ? 84.714  20.874  178.570 0.50 21.24  ?  874  DT  H "O3'" 1 
ATOM   6112 C  "C2'" B DT  D 3 19  ? 86.849  20.223  177.562 0.50 21.44  ?  874  DT  H "C2'" 1 
ATOM   6113 C  "C1'" B DT  D 3 19  ? 87.253  18.946  176.796 0.50 16.11  ?  874  DT  H "C1'" 1 
ATOM   6114 N  N1    B DT  D 3 19  ? 87.656  19.211  175.363 0.50 17.10  ?  874  DT  H N1    1 
ATOM   6115 C  C2    B DT  D 3 19  ? 88.988  19.396  175.070 0.50 17.12  ?  874  DT  H C2    1 
ATOM   6116 O  O2    B DT  D 3 19  ? 89.872  19.319  175.907 0.50 19.71  ?  874  DT  H O2    1 
ATOM   6117 N  N3    B DT  D 3 19  ? 89.258  19.649  173.755 0.50 19.05  ?  874  DT  H N3    1 
ATOM   6118 C  C4    B DT  D 3 19  ? 88.341  19.766  172.722 0.50 20.39  ?  874  DT  H C4    1 
ATOM   6119 O  O4    B DT  D 3 19  ? 88.684  20.008  171.572 0.50 16.59  ?  874  DT  H O4    1 
ATOM   6120 C  C5    B DT  D 3 19  ? 86.956  19.590  173.098 0.50 16.22  ?  874  DT  H C5    1 
ATOM   6121 C  C7    B DT  D 3 19  ? 85.875  19.692  172.063 0.50 18.60  ?  874  DT  H C7    1 
ATOM   6122 C  C6    B DT  D 3 19  ? 86.680  19.338  174.387 0.50 22.16  ?  874  DT  H C6    1 
ATOM   6123 O  "O5'" . DT  E 2 1   ? 115.232 41.019  135.460 1.00 98.76  ?  837  DT  B "O5'" 1 
ATOM   6124 C  "C5'" . DT  E 2 1   ? 113.945 41.188  134.878 1.00 91.69  ?  837  DT  B "C5'" 1 
ATOM   6125 C  "C4'" . DT  E 2 1   ? 113.214 39.858  134.773 1.00 84.63  ?  837  DT  B "C4'" 1 
ATOM   6126 O  "O4'" . DT  E 2 1   ? 113.957 38.955  133.906 1.00 80.34  ?  837  DT  B "O4'" 1 
ATOM   6127 C  "C3'" . DT  E 2 1   ? 113.032 39.103  136.098 1.00 78.54  ?  837  DT  B "C3'" 1 
ATOM   6128 O  "O3'" . DT  E 2 1   ? 111.732 38.501  136.137 1.00 66.02  ?  837  DT  B "O3'" 1 
ATOM   6129 C  "C2'" . DT  E 2 1   ? 114.133 38.050  136.028 1.00 75.74  ?  837  DT  B "C2'" 1 
ATOM   6130 C  "C1'" . DT  E 2 1   ? 114.074 37.712  134.554 1.00 78.59  ?  837  DT  B "C1'" 1 
ATOM   6131 N  N1    . DT  E 2 1   ? 115.271 36.998  134.040 1.00 84.02  ?  837  DT  B N1    1 
ATOM   6132 C  C2    . DT  E 2 1   ? 115.152 35.671  133.705 1.00 80.43  ?  837  DT  B C2    1 
ATOM   6133 O  O2    . DT  E 2 1   ? 114.112 35.055  133.810 1.00 72.52  ?  837  DT  B O2    1 
ATOM   6134 N  N3    . DT  E 2 1   ? 116.298 35.088  133.240 1.00 84.16  ?  837  DT  B N3    1 
ATOM   6135 C  C4    . DT  E 2 1   ? 117.532 35.688  133.080 1.00 93.02  ?  837  DT  B C4    1 
ATOM   6136 O  O4    . DT  E 2 1   ? 118.507 35.076  132.652 1.00 95.07  ?  837  DT  B O4    1 
ATOM   6137 C  C5    . DT  E 2 1   ? 117.592 37.086  133.451 1.00 95.18  ?  837  DT  B C5    1 
ATOM   6138 C  C7    . DT  E 2 1   ? 118.880 37.845  133.320 1.00 98.35  ?  837  DT  B C7    1 
ATOM   6139 C  C6    . DT  E 2 1   ? 116.470 37.669  133.908 1.00 88.59  ?  837  DT  B C6    1 
ATOM   6140 P  P     . DC  E 2 2   ? 111.166 37.844  137.495 1.00 59.35  ?  838  DC  B P     1 
ATOM   6141 O  OP1   . DC  E 2 2   ? 109.758 37.457  137.265 1.00 66.98  ?  838  DC  B OP1   1 
ATOM   6142 O  OP2   . DC  E 2 2   ? 111.476 38.766  138.611 1.00 72.55  ?  838  DC  B OP2   1 
ATOM   6143 O  "O5'" . DC  E 2 2   ? 112.086 36.543  137.722 1.00 58.31  ?  838  DC  B "O5'" 1 
ATOM   6144 C  "C5'" . DC  E 2 2   ? 112.020 35.419  136.834 1.00 48.17  ?  838  DC  B "C5'" 1 
ATOM   6145 C  "C4'" . DC  E 2 2   ? 112.259 34.125  137.595 1.00 37.74  ?  838  DC  B "C4'" 1 
ATOM   6146 O  "O4'" . DC  E 2 2   ? 113.507 34.216  138.352 1.00 43.25  ?  838  DC  B "O4'" 1 
ATOM   6147 C  "C3'" . DC  E 2 2   ? 111.192 33.812  138.640 1.00 37.06  ?  838  DC  B "C3'" 1 
ATOM   6148 O  "O3'" . DC  E 2 2   ? 111.092 32.422  138.850 1.00 41.21  ?  838  DC  B "O3'" 1 
ATOM   6149 C  "C2'" . DC  E 2 2   ? 111.742 34.472  139.876 1.00 42.98  ?  838  DC  B "C2'" 1 
ATOM   6150 C  "C1'" . DC  E 2 2   ? 113.215 34.137  139.740 1.00 52.79  ?  838  DC  B "C1'" 1 
ATOM   6151 N  N1    . DC  E 2 2   ? 114.071 35.085  140.510 1.00 75.80  ?  838  DC  B N1    1 
ATOM   6152 C  C2    . DC  E 2 2   ? 115.255 34.635  141.118 1.00 79.17  ?  838  DC  B C2    1 
ATOM   6153 O  O2    . DC  E 2 2   ? 115.608 33.458  140.961 1.00 74.77  ?  838  DC  B O2    1 
ATOM   6154 N  N3    . DC  E 2 2   ? 115.992 35.517  141.847 1.00 82.14  ?  838  DC  B N3    1 
ATOM   6155 C  C4    . DC  E 2 2   ? 115.575 36.783  141.992 1.00 85.59  ?  838  DC  B C4    1 
ATOM   6156 N  N4    . DC  E 2 2   ? 116.330 37.617  142.719 1.00 79.48  ?  838  DC  B N4    1 
ATOM   6157 C  C5    . DC  E 2 2   ? 114.364 37.248  141.399 1.00 88.23  ?  838  DC  B C5    1 
ATOM   6158 C  C6    . DC  E 2 2   ? 113.648 36.374  140.683 1.00 84.51  ?  838  DC  B C6    1 
ATOM   6159 P  P     . DT  E 2 3   ? 109.678 31.813  139.275 1.00 40.45  ?  839  DT  B P     1 
ATOM   6160 O  OP1   . DT  E 2 3   ? 108.680 32.901  139.288 1.00 51.31  ?  839  DT  B OP1   1 
ATOM   6161 O  OP2   . DT  E 2 3   ? 109.883 30.927  140.443 1.00 37.00  ?  839  DT  B OP2   1 
ATOM   6162 O  "O5'" . DT  E 2 3   ? 109.290 30.961  138.021 1.00 48.78  ?  839  DT  B "O5'" 1 
ATOM   6163 C  "C5'" . DT  E 2 3   ? 110.070 29.942  137.721 1.00 51.60  ?  839  DT  B "C5'" 1 
ATOM   6164 C  "C4'" . DT  E 2 3   ? 110.538 29.985  136.301 1.00 40.80  ?  839  DT  B "C4'" 1 
ATOM   6165 O  "O4'" . DT  E 2 3   ? 111.708 30.838  136.187 1.00 34.46  ?  839  DT  B "O4'" 1 
ATOM   6166 C  "C3'" . DT  E 2 3   ? 110.993 28.620  135.892 1.00 29.57  ?  839  DT  B "C3'" 1 
ATOM   6167 O  "O3'" . DT  E 2 3   ? 109.960 28.006  135.212 1.00 34.52  ?  839  DT  B "O3'" 1 
ATOM   6168 C  "C2'" . DT  E 2 3   ? 112.224 28.879  135.033 1.00 35.44  ?  839  DT  B "C2'" 1 
ATOM   6169 C  "C1'" . DT  E 2 3   ? 112.818 30.083  135.747 1.00 30.98  ?  839  DT  B "C1'" 1 
ATOM   6170 N  N1    . DT  E 2 3   ? 113.677 29.723  136.951 1.00 38.12  ?  839  DT  B N1    1 
ATOM   6171 C  C2    . DT  E 2 3   ? 114.856 29.032  136.767 1.00 28.57  ?  839  DT  B C2    1 
ATOM   6172 O  O2    . DT  E 2 3   ? 115.258 28.685  135.682 1.00 36.38  ?  839  DT  B O2    1 
ATOM   6173 N  N3    . DT  E 2 3   ? 115.548 28.754  137.921 1.00 33.50  ?  839  DT  B N3    1 
ATOM   6174 C  C4    . DT  E 2 3   ? 115.190 29.102  139.217 1.00 43.97  ?  839  DT  B C4    1 
ATOM   6175 O  O4    . DT  E 2 3   ? 115.878 28.810  140.197 1.00 46.03  ?  839  DT  B O4    1 
ATOM   6176 C  C5    . DT  E 2 3   ? 113.944 29.826  139.336 1.00 44.73  ?  839  DT  B C5    1 
ATOM   6177 C  C7    . DT  E 2 3   ? 113.443 30.255  140.683 1.00 50.79  ?  839  DT  B C7    1 
ATOM   6178 C  C6    . DT  E 2 3   ? 113.267 30.103  138.213 1.00 40.64  ?  839  DT  B C6    1 
ATOM   6179 P  P     . DA  E 2 4   ? 109.651 26.466  135.497 1.00 27.46  ?  840  DA  B P     1 
ATOM   6180 O  OP1   . DA  E 2 4   ? 109.484 26.288  136.968 1.00 23.79  ?  840  DA  B OP1   1 
ATOM   6181 O  OP2   . DA  E 2 4   ? 110.676 25.687  134.770 1.00 27.19  ?  840  DA  B OP2   1 
ATOM   6182 O  "O5'" . DA  E 2 4   ? 108.257 26.230  134.759 1.00 27.69  ?  840  DA  B "O5'" 1 
ATOM   6183 C  "C5'" . DA  E 2 4   ? 107.113 26.950  135.150 1.00 25.96  ?  840  DA  B "C5'" 1 
ATOM   6184 C  "C4'" . DA  E 2 4   ? 105.869 26.232  134.677 1.00 29.22  ?  840  DA  B "C4'" 1 
ATOM   6185 O  "O4'" . DA  E 2 4   ? 105.880 26.153  133.228 1.00 27.35  ?  840  DA  B "O4'" 1 
ATOM   6186 C  "C3'" . DA  E 2 4   ? 105.747 24.800  135.164 1.00 27.54  ?  840  DA  B "C3'" 1 
ATOM   6187 O  "O3'" . DA  E 2 4   ? 104.364 24.466  135.338 1.00 28.51  ?  840  DA  B "O3'" 1 
ATOM   6188 C  "C2'" . DA  E 2 4   ? 106.404 23.987  134.043 1.00 21.82  ?  840  DA  B "C2'" 1 
ATOM   6189 C  "C1'" . DA  E 2 4   ? 106.081 24.811  132.797 1.00 25.92  ?  840  DA  B "C1'" 1 
ATOM   6190 N  N9    . DA  E 2 4   ? 107.153 24.839  131.804 1.00 26.86  ?  840  DA  B N9    1 
ATOM   6191 C  C8    . DA  E 2 4   ? 108.502 24.882  132.043 1.00 25.64  ?  840  DA  B C8    1 
ATOM   6192 N  N7    . DA  E 2 4   ? 109.235 24.931  130.948 1.00 28.18  ?  840  DA  B N7    1 
ATOM   6193 C  C5    . DA  E 2 4   ? 108.301 24.917  129.913 1.00 23.33  ?  840  DA  B C5    1 
ATOM   6194 C  C6    . DA  E 2 4   ? 108.433 24.960  128.502 1.00 26.60  ?  840  DA  B C6    1 
ATOM   6195 N  N6    . DA  E 2 4   ? 109.607 25.009  127.867 1.00 27.91  ?  840  DA  B N6    1 
ATOM   6196 N  N1    . DA  E 2 4   ? 107.299 24.936  127.768 1.00 27.64  ?  840  DA  B N1    1 
ATOM   6197 C  C2    . DA  E 2 4   ? 106.125 24.872  128.407 1.00 26.89  ?  840  DA  B C2    1 
ATOM   6198 N  N3    . DA  E 2 4   ? 105.879 24.834  129.720 1.00 29.50  ?  840  DA  B N3    1 
ATOM   6199 C  C4    . DA  E 2 4   ? 107.015 24.864  130.422 1.00 27.62  ?  840  DA  B C4    1 
ATOM   6200 P  P     . DG  E 2 5   ? 103.919 23.068  135.976 1.00 26.93  ?  841  DG  B P     1 
ATOM   6201 O  OP1   . DG  E 2 5   ? 102.659 23.301  136.714 1.00 26.27  ?  841  DG  B OP1   1 
ATOM   6202 O  OP2   . DG  E 2 5   ? 105.072 22.453  136.674 1.00 29.45  ?  841  DG  B OP2   1 
ATOM   6203 O  "O5'" . DG  E 2 5   ? 103.683 22.131  134.713 1.00 28.48  ?  841  DG  B "O5'" 1 
ATOM   6204 C  "C5'" . DG  E 2 5   ? 102.649 22.414  133.794 1.00 26.99  ?  841  DG  B "C5'" 1 
ATOM   6205 C  "C4'" . DG  E 2 5   ? 102.707 21.407  132.673 1.00 24.77  ?  841  DG  B "C4'" 1 
ATOM   6206 O  "O4'" . DG  E 2 5   ? 103.833 21.720  131.809 1.00 26.93  ?  841  DG  B "O4'" 1 
ATOM   6207 C  "C3'" . DG  E 2 5   ? 102.926 19.960  133.126 1.00 27.43  ?  841  DG  B "C3'" 1 
ATOM   6208 O  "O3'" . DG  E 2 5   ? 102.150 19.098  132.314 1.00 27.21  ?  841  DG  B "O3'" 1 
ATOM   6209 C  "C2'" . DG  E 2 5   ? 104.420 19.752  132.863 1.00 23.27  ?  841  DG  B "C2'" 1 
ATOM   6210 C  "C1'" . DG  E 2 5   ? 104.552 20.528  131.577 1.00 23.76  ?  841  DG  B "C1'" 1 
ATOM   6211 N  N9    . DG  E 2 5   ? 105.920 20.875  131.194 1.00 27.56  ?  841  DG  B N9    1 
ATOM   6212 C  C8    . DG  E 2 5   ? 106.993 21.132  132.014 1.00 26.18  ?  841  DG  B C8    1 
ATOM   6213 N  N7    . DG  E 2 5   ? 108.083 21.442  131.347 1.00 22.60  ?  841  DG  B N7    1 
ATOM   6214 C  C5    . DG  E 2 5   ? 107.695 21.376  130.020 1.00 21.36  ?  841  DG  B C5    1 
ATOM   6215 C  C6    . DG  E 2 5   ? 108.443 21.586  128.841 1.00 23.73  ?  841  DG  B C6    1 
ATOM   6216 O  O6    . DG  E 2 5   ? 109.641 21.899  128.740 1.00 27.92  ?  841  DG  B O6    1 
ATOM   6217 N  N1    . DG  E 2 5   ? 107.659 21.407  127.694 1.00 23.92  ?  841  DG  B N1    1 
ATOM   6218 C  C2    . DG  E 2 5   ? 106.323 21.070  127.705 1.00 30.56  ?  841  DG  B C2    1 
ATOM   6219 N  N2    . DG  E 2 5   ? 105.720 20.937  126.509 1.00 29.41  ?  841  DG  B N2    1 
ATOM   6220 N  N3    . DG  E 2 5   ? 105.626 20.865  128.806 1.00 24.90  ?  841  DG  B N3    1 
ATOM   6221 C  C4    . DG  E 2 5   ? 106.370 21.038  129.917 1.00 26.51  ?  841  DG  B C4    1 
ATOM   6222 P  P     . DG  E 2 6   ? 101.541 17.745  132.919 1.00 32.32  ?  842  DG  B P     1 
ATOM   6223 O  OP1   . DG  E 2 6   ? 100.181 18.052  133.418 1.00 59.72  ?  842  DG  B OP1   1 
ATOM   6224 O  OP2   . DG  E 2 6   ? 102.533 17.129  133.820 1.00 39.35  ?  842  DG  B OP2   1 
ATOM   6225 O  "O5'" . DG  E 2 6   ? 101.434 16.791  131.684 1.00 43.23  ?  842  DG  B "O5'" 1 
ATOM   6226 C  "C5'" . DG  E 2 6   ? 102.521 15.974  131.406 1.00 44.62  ?  842  DG  B "C5'" 1 
ATOM   6227 C  "C4'" . DG  E 2 6   ? 103.048 16.288  130.045 1.00 37.80  ?  842  DG  B "C4'" 1 
ATOM   6228 O  "O4'" . DG  E 2 6   ? 104.014 17.349  130.117 1.00 40.21  ?  842  DG  B "O4'" 1 
ATOM   6229 C  "C3'" . DG  E 2 6   ? 103.790 15.153  129.409 1.00 34.39  ?  842  DG  B "C3'" 1 
ATOM   6230 O  "O3'" . DG  E 2 6   ? 102.849 14.291  128.832 1.00 35.93  ?  842  DG  B "O3'" 1 
ATOM   6231 C  "C2'" . DG  E 2 6   ? 104.616 15.879  128.345 1.00 41.19  ?  842  DG  B "C2'" 1 
ATOM   6232 C  "C1'" . DG  E 2 6   ? 104.834 17.262  128.968 1.00 44.77  ?  842  DG  B "C1'" 1 
ATOM   6233 N  N9    . DG  E 2 6   ? 106.225 17.561  129.335 1.00 33.02  ?  842  DG  B N9    1 
ATOM   6234 C  C8    . DG  E 2 6   ? 106.743 17.731  130.601 1.00 32.51  ?  842  DG  B C8    1 
ATOM   6235 N  N7    . DG  E 2 6   ? 108.015 18.028  130.605 1.00 31.26  ?  842  DG  B N7    1 
ATOM   6236 C  C5    . DG  E 2 6   ? 108.356 18.056  129.255 1.00 29.65  ?  842  DG  B C5    1 
ATOM   6237 C  C6    . DG  E 2 6   ? 109.600 18.310  128.631 1.00 24.44  ?  842  DG  B C6    1 
ATOM   6238 O  O6    . DG  E 2 6   ? 110.683 18.591  129.161 1.00 26.93  ?  842  DG  B O6    1 
ATOM   6239 N  N1    . DG  E 2 6   ? 109.510 18.219  127.247 1.00 21.77  ?  842  DG  B N1    1 
ATOM   6240 C  C2    . DG  E 2 6   ? 108.356 17.929  126.549 1.00 28.78  ?  842  DG  B C2    1 
ATOM   6241 N  N2    . DG  E 2 6   ? 108.459 17.894  125.213 1.00 24.71  ?  842  DG  B N2    1 
ATOM   6242 N  N3    . DG  E 2 6   ? 107.187 17.681  127.121 1.00 26.05  ?  842  DG  B N3    1 
ATOM   6243 C  C4    . DG  E 2 6   ? 107.262 17.764  128.470 1.00 28.85  ?  842  DG  B C4    1 
ATOM   6244 P  P     . DG  E 2 7   ? 102.869 12.726  129.149 1.00 34.58  ?  843  DG  B P     1 
ATOM   6245 O  OP1   . DG  E 2 7   ? 101.476 12.288  128.900 1.00 46.65  ?  843  DG  B OP1   1 
ATOM   6246 O  OP2   . DG  E 2 7   ? 103.507 12.415  130.462 1.00 30.31  ?  843  DG  B OP2   1 
ATOM   6247 O  "O5'" . DG  E 2 7   ? 103.773 12.120  127.986 1.00 37.68  ?  843  DG  B "O5'" 1 
ATOM   6248 C  "C5'" . DG  E 2 7   ? 105.106 11.725  128.231 1.00 30.81  ?  843  DG  B "C5'" 1 
ATOM   6249 C  "C4'" . DG  E 2 7   ? 106.006 12.272  127.139 1.00 26.93  ?  843  DG  B "C4'" 1 
ATOM   6250 O  "O4'" . DG  E 2 7   ? 106.440 13.618  127.483 1.00 30.09  ?  843  DG  B "O4'" 1 
ATOM   6251 C  "C3'" . DG  E 2 7   ? 107.282 11.504  126.932 1.00 26.32  ?  843  DG  B "C3'" 1 
ATOM   6252 O  "O3'" . DG  E 2 7   ? 107.013 10.398  126.070 1.00 29.46  ?  843  DG  B "O3'" 1 
ATOM   6253 C  "C2'" . DG  E 2 7   ? 108.167 12.541  126.250 1.00 27.25  ?  843  DG  B "C2'" 1 
ATOM   6254 C  "C1'" . DG  E 2 7   ? 107.717 13.849  126.917 1.00 30.34  ?  843  DG  B "C1'" 1 
ATOM   6255 N  N9    . DG  E 2 7   ? 108.628 14.306  127.965 1.00 26.15  ?  843  DG  B N9    1 
ATOM   6256 C  C8    . DG  E 2 7   ? 108.394 14.385  129.318 1.00 26.87  ?  843  DG  B C8    1 
ATOM   6257 N  N7    . DG  E 2 7   ? 109.420 14.852  129.992 1.00 26.70  ?  843  DG  B N7    1 
ATOM   6258 C  C5    . DG  E 2 7   ? 110.387 15.086  129.016 1.00 25.89  ?  843  DG  B C5    1 
ATOM   6259 C  C6    . DG  E 2 7   ? 111.716 15.584  129.131 1.00 21.33  ?  843  DG  B C6    1 
ATOM   6260 O  O6    . DG  E 2 7   ? 112.317 15.933  130.172 1.00 23.98  ?  843  DG  B O6    1 
ATOM   6261 N  N1    . DG  E 2 7   ? 112.350 15.658  127.883 1.00 22.92  ?  843  DG  B N1    1 
ATOM   6262 C  C2    . DG  E 2 7   ? 111.760 15.304  126.685 1.00 27.21  ?  843  DG  B C2    1 
ATOM   6263 N  N2    . DG  E 2 7   ? 112.508 15.428  125.569 1.00 25.11  ?  843  DG  B N2    1 
ATOM   6264 N  N3    . DG  E 2 7   ? 110.525 14.833  126.583 1.00 24.07  ?  843  DG  B N3    1 
ATOM   6265 C  C4    . DG  E 2 7   ? 109.906 14.758  127.771 1.00 23.66  ?  843  DG  B C4    1 
ATOM   6266 P  P     . DT  E 2 8   ? 107.942 9.106   126.088 1.00 29.27  ?  844  DT  B P     1 
ATOM   6267 O  OP1   . DT  E 2 8   ? 107.203 8.192   125.186 1.00 33.65  ?  844  DT  B OP1   1 
ATOM   6268 O  OP2   . DT  E 2 8   ? 108.374 8.715   127.463 1.00 28.43  ?  844  DT  B OP2   1 
ATOM   6269 O  "O5'" . DT  E 2 8   ? 109.276 9.575   125.323 1.00 28.27  ?  844  DT  B "O5'" 1 
ATOM   6270 C  "C5'" . DT  E 2 8   ? 109.199 10.002  123.960 1.00 26.63  ?  844  DT  B "C5'" 1 
ATOM   6271 C  "C4'" . DT  E 2 8   ? 110.588 10.269  123.433 1.00 33.21  ?  844  DT  B "C4'" 1 
ATOM   6272 O  "O4'" . DT  E 2 8   ? 111.141 11.405  124.148 1.00 32.18  ?  844  DT  B "O4'" 1 
ATOM   6273 C  "C3'" . DT  E 2 8   ? 111.537 9.097   123.649 1.00 36.49  ?  844  DT  B "C3'" 1 
ATOM   6274 O  "O3'" . DT  E 2 8   ? 111.987 8.577   122.430 1.00 32.98  ?  844  DT  B "O3'" 1 
ATOM   6275 C  "C2'" . DT  E 2 8   ? 112.698 9.642   124.453 1.00 48.85  ?  844  DT  B "C2'" 1 
ATOM   6276 C  "C1'" . DT  E 2 8   ? 112.474 11.138  124.518 1.00 42.02  ?  844  DT  B "C1'" 1 
ATOM   6277 N  N1    . DT  E 2 8   ? 112.682 11.614  125.864 1.00 30.06  ?  844  DT  B N1    1 
ATOM   6278 C  C2    . DT  E 2 8   ? 113.818 12.310  126.140 1.00 33.66  ?  844  DT  B C2    1 
ATOM   6279 O  O2    . DT  E 2 8   ? 114.639 12.590  125.285 1.00 29.16  ?  844  DT  B O2    1 
ATOM   6280 N  N3    . DT  E 2 8   ? 113.956 12.685  127.455 1.00 24.36  ?  844  DT  B N3    1 
ATOM   6281 C  C4    . DT  E 2 8   ? 113.073 12.424  128.486 1.00 23.44  ?  844  DT  B C4    1 
ATOM   6282 O  O4    . DT  E 2 8   ? 113.266 12.816  129.627 1.00 22.80  ?  844  DT  B O4    1 
ATOM   6283 C  C5    . DT  E 2 8   ? 111.903 11.649  128.120 1.00 25.99  ?  844  DT  B C5    1 
ATOM   6284 C  C7    . DT  E 2 8   ? 110.874 11.289  129.154 1.00 27.78  ?  844  DT  B C7    1 
ATOM   6285 C  C6    . DT  E 2 8   ? 111.780 11.274  126.845 1.00 25.51  ?  844  DT  B C6    1 
ATOM   6286 P  P     . DC  E 2 9   ? 112.721 7.147   122.410 1.00 43.20  ?  845  DC  B P     1 
ATOM   6287 O  OP1   . DC  E 2 9   ? 112.657 6.707   121.009 1.00 49.32  ?  845  DC  B OP1   1 
ATOM   6288 O  OP2   . DC  E 2 9   ? 112.160 6.333   123.515 1.00 46.82  ?  845  DC  B OP2   1 
ATOM   6289 O  "O5'" . DC  E 2 9   ? 114.235 7.436   122.844 1.00 37.81  ?  845  DC  B "O5'" 1 
ATOM   6290 C  "C5'" . DC  E 2 9   ? 115.029 8.378   122.132 1.00 46.70  ?  845  DC  B "C5'" 1 
ATOM   6291 C  "C4'" . DC  E 2 9   ? 116.253 8.753   122.951 1.00 38.16  ?  845  DC  B "C4'" 1 
ATOM   6292 O  "O4'" . DC  E 2 9   ? 115.837 9.432   124.153 1.00 32.81  ?  845  DC  B "O4'" 1 
ATOM   6293 C  "C3'" . DC  E 2 9   ? 117.092 7.563   123.419 1.00 38.43  ?  845  DC  B "C3'" 1 
ATOM   6294 O  "O3'" . DC  E 2 9   ? 118.310 7.534   122.711 1.00 43.56  ?  845  DC  B "O3'" 1 
ATOM   6295 C  "C2'" . DC  E 2 9   ? 117.332 7.811   124.910 1.00 32.16  ?  845  DC  B "C2'" 1 
ATOM   6296 C  "C1'" . DC  E 2 9   ? 116.805 9.227   125.134 1.00 35.17  ?  845  DC  B "C1'" 1 
ATOM   6297 N  N1    . DC  E 2 9   ? 116.174 9.396   126.480 1.00 30.52  ?  845  DC  B N1    1 
ATOM   6298 C  C2    . DC  E 2 9   ? 116.776 10.234  127.423 1.00 28.61  ?  845  DC  B C2    1 
ATOM   6299 O  O2    . DC  E 2 9   ? 117.810 10.839  127.117 1.00 32.20  ?  845  DC  B O2    1 
ATOM   6300 N  N3    . DC  E 2 9   ? 116.210 10.353  128.651 1.00 25.84  ?  845  DC  B N3    1 
ATOM   6301 C  C4    . DC  E 2 9   ? 115.091 9.691   128.942 1.00 29.41  ?  845  DC  B C4    1 
ATOM   6302 N  N4    . DC  E 2 9   ? 114.566 9.853   130.165 1.00 30.54  ?  845  DC  B N4    1 
ATOM   6303 C  C5    . DC  E 2 9   ? 114.465 8.827   127.996 1.00 34.75  ?  845  DC  B C5    1 
ATOM   6304 C  C6    . DC  E 2 9   ? 115.039 8.707   126.790 1.00 31.01  ?  845  DC  B C6    1 
ATOM   6305 P  P     . DC  E 2 10  ? 119.399 6.394   123.014 1.00 54.43  ?  846  DC  B P     1 
ATOM   6306 O  OP1   . DC  E 2 10  ? 120.136 6.268   121.742 1.00 50.51  ?  846  DC  B OP1   1 
ATOM   6307 O  OP2   . DC  E 2 10  ? 118.751 5.232   123.671 1.00 55.22  ?  846  DC  B OP2   1 
ATOM   6308 O  "O5'" . DC  E 2 10  ? 120.373 7.047   124.093 1.00 40.06  ?  846  DC  B "O5'" 1 
ATOM   6309 C  "C5'" . DC  E 2 10  ? 121.103 8.225   123.764 1.00 38.22  ?  846  DC  B "C5'" 1 
ATOM   6310 C  "C4'" . DC  E 2 10  ? 121.955 8.642   124.936 1.00 39.82  ?  846  DC  B "C4'" 1 
ATOM   6311 O  "O4'" . DC  E 2 10  ? 121.086 9.046   126.024 1.00 39.73  ?  846  DC  B "O4'" 1 
ATOM   6312 C  "C3'" . DC  E 2 10  ? 122.853 7.525   125.476 1.00 36.80  ?  846  DC  B "C3'" 1 
ATOM   6313 O  "O3'" . DC  E 2 10  ? 124.203 7.970   125.531 1.00 31.21  ?  846  DC  B "O3'" 1 
ATOM   6314 C  "C2'" . DC  E 2 10  ? 122.285 7.216   126.863 1.00 41.70  ?  846  DC  B "C2'" 1 
ATOM   6315 C  "C1'" . DC  E 2 10  ? 121.552 8.499   127.232 1.00 43.93  ?  846  DC  B "C1'" 1 
ATOM   6316 N  N1    . DC  E 2 10  ? 120.373 8.259   128.130 1.00 36.20  ?  846  DC  B N1    1 
ATOM   6317 C  C2    . DC  E 2 10  ? 120.337 8.850   129.390 1.00 31.37  ?  846  DC  B C2    1 
ATOM   6318 O  O2    . DC  E 2 10  ? 121.275 9.584   129.745 1.00 33.93  ?  846  DC  B O2    1 
ATOM   6319 N  N3    . DC  E 2 10  ? 119.275 8.603   130.194 1.00 28.63  ?  846  DC  B N3    1 
ATOM   6320 C  C4    . DC  E 2 10  ? 118.285 7.822   129.784 1.00 27.83  ?  846  DC  B C4    1 
ATOM   6321 N  N4    . DC  E 2 10  ? 117.263 7.625   130.621 1.00 29.44  ?  846  DC  B N4    1 
ATOM   6322 C  C5    . DC  E 2 10  ? 118.301 7.199   128.504 1.00 28.37  ?  846  DC  B C5    1 
ATOM   6323 C  C6    . DC  E 2 10  ? 119.357 7.438   127.718 1.00 34.01  ?  846  DC  B C6    1 
ATOM   6324 P  P     . DT  E 2 11  ? 125.359 7.014   126.115 1.00 38.84  ?  847  DT  B P     1 
ATOM   6325 O  OP1   . DT  E 2 11  ? 126.621 7.433   125.460 1.00 36.03  ?  847  DT  B OP1   1 
ATOM   6326 O  OP2   . DT  E 2 11  ? 124.870 5.612   126.056 1.00 44.21  ?  847  DT  B OP2   1 
ATOM   6327 O  "O5'" . DT  E 2 11  ? 125.466 7.432   127.647 1.00 38.53  ?  847  DT  B "O5'" 1 
ATOM   6328 C  "C5'" . DT  E 2 11  ? 125.721 8.771   127.984 1.00 37.62  ?  847  DT  B "C5'" 1 
ATOM   6329 C  "C4'" . DT  E 2 11  ? 125.993 8.900   129.467 1.00 44.50  ?  847  DT  B "C4'" 1 
ATOM   6330 O  "O4'" . DT  E 2 11  ? 124.752 8.810   130.208 1.00 46.68  ?  847  DT  B "O4'" 1 
ATOM   6331 C  "C3'" . DT  E 2 11  ? 126.917 7.831   130.046 1.00 46.75  ?  847  DT  B "C3'" 1 
ATOM   6332 O  "O3'" . DT  E 2 11  ? 127.809 8.445   130.948 1.00 53.20  ?  847  DT  B "O3'" 1 
ATOM   6333 C  "C2'" . DT  E 2 11  ? 125.957 6.870   130.755 1.00 50.21  ?  847  DT  B "C2'" 1 
ATOM   6334 C  "C1'" . DT  E 2 11  ? 124.864 7.824   131.217 1.00 44.73  ?  847  DT  B "C1'" 1 
ATOM   6335 N  N1    . DT  E 2 11  ? 123.527 7.200   131.380 1.00 34.35  ?  847  DT  B N1    1 
ATOM   6336 C  C2    . DT  E 2 11  ? 122.785 7.503   132.504 1.00 30.38  ?  847  DT  B C2    1 
ATOM   6337 O  O2    . DT  E 2 11  ? 123.185 8.241   133.383 1.00 32.93  ?  847  DT  B O2    1 
ATOM   6338 N  N3    . DT  E 2 11  ? 121.556 6.916   132.556 1.00 29.27  ?  847  DT  B N3    1 
ATOM   6339 C  C4    . DT  E 2 11  ? 120.995 6.081   131.604 1.00 29.57  ?  847  DT  B C4    1 
ATOM   6340 O  O4    . DT  E 2 11  ? 119.878 5.602   131.733 1.00 30.56  ?  847  DT  B O4    1 
ATOM   6341 C  C5    . DT  E 2 11  ? 121.829 5.799   130.450 1.00 33.50  ?  847  DT  B C5    1 
ATOM   6342 C  C7    . DT  E 2 11  ? 121.329 4.893   129.363 1.00 36.71  ?  847  DT  B C7    1 
ATOM   6343 C  C6    . DT  E 2 11  ? 123.035 6.378   130.388 1.00 29.79  ?  847  DT  B C6    1 
ATOM   6344 P  P     . DA  E 2 12  ? 129.099 7.656   131.479 1.00 61.71  ?  848  DA  B P     1 
ATOM   6345 O  OP1   . DA  E 2 12  ? 130.229 8.608   131.449 1.00 66.39  ?  848  DA  B OP1   1 
ATOM   6346 O  OP2   . DA  E 2 12  ? 129.173 6.340   130.795 1.00 57.05  ?  848  DA  B OP2   1 
ATOM   6347 O  "O5'" . DA  E 2 12  ? 128.737 7.377   132.997 1.00 47.08  ?  848  DA  B "O5'" 1 
ATOM   6348 C  "C5'" . DA  E 2 12  ? 128.186 8.413   133.782 1.00 48.69  ?  848  DA  B "C5'" 1 
ATOM   6349 C  "C4'" . DA  E 2 12  ? 127.635 7.824   135.046 1.00 43.53  ?  848  DA  B "C4'" 1 
ATOM   6350 O  "O4'" . DA  E 2 12  ? 126.300 7.317   134.790 1.00 42.63  ?  848  DA  B "O4'" 1 
ATOM   6351 C  "C3'" . DA  E 2 12  ? 128.452 6.631   135.547 1.00 46.33  ?  848  DA  B "C3'" 1 
ATOM   6352 O  "O3'" . DA  E 2 12  ? 128.705 6.750   136.918 1.00 56.47  ?  848  DA  B "O3'" 1 
ATOM   6353 C  "C2'" . DA  E 2 12  ? 127.569 5.424   135.231 1.00 50.02  ?  848  DA  B "C2'" 1 
ATOM   6354 C  "C1'" . DA  E 2 12  ? 126.190 6.034   135.354 1.00 41.57  ?  848  DA  B "C1'" 1 
ATOM   6355 N  N9    . DA  E 2 12  ? 125.161 5.282   134.652 1.00 34.56  ?  848  DA  B N9    1 
ATOM   6356 C  C8    . DA  E 2 12  ? 125.273 4.647   133.454 1.00 37.12  ?  848  DA  B C8    1 
ATOM   6357 N  N7    . DA  E 2 12  ? 124.173 4.035   133.075 1.00 41.34  ?  848  DA  B N7    1 
ATOM   6358 C  C5    . DA  E 2 12  ? 123.285 4.279   134.105 1.00 35.69  ?  848  DA  B C5    1 
ATOM   6359 C  C6    . DA  E 2 12  ? 121.943 3.900   134.316 1.00 30.46  ?  848  DA  B C6    1 
ATOM   6360 N  N6    . DA  E 2 12  ? 121.233 3.169   133.447 1.00 30.55  ?  848  DA  B N6    1 
ATOM   6361 N  N1    . DA  E 2 12  ? 121.354 4.305   135.455 1.00 33.44  ?  848  DA  B N1    1 
ATOM   6362 C  C2    . DA  E 2 12  ? 122.057 5.037   136.319 1.00 31.58  ?  848  DA  B C2    1 
ATOM   6363 N  N3    . DA  E 2 12  ? 123.315 5.464   136.230 1.00 42.09  ?  848  DA  B N3    1 
ATOM   6364 C  C4    . DA  E 2 12  ? 123.878 5.042   135.087 1.00 44.17  ?  848  DA  B C4    1 
ATOM   6365 P  P     . DG  E 2 13  ? 129.962 5.979   137.551 1.00 63.09  ?  849  DG  B P     1 
ATOM   6366 O  OP1   . DG  E 2 13  ? 131.090 6.933   137.586 1.00 60.80  ?  849  DG  B OP1   1 
ATOM   6367 O  OP2   . DG  E 2 13  ? 130.093 4.654   136.883 1.00 53.16  ?  849  DG  B OP2   1 
ATOM   6368 O  "O5'" . DG  E 2 13  ? 129.498 5.665   139.036 1.00 62.93  ?  849  DG  B "O5'" 1 
ATOM   6369 C  "C5'" . DG  E 2 13  ? 128.492 6.438   139.632 1.00 48.72  ?  849  DG  B "C5'" 1 
ATOM   6370 C  "C4'" . DG  E 2 13  ? 127.663 5.566   140.546 1.00 42.17  ?  849  DG  B "C4'" 1 
ATOM   6371 O  "O4'" . DG  E 2 13  ? 126.552 5.021   139.804 1.00 41.05  ?  849  DG  B "O4'" 1 
ATOM   6372 C  "C3'" . DG  E 2 13  ? 128.409 4.374   141.136 1.00 39.19  ?  849  DG  B "C3'" 1 
ATOM   6373 O  "O3'" . DG  E 2 13  ? 128.096 4.263   142.513 1.00 46.29  ?  849  DG  B "O3'" 1 
ATOM   6374 C  "C2'" . DG  E 2 13  ? 127.883 3.178   140.332 1.00 38.78  ?  849  DG  B "C2'" 1 
ATOM   6375 C  "C1'" . DG  E 2 13  ? 126.469 3.631   140.002 1.00 41.67  ?  849  DG  B "C1'" 1 
ATOM   6376 N  N9    . DG  E 2 13  ? 125.916 3.059   138.776 1.00 37.91  ?  849  DG  B N9    1 
ATOM   6377 C  C8    . DG  E 2 13  ? 126.546 2.923   137.562 1.00 37.97  ?  849  DG  B C8    1 
ATOM   6378 N  N7    . DG  E 2 13  ? 125.781 2.408   136.636 1.00 41.91  ?  849  DG  B N7    1 
ATOM   6379 C  C5    . DG  E 2 13  ? 124.561 2.208   137.272 1.00 39.85  ?  849  DG  B C5    1 
ATOM   6380 C  C6    . DG  E 2 13  ? 123.342 1.674   136.772 1.00 34.42  ?  849  DG  B C6    1 
ATOM   6381 O  O6    . DG  E 2 13  ? 123.095 1.263   135.630 1.00 32.75  ?  849  DG  B O6    1 
ATOM   6382 N  N1    . DG  E 2 13  ? 122.354 1.644   137.754 1.00 33.49  ?  849  DG  B N1    1 
ATOM   6383 C  C2    . DG  E 2 13  ? 122.524 2.078   139.048 1.00 34.58  ?  849  DG  B C2    1 
ATOM   6384 N  N2    . DG  E 2 13  ? 121.463 1.973   139.856 1.00 34.20  ?  849  DG  B N2    1 
ATOM   6385 N  N3    . DG  E 2 13  ? 123.657 2.576   139.524 1.00 38.03  ?  849  DG  B N3    1 
ATOM   6386 C  C4    . DG  E 2 13  ? 124.626 2.613   138.585 1.00 34.99  ?  849  DG  B C4    1 
ATOM   6387 P  P     . DG  E 2 14  ? 128.889 3.215   143.433 1.00 54.50  ?  850  DG  B P     1 
ATOM   6388 O  OP1   . DG  E 2 14  ? 129.012 3.835   144.770 1.00 64.09  ?  850  DG  B OP1   1 
ATOM   6389 O  OP2   . DG  E 2 14  ? 130.079 2.758   142.680 1.00 57.70  ?  850  DG  B OP2   1 
ATOM   6390 O  "O5'" . DG  E 2 14  ? 127.893 1.979   143.533 1.00 45.04  ?  850  DG  B "O5'" 1 
ATOM   6391 C  "C5'" . DG  E 2 14  ? 126.584 2.186   144.014 1.00 40.12  ?  850  DG  B "C5'" 1 
ATOM   6392 C  "C4'" . DG  E 2 14  ? 125.695 1.020   143.648 1.00 41.21  ?  850  DG  B "C4'" 1 
ATOM   6393 O  "O4'" . DG  E 2 14  ? 125.477 0.980   142.208 1.00 48.02  ?  850  DG  B "O4'" 1 
ATOM   6394 C  "C3'" . DG  E 2 14  ? 126.254 -0.368  144.014 1.00 52.49  ?  850  DG  B "C3'" 1 
ATOM   6395 O  "O3'" . DG  E 2 14  ? 125.199 -1.155  144.493 1.00 55.66  ?  850  DG  B "O3'" 1 
ATOM   6396 C  "C2'" . DG  E 2 14  ? 126.723 -0.895  142.662 1.00 56.15  ?  850  DG  B "C2'" 1 
ATOM   6397 C  "C1'" . DG  E 2 14  ? 125.575 -0.370  141.830 1.00 48.88  ?  850  DG  B "C1'" 1 
ATOM   6398 N  N9    . DG  E 2 14  ? 125.714 -0.519  140.383 1.00 40.72  ?  850  DG  B N9    1 
ATOM   6399 C  C8    . DG  E 2 14  ? 126.835 -0.337  139.605 1.00 36.83  ?  850  DG  B C8    1 
ATOM   6400 N  N7    . DG  E 2 14  ? 126.627 -0.581  138.332 1.00 39.63  ?  850  DG  B N7    1 
ATOM   6401 C  C5    . DG  E 2 14  ? 125.288 -0.965  138.280 1.00 40.91  ?  850  DG  B C5    1 
ATOM   6402 C  C6    . DG  E 2 14  ? 124.483 -1.353  137.176 1.00 31.96  ?  850  DG  B C6    1 
ATOM   6403 O  O6    . DG  E 2 14  ? 124.806 -1.433  135.984 1.00 33.12  ?  850  DG  B O6    1 
ATOM   6404 N  N1    . DG  E 2 14  ? 123.178 -1.658  137.572 1.00 26.45  ?  850  DG  B N1    1 
ATOM   6405 C  C2    . DG  E 2 14  ? 122.717 -1.600  138.873 1.00 28.16  ?  850  DG  B C2    1 
ATOM   6406 N  N2    . DG  E 2 14  ? 121.435 -1.923  139.081 1.00 29.57  ?  850  DG  B N2    1 
ATOM   6407 N  N3    . DG  E 2 14  ? 123.460 -1.233  139.903 1.00 38.03  ?  850  DG  B N3    1 
ATOM   6408 C  C4    . DG  E 2 14  ? 124.724 -0.929  139.533 1.00 40.34  ?  850  DG  B C4    1 
ATOM   6409 P  P     . DA  E 2 15  ? 125.364 -2.033  145.821 1.00 58.28  ?  851  DA  B P     1 
ATOM   6410 O  OP1   . DA  E 2 15  ? 125.264 -1.104  146.971 1.00 73.11  ?  851  DA  B OP1   1 
ATOM   6411 O  OP2   . DA  E 2 15  ? 126.559 -2.880  145.638 1.00 46.56  ?  851  DA  B OP2   1 
ATOM   6412 O  "O5'" . DA  E 2 15  ? 124.050 -2.934  145.814 1.00 43.88  ?  851  DA  B "O5'" 1 
ATOM   6413 C  "C5'" . DA  E 2 15  ? 122.781 -2.300  145.668 1.00 38.31  ?  851  DA  B "C5'" 1 
ATOM   6414 C  "C4'" . DA  E 2 15  ? 121.818 -3.185  144.910 1.00 39.54  ?  851  DA  B "C4'" 1 
ATOM   6415 O  "O4'" . DA  E 2 15  ? 122.138 -3.154  143.491 1.00 35.34  ?  851  DA  B "O4'" 1 
ATOM   6416 C  "C3'" . DA  E 2 15  ? 121.843 -4.652  145.316 1.00 32.71  ?  851  DA  B "C3'" 1 
ATOM   6417 O  "O3'" . DA  E 2 15  ? 120.499 -5.166  145.296 1.00 30.82  ?  851  DA  B "O3'" 1 
ATOM   6418 C  "C2'" . DA  E 2 15  ? 122.735 -5.290  144.232 1.00 34.89  ?  851  DA  B "C2'" 1 
ATOM   6419 C  "C1'" . DA  E 2 15  ? 122.339 -4.471  143.008 1.00 36.36  ?  851  DA  B "C1'" 1 
ATOM   6420 N  N9    . DA  E 2 15  ? 123.352 -4.400  141.950 1.00 29.59  ?  851  DA  B N9    1 
ATOM   6421 C  C8    . DA  E 2 15  ? 124.652 -3.983  142.083 1.00 31.15  ?  851  DA  B C8    1 
ATOM   6422 N  N7    . DA  E 2 15  ? 125.324 -3.972  140.953 1.00 34.32  ?  851  DA  B N7    1 
ATOM   6423 C  C5    . DA  E 2 15  ? 124.400 -4.403  140.012 1.00 33.80  ?  851  DA  B C5    1 
ATOM   6424 C  C6    . DA  E 2 15  ? 124.489 -4.610  138.618 1.00 29.42  ?  851  DA  B C6    1 
ATOM   6425 N  N6    . DA  E 2 15  ? 125.601 -4.400  137.915 1.00 28.09  ?  851  DA  B N6    1 
ATOM   6426 N  N1    . DA  E 2 15  ? 123.379 -5.036  137.974 1.00 27.45  ?  851  DA  B N1    1 
ATOM   6427 C  C2    . DA  E 2 15  ? 122.267 -5.245  138.681 1.00 25.76  ?  851  DA  B C2    1 
ATOM   6428 N  N3    . DA  E 2 15  ? 122.060 -5.080  139.987 1.00 27.44  ?  851  DA  B N3    1 
ATOM   6429 C  C4    . DA  E 2 15  ? 123.178 -4.657  140.603 1.00 30.19  ?  851  DA  B C4    1 
ATOM   6430 P  P     . DC  E 2 16  ? 120.124 -6.592  145.948 1.00 41.83  ?  852  DC  B P     1 
ATOM   6431 O  OP1   . DC  E 2 16  ? 118.921 -6.403  146.793 1.00 49.67  ?  852  DC  B OP1   1 
ATOM   6432 O  OP2   . DC  E 2 16  ? 121.348 -7.222  146.501 1.00 44.54  ?  852  DC  B OP2   1 
ATOM   6433 O  "O5'" . DC  E 2 16  ? 119.634 -7.455  144.703 1.00 51.12  ?  852  DC  B "O5'" 1 
ATOM   6434 C  "C5'" . DC  E 2 16  ? 120.140 -7.139  143.466 1.00 51.94  ?  852  DC  B "C5'" 1 
ATOM   6435 C  "C4'" . DC  E 2 16  ? 119.485 -7.898  142.360 1.00 35.79  ?  852  DC  B "C4'" 1 
ATOM   6436 O  "O4'" . DC  E 2 16  ? 120.268 -7.660  141.183 1.00 37.27  ?  852  DC  B "O4'" 1 
ATOM   6437 C  "C3'" . DC  E 2 16  ? 119.452 -9.407  142.539 1.00 38.46  ?  852  DC  B "C3'" 1 
ATOM   6438 O  "O3'" . DC  E 2 16  ? 118.333 -9.953  141.821 1.00 42.79  ?  852  DC  B "O3'" 1 
ATOM   6439 C  "C2'" . DC  E 2 16  ? 120.791 -9.846  141.948 1.00 34.18  ?  852  DC  B "C2'" 1 
ATOM   6440 C  "C1'" . DC  E 2 16  ? 121.006 -8.815  140.841 1.00 31.85  ?  852  DC  B "C1'" 1 
ATOM   6441 N  N1    . DC  E 2 16  ? 122.413 -8.413  140.652 1.00 28.85  ?  852  DC  B N1    1 
ATOM   6442 C  C2    . DC  E 2 16  ? 122.927 -8.361  139.363 1.00 31.18  ?  852  DC  B C2    1 
ATOM   6443 O  O2    . DC  E 2 16  ? 122.188 -8.658  138.415 1.00 34.62  ?  852  DC  B O2    1 
ATOM   6444 N  N3    . DC  E 2 16  ? 124.214 -7.989  139.184 1.00 29.70  ?  852  DC  B N3    1 
ATOM   6445 C  C4    . DC  E 2 16  ? 124.976 -7.685  140.234 1.00 31.57  ?  852  DC  B C4    1 
ATOM   6446 N  N4    . DC  E 2 16  ? 126.247 -7.332  140.004 1.00 35.80  ?  852  DC  B N4    1 
ATOM   6447 C  C5    . DC  E 2 16  ? 124.468 -7.730  141.566 1.00 28.76  ?  852  DC  B C5    1 
ATOM   6448 C  C6    . DC  E 2 16  ? 123.192 -8.095  141.728 1.00 33.24  ?  852  DC  B C6    1 
ATOM   6449 P  P     . DC  E 2 17  ? 117.948 -11.511 141.933 1.00 42.54  ?  853  DC  B P     1 
ATOM   6450 O  OP1   . DC  E 2 17  ? 116.501 -11.624 141.623 1.00 49.55  ?  853  DC  B OP1   1 
ATOM   6451 O  OP2   . DC  E 2 17  ? 118.472 -12.101 143.185 1.00 36.61  ?  853  DC  B OP2   1 
ATOM   6452 O  "O5'" . DC  E 2 17  ? 118.743 -12.176 140.723 1.00 44.18  ?  853  DC  B "O5'" 1 
ATOM   6453 C  "C5'" . DC  E 2 17  ? 118.472 -11.769 139.399 1.00 46.65  ?  853  DC  B "C5'" 1 
ATOM   6454 C  "C4'" . DC  E 2 17  ? 119.360 -12.514 138.427 1.00 43.31  ?  853  DC  B "C4'" 1 
ATOM   6455 O  "O4'" . DC  E 2 17  ? 120.674 -11.896 138.393 1.00 40.98  ?  853  DC  B "O4'" 1 
ATOM   6456 C  "C3'" . DC  E 2 17  ? 119.584 -13.998 138.757 1.00 44.46  ?  853  DC  B "C3'" 1 
ATOM   6457 O  "O3'" . DC  E 2 17  ? 119.300 -14.778 137.592 1.00 62.42  ?  853  DC  B "O3'" 1 
ATOM   6458 C  "C2'" . DC  E 2 17  ? 121.072 -14.059 139.150 1.00 43.32  ?  853  DC  B "C2'" 1 
ATOM   6459 C  "C1'" . DC  E 2 17  ? 121.649 -12.901 138.345 1.00 37.29  ?  853  DC  B "C1'" 1 
ATOM   6460 N  N1    . DC  E 2 17  ? 122.936 -12.323 138.878 1.00 36.83  ?  853  DC  B N1    1 
ATOM   6461 C  C2    . DC  E 2 17  ? 123.995 -12.083 137.994 1.00 38.55  ?  853  DC  B C2    1 
ATOM   6462 O  O2    . DC  E 2 17  ? 123.860 -12.374 136.798 1.00 41.29  ?  853  DC  B O2    1 
ATOM   6463 N  N3    . DC  E 2 17  ? 125.140 -11.541 138.472 1.00 33.23  ?  853  DC  B N3    1 
ATOM   6464 C  C4    . DC  E 2 17  ? 125.251 -11.247 139.768 1.00 31.14  ?  853  DC  B C4    1 
ATOM   6465 N  N4    . DC  E 2 17  ? 126.398 -10.712 140.185 1.00 30.66  ?  853  DC  B N4    1 
ATOM   6466 C  C5    . DC  E 2 17  ? 124.184 -11.476 140.688 1.00 32.23  ?  853  DC  B C5    1 
ATOM   6467 C  C6    . DC  E 2 17  ? 123.051 -12.005 140.201 1.00 34.56  ?  853  DC  B C6    1 
ATOM   6468 P  P     . DC  E 2 18  ? 118.814 -16.310 137.690 1.00 57.79  ?  854  DC  B P     1 
ATOM   6469 O  OP1   . DC  E 2 18  ? 117.541 -16.415 136.939 1.00 59.71  ?  854  DC  B OP1   1 
ATOM   6470 O  OP2   . DC  E 2 18  ? 118.868 -16.788 139.087 1.00 67.44  ?  854  DC  B OP2   1 
ATOM   6471 O  "O5'" . DC  E 2 18  ? 119.948 -17.084 136.876 1.00 59.28  ?  854  DC  B "O5'" 1 
ATOM   6472 C  "C5'" . DC  E 2 18  ? 120.246 -16.679 135.547 1.00 60.25  ?  854  DC  B "C5'" 1 
ATOM   6473 C  "C4'" . DC  E 2 18  ? 121.645 -17.103 135.155 1.00 58.84  ?  854  DC  B "C4'" 1 
ATOM   6474 O  "O4'" . DC  E 2 18  ? 122.580 -16.094 135.565 1.00 52.11  ?  854  DC  B "O4'" 1 
ATOM   6475 C  "C3'" . DC  E 2 18  ? 122.131 -18.373 135.825 1.00 57.02  ?  854  DC  B "C3'" 1 
ATOM   6476 O  "O3'" . DC  E 2 18  ? 121.752 -19.494 135.048 1.00 66.49  ?  854  DC  B "O3'" 1 
ATOM   6477 C  "C2'" . DC  E 2 18  ? 123.654 -18.200 135.852 1.00 49.39  ?  854  DC  B "C2'" 1 
ATOM   6478 C  "C1'" . DC  E 2 18  ? 123.851 -16.684 135.707 1.00 46.51  ?  854  DC  B "C1'" 1 
ATOM   6479 N  N1    . DC  E 2 18  ? 124.524 -16.062 136.869 1.00 43.04  ?  854  DC  B N1    1 
ATOM   6480 C  C2    . DC  E 2 18  ? 125.707 -15.355 136.670 1.00 40.90  ?  854  DC  B C2    1 
ATOM   6481 O  O2    . DC  E 2 18  ? 126.165 -15.258 135.524 1.00 38.64  ?  854  DC  B O2    1 
ATOM   6482 N  N3    . DC  E 2 18  ? 126.314 -14.791 137.734 1.00 35.19  ?  854  DC  B N3    1 
ATOM   6483 C  C4    . DC  E 2 18  ? 125.787 -14.918 138.952 1.00 33.44  ?  854  DC  B C4    1 
ATOM   6484 N  N4    . DC  E 2 18  ? 126.424 -14.343 139.967 1.00 29.92  ?  854  DC  B N4    1 
ATOM   6485 C  C5    . DC  E 2 18  ? 124.577 -15.637 139.178 1.00 41.69  ?  854  DC  B C5    1 
ATOM   6486 C  C6    . DC  E 2 18  ? 123.986 -16.187 138.117 1.00 40.60  ?  854  DC  B C6    1 
ATOM   6487 O  "O5'" . DC  F 3 2   ? 139.392 -22.320 142.008 1.00 49.52  ?  857  DC  C "O5'" 1 
ATOM   6488 C  "C5'" . DC  F 3 2   ? 140.265 -23.012 142.880 1.00 46.10  ?  857  DC  C "C5'" 1 
ATOM   6489 C  "C4'" . DC  F 3 2   ? 139.865 -22.867 144.357 1.00 52.90  ?  857  DC  C "C4'" 1 
ATOM   6490 O  "O4'" . DC  F 3 2   ? 141.035 -23.107 145.173 1.00 56.38  ?  857  DC  C "O4'" 1 
ATOM   6491 C  "C3'" . DC  F 3 2   ? 139.296 -21.502 144.786 1.00 59.51  ?  857  DC  C "C3'" 1 
ATOM   6492 O  "O3'" . DC  F 3 2   ? 137.960 -21.646 145.228 1.00 66.66  ?  857  DC  C "O3'" 1 
ATOM   6493 C  "C2'" . DC  F 3 2   ? 140.160 -21.043 145.959 1.00 57.71  ?  857  DC  C "C2'" 1 
ATOM   6494 C  "C1'" . DC  F 3 2   ? 141.362 -21.969 145.945 1.00 60.33  ?  857  DC  C "C1'" 1 
ATOM   6495 N  N1    . DC  F 3 2   ? 142.614 -21.310 145.416 1.00 63.54  ?  857  DC  C N1    1 
ATOM   6496 C  C2    . DC  F 3 2   ? 143.597 -20.883 146.320 1.00 71.67  ?  857  DC  C C2    1 
ATOM   6497 O  O2    . DC  F 3 2   ? 143.431 -21.081 147.531 1.00 81.96  ?  857  DC  C O2    1 
ATOM   6498 N  N3    . DC  F 3 2   ? 144.712 -20.278 145.842 1.00 60.16  ?  857  DC  C N3    1 
ATOM   6499 C  C4    . DC  F 3 2   ? 144.857 -20.083 144.532 1.00 53.07  ?  857  DC  C C4    1 
ATOM   6500 N  N4    . DC  F 3 2   ? 145.973 -19.483 144.110 1.00 48.48  ?  857  DC  C N4    1 
ATOM   6501 C  C5    . DC  F 3 2   ? 143.867 -20.505 143.596 1.00 54.36  ?  857  DC  C C5    1 
ATOM   6502 C  C6    . DC  F 3 2   ? 142.767 -21.092 144.077 1.00 55.02  ?  857  DC  C C6    1 
ATOM   6503 P  P     . DT  F 3 3   ? 136.891 -20.475 144.974 1.00 67.17  ?  858  DT  C P     1 
ATOM   6504 O  OP1   . DT  F 3 3   ? 135.676 -21.165 144.489 1.00 55.29  ?  858  DT  C OP1   1 
ATOM   6505 O  OP2   . DT  F 3 3   ? 137.562 -19.427 144.170 1.00 72.23  ?  858  DT  C OP2   1 
ATOM   6506 O  "O5'" . DT  F 3 3   ? 136.606 -19.824 146.414 1.00 63.37  ?  858  DT  C "O5'" 1 
ATOM   6507 C  "C5'" . DT  F 3 3   ? 136.988 -18.462 146.681 1.00 37.10  ?  858  DT  C "C5'" 1 
ATOM   6508 C  "C4'" . DT  F 3 3   ? 135.799 -17.504 146.580 1.00 26.95  ?  858  DT  C "C4'" 1 
ATOM   6509 O  "O4'" . DT  F 3 3   ? 135.802 -16.615 147.727 1.00 26.64  ?  858  DT  C "O4'" 1 
ATOM   6510 C  "C3'" . DT  F 3 3   ? 135.812 -16.575 145.380 1.00 26.88  ?  858  DT  C "C3'" 1 
ATOM   6511 O  "O3'" . DT  F 3 3   ? 134.459 -16.143 145.103 1.00 27.38  ?  858  DT  C "O3'" 1 
ATOM   6512 C  "C2'" . DT  F 3 3   ? 136.658 -15.410 145.917 1.00 26.63  ?  858  DT  C "C2'" 1 
ATOM   6513 C  "C1'" . DT  F 3 3   ? 136.062 -15.285 147.305 1.00 26.43  ?  858  DT  C "C1'" 1 
ATOM   6514 N  N1    . DT  F 3 3   ? 136.958 -14.662 148.344 1.00 26.33  ?  858  DT  C N1    1 
ATOM   6515 C  C2    . DT  F 3 3   ? 136.467 -13.637 149.114 1.00 27.09  ?  858  DT  C C2    1 
ATOM   6516 O  O2    . DT  F 3 3   ? 135.355 -13.159 148.957 1.00 26.03  ?  858  DT  C O2    1 
ATOM   6517 N  N3    . DT  F 3 3   ? 137.339 -13.167 150.063 1.00 26.20  ?  858  DT  C N3    1 
ATOM   6518 C  C4    . DT  F 3 3   ? 138.616 -13.641 150.335 1.00 29.83  ?  858  DT  C C4    1 
ATOM   6519 O  O4    . DT  F 3 3   ? 139.326 -13.161 151.217 1.00 29.27  ?  858  DT  C O4    1 
ATOM   6520 C  C5    . DT  F 3 3   ? 139.059 -14.730 149.508 1.00 26.50  ?  858  DT  C C5    1 
ATOM   6521 C  C7    . DT  F 3 3   ? 140.431 -15.325 149.720 1.00 28.57  ?  858  DT  C C7    1 
ATOM   6522 C  C6    . DT  F 3 3   ? 138.218 -15.195 148.571 1.00 26.50  ?  858  DT  C C6    1 
ATOM   6523 P  P     . DA  F 3 4   ? 133.910 -16.071 143.602 1.00 29.16  ?  859  DA  C P     1 
ATOM   6524 O  OP1   . DA  F 3 4   ? 132.594 -15.394 143.674 1.00 31.66  ?  859  DA  C OP1   1 
ATOM   6525 O  OP2   . DA  F 3 4   ? 134.089 -17.393 142.951 1.00 28.82  ?  859  DA  C OP2   1 
ATOM   6526 O  "O5'" . DA  F 3 4   ? 134.877 -15.018 142.913 1.00 32.71  ?  859  DA  C "O5'" 1 
ATOM   6527 C  "C5'" . DA  F 3 4   ? 135.691 -15.406 141.844 1.00 31.90  ?  859  DA  C "C5'" 1 
ATOM   6528 C  "C4'" . DA  F 3 4   ? 135.227 -14.753 140.557 1.00 29.92  ?  859  DA  C "C4'" 1 
ATOM   6529 O  "O4'" . DA  F 3 4   ? 134.030 -15.416 140.077 1.00 32.36  ?  859  DA  C "O4'" 1 
ATOM   6530 C  "C3'" . DA  F 3 4   ? 134.863 -13.260 140.637 1.00 28.77  ?  859  DA  C "C3'" 1 
ATOM   6531 O  "O3'" . DA  F 3 4   ? 135.149 -12.688 139.384 1.00 38.01  ?  859  DA  C "O3'" 1 
ATOM   6532 C  "C2'" . DA  F 3 4   ? 133.349 -13.322 140.815 1.00 32.39  ?  859  DA  C "C2'" 1 
ATOM   6533 C  "C1'" . DA  F 3 4   ? 133.048 -14.427 139.814 1.00 35.26  ?  859  DA  C "C1'" 1 
ATOM   6534 N  N9    . DA  F 3 4   ? 131.731 -15.040 139.947 1.00 37.76  ?  859  DA  C N9    1 
ATOM   6535 C  C8    . DA  F 3 4   ? 130.957 -15.112 141.070 1.00 38.21  ?  859  DA  C C8    1 
ATOM   6536 N  N7    . DA  F 3 4   ? 129.828 -15.751 140.886 1.00 34.71  ?  859  DA  C N7    1 
ATOM   6537 C  C5    . DA  F 3 4   ? 129.866 -16.127 139.558 1.00 30.29  ?  859  DA  C C5    1 
ATOM   6538 C  C6    . DA  F 3 4   ? 128.965 -16.848 138.753 1.00 37.75  ?  859  DA  C C6    1 
ATOM   6539 N  N6    . DA  F 3 4   ? 127.793 -17.319 139.204 1.00 35.21  ?  859  DA  C N6    1 
ATOM   6540 N  N1    . DA  F 3 4   ? 129.312 -17.062 137.466 1.00 37.77  ?  859  DA  C N1    1 
ATOM   6541 C  C2    . DA  F 3 4   ? 130.487 -16.597 137.028 1.00 43.18  ?  859  DA  C C2    1 
ATOM   6542 N  N3    . DA  F 3 4   ? 131.414 -15.906 137.692 1.00 36.50  ?  859  DA  C N3    1 
ATOM   6543 C  C4    . DA  F 3 4   ? 131.037 -15.708 138.965 1.00 33.43  ?  859  DA  C C4    1 
ATOM   6544 P  P     . DG  F 3 5   ? 135.938 -11.297 139.218 1.00 31.23  ?  860  DG  C P     1 
ATOM   6545 O  OP1   . DG  F 3 5   ? 137.351 -11.507 139.597 1.00 36.84  ?  860  DG  C OP1   1 
ATOM   6546 O  OP2   . DG  F 3 5   ? 135.149 -10.247 139.883 1.00 32.15  ?  860  DG  C OP2   1 
ATOM   6547 O  "O5'" . DG  F 3 5   ? 135.851 -11.061 137.649 1.00 27.61  ?  860  DG  C "O5'" 1 
ATOM   6548 C  "C5'" . DG  F 3 5   ? 136.449 -11.988 136.783 1.00 29.72  ?  860  DG  C "C5'" 1 
ATOM   6549 C  "C4'" . DG  F 3 5   ? 135.626 -12.142 135.520 1.00 33.82  ?  860  DG  C "C4'" 1 
ATOM   6550 O  "O4'" . DG  F 3 5   ? 134.312 -12.671 135.831 1.00 30.50  ?  860  DG  C "O4'" 1 
ATOM   6551 C  "C3'" . DG  F 3 5   ? 135.384 -10.865 134.732 1.00 37.98  ?  860  DG  C "C3'" 1 
ATOM   6552 O  "O3'" . DG  F 3 5   ? 135.391 -11.200 133.361 1.00 45.28  ?  860  DG  C "O3'" 1 
ATOM   6553 C  "C2'" . DG  F 3 5   ? 133.999 -10.416 135.214 1.00 34.08  ?  860  DG  C "C2'" 1 
ATOM   6554 C  "C1'" . DG  F 3 5   ? 133.301 -11.748 135.456 1.00 29.07  ?  860  DG  C "C1'" 1 
ATOM   6555 N  N9    . DG  F 3 5   ? 132.323 -11.743 136.537 1.00 32.96  ?  860  DG  C N9    1 
ATOM   6556 C  C8    . DG  F 3 5   ? 132.416 -11.095 137.750 1.00 28.43  ?  860  DG  C C8    1 
ATOM   6557 N  N7    . DG  F 3 5   ? 131.402 -11.332 138.543 1.00 28.88  ?  860  DG  C N7    1 
ATOM   6558 C  C5    . DG  F 3 5   ? 130.594 -12.204 137.807 1.00 28.03  ?  860  DG  C C5    1 
ATOM   6559 C  C6    . DG  F 3 5   ? 129.363 -12.818 138.149 1.00 37.00  ?  860  DG  C C6    1 
ATOM   6560 O  O6    . DG  F 3 5   ? 128.720 -12.705 139.200 1.00 33.64  ?  860  DG  C O6    1 
ATOM   6561 N  N1    . DG  F 3 5   ? 128.881 -13.633 137.115 1.00 32.10  ?  860  DG  C N1    1 
ATOM   6562 C  C2    . DG  F 3 5   ? 129.517 -13.832 135.915 1.00 38.98  ?  860  DG  C C2    1 
ATOM   6563 N  N2    . DG  F 3 5   ? 128.905 -14.654 135.045 1.00 35.23  ?  860  DG  C N2    1 
ATOM   6564 N  N3    . DG  F 3 5   ? 130.682 -13.278 135.590 1.00 36.19  ?  860  DG  C N3    1 
ATOM   6565 C  C4    . DG  F 3 5   ? 131.157 -12.474 136.583 1.00 34.97  ?  860  DG  C C4    1 
ATOM   6566 P  P     . DG  F 3 6   ? 135.351 -10.071 132.222 1.00 43.70  ?  861  DG  C P     1 
ATOM   6567 O  OP1   . DG  F 3 6   ? 136.113 -10.691 131.110 1.00 39.14  ?  861  DG  C OP1   1 
ATOM   6568 O  OP2   . DG  F 3 6   ? 135.700 -8.748  132.786 1.00 50.66  ?  861  DG  C OP2   1 
ATOM   6569 O  "O5'" . DG  F 3 6   ? 133.807 -10.026 131.836 1.00 40.06  ?  861  DG  C "O5'" 1 
ATOM   6570 C  "C5'" . DG  F 3 6   ? 133.235 -11.162 131.239 1.00 35.63  ?  861  DG  C "C5'" 1 
ATOM   6571 C  "C4'" . DG  F 3 6   ? 131.738 -11.030 131.159 1.00 39.67  ?  861  DG  C "C4'" 1 
ATOM   6572 O  "O4'" . DG  F 3 6   ? 131.174 -11.087 132.482 1.00 39.85  ?  861  DG  C "O4'" 1 
ATOM   6573 C  "C3'" . DG  F 3 6   ? 131.222 -9.734  130.519 1.00 38.15  ?  861  DG  C "C3'" 1 
ATOM   6574 O  "O3'" . DG  F 3 6   ? 130.316 -10.088 129.502 1.00 45.60  ?  861  DG  C "O3'" 1 
ATOM   6575 C  "C2'" . DG  F 3 6   ? 130.521 -9.014  131.678 1.00 39.39  ?  861  DG  C "C2'" 1 
ATOM   6576 C  "C1'" . DG  F 3 6   ? 130.104 -10.188 132.548 1.00 37.36  ?  861  DG  C "C1'" 1 
ATOM   6577 N  N9    . DG  F 3 6   ? 129.890 -9.857  133.950 1.00 35.29  ?  861  DG  C N9    1 
ATOM   6578 C  C8    . DG  F 3 6   ? 130.685 -9.077  134.762 1.00 33.60  ?  861  DG  C C8    1 
ATOM   6579 N  N7    . DG  F 3 6   ? 130.240 -8.990  135.993 1.00 33.55  ?  861  DG  C N7    1 
ATOM   6580 C  C5    . DG  F 3 6   ? 129.085 -9.769  135.986 1.00 31.18  ?  861  DG  C C5    1 
ATOM   6581 C  C6    . DG  F 3 6   ? 128.165 -10.058 137.022 1.00 31.64  ?  861  DG  C C6    1 
ATOM   6582 O  O6    . DG  F 3 6   ? 128.187 -9.676  138.191 1.00 35.12  ?  861  DG  C O6    1 
ATOM   6583 N  N1    . DG  F 3 6   ? 127.134 -10.886 136.579 1.00 28.08  ?  861  DG  C N1    1 
ATOM   6584 C  C2    . DG  F 3 6   ? 127.017 -11.383 135.303 1.00 33.63  ?  861  DG  C C2    1 
ATOM   6585 N  N2    . DG  F 3 6   ? 125.965 -12.174 135.063 1.00 37.87  ?  861  DG  C N2    1 
ATOM   6586 N  N3    . DG  F 3 6   ? 127.870 -11.123 134.331 1.00 34.26  ?  861  DG  C N3    1 
ATOM   6587 C  C4    . DG  F 3 6   ? 128.873 -10.317 134.739 1.00 27.80  ?  861  DG  C C4    1 
ATOM   6588 P  P     . DG  F 3 7   ? 129.613 -8.988  128.573 1.00 45.94  ?  862  DG  C P     1 
ATOM   6589 O  OP1   . DG  F 3 7   ? 129.807 -9.456  127.187 1.00 49.93  ?  862  DG  C OP1   1 
ATOM   6590 O  OP2   . DG  F 3 7   ? 129.992 -7.624  128.994 1.00 36.95  ?  862  DG  C OP2   1 
ATOM   6591 O  "O5'" . DG  F 3 7   ? 128.075 -9.164  128.926 1.00 46.80  ?  862  DG  C "O5'" 1 
ATOM   6592 C  "C5'" . DG  F 3 7   ? 127.526 -10.458 128.947 1.00 42.29  ?  862  DG  C "C5'" 1 
ATOM   6593 C  "C4'" . DG  F 3 7   ? 126.160 -10.432 129.578 1.00 51.56  ?  862  DG  C "C4'" 1 
ATOM   6594 O  "O4'" . DG  F 3 7   ? 126.296 -10.244 131.008 1.00 49.74  ?  862  DG  C "O4'" 1 
ATOM   6595 C  "C3'" . DG  F 3 7   ? 125.249 -9.310  129.073 1.00 56.26  ?  862  DG  C "C3'" 1 
ATOM   6596 O  "O3'" . DG  F 3 7   ? 123.967 -9.853  128.782 1.00 59.53  ?  862  DG  C "O3'" 1 
ATOM   6597 C  "C2'" . DG  F 3 7   ? 125.216 -8.312  130.240 1.00 51.45  ?  862  DG  C "C2'" 1 
ATOM   6598 C  "C1'" . DG  F 3 7   ? 125.424 -9.232  131.438 1.00 46.45  ?  862  DG  C "C1'" 1 
ATOM   6599 N  N9    . DG  F 3 7   ? 126.011 -8.569  132.608 1.00 43.46  ?  862  DG  C N9    1 
ATOM   6600 C  C8    . DG  F 3 7   ? 127.177 -7.836  132.668 1.00 39.25  ?  862  DG  C C8    1 
ATOM   6601 N  N7    . DG  F 3 7   ? 127.429 -7.365  133.861 1.00 38.37  ?  862  DG  C N7    1 
ATOM   6602 C  C5    . DG  F 3 7   ? 126.367 -7.820  134.639 1.00 34.69  ?  862  DG  C C5    1 
ATOM   6603 C  C6    . DG  F 3 7   ? 126.088 -7.634  136.026 1.00 33.24  ?  862  DG  C C6    1 
ATOM   6604 O  O6    . DG  F 3 7   ? 126.747 -7.009  136.873 1.00 37.38  ?  862  DG  C O6    1 
ATOM   6605 N  N1    . DG  F 3 7   ? 124.914 -8.283  136.402 1.00 33.95  ?  862  DG  C N1    1 
ATOM   6606 C  C2    . DG  F 3 7   ? 124.108 -9.004  135.551 1.00 33.89  ?  862  DG  C C2    1 
ATOM   6607 N  N2    . DG  F 3 7   ? 123.011 -9.548  136.082 1.00 30.89  ?  862  DG  C N2    1 
ATOM   6608 N  N3    . DG  F 3 7   ? 124.358 -9.180  134.263 1.00 36.73  ?  862  DG  C N3    1 
ATOM   6609 C  C4    . DG  F 3 7   ? 125.498 -8.568  133.881 1.00 30.84  ?  862  DG  C C4    1 
ATOM   6610 P  P     . DT  F 3 8   ? 122.808 -8.958  128.121 1.00 57.42  ?  863  DT  C P     1 
ATOM   6611 O  OP1   . DT  F 3 8   ? 122.010 -9.896  127.302 1.00 71.61  ?  863  DT  C OP1   1 
ATOM   6612 O  OP2   . DT  F 3 8   ? 123.356 -7.702  127.548 1.00 48.29  ?  863  DT  C OP2   1 
ATOM   6613 O  "O5'" . DT  F 3 8   ? 121.911 -8.560  129.364 1.00 52.17  ?  863  DT  C "O5'" 1 
ATOM   6614 C  "C5'" . DT  F 3 8   ? 121.430 -9.574  130.194 1.00 43.72  ?  863  DT  C "C5'" 1 
ATOM   6615 C  "C4'" . DT  F 3 8   ? 120.731 -8.972  131.378 1.00 41.49  ?  863  DT  C "C4'" 1 
ATOM   6616 O  "O4'" . DT  F 3 8   ? 121.700 -8.394  132.263 1.00 38.18  ?  863  DT  C "O4'" 1 
ATOM   6617 C  "C3'" . DT  F 3 8   ? 119.753 -7.859  131.026 1.00 42.84  ?  863  DT  C "C3'" 1 
ATOM   6618 O  "O3'" . DT  F 3 8   ? 118.476 -8.300  131.395 1.00 42.07  ?  863  DT  C "O3'" 1 
ATOM   6619 C  "C2'" . DT  F 3 8   ? 120.244 -6.635  131.847 1.00 35.34  ?  863  DT  C "C2'" 1 
ATOM   6620 C  "C1'" . DT  F 3 8   ? 121.123 -7.293  132.900 1.00 32.69  ?  863  DT  C "C1'" 1 
ATOM   6621 N  N1    . DT  F 3 8   ? 122.240 -6.462  133.439 1.00 33.46  ?  863  DT  C N1    1 
ATOM   6622 C  C2    . DT  F 3 8   ? 122.305 -6.247  134.795 1.00 29.92  ?  863  DT  C C2    1 
ATOM   6623 O  O2    . DT  F 3 8   ? 121.474 -6.666  135.569 1.00 30.82  ?  863  DT  C O2    1 
ATOM   6624 N  N3    . DT  F 3 8   ? 123.382 -5.518  135.213 1.00 27.89  ?  863  DT  C N3    1 
ATOM   6625 C  C4    . DT  F 3 8   ? 124.385 -4.979  134.427 1.00 32.07  ?  863  DT  C C4    1 
ATOM   6626 O  O4    . DT  F 3 8   ? 125.316 -4.320  134.900 1.00 30.47  ?  863  DT  C O4    1 
ATOM   6627 C  C5    . DT  F 3 8   ? 124.263 -5.242  133.010 1.00 29.91  ?  863  DT  C C5    1 
ATOM   6628 C  C7    . DT  F 3 8   ? 125.294 -4.714  132.062 1.00 34.06  ?  863  DT  C C7    1 
ATOM   6629 C  C6    . DT  F 3 8   ? 123.217 -5.983  132.591 1.00 31.63  ?  863  DT  C C6    1 
ATOM   6630 P  P     . DC  F 3 9   ? 117.184 -7.370  131.262 1.00 45.66  ?  864  DC  C P     1 
ATOM   6631 O  OP1   . DC  F 3 9   ? 116.068 -8.325  131.075 1.00 53.31  ?  864  DC  C OP1   1 
ATOM   6632 O  OP2   . DC  F 3 9   ? 117.416 -6.247  130.325 1.00 46.22  ?  864  DC  C OP2   1 
ATOM   6633 O  "O5'" . DC  F 3 9   ? 117.048 -6.741  132.722 1.00 43.33  ?  864  DC  C "O5'" 1 
ATOM   6634 C  "C5'" . DC  F 3 9   ? 116.997 -7.600  133.835 1.00 39.35  ?  864  DC  C "C5'" 1 
ATOM   6635 C  "C4'" . DC  F 3 9   ? 116.992 -6.795  135.113 1.00 36.28  ?  864  DC  C "C4'" 1 
ATOM   6636 O  "O4'" . DC  F 3 9   ? 118.283 -6.154  135.295 1.00 33.24  ?  864  DC  C "O4'" 1 
ATOM   6637 C  "C3'" . DC  F 3 9   ? 115.949 -5.687  135.165 1.00 29.41  ?  864  DC  C "C3'" 1 
ATOM   6638 O  "O3'" . DC  F 3 9   ? 115.220 -5.816  136.393 1.00 37.49  ?  864  DC  C "O3'" 1 
ATOM   6639 C  "C2'" . DC  F 3 9   ? 116.797 -4.390  135.090 1.00 34.05  ?  864  DC  C "C2'" 1 
ATOM   6640 C  "C1'" . DC  F 3 9   ? 118.105 -4.834  135.738 1.00 31.88  ?  864  DC  C "C1'" 1 
ATOM   6641 N  N1    . DC  F 3 9   ? 119.321 -4.054  135.305 1.00 29.71  ?  864  DC  C N1    1 
ATOM   6642 C  C2    . DC  F 3 9   ? 120.151 -3.441  136.260 1.00 28.70  ?  864  DC  C C2    1 
ATOM   6643 O  O2    . DC  F 3 9   ? 119.865 -3.530  137.460 1.00 32.30  ?  864  DC  C O2    1 
ATOM   6644 N  N3    . DC  F 3 9   ? 121.260 -2.778  135.834 1.00 29.22  ?  864  DC  C N3    1 
ATOM   6645 C  C4    . DC  F 3 9   ? 121.533 -2.704  134.533 1.00 32.22  ?  864  DC  C C4    1 
ATOM   6646 N  N4    . DC  F 3 9   ? 122.620 -2.026  134.157 1.00 30.52  ?  864  DC  C N4    1 
ATOM   6647 C  C5    . DC  F 3 9   ? 120.698 -3.316  133.553 1.00 28.82  ?  864  DC  C C5    1 
ATOM   6648 C  C6    . DC  F 3 9   ? 119.620 -3.969  133.980 1.00 30.38  ?  864  DC  C C6    1 
ATOM   6649 P  P     . DC  F 3 10  ? 113.846 -5.016  136.655 1.00 42.86  ?  865  DC  C P     1 
ATOM   6650 O  OP1   . DC  F 3 10  ? 112.867 -5.993  137.178 1.00 50.52  ?  865  DC  C OP1   1 
ATOM   6651 O  OP2   . DC  F 3 10  ? 113.556 -4.112  135.504 1.00 39.92  ?  865  DC  C OP2   1 
ATOM   6652 O  "O5'" . DC  F 3 10  ? 114.219 -4.070  137.872 1.00 46.78  ?  865  DC  C "O5'" 1 
ATOM   6653 C  "C5'" . DC  F 3 10  ? 115.483 -3.571  137.904 1.00 41.88  ?  865  DC  C "C5'" 1 
ATOM   6654 C  "C4'" . DC  F 3 10  ? 115.799 -2.896  139.189 1.00 39.94  ?  865  DC  C "C4'" 1 
ATOM   6655 O  "O4'" . DC  F 3 10  ? 117.129 -2.362  139.048 1.00 32.31  ?  865  DC  C "O4'" 1 
ATOM   6656 C  "C3'" . DC  F 3 10  ? 114.917 -1.697  139.470 1.00 32.37  ?  865  DC  C "C3'" 1 
ATOM   6657 O  "O3'" . DC  F 3 10  ? 114.941 -1.384  140.876 1.00 37.85  ?  865  DC  C "O3'" 1 
ATOM   6658 C  "C2'" . DC  F 3 10  ? 115.584 -0.620  138.619 1.00 31.31  ?  865  DC  C "C2'" 1 
ATOM   6659 C  "C1'" . DC  F 3 10  ? 117.058 -0.958  138.822 1.00 29.95  ?  865  DC  C "C1'" 1 
ATOM   6660 N  N1    . DC  F 3 10  ? 117.954 -0.607  137.669 1.00 26.51  ?  865  DC  C N1    1 
ATOM   6661 C  C2    . DC  F 3 10  ? 119.132 0.087   137.931 1.00 29.22  ?  865  DC  C C2    1 
ATOM   6662 O  O2    . DC  F 3 10  ? 119.389 0.396   139.106 1.00 35.19  ?  865  DC  C O2    1 
ATOM   6663 N  N3    . DC  F 3 10  ? 119.959 0.394   136.903 1.00 30.48  ?  865  DC  C N3    1 
ATOM   6664 C  C4    . DC  F 3 10  ? 119.644 0.028   135.660 1.00 35.19  ?  865  DC  C C4    1 
ATOM   6665 N  N4    . DC  F 3 10  ? 120.492 0.360   134.682 1.00 36.27  ?  865  DC  C N4    1 
ATOM   6666 C  C5    . DC  F 3 10  ? 118.442 -0.694  135.367 1.00 28.74  ?  865  DC  C C5    1 
ATOM   6667 C  C6    . DC  F 3 10  ? 117.635 -0.988  136.394 1.00 27.80  ?  865  DC  C C6    1 
ATOM   6668 P  P     . DT  F 3 11  ? 113.834 -0.392  141.496 1.00 36.02  ?  866  DT  C P     1 
ATOM   6669 O  OP1   . DT  F 3 11  ? 113.711 -0.675  142.951 1.00 35.30  ?  866  DT  C OP1   1 
ATOM   6670 O  OP2   . DT  F 3 11  ? 112.640 -0.425  140.613 1.00 30.89  ?  866  DT  C OP2   1 
ATOM   6671 O  "O5'" . DT  F 3 11  ? 114.500 1.058   141.346 1.00 32.77  ?  866  DT  C "O5'" 1 
ATOM   6672 C  "C5'" . DT  F 3 11  ? 115.662 1.352   142.112 1.00 27.79  ?  866  DT  C "C5'" 1 
ATOM   6673 C  "C4'" . DT  F 3 11  ? 116.432 2.509   141.519 1.00 24.89  ?  866  DT  C "C4'" 1 
ATOM   6674 O  "O4'" . DT  F 3 11  ? 116.964 2.170   140.220 1.00 30.33  ?  866  DT  C "O4'" 1 
ATOM   6675 C  "C3'" . DT  F 3 11  ? 115.606 3.769   141.276 1.00 28.12  ?  866  DT  C "C3'" 1 
ATOM   6676 O  "O3'" . DT  F 3 11  ? 115.714 4.611   142.401 1.00 31.28  ?  866  DT  C "O3'" 1 
ATOM   6677 C  "C2'" . DT  F 3 11  ? 116.254 4.396   140.016 1.00 26.76  ?  866  DT  C "C2'" 1 
ATOM   6678 C  "C1'" . DT  F 3 11  ? 117.353 3.392   139.645 1.00 31.29  ?  866  DT  C "C1'" 1 
ATOM   6679 N  N1    . DT  F 3 11  ? 117.562 3.227   138.179 1.00 32.54  ?  866  DT  C N1    1 
ATOM   6680 C  C2    . DT  F 3 11  ? 118.757 3.639   137.636 1.00 32.27  ?  866  DT  C C2    1 
ATOM   6681 O  O2    . DT  F 3 11  ? 119.661 4.114   138.302 1.00 31.74  ?  866  DT  C O2    1 
ATOM   6682 N  N3    . DT  F 3 11  ? 118.866 3.459   136.284 1.00 32.86  ?  866  DT  C N3    1 
ATOM   6683 C  C4    . DT  F 3 11  ? 117.920 2.924   135.437 1.00 26.01  ?  866  DT  C C4    1 
ATOM   6684 O  O4    . DT  F 3 11  ? 118.121 2.791   134.232 1.00 32.75  ?  866  DT  C O4    1 
ATOM   6685 C  C5    . DT  F 3 11  ? 116.683 2.524   136.060 1.00 27.65  ?  866  DT  C C5    1 
ATOM   6686 C  C7    . DT  F 3 11  ? 115.586 1.935   135.225 1.00 33.44  ?  866  DT  C C7    1 
ATOM   6687 C  C6    . DT  F 3 11  ? 116.560 2.686   137.392 1.00 23.93  ?  866  DT  C C6    1 
ATOM   6688 P  P     . DA  F 3 12  ? 115.065 6.084   142.394 1.00 27.64  ?  867  DA  C P     1 
ATOM   6689 O  OP1   . DA  F 3 12  ? 114.829 6.389   143.833 1.00 24.42  ?  867  DA  C OP1   1 
ATOM   6690 O  OP2   . DA  F 3 12  ? 113.937 6.110   141.439 1.00 23.73  ?  867  DA  C OP2   1 
ATOM   6691 O  "O5'" . DA  F 3 12  ? 116.249 7.000   141.864 1.00 28.69  ?  867  DA  C "O5'" 1 
ATOM   6692 C  "C5'" . DA  F 3 12  ? 117.495 6.985   142.544 1.00 28.51  ?  867  DA  C "C5'" 1 
ATOM   6693 C  "C4'" . DA  F 3 12  ? 118.413 8.016   141.946 1.00 27.28  ?  867  DA  C "C4'" 1 
ATOM   6694 O  "O4'" . DA  F 3 12  ? 118.824 7.587   140.620 1.00 29.65  ?  867  DA  C "O4'" 1 
ATOM   6695 C  "C3'" . DA  F 3 12  ? 117.767 9.385   141.778 1.00 25.62  ?  867  DA  C "C3'" 1 
ATOM   6696 O  "O3'" . DA  F 3 12  ? 118.656 10.368  142.224 1.00 31.69  ?  867  DA  C "O3'" 1 
ATOM   6697 C  "C2'" . DA  F 3 12  ? 117.494 9.485   140.267 1.00 25.82  ?  867  DA  C "C2'" 1 
ATOM   6698 C  "C1'" . DA  F 3 12  ? 118.593 8.616   139.675 1.00 28.60  ?  867  DA  C "C1'" 1 
ATOM   6699 N  N9    . DA  F 3 12  ? 118.213 7.986   138.409 1.00 28.62  ?  867  DA  C N9    1 
ATOM   6700 C  C8    . DA  F 3 12  ? 117.020 7.374   138.119 1.00 26.03  ?  867  DA  C C8    1 
ATOM   6701 N  N7    . DA  F 3 12  ? 116.957 6.889   136.899 1.00 27.48  ?  867  DA  C N7    1 
ATOM   6702 C  C5    . DA  F 3 12  ? 118.198 7.189   136.355 1.00 28.41  ?  867  DA  C C5    1 
ATOM   6703 C  C6    . DA  F 3 12  ? 118.768 6.935   135.092 1.00 32.45  ?  867  DA  C C6    1 
ATOM   6704 N  N6    . DA  F 3 12  ? 118.132 6.279   134.109 1.00 29.38  ?  867  DA  C N6    1 
ATOM   6705 N  N1    . DA  F 3 12  ? 120.031 7.370   134.878 1.00 30.83  ?  867  DA  C N1    1 
ATOM   6706 C  C2    . DA  F 3 12  ? 120.671 8.015   135.858 1.00 29.89  ?  867  DA  C C2    1 
ATOM   6707 N  N3    . DA  F 3 12  ? 120.242 8.307   137.089 1.00 28.95  ?  867  DA  C N3    1 
ATOM   6708 C  C4    . DA  F 3 12  ? 118.985 7.865   137.273 1.00 28.99  ?  867  DA  C C4    1 
ATOM   6709 P  P     . DG  F 3 13  ? 118.256 11.914  142.164 1.00 32.70  ?  868  DG  C P     1 
ATOM   6710 O  OP1   . DG  F 3 13  ? 118.927 12.543  143.331 1.00 32.97  ?  868  DG  C OP1   1 
ATOM   6711 O  OP2   . DG  F 3 13  ? 116.797 12.055  141.972 1.00 33.99  ?  868  DG  C OP2   1 
ATOM   6712 O  "O5'" . DG  F 3 13  ? 118.941 12.399  140.818 1.00 32.75  ?  868  DG  C "O5'" 1 
ATOM   6713 C  "C5'" . DG  F 3 13  ? 120.338 12.283  140.675 1.00 33.46  ?  868  DG  C "C5'" 1 
ATOM   6714 C  "C4'" . DG  F 3 13  ? 120.738 12.727  139.293 1.00 26.44  ?  868  DG  C "C4'" 1 
ATOM   6715 O  "O4'" . DG  F 3 13  ? 120.249 11.769  138.330 1.00 29.86  ?  868  DG  C "O4'" 1 
ATOM   6716 C  "C3'" . DG  F 3 13  ? 120.151 14.081  138.887 1.00 33.05  ?  868  DG  C "C3'" 1 
ATOM   6717 O  "O3'" . DG  F 3 13  ? 121.211 14.989  138.646 1.00 40.30  ?  868  DG  C "O3'" 1 
ATOM   6718 C  "C2'" . DG  F 3 13  ? 119.333 13.795  137.619 1.00 29.73  ?  868  DG  C "C2'" 1 
ATOM   6719 C  "C1'" . DG  F 3 13  ? 119.906 12.465  137.155 1.00 30.73  ?  868  DG  C "C1'" 1 
ATOM   6720 N  N9    . DG  F 3 13  ? 118.973 11.656  136.380 1.00 26.14  ?  868  DG  C N9    1 
ATOM   6721 C  C8    . DG  F 3 13  ? 117.707 11.246  136.744 1.00 25.81  ?  868  DG  C C8    1 
ATOM   6722 N  N7    . DG  F 3 13  ? 117.118 10.516  135.823 1.00 26.85  ?  868  DG  C N7    1 
ATOM   6723 C  C5    . DG  F 3 13  ? 118.065 10.415  134.806 1.00 23.44  ?  868  DG  C C5    1 
ATOM   6724 C  C6    . DG  F 3 13  ? 118.006 9.748   133.542 1.00 27.94  ?  868  DG  C C6    1 
ATOM   6725 O  O6    . DG  F 3 13  ? 117.080 9.089   133.056 1.00 31.68  ?  868  DG  C O6    1 
ATOM   6726 N  N1    . DG  F 3 13  ? 119.184 9.912   132.821 1.00 29.42  ?  868  DG  C N1    1 
ATOM   6727 C  C2    . DG  F 3 13  ? 120.278 10.627  133.253 1.00 30.50  ?  868  DG  C C2    1 
ATOM   6728 N  N2    . DG  F 3 13  ? 121.325 10.684  132.411 1.00 32.06  ?  868  DG  C N2    1 
ATOM   6729 N  N3    . DG  F 3 13  ? 120.347 11.244  134.419 1.00 29.08  ?  868  DG  C N3    1 
ATOM   6730 C  C4    . DG  F 3 13  ? 119.206 11.109  135.136 1.00 28.14  ?  868  DG  C C4    1 
ATOM   6731 P  P     . DG  F 3 14  ? 120.922 16.509  138.242 1.00 44.11  ?  869  DG  C P     1 
ATOM   6732 O  OP1   . DG  F 3 14  ? 122.065 17.278  138.774 1.00 42.85  ?  869  DG  C OP1   1 
ATOM   6733 O  OP2   . DG  F 3 14  ? 119.524 16.887  138.563 1.00 55.41  ?  869  DG  C OP2   1 
ATOM   6734 O  "O5'" . DG  F 3 14  ? 121.048 16.485  136.672 1.00 35.37  ?  869  DG  C "O5'" 1 
ATOM   6735 C  "C5'" . DG  F 3 14  ? 122.208 15.948  136.097 1.00 40.87  ?  869  DG  C "C5'" 1 
ATOM   6736 C  "C4'" . DG  F 3 14  ? 122.048 15.894  134.611 1.00 48.37  ?  869  DG  C "C4'" 1 
ATOM   6737 O  "O4'" . DG  F 3 14  ? 121.117 14.836  134.280 1.00 47.11  ?  869  DG  C "O4'" 1 
ATOM   6738 C  "C3'" . DG  F 3 14  ? 121.466 17.173  134.003 1.00 49.59  ?  869  DG  C "C3'" 1 
ATOM   6739 O  "O3'" . DG  F 3 14  ? 122.203 17.521  132.877 1.00 52.46  ?  869  DG  C "O3'" 1 
ATOM   6740 C  "C2'" . DG  F 3 14  ? 120.044 16.764  133.625 1.00 52.98  ?  869  DG  C "C2'" 1 
ATOM   6741 C  "C1'" . DG  F 3 14  ? 120.267 15.306  133.281 1.00 47.97  ?  869  DG  C "C1'" 1 
ATOM   6742 N  N9    . DG  F 3 14  ? 119.045 14.516  133.259 1.00 34.85  ?  869  DG  C N9    1 
ATOM   6743 C  C8    . DG  F 3 14  ? 118.037 14.498  134.194 1.00 38.45  ?  869  DG  C C8    1 
ATOM   6744 N  N7    . DG  F 3 14  ? 117.048 13.707  133.871 1.00 34.05  ?  869  DG  C N7    1 
ATOM   6745 C  C5    . DG  F 3 14  ? 117.434 13.182  132.642 1.00 36.16  ?  869  DG  C C5    1 
ATOM   6746 C  C6    . DG  F 3 14  ? 116.773 12.264  131.798 1.00 31.11  ?  869  DG  C C6    1 
ATOM   6747 O  O6    . DG  F 3 14  ? 115.677 11.724  131.976 1.00 31.95  ?  869  DG  C O6    1 
ATOM   6748 N  N1    . DG  F 3 14  ? 117.507 12.003  130.642 1.00 27.50  ?  869  DG  C N1    1 
ATOM   6749 C  C2    . DG  F 3 14  ? 118.730 12.556  130.354 1.00 26.97  ?  869  DG  C C2    1 
ATOM   6750 N  N2    . DG  F 3 14  ? 119.293 12.201  129.195 1.00 27.45  ?  869  DG  C N2    1 
ATOM   6751 N  N3    . DG  F 3 14  ? 119.360 13.409  131.146 1.00 30.14  ?  869  DG  C N3    1 
ATOM   6752 C  C4    . DG  F 3 14  ? 118.653 13.676  132.259 1.00 29.91  ?  869  DG  C C4    1 
ATOM   6753 P  P     . DA  F 3 15  ? 122.261 19.042  132.365 1.00 47.38  ?  870  DA  C P     1 
ATOM   6754 O  OP1   . DA  F 3 15  ? 123.526 19.618  132.862 1.00 50.69  ?  870  DA  C OP1   1 
ATOM   6755 O  OP2   . DA  F 3 15  ? 120.962 19.714  132.598 1.00 45.16  ?  870  DA  C OP2   1 
ATOM   6756 O  "O5'" . DA  F 3 15  ? 122.420 18.866  130.797 1.00 43.28  ?  870  DA  C "O5'" 1 
ATOM   6757 C  "C5'" . DA  F 3 15  ? 123.133 17.762  130.291 1.00 36.01  ?  870  DA  C "C5'" 1 
ATOM   6758 C  "C4'" . DA  F 3 15  ? 122.697 17.484  128.871 1.00 31.38  ?  870  DA  C "C4'" 1 
ATOM   6759 O  "O4'" . DA  F 3 15  ? 121.608 16.532  128.883 1.00 28.91  ?  870  DA  C "O4'" 1 
ATOM   6760 C  "C3'" . DA  F 3 15  ? 122.197 18.708  128.126 1.00 30.75  ?  870  DA  C "C3'" 1 
ATOM   6761 O  "O3'" . DA  F 3 15  ? 122.713 18.691  126.813 1.00 31.02  ?  870  DA  C "O3'" 1 
ATOM   6762 C  "C2'" . DA  F 3 15  ? 120.670 18.555  128.145 1.00 28.28  ?  870  DA  C "C2'" 1 
ATOM   6763 C  "C1'" . DA  F 3 15  ? 120.490 17.047  128.193 1.00 27.20  ?  870  DA  C "C1'" 1 
ATOM   6764 N  N9    . DA  F 3 15  ? 119.289 16.634  128.927 1.00 25.84  ?  870  DA  C N9    1 
ATOM   6765 C  C8    . DA  F 3 15  ? 118.895 17.052  130.175 1.00 26.55  ?  870  DA  C C8    1 
ATOM   6766 N  N7    . DA  F 3 15  ? 117.774 16.496  130.587 1.00 22.92  ?  870  DA  C N7    1 
ATOM   6767 C  C5    . DA  F 3 15  ? 117.416 15.666  129.537 1.00 22.68  ?  870  DA  C C5    1 
ATOM   6768 C  C6    . DA  F 3 15  ? 116.323 14.802  129.347 1.00 24.51  ?  870  DA  C C6    1 
ATOM   6769 N  N6    . DA  F 3 15  ? 115.350 14.641  130.254 1.00 25.43  ?  870  DA  C N6    1 
ATOM   6770 N  N1    . DA  F 3 15  ? 116.254 14.132  128.180 1.00 25.63  ?  870  DA  C N1    1 
ATOM   6771 C  C2    . DA  F 3 15  ? 117.225 14.300  127.276 1.00 26.98  ?  870  DA  C C2    1 
ATOM   6772 N  N3    . DA  F 3 15  ? 118.309 15.068  127.353 1.00 26.87  ?  870  DA  C N3    1 
ATOM   6773 C  C4    . DA  F 3 15  ? 118.338 15.738  128.514 1.00 23.08  ?  870  DA  C C4    1 
ATOM   6774 P  P     . DC  F 3 16  ? 122.412 19.897  125.808 1.00 29.67  ?  871  DC  C P     1 
ATOM   6775 O  OP1   . DC  F 3 16  ? 123.397 19.738  124.722 1.00 27.44  ?  871  DC  C OP1   1 
ATOM   6776 O  OP2   . DC  F 3 16  ? 122.277 21.198  126.516 1.00 33.74  ?  871  DC  C OP2   1 
ATOM   6777 O  "O5'" . DC  F 3 16  ? 120.983 19.528  125.204 1.00 28.63  ?  871  DC  C "O5'" 1 
ATOM   6778 C  "C5'" . DC  F 3 16  ? 120.849 18.340  124.476 1.00 31.06  ?  871  DC  C "C5'" 1 
ATOM   6779 C  "C4'" . DC  F 3 16  ? 119.398 18.081  124.153 1.00 24.54  ?  871  DC  C "C4'" 1 
ATOM   6780 O  "O4'" . DC  F 3 16  ? 118.706 17.734  125.338 1.00 23.92  ?  871  DC  C "O4'" 1 
ATOM   6781 C  "C3'" . DC  F 3 16  ? 118.639 19.278  123.600 1.00 24.45  ?  871  DC  C "C3'" 1 
ATOM   6782 O  "O3'" . DC  F 3 16  ? 118.678 19.216  122.185 1.00 25.14  ?  871  DC  C "O3'" 1 
ATOM   6783 C  "C2'" . DC  F 3 16  ? 117.211 19.101  124.164 1.00 23.66  ?  871  DC  C "C2'" 1 
ATOM   6784 C  "C1'" . DC  F 3 16  ? 117.339 17.851  125.047 1.00 26.58  ?  871  DC  C "C1'" 1 
ATOM   6785 N  N1    . DC  F 3 16  ? 116.603 17.909  126.333 1.00 27.99  ?  871  DC  C N1    1 
ATOM   6786 C  C2    . DC  F 3 16  ? 115.482 17.095  126.509 1.00 24.61  ?  871  DC  C C2    1 
ATOM   6787 O  O2    . DC  F 3 16  ? 115.118 16.379  125.576 1.00 24.78  ?  871  DC  C O2    1 
ATOM   6788 N  N3    . DC  F 3 16  ? 114.817 17.141  127.680 1.00 25.90  ?  871  DC  C N3    1 
ATOM   6789 C  C4    . DC  F 3 16  ? 115.244 17.937  128.662 1.00 22.73  ?  871  DC  C C4    1 
ATOM   6790 N  N4    . DC  F 3 16  ? 114.568 17.923  129.822 1.00 23.22  ?  871  DC  C N4    1 
ATOM   6791 C  C5    . DC  F 3 16  ? 116.396 18.774  128.506 1.00 24.16  ?  871  DC  C C5    1 
ATOM   6792 C  C6    . DC  F 3 16  ? 117.041 18.725  127.339 1.00 23.75  ?  871  DC  C C6    1 
ATOM   6793 P  P     . DC  F 3 17  ? 118.010 20.358  121.296 1.00 27.71  ?  872  DC  C P     1 
ATOM   6794 O  OP1   . DC  F 3 17  ? 118.568 20.246  119.937 1.00 25.76  ?  872  DC  C OP1   1 
ATOM   6795 O  OP2   . DC  F 3 17  ? 118.063 21.644  122.067 1.00 28.12  ?  872  DC  C OP2   1 
ATOM   6796 O  "O5'" . DC  F 3 17  ? 116.483 19.931  121.230 1.00 27.09  ?  872  DC  C "O5'" 1 
ATOM   6797 C  "C5'" . DC  F 3 17  ? 116.113 18.757  120.506 1.00 29.53  ?  872  DC  C "C5'" 1 
ATOM   6798 C  "C4'" . DC  F 3 17  ? 114.645 18.460  120.714 1.00 26.76  ?  872  DC  C "C4'" 1 
ATOM   6799 O  "O4'" . DC  F 3 17  ? 114.430 18.038  122.076 1.00 28.27  ?  872  DC  C "O4'" 1 
ATOM   6800 C  "C3'" . DC  F 3 17  ? 113.716 19.658  120.578 1.00 23.76  ?  872  DC  C "C3'" 1 
ATOM   6801 O  "O3'" . DC  F 3 17  ? 113.415 19.913  119.227 1.00 31.37  ?  872  DC  C "O3'" 1 
ATOM   6802 C  "C2'" . DC  F 3 17  ? 112.480 19.175  121.326 1.00 26.34  ?  872  DC  C "C2'" 1 
ATOM   6803 C  "C1'" . DC  F 3 17  ? 113.067 18.241  122.382 1.00 27.76  ?  872  DC  C "C1'" 1 
ATOM   6804 N  N1    . DC  F 3 17  ? 112.958 18.762  123.747 1.00 26.03  ?  872  DC  C N1    1 
ATOM   6805 C  C2    . DC  F 3 17  ? 111.843 18.419  124.490 1.00 27.13  ?  872  DC  C C2    1 
ATOM   6806 O  O2    . DC  F 3 17  ? 110.987 17.714  123.963 1.00 27.96  ?  872  DC  C O2    1 
ATOM   6807 N  N3    . DC  F 3 17  ? 111.738 18.859  125.764 1.00 29.45  ?  872  DC  C N3    1 
ATOM   6808 C  C4    . DC  F 3 17  ? 112.691 19.639  126.279 1.00 30.21  ?  872  DC  C C4    1 
ATOM   6809 N  N4    . DC  F 3 17  ? 112.543 20.049  127.537 1.00 26.59  ?  872  DC  C N4    1 
ATOM   6810 C  C5    . DC  F 3 17  ? 113.842 20.018  125.525 1.00 28.30  ?  872  DC  C C5    1 
ATOM   6811 C  C6    . DC  F 3 17  ? 113.929 19.562  124.267 1.00 30.43  ?  872  DC  C C6    1 
ATOM   6812 P  P     A DC  F 3 18  ? 112.704 21.265  118.905 0.80 30.88  ?  873  DC  C P     1 
ATOM   6813 P  P     B DC  F 3 18  ? 112.733 21.311  118.810 0.20 30.45  ?  873  DC  C P     1 
ATOM   6814 O  OP1   A DC  F 3 18  ? 112.689 21.479  117.411 0.80 31.81  ?  873  DC  C OP1   1 
ATOM   6815 O  OP1   B DC  F 3 18  ? 112.674 21.372  117.336 0.20 31.63  ?  873  DC  C OP1   1 
ATOM   6816 O  OP2   A DC  F 3 18  ? 113.348 22.456  119.603 0.80 32.59  -1 873  DC  C OP2   1 
ATOM   6817 O  OP2   B DC  F 3 18  ? 113.422 22.383  119.566 0.20 32.68  ?  873  DC  C OP2   1 
ATOM   6818 O  "O5'" A DC  F 3 18  ? 111.130 21.118  119.417 0.80 29.53  ?  873  DC  C "O5'" 1 
ATOM   6819 O  "O5'" B DC  F 3 18  ? 111.236 21.208  119.380 0.20 29.00  ?  873  DC  C "O5'" 1 
ATOM   6820 C  "C5'" A DC  F 3 18  ? 110.321 20.107  118.849 0.80 25.85  ?  873  DC  C "C5'" 1 
ATOM   6821 C  "C5'" B DC  F 3 18  ? 110.345 20.205  118.891 0.20 27.96  ?  873  DC  C "C5'" 1 
ATOM   6822 C  "C4'" A DC  F 3 18  ? 108.959 20.171  119.569 0.80 28.69  ?  873  DC  C "C4'" 1 
ATOM   6823 C  "C4'" B DC  F 3 18  ? 108.998 20.288  119.589 0.20 27.64  ?  873  DC  C "C4'" 1 
ATOM   6824 O  "O4'" A DC  F 3 18  ? 109.103 19.770  120.793 0.80 26.05  ?  873  DC  C "O4'" 1 
ATOM   6825 O  "O4'" B DC  F 3 18  ? 109.104 19.784  120.948 0.20 25.66  ?  873  DC  C "O4'" 1 
ATOM   6826 C  "C3'" A DC  F 3 18  ? 108.474 21.733  119.644 0.80 28.19  ?  873  DC  C "C3'" 1 
ATOM   6827 C  "C3'" B DC  F 3 18  ? 108.456 21.691  119.755 0.20 27.50  ?  873  DC  C "C3'" 1 
ATOM   6828 O  "O3'" A DC  F 3 18  ? 108.181 22.516  118.355 0.80 35.79  ?  873  DC  C "O3'" 1 
ATOM   6829 O  "O3'" B DC  F 3 18  ? 107.828 22.129  118.544 0.20 21.59  ?  873  DC  C "O3'" 1 
ATOM   6830 C  "C2'" A DC  F 3 18  ? 107.693 21.785  120.677 0.80 25.01  ?  873  DC  C "C2'" 1 
ATOM   6831 C  "C2'" B DC  F 3 18  ? 107.455 21.501  120.893 0.20 24.64  ?  873  DC  C "C2'" 1 
ATOM   6832 C  "C1'" A DC  F 3 18  ? 108.185 20.693  121.646 0.80 27.23  ?  873  DC  C "C1'" 1 
ATOM   6833 C  "C1'" B DC  F 3 18  ? 108.165 20.464  121.775 0.20 24.84  ?  873  DC  C "C1'" 1 
ATOM   6834 N  N1    A DC  F 3 18  ? 108.842 21.150  122.769 0.80 23.48  ?  873  DC  C N1    1 
ATOM   6835 N  N1    B DC  F 3 18  ? 108.892 21.063  122.950 0.20 23.96  ?  873  DC  C N1    1 
ATOM   6836 C  C2    A DC  F 3 18  ? 108.254 21.165  123.965 0.80 25.85  ?  873  DC  C C2    1 
ATOM   6837 C  C2    B DC  F 3 18  ? 108.240 21.181  124.186 0.20 25.58  ?  873  DC  C C2    1 
ATOM   6838 O  O2    A DC  F 3 18  ? 107.123 20.797  124.084 0.80 27.33  ?  873  DC  C O2    1 
ATOM   6839 O  O2    B DC  F 3 18  ? 107.070 20.788  124.291 0.20 25.39  ?  873  DC  C O2    1 
ATOM   6840 N  N3    A DC  F 3 18  ? 108.918 21.597  125.043 0.80 26.49  ?  873  DC  C N3    1 
ATOM   6841 N  N3    B DC  F 3 18  ? 108.913 21.723  125.235 0.20 24.43  ?  873  DC  C N3    1 
ATOM   6842 C  C4    A DC  F 3 18  ? 110.178 22.025  124.974 0.80 24.11  ?  873  DC  C C4    1 
ATOM   6843 C  C4    B DC  F 3 18  ? 110.173 22.135  125.080 0.20 23.90  ?  873  DC  C C4    1 
ATOM   6844 N  N4    A DC  F 3 18  ? 110.893 22.480  126.157 0.80 24.23  ?  873  DC  C N4    1 
ATOM   6845 N  N4    B DC  F 3 18  ? 110.796 22.659  126.140 0.20 26.32  ?  873  DC  C N4    1 
ATOM   6846 C  C5    A DC  F 3 18  ? 110.824 22.008  123.740 0.80 21.57  ?  873  DC  C C5    1 
ATOM   6847 C  C5    B DC  F 3 18  ? 110.852 22.024  123.831 0.20 23.77  ?  873  DC  C C5    1 
ATOM   6848 C  C6    A DC  F 3 18  ? 110.103 21.554  122.634 0.80 24.50  ?  873  DC  C C6    1 
ATOM   6849 C  C6    B DC  F 3 18  ? 110.181 21.489  122.805 0.20 23.55  ?  873  DC  C C6    1 
ATOM   6850 P  P     B DT  F 3 19  ? 107.856 23.698  118.150 0.20 22.75  ?  874  DT  C P     1 
ATOM   6851 O  OP1   B DT  F 3 19  ? 107.460 23.841  116.735 0.20 23.72  ?  874  DT  C OP1   1 
ATOM   6852 O  OP2   B DT  F 3 19  ? 109.165 24.255  118.553 0.20 22.02  ?  874  DT  C OP2   1 
ATOM   6853 O  "O5'" B DT  F 3 19  ? 106.705 24.318  119.077 0.20 26.27  ?  874  DT  C "O5'" 1 
ATOM   6854 C  "C5'" B DT  F 3 19  ? 105.351 23.884  118.910 0.20 26.72  ?  874  DT  C "C5'" 1 
ATOM   6855 C  "C4'" B DT  F 3 19  ? 104.477 24.305  120.084 0.20 22.92  ?  874  DT  C "C4'" 1 
ATOM   6856 O  "O4'" B DT  F 3 19  ? 104.936 23.661  121.300 0.20 21.96  ?  874  DT  C "O4'" 1 
ATOM   6857 C  "C3'" B DT  F 3 19  ? 104.488 25.785  120.403 0.20 25.10  ?  874  DT  C "C3'" 1 
ATOM   6858 O  "O3'" B DT  F 3 19  ? 103.553 26.474  119.569 0.20 23.77  ?  874  DT  C "O3'" 1 
ATOM   6859 C  "C2'" B DT  F 3 19  ? 104.052 25.794  121.869 0.20 23.08  ?  874  DT  C "C2'" 1 
ATOM   6860 C  "C1'" B DT  F 3 19  ? 104.679 24.498  122.411 0.20 23.25  ?  874  DT  C "C1'" 1 
ATOM   6861 N  N1    B DT  F 3 19  ? 105.966 24.713  123.146 0.20 23.84  ?  874  DT  C N1    1 
ATOM   6862 C  C2    B DT  F 3 19  ? 105.959 24.762  124.520 0.20 25.93  ?  874  DT  C C2    1 
ATOM   6863 O  O2    B DT  F 3 19  ? 104.947 24.635  125.188 0.20 26.55  ?  874  DT  C O2    1 
ATOM   6864 N  N3    B DT  F 3 19  ? 107.189 24.965  125.092 0.20 25.44  ?  874  DT  C N3    1 
ATOM   6865 C  C4    B DT  F 3 19  ? 108.399 25.122  124.438 0.20 25.15  ?  874  DT  C C4    1 
ATOM   6866 O  O4    B DT  F 3 19  ? 109.455 25.300  125.041 0.20 23.10  ?  874  DT  C O4    1 
ATOM   6867 C  C5    B DT  F 3 19  ? 108.333 25.057  122.998 0.20 21.05  ?  874  DT  C C5    1 
ATOM   6868 C  C7    B DT  F 3 19  ? 109.577 25.211  122.177 0.20 23.53  ?  874  DT  C C7    1 
ATOM   6869 C  C6    B DT  F 3 19  ? 107.135 24.858  122.430 0.20 25.98  ?  874  DT  C C6    1 
HETATM 6870 MG MG    . MG  G 4 .   ? 79.724  19.238  176.841 1.00 17.23  ?  901  MG  F MG    1 
HETATM 6871 MG MG    . MG  H 4 .   ? 80.542  16.233  175.543 1.00 32.91  ?  902  MG  F MG    1 
HETATM 6872 P  P1    B DPO I 5 .   ? 79.408  22.630  175.439 0.50 30.59  ?  903  DPO F P1    1 
HETATM 6873 O  O1    B DPO I 5 .   ? 79.408  23.267  174.069 0.50 32.10  ?  903  DPO F O1    1 
HETATM 6874 O  O2    B DPO I 5 .   ? 78.351  23.244  176.312 0.50 29.68  ?  903  DPO F O2    1 
HETATM 6875 O  O3    B DPO I 5 .   ? 79.136  21.141  175.322 0.50 34.68  ?  903  DPO F O3    1 
HETATM 6876 O  O4    B DPO I 5 .   ? 80.886  22.939  176.108 0.50 33.52  ?  903  DPO F O4    1 
HETATM 6877 P  P2    B DPO I 5 .   ? 81.998  21.795  176.537 0.50 19.32  ?  903  DPO F P2    1 
HETATM 6878 O  O5    B DPO I 5 .   ? 82.444  21.130  175.252 0.50 22.60  ?  903  DPO F O5    1 
HETATM 6879 O  O6    B DPO I 5 .   ? 83.127  22.504  177.219 0.50 16.56  ?  903  DPO F O6    1 
HETATM 6880 O  O7    B DPO I 5 .   ? 81.341  20.837  177.488 0.50 24.02  ?  903  DPO F O7    1 
HETATM 6881 MG MG    . MG  J 4 .   ? 106.317 24.842  115.056 1.00 21.95  ?  901  MG  A MG    1 
HETATM 6882 MG MG    . MG  K 4 .   ? 107.563 21.727  116.003 1.00 55.97  ?  902  MG  A MG    1 
HETATM 6883 P  P1    B DPO L 5 .   ? 107.867 28.215  115.194 0.20 33.48  ?  903  DPO A P1    1 
HETATM 6884 O  O1    B DPO L 5 .   ? 107.229 28.592  113.878 0.20 31.67  ?  903  DPO A O1    1 
HETATM 6885 O  O2    B DPO L 5 .   ? 109.189 28.930  115.347 0.20 36.34  ?  903  DPO A O2    1 
HETATM 6886 O  O3    B DPO L 5 .   ? 108.083 26.719  115.246 0.20 37.66  ?  903  DPO A O3    1 
HETATM 6887 O  O4    B DPO L 5 .   ? 106.872 28.668  116.422 0.20 33.35  ?  903  DPO A O4    1 
HETATM 6888 P  P2    B DPO L 5 .   ? 106.208 27.600  117.480 0.20 21.26  ?  903  DPO A P2    1 
HETATM 6889 O  O5    B DPO L 5 .   ? 105.403 26.587  116.705 0.20 28.46  ?  903  DPO A O5    1 
HETATM 6890 O  O6    B DPO L 5 .   ? 105.295 28.333  118.427 0.20 20.79  ?  903  DPO A O6    1 
HETATM 6891 O  O7    B DPO L 5 .   ? 107.316 26.911  118.247 0.20 30.51  ?  903  DPO A O7    1 
HETATM 6892 P  PA    A TTP M 6 .   ? 82.565  18.656  174.937 0.50 26.69  ?  901  TTP H PA    1 
HETATM 6893 O  O1A   A TTP M 6 .   ? 82.915  19.065  173.575 0.50 23.40  ?  901  TTP H O1A   1 
HETATM 6894 O  O2A   A TTP M 6 .   ? 81.129  18.264  175.670 0.50 27.88  -1 901  TTP H O2A   1 
HETATM 6895 O  O3A   A TTP M 6 .   ? 81.880  20.188  174.942 0.50 43.16  ?  901  TTP H O3A   1 
HETATM 6896 P  PB    A TTP M 6 .   ? 81.840  21.298  176.203 0.50 32.70  ?  901  TTP H PB    1 
HETATM 6897 O  O1B   A TTP M 6 .   ? 83.169  21.930  176.549 0.50 32.43  -1 901  TTP H O1B   1 
HETATM 6898 O  O2B   A TTP M 6 .   ? 81.223  20.726  177.456 0.50 25.73  ?  901  TTP H O2B   1 
HETATM 6899 O  O3B   A TTP M 6 .   ? 80.902  22.547  175.698 0.50 31.43  ?  901  TTP H O3B   1 
HETATM 6900 P  PG    A TTP M 6 .   ? 79.292  22.408  175.384 0.50 28.87  ?  901  TTP H PG    1 
HETATM 6901 O  O1G   A TTP M 6 .   ? 79.126  22.876  173.963 0.50 33.96  -1 901  TTP H O1G   1 
HETATM 6902 O  O2G   A TTP M 6 .   ? 78.806  20.973  175.515 0.50 24.90  ?  901  TTP H O2G   1 
HETATM 6903 O  O3G   A TTP M 6 .   ? 78.577  23.292  176.366 0.50 28.09  ?  901  TTP H O3G   1 
HETATM 6904 O  "O5'" A TTP M 6 .   ? 83.837  18.671  175.999 0.50 25.47  ?  901  TTP H "O5'" 1 
HETATM 6905 C  "C5'" A TTP M 6 .   ? 83.679  18.235  177.337 0.50 18.68  ?  901  TTP H "C5'" 1 
HETATM 6906 C  "C4'" A TTP M 6 .   ? 85.047  18.669  177.952 0.50 16.33  ?  901  TTP H "C4'" 1 
HETATM 6907 O  "O4'" A TTP M 6 .   ? 85.975  18.098  177.255 0.50 21.92  ?  901  TTP H "O4'" 1 
HETATM 6908 C  "C3'" A TTP M 6 .   ? 85.263  20.197  177.625 0.50 22.30  ?  901  TTP H "C3'" 1 
HETATM 6909 O  "O3'" A TTP M 6 .   ? 84.678  21.029  178.546 0.50 20.47  ?  901  TTP H "O3'" 1 
HETATM 6910 C  "C2'" A TTP M 6 .   ? 86.749  20.331  177.526 0.50 20.31  ?  901  TTP H "C2'" 1 
HETATM 6911 C  "C1'" A TTP M 6 .   ? 87.160  19.147  177.022 0.50 24.53  ?  901  TTP H "C1'" 1 
HETATM 6912 N  N1    A TTP M 6 .   ? 87.460  19.284  175.612 0.50 23.14  ?  901  TTP H N1    1 
HETATM 6913 C  C2    A TTP M 6 .   ? 88.731  19.337  175.244 0.50 18.30  ?  901  TTP H C2    1 
HETATM 6914 O  O2    A TTP M 6 .   ? 89.583  19.253  176.071 0.50 21.58  ?  901  TTP H O2    1 
HETATM 6915 N  N3    A TTP M 6 .   ? 89.057  19.474  173.972 0.50 17.34  ?  901  TTP H N3    1 
HETATM 6916 C  C4    A TTP M 6 .   ? 88.143  19.584  173.012 0.50 16.27  ?  901  TTP H C4    1 
HETATM 6917 O  O4    A TTP M 6 .   ? 88.465  19.720  171.873 0.50 21.23  ?  901  TTP H O4    1 
HETATM 6918 C  C5    A TTP M 6 .   ? 86.798  19.551  173.370 0.50 20.59  ?  901  TTP H C5    1 
HETATM 6919 C  C5M   A TTP M 6 .   ? 85.705  19.670  172.290 0.50 18.52  ?  901  TTP H C5M   1 
HETATM 6920 C  C6    A TTP M 6 .   ? 86.476  19.404  174.719 0.50 16.09  ?  901  TTP H C6    1 
HETATM 6921 P  PA    A TTP N 6 .   ? 107.581 24.136  118.283 0.80 33.48  ?  901  TTP C PA    1 
HETATM 6922 O  O1A   A TTP N 6 .   ? 107.128 23.836  116.720 0.80 30.13  -1 901  TTP C O1A   1 
HETATM 6923 O  O2A   A TTP N 6 .   ? 108.904 24.458  118.828 0.80 30.35  ?  901  TTP C O2A   1 
HETATM 6924 O  O3A   A TTP N 6 .   ? 107.620 25.798  117.789 0.80 44.39  ?  901  TTP C O3A   1 
HETATM 6925 P  PB    A TTP N 6 .   ? 106.398 26.963  117.395 0.80 33.63  ?  901  TTP C PB    1 
HETATM 6926 O  O1B   A TTP N 6 .   ? 105.415 26.387  116.403 0.80 31.04  ?  901  TTP C O1B   1 
HETATM 6927 O  O2B   A TTP N 6 .   ? 105.612 27.653  118.480 0.80 32.65  -1 901  TTP C O2B   1 
HETATM 6928 O  O3B   A TTP N 6 .   ? 107.111 28.220  116.641 0.80 29.97  ?  901  TTP C O3B   1 
HETATM 6929 P  PG    A TTP N 6 .   ? 107.893 28.046  115.209 0.80 34.62  ?  901  TTP C PG    1 
HETATM 6930 O  O1G   A TTP N 6 .   ? 107.082 28.685  114.100 0.80 29.17  ?  901  TTP C O1G   1 
HETATM 6931 O  O2G   A TTP N 6 .   ? 109.240 28.730  115.340 0.80 36.30  -1 901  TTP C O2G   1 
HETATM 6932 O  O3G   A TTP N 6 .   ? 108.050 26.560  114.920 0.80 38.96  ?  901  TTP C O3G   1 
HETATM 6933 O  "O5'" A TTP N 6 .   ? 106.340 24.121  119.368 0.80 28.83  ?  901  TTP C "O5'" 1 
HETATM 6934 C  "C5'" A TTP N 6 .   ? 105.032 23.854  118.907 0.80 28.68  ?  901  TTP C "C5'" 1 
HETATM 6935 C  "C4'" A TTP N 6 .   ? 104.202 24.138  120.186 0.80 23.91  ?  901  TTP C "C4'" 1 
HETATM 6936 O  "O4'" A TTP N 6 .   ? 104.775 23.541  121.197 0.80 26.20  ?  901  TTP C "O4'" 1 
HETATM 6937 C  "C3'" A TTP N 6 .   ? 104.384 25.648  120.526 0.80 26.03  ?  901  TTP C "C3'" 1 
HETATM 6938 O  "O3'" A TTP N 6 .   ? 103.599 26.459  119.733 0.80 28.23  ?  901  TTP C "O3'" 1 
HETATM 6939 C  "C2'" A TTP N 6 .   ? 104.137 25.675  122.008 0.80 23.12  ?  901  TTP C "C2'" 1 
HETATM 6940 C  "C1'" A TTP N 6 .   ? 104.627 24.487  122.465 0.80 23.37  ?  901  TTP C "C1'" 1 
HETATM 6941 N  N1    A TTP N 6 .   ? 105.938 24.662  123.069 0.80 24.13  ?  901  TTP C N1    1 
HETATM 6942 C  C2    A TTP N 6 .   ? 106.031 24.680  124.381 0.80 26.28  ?  901  TTP C C2    1 
HETATM 6943 O  O2    A TTP N 6 .   ? 105.041 24.535  125.028 0.80 24.30  ?  901  TTP C O2    1 
HETATM 6944 N  N3    A TTP N 6 .   ? 107.213 24.853  124.971 0.80 26.61  ?  901  TTP C N3    1 
HETATM 6945 C  C4    A TTP N 6 .   ? 108.340 25.022  124.293 0.80 22.25  ?  901  TTP C C4    1 
HETATM 6946 O  O4    A TTP N 6 .   ? 109.391 25.172  124.854 0.80 27.86  ?  901  TTP C O4    1 
HETATM 6947 C  C5    A TTP N 6 .   ? 108.269 24.996  122.907 0.80 21.03  ?  901  TTP C C5    1 
HETATM 6948 C  C5M   A TTP N 6 .   ? 109.541 25.178  122.056 0.80 23.00  ?  901  TTP C C5M   1 
HETATM 6949 C  C6    A TTP N 6 .   ? 107.017 24.813  122.306 0.80 25.67  ?  901  TTP C C6    1 
HETATM 6950 O  O     . HOH O 7 .   ? 107.709 17.102  159.040 1.00 50.53  ?  1001 HOH F O     1 
HETATM 6951 O  O     . HOH O 7 .   ? 79.528  16.840  173.399 1.00 40.29  ?  1002 HOH F O     1 
HETATM 6952 O  O     . HOH O 7 .   ? 107.964 17.460  157.203 1.00 39.02  ?  1003 HOH F O     1 
HETATM 6953 O  O     . HOH O 7 .   ? 108.483 0.433   185.899 1.00 49.66  ?  1004 HOH F O     1 
HETATM 6954 O  O     . HOH O 7 .   ? 75.254  -5.501  178.056 1.00 47.61  ?  1005 HOH F O     1 
HETATM 6955 O  O     . HOH O 7 .   ? 72.316  2.074   145.026 1.00 46.54  ?  1006 HOH F O     1 
HETATM 6956 O  O     . HOH O 7 .   ? 73.404  0.188   155.101 1.00 34.79  ?  1007 HOH F O     1 
HETATM 6957 O  O     . HOH O 7 .   ? 108.024 -3.400  187.769 1.00 59.49  ?  1008 HOH F O     1 
HETATM 6958 O  O     . HOH O 7 .   ? 93.023  10.288  189.425 1.00 54.23  ?  1009 HOH F O     1 
HETATM 6959 O  O     . HOH O 7 .   ? 76.741  24.811  176.723 1.00 26.90  ?  1010 HOH F O     1 
HETATM 6960 O  O     . HOH O 7 .   ? 72.598  -4.689  173.401 1.00 47.95  ?  1011 HOH F O     1 
HETATM 6961 O  O     . HOH O 7 .   ? 94.959  8.826   186.900 1.00 33.68  ?  1012 HOH F O     1 
HETATM 6962 O  O     . HOH O 7 .   ? 86.029  17.899  193.208 1.00 56.71  ?  1013 HOH F O     1 
HETATM 6963 O  O     . HOH O 7 .   ? 75.802  18.130  172.866 1.00 30.24  ?  1014 HOH F O     1 
HETATM 6964 O  O     . HOH O 7 .   ? 61.881  5.045   164.633 1.00 57.47  ?  1015 HOH F O     1 
HETATM 6965 O  O     . HOH O 7 .   ? 80.845  16.082  162.595 1.00 18.01  ?  1016 HOH F O     1 
HETATM 6966 O  O     . HOH O 7 .   ? 100.571 -0.090  168.799 1.00 37.55  ?  1017 HOH F O     1 
HETATM 6967 O  O     . HOH O 7 .   ? 117.339 18.522  165.506 1.00 59.56  ?  1018 HOH F O     1 
HETATM 6968 O  O     . HOH O 7 .   ? 66.813  -0.845  172.955 1.00 45.57  ?  1019 HOH F O     1 
HETATM 6969 O  O     . HOH O 7 .   ? 118.556 14.805  162.554 1.00 52.43  ?  1020 HOH F O     1 
HETATM 6970 O  O     . HOH O 7 .   ? 70.257  1.008   171.803 1.00 26.65  ?  1021 HOH F O     1 
HETATM 6971 O  O     . HOH O 7 .   ? 66.353  24.707  181.269 1.00 49.25  ?  1022 HOH F O     1 
HETATM 6972 O  O     . HOH O 7 .   ? 91.724  19.085  177.790 1.00 21.87  ?  1023 HOH F O     1 
HETATM 6973 O  O     . HOH O 7 .   ? 104.836 18.942  158.361 1.00 40.24  ?  1024 HOH F O     1 
HETATM 6974 O  O     . HOH O 7 .   ? 71.477  23.570  150.937 1.00 56.42  ?  1025 HOH F O     1 
HETATM 6975 O  O     . HOH O 7 .   ? 97.641  -10.008 182.024 1.00 46.34  ?  1026 HOH F O     1 
HETATM 6976 O  O     . HOH O 7 .   ? 106.862 29.332  174.059 1.00 39.46  ?  1027 HOH F O     1 
HETATM 6977 O  O     . HOH O 7 .   ? 100.873 9.850   163.730 1.00 30.57  ?  1028 HOH F O     1 
HETATM 6978 O  O     . HOH O 7 .   ? 94.162  -2.750  173.625 1.00 37.18  ?  1029 HOH F O     1 
HETATM 6979 O  O     . HOH O 7 .   ? 100.423 10.313  185.876 1.00 37.73  ?  1030 HOH F O     1 
HETATM 6980 O  O     . HOH O 7 .   ? 119.704 5.152   166.021 1.00 43.74  ?  1031 HOH F O     1 
HETATM 6981 O  O     . HOH O 7 .   ? 66.730  1.071   160.605 1.00 40.46  ?  1032 HOH F O     1 
HETATM 6982 O  O     . HOH O 7 .   ? 110.045 12.877  158.637 1.00 44.53  ?  1033 HOH F O     1 
HETATM 6983 O  O     . HOH O 7 .   ? 108.533 -6.350  169.472 1.00 38.68  ?  1034 HOH F O     1 
HETATM 6984 O  O     . HOH O 7 .   ? 96.034  20.252  185.115 1.00 44.99  ?  1035 HOH F O     1 
HETATM 6985 O  O     . HOH O 7 .   ? 99.127  37.121  173.368 1.00 61.54  ?  1036 HOH F O     1 
HETATM 6986 O  O     . HOH O 7 .   ? 118.201 12.169  181.173 1.00 41.96  ?  1037 HOH F O     1 
HETATM 6987 O  O     . HOH O 7 .   ? 103.190 5.943   169.933 1.00 30.76  ?  1038 HOH F O     1 
HETATM 6988 O  O     . HOH O 7 .   ? 69.040  14.649  194.753 1.00 49.55  ?  1039 HOH F O     1 
HETATM 6989 O  O     . HOH O 7 .   ? 67.449  1.734   164.659 1.00 42.11  ?  1040 HOH F O     1 
HETATM 6990 O  O     . HOH O 7 .   ? 75.565  0.231   183.016 1.00 50.97  ?  1041 HOH F O     1 
HETATM 6991 O  O     . HOH O 7 .   ? 83.617  22.999  173.120 1.00 38.37  ?  1042 HOH F O     1 
HETATM 6992 O  O     . HOH O 7 .   ? 77.087  -3.392  181.383 1.00 41.54  ?  1043 HOH F O     1 
HETATM 6993 O  O     . HOH O 7 .   ? 77.458  7.435   162.583 1.00 36.34  ?  1044 HOH F O     1 
HETATM 6994 O  O     . HOH O 7 .   ? 94.852  11.665  191.945 1.00 40.22  ?  1045 HOH F O     1 
HETATM 6995 O  O     . HOH O 7 .   ? 81.133  23.775  172.255 1.00 47.81  ?  1046 HOH F O     1 
HETATM 6996 O  O     . HOH O 7 .   ? 65.743  7.154   150.861 1.00 37.93  ?  1047 HOH F O     1 
HETATM 6997 O  O     . HOH O 7 .   ? 87.860  1.461   173.782 1.00 30.06  ?  1048 HOH F O     1 
HETATM 6998 O  O     . HOH O 7 .   ? 107.116 23.844  166.810 1.00 34.97  ?  1049 HOH F O     1 
HETATM 6999 O  O     . HOH O 7 .   ? 64.472  7.604   159.200 1.00 33.49  ?  1050 HOH F O     1 
HETATM 7000 O  O     . HOH O 7 .   ? 112.171 8.323   184.826 1.00 40.28  ?  1051 HOH F O     1 
HETATM 7001 O  O     . HOH O 7 .   ? 94.503  4.712   184.273 1.00 36.52  ?  1052 HOH F O     1 
HETATM 7002 O  O     . HOH O 7 .   ? 122.500 17.645  168.669 1.00 41.96  ?  1053 HOH F O     1 
HETATM 7003 O  O     . HOH O 7 .   ? 64.678  3.724   166.597 1.00 34.20  ?  1054 HOH F O     1 
HETATM 7004 O  O     . HOH O 7 .   ? 88.144  26.928  189.862 1.00 39.16  ?  1055 HOH F O     1 
HETATM 7005 O  O     . HOH O 7 .   ? 99.189  3.846   189.904 1.00 34.67  ?  1056 HOH F O     1 
HETATM 7006 O  O     . HOH O 7 .   ? 71.385  4.128   167.265 1.00 20.86  ?  1057 HOH F O     1 
HETATM 7007 O  O     . HOH O 7 .   ? 92.096  24.654  186.416 1.00 38.99  ?  1058 HOH F O     1 
HETATM 7008 O  O     . HOH O 7 .   ? 68.424  20.159  151.651 1.00 46.10  ?  1059 HOH F O     1 
HETATM 7009 O  O     . HOH O 7 .   ? 117.321 5.696   182.344 1.00 41.85  ?  1060 HOH F O     1 
HETATM 7010 O  O     . HOH O 7 .   ? 114.950 -2.085  173.111 1.00 31.76  ?  1061 HOH F O     1 
HETATM 7011 O  O     . HOH O 7 .   ? 94.648  37.795  179.519 1.00 42.40  ?  1062 HOH F O     1 
HETATM 7012 O  O     . HOH O 7 .   ? 94.479  23.714  167.166 1.00 40.01  ?  1063 HOH F O     1 
HETATM 7013 O  O     . HOH O 7 .   ? 58.993  15.260  159.366 1.00 25.87  ?  1064 HOH F O     1 
HETATM 7014 O  O     . HOH O 7 .   ? 75.519  -1.091  158.089 1.00 41.98  ?  1065 HOH F O     1 
HETATM 7015 O  O     . HOH O 7 .   ? 67.580  20.466  159.731 1.00 39.13  ?  1066 HOH F O     1 
HETATM 7016 O  O     . HOH O 7 .   ? 102.749 3.330   165.296 1.00 32.26  ?  1067 HOH F O     1 
HETATM 7017 O  O     . HOH O 7 .   ? 79.599  27.914  193.592 1.00 47.64  ?  1068 HOH F O     1 
HETATM 7018 O  O     . HOH O 7 .   ? 102.328 -9.451  178.458 1.00 37.25  ?  1069 HOH F O     1 
HETATM 7019 O  O     . HOH O 7 .   ? 62.154  8.862   188.619 1.00 50.28  ?  1070 HOH F O     1 
HETATM 7020 O  O     . HOH O 7 .   ? 104.499 23.551  176.722 1.00 30.83  ?  1071 HOH F O     1 
HETATM 7021 O  O     . HOH O 7 .   ? 79.558  1.766   170.619 1.00 35.28  ?  1072 HOH F O     1 
HETATM 7022 O  O     . HOH O 7 .   ? 79.065  32.542  183.058 1.00 45.26  ?  1073 HOH F O     1 
HETATM 7023 O  O     . HOH O 7 .   ? 100.964 -8.007  171.674 1.00 39.64  ?  1074 HOH F O     1 
HETATM 7024 O  O     . HOH O 7 .   ? 98.743  2.652   167.518 1.00 32.72  ?  1075 HOH F O     1 
HETATM 7025 O  O     . HOH O 7 .   ? 101.452 29.958  171.628 1.00 31.22  ?  1076 HOH F O     1 
HETATM 7026 O  O     . HOH O 7 .   ? 99.538  5.584   168.198 1.00 31.40  ?  1077 HOH F O     1 
HETATM 7027 O  O     . HOH O 7 .   ? 111.408 22.564  159.964 1.00 52.20  ?  1078 HOH F O     1 
HETATM 7028 O  O     . HOH O 7 .   ? 88.960  37.028  182.652 1.00 32.01  ?  1079 HOH F O     1 
HETATM 7029 O  O     . HOH O 7 .   ? 99.387  16.309  172.200 1.00 20.24  ?  1080 HOH F O     1 
HETATM 7030 O  O     . HOH O 7 .   ? 70.581  11.556  195.835 1.00 46.54  ?  1081 HOH F O     1 
HETATM 7031 O  O     . HOH O 7 .   ? 97.017  13.039  171.261 1.00 36.78  ?  1082 HOH F O     1 
HETATM 7032 O  O     . HOH O 7 .   ? 68.659  18.710  148.924 1.00 39.14  ?  1083 HOH F O     1 
HETATM 7033 O  O     . HOH O 7 .   ? 84.749  9.305   160.721 1.00 42.70  ?  1084 HOH F O     1 
HETATM 7034 O  O     . HOH O 7 .   ? 95.951  -9.222  174.325 1.00 55.28  ?  1085 HOH F O     1 
HETATM 7035 O  O     . HOH O 7 .   ? 119.580 13.817  178.997 1.00 38.27  ?  1086 HOH F O     1 
HETATM 7036 O  O     . HOH O 7 .   ? 97.239  -4.510  179.425 1.00 29.76  ?  1087 HOH F O     1 
HETATM 7037 O  O     . HOH O 7 .   ? 73.473  -2.533  179.329 1.00 44.12  ?  1088 HOH F O     1 
HETATM 7038 O  O     . HOH O 7 .   ? 94.275  22.793  176.638 1.00 34.42  ?  1089 HOH F O     1 
HETATM 7039 O  O     . HOH O 7 .   ? 57.964  10.545  160.042 1.00 40.03  ?  1090 HOH F O     1 
HETATM 7040 O  O     . HOH O 7 .   ? 66.298  15.134  149.230 1.00 44.27  ?  1091 HOH F O     1 
HETATM 7041 O  O     . HOH O 7 .   ? 109.532 26.286  165.768 1.00 42.77  ?  1092 HOH F O     1 
HETATM 7042 O  O     . HOH O 7 .   ? 95.807  6.451   172.750 1.00 26.77  ?  1093 HOH F O     1 
HETATM 7043 O  O     . HOH O 7 .   ? 109.534 -0.266  167.085 1.00 57.23  ?  1094 HOH F O     1 
HETATM 7044 O  O     . HOH O 7 .   ? 122.100 11.457  167.852 1.00 54.27  ?  1095 HOH F O     1 
HETATM 7045 O  O     . HOH O 7 .   ? 66.656  22.241  185.278 1.00 53.49  ?  1096 HOH F O     1 
HETATM 7046 O  O     . HOH O 7 .   ? 77.914  22.300  183.411 1.00 31.81  ?  1097 HOH F O     1 
HETATM 7047 O  O     . HOH O 7 .   ? 99.282  13.732  168.522 1.00 42.75  ?  1098 HOH F O     1 
HETATM 7048 O  O     . HOH O 7 .   ? 78.746  19.435  172.712 1.00 46.41  ?  1099 HOH F O     1 
HETATM 7049 O  O     . HOH O 7 .   ? 114.298 1.944   160.428 1.00 53.71  ?  1100 HOH F O     1 
HETATM 7050 O  O     . HOH O 7 .   ? 104.672 -8.017  186.193 1.00 46.88  ?  1101 HOH F O     1 
HETATM 7051 O  O     . HOH O 7 .   ? 85.713  24.258  168.439 1.00 41.68  ?  1102 HOH F O     1 
HETATM 7052 O  O     . HOH O 7 .   ? 83.998  17.857  190.987 1.00 34.57  ?  1103 HOH F O     1 
HETATM 7053 O  O     . HOH O 7 .   ? 81.653  3.610   176.785 1.00 25.87  ?  1104 HOH F O     1 
HETATM 7054 O  O     . HOH O 7 .   ? 90.467  -1.363  179.726 1.00 48.63  ?  1105 HOH F O     1 
HETATM 7055 O  O     . HOH O 7 .   ? 97.030  1.273   170.337 1.00 39.52  ?  1106 HOH F O     1 
HETATM 7056 O  O     . HOH O 7 .   ? 87.930  41.116  170.050 1.00 39.28  ?  1107 HOH F O     1 
HETATM 7057 O  O     . HOH O 7 .   ? 65.119  -2.365  174.180 1.00 48.45  ?  1108 HOH F O     1 
HETATM 7058 O  O     . HOH O 7 .   ? 55.576  14.034  166.642 1.00 46.60  ?  1109 HOH F O     1 
HETATM 7059 O  O     . HOH O 7 .   ? 56.494  10.151  165.682 1.00 37.76  ?  1110 HOH F O     1 
HETATM 7060 O  O     . HOH O 7 .   ? 79.992  15.622  192.981 1.00 40.14  ?  1111 HOH F O     1 
HETATM 7061 O  O     . HOH O 7 .   ? 85.078  21.585  155.993 1.00 44.96  ?  1112 HOH F O     1 
HETATM 7062 O  O     . HOH O 7 .   ? 117.583 22.953  172.276 1.00 48.60  ?  1113 HOH F O     1 
HETATM 7063 O  O     . HOH O 7 .   ? 76.612  25.180  149.545 1.00 51.31  ?  1114 HOH F O     1 
HETATM 7064 O  O     . HOH O 7 .   ? 66.753  -2.029  177.347 1.00 36.03  ?  1115 HOH F O     1 
HETATM 7065 O  O     . HOH O 7 .   ? 112.693 24.366  165.247 1.00 36.78  ?  1116 HOH F O     1 
HETATM 7066 O  O     . HOH O 7 .   ? 86.699  20.534  193.308 1.00 49.30  ?  1117 HOH F O     1 
HETATM 7067 O  O     . HOH O 7 .   ? 92.195  -4.041  175.168 1.00 42.46  ?  1118 HOH F O     1 
HETATM 7068 O  O     . HOH O 7 .   ? 64.451  14.128  154.549 1.00 30.13  ?  1119 HOH F O     1 
HETATM 7069 O  O     . HOH O 7 .   ? 115.368 24.376  173.131 1.00 43.26  ?  1120 HOH F O     1 
HETATM 7070 O  O     . HOH O 7 .   ? 82.414  -0.920  180.481 1.00 40.05  ?  1121 HOH F O     1 
HETATM 7071 O  O     . HOH O 7 .   ? 79.871  6.349   188.516 1.00 31.98  ?  1122 HOH F O     1 
HETATM 7072 O  O     . HOH O 7 .   ? 90.201  -3.254  176.550 1.00 45.04  ?  1123 HOH F O     1 
HETATM 7073 O  O     . HOH O 7 .   ? 79.109  26.376  186.979 1.00 41.66  ?  1124 HOH F O     1 
HETATM 7074 O  O     . HOH O 7 .   ? 114.845 -2.578  177.582 1.00 24.25  ?  1125 HOH F O     1 
HETATM 7075 O  O     . HOH O 7 .   ? 103.360 29.617  181.178 1.00 47.07  ?  1126 HOH F O     1 
HETATM 7076 O  O     . HOH O 7 .   ? 69.492  20.650  173.354 1.00 26.32  ?  1127 HOH F O     1 
HETATM 7077 O  O     . HOH O 7 .   ? 79.382  18.807  153.156 1.00 33.67  ?  1128 HOH F O     1 
HETATM 7078 O  O     . HOH O 7 .   ? 100.788 23.151  175.861 1.00 37.64  ?  1129 HOH F O     1 
HETATM 7079 O  O     . HOH O 7 .   ? 77.455  26.224  193.208 1.00 47.85  ?  1130 HOH F O     1 
HETATM 7080 O  O     . HOH O 7 .   ? 117.373 12.176  160.673 1.00 35.51  ?  1131 HOH F O     1 
HETATM 7081 O  O     . HOH O 7 .   ? 61.286  18.155  162.159 1.00 37.40  ?  1132 HOH F O     1 
HETATM 7082 O  O     . HOH O 7 .   ? 82.806  36.823  168.470 1.00 30.39  ?  1133 HOH F O     1 
HETATM 7083 O  O     . HOH O 7 .   ? 78.041  2.156   181.483 1.00 24.94  ?  1134 HOH F O     1 
HETATM 7084 O  O     . HOH O 7 .   ? 77.614  1.342   168.963 1.00 39.32  ?  1135 HOH F O     1 
HETATM 7085 O  O     . HOH O 7 .   ? 106.932 25.457  164.716 1.00 40.08  ?  1136 HOH F O     1 
HETATM 7086 O  O     . HOH O 7 .   ? 58.707  11.835  175.183 1.00 47.27  ?  1137 HOH F O     1 
HETATM 7087 O  O     . HOH O 7 .   ? 61.648  18.217  166.697 1.00 41.80  ?  1138 HOH F O     1 
HETATM 7088 O  O     . HOH O 7 .   ? 98.954  16.187  169.464 1.00 35.39  ?  1139 HOH F O     1 
HETATM 7089 O  O     . HOH O 7 .   ? 101.795 -1.721  190.474 1.00 51.79  ?  1140 HOH F O     1 
HETATM 7090 O  O     . HOH O 7 .   ? 83.923  15.015  178.154 1.00 32.16  ?  1141 HOH F O     1 
HETATM 7091 O  O     . HOH O 7 .   ? 107.845 -1.293  165.114 1.00 55.43  ?  1142 HOH F O     1 
HETATM 7092 O  O     . HOH O 7 .   ? 79.850  10.504  180.950 1.00 24.05  ?  1143 HOH F O     1 
HETATM 7093 O  O     . HOH O 7 .   ? 78.767  33.565  174.354 1.00 28.95  ?  1144 HOH F O     1 
HETATM 7094 O  O     . HOH O 7 .   ? 101.911 9.341   173.123 1.00 28.60  ?  1145 HOH F O     1 
HETATM 7095 O  O     . HOH O 7 .   ? 97.114  27.185  181.933 1.00 41.95  ?  1146 HOH F O     1 
HETATM 7096 O  O     . HOH O 7 .   ? 71.035  20.814  184.268 1.00 28.73  ?  1147 HOH F O     1 
HETATM 7097 O  O     . HOH O 7 .   ? 96.038  40.008  173.184 1.00 50.54  ?  1148 HOH F O     1 
HETATM 7098 O  O     . HOH O 7 .   ? 76.400  16.821  170.892 1.00 34.90  ?  1149 HOH F O     1 
HETATM 7099 O  O     . HOH O 7 .   ? 77.982  19.790  155.572 1.00 33.43  ?  1150 HOH F O     1 
HETATM 7100 O  O     . HOH O 7 .   ? 78.392  5.412   170.285 1.00 39.11  ?  1151 HOH F O     1 
HETATM 7101 O  O     . HOH O 7 .   ? 77.256  26.567  190.072 1.00 48.65  ?  1152 HOH F O     1 
HETATM 7102 O  O     . HOH O 7 .   ? 81.997  42.493  177.224 1.00 61.75  ?  1153 HOH F O     1 
HETATM 7103 O  O     . HOH O 7 .   ? 118.261 2.634   169.898 1.00 36.92  ?  1154 HOH F O     1 
HETATM 7104 O  O     . HOH O 7 .   ? 72.965  1.347   161.139 1.00 28.61  ?  1155 HOH F O     1 
HETATM 7105 O  O     . HOH O 7 .   ? 114.613 14.484  183.191 1.00 31.30  ?  1156 HOH F O     1 
HETATM 7106 O  O     . HOH O 7 .   ? 65.844  0.519   178.149 1.00 34.36  ?  1157 HOH F O     1 
HETATM 7107 O  O     . HOH O 7 .   ? 98.886  29.301  171.257 1.00 28.35  ?  1158 HOH F O     1 
HETATM 7108 O  O     . HOH O 7 .   ? 80.444  1.450   177.525 1.00 25.47  ?  1159 HOH F O     1 
HETATM 7109 O  O     . HOH O 7 .   ? 61.472  7.032   168.826 1.00 54.09  ?  1160 HOH F O     1 
HETATM 7110 O  O     . HOH O 7 .   ? 117.664 2.691   176.393 1.00 28.23  ?  1161 HOH F O     1 
HETATM 7111 O  O     . HOH O 7 .   ? 80.981  -6.920  175.484 1.00 42.97  ?  1162 HOH F O     1 
HETATM 7112 O  O     . HOH O 7 .   ? 76.764  4.284   185.403 1.00 34.81  ?  1163 HOH F O     1 
HETATM 7113 O  O     . HOH O 7 .   ? 105.159 6.014   188.795 1.00 37.39  ?  1164 HOH F O     1 
HETATM 7114 O  O     . HOH O 7 .   ? 82.121  6.041   187.053 1.00 52.42  ?  1165 HOH F O     1 
HETATM 7115 O  O     . HOH O 7 .   ? 98.251  -0.554  191.165 1.00 48.07  ?  1166 HOH F O     1 
HETATM 7116 O  O     . HOH O 7 .   ? 95.815  -5.867  172.263 1.00 47.12  ?  1167 HOH F O     1 
HETATM 7117 O  O     . HOH O 7 .   ? 111.215 26.836  169.839 1.00 30.35  ?  1168 HOH F O     1 
HETATM 7118 O  O     . HOH O 7 .   ? 67.575  24.806  157.868 1.00 49.03  ?  1169 HOH F O     1 
HETATM 7119 O  O     . HOH O 7 .   ? 99.757  26.620  180.863 1.00 36.79  ?  1170 HOH F O     1 
HETATM 7120 O  O     . HOH O 7 .   ? 70.729  8.473   151.792 1.00 35.79  ?  1171 HOH F O     1 
HETATM 7121 O  O     . HOH O 7 .   ? 80.592  1.416   180.348 1.00 35.46  ?  1172 HOH F O     1 
HETATM 7122 O  O     . HOH O 7 .   ? 81.078  17.300  190.895 1.00 33.99  ?  1173 HOH F O     1 
HETATM 7123 O  O     . HOH O 7 .   ? 58.604  16.062  174.040 1.00 35.90  ?  1174 HOH F O     1 
HETATM 7124 O  O     . HOH O 7 .   ? 86.838  12.285  178.236 1.00 28.53  ?  1175 HOH F O     1 
HETATM 7125 O  O     . HOH O 7 .   ? 112.247 22.656  175.396 1.00 32.30  ?  1176 HOH F O     1 
HETATM 7126 O  O     . HOH O 7 .   ? 82.648  26.833  172.430 1.00 35.44  ?  1177 HOH F O     1 
HETATM 7127 O  O     . HOH O 7 .   ? 71.511  27.917  183.443 1.00 38.20  ?  1178 HOH F O     1 
HETATM 7128 O  O     . HOH O 7 .   ? 79.766  8.709   161.067 1.00 40.92  ?  1179 HOH F O     1 
HETATM 7129 O  O     . HOH O 7 .   ? 77.299  9.455   164.198 1.00 41.20  ?  1180 HOH F O     1 
HETATM 7130 O  O     . HOH O 7 .   ? 65.233  7.439   162.595 1.00 37.67  ?  1181 HOH F O     1 
HETATM 7131 O  O     . HOH O 7 .   ? 64.657  22.877  176.909 1.00 33.13  ?  1182 HOH F O     1 
HETATM 7132 O  O     . HOH O 7 .   ? 67.836  3.029   162.485 1.00 22.77  ?  1183 HOH F O     1 
HETATM 7133 O  O     . HOH O 7 .   ? 77.252  9.749   193.607 1.00 50.04  ?  1184 HOH F O     1 
HETATM 7134 O  O     . HOH O 7 .   ? 101.492 0.988   171.498 1.00 22.56  ?  1185 HOH F O     1 
HETATM 7135 O  O     . HOH O 7 .   ? 84.493  26.192  174.250 1.00 41.87  ?  1186 HOH F O     1 
HETATM 7136 O  O     . HOH O 7 .   ? 109.482 -1.453  184.043 1.00 36.67  ?  1187 HOH F O     1 
HETATM 7137 O  O     . HOH O 7 .   ? 78.856  27.250  172.193 1.00 51.32  ?  1188 HOH F O     1 
HETATM 7138 O  O     . HOH O 7 .   ? 111.539 0.138   183.141 1.00 24.43  ?  1189 HOH F O     1 
HETATM 7139 O  O     . HOH O 7 .   ? 87.310  7.229   189.409 1.00 48.30  ?  1190 HOH F O     1 
HETATM 7140 O  O     . HOH O 7 .   ? 74.224  21.589  148.379 1.00 49.95  ?  1191 HOH F O     1 
HETATM 7141 O  O     . HOH O 7 .   ? 76.562  1.931   161.289 1.00 37.17  ?  1192 HOH F O     1 
HETATM 7142 O  O     . HOH O 7 .   ? 66.109  0.979   180.434 1.00 40.96  ?  1193 HOH F O     1 
HETATM 7143 O  O     . HOH O 7 .   ? 74.956  -3.276  173.431 1.00 38.85  ?  1194 HOH F O     1 
HETATM 7144 O  O     . HOH O 7 .   ? 64.018  26.772  172.939 1.00 38.74  ?  1195 HOH F O     1 
HETATM 7145 O  O     . HOH O 7 .   ? 77.091  24.664  184.821 1.00 41.54  ?  1196 HOH F O     1 
HETATM 7146 O  O     . HOH O 7 .   ? 80.077  3.840   166.334 1.00 36.71  ?  1197 HOH F O     1 
HETATM 7147 O  O     . HOH O 7 .   ? 90.291  28.912  190.711 1.00 53.38  ?  1198 HOH F O     1 
HETATM 7148 O  O     . HOH O 7 .   ? 81.921  -4.169  172.905 1.00 56.68  ?  1199 HOH F O     1 
HETATM 7149 O  O     . HOH O 7 .   ? 76.427  18.124  165.859 1.00 35.78  ?  1200 HOH F O     1 
HETATM 7150 O  O     . HOH O 7 .   ? 80.456  20.073  162.983 1.00 45.10  ?  1201 HOH F O     1 
HETATM 7151 O  O     . HOH O 7 .   ? 75.220  -2.214  167.485 1.00 34.65  ?  1202 HOH F O     1 
HETATM 7152 O  O     . HOH O 7 .   ? 85.465  0.818   172.507 1.00 41.00  ?  1203 HOH F O     1 
HETATM 7153 O  O     . HOH O 7 .   ? 73.949  19.817  166.830 1.00 35.27  ?  1204 HOH F O     1 
HETATM 7154 O  O     . HOH O 7 .   ? 112.396 -3.045  170.382 1.00 40.24  ?  1205 HOH F O     1 
HETATM 7155 O  O     . HOH O 7 .   ? 59.094  8.995   175.283 1.00 46.09  ?  1206 HOH F O     1 
HETATM 7156 O  O     . HOH O 7 .   ? 98.347  36.629  171.361 1.00 48.36  ?  1207 HOH F O     1 
HETATM 7157 O  O     . HOH O 7 .   ? 77.993  8.944   167.828 1.00 23.75  ?  1208 HOH F O     1 
HETATM 7158 O  O     . HOH O 7 .   ? 82.964  20.192  161.412 1.00 58.81  ?  1209 HOH F O     1 
HETATM 7159 O  O     . HOH O 7 .   ? 102.042 -9.555  175.783 1.00 45.27  ?  1210 HOH F O     1 
HETATM 7160 O  O     . HOH O 7 .   ? 110.019 -5.515  179.558 1.00 29.02  ?  1211 HOH F O     1 
HETATM 7161 O  O     . HOH O 7 .   ? 93.221  16.520  150.744 1.00 45.83  ?  1212 HOH F O     1 
HETATM 7162 O  O     . HOH O 7 .   ? 108.895 18.590  180.210 1.00 37.87  ?  1213 HOH F O     1 
HETATM 7163 O  O     . HOH O 7 .   ? 69.668  23.437  158.804 1.00 54.78  ?  1214 HOH F O     1 
HETATM 7164 O  O     . HOH O 7 .   ? 79.444  33.321  169.705 1.00 34.52  ?  1215 HOH F O     1 
HETATM 7165 O  O     . HOH O 7 .   ? 85.465  -1.786  173.955 1.00 39.06  ?  1216 HOH F O     1 
HETATM 7166 O  O     . HOH O 7 .   ? 71.993  23.437  192.920 1.00 42.88  ?  1217 HOH F O     1 
HETATM 7167 O  O     . HOH O 7 .   ? 70.679  3.886   146.437 1.00 42.25  ?  1218 HOH F O     1 
HETATM 7168 O  O     . HOH O 7 .   ? 91.702  12.280  186.516 1.00 43.79  ?  1219 HOH F O     1 
HETATM 7169 O  O     . HOH O 7 .   ? 107.737 13.024  186.303 1.00 43.35  ?  1220 HOH F O     1 
HETATM 7170 O  O     . HOH O 7 .   ? 121.119 13.842  167.628 1.00 50.08  ?  1221 HOH F O     1 
HETATM 7171 O  O     . HOH O 7 .   ? 93.717  -5.250  179.569 1.00 48.59  ?  1222 HOH F O     1 
HETATM 7172 O  O     . HOH O 7 .   ? 112.883 -0.784  169.295 1.00 53.22  ?  1223 HOH F O     1 
HETATM 7173 O  O     . HOH O 7 .   ? 61.771  19.509  172.111 1.00 31.42  ?  1224 HOH F O     1 
HETATM 7174 O  O     . HOH O 7 .   ? 76.523  23.995  156.062 1.00 39.35  ?  1225 HOH F O     1 
HETATM 7175 O  O     . HOH O 7 .   ? 120.675 12.161  164.946 1.00 44.00  ?  1226 HOH F O     1 
HETATM 7176 O  O     . HOH O 7 .   ? 95.471  34.182  182.489 1.00 46.97  ?  1227 HOH F O     1 
HETATM 7177 O  O     . HOH O 7 .   ? 66.599  24.471  189.771 1.00 45.36  ?  1228 HOH F O     1 
HETATM 7178 O  O     . HOH O 7 .   ? 61.743  18.851  175.989 1.00 36.65  ?  1229 HOH F O     1 
HETATM 7179 O  O     . HOH O 7 .   ? 75.583  -3.297  176.218 1.00 32.59  ?  1230 HOH F O     1 
HETATM 7180 O  O     . HOH O 7 .   ? 115.744 2.933   184.758 1.00 48.85  ?  1231 HOH F O     1 
HETATM 7181 O  O     . HOH O 7 .   ? 85.790  31.943  166.252 1.00 48.11  ?  1232 HOH F O     1 
HETATM 7182 O  O     . HOH O 7 .   ? 106.579 28.278  168.743 1.00 45.51  ?  1233 HOH F O     1 
HETATM 7183 O  O     . HOH O 7 .   ? 59.240  16.796  169.769 1.00 38.63  ?  1234 HOH F O     1 
HETATM 7184 O  O     . HOH O 7 .   ? 74.753  9.107   142.961 1.00 42.88  ?  1235 HOH F O     1 
HETATM 7185 O  O     . HOH O 7 .   ? 79.379  30.514  181.180 1.00 23.68  ?  1236 HOH F O     1 
HETATM 7186 O  O     . HOH O 7 .   ? 68.172  -2.741  171.114 1.00 44.92  ?  1237 HOH F O     1 
HETATM 7187 O  O     . HOH O 7 .   ? 97.188  29.081  183.442 1.00 50.09  ?  1238 HOH F O     1 
HETATM 7188 O  O     . HOH O 7 .   ? 74.334  23.834  149.377 1.00 40.09  ?  1239 HOH F O     1 
HETATM 7189 O  O     . HOH O 7 .   ? 98.499  9.792   167.373 1.00 28.81  ?  1240 HOH F O     1 
HETATM 7190 O  O     . HOH O 7 .   ? 80.184  -0.519  170.613 1.00 50.48  ?  1241 HOH F O     1 
HETATM 7191 O  O     . HOH O 7 .   ? 113.228 10.624  170.807 1.00 55.24  ?  1242 HOH F O     1 
HETATM 7192 O  O     . HOH O 7 .   ? 70.990  25.741  167.902 1.00 46.21  ?  1243 HOH F O     1 
HETATM 7193 O  O     . HOH O 7 .   ? 99.314  33.315  177.770 1.00 45.78  ?  1244 HOH F O     1 
HETATM 7194 O  O     . HOH O 7 .   ? 110.516 20.913  158.120 1.00 42.56  ?  1245 HOH F O     1 
HETATM 7195 O  O     . HOH O 7 .   ? 82.449  5.170   184.954 1.00 52.22  ?  1246 HOH F O     1 
HETATM 7196 O  O     . HOH O 7 .   ? 102.483 19.715  182.172 1.00 36.47  ?  1247 HOH F O     1 
HETATM 7197 O  O     . HOH O 7 .   ? 107.885 4.725   162.624 1.00 48.90  ?  1248 HOH F O     1 
HETATM 7198 O  O     . HOH O 7 .   ? 69.402  25.359  186.450 1.00 42.18  ?  1249 HOH F O     1 
HETATM 7199 O  O     . HOH O 7 .   ? 88.570  40.573  176.775 1.00 36.78  ?  1250 HOH F O     1 
HETATM 7200 O  O     . HOH O 7 .   ? 65.292  15.292  191.267 1.00 67.09  ?  1251 HOH F O     1 
HETATM 7201 O  O     . HOH O 7 .   ? 90.143  13.097  184.401 1.00 35.17  ?  1252 HOH F O     1 
HETATM 7202 O  O     . HOH O 7 .   ? 73.145  0.876   141.506 1.00 45.77  ?  1253 HOH F O     1 
HETATM 7203 O  O     . HOH O 7 .   ? 76.926  16.783  168.486 1.00 46.08  ?  1254 HOH F O     1 
HETATM 7204 O  O     . HOH O 7 .   ? 108.429 23.224  178.477 1.00 29.17  ?  1255 HOH F O     1 
HETATM 7205 O  O     . HOH O 7 .   ? 110.198 1.835   187.161 1.00 55.53  ?  1256 HOH F O     1 
HETATM 7206 O  O     . HOH O 7 .   ? 79.113  38.069  178.546 1.00 46.56  ?  1257 HOH F O     1 
HETATM 7207 O  O     . HOH O 7 .   ? 61.880  10.151  170.391 1.00 47.59  ?  1258 HOH F O     1 
HETATM 7208 O  O     . HOH O 7 .   ? 67.366  15.900  192.895 1.00 39.64  ?  1259 HOH F O     1 
HETATM 7209 O  O     . HOH O 7 .   ? 100.236 23.973  179.625 1.00 47.05  ?  1260 HOH F O     1 
HETATM 7210 O  O     . HOH O 7 .   ? 95.596  22.539  188.695 1.00 40.63  ?  1261 HOH F O     1 
HETATM 7211 O  O     . HOH O 7 .   ? 113.704 10.378  157.063 1.00 37.68  ?  1262 HOH F O     1 
HETATM 7212 O  O     . HOH O 7 .   ? 62.216  20.218  155.866 1.00 51.11  ?  1263 HOH F O     1 
HETATM 7213 O  O     . HOH O 7 .   ? 65.693  4.523   161.961 1.00 35.35  ?  1264 HOH F O     1 
HETATM 7214 O  O     . HOH O 7 .   ? 62.535  21.696  175.700 1.00 49.21  ?  1265 HOH F O     1 
HETATM 7215 O  O     . HOH O 7 .   ? 74.064  27.437  182.226 1.00 54.08  ?  1266 HOH F O     1 
HETATM 7216 O  O     . HOH O 7 .   ? 94.845  20.991  180.351 1.00 44.22  ?  1267 HOH F O     1 
HETATM 7217 O  O     . HOH O 7 .   ? 110.763 24.166  176.834 1.00 36.56  ?  1268 HOH F O     1 
HETATM 7218 O  O     . HOH O 7 .   ? 109.710 6.149   162.386 1.00 43.98  ?  1269 HOH F O     1 
HETATM 7219 O  O     . HOH O 7 .   ? 119.681 20.982  163.498 1.00 53.68  ?  1270 HOH F O     1 
HETATM 7220 O  O     . HOH O 7 .   ? 57.556  4.707   164.483 1.00 48.12  ?  1271 HOH F O     1 
HETATM 7221 O  O     . HOH O 7 .   ? 88.817  26.145  166.627 1.00 48.59  ?  1272 HOH F O     1 
HETATM 7222 O  O     . HOH O 7 .   ? 56.772  1.312   164.476 1.00 56.86  ?  1273 HOH F O     1 
HETATM 7223 O  O     . HOH O 7 .   ? 66.594  24.360  184.330 1.00 47.30  ?  1274 HOH F O     1 
HETATM 7224 O  O     . HOH O 7 .   ? 60.245  18.978  178.573 1.00 54.66  ?  1275 HOH F O     1 
HETATM 7225 O  O     . HOH O 7 .   ? 96.685  7.075   170.193 1.00 27.07  ?  1276 HOH F O     1 
HETATM 7226 O  O     . HOH O 7 .   ? 56.169  -2.727  164.931 1.00 61.72  ?  1277 HOH F O     1 
HETATM 7227 O  O     . HOH O 7 .   ? 96.516  22.259  180.179 1.00 49.04  ?  1278 HOH F O     1 
HETATM 7228 O  O     . HOH O 7 .   ? 92.126  20.424  192.805 1.00 46.96  ?  1279 HOH F O     1 
HETATM 7229 O  O     . HOH O 7 .   ? 79.077  32.061  171.943 1.00 36.51  ?  1280 HOH F O     1 
HETATM 7230 O  O     . HOH O 7 .   ? 79.476  38.604  180.888 1.00 42.87  ?  1281 HOH F O     1 
HETATM 7231 O  O     . HOH O 7 .   ? 77.059  30.887  183.693 1.00 46.23  ?  1282 HOH F O     1 
HETATM 7232 O  O     . HOH O 7 .   ? 99.144  7.971   169.397 1.00 31.23  ?  1283 HOH F O     1 
HETATM 7233 O  O     . HOH O 7 .   ? 55.302  17.834  165.188 1.00 59.00  ?  1284 HOH F O     1 
HETATM 7234 O  O     . HOH O 7 .   ? 106.127 21.089  178.911 1.00 59.94  ?  1285 HOH F O     1 
HETATM 7235 O  O     . HOH O 7 .   ? 105.276 14.373  182.821 1.00 55.14  ?  1286 HOH F O     1 
HETATM 7236 O  O     . HOH O 7 .   ? 57.576  -3.066  163.743 1.00 49.51  ?  1287 HOH F O     1 
HETATM 7237 O  O     . HOH O 7 .   ? 88.102  43.066  175.702 1.00 42.56  ?  1288 HOH F O     1 
HETATM 7238 O  O     . HOH O 7 .   ? 79.819  9.458   192.314 1.00 52.18  ?  1289 HOH F O     1 
HETATM 7239 O  O     . HOH O 7 .   ? 87.426  -3.606  174.647 1.00 47.01  ?  1290 HOH F O     1 
HETATM 7240 O  O     . HOH O 7 .   ? 62.776  20.405  161.067 1.00 40.67  ?  1291 HOH F O     1 
HETATM 7241 O  O     . HOH O 7 .   ? 104.210 16.412  182.752 1.00 47.29  ?  1292 HOH F O     1 
HETATM 7242 O  O     . HOH O 7 .   ? 64.858  12.749  148.489 1.00 63.41  ?  1293 HOH F O     1 
HETATM 7243 O  O     . HOH O 7 .   ? 122.699 8.768   175.583 1.00 65.75  ?  1294 HOH F O     1 
HETATM 7244 O  O     . HOH O 7 .   ? 77.973  4.527   188.192 1.00 43.65  ?  1295 HOH F O     1 
HETATM 7245 O  O     . HOH O 7 .   ? 97.328  18.601  182.958 1.00 50.16  ?  1296 HOH F O     1 
HETATM 7246 O  O     . HOH O 7 .   ? 94.610  0.531   170.730 1.00 42.52  ?  1297 HOH F O     1 
HETATM 7247 O  O     . HOH O 7 .   ? 80.104  6.877   169.284 1.00 70.01  ?  1298 HOH F O     1 
HETATM 7248 O  O     . HOH O 7 .   ? 89.435  25.839  192.499 1.00 50.53  ?  1299 HOH F O     1 
HETATM 7249 O  O     . HOH O 7 .   ? 98.280  1.893   191.361 1.00 48.45  ?  1300 HOH F O     1 
HETATM 7250 O  O     . HOH O 7 .   ? 96.856  4.763   168.532 1.00 31.00  ?  1301 HOH F O     1 
HETATM 7251 O  O     . HOH O 7 .   ? 58.050  12.574  172.790 1.00 48.70  ?  1302 HOH F O     1 
HETATM 7252 O  O     . HOH O 7 .   ? 97.761  -0.708  167.784 1.00 44.32  ?  1303 HOH F O     1 
HETATM 7253 O  O     . HOH O 7 .   ? 77.796  0.256   183.217 1.00 56.93  ?  1304 HOH F O     1 
HETATM 7254 O  O     . HOH O 7 .   ? 111.080 -4.754  169.370 1.00 47.35  ?  1305 HOH F O     1 
HETATM 7255 O  O     . HOH O 7 .   ? 82.966  21.424  158.823 1.00 60.63  ?  1306 HOH F O     1 
HETATM 7256 O  O     . HOH O 7 .   ? 71.457  27.123  186.472 1.00 47.05  ?  1307 HOH F O     1 
HETATM 7257 O  O     . HOH O 7 .   ? 89.895  16.689  193.331 1.00 46.10  ?  1308 HOH F O     1 
HETATM 7258 O  O     . HOH O 7 .   ? 110.720 -3.344  166.664 1.00 53.36  ?  1309 HOH F O     1 
HETATM 7259 O  O     . HOH O 7 .   ? 112.315 -1.815  167.782 1.00 68.01  ?  1310 HOH F O     1 
HETATM 7260 O  O     . HOH O 7 .   ? 106.286 -10.109 184.154 1.00 49.84  ?  1311 HOH F O     1 
HETATM 7261 O  O     . HOH O 7 .   ? 83.266  4.840   189.519 1.00 51.54  ?  1312 HOH F O     1 
HETATM 7262 O  O     . HOH O 7 .   ? 76.561  27.318  181.821 1.00 48.47  ?  1313 HOH F O     1 
HETATM 7263 O  O     . HOH O 7 .   ? 57.373  17.366  160.864 1.00 53.54  ?  1314 HOH F O     1 
HETATM 7264 O  O     . HOH O 7 .   ? 80.983  3.960   183.751 1.00 42.92  ?  1315 HOH F O     1 
HETATM 7265 O  O     . HOH O 7 .   ? 101.424 7.682   170.857 1.00 32.33  ?  1316 HOH F O     1 
HETATM 7266 O  O     . HOH O 7 .   ? 78.928  13.543  142.443 1.00 58.75  ?  1317 HOH F O     1 
HETATM 7267 O  O     . HOH O 7 .   ? 98.205  4.661   166.887 1.00 26.40  ?  1318 HOH F O     1 
HETATM 7268 O  O     . HOH O 7 .   ? 98.756  20.775  179.155 1.00 49.32  ?  1319 HOH F O     1 
HETATM 7269 O  O     . HOH O 7 .   ? 79.494  21.859  161.931 1.00 50.22  ?  1320 HOH F O     1 
HETATM 7270 O  O     . HOH O 7 .   ? 119.185 4.353   174.450 1.00 50.36  ?  1321 HOH F O     1 
HETATM 7271 O  O     . HOH O 7 .   ? 74.866  -0.439  162.293 1.00 52.11  ?  1322 HOH F O     1 
HETATM 7272 O  O     . HOH O 7 .   ? 55.283  16.162  162.670 1.00 51.57  ?  1323 HOH F O     1 
HETATM 7273 O  O     . HOH O 7 .   ? 87.771  9.484   156.364 1.00 54.87  ?  1324 HOH F O     1 
HETATM 7274 O  O     . HOH O 7 .   ? 96.918  15.139  165.935 1.00 40.78  ?  1325 HOH F O     1 
HETATM 7275 O  O     . HOH O 7 .   ? 65.802  1.023   158.181 1.00 43.27  ?  1326 HOH F O     1 
HETATM 7276 O  O     . HOH O 7 .   ? 119.721 3.283   167.620 1.00 41.40  ?  1327 HOH F O     1 
HETATM 7277 O  O     . HOH O 7 .   ? 117.085 3.417   181.000 1.00 39.65  ?  1328 HOH F O     1 
HETATM 7278 O  O     . HOH O 7 .   ? 73.700  0.361   186.303 1.00 55.84  ?  1329 HOH F O     1 
HETATM 7279 O  O     . HOH O 7 .   ? 112.133 1.752   185.195 1.00 36.55  ?  1330 HOH F O     1 
HETATM 7280 O  O     . HOH O 7 .   ? 70.095  4.852   193.736 1.00 63.09  ?  1331 HOH F O     1 
HETATM 7281 O  O     . HOH O 7 .   ? 104.389 20.295  184.110 1.00 44.78  ?  1332 HOH F O     1 
HETATM 7282 O  O     . HOH O 7 .   ? 82.301  3.010   181.521 1.00 54.43  ?  1333 HOH F O     1 
HETATM 7283 O  O     . HOH O 7 .   ? 66.867  5.845   148.291 1.00 56.14  ?  1334 HOH F O     1 
HETATM 7284 O  O     . HOH O 7 .   ? 104.520 -11.575 180.019 1.00 37.77  ?  1335 HOH F O     1 
HETATM 7285 O  O     . HOH O 7 .   ? 74.400  27.601  187.006 1.00 47.29  ?  1336 HOH F O     1 
HETATM 7286 O  O     . HOH O 7 .   ? 60.352  10.570  171.600 1.00 48.13  ?  1337 HOH F O     1 
HETATM 7287 O  O     . HOH O 7 .   ? 107.632 16.974  180.338 1.00 46.57  ?  1338 HOH F O     1 
HETATM 7288 O  O     . HOH O 7 .   ? 62.813  7.350   163.091 1.00 41.62  ?  1339 HOH F O     1 
HETATM 7289 O  O     . HOH O 7 .   ? 78.460  22.289  156.575 1.00 41.17  ?  1340 HOH F O     1 
HETATM 7290 O  O     . HOH O 7 .   ? 64.434  21.648  161.467 1.00 55.74  ?  1341 HOH F O     1 
HETATM 7291 O  O     . HOH O 7 .   ? 120.005 13.404  159.888 1.00 53.76  ?  1342 HOH F O     1 
HETATM 7292 O  O     . HOH O 7 .   ? 62.496  19.110  164.612 1.00 46.91  ?  1343 HOH F O     1 
HETATM 7293 O  O     . HOH O 7 .   ? 59.948  18.718  173.627 1.00 49.22  ?  1344 HOH F O     1 
HETATM 7294 O  O     . HOH O 7 .   ? 91.507  -0.924  167.360 1.00 52.90  ?  1345 HOH F O     1 
HETATM 7295 O  O     . HOH O 7 .   ? 73.757  -4.591  167.708 1.00 49.11  ?  1346 HOH F O     1 
HETATM 7296 O  O     . HOH O 7 .   ? 93.273  26.200  188.906 1.00 66.62  ?  1347 HOH F O     1 
HETATM 7297 O  O     . HOH O 7 .   ? 106.439 -10.375 181.348 1.00 54.75  ?  1348 HOH F O     1 
HETATM 7298 O  O     . HOH O 7 .   ? 97.255  -5.558  170.041 1.00 47.90  ?  1349 HOH F O     1 
HETATM 7299 O  O     . HOH O 7 .   ? 67.522  5.764   192.851 1.00 59.96  ?  1350 HOH F O     1 
HETATM 7300 O  O     . HOH O 7 .   ? 111.402 26.544  178.144 1.00 46.58  ?  1351 HOH F O     1 
HETATM 7301 O  O     . HOH O 7 .   ? 119.763 2.800   172.503 1.00 50.90  ?  1352 HOH F O     1 
HETATM 7302 O  O     . HOH O 7 .   ? 76.016  2.102   185.472 1.00 44.17  ?  1353 HOH F O     1 
HETATM 7303 O  O     . HOH O 7 .   ? 78.431  4.390   183.136 1.00 28.79  ?  1354 HOH F O     1 
HETATM 7304 O  O     . HOH O 7 .   ? 94.509  24.764  189.706 1.00 46.93  ?  1355 HOH F O     1 
HETATM 7305 O  O     . HOH O 7 .   ? 98.348  22.829  187.780 1.00 49.53  ?  1356 HOH F O     1 
HETATM 7306 O  O     . HOH O 7 .   ? 118.467 3.525   178.952 1.00 40.24  ?  1357 HOH F O     1 
HETATM 7307 O  O     . HOH O 7 .   ? 116.635 -1.873  170.821 1.00 51.15  ?  1358 HOH F O     1 
HETATM 7308 O  O     . HOH O 7 .   ? 86.303  8.312   157.973 1.00 64.37  ?  1359 HOH F O     1 
HETATM 7309 O  O     . HOH O 7 .   ? 77.896  22.966  159.802 1.00 48.34  ?  1360 HOH F O     1 
HETATM 7310 O  O     . HOH O 7 .   ? 79.698  1.205   165.027 1.00 47.24  ?  1361 HOH F O     1 
HETATM 7311 O  O     . HOH O 7 .   ? 67.508  26.163  187.926 1.00 43.98  ?  1362 HOH F O     1 
HETATM 7312 O  O     . HOH O 7 .   ? 100.253 -11.434 174.988 1.00 57.47  ?  1363 HOH F O     1 
HETATM 7313 O  O     . HOH O 7 .   ? 100.222 -11.065 179.678 1.00 41.67  ?  1364 HOH F O     1 
HETATM 7314 O  O     . HOH O 7 .   ? 119.848 1.117   166.190 1.00 55.19  ?  1365 HOH F O     1 
HETATM 7315 O  O     . HOH O 7 .   ? 80.526  10.843  142.611 1.00 61.43  ?  1366 HOH F O     1 
HETATM 7316 O  O     . HOH O 7 .   ? 106.495 -12.781 178.138 1.00 57.52  ?  1367 HOH F O     1 
HETATM 7317 O  O     . HOH O 7 .   ? 98.852  -12.297 177.925 1.00 49.47  ?  1368 HOH F O     1 
HETATM 7318 O  O     . HOH O 7 .   ? 108.014 -12.848 181.795 1.00 67.24  ?  1369 HOH F O     1 
HETATM 7319 O  O     . HOH P 7 .   ? 109.568 22.113  136.762 1.00 48.61  ?  1001 HOH A O     1 
HETATM 7320 O  O     . HOH P 7 .   ? 139.086 8.180   113.366 1.00 42.84  ?  1002 HOH A O     1 
HETATM 7321 O  O     . HOH P 7 .   ? 134.978 27.809  118.095 1.00 56.18  ?  1003 HOH A O     1 
HETATM 7322 O  O     . HOH P 7 .   ? 106.039 32.430  146.304 1.00 55.60  ?  1004 HOH A O     1 
HETATM 7323 O  O     . HOH P 7 .   ? 90.465  21.532  112.365 1.00 48.19  ?  1005 HOH A O     1 
HETATM 7324 O  O     . HOH P 7 .   ? 109.060 -1.018  130.734 1.00 45.40  ?  1006 HOH A O     1 
HETATM 7325 O  O     . HOH P 7 .   ? 95.514  10.092  99.226  1.00 45.60  ?  1007 HOH A O     1 
HETATM 7326 O  O     . HOH P 7 .   ? 102.877 -0.887  126.863 1.00 52.29  ?  1008 HOH A O     1 
HETATM 7327 O  O     . HOH P 7 .   ? 111.527 17.189  117.200 1.00 48.25  ?  1009 HOH A O     1 
HETATM 7328 O  O     . HOH P 7 .   ? 134.258 12.723  106.081 1.00 49.04  ?  1010 HOH A O     1 
HETATM 7329 O  O     . HOH P 7 .   ? 104.940 30.341  101.009 1.00 47.04  ?  1011 HOH A O     1 
HETATM 7330 O  O     . HOH P 7 .   ? 91.341  32.445  109.426 1.00 50.52  ?  1012 HOH A O     1 
HETATM 7331 O  O     . HOH P 7 .   ? 100.754 43.114  129.245 1.00 41.22  ?  1013 HOH A O     1 
HETATM 7332 O  O     . HOH P 7 .   ? 102.289 -1.624  122.606 1.00 57.06  ?  1014 HOH A O     1 
HETATM 7333 O  O     . HOH P 7 .   ? 91.936  32.762  120.751 1.00 46.79  ?  1015 HOH A O     1 
HETATM 7334 O  O     . HOH P 7 .   ? 135.474 19.627  126.771 1.00 63.82  ?  1016 HOH A O     1 
HETATM 7335 O  O     . HOH P 7 .   ? 101.584 25.180  127.217 1.00 40.49  ?  1017 HOH A O     1 
HETATM 7336 O  O     . HOH P 7 .   ? 93.114  29.337  101.279 1.00 49.62  ?  1018 HOH A O     1 
HETATM 7337 O  O     . HOH P 7 .   ? 119.566 20.606  153.494 1.00 46.04  ?  1019 HOH A O     1 
HETATM 7338 O  O     . HOH P 7 .   ? 110.009 8.539   155.662 1.00 41.44  ?  1020 HOH A O     1 
HETATM 7339 O  O     . HOH P 7 .   ? 99.222  42.690  123.417 1.00 33.01  ?  1021 HOH A O     1 
HETATM 7340 O  O     . HOH P 7 .   ? 106.929 30.567  112.373 1.00 28.70  ?  1022 HOH A O     1 
HETATM 7341 O  O     . HOH P 7 .   ? 129.213 5.834   112.563 1.00 35.49  ?  1023 HOH A O     1 
HETATM 7342 O  O     . HOH P 7 .   ? 111.465 16.653  154.959 1.00 43.61  ?  1024 HOH A O     1 
HETATM 7343 O  O     . HOH P 7 .   ? 93.151  3.394   140.890 1.00 51.01  ?  1025 HOH A O     1 
HETATM 7344 O  O     . HOH P 7 .   ? 96.939  32.335  112.410 1.00 32.13  ?  1026 HOH A O     1 
HETATM 7345 O  O     . HOH P 7 .   ? 127.165 25.857  104.944 1.00 53.45  ?  1027 HOH A O     1 
HETATM 7346 O  O     . HOH P 7 .   ? 113.033 6.722   106.125 1.00 26.10  ?  1028 HOH A O     1 
HETATM 7347 O  O     . HOH P 7 .   ? 109.801 6.104   132.600 1.00 40.11  ?  1029 HOH A O     1 
HETATM 7348 O  O     . HOH P 7 .   ? 111.281 30.051  146.540 1.00 37.36  ?  1030 HOH A O     1 
HETATM 7349 O  O     . HOH P 7 .   ? 98.230  21.175  155.170 1.00 47.01  ?  1031 HOH A O     1 
HETATM 7350 O  O     . HOH P 7 .   ? 89.924  1.861   133.016 1.00 52.22  ?  1032 HOH A O     1 
HETATM 7351 O  O     . HOH P 7 .   ? 121.737 10.454  99.849  1.00 55.97  ?  1033 HOH A O     1 
HETATM 7352 O  O     . HOH P 7 .   ? 98.029  32.354  131.496 1.00 48.18  ?  1034 HOH A O     1 
HETATM 7353 O  O     . HOH P 7 .   ? 110.749 23.683  111.789 1.00 37.53  ?  1035 HOH A O     1 
HETATM 7354 O  O     . HOH P 7 .   ? 119.529 24.198  140.904 1.00 44.07  ?  1036 HOH A O     1 
HETATM 7355 O  O     . HOH P 7 .   ? 100.515 28.588  103.212 1.00 36.89  ?  1037 HOH A O     1 
HETATM 7356 O  O     . HOH P 7 .   ? 102.475 4.493   116.555 1.00 39.90  ?  1038 HOH A O     1 
HETATM 7357 O  O     . HOH P 7 .   ? 107.701 -4.176  130.598 1.00 47.21  ?  1039 HOH A O     1 
HETATM 7358 O  O     . HOH P 7 .   ? 105.612 6.930   114.911 1.00 27.06  ?  1040 HOH A O     1 
HETATM 7359 O  O     . HOH P 7 .   ? 126.914 29.426  109.265 1.00 41.20  ?  1041 HOH A O     1 
HETATM 7360 O  O     . HOH P 7 .   ? 114.381 39.205  119.030 1.00 51.29  ?  1042 HOH A O     1 
HETATM 7361 O  O     . HOH P 7 .   ? 113.943 8.068   139.422 1.00 30.55  ?  1043 HOH A O     1 
HETATM 7362 O  O     . HOH P 7 .   ? 106.437 0.949   126.663 1.00 46.07  ?  1044 HOH A O     1 
HETATM 7363 O  O     . HOH P 7 .   ? 121.099 20.171  93.305  1.00 48.59  ?  1045 HOH A O     1 
HETATM 7364 O  O     . HOH P 7 .   ? 107.600 4.449   108.122 1.00 36.57  ?  1046 HOH A O     1 
HETATM 7365 O  O     . HOH P 7 .   ? 111.036 4.835   136.468 1.00 38.25  ?  1047 HOH A O     1 
HETATM 7366 O  O     . HOH P 7 .   ? 92.064  14.245  131.525 1.00 43.08  ?  1048 HOH A O     1 
HETATM 7367 O  O     . HOH P 7 .   ? 88.829  26.816  118.286 1.00 51.29  ?  1049 HOH A O     1 
HETATM 7368 O  O     . HOH P 7 .   ? 108.856 10.534  139.002 1.00 32.47  ?  1050 HOH A O     1 
HETATM 7369 O  O     . HOH P 7 .   ? 111.626 10.302  135.975 1.00 30.54  ?  1051 HOH A O     1 
HETATM 7370 O  O     . HOH P 7 .   ? 104.223 20.555  118.756 1.00 42.15  ?  1052 HOH A O     1 
HETATM 7371 O  O     . HOH P 7 .   ? 107.447 2.157   128.747 1.00 43.46  ?  1053 HOH A O     1 
HETATM 7372 O  O     . HOH P 7 .   ? 118.360 27.575  111.385 1.00 50.05  ?  1054 HOH A O     1 
HETATM 7373 O  O     . HOH P 7 .   ? 92.501  10.496  105.051 1.00 45.05  ?  1055 HOH A O     1 
HETATM 7374 O  O     . HOH P 7 .   ? 119.554 23.949  98.839  1.00 53.20  ?  1056 HOH A O     1 
HETATM 7375 O  O     . HOH P 7 .   ? 105.126 3.028   107.973 1.00 37.64  ?  1057 HOH A O     1 
HETATM 7376 O  O     . HOH P 7 .   ? 120.634 13.102  115.101 1.00 42.92  ?  1058 HOH A O     1 
HETATM 7377 O  O     . HOH P 7 .   ? 99.978  5.129   151.501 1.00 38.43  ?  1059 HOH A O     1 
HETATM 7378 O  O     . HOH P 7 .   ? 91.624  20.560  100.650 1.00 49.62  ?  1060 HOH A O     1 
HETATM 7379 O  O     . HOH P 7 .   ? 106.662 -2.922  110.615 1.00 40.63  ?  1061 HOH A O     1 
HETATM 7380 O  O     . HOH P 7 .   ? 112.864 28.454  131.537 1.00 44.07  ?  1062 HOH A O     1 
HETATM 7381 O  O     . HOH P 7 .   ? 121.164 23.973  147.031 1.00 25.65  ?  1063 HOH A O     1 
HETATM 7382 O  O     . HOH P 7 .   ? 131.036 19.671  103.836 1.00 35.52  ?  1064 HOH A O     1 
HETATM 7383 O  O     . HOH P 7 .   ? 103.783 2.253   105.995 1.00 50.32  ?  1065 HOH A O     1 
HETATM 7384 O  O     . HOH P 7 .   ? 119.147 9.489   101.652 1.00 32.58  ?  1066 HOH A O     1 
HETATM 7385 O  O     . HOH P 7 .   ? 100.162 13.136  131.108 1.00 40.51  ?  1067 HOH A O     1 
HETATM 7386 O  O     . HOH P 7 .   ? 96.833  16.708  153.678 1.00 37.56  ?  1068 HOH A O     1 
HETATM 7387 O  O     . HOH P 7 .   ? 103.301 27.531  136.655 1.00 37.32  ?  1069 HOH A O     1 
HETATM 7388 O  O     . HOH P 7 .   ? 101.816 -0.243  130.665 1.00 28.57  ?  1070 HOH A O     1 
HETATM 7389 O  O     . HOH P 7 .   ? 112.543 7.453   115.610 1.00 28.34  ?  1071 HOH A O     1 
HETATM 7390 O  O     . HOH P 7 .   ? 113.932 8.719   149.341 1.00 38.53  ?  1072 HOH A O     1 
HETATM 7391 O  O     . HOH P 7 .   ? 95.924  17.559  99.853  1.00 55.54  ?  1073 HOH A O     1 
HETATM 7392 O  O     . HOH P 7 .   ? 101.512 27.871  140.013 1.00 33.63  ?  1074 HOH A O     1 
HETATM 7393 O  O     . HOH P 7 .   ? 109.830 22.064  115.677 1.00 55.40  ?  1075 HOH A O     1 
HETATM 7394 O  O     . HOH P 7 .   ? 94.260  30.404  125.312 1.00 40.96  ?  1076 HOH A O     1 
HETATM 7395 O  O     . HOH P 7 .   ? 121.979 7.720   114.430 1.00 59.40  ?  1077 HOH A O     1 
HETATM 7396 O  O     . HOH P 7 .   ? 108.917 24.177  138.512 1.00 23.56  ?  1078 HOH A O     1 
HETATM 7397 O  O     . HOH P 7 .   ? 91.701  23.701  116.344 1.00 37.93  ?  1079 HOH A O     1 
HETATM 7398 O  O     . HOH P 7 .   ? 102.101 2.288   110.861 1.00 48.00  ?  1080 HOH A O     1 
HETATM 7399 O  O     . HOH P 7 .   ? 108.965 18.190  133.254 1.00 31.96  ?  1081 HOH A O     1 
HETATM 7400 O  O     . HOH P 7 .   ? 100.331 28.073  111.915 1.00 36.70  ?  1082 HOH A O     1 
HETATM 7401 O  O     . HOH P 7 .   ? 103.764 27.305  152.091 1.00 48.95  ?  1083 HOH A O     1 
HETATM 7402 O  O     . HOH P 7 .   ? 107.023 21.001  135.351 1.00 22.93  ?  1084 HOH A O     1 
HETATM 7403 O  O     . HOH P 7 .   ? 113.013 21.848  94.582  1.00 38.29  ?  1085 HOH A O     1 
HETATM 7404 O  O     . HOH P 7 .   ? 116.051 10.064  95.452  1.00 58.71  ?  1086 HOH A O     1 
HETATM 7405 O  O     . HOH P 7 .   ? 96.089  -4.093  127.696 1.00 59.75  ?  1087 HOH A O     1 
HETATM 7406 O  O     . HOH P 7 .   ? 101.866 11.898  89.970  1.00 45.87  ?  1088 HOH A O     1 
HETATM 7407 O  O     . HOH P 7 .   ? 102.095 7.821   112.078 1.00 34.07  ?  1089 HOH A O     1 
HETATM 7408 O  O     . HOH P 7 .   ? 112.660 7.593   135.176 1.00 39.64  ?  1090 HOH A O     1 
HETATM 7409 O  O     . HOH P 7 .   ? 112.575 4.816   102.674 1.00 40.84  ?  1091 HOH A O     1 
HETATM 7410 O  O     . HOH P 7 .   ? 113.763 17.443  155.212 1.00 39.05  ?  1092 HOH A O     1 
HETATM 7411 O  O     . HOH P 7 .   ? 111.793 17.756  94.445  1.00 41.73  ?  1093 HOH A O     1 
HETATM 7412 O  O     . HOH P 7 .   ? 112.658 7.703   156.104 1.00 43.59  ?  1094 HOH A O     1 
HETATM 7413 O  O     . HOH P 7 .   ? 106.002 9.139   116.596 1.00 28.95  ?  1095 HOH A O     1 
HETATM 7414 O  O     . HOH P 7 .   ? 117.809 23.604  113.685 1.00 37.94  ?  1096 HOH A O     1 
HETATM 7415 O  O     . HOH P 7 .   ? 111.683 15.181  94.892  1.00 36.81  ?  1097 HOH A O     1 
HETATM 7416 O  O     . HOH P 7 .   ? 100.937 38.220  113.522 1.00 42.33  ?  1098 HOH A O     1 
HETATM 7417 O  O     . HOH P 7 .   ? 135.526 27.182  114.444 1.00 46.66  ?  1099 HOH A O     1 
HETATM 7418 O  O     . HOH P 7 .   ? 97.432  14.509  117.235 1.00 37.17  ?  1100 HOH A O     1 
HETATM 7419 O  O     . HOH P 7 .   ? 121.193 14.935  122.617 1.00 44.98  ?  1101 HOH A O     1 
HETATM 7420 O  O     . HOH P 7 .   ? 93.738  17.532  148.193 1.00 39.04  ?  1102 HOH A O     1 
HETATM 7421 O  O     . HOH P 7 .   ? 109.162 28.641  119.759 1.00 44.08  ?  1103 HOH A O     1 
HETATM 7422 O  O     . HOH P 7 .   ? 122.922 13.196  103.415 1.00 58.47  ?  1104 HOH A O     1 
HETATM 7423 O  O     . HOH P 7 .   ? 117.371 9.916   108.382 1.00 23.53  ?  1105 HOH A O     1 
HETATM 7424 O  O     . HOH P 7 .   ? 104.060 33.504  143.125 1.00 39.90  ?  1106 HOH A O     1 
HETATM 7425 O  O     . HOH P 7 .   ? 132.502 14.093  110.387 1.00 41.58  ?  1107 HOH A O     1 
HETATM 7426 O  O     . HOH P 7 .   ? 135.844 24.356  109.217 1.00 41.82  ?  1108 HOH A O     1 
HETATM 7427 O  O     . HOH P 7 .   ? 138.710 26.475  125.940 1.00 52.14  ?  1109 HOH A O     1 
HETATM 7428 O  O     . HOH P 7 .   ? 94.108  25.639  96.815  1.00 51.90  ?  1110 HOH A O     1 
HETATM 7429 O  O     . HOH P 7 .   ? 108.080 6.811   122.937 1.00 39.38  ?  1111 HOH A O     1 
HETATM 7430 O  O     . HOH P 7 .   ? 109.675 22.587  156.120 1.00 43.25  ?  1112 HOH A O     1 
HETATM 7431 O  O     . HOH P 7 .   ? 110.733 27.718  144.283 1.00 25.89  ?  1113 HOH A O     1 
HETATM 7432 O  O     . HOH P 7 .   ? 101.935 37.847  134.904 1.00 45.52  ?  1114 HOH A O     1 
HETATM 7433 O  O     . HOH P 7 .   ? 103.578 0.224   148.781 1.00 47.31  ?  1115 HOH A O     1 
HETATM 7434 O  O     . HOH P 7 .   ? 115.978 12.438  139.358 1.00 23.61  ?  1116 HOH A O     1 
HETATM 7435 O  O     . HOH P 7 .   ? 89.363  17.629  102.528 1.00 52.28  ?  1117 HOH A O     1 
HETATM 7436 O  O     . HOH P 7 .   ? 94.684  8.403   150.503 1.00 56.85  ?  1118 HOH A O     1 
HETATM 7437 O  O     . HOH P 7 .   ? 106.353 5.959   153.519 1.00 37.25  ?  1119 HOH A O     1 
HETATM 7438 O  O     . HOH P 7 .   ? 123.038 7.090   111.292 1.00 32.93  ?  1120 HOH A O     1 
HETATM 7439 O  O     . HOH P 7 .   ? 107.913 11.201  131.091 1.00 28.82  ?  1121 HOH A O     1 
HETATM 7440 O  O     . HOH P 7 .   ? 109.360 39.049  115.165 1.00 30.07  ?  1122 HOH A O     1 
HETATM 7441 O  O     . HOH P 7 .   ? 115.931 29.138  143.011 1.00 33.67  ?  1123 HOH A O     1 
HETATM 7442 O  O     . HOH P 7 .   ? 113.528 22.213  135.543 1.00 45.03  ?  1124 HOH A O     1 
HETATM 7443 O  O     . HOH P 7 .   ? 111.491 27.662  150.300 1.00 29.36  ?  1125 HOH A O     1 
HETATM 7444 O  O     . HOH P 7 .   ? 99.731  27.781  144.320 1.00 40.90  ?  1126 HOH A O     1 
HETATM 7445 O  O     . HOH P 7 .   ? 90.410  9.365   137.504 1.00 40.87  ?  1127 HOH A O     1 
HETATM 7446 O  O     . HOH P 7 .   ? 132.250 27.408  125.461 1.00 40.66  ?  1128 HOH A O     1 
HETATM 7447 O  O     . HOH P 7 .   ? 115.419 14.810  137.841 1.00 28.89  ?  1129 HOH A O     1 
HETATM 7448 O  O     . HOH P 7 .   ? 112.204 4.741   115.819 1.00 47.38  ?  1130 HOH A O     1 
HETATM 7449 O  O     . HOH P 7 .   ? 97.855  39.617  129.463 1.00 49.67  ?  1131 HOH A O     1 
HETATM 7450 O  O     . HOH P 7 .   ? 126.492 13.325  102.857 1.00 47.90  ?  1132 HOH A O     1 
HETATM 7451 O  O     . HOH P 7 .   ? 128.183 17.977  95.115  1.00 48.17  ?  1133 HOH A O     1 
HETATM 7452 O  O     . HOH P 7 .   ? 116.439 9.807   116.970 1.00 49.07  ?  1134 HOH A O     1 
HETATM 7453 O  O     . HOH P 7 .   ? 127.674 20.763  97.730  1.00 29.99  ?  1135 HOH A O     1 
HETATM 7454 O  O     . HOH P 7 .   ? 124.967 26.172  105.670 1.00 48.44  ?  1136 HOH A O     1 
HETATM 7455 O  O     . HOH P 7 .   ? 140.836 14.969  115.963 1.00 45.39  ?  1137 HOH A O     1 
HETATM 7456 O  O     . HOH P 7 .   ? 102.417 6.869   96.588  1.00 47.52  ?  1138 HOH A O     1 
HETATM 7457 O  O     . HOH P 7 .   ? 107.458 30.554  147.825 1.00 33.95  ?  1139 HOH A O     1 
HETATM 7458 O  O     . HOH P 7 .   ? 129.639 24.552  119.084 1.00 33.14  ?  1140 HOH A O     1 
HETATM 7459 O  O     . HOH P 7 .   ? 100.749 20.160  158.581 1.00 39.32  ?  1141 HOH A O     1 
HETATM 7460 O  O     . HOH P 7 .   ? 107.896 3.555   120.601 1.00 45.03  ?  1142 HOH A O     1 
HETATM 7461 O  O     . HOH P 7 .   ? 119.331 15.295  114.809 1.00 39.78  ?  1143 HOH A O     1 
HETATM 7462 O  O     . HOH P 7 .   ? 110.688 18.840  136.024 1.00 40.52  ?  1144 HOH A O     1 
HETATM 7463 O  O     . HOH P 7 .   ? 91.816  16.324  141.001 1.00 49.13  ?  1145 HOH A O     1 
HETATM 7464 O  O     . HOH P 7 .   ? 97.179  44.878  109.790 1.00 56.82  ?  1146 HOH A O     1 
HETATM 7465 O  O     . HOH P 7 .   ? 118.650 18.344  140.827 1.00 43.49  ?  1147 HOH A O     1 
HETATM 7466 O  O     . HOH P 7 .   ? 117.515 22.605  96.331  1.00 40.99  ?  1148 HOH A O     1 
HETATM 7467 O  O     . HOH P 7 .   ? 113.203 32.634  100.405 1.00 36.99  ?  1149 HOH A O     1 
HETATM 7468 O  O     . HOH P 7 .   ? 105.193 1.963   124.533 1.00 37.98  ?  1150 HOH A O     1 
HETATM 7469 O  O     . HOH P 7 .   ? 94.956  3.399   143.955 1.00 35.55  ?  1151 HOH A O     1 
HETATM 7470 O  O     . HOH P 7 .   ? 120.089 18.836  145.931 1.00 45.67  ?  1152 HOH A O     1 
HETATM 7471 O  O     . HOH P 7 .   ? 111.699 26.412  105.298 1.00 29.27  ?  1153 HOH A O     1 
HETATM 7472 O  O     . HOH P 7 .   ? 93.185  -4.008  136.381 1.00 60.15  ?  1154 HOH A O     1 
HETATM 7473 O  O     . HOH P 7 .   ? 134.991 21.265  126.176 1.00 47.67  ?  1155 HOH A O     1 
HETATM 7474 O  O     . HOH P 7 .   ? 114.239 3.210   104.462 1.00 50.19  ?  1156 HOH A O     1 
HETATM 7475 O  O     . HOH P 7 .   ? 109.577 14.470  90.373  1.00 52.12  ?  1157 HOH A O     1 
HETATM 7476 O  O     . HOH P 7 .   ? 113.499 4.826   138.291 1.00 39.37  ?  1158 HOH A O     1 
HETATM 7477 O  O     . HOH P 7 .   ? 103.441 18.473  121.404 1.00 53.43  ?  1159 HOH A O     1 
HETATM 7478 O  O     . HOH P 7 .   ? 115.663 15.071  154.024 1.00 35.02  ?  1160 HOH A O     1 
HETATM 7479 O  O     . HOH P 7 .   ? 90.641  23.380  124.430 1.00 51.54  ?  1161 HOH A O     1 
HETATM 7480 O  O     . HOH P 7 .   ? 134.142 30.657  117.745 1.00 47.39  ?  1162 HOH A O     1 
HETATM 7481 O  O     . HOH P 7 .   ? 116.199 3.503   111.895 1.00 39.00  ?  1163 HOH A O     1 
HETATM 7482 O  O     . HOH P 7 .   ? 129.423 26.325  101.763 1.00 54.27  ?  1164 HOH A O     1 
HETATM 7483 O  O     . HOH P 7 .   ? 120.610 7.636   104.786 1.00 44.68  ?  1165 HOH A O     1 
HETATM 7484 O  O     . HOH P 7 .   ? 133.974 29.543  114.881 1.00 57.41  ?  1166 HOH A O     1 
HETATM 7485 O  O     . HOH P 7 .   ? 100.837 26.517  105.089 1.00 35.20  ?  1167 HOH A O     1 
HETATM 7486 O  O     . HOH P 7 .   ? 105.908 13.825  137.091 1.00 29.91  ?  1168 HOH A O     1 
HETATM 7487 O  O     . HOH P 7 .   ? 102.178 16.024  114.271 1.00 27.56  ?  1169 HOH A O     1 
HETATM 7488 O  O     . HOH P 7 .   ? 106.006 45.194  132.075 1.00 44.72  ?  1170 HOH A O     1 
HETATM 7489 O  O     . HOH P 7 .   ? 92.360  13.446  119.908 1.00 48.46  ?  1171 HOH A O     1 
HETATM 7490 O  O     . HOH P 7 .   ? 109.415 -2.281  143.796 1.00 34.96  ?  1172 HOH A O     1 
HETATM 7491 O  O     . HOH P 7 .   ? 116.516 28.257  147.541 1.00 24.95  ?  1173 HOH A O     1 
HETATM 7492 O  O     . HOH P 7 .   ? 114.605 25.289  98.288  1.00 33.08  ?  1174 HOH A O     1 
HETATM 7493 O  O     . HOH P 7 .   ? 112.848 10.946  114.646 1.00 43.56  ?  1175 HOH A O     1 
HETATM 7494 O  O     . HOH P 7 .   ? 126.015 26.229  128.539 1.00 62.31  ?  1176 HOH A O     1 
HETATM 7495 O  O     . HOH P 7 .   ? 98.263  14.967  95.180  1.00 49.52  ?  1177 HOH A O     1 
HETATM 7496 O  O     . HOH P 7 .   ? 101.503 33.781  105.878 1.00 33.75  ?  1178 HOH A O     1 
HETATM 7497 O  O     . HOH P 7 .   ? 101.897 -5.451  135.391 1.00 35.56  ?  1179 HOH A O     1 
HETATM 7498 O  O     . HOH P 7 .   ? 129.129 22.957  128.447 1.00 41.67  ?  1180 HOH A O     1 
HETATM 7499 O  O     . HOH P 7 .   ? 115.485 37.056  124.060 1.00 54.15  ?  1181 HOH A O     1 
HETATM 7500 O  O     . HOH P 7 .   ? 109.619 5.999   120.676 1.00 40.17  ?  1182 HOH A O     1 
HETATM 7501 O  O     . HOH P 7 .   ? 103.408 27.891  129.642 1.00 29.84  ?  1183 HOH A O     1 
HETATM 7502 O  O     . HOH P 7 .   ? 90.584  0.958   140.526 1.00 57.90  ?  1184 HOH A O     1 
HETATM 7503 O  O     . HOH P 7 .   ? 124.142 23.824  99.478  1.00 35.22  ?  1185 HOH A O     1 
HETATM 7504 O  O     . HOH P 7 .   ? 99.176  0.549   126.493 1.00 57.18  ?  1186 HOH A O     1 
HETATM 7505 O  O     . HOH P 7 .   ? 111.014 30.644  120.792 1.00 39.97  ?  1187 HOH A O     1 
HETATM 7506 O  O     . HOH P 7 .   ? 113.549 4.147   113.095 1.00 48.72  ?  1188 HOH A O     1 
HETATM 7507 O  O     . HOH P 7 .   ? 96.742  9.647   127.616 1.00 60.25  ?  1189 HOH A O     1 
HETATM 7508 O  O     . HOH P 7 .   ? 114.911 30.149  99.503  1.00 51.97  ?  1190 HOH A O     1 
HETATM 7509 O  O     . HOH P 7 .   ? 89.935  15.648  116.177 1.00 51.28  ?  1191 HOH A O     1 
HETATM 7510 O  O     . HOH P 7 .   ? 99.499  13.990  92.388  1.00 46.08  ?  1192 HOH A O     1 
HETATM 7511 O  O     . HOH P 7 .   ? 99.312  31.304  103.102 1.00 39.80  ?  1193 HOH A O     1 
HETATM 7512 O  O     . HOH P 7 .   ? 96.382  -0.872  142.086 1.00 39.27  ?  1194 HOH A O     1 
HETATM 7513 O  O     . HOH P 7 .   ? 107.074 0.473   147.373 1.00 42.68  ?  1195 HOH A O     1 
HETATM 7514 O  O     . HOH P 7 .   ? 136.163 20.741  106.679 1.00 47.14  ?  1196 HOH A O     1 
HETATM 7515 O  O     . HOH P 7 .   ? 111.364 27.277  98.399  1.00 49.91  ?  1197 HOH A O     1 
HETATM 7516 O  O     . HOH P 7 .   ? 113.470 5.385   150.028 1.00 41.78  ?  1198 HOH A O     1 
HETATM 7517 O  O     . HOH P 7 .   ? 112.954 3.221   144.368 1.00 41.78  ?  1199 HOH A O     1 
HETATM 7518 O  O     . HOH P 7 .   ? 99.660  28.230  134.471 1.00 64.55  ?  1200 HOH A O     1 
HETATM 7519 O  O     . HOH P 7 .   ? 121.668 15.779  93.789  1.00 34.39  ?  1201 HOH A O     1 
HETATM 7520 O  O     . HOH P 7 .   ? 94.676  12.068  112.833 1.00 34.56  ?  1202 HOH A O     1 
HETATM 7521 O  O     . HOH P 7 .   ? 127.431 29.497  115.895 1.00 41.29  ?  1203 HOH A O     1 
HETATM 7522 O  O     . HOH P 7 .   ? 100.191 12.096  119.829 1.00 48.85  ?  1204 HOH A O     1 
HETATM 7523 O  O     . HOH P 7 .   ? 89.716  39.767  122.293 1.00 45.75  ?  1205 HOH A O     1 
HETATM 7524 O  O     . HOH P 7 .   ? 102.577 21.538  94.678  1.00 46.64  ?  1206 HOH A O     1 
HETATM 7525 O  O     . HOH P 7 .   ? 115.452 14.614  114.695 1.00 27.35  ?  1207 HOH A O     1 
HETATM 7526 O  O     . HOH P 7 .   ? 100.712 28.001  100.449 1.00 46.99  ?  1208 HOH A O     1 
HETATM 7527 O  O     . HOH P 7 .   ? 98.456  10.160  110.326 1.00 37.48  ?  1209 HOH A O     1 
HETATM 7528 O  O     . HOH P 7 .   ? 127.693 25.496  117.187 1.00 29.31  ?  1210 HOH A O     1 
HETATM 7529 O  O     . HOH P 7 .   ? 100.409 26.020  96.760  1.00 51.85  ?  1211 HOH A O     1 
HETATM 7530 O  O     . HOH P 7 .   ? 97.777  10.836  116.102 1.00 38.91  ?  1212 HOH A O     1 
HETATM 7531 O  O     . HOH P 7 .   ? 101.457 26.652  147.978 1.00 32.39  ?  1213 HOH A O     1 
HETATM 7532 O  O     . HOH P 7 .   ? 108.270 43.296  139.203 1.00 58.94  ?  1214 HOH A O     1 
HETATM 7533 O  O     . HOH P 7 .   ? 108.066 6.122   100.850 1.00 34.88  ?  1215 HOH A O     1 
HETATM 7534 O  O     . HOH P 7 .   ? 88.505  24.732  102.916 1.00 55.21  ?  1216 HOH A O     1 
HETATM 7535 O  O     . HOH P 7 .   ? 102.549 17.937  157.767 1.00 26.06  ?  1217 HOH A O     1 
HETATM 7536 O  O     . HOH P 7 .   ? 122.810 8.658   105.736 1.00 27.63  ?  1218 HOH A O     1 
HETATM 7537 O  O     . HOH P 7 .   ? 120.322 11.025  116.463 1.00 54.85  ?  1219 HOH A O     1 
HETATM 7538 O  O     . HOH P 7 .   ? 105.526 43.584  114.501 1.00 49.08  ?  1220 HOH A O     1 
HETATM 7539 O  O     . HOH P 7 .   ? 104.516 -5.289  135.709 1.00 45.54  ?  1221 HOH A O     1 
HETATM 7540 O  O     . HOH P 7 .   ? 109.062 28.811  100.165 1.00 34.63  ?  1222 HOH A O     1 
HETATM 7541 O  O     . HOH P 7 .   ? 100.948 1.828   102.953 1.00 63.16  ?  1223 HOH A O     1 
HETATM 7542 O  O     . HOH P 7 .   ? 110.099 47.156  130.991 1.00 50.26  ?  1224 HOH A O     1 
HETATM 7543 O  O     . HOH P 7 .   ? 114.422 6.910   114.059 1.00 49.92  ?  1225 HOH A O     1 
HETATM 7544 O  O     . HOH P 7 .   ? 101.346 4.085   124.624 1.00 49.72  ?  1226 HOH A O     1 
HETATM 7545 O  O     . HOH P 7 .   ? 110.677 5.276   94.396  1.00 61.61  ?  1227 HOH A O     1 
HETATM 7546 O  O     . HOH P 7 .   ? 103.136 45.935  131.703 1.00 51.03  ?  1228 HOH A O     1 
HETATM 7547 O  O     . HOH P 7 .   ? 129.266 4.366   119.417 1.00 40.71  ?  1229 HOH A O     1 
HETATM 7548 O  O     . HOH P 7 .   ? 107.953 5.610   136.758 1.00 17.47  ?  1230 HOH A O     1 
HETATM 7549 O  O     . HOH P 7 .   ? 111.378 -1.713  135.571 1.00 42.00  ?  1231 HOH A O     1 
HETATM 7550 O  O     . HOH P 7 .   ? 110.828 3.881   145.746 1.00 43.80  ?  1232 HOH A O     1 
HETATM 7551 O  O     . HOH P 7 .   ? 107.577 2.358   110.455 1.00 32.41  ?  1233 HOH A O     1 
HETATM 7552 O  O     . HOH P 7 .   ? 114.766 42.265  119.872 1.00 48.72  ?  1234 HOH A O     1 
HETATM 7553 O  O     . HOH P 7 .   ? 105.090 46.027  124.297 1.00 37.16  ?  1235 HOH A O     1 
HETATM 7554 O  O     . HOH P 7 .   ? 109.205 1.074   117.037 1.00 48.04  ?  1236 HOH A O     1 
HETATM 7555 O  O     . HOH P 7 .   ? 102.627 7.205   114.559 1.00 34.64  ?  1237 HOH A O     1 
HETATM 7556 O  O     . HOH P 7 .   ? 138.109 13.993  107.190 1.00 45.21  ?  1238 HOH A O     1 
HETATM 7557 O  O     . HOH P 7 .   ? 108.129 33.995  135.605 1.00 41.11  ?  1239 HOH A O     1 
HETATM 7558 O  O     . HOH P 7 .   ? 119.502 7.258   103.054 1.00 50.86  ?  1240 HOH A O     1 
HETATM 7559 O  O     . HOH P 7 .   ? 115.568 5.843   148.133 1.00 47.68  ?  1241 HOH A O     1 
HETATM 7560 O  O     . HOH P 7 .   ? 109.901 20.584  135.462 1.00 40.43  ?  1242 HOH A O     1 
HETATM 7561 O  O     . HOH P 7 .   ? 130.993 3.076   119.079 1.00 47.25  ?  1243 HOH A O     1 
HETATM 7562 O  O     . HOH P 7 .   ? 99.597  30.559  110.848 1.00 47.34  ?  1244 HOH A O     1 
HETATM 7563 O  O     . HOH P 7 .   ? 102.345 36.170  114.288 1.00 31.75  ?  1245 HOH A O     1 
HETATM 7564 O  O     . HOH P 7 .   ? 113.841 16.551  116.977 1.00 45.89  ?  1246 HOH A O     1 
HETATM 7565 O  O     . HOH P 7 .   ? 98.026  6.500   104.928 1.00 47.20  ?  1247 HOH A O     1 
HETATM 7566 O  O     . HOH P 7 .   ? 102.519 32.921  108.333 1.00 38.87  ?  1248 HOH A O     1 
HETATM 7567 O  O     . HOH P 7 .   ? 95.506  2.853   146.656 1.00 36.87  ?  1249 HOH A O     1 
HETATM 7568 O  O     . HOH P 7 .   ? 95.284  11.508  115.398 1.00 60.18  ?  1250 HOH A O     1 
HETATM 7569 O  O     . HOH P 7 .   ? 90.613  15.873  109.136 1.00 48.60  ?  1251 HOH A O     1 
HETATM 7570 O  O     . HOH P 7 .   ? 123.665 10.368  103.775 1.00 39.20  ?  1252 HOH A O     1 
HETATM 7571 O  O     . HOH P 7 .   ? 93.772  16.394  99.700  1.00 41.20  ?  1253 HOH A O     1 
HETATM 7572 O  O     . HOH P 7 .   ? 118.440 16.795  145.847 1.00 38.85  ?  1254 HOH A O     1 
HETATM 7573 O  O     . HOH P 7 .   ? 108.462 3.790   101.653 1.00 37.87  ?  1255 HOH A O     1 
HETATM 7574 O  O     . HOH P 7 .   ? 114.030 38.887  116.825 1.00 41.87  ?  1256 HOH A O     1 
HETATM 7575 O  O     . HOH P 7 .   ? 142.182 7.086   114.984 1.00 52.59  ?  1257 HOH A O     1 
HETATM 7576 O  O     . HOH P 7 .   ? 98.251  31.438  134.409 1.00 42.08  ?  1258 HOH A O     1 
HETATM 7577 O  O     . HOH P 7 .   ? 122.854 2.786   103.492 1.00 55.51  ?  1259 HOH A O     1 
HETATM 7578 O  O     . HOH P 7 .   ? 109.365 -3.398  135.842 1.00 43.29  ?  1260 HOH A O     1 
HETATM 7579 O  O     . HOH P 7 .   ? 91.874  23.086  113.628 1.00 38.00  ?  1261 HOH A O     1 
HETATM 7580 O  O     . HOH P 7 .   ? 108.226 2.790   148.510 1.00 57.18  ?  1262 HOH A O     1 
HETATM 7581 O  O     . HOH P 7 .   ? 133.839 29.254  112.390 1.00 50.07  ?  1263 HOH A O     1 
HETATM 7582 O  O     . HOH P 7 .   ? 110.345 15.641  156.495 1.00 52.17  ?  1264 HOH A O     1 
HETATM 7583 O  O     . HOH P 7 .   ? 108.247 25.314  95.451  1.00 55.98  ?  1265 HOH A O     1 
HETATM 7584 O  O     . HOH P 7 .   ? 117.649 25.824  110.764 1.00 42.91  ?  1266 HOH A O     1 
HETATM 7585 O  O     . HOH P 7 .   ? 125.119 5.247   110.562 1.00 48.55  ?  1267 HOH A O     1 
HETATM 7586 O  O     . HOH P 7 .   ? 110.783 24.706  97.344  1.00 37.00  ?  1268 HOH A O     1 
HETATM 7587 O  O     . HOH P 7 .   ? 102.102 14.124  120.259 1.00 45.09  ?  1269 HOH A O     1 
HETATM 7588 O  O     . HOH P 7 .   ? 100.734 27.576  146.375 1.00 36.15  ?  1270 HOH A O     1 
HETATM 7589 O  O     . HOH P 7 .   ? 100.192 36.397  111.491 1.00 49.51  ?  1271 HOH A O     1 
HETATM 7590 O  O     . HOH P 7 .   ? 103.242 49.804  128.755 1.00 47.57  ?  1272 HOH A O     1 
HETATM 7591 O  O     . HOH P 7 .   ? 127.935 30.607  107.270 1.00 42.51  ?  1273 HOH A O     1 
HETATM 7592 O  O     . HOH P 7 .   ? 96.338  30.543  99.704  1.00 40.13  ?  1274 HOH A O     1 
HETATM 7593 O  O     . HOH P 7 .   ? 122.351 14.572  117.720 1.00 61.41  ?  1275 HOH A O     1 
HETATM 7594 O  O     . HOH P 7 .   ? 90.875  34.632  122.644 1.00 50.58  ?  1276 HOH A O     1 
HETATM 7595 O  O     . HOH P 7 .   ? 111.961 14.609  135.021 1.00 36.35  ?  1277 HOH A O     1 
HETATM 7596 O  O     . HOH P 7 .   ? 118.193 15.084  147.155 1.00 59.58  ?  1278 HOH A O     1 
HETATM 7597 O  O     . HOH P 7 .   ? 138.307 9.633   111.442 1.00 43.12  ?  1279 HOH A O     1 
HETATM 7598 O  O     . HOH P 7 .   ? 122.216 24.818  120.966 1.00 43.21  ?  1280 HOH A O     1 
HETATM 7599 O  O     . HOH P 7 .   ? 109.668 -7.082  127.461 1.00 56.21  ?  1281 HOH A O     1 
HETATM 7600 O  O     . HOH P 7 .   ? 118.321 22.078  117.037 1.00 38.06  ?  1282 HOH A O     1 
HETATM 7601 O  O     . HOH P 7 .   ? 112.185 28.353  153.606 1.00 45.06  ?  1283 HOH A O     1 
HETATM 7602 O  O     . HOH P 7 .   ? 112.385 29.968  144.527 1.00 41.65  ?  1284 HOH A O     1 
HETATM 7603 O  O     . HOH P 7 .   ? 119.667 20.506  150.907 1.00 31.72  ?  1285 HOH A O     1 
HETATM 7604 O  O     . HOH P 7 .   ? 91.408  9.033   144.277 1.00 66.28  ?  1286 HOH A O     1 
HETATM 7605 O  O     . HOH P 7 .   ? 110.056 11.752  132.554 1.00 27.31  ?  1287 HOH A O     1 
HETATM 7606 O  O     . HOH P 7 .   ? 112.519 3.475   100.739 1.00 63.27  ?  1288 HOH A O     1 
HETATM 7607 O  O     . HOH P 7 .   ? 136.890 18.665  105.656 1.00 56.44  ?  1289 HOH A O     1 
HETATM 7608 O  O     . HOH P 7 .   ? 88.342  16.180  104.440 1.00 58.08  ?  1290 HOH A O     1 
HETATM 7609 O  O     . HOH P 7 .   ? 114.025 12.654  116.268 1.00 44.64  ?  1291 HOH A O     1 
HETATM 7610 O  O     . HOH P 7 .   ? 114.761 30.228  146.658 1.00 33.15  ?  1292 HOH A O     1 
HETATM 7611 O  O     . HOH P 7 .   ? 119.480 25.328  124.047 1.00 51.62  ?  1293 HOH A O     1 
HETATM 7612 O  O     . HOH P 7 .   ? 93.147  21.689  99.511  1.00 49.61  ?  1294 HOH A O     1 
HETATM 7613 O  O     . HOH P 7 .   ? 111.636 14.251  91.826  1.00 63.72  ?  1295 HOH A O     1 
HETATM 7614 O  O     . HOH P 7 .   ? 95.545  10.512  110.903 1.00 49.85  ?  1296 HOH A O     1 
HETATM 7615 O  O     . HOH P 7 .   ? 96.716  37.917  131.490 1.00 70.56  ?  1297 HOH A O     1 
HETATM 7616 O  O     . HOH P 7 .   ? 110.278 0.456   94.769  1.00 49.35  ?  1298 HOH A O     1 
HETATM 7617 O  O     . HOH P 7 .   ? 131.930 23.796  128.211 1.00 43.44  ?  1299 HOH A O     1 
HETATM 7618 O  O     . HOH P 7 .   ? 111.387 37.814  115.729 1.00 50.67  ?  1300 HOH A O     1 
HETATM 7619 O  O     . HOH P 7 .   ? 107.237 1.597   122.356 1.00 43.18  ?  1301 HOH A O     1 
HETATM 7620 O  O     . HOH P 7 .   ? 125.110 26.096  101.041 1.00 44.49  ?  1302 HOH A O     1 
HETATM 7621 O  O     . HOH P 7 .   ? 123.035 14.490  93.054  1.00 56.59  ?  1303 HOH A O     1 
HETATM 7622 O  O     . HOH P 7 .   ? 114.005 26.733  153.729 1.00 43.87  ?  1304 HOH A O     1 
HETATM 7623 O  O     . HOH P 7 .   ? 120.383 18.136  150.174 1.00 42.97  ?  1305 HOH A O     1 
HETATM 7624 O  O     . HOH P 7 .   ? 124.722 6.739   104.890 1.00 41.69  ?  1306 HOH A O     1 
HETATM 7625 O  O     . HOH P 7 .   ? 101.677 30.688  100.302 1.00 56.46  ?  1307 HOH A O     1 
HETATM 7626 O  O     . HOH P 7 .   ? 98.362  45.250  122.668 1.00 42.82  ?  1308 HOH A O     1 
HETATM 7627 O  O     . HOH P 7 .   ? 102.045 28.226  134.277 1.00 44.86  ?  1309 HOH A O     1 
HETATM 7628 O  O     . HOH P 7 .   ? 110.221 5.257   130.246 1.00 49.32  ?  1310 HOH A O     1 
HETATM 7629 O  O     . HOH P 7 .   ? 100.662 2.978   109.382 1.00 62.76  ?  1311 HOH A O     1 
HETATM 7630 O  O     . HOH P 7 .   ? 98.778  33.278  105.368 1.00 42.90  ?  1312 HOH A O     1 
HETATM 7631 O  O     . HOH P 7 .   ? 132.274 26.529  128.116 1.00 71.50  ?  1313 HOH A O     1 
HETATM 7632 O  O     . HOH P 7 .   ? 112.542 4.495   133.850 1.00 53.55  ?  1314 HOH A O     1 
HETATM 7633 O  O     . HOH P 7 .   ? 99.102  9.590   114.630 1.00 51.63  ?  1315 HOH A O     1 
HETATM 7634 O  O     . HOH P 7 .   ? 116.680 14.952  119.160 1.00 51.91  ?  1316 HOH A O     1 
HETATM 7635 O  O     . HOH P 7 .   ? 111.999 17.972  133.681 1.00 46.47  ?  1317 HOH A O     1 
HETATM 7636 O  O     . HOH P 7 .   ? 113.742 19.864  134.186 1.00 37.68  ?  1318 HOH A O     1 
HETATM 7637 O  O     . HOH P 7 .   ? 95.298  -1.794  126.624 1.00 63.49  ?  1319 HOH A O     1 
HETATM 7638 O  O     . HOH P 7 .   ? 102.911 0.249   124.471 1.00 47.70  ?  1320 HOH A O     1 
HETATM 7639 O  O     . HOH P 7 .   ? 115.360 22.566  114.032 1.00 51.79  ?  1321 HOH A O     1 
HETATM 7640 O  O     . HOH P 7 .   ? 108.446 12.400  137.032 1.00 27.98  ?  1322 HOH A O     1 
HETATM 7641 O  O     . HOH P 7 .   ? 113.194 9.536   134.761 1.00 23.69  ?  1323 HOH A O     1 
HETATM 7642 O  O     . HOH P 7 .   ? 121.697 19.052  148.697 1.00 47.62  ?  1324 HOH A O     1 
HETATM 7643 O  O     . HOH P 7 .   ? 109.520 -7.800  129.375 1.00 50.73  ?  1325 HOH A O     1 
HETATM 7644 O  O     . HOH P 7 .   ? 94.159  4.434   148.493 1.00 52.79  ?  1326 HOH A O     1 
HETATM 7645 O  O     . HOH P 7 .   ? 89.831  14.589  101.177 1.00 59.63  ?  1327 HOH A O     1 
HETATM 7646 O  O     . HOH P 7 .   ? 101.112 15.704  158.623 1.00 36.79  ?  1328 HOH A O     1 
HETATM 7647 O  O     . HOH P 7 .   ? 110.300 12.409  135.144 1.00 31.57  ?  1329 HOH A O     1 
HETATM 7648 O  O     . HOH P 7 .   ? 123.337 30.542  114.142 1.00 49.29  ?  1330 HOH A O     1 
HETATM 7649 O  O     . HOH P 7 .   ? 120.305 7.750   117.030 1.00 52.40  ?  1331 HOH A O     1 
HETATM 7650 O  O     . HOH P 7 .   ? 106.277 31.127  99.097  1.00 42.00  ?  1332 HOH A O     1 
HETATM 7651 O  O     . HOH P 7 .   ? 91.760  18.630  98.767  1.00 50.91  ?  1333 HOH A O     1 
HETATM 7652 O  O     . HOH P 7 .   ? 100.360 2.022   124.507 1.00 65.18  ?  1334 HOH A O     1 
HETATM 7653 O  O     . HOH P 7 .   ? 93.935  31.204  99.682  1.00 60.61  ?  1335 HOH A O     1 
HETATM 7654 O  O     . HOH P 7 .   ? 106.848 -6.671  129.967 1.00 45.24  ?  1336 HOH A O     1 
HETATM 7655 O  O     . HOH P 7 .   ? 92.481  5.360   144.224 1.00 57.17  ?  1337 HOH A O     1 
HETATM 7656 O  O     . HOH P 7 .   ? 109.538 0.144   123.032 1.00 45.05  ?  1338 HOH A O     1 
HETATM 7657 O  O     . HOH P 7 .   ? 101.599 8.773   116.423 1.00 58.34  ?  1339 HOH A O     1 
HETATM 7658 O  O     . HOH P 7 .   ? 126.353 27.775  117.426 1.00 49.45  ?  1340 HOH A O     1 
HETATM 7659 O  O     . HOH P 7 .   ? 97.286  -4.107  144.063 1.00 65.17  ?  1341 HOH A O     1 
HETATM 7660 O  O     . HOH P 7 .   ? 99.768  5.972   117.664 1.00 54.67  ?  1342 HOH A O     1 
HETATM 7661 O  O     . HOH P 7 .   ? 98.798  27.764  145.960 1.00 52.48  ?  1343 HOH A O     1 
HETATM 7662 O  O     . HOH P 7 .   ? 100.819 -0.070  127.705 1.00 56.59  ?  1344 HOH A O     1 
HETATM 7663 O  O     . HOH P 7 .   ? 121.930 5.170   112.669 1.00 54.93  ?  1345 HOH A O     1 
HETATM 7664 O  O     . HOH P 7 .   ? 118.260 13.770  120.109 1.00 54.10  ?  1346 HOH A O     1 
HETATM 7665 O  O     . HOH P 7 .   ? 122.817 13.065  100.809 1.00 47.04  ?  1347 HOH A O     1 
HETATM 7666 O  O     . HOH P 7 .   ? 127.755 24.686  129.657 1.00 54.99  ?  1348 HOH A O     1 
HETATM 7667 O  O     . HOH P 7 .   ? 121.605 24.616  100.467 1.00 44.35  ?  1349 HOH A O     1 
HETATM 7668 O  O     . HOH P 7 .   ? 101.005 46.809  121.362 1.00 64.66  ?  1350 HOH A O     1 
HETATM 7669 O  O     . HOH P 7 .   ? 112.860 24.326  96.117  1.00 40.73  ?  1351 HOH A O     1 
HETATM 7670 O  O     . HOH P 7 .   ? 108.350 6.301   155.439 1.00 31.29  ?  1352 HOH A O     1 
HETATM 7671 O  O     . HOH P 7 .   ? 118.419 4.031   113.583 1.00 47.15  ?  1353 HOH A O     1 
HETATM 7672 O  O     . HOH P 7 .   ? 115.402 32.407  129.146 1.00 65.47  ?  1354 HOH A O     1 
HETATM 7673 O  O     . HOH P 7 .   ? 123.765 27.100  121.719 1.00 42.27  ?  1355 HOH A O     1 
HETATM 7674 O  O     . HOH P 7 .   ? 133.550 22.348  128.407 1.00 50.58  ?  1356 HOH A O     1 
HETATM 7675 O  O     . HOH P 7 .   ? 123.894 29.422  108.705 1.00 51.69  ?  1357 HOH A O     1 
HETATM 7676 O  O     . HOH P 7 .   ? 124.237 27.280  103.324 1.00 47.60  ?  1358 HOH A O     1 
HETATM 7677 O  O     . HOH P 7 .   ? 137.120 11.612  107.347 1.00 44.46  ?  1359 HOH A O     1 
HETATM 7678 O  O     . HOH P 7 .   ? 108.983 31.253  153.665 1.00 53.53  ?  1360 HOH A O     1 
HETATM 7679 O  O     . HOH P 7 .   ? 114.480 26.036  129.785 1.00 54.57  ?  1361 HOH A O     1 
HETATM 7680 O  O     . HOH P 7 .   ? 130.019 20.426  129.798 1.00 61.74  ?  1362 HOH A O     1 
HETATM 7681 O  O     . HOH P 7 .   ? 103.588 46.372  122.078 1.00 58.73  ?  1363 HOH A O     1 
HETATM 7682 O  O     . HOH P 7 .   ? 111.022 3.229   129.310 1.00 53.66  ?  1364 HOH A O     1 
HETATM 7683 O  O     . HOH P 7 .   ? 100.355 10.096  112.183 1.00 31.56  ?  1365 HOH A O     1 
HETATM 7684 O  O     . HOH P 7 .   ? 98.456  7.636   109.296 1.00 42.10  ?  1366 HOH A O     1 
HETATM 7685 O  O     . HOH P 7 .   ? 103.443 48.880  131.691 1.00 46.03  ?  1367 HOH A O     1 
HETATM 7686 O  O     . HOH P 7 .   ? 111.009 -0.450  132.733 1.00 44.63  ?  1368 HOH A O     1 
HETATM 7687 O  O     . HOH P 7 .   ? 112.024 35.048  114.911 1.00 49.32  ?  1369 HOH A O     1 
HETATM 7688 O  O     . HOH P 7 .   ? 143.487 6.028   117.629 1.00 54.02  ?  1370 HOH A O     1 
HETATM 7689 O  O     . HOH P 7 .   ? 113.411 13.615  90.916  1.00 71.30  ?  1371 HOH A O     1 
HETATM 7690 O  O     . HOH P 7 .   ? 103.094 34.695  109.152 1.00 43.58  ?  1372 HOH A O     1 
HETATM 7691 O  O     . HOH P 7 .   ? 98.440  37.158  133.302 1.00 61.63  ?  1373 HOH A O     1 
HETATM 7692 O  O     . HOH P 7 .   ? 114.511 16.235  96.441  1.00 65.38  ?  1374 HOH A O     1 
HETATM 7693 O  O     . HOH P 7 .   ? 98.978  6.277   114.875 1.00 53.93  ?  1375 HOH A O     1 
HETATM 7694 O  O     . HOH P 7 .   ? 98.107  32.110  100.787 1.00 41.61  ?  1376 HOH A O     1 
HETATM 7695 O  O     . HOH P 7 .   ? 116.536 5.477   115.136 1.00 55.69  ?  1377 HOH A O     1 
HETATM 7696 O  O     . HOH P 7 .   ? 110.323 -2.328  121.908 1.00 55.92  ?  1378 HOH A O     1 
HETATM 7697 O  O     . HOH P 7 .   ? 133.611 20.472  129.966 1.00 59.51  ?  1379 HOH A O     1 
HETATM 7698 O  O     . HOH P 7 .   ? 101.261 -7.081  133.125 1.00 43.20  ?  1380 HOH A O     1 
HETATM 7699 O  O     . HOH P 7 .   ? 125.473 28.396  119.811 1.00 46.20  ?  1381 HOH A O     1 
HETATM 7700 O  O     . HOH P 7 .   ? 96.130  46.488  122.246 1.00 49.78  ?  1382 HOH A O     1 
HETATM 7701 O  O     . HOH P 7 .   ? 105.592 49.250  131.993 1.00 54.04  ?  1383 HOH A O     1 
HETATM 7702 O  O     . HOH P 7 .   ? 121.855 26.942  101.650 1.00 55.72  ?  1384 HOH A O     1 
HETATM 7703 O  O     . HOH P 7 .   ? 88.623  13.901  98.889  1.00 54.68  ?  1385 HOH A O     1 
HETATM 7704 O  O     . HOH P 7 .   ? 133.258 21.313  132.390 1.00 69.24  ?  1386 HOH A O     1 
HETATM 7705 O  O     . HOH Q 7 .   ? 98.787  19.676  166.968 1.00 48.31  ?  901  HOH G O     1 
HETATM 7706 O  O     . HOH Q 7 .   ? 95.139  0.656   146.994 1.00 51.92  ?  902  HOH G O     1 
HETATM 7707 O  O     . HOH Q 7 .   ? 104.821 29.633  169.781 1.00 40.94  ?  903  HOH G O     1 
HETATM 7708 O  O     . HOH Q 7 .   ? 86.566  6.691   165.531 1.00 42.06  ?  904  HOH G O     1 
HETATM 7709 O  O     . HOH Q 7 .   ? 96.183  10.539  167.745 1.00 25.73  ?  905  HOH G O     1 
HETATM 7710 O  O     . HOH Q 7 .   ? 102.099 19.667  169.608 1.00 24.57  ?  906  HOH G O     1 
HETATM 7711 O  O     . HOH Q 7 .   ? 95.238  13.851  169.214 1.00 38.88  ?  907  HOH G O     1 
HETATM 7712 O  O     . HOH Q 7 .   ? 95.722  8.154   167.932 1.00 26.00  ?  908  HOH G O     1 
HETATM 7713 O  O     . HOH Q 7 .   ? 93.336  -1.724  162.712 1.00 34.24  ?  909  HOH G O     1 
HETATM 7714 O  O     . HOH Q 7 .   ? 101.544 -7.070  149.298 1.00 49.97  ?  910  HOH G O     1 
HETATM 7715 O  O     . HOH Q 7 .   ? 98.251  10.892  174.780 1.00 32.05  ?  911  HOH G O     1 
HETATM 7716 O  O     . HOH Q 7 .   ? 93.597  17.495  168.563 1.00 34.38  ?  912  HOH G O     1 
HETATM 7717 O  O     . HOH Q 7 .   ? 91.085  5.596   157.545 1.00 47.53  ?  913  HOH G O     1 
HETATM 7718 O  O     . HOH Q 7 .   ? 97.959  14.729  180.996 1.00 37.21  ?  914  HOH G O     1 
HETATM 7719 O  O     . HOH Q 7 .   ? 92.695  2.339   170.343 1.00 28.40  ?  915  HOH G O     1 
HETATM 7720 O  O     . HOH Q 7 .   ? 85.610  4.165   154.940 1.00 36.41  ?  916  HOH G O     1 
HETATM 7721 O  O     . HOH Q 7 .   ? 96.706  10.641  170.280 1.00 28.02  ?  917  HOH G O     1 
HETATM 7722 O  O     . HOH Q 7 .   ? 101.155 -10.097 150.895 1.00 43.85  ?  918  HOH G O     1 
HETATM 7723 O  O     . HOH Q 7 .   ? 102.192 -15.854 150.406 1.00 51.03  ?  919  HOH G O     1 
HETATM 7724 O  O     . HOH Q 7 .   ? 96.335  16.718  169.297 1.00 29.57  ?  920  HOH G O     1 
HETATM 7725 O  O     . HOH Q 7 .   ? 105.600 27.302  166.556 1.00 48.90  ?  921  HOH G O     1 
HETATM 7726 O  O     . HOH Q 7 .   ? 95.556  21.386  167.935 1.00 38.38  ?  922  HOH G O     1 
HETATM 7727 O  O     . HOH Q 7 .   ? 95.644  20.371  176.506 1.00 33.15  ?  923  HOH G O     1 
HETATM 7728 O  O     . HOH Q 7 .   ? 102.345 21.310  177.093 1.00 28.39  ?  924  HOH G O     1 
HETATM 7729 O  O     . HOH Q 7 .   ? 96.307  8.802   174.332 1.00 31.97  ?  925  HOH G O     1 
HETATM 7730 O  O     . HOH Q 7 .   ? 87.675  6.276   161.721 1.00 41.70  ?  926  HOH G O     1 
HETATM 7731 O  O     . HOH Q 7 .   ? 94.281  -23.513 151.779 1.00 57.03  ?  927  HOH G O     1 
HETATM 7732 O  O     . HOH Q 7 .   ? 93.435  0.391   165.758 1.00 35.42  ?  928  HOH G O     1 
HETATM 7733 O  O     . HOH Q 7 .   ? 99.197  23.173  160.422 1.00 63.88  ?  929  HOH G O     1 
HETATM 7734 O  O     . HOH Q 7 .   ? 87.961  9.004   171.778 1.00 35.54  ?  930  HOH G O     1 
HETATM 7735 O  O     . HOH Q 7 .   ? 97.204  23.265  175.842 1.00 24.74  ?  931  HOH G O     1 
HETATM 7736 O  O     . HOH Q 7 .   ? 94.472  3.150   168.430 1.00 30.98  ?  932  HOH G O     1 
HETATM 7737 O  O     . HOH Q 7 .   ? 91.833  19.642  167.913 1.00 34.14  ?  933  HOH G O     1 
HETATM 7738 O  O     . HOH Q 7 .   ? 89.701  11.073  176.320 1.00 41.52  ?  934  HOH G O     1 
HETATM 7739 O  O     . HOH Q 7 .   ? 102.065 -13.096 150.102 1.00 46.76  ?  935  HOH G O     1 
HETATM 7740 O  O     . HOH Q 7 .   ? 88.253  2.977   150.361 1.00 57.40  ?  936  HOH G O     1 
HETATM 7741 O  O     . HOH Q 7 .   ? 106.404 -17.865 155.375 1.00 42.22  ?  937  HOH G O     1 
HETATM 7742 O  O     . HOH Q 7 .   ? 87.416  12.269  175.485 1.00 59.70  ?  938  HOH G O     1 
HETATM 7743 O  O     . HOH Q 7 .   ? 94.925  25.056  164.949 1.00 49.07  ?  939  HOH G O     1 
HETATM 7744 O  O     . HOH Q 7 .   ? 88.113  9.307   174.476 1.00 52.84  ?  940  HOH G O     1 
HETATM 7745 O  O     . HOH Q 7 .   ? 96.305  -3.454  145.559 1.00 62.79  ?  941  HOH G O     1 
HETATM 7746 O  O     . HOH Q 7 .   ? 96.722  13.027  167.686 1.00 36.22  ?  942  HOH G O     1 
HETATM 7747 O  O     . HOH Q 7 .   ? 95.473  1.197   166.723 1.00 48.48  ?  943  HOH G O     1 
HETATM 7748 O  O     . HOH Q 7 .   ? 89.409  9.327   178.068 1.00 45.79  ?  944  HOH G O     1 
HETATM 7749 O  O     . HOH Q 7 .   ? 96.646  19.981  179.241 1.00 60.10  ?  945  HOH G O     1 
HETATM 7750 O  O     . HOH R 7 .   ? 88.597  -12.672 160.424 1.00 48.57  ?  1001 HOH H O     1 
HETATM 7751 O  O     . HOH R 7 .   ? 96.891  -27.457 145.593 1.00 50.42  ?  1002 HOH H O     1 
HETATM 7752 O  O     . HOH R 7 .   ? 101.781 13.577  160.120 1.00 37.19  ?  1003 HOH H O     1 
HETATM 7753 O  O     . HOH R 7 .   ? 88.419  15.473  176.998 1.00 38.19  ?  1004 HOH H O     1 
HETATM 7754 O  O     . HOH R 7 .   ? 100.041 4.095   157.123 1.00 44.70  ?  1005 HOH H O     1 
HETATM 7755 O  O     . HOH R 7 .   ? 102.149 7.621   162.878 1.00 31.37  ?  1006 HOH H O     1 
HETATM 7756 O  O     . HOH R 7 .   ? 106.474 6.087   157.642 1.00 48.69  ?  1007 HOH H O     1 
HETATM 7757 O  O     . HOH R 7 .   ? 100.583 -15.820 146.650 1.00 52.91  ?  1008 HOH H O     1 
HETATM 7758 O  O     . HOH R 7 .   ? 96.792  -11.423 150.560 1.00 42.52  ?  1009 HOH H O     1 
HETATM 7759 O  O     . HOH R 7 .   ? 85.445  17.769  168.170 1.00 36.71  ?  1010 HOH H O     1 
HETATM 7760 O  O     . HOH R 7 .   ? 103.005 -20.267 142.935 1.00 49.88  ?  1011 HOH H O     1 
HETATM 7761 O  O     . HOH R 7 .   ? 85.889  11.408  172.314 1.00 37.79  ?  1012 HOH H O     1 
HETATM 7762 O  O     . HOH R 7 .   ? 88.180  -17.378 158.839 1.00 54.81  ?  1013 HOH H O     1 
HETATM 7763 O  O     . HOH R 7 .   ? 87.125  -12.561 153.341 1.00 49.65  ?  1014 HOH H O     1 
HETATM 7764 O  O     . HOH R 7 .   ? 87.539  8.993   161.685 1.00 34.67  ?  1015 HOH H O     1 
HETATM 7765 O  O     . HOH R 7 .   ? 93.482  15.736  154.717 1.00 55.91  ?  1016 HOH H O     1 
HETATM 7766 O  O     . HOH R 7 .   ? 97.247  6.623   166.094 1.00 30.00  ?  1017 HOH H O     1 
HETATM 7767 O  O     . HOH R 7 .   ? 82.530  19.059  170.685 1.00 41.85  ?  1018 HOH H O     1 
HETATM 7768 O  O     . HOH R 7 .   ? 96.858  3.564   165.649 1.00 29.79  ?  1019 HOH H O     1 
HETATM 7769 O  O     . HOH R 7 .   ? 108.475 -3.829  164.816 1.00 42.27  ?  1020 HOH H O     1 
HETATM 7770 O  O     . HOH R 7 .   ? 96.479  -24.081 135.425 1.00 48.76  ?  1021 HOH H O     1 
HETATM 7771 O  O     . HOH R 7 .   ? 86.495  16.734  165.765 1.00 40.01  ?  1022 HOH H O     1 
HETATM 7772 O  O     . HOH R 7 .   ? 86.577  17.529  162.576 1.00 35.97  ?  1023 HOH H O     1 
HETATM 7773 O  O     . HOH R 7 .   ? 87.539  19.930  169.050 1.00 25.01  ?  1024 HOH H O     1 
HETATM 7774 O  O     . HOH R 7 .   ? 86.452  9.323   166.247 1.00 28.93  ?  1025 HOH H O     1 
HETATM 7775 O  O     . HOH R 7 .   ? 108.220 -6.723  166.661 1.00 58.28  ?  1026 HOH H O     1 
HETATM 7776 O  O     . HOH R 7 .   ? 95.720  11.969  163.478 1.00 33.90  ?  1027 HOH H O     1 
HETATM 7777 O  O     . HOH R 7 .   ? 89.444  18.497  167.666 1.00 38.99  ?  1028 HOH H O     1 
HETATM 7778 O  O     . HOH R 7 .   ? 99.497  0.804   165.288 1.00 47.74  ?  1029 HOH H O     1 
HETATM 7779 O  O     . HOH R 7 .   ? 99.425  4.728   165.191 1.00 31.24  ?  1030 HOH H O     1 
HETATM 7780 O  O     . HOH R 7 .   ? 96.467  6.768   156.892 1.00 47.94  ?  1031 HOH H O     1 
HETATM 7781 O  O     . HOH R 7 .   ? 99.737  11.279  161.515 1.00 34.75  ?  1032 HOH H O     1 
HETATM 7782 O  O     . HOH R 7 .   ? 103.914 -21.711 145.007 1.00 47.89  ?  1033 HOH H O     1 
HETATM 7783 O  O     . HOH R 7 .   ? 82.473  18.000  163.219 1.00 39.40  ?  1034 HOH H O     1 
HETATM 7784 O  O     . HOH R 7 .   ? 92.419  16.204  166.446 1.00 37.76  ?  1035 HOH H O     1 
HETATM 7785 O  O     . HOH R 7 .   ? 94.664  -12.361 149.810 1.00 50.25  ?  1036 HOH H O     1 
HETATM 7786 O  O     . HOH R 7 .   ? 89.194  -16.173 161.769 1.00 42.21  ?  1037 HOH H O     1 
HETATM 7787 O  O     . HOH R 7 .   ? 98.683  8.515   164.980 1.00 32.09  ?  1038 HOH H O     1 
HETATM 7788 O  O     . HOH R 7 .   ? 94.628  14.899  164.720 1.00 37.35  ?  1039 HOH H O     1 
HETATM 7789 O  O     . HOH R 7 .   ? 95.970  10.899  165.091 1.00 31.71  ?  1040 HOH H O     1 
HETATM 7790 O  O     . HOH R 7 .   ? 97.216  15.118  160.756 1.00 44.27  ?  1041 HOH H O     1 
HETATM 7791 O  O     . HOH R 7 .   ? 86.342  15.270  178.620 1.00 35.79  ?  1042 HOH H O     1 
HETATM 7792 O  O     . HOH R 7 .   ? 94.313  -5.413  161.218 1.00 48.95  ?  1043 HOH H O     1 
HETATM 7793 O  O     . HOH R 7 .   ? 94.725  -27.951 147.114 1.00 54.30  ?  1044 HOH H O     1 
HETATM 7794 O  O     . HOH R 7 .   ? 93.081  15.639  162.041 1.00 58.22  ?  1045 HOH H O     1 
HETATM 7795 O  O     . HOH R 7 .   ? 86.027  -13.189 157.364 1.00 52.54  ?  1046 HOH H O     1 
HETATM 7796 O  O     . HOH R 7 .   ? 107.803 4.507   159.648 1.00 42.64  ?  1047 HOH H O     1 
HETATM 7797 O  O     . HOH R 7 .   ? 89.367  -11.057 154.528 1.00 47.37  ?  1048 HOH H O     1 
HETATM 7798 O  O     . HOH R 7 .   ? 92.826  13.547  153.816 1.00 59.22  ?  1049 HOH H O     1 
HETATM 7799 O  O     . HOH R 7 .   ? 84.812  9.221   168.825 1.00 41.01  ?  1050 HOH H O     1 
HETATM 7800 O  O     . HOH R 7 .   ? 90.670  -13.661 167.137 1.00 61.76  ?  1051 HOH H O     1 
HETATM 7801 O  O     . HOH R 7 .   ? 80.472  10.794  168.759 1.00 46.75  ?  1052 HOH H O     1 
HETATM 7802 O  O     . HOH R 7 .   ? 89.244  -12.701 164.737 1.00 48.67  ?  1053 HOH H O     1 
HETATM 7803 O  O     . HOH R 7 .   ? 99.048  13.728  161.855 1.00 46.68  ?  1054 HOH H O     1 
HETATM 7804 O  O     . HOH R 7 .   ? 84.983  9.521   164.079 1.00 38.26  ?  1055 HOH H O     1 
HETATM 7805 O  O     . HOH R 7 .   ? 82.519  10.104  169.789 1.00 50.12  ?  1056 HOH H O     1 
HETATM 7806 O  O     . HOH R 7 .   ? 89.086  17.409  165.105 1.00 46.81  ?  1057 HOH H O     1 
HETATM 7807 O  O     . HOH R 7 .   ? 96.499  -9.645  149.126 1.00 57.18  ?  1058 HOH H O     1 
HETATM 7808 O  O     . HOH R 7 .   ? 91.274  17.367  164.441 1.00 40.79  ?  1059 HOH H O     1 
HETATM 7809 O  O     . HOH R 7 .   ? 94.630  -28.597 149.248 1.00 52.47  ?  1060 HOH H O     1 
HETATM 7810 O  O     . HOH R 7 .   ? 100.951 -12.985 173.132 1.00 52.69  ?  1061 HOH H O     1 
HETATM 7811 O  O     . HOH S 7 .   ? 121.105 -17.452 139.816 1.00 63.19  ?  901  HOH B O     1 
HETATM 7812 O  O     . HOH S 7 .   ? 111.412 19.057  131.463 1.00 42.60  ?  902  HOH B O     1 
HETATM 7813 O  O     . HOH S 7 .   ? 112.291 15.455  132.602 1.00 22.61  ?  903  HOH B O     1 
HETATM 7814 O  O     . HOH S 7 .   ? 128.923 6.597   125.891 1.00 49.32  ?  904  HOH B O     1 
HETATM 7815 O  O     . HOH S 7 .   ? 111.046 23.154  134.625 1.00 40.20  ?  905  HOH B O     1 
HETATM 7816 O  O     . HOH S 7 .   ? 111.785 25.986  132.454 1.00 36.52  ?  906  HOH B O     1 
HETATM 7817 O  O     . HOH S 7 .   ? 112.248 13.193  131.994 1.00 31.27  ?  907  HOH B O     1 
HETATM 7818 O  O     . HOH S 7 .   ? 101.665 25.540  137.599 1.00 31.23  ?  908  HOH B O     1 
HETATM 7819 O  O     . HOH S 7 .   ? 110.597 7.597   128.273 1.00 35.59  ?  909  HOH B O     1 
HETATM 7820 O  O     . HOH S 7 .   ? 111.699 22.258  130.345 1.00 28.43  ?  910  HOH B O     1 
HETATM 7821 O  O     . HOH S 7 .   ? 126.478 9.910   124.530 1.00 44.09  ?  911  HOH B O     1 
HETATM 7822 O  O     . HOH S 7 .   ? 118.174 4.149   130.310 1.00 40.74  ?  912  HOH B O     1 
HETATM 7823 O  O     . HOH S 7 .   ? 105.221 17.403  125.310 1.00 39.70  ?  913  HOH B O     1 
HETATM 7824 O  O     . HOH S 7 .   ? 124.429 0.856   133.325 1.00 39.68  ?  914  HOH B O     1 
HETATM 7825 O  O     . HOH S 7 .   ? 125.210 -14.505 142.378 1.00 41.71  ?  915  HOH B O     1 
HETATM 7826 O  O     . HOH S 7 .   ? 110.676 31.766  142.894 1.00 43.68  ?  916  HOH B O     1 
HETATM 7827 O  O     . HOH S 7 .   ? 119.356 -4.866  139.783 1.00 37.72  ?  917  HOH B O     1 
HETATM 7828 O  O     . HOH S 7 .   ? 127.982 -3.681  140.363 1.00 42.46  ?  918  HOH B O     1 
HETATM 7829 O  O     . HOH S 7 .   ? 123.056 -8.781  144.966 1.00 35.94  ?  919  HOH B O     1 
HETATM 7830 O  O     . HOH S 7 .   ? 126.878 1.488   134.250 1.00 45.79  ?  920  HOH B O     1 
HETATM 7831 O  O     . HOH S 7 .   ? 110.483 21.520  132.811 1.00 27.92  ?  921  HOH B O     1 
HETATM 7832 O  O     . HOH S 7 .   ? 106.001 12.937  131.666 1.00 35.07  ?  922  HOH B O     1 
HETATM 7833 O  O     . HOH S 7 .   ? 109.797 15.488  132.732 1.00 28.85  ?  923  HOH B O     1 
HETATM 7834 O  O     . HOH S 7 .   ? 109.662 14.311  123.891 1.00 38.54  ?  924  HOH B O     1 
HETATM 7835 O  O     . HOH S 7 .   ? 121.141 -13.152 142.896 1.00 34.07  ?  925  HOH B O     1 
HETATM 7836 O  O     . HOH S 7 .   ? 128.323 -6.717  141.916 1.00 57.42  ?  926  HOH B O     1 
HETATM 7837 O  O     . HOH S 7 .   ? 103.197 25.116  130.776 1.00 42.88  ?  927  HOH B O     1 
HETATM 7838 O  O     . HOH S 7 .   ? 126.811 -10.136 142.999 1.00 39.06  ?  928  HOH B O     1 
HETATM 7839 O  O     . HOH S 7 .   ? 103.900 28.144  132.487 1.00 32.09  ?  929  HOH B O     1 
HETATM 7840 O  O     . HOH S 7 .   ? 112.373 8.027   130.774 1.00 40.14  ?  930  HOH B O     1 
HETATM 7841 O  O     . HOH S 7 .   ? 118.060 27.396  137.245 1.00 55.79  ?  931  HOH B O     1 
HETATM 7842 O  O     . HOH S 7 .   ? 122.613 -7.410  149.143 1.00 30.70  ?  932  HOH B O     1 
HETATM 7843 O  O     . HOH S 7 .   ? 119.471 11.941  124.959 1.00 42.35  ?  933  HOH B O     1 
HETATM 7844 O  O     . HOH S 7 .   ? 102.719 21.719  128.556 1.00 35.71  ?  934  HOH B O     1 
HETATM 7845 O  O     . HOH S 7 .   ? 115.574 32.507  131.774 1.00 49.39  ?  935  HOH B O     1 
HETATM 7846 O  O     . HOH S 7 .   ? 123.622 -0.802  149.624 1.00 53.61  ?  936  HOH B O     1 
HETATM 7847 O  O     . HOH S 7 .   ? 112.575 24.659  128.877 1.00 36.79  ?  937  HOH B O     1 
HETATM 7848 O  O     . HOH S 7 .   ? 122.393 1.325   131.119 1.00 63.66  ?  938  HOH B O     1 
HETATM 7849 O  O     . HOH S 7 .   ? 106.794 17.205  122.565 1.00 59.41  ?  939  HOH B O     1 
HETATM 7850 O  O     . HOH S 7 .   ? 118.152 -7.107  138.806 1.00 37.40  ?  940  HOH B O     1 
HETATM 7851 O  O     . HOH S 7 .   ? 114.777 29.840  132.692 1.00 58.96  ?  941  HOH B O     1 
HETATM 7852 O  O     . HOH S 7 .   ? 112.750 6.045   126.754 1.00 47.01  ?  942  HOH B O     1 
HETATM 7853 O  O     . HOH S 7 .   ? 124.289 -6.948  147.997 1.00 52.23  ?  943  HOH B O     1 
HETATM 7854 O  O     . HOH S 7 .   ? 130.159 0.496   140.184 1.00 51.82  ?  944  HOH B O     1 
HETATM 7855 O  O     . HOH S 7 .   ? 122.298 -3.327  148.886 1.00 42.31  ?  945  HOH B O     1 
HETATM 7856 O  O     . HOH S 7 .   ? 128.267 0.107   135.247 1.00 53.87  ?  946  HOH B O     1 
HETATM 7857 O  O     . HOH S 7 .   ? 112.041 9.468   132.980 1.00 31.00  ?  947  HOH B O     1 
HETATM 7858 O  O     . HOH S 7 .   ? 115.766 4.440   120.392 1.00 71.59  ?  948  HOH B O     1 
HETATM 7859 O  O     . HOH S 7 .   ? 132.002 3.125   147.202 1.00 55.30  ?  949  HOH B O     1 
HETATM 7860 O  O     . HOH S 7 .   ? 119.867 4.024   142.801 1.00 43.70  ?  950  HOH B O     1 
HETATM 7861 O  O     . HOH S 7 .   ? 115.317 3.723   122.108 1.00 59.31  ?  951  HOH B O     1 
HETATM 7862 O  O     . HOH S 7 .   ? 123.634 -9.603  148.774 1.00 51.72  ?  952  HOH B O     1 
HETATM 7863 O  O     . HOH S 7 .   ? 130.546 0.758   138.276 1.00 61.22  ?  953  HOH B O     1 
HETATM 7864 O  O     . HOH S 7 .   ? 122.913 -11.605 144.432 1.00 34.53  ?  954  HOH B O     1 
HETATM 7865 O  O     . HOH S 7 .   ? 125.621 -12.758 144.342 1.00 50.99  ?  955  HOH B O     1 
HETATM 7866 O  O     . HOH S 7 .   ? 128.244 0.255   131.982 1.00 73.35  ?  956  HOH B O     1 
HETATM 7867 O  O     . HOH T 7 .   ? 138.361 -18.691 142.421 1.00 50.68  ?  1001 HOH C O     1 
HETATM 7868 O  O     . HOH T 7 .   ? 134.326 -7.623  133.871 1.00 44.47  ?  1002 HOH C O     1 
HETATM 7869 O  O     . HOH T 7 .   ? 117.783 1.938   132.195 1.00 49.79  ?  1003 HOH C O     1 
HETATM 7870 O  O     . HOH T 7 .   ? 135.334 -21.428 147.332 1.00 38.43  ?  1004 HOH C O     1 
HETATM 7871 O  O     . HOH T 7 .   ? 122.288 -12.125 127.490 1.00 55.17  ?  1005 HOH C O     1 
HETATM 7872 O  O     . HOH T 7 .   ? 124.028 -5.698  128.552 1.00 39.14  ?  1006 HOH C O     1 
HETATM 7873 O  O     . HOH T 7 .   ? 144.845 -19.929 149.139 1.00 37.64  ?  1007 HOH C O     1 
HETATM 7874 O  O     . HOH T 7 .   ? 128.956 -6.001  137.182 1.00 40.96  ?  1008 HOH C O     1 
HETATM 7875 O  O     . HOH T 7 .   ? 114.684 8.640   133.396 1.00 42.13  ?  1009 HOH C O     1 
HETATM 7876 O  O     . HOH T 7 .   ? 125.400 18.099  132.099 1.00 56.68  ?  1010 HOH C O     1 
HETATM 7877 O  O     . HOH T 7 .   ? 126.973 -2.382  134.771 1.00 42.96  ?  1011 HOH C O     1 
HETATM 7878 O  O     . HOH T 7 .   ? 119.946 21.818  118.454 1.00 22.65  ?  1012 HOH C O     1 
HETATM 7879 O  O     . HOH T 7 .   ? 114.785 5.830   136.039 1.00 40.15  ?  1013 HOH C O     1 
HETATM 7880 O  O     . HOH T 7 .   ? 119.871 -8.053  137.053 1.00 35.45  ?  1014 HOH C O     1 
HETATM 7881 O  O     . HOH T 7 .   ? 110.329 -5.801  136.553 1.00 37.36  ?  1015 HOH C O     1 
HETATM 7882 O  O     . HOH T 7 .   ? 119.820 -0.313  132.236 1.00 45.69  ?  1016 HOH C O     1 
HETATM 7883 O  O     . HOH T 7 .   ? 109.521 16.937  121.925 1.00 34.15  ?  1017 HOH C O     1 
HETATM 7884 O  O     . HOH T 7 .   ? 133.556 -15.433 136.240 1.00 37.61  ?  1018 HOH C O     1 
HETATM 7885 O  O     . HOH T 7 .   ? 117.234 16.556  137.275 1.00 34.01  ?  1019 HOH C O     1 
HETATM 7886 O  O     . HOH T 7 .   ? 113.743 23.151  122.128 1.00 36.58  ?  1020 HOH C O     1 
HETATM 7887 O  O     . HOH T 7 .   ? 116.635 17.441  132.793 1.00 38.05  ?  1021 HOH C O     1 
HETATM 7888 O  O     . HOH T 7 .   ? 134.779 -7.868  138.745 1.00 33.38  ?  1022 HOH C O     1 
HETATM 7889 O  O     . HOH T 7 .   ? 122.282 9.514   138.370 1.00 42.32  ?  1023 HOH C O     1 
HETATM 7890 O  O     . HOH T 7 .   ? 119.305 0.117   141.796 1.00 46.90  ?  1024 HOH C O     1 
HETATM 7891 O  O     . HOH T 7 .   ? 112.062 25.504  124.313 1.00 30.17  ?  1025 HOH C O     1 
HETATM 7892 O  O     . HOH T 7 .   ? 113.056 0.963   145.020 1.00 42.39  ?  1026 HOH C O     1 
HETATM 7893 O  O     . HOH T 7 .   ? 115.845 22.562  123.352 1.00 40.65  ?  1027 HOH C O     1 
HETATM 7894 O  O     . HOH T 7 .   ? 137.769 -10.661 128.948 1.00 50.48  ?  1028 HOH C O     1 
HETATM 7895 O  O     . HOH T 7 .   ? 119.137 23.537  120.417 1.00 41.77  ?  1029 HOH C O     1 
HETATM 7896 O  O     . HOH T 7 .   ? 113.817 11.413  133.956 1.00 30.91  ?  1030 HOH C O     1 
HETATM 7897 O  O     . HOH T 7 .   ? 131.504 -16.331 146.003 1.00 50.88  ?  1031 HOH C O     1 
HETATM 7898 O  O     . HOH T 7 .   ? 135.556 -10.259 142.592 1.00 34.32  ?  1032 HOH C O     1 
HETATM 7899 O  O     . HOH T 7 .   ? 129.710 -11.743 141.581 1.00 42.87  ?  1033 HOH C O     1 
HETATM 7900 O  O     . HOH T 7 .   ? 110.502 25.257  114.941 1.00 46.80  ?  1034 HOH C O     1 
HETATM 7901 O  O     . HOH T 7 .   ? 120.366 22.065  128.361 1.00 47.09  ?  1035 HOH C O     1 
HETATM 7902 O  O     . HOH T 7 .   ? 121.371 11.624  144.335 1.00 49.03  ?  1036 HOH C O     1 
HETATM 7903 O  O     . HOH T 7 .   ? 114.465 9.719   136.248 1.00 34.59  ?  1037 HOH C O     1 
HETATM 7904 O  O     . HOH T 7 .   ? 136.497 -11.244 151.923 1.00 24.54  ?  1038 HOH C O     1 
HETATM 7905 O  O     . HOH T 7 .   ? 115.474 4.436   145.740 1.00 45.04  ?  1039 HOH C O     1 
HETATM 7906 O  O     . HOH T 7 .   ? 115.738 -1.810  144.533 1.00 45.52  ?  1040 HOH C O     1 
HETATM 7907 O  O     . HOH T 7 .   ? 111.733 24.936  119.485 1.00 46.00  ?  1041 HOH C O     1 
HETATM 7908 O  O     . HOH T 7 .   ? 124.652 -7.541  125.053 1.00 41.44  ?  1042 HOH C O     1 
HETATM 7909 O  O     . HOH T 7 .   ? 115.327 14.897  123.190 1.00 31.57  ?  1043 HOH C O     1 
HETATM 7910 O  O     . HOH T 7 .   ? 102.836 23.020  126.120 1.00 38.94  ?  1044 HOH C O     1 
HETATM 7911 O  O     . HOH T 7 .   ? 113.330 23.898  126.229 1.00 34.52  ?  1045 HOH C O     1 
HETATM 7912 O  O     . HOH T 7 .   ? 119.284 -10.635 127.125 1.00 46.54  ?  1046 HOH C O     1 
HETATM 7913 O  O     . HOH T 7 .   ? 114.712 13.475  135.454 1.00 36.41  ?  1047 HOH C O     1 
HETATM 7914 O  O     . HOH T 7 .   ? 119.836 14.565  124.992 1.00 33.93  ?  1048 HOH C O     1 
HETATM 7915 O  O     . HOH T 7 .   ? 138.458 -9.067  133.480 1.00 49.09  ?  1049 HOH C O     1 
HETATM 7916 O  O     . HOH T 7 .   ? 112.768 -6.289  140.036 1.00 48.01  ?  1050 HOH C O     1 
HETATM 7917 O  O     . HOH T 7 .   ? 133.621 -10.845 148.743 1.00 38.84  ?  1051 HOH C O     1 
HETATM 7918 O  O     . HOH T 7 .   ? 104.478 20.835  122.845 1.00 50.27  ?  1052 HOH C O     1 
HETATM 7919 O  O     . HOH T 7 .   ? 114.437 21.690  129.040 1.00 40.83  ?  1053 HOH C O     1 
HETATM 7920 O  O     . HOH T 7 .   ? 118.568 15.439  143.527 1.00 41.64  ?  1054 HOH C O     1 
HETATM 7921 O  O     . HOH T 7 .   ? 118.776 20.705  130.897 1.00 55.85  ?  1055 HOH C O     1 
HETATM 7922 O  O     . HOH T 7 .   ? 126.473 -19.549 137.783 1.00 47.36  ?  1056 HOH C O     1 
HETATM 7923 O  O     . HOH T 7 .   ? 114.624 15.842  132.856 1.00 34.45  ?  1057 HOH C O     1 
HETATM 7924 O  O     . HOH T 7 .   ? 123.064 -1.849  131.221 1.00 52.33  ?  1058 HOH C O     1 
HETATM 7925 O  O     . HOH T 7 .   ? 115.414 5.375   133.276 1.00 50.69  ?  1059 HOH C O     1 
HETATM 7926 O  O     . HOH T 7 .   ? 113.111 -4.934  132.670 1.00 56.18  ?  1060 HOH C O     1 
HETATM 7927 O  O     . HOH T 7 .   ? 131.682 -7.437  138.100 1.00 47.11  ?  1061 HOH C O     1 
HETATM 7928 O  O     . HOH T 7 .   ? 136.616 -6.967  130.565 1.00 50.29  ?  1062 HOH C O     1 
HETATM 7929 O  O     . HOH T 7 .   ? 120.862 5.397   140.725 1.00 43.25  ?  1063 HOH C O     1 
HETATM 7930 O  O     . HOH T 7 .   ? 115.100 19.900  132.006 1.00 41.23  ?  1064 HOH C O     1 
HETATM 7931 O  O     . HOH T 7 .   ? 123.066 11.642  135.703 1.00 48.30  ?  1065 HOH C O     1 
HETATM 7932 O  O     . HOH T 7 .   ? 119.330 23.224  124.328 1.00 44.06  ?  1066 HOH C O     1 
HETATM 7933 O  O     . HOH T 7 .   ? 131.590 -14.519 132.877 1.00 45.29  ?  1067 HOH C O     1 
HETATM 7934 O  O     . HOH T 7 .   ? 139.391 -10.038 137.743 1.00 38.44  ?  1068 HOH C O     1 
HETATM 7935 O  O     . HOH T 7 .   ? 116.260 23.622  118.657 1.00 56.35  ?  1069 HOH C O     1 
HETATM 7936 O  O     . HOH T 7 .   ? 116.777 -6.892  127.139 1.00 53.04  ?  1070 HOH C O     1 
HETATM 7937 O  O     . HOH T 7 .   ? 117.732 3.656   144.986 1.00 61.17  ?  1071 HOH C O     1 
HETATM 7938 O  O     . HOH T 7 .   ? 113.070 14.794  121.596 1.00 49.21  ?  1072 HOH C O     1 
HETATM 7939 O  O     . HOH T 7 .   ? 118.778 -3.299  142.119 1.00 44.26  ?  1073 HOH C O     1 
HETATM 7940 O  O     . HOH T 7 .   ? 142.774 -18.314 149.878 1.00 39.95  ?  1074 HOH C O     1 
HETATM 7941 O  O     . HOH T 7 .   ? 125.011 -10.374 124.923 1.00 42.77  ?  1075 HOH C O     1 
HETATM 7942 O  O     . HOH T 7 .   ? 136.179 -7.173  136.498 1.00 46.88  ?  1076 HOH C O     1 
HETATM 7943 O  O     . HOH T 7 .   ? 117.833 15.224  122.064 1.00 43.91  ?  1077 HOH C O     1 
HETATM 7944 O  O     . HOH T 7 .   ? 126.056 -1.295  132.065 1.00 64.52  ?  1078 HOH C O     1 
HETATM 7945 O  O     . HOH T 7 .   ? 122.470 -4.063  129.624 1.00 47.27  ?  1079 HOH C O     1 
HETATM 7946 O  O     . HOH T 7 .   ? 119.582 8.819   146.120 1.00 66.75  ?  1080 HOH C O     1 
HETATM 7947 O  O     . HOH T 7 .   ? 115.994 23.218  126.164 1.00 51.10  ?  1081 HOH C O     1 
HETATM 7948 O  O     . HOH T 7 .   ? 120.099 24.964  128.725 1.00 56.31  ?  1082 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . GLY A 1   ? 0.6830 0.7130 1.1606 -0.0966 -0.0979 -0.0256 0   GLY F N     
2    C  CA    . GLY A 1   ? 0.7338 0.7546 1.1988 -0.0941 -0.0821 -0.0195 0   GLY F CA    
3    C  C     . GLY A 1   ? 0.5439 0.5663 0.9933 -0.0809 -0.0797 -0.0196 0   GLY F C     
4    O  O     . GLY A 1   ? 0.6627 0.6673 1.0887 -0.0761 -0.0843 -0.0227 0   GLY F O     
5    N  N     . SER A 2   ? 0.5723 0.6159 1.0343 -0.0751 -0.0725 -0.0165 1   SER F N     
6    C  CA    . SER A 2   ? 0.6200 0.6657 1.0681 -0.0637 -0.0695 -0.0159 1   SER F CA    
7    C  C     . SER A 2   ? 0.5394 0.5819 0.9809 -0.0628 -0.0511 -0.0093 1   SER F C     
8    O  O     . SER A 2   ? 0.6187 0.6694 1.0737 -0.0679 -0.0375 -0.0039 1   SER F O     
9    C  CB    . SER A 2   ? 0.6611 0.7270 1.1225 -0.0571 -0.0719 -0.0163 1   SER F CB    
10   O  OG    . SER A 2   ? 0.6802 0.7447 1.1359 -0.0537 -0.0903 -0.0221 1   SER F OG    
11   N  N     . ARG A 3   ? 0.4458 0.4772 0.8658 -0.0565 -0.0507 -0.0096 2   ARG F N     
12   C  CA    . ARG A 3   ? 0.2564 0.2855 0.6685 -0.0544 -0.0341 -0.0034 2   ARG F CA    
13   C  C     . ARG A 3   ? 0.2424 0.2895 0.6602 -0.0467 -0.0266 -0.0014 2   ARG F C     
14   O  O     . ARG A 3   ? 0.2619 0.3191 0.6847 -0.0416 -0.0359 -0.0049 2   ARG F O     
15   C  CB    . ARG A 3   ? 0.2209 0.2309 0.6085 -0.0510 -0.0367 -0.0048 2   ARG F CB    
16   C  CG    . ARG A 3   ? 0.3193 0.3046 0.6963 -0.0570 -0.0402 -0.0060 2   ARG F CG    
17   C  CD    . ARG A 3   ? 0.4474 0.4152 0.7883 -0.0469 -0.0426 -0.0086 2   ARG F CD    
18   N  NE    . ARG A 3   ? 0.4052 0.3770 0.7357 -0.0406 -0.0570 -0.0164 2   ARG F NE    
19   C  CZ    . ARG A 3   ? 0.3451 0.3153 0.6479 -0.0300 -0.0583 -0.0184 2   ARG F CZ    
20   N  NH1   . ARG A 3   ? 0.3141 0.2886 0.6088 -0.0263 -0.0713 -0.0247 2   ARG F NH1   
21   N  NH2   . ARG A 3   ? 0.3064 0.2722 0.5899 -0.0235 -0.0470 -0.0139 2   ARG F NH2   
22   N  N     . LYS A 4   ? 0.2811 0.3297 0.6953 -0.0456 -0.0100 0.0042  3   LYS F N     
23   C  CA    . LYS A 4   ? 0.2562 0.3170 0.6698 -0.0376 -0.0019 0.0056  3   LYS F CA    
24   C  C     . LYS A 4   ? 0.1805 0.2322 0.5731 -0.0335 0.0045  0.0081  3   LYS F C     
25   O  O     . LYS A 4   ? 0.2315 0.2744 0.6128 -0.0356 0.0169  0.0132  3   LYS F O     
26   C  CB    . LYS A 4   ? 0.2738 0.3478 0.7028 -0.0396 0.0131  0.0091  3   LYS F CB    
27   C  CG    . LYS A 4   ? 0.3507 0.4374 0.8040 -0.0447 0.0083  0.0070  3   LYS F CG    
28   C  CD    . LYS A 4   ? 0.4199 0.5209 0.8871 -0.0476 0.0251  0.0109  3   LYS F CD    
29   C  CE    . LYS A 4   ? 0.6297 0.7304 1.1089 -0.0603 0.0284  0.0143  3   LYS F CE    
30   N  NZ    . LYS A 4   ? 0.6608 0.7723 1.1463 -0.0644 0.0478  0.0199  3   LYS F NZ    
31   N  N     . ILE A 5   ? 0.1578 0.2076 0.5326 -0.0255 -0.0044 0.0050  4   ILE F N     
32   C  CA    . ILE A 5   ? 0.1539 0.1929 0.4953 -0.0188 -0.0006 0.0066  4   ILE F CA    
33   C  C     . ILE A 5   ? 0.2202 0.2686 0.5595 -0.0123 0.0048  0.0073  4   ILE F C     
34   O  O     . ILE A 5   ? 0.1994 0.2568 0.5509 -0.0097 -0.0032 0.0046  4   ILE F O     
35   C  CB    . ILE A 5   ? 0.1897 0.2190 0.5097 -0.0158 -0.0143 0.0027  4   ILE F CB    
36   C  CG1   . ILE A 5   ? 0.2563 0.2750 0.5800 -0.0216 -0.0220 -0.0002 4   ILE F CG1   
37   C  CG2   . ILE A 5   ? 0.1723 0.1940 0.4606 -0.0095 -0.0096 0.0045  4   ILE F CG2   
38   C  CD1   . ILE A 5   ? 0.2355 0.2417 0.5557 -0.0257 -0.0118 0.0039  4   ILE F CD1   
39   N  N     . ILE A 6   ? 0.1801 0.2248 0.5032 -0.0095 0.0174  0.0108  5   ILE F N     
40   C  CA    . ILE A 6   ? 0.1293 0.1781 0.4437 -0.0032 0.0218  0.0106  5   ILE F CA    
41   C  C     . ILE A 6   ? 0.1564 0.1955 0.4391 0.0005  0.0185  0.0110  5   ILE F C     
42   O  O     . ILE A 6   ? 0.2110 0.2415 0.4774 -0.0001 0.0215  0.0132  5   ILE F O     
43   C  CB    . ILE A 6   ? 0.1758 0.2292 0.4950 -0.0028 0.0388  0.0133  5   ILE F CB    
44   C  CG1   . ILE A 6   ? 0.1515 0.2191 0.5053 -0.0070 0.0439  0.0130  5   ILE F CG1   
45   C  CG2   . ILE A 6   ? 0.1900 0.2449 0.4979 0.0044  0.0421  0.0115  5   ILE F CG2   
46   C  CD1   . ILE A 6   ? 0.1904 0.2636 0.5476 -0.0078 0.0628  0.0163  5   ILE F CD1   
47   N  N     . HIS A 7   ? 0.1617 0.2024 0.4362 0.0043  0.0122  0.0093  6   HIS F N     
48   C  CA    . HIS A 7   ? 0.1830 0.2184 0.4301 0.0068  0.0114  0.0102  6   HIS F CA    
49   C  C     . HIS A 7   ? 0.2491 0.2852 0.4914 0.0099  0.0185  0.0103  6   HIS F C     
50   O  O     . HIS A 7   ? 0.1713 0.2102 0.4252 0.0118  0.0155  0.0083  6   HIS F O     
51   C  CB    . HIS A 7   ? 0.1434 0.1785 0.3816 0.0067  -0.0020 0.0088  6   HIS F CB    
52   C  CG    . HIS A 7   ? 0.1851 0.2186 0.3980 0.0079  -0.0027 0.0100  6   HIS F CG    
53   N  ND1   . HIS A 7   ? 0.1747 0.2081 0.3789 0.0082  -0.0048 0.0106  6   HIS F ND1   
54   C  CD2   . HIS A 7   ? 0.2227 0.2551 0.4184 0.0087  -0.0018 0.0105  6   HIS F CD2   
55   C  CE1   . HIS A 7   ? 0.2039 0.2382 0.3878 0.0077  -0.0050 0.0118  6   HIS F CE1   
56   N  NE2   . HIS A 7   ? 0.2444 0.2796 0.4235 0.0089  -0.0030 0.0116  6   HIS F NE2   
57   N  N     . VAL A 8   ? 0.1994 0.2318 0.4244 0.0111  0.0274  0.0122  7   VAL F N     
58   C  CA    . VAL A 8   ? 0.1604 0.1914 0.3765 0.0141  0.0338  0.0112  7   VAL F CA    
59   C  C     . VAL A 8   ? 0.1948 0.2223 0.3873 0.0141  0.0279  0.0114  7   VAL F C     
60   O  O     . VAL A 8   ? 0.2098 0.2372 0.3890 0.0133  0.0261  0.0133  7   VAL F O     
61   C  CB    . VAL A 8   ? 0.2141 0.2441 0.4267 0.0150  0.0482  0.0132  7   VAL F CB    
62   C  CG1   . VAL A 8   ? 0.2103 0.2382 0.4120 0.0187  0.0543  0.0107  7   VAL F CG1   
63   C  CG2   . VAL A 8   ? 0.2544 0.2905 0.4926 0.0129  0.0551  0.0139  7   VAL F CG2   
64   N  N     . ASP A 9   ? 0.2167 0.2415 0.4048 0.0150  0.0247  0.0093  8   ASP F N     
65   C  CA    . ASP A 9   ? 0.2476 0.2702 0.4166 0.0126  0.0175  0.0099  8   ASP F CA    
66   C  C     . ASP A 9   ? 0.2273 0.2432 0.3866 0.0139  0.0201  0.0073  8   ASP F C     
67   O  O     . ASP A 9   ? 0.2353 0.2464 0.4046 0.0163  0.0190  0.0046  8   ASP F O     
68   C  CB    A ASP A 9   ? 0.2433 0.2667 0.4161 0.0097  0.0054  0.0107  8   ASP F CB    
69   C  CB    B ASP A 9   ? 0.2456 0.2690 0.4188 0.0098  0.0055  0.0106  8   ASP F CB    
70   C  CG    A ASP A 9   ? 0.3065 0.3306 0.4602 0.0053  -0.0009 0.0125  8   ASP F CG    
71   C  CG    B ASP A 9   ? 0.3046 0.3290 0.4592 0.0054  -0.0010 0.0125  8   ASP F CG    
72   O  OD1   A ASP A 9   ? 0.2525 0.2707 0.3970 0.0036  -0.0019 0.0118  8   ASP F OD1   
73   O  OD1   B ASP A 9   ? 0.2204 0.2470 0.3607 0.0047  0.0028  0.0128  8   ASP F OD1   
74   O  OD2   A ASP A 9   ? 0.3523 0.3833 0.5006 0.0032  -0.0048 0.0142  8   ASP F OD2   
75   O  OD2   B ASP A 9   ? 0.3641 0.3881 0.5186 0.0022  -0.0102 0.0140  8   ASP F OD2   
76   N  N     . MET A 10  ? 0.2216 0.2366 0.3615 0.0129  0.0224  0.0076  9   MET F N     
77   C  CA    . MET A 10  ? 0.2250 0.2317 0.3532 0.0138  0.0241  0.0041  9   MET F CA    
78   C  C     . MET A 10  ? 0.2370 0.2366 0.3619 0.0097  0.0132  0.0033  9   MET F C     
79   O  O     . MET A 10  ? 0.2191 0.2229 0.3418 0.0044  0.0049  0.0067  9   MET F O     
80   C  CB    . MET A 10  ? 0.2338 0.2419 0.3414 0.0131  0.0272  0.0046  9   MET F CB    
81   C  CG    . MET A 10  ? 0.2436 0.2548 0.3498 0.0171  0.0377  0.0066  9   MET F CG    
82   S  SD    . MET A 10  ? 0.2746 0.2809 0.3883 0.0225  0.0512  0.0036  9   MET F SD    
83   C  CE    . MET A 10  ? 0.3022 0.2988 0.3932 0.0239  0.0514  -0.0022 9   MET F CE    
84   N  N     . ASP A 11  ? 0.2494 0.2372 0.3727 0.0124  0.0136  -0.0012 10  ASP F N     
85   C  CA    . ASP A 11  ? 0.2282 0.2043 0.3470 0.0085  0.0029  -0.0017 10  ASP F CA    
86   C  C     . ASP A 11  ? 0.2580 0.2304 0.3554 0.0011  -0.0017 -0.0015 10  ASP F C     
87   O  O     . ASP A 11  ? 0.2570 0.2267 0.3422 0.0028  0.0035  -0.0054 10  ASP F O     
88   C  CB    . ASP A 11  ? 0.2125 0.1750 0.3382 0.0157  0.0042  -0.0076 10  ASP F CB    
89   C  CG    . ASP A 11  ? 0.2486 0.2174 0.3993 0.0226  0.0071  -0.0080 10  ASP F CG    
90   O  OD1   . ASP A 11  ? 0.3044 0.2801 0.4660 0.0199  0.0009  -0.0033 10  ASP F OD1   
91   O  OD2   . ASP A 11  ? 0.3270 0.2953 0.4865 0.0307  0.0157  -0.0133 10  ASP F OD2   
92   N  N     . CYS A 12  ? 0.2420 0.2332 0.4394 0.0264  -0.0501 -0.0422 11  CYS F N     
93   C  CA    . CYS A 12  ? 0.2666 0.2570 0.4591 0.0196  -0.0577 -0.0362 11  CYS F CA    
94   C  C     . CYS A 12  ? 0.2834 0.2794 0.4544 0.0142  -0.0551 -0.0386 11  CYS F C     
95   O  O     . CYS A 12  ? 0.2398 0.2294 0.4052 0.0084  -0.0577 -0.0460 11  CYS F O     
96   C  CB    . CYS A 12  ? 0.3450 0.3222 0.5512 0.0168  -0.0635 -0.0440 11  CYS F CB    
97   S  SG    . CYS A 12  ? 0.3785 0.3466 0.6109 0.0224  -0.0685 -0.0416 11  CYS F SG    
98   N  N     . PHE A 13  ? 0.2082 0.2151 0.3664 0.0161  -0.0510 -0.0318 12  PHE F N     
99   C  CA    . PHE A 13  ? 0.2165 0.2274 0.3537 0.0125  -0.0463 -0.0371 12  PHE F CA    
100  C  C     . PHE A 13  ? 0.2393 0.2475 0.3664 0.0043  -0.0523 -0.0381 12  PHE F C     
101  O  O     . PHE A 13  ? 0.2765 0.2777 0.3926 0.0003  -0.0497 -0.0507 12  PHE F O     
102  C  CB    . PHE A 13  ? 0.1985 0.2215 0.3257 0.0156  -0.0439 -0.0265 12  PHE F CB    
103  C  CG    . PHE A 13  ? 0.2466 0.2736 0.3518 0.0117  -0.0399 -0.0304 12  PHE F CG    
104  C  CD1   . PHE A 13  ? 0.2640 0.2853 0.3605 0.0098  -0.0328 -0.0447 12  PHE F CD1   
105  C  CD2   . PHE A 13  ? 0.2347 0.2708 0.3280 0.0101  -0.0433 -0.0197 12  PHE F CD2   
106  C  CE1   . PHE A 13  ? 0.3184 0.3422 0.3929 0.0057  -0.0293 -0.0477 12  PHE F CE1   
107  C  CE2   . PHE A 13  ? 0.2656 0.3042 0.3385 0.0062  -0.0408 -0.0227 12  PHE F CE2   
108  C  CZ    . PHE A 13  ? 0.2969 0.3289 0.3594 0.0036  -0.0341 -0.0364 12  PHE F CZ    
109  N  N     . PHE A 14  ? 0.2203 0.2340 0.3500 0.0016  -0.0601 -0.0250 13  PHE F N     
110  C  CA    . PHE A 14  ? 0.2671 0.2787 0.3876 -0.0065 -0.0667 -0.0254 13  PHE F CA    
111  C  C     . PHE A 14  ? 0.2845 0.2817 0.4112 -0.0105 -0.0703 -0.0372 13  PHE F C     
112  O  O     . PHE A 14  ? 0.2908 0.2809 0.4037 -0.0161 -0.0716 -0.0467 13  PHE F O     
113  C  CB    . PHE A 14  ? 0.2580 0.2785 0.3850 -0.0090 -0.0746 -0.0091 13  PHE F CB    
114  C  CG    . PHE A 14  ? 0.2551 0.2898 0.3745 -0.0058 -0.0724 0.0023  13  PHE F CG    
115  C  CD1   . PHE A 14  ? 0.2632 0.3016 0.3708 -0.0012 -0.0647 -0.0010 13  PHE F CD1   
116  C  CD2   . PHE A 14  ? 0.2631 0.3076 0.3882 -0.0076 -0.0781 0.0167  13  PHE F CD2   
117  C  CE1   . PHE A 14  ? 0.2754 0.3255 0.3766 0.0020  -0.0636 0.0094  13  PHE F CE1   
118  C  CE2   . PHE A 14  ? 0.2418 0.2992 0.3607 -0.0039 -0.0759 0.0268  13  PHE F CE2   
119  C  CZ    . PHE A 14  ? 0.2449 0.3043 0.3514 0.0010  -0.0692 0.0229  13  PHE F CZ    
120  N  N     . ALA A 15  ? 0.2842 0.2756 0.4308 -0.0076 -0.0727 -0.0367 14  ALA F N     
121  C  CA    . ALA A 15  ? 0.3069 0.2834 0.4612 -0.0107 -0.0772 -0.0477 14  ALA F CA    
122  C  C     . ALA A 15  ? 0.3275 0.2952 0.4734 -0.0088 -0.0687 -0.0665 14  ALA F C     
123  O  O     . ALA A 15  ? 0.3336 0.2896 0.4736 -0.0132 -0.0711 -0.0784 14  ALA F O     
124  C  CB    . ALA A 15  ? 0.3175 0.2895 0.4957 -0.0075 -0.0818 -0.0424 14  ALA F CB    
125  N  N     . ALA A 16  ? 0.3148 0.2878 0.4602 -0.0024 -0.0587 -0.0695 15  ALA F N     
126  C  CA    . ALA A 16  ? 0.3773 0.3440 0.5157 -0.0006 -0.0489 -0.0868 15  ALA F CA    
127  C  C     . ALA A 16  ? 0.3533 0.3189 0.4649 -0.0068 -0.0463 -0.0935 15  ALA F C     
128  O  O     . ALA A 16  ? 0.3924 0.3476 0.4951 -0.0087 -0.0423 -0.1090 15  ALA F O     
129  C  CB    . ALA A 16  ? 0.3476 0.3221 0.4919 0.0068  -0.0392 -0.0865 15  ALA F CB    
130  N  N     . VAL A 17  ? 0.3301 0.3056 0.4278 -0.0099 -0.0489 -0.0821 16  VAL F N     
131  C  CA    . VAL A 17  ? 0.3300 0.3035 0.4016 -0.0165 -0.0486 -0.0870 16  VAL F CA    
132  C  C     . VAL A 17  ? 0.3852 0.3464 0.4528 -0.0235 -0.0584 -0.0921 16  VAL F C     
133  O  O     . VAL A 17  ? 0.4306 0.3814 0.4799 -0.0276 -0.0563 -0.1052 16  VAL F O     
134  C  CB    . VAL A 17  ? 0.3125 0.2993 0.3731 -0.0179 -0.0508 -0.0727 16  VAL F CB    
135  C  CG1   . VAL A 17  ? 0.3659 0.3491 0.4016 -0.0258 -0.0546 -0.0754 16  VAL F CG1   
136  C  CG2   . VAL A 17  ? 0.2772 0.2736 0.3366 -0.0116 -0.0404 -0.0707 16  VAL F CG2   
137  N  N     . GLU A 18  ? 0.3657 0.3274 0.4496 -0.0251 -0.0693 -0.0816 17  GLU F N     
138  C  CA    . GLU A 18  ? 0.3498 0.2998 0.4318 -0.0323 -0.0802 -0.0851 17  GLU F CA    
139  C  C     . GLU A 18  ? 0.4792 0.4123 0.5648 -0.0314 -0.0785 -0.1026 17  GLU F C     
140  O  O     . GLU A 18  ? 0.4919 0.4121 0.5641 -0.0372 -0.0835 -0.1124 17  GLU F O     
141  C  CB    . GLU A 18  ? 0.3596 0.3149 0.4613 -0.0343 -0.0916 -0.0692 17  GLU F CB    
142  C  CG    . GLU A 18  ? 0.3517 0.3239 0.4513 -0.0350 -0.0936 -0.0519 17  GLU F CG    
143  C  CD    . GLU A 18  ? 0.4225 0.3961 0.4997 -0.0416 -0.0974 -0.0517 17  GLU F CD    
144  O  OE1   . GLU A 18  ? 0.4274 0.3878 0.4897 -0.0472 -0.1008 -0.0635 17  GLU F OE1   
145  O  OE2   . GLU A 18  ? 0.3838 0.3711 0.4577 -0.0412 -0.0976 -0.0397 17  GLU F OE2   
146  N  N     . MET A 19  ? 0.4379 0.3702 0.5415 -0.0241 -0.0720 -0.1070 18  MET F N     
147  C  CA    . MET A 19  ? 0.4859 0.4025 0.5952 -0.0222 -0.0699 -0.1243 18  MET F CA    
148  C  C     . MET A 19  ? 0.5571 0.4683 0.6439 -0.0220 -0.0582 -0.1414 18  MET F C     
149  O  O     . MET A 19  ? 0.5199 0.4157 0.5985 -0.0241 -0.0588 -0.1566 18  MET F O     
150  C  CB    . MET A 19  ? 0.3889 0.3064 0.5254 -0.0142 -0.0669 -0.1238 18  MET F CB    
151  C  CG    . MET A 19  ? 0.4574 0.3755 0.6159 -0.0150 -0.0789 -0.1095 18  MET F CG    
152  S  SD    . MET A 19  ? 0.3967 0.3128 0.5853 -0.0061 -0.0767 -0.1097 18  MET F SD    
153  C  CE    . MET A 19  ? 0.3092 0.2423 0.4929 0.0005  -0.0638 -0.1043 18  MET F CE    
154  N  N     . ARG A 20  ? 0.5263 0.4493 0.6025 -0.0194 -0.0474 -0.1391 19  ARG F N     
155  C  CA    . ARG A 20  ? 0.4764 0.3959 0.5291 -0.0202 -0.0356 -0.1533 19  ARG F CA    
156  C  C     . ARG A 20  ? 0.5162 0.4264 0.5404 -0.0292 -0.0419 -0.1571 19  ARG F C     
157  O  O     . ARG A 20  ? 0.5760 0.4732 0.5829 -0.0311 -0.0370 -0.1735 19  ARG F O     
158  C  CB    . ARG A 20  ? 0.4581 0.3929 0.5049 -0.0172 -0.0251 -0.1467 19  ARG F CB    
159  C  CG    . ARG A 20  ? 0.4577 0.3900 0.4784 -0.0192 -0.0126 -0.1592 19  ARG F CG    
160  C  CD    . ARG A 20  ? 0.4332 0.3800 0.4432 -0.0190 -0.0065 -0.1492 19  ARG F CD    
161  N  NE    . ARG A 20  ? 0.4443 0.3955 0.4398 -0.0250 -0.0173 -0.1356 19  ARG F NE    
162  C  CZ    . ARG A 20  ? 0.4176 0.3815 0.4070 -0.0248 -0.0163 -0.1235 19  ARG F CZ    
163  N  NH1   . ARG A 20  ? 0.4303 0.4033 0.4259 -0.0194 -0.0055 -0.1228 19  ARG F NH1   
164  N  NH2   . ARG A 20  ? 0.4575 0.4248 0.4354 -0.0300 -0.0265 -0.1121 19  ARG F NH2   
165  N  N     . ASP A 21  ? 0.4743 0.3903 0.4931 -0.0346 -0.0530 -0.1424 20  ASP F N     
166  C  CA    . ASP A 21  ? 0.4768 0.3847 0.4691 -0.0434 -0.0606 -0.1443 20  ASP F CA    
167  C  C     . ASP A 21  ? 0.5813 0.4733 0.5771 -0.0482 -0.0737 -0.1495 20  ASP F C     
168  O  O     . ASP A 21  ? 0.6199 0.5008 0.5923 -0.0555 -0.0802 -0.1547 20  ASP F O     
169  C  CB    . ASP A 21  ? 0.4379 0.3596 0.4244 -0.0470 -0.0672 -0.1264 20  ASP F CB    
170  C  CG    . ASP A 21  ? 0.5188 0.4536 0.4966 -0.0433 -0.0554 -0.1226 20  ASP F CG    
171  O  OD1   . ASP A 21  ? 0.6296 0.5615 0.6005 -0.0400 -0.0423 -0.1348 20  ASP F OD1   
172  O  OD2   . ASP A 21  ? 0.5654 0.5132 0.5437 -0.0438 -0.0591 -0.1076 20  ASP F OD2   
173  N  N     . ASN A 22  ? 0.6070 0.4961 0.6306 -0.0446 -0.0783 -0.1484 21  ASN F N     
174  C  CA    . ASN A 22  ? 0.6126 0.4850 0.6417 -0.0488 -0.0908 -0.1541 21  ASN F CA    
175  C  C     . ASN A 22  ? 0.6077 0.4740 0.6626 -0.0419 -0.0879 -0.1616 21  ASN F C     
176  O  O     . ASN A 22  ? 0.5635 0.4357 0.6449 -0.0396 -0.0939 -0.1498 21  ASN F O     
177  C  CB    . ASN A 22  ? 0.6312 0.5085 0.6702 -0.0552 -0.1070 -0.1368 21  ASN F CB    
178  C  CG    . ASN A 22  ? 0.7263 0.5861 0.7726 -0.0603 -0.1213 -0.1417 21  ASN F CG    
179  O  OD1   . ASN A 22  ? 0.6519 0.4940 0.6911 -0.0596 -0.1199 -0.1593 21  ASN F OD1   
180  N  ND2   . ASN A 22  ? 0.8056 0.6704 0.8667 -0.0654 -0.1349 -0.1260 21  ASN F ND2   
181  N  N     . PRO A 23  ? 0.6338 0.4879 0.6816 -0.0382 -0.0787 -0.1812 22  PRO F N     
182  C  CA    . PRO A 23  ? 0.6589 0.5083 0.7331 -0.0304 -0.0747 -0.1889 22  PRO F CA    
183  C  C     . PRO A 23  ? 0.6566 0.4941 0.7517 -0.0323 -0.0901 -0.1865 22  PRO F C     
184  O  O     . PRO A 23  ? 0.7183 0.5533 0.8392 -0.0262 -0.0896 -0.1887 22  PRO F O     
185  C  CB    . PRO A 23  ? 0.7520 0.5898 0.8101 -0.0272 -0.0619 -0.2117 22  PRO F CB    
186  C  CG    . PRO A 23  ? 0.7526 0.5957 0.7774 -0.0318 -0.0547 -0.2122 22  PRO F CG    
187  C  CD    . PRO A 23  ? 0.7198 0.5652 0.7354 -0.0405 -0.0699 -0.1969 22  PRO F CD    
188  N  N     . ALA A 24  ? 0.6517 0.4818 0.7378 -0.0410 -0.1045 -0.1815 23  ALA F N     
189  C  CA    . ALA A 24  ? 0.7347 0.5548 0.8423 -0.0438 -0.1202 -0.1764 23  ALA F CA    
190  C  C     . ALA A 24  ? 0.7136 0.5483 0.8498 -0.0413 -0.1235 -0.1571 23  ALA F C     
191  O  O     . ALA A 24  ? 0.6159 0.4430 0.7748 -0.0414 -0.1334 -0.1536 23  ALA F O     
192  C  CB    . ALA A 24  ? 0.7073 0.5192 0.8006 -0.0543 -0.1354 -0.1723 23  ALA F CB    
193  N  N     . LEU A 25  ? 0.6169 0.4714 0.7514 -0.0390 -0.1157 -0.1445 24  LEU F N     
194  C  CA    . LEU A 25  ? 0.5715 0.4400 0.7287 -0.0367 -0.1181 -0.1257 24  LEU F CA    
195  C  C     . LEU A 25  ? 0.5155 0.3870 0.6905 -0.0270 -0.1086 -0.1289 24  LEU F C     
196  O  O     . LEU A 25  ? 0.4673 0.3482 0.6606 -0.0245 -0.1106 -0.1144 24  LEU F O     
197  C  CB    . LEU A 25  ? 0.5518 0.4395 0.6980 -0.0389 -0.1156 -0.1101 24  LEU F CB    
198  C  CG    . LEU A 25  ? 0.4655 0.3533 0.5920 -0.0479 -0.1235 -0.1065 24  LEU F CG    
199  C  CD1   . LEU A 25  ? 0.4831 0.3905 0.6006 -0.0478 -0.1189 -0.0926 24  LEU F CD1   
200  C  CD2   . LEU A 25  ? 0.5679 0.4489 0.7084 -0.0550 -0.1399 -0.0981 24  LEU F CD2   
201  N  N     . ARG A 26  ? 0.4803 0.3439 0.6505 -0.0218 -0.0984 -0.1476 25  ARG F N     
202  C  CA    . ARG A 26  ? 0.4913 0.3601 0.6772 -0.0124 -0.0878 -0.1511 25  ARG F CA    
203  C  C     . ARG A 26  ? 0.5027 0.3657 0.7191 -0.0090 -0.0961 -0.1459 25  ARG F C     
204  O  O     . ARG A 26  ? 0.4829 0.3550 0.7148 -0.0035 -0.0929 -0.1371 25  ARG F O     
205  C  CB    . ARG A 26  ? 0.6553 0.5161 0.8313 -0.0081 -0.0754 -0.1732 25  ARG F CB    
206  C  CG    . ARG A 26  ? 0.7100 0.5734 0.9070 0.0016  -0.0656 -0.1795 25  ARG F CG    
207  C  CD    . ARG A 26  ? 0.7216 0.6039 0.9166 0.0052  -0.0555 -0.1697 25  ARG F CD    
208  N  NE    . ARG A 26  ? 0.7485 0.6369 0.9145 0.0021  -0.0457 -0.1743 25  ARG F NE    
209  C  CZ    . ARG A 26  ? 0.6630 0.5672 0.8202 0.0028  -0.0388 -0.1645 25  ARG F CZ    
210  N  NH1   . ARG A 26  ? 0.5639 0.4788 0.7383 0.0068  -0.0405 -0.1502 25  ARG F NH1   
211  N  NH2   . ARG A 26  ? 0.6801 0.5881 0.8103 -0.0006 -0.0308 -0.1689 25  ARG F NH2   
212  N  N     . ASP A 27  ? 0.4915 0.3388 0.7156 -0.0123 -0.1072 -0.1505 26  ASP F N     
213  C  CA    . ASP A 27  ? 0.6337 0.4786 0.8811 -0.0075 -0.1115 -0.1449 26  ASP F CA    
214  C  C     . ASP A 27  ? 0.5873 0.4315 0.8475 -0.0132 -0.1265 -0.1271 26  ASP F C     
215  O  O     . ASP A 27  ? 0.6522 0.4944 0.9307 -0.0101 -0.1315 -0.1211 26  ASP F O     
216  C  CB    . ASP A 27  ? 0.7023 0.5352 0.9482 -0.0041 -0.1089 -0.1607 26  ASP F CB    
217  C  CG    . ASP A 27  ? 0.7458 0.5825 0.9861 0.0033  -0.0923 -0.1755 26  ASP F CG    
218  O  OD1   . ASP A 27  ? 0.7020 0.5502 0.9552 0.0093  -0.0853 -0.1709 26  ASP F OD1   
219  O  OD2   . ASP A 27  ? 0.8086 0.6372 1.0309 0.0028  -0.0861 -0.1908 26  ASP F OD2   
220  N  N     . ILE A 28  ? 0.4506 0.2979 0.7019 -0.0218 -0.1337 -0.1177 27  ILE F N     
221  C  CA    . ILE A 28  ? 0.5133 0.3628 0.7765 -0.0280 -0.1466 -0.0990 27  ILE F CA    
222  C  C     . ILE A 28  ? 0.4536 0.3209 0.7197 -0.0278 -0.1436 -0.0811 27  ILE F C     
223  O  O     . ILE A 28  ? 0.4105 0.2901 0.6621 -0.0241 -0.1320 -0.0824 27  ILE F O     
224  C  CB    . ILE A 28  ? 0.5838 0.4275 0.8348 -0.0375 -0.1565 -0.0982 27  ILE F CB    
225  C  CG1   . ILE A 28  ? 0.5488 0.4004 0.7764 -0.0411 -0.1512 -0.1013 27  ILE F CG1   
226  C  CG2   . ILE A 28  ? 0.5707 0.3979 0.8177 -0.0368 -0.1596 -0.1124 27  ILE F CG2   
227  C  CD1   . ILE A 28  ? 0.6322 0.4806 0.8494 -0.0514 -0.1627 -0.0970 27  ILE F CD1   
228  N  N     . PRO A 29  ? 0.4641 0.3354 0.7456 -0.0307 -0.1519 -0.0629 28  PRO F N     
229  C  CA    . PRO A 29  ? 0.3764 0.2671 0.6564 -0.0294 -0.1470 -0.0446 28  PRO F CA    
230  C  C     . PRO A 29  ? 0.3617 0.2655 0.6240 -0.0350 -0.1457 -0.0378 28  PRO F C     
231  O  O     . PRO A 29  ? 0.3942 0.2953 0.6564 -0.0433 -0.1554 -0.0334 28  PRO F O     
232  C  CB    . PRO A 29  ? 0.3739 0.2623 0.6742 -0.0325 -0.1572 -0.0284 28  PRO F CB    
233  C  CG    . PRO A 29  ? 0.3861 0.2593 0.6919 -0.0379 -0.1683 -0.0341 28  PRO F CG    
234  C  CD    . PRO A 29  ? 0.4312 0.2932 0.7277 -0.0332 -0.1630 -0.0569 28  PRO F CD    
235  N  N     . ILE A 30  ? 0.3665 0.2841 0.6147 -0.0305 -0.1346 -0.0368 29  ILE F N     
236  C  CA    . ILE A 30  ? 0.2968 0.2277 0.5286 -0.0347 -0.1331 -0.0299 29  ILE F CA    
237  C  C     . ILE A 30  ? 0.3131 0.2621 0.5438 -0.0301 -0.1261 -0.0152 29  ILE F C     
238  O  O     . ILE A 30  ? 0.2896 0.2403 0.5260 -0.0228 -0.1200 -0.0144 29  ILE F O     
239  C  CB    . ILE A 30  ? 0.3303 0.2581 0.5396 -0.0348 -0.1268 -0.0461 29  ILE F CB    
240  C  CG1   . ILE A 30  ? 0.3073 0.2421 0.5085 -0.0264 -0.1132 -0.0516 29  ILE F CG1   
241  C  CG2   . ILE A 30  ? 0.3915 0.2993 0.5997 -0.0371 -0.1314 -0.0639 29  ILE F CG2   
242  C  CD1   . ILE A 30  ? 0.3547 0.2914 0.5314 -0.0274 -0.1062 -0.0620 29  ILE F CD1   
243  N  N     . ALA A 31  ? 0.3128 0.2749 0.5358 -0.0343 -0.1274 -0.0039 30  ALA F N     
244  C  CA    . ALA A 31  ? 0.3176 0.2971 0.5370 -0.0299 -0.1206 0.0091  30  ALA F CA    
245  C  C     . ALA A 31  ? 0.3219 0.3127 0.5269 -0.0340 -0.1207 0.0132  30  ALA F C     
246  O  O     . ALA A 31  ? 0.3350 0.3229 0.5395 -0.0418 -0.1289 0.0131  30  ALA F O     
247  C  CB    . ALA A 31  ? 0.2560 0.2415 0.4921 -0.0299 -0.1242 0.0269  30  ALA F CB    
248  N  N     . ILE A 32  ? 0.2344 0.2374 0.4281 -0.0287 -0.1123 0.0164  31  ILE F N     
249  C  CA    . ILE A 32  ? 0.2401 0.2562 0.4231 -0.0315 -0.1125 0.0237  31  ILE F CA    
250  C  C     . ILE A 32  ? 0.2635 0.2939 0.4587 -0.0305 -0.1134 0.0427  31  ILE F C     
251  O  O     . ILE A 32  ? 0.2906 0.3253 0.4902 -0.0238 -0.1078 0.0488  31  ILE F O     
252  C  CB    . ILE A 32  ? 0.2958 0.3167 0.4597 -0.0264 -0.1034 0.0171  31  ILE F CB    
253  C  CG1   . ILE A 32  ? 0.3172 0.3250 0.4666 -0.0287 -0.1021 -0.0010 31  ILE F CG1   
254  C  CG2   . ILE A 32  ? 0.3237 0.3595 0.4792 -0.0279 -0.1042 0.0273  31  ILE F CG2   
255  C  CD1   . ILE A 32  ? 0.3254 0.3216 0.4793 -0.0239 -0.0968 -0.0136 31  ILE F CD1   
256  N  N     . GLY A 33  ? 0.2748 0.3121 0.4758 -0.0373 -0.1204 0.0520  32  GLY F N     
257  C  CA    . GLY A 33  ? 0.2387 0.2907 0.4524 -0.0370 -0.1205 0.0701  32  GLY F CA    
258  C  C     . GLY A 33  ? 0.2705 0.3284 0.4936 -0.0459 -0.1295 0.0784  32  GLY F C     
259  O  O     . GLY A 33  ? 0.3515 0.3983 0.5746 -0.0530 -0.1379 0.0705  32  GLY F O     
260  N  N     . GLY A 34  ? 0.3225 0.3977 0.5544 -0.0455 -0.1280 0.0943  33  GLY F N     
261  C  CA    . GLY A 34  ? 0.2505 0.3314 0.4920 -0.0533 -0.1344 0.1031  33  GLY F CA    
262  C  C     . GLY A 34  ? 0.3301 0.4020 0.5887 -0.0598 -0.1415 0.1077  33  GLY F C     
263  O  O     . GLY A 34  ? 0.2863 0.3537 0.5532 -0.0575 -0.1397 0.1105  33  GLY F O     
264  N  N     . SER A 35  ? 0.2937 0.3619 0.5571 -0.0680 -0.1501 0.1087  34  SER F N     
265  C  CA    . SER A 35  ? 0.3201 0.3785 0.5987 -0.0744 -0.1575 0.1133  34  SER F CA    
266  C  C     . SER A 35  ? 0.2914 0.3598 0.5822 -0.0729 -0.1510 0.1309  34  SER F C     
267  O  O     . SER A 35  ? 0.2886 0.3719 0.5756 -0.0680 -0.1410 0.1395  34  SER F O     
268  C  CB    . SER A 35  ? 0.3499 0.4025 0.6296 -0.0826 -0.1677 0.1120  34  SER F CB    
269  O  OG    . SER A 35  ? 0.3254 0.3931 0.6066 -0.0830 -0.1643 0.1234  34  SER F OG    
270  N  N     . ARG A 36  ? 0.2936 0.3525 0.5980 -0.0773 -0.1567 0.1357  35  ARG F N     
271  C  CA    . ARG A 36  ? 0.2555 0.3230 0.5719 -0.0778 -0.1521 0.1534  35  ARG F CA    
272  C  C     . ARG A 36  ? 0.3213 0.4028 0.6418 -0.0808 -0.1501 0.1648  35  ARG F C     
273  O  O     . ARG A 36  ? 0.2908 0.3865 0.6147 -0.0782 -0.1410 0.1779  35  ARG F O     
274  C  CB    . ARG A 36  ? 0.3344 0.3876 0.6645 -0.0828 -0.1608 0.1563  35  ARG F CB    
275  C  CG    . ARG A 36  ? 0.4151 0.4764 0.7586 -0.0853 -0.1583 0.1757  35  ARG F CG    
276  C  CD    . ARG A 36  ? 0.5565 0.6021 0.9119 -0.0894 -0.1677 0.1778  35  ARG F CD    
277  N  NE    . ARG A 36  ? 0.7054 0.7319 1.0577 -0.0914 -0.1780 0.1607  35  ARG F NE    
278  C  CZ    . ARG A 36  ? 0.8523 0.8717 1.2065 -0.0970 -0.1874 0.1563  35  ARG F CZ    
279  N  NH1   . ARG A 36  ? 0.9143 0.9444 1.2754 -0.1015 -0.1885 0.1683  35  ARG F NH1   
280  N  NH2   . ARG A 36  ? 0.8787 0.8800 1.2278 -0.0980 -0.1956 0.1398  35  ARG F NH2   
281  N  N     . GLU A 37  ? 0.3293 0.4066 0.6494 -0.0862 -0.1588 0.1596  36  GLU F N     
282  C  CA    . GLU A 37  ? 0.3266 0.4162 0.6521 -0.0892 -0.1582 0.1695  36  GLU F CA    
283  C  C     . GLU A 37  ? 0.3328 0.4373 0.6470 -0.0829 -0.1479 0.1694  36  GLU F C     
284  O  O     . GLU A 37  ? 0.3505 0.4693 0.6708 -0.0822 -0.1420 0.1810  36  GLU F O     
285  C  CB    . GLU A 37  ? 0.3982 0.4771 0.7249 -0.0964 -0.1714 0.1630  36  GLU F CB    
286  C  CG    . GLU A 37  ? 0.5799 0.6444 0.9191 -0.1029 -0.1823 0.1649  36  GLU F CG    
287  C  CD    . GLU A 37  ? 0.7172 0.7632 1.0512 -0.1020 -0.1870 0.1516  36  GLU F CD    
288  O  OE1   . GLU A 37  ? 0.8684 0.9017 1.2119 -0.1063 -0.1956 0.1525  36  GLU F OE1   
289  O  OE2   . GLU A 37  ? 0.4599 0.5039 0.7811 -0.0969 -0.1824 0.1400  36  GLU F OE2   
290  N  N     . ARG A 38  ? 0.2303 0.3315 0.5281 -0.0779 -0.1457 0.1563  37  ARG F N     
291  C  CA    . ARG A 38  ? 0.2223 0.3360 0.5075 -0.0708 -0.1356 0.1554  37  ARG F CA    
292  C  C     . ARG A 38  ? 0.2733 0.3950 0.5565 -0.0632 -0.1230 0.1620  37  ARG F C     
293  O  O     . ARG A 38  ? 0.2382 0.3681 0.5089 -0.0561 -0.1139 0.1601  37  ARG F O     
294  C  CB    . ARG A 38  ? 0.2629 0.3694 0.5307 -0.0685 -0.1387 0.1395  37  ARG F CB    
295  C  CG    . ARG A 38  ? 0.3303 0.4312 0.5949 -0.0751 -0.1495 0.1333  37  ARG F CG    
296  C  CD    . ARG A 38  ? 0.3495 0.4631 0.6109 -0.0736 -0.1458 0.1387  37  ARG F CD    
297  N  NE    . ARG A 38  ? 0.3194 0.4405 0.5658 -0.0650 -0.1359 0.1348  37  ARG F NE    
298  C  CZ    . ARG A 38  ? 0.3896 0.5065 0.6190 -0.0635 -0.1382 0.1237  37  ARG F CZ    
299  N  NH1   . ARG A 38  ? 0.4938 0.5991 0.7178 -0.0702 -0.1499 0.1148  37  ARG F NH1   
300  N  NH2   . ARG A 38  ? 0.3200 0.4432 0.5363 -0.0554 -0.1289 0.1212  37  ARG F NH2   
301  N  N     . ARG A 39  ? 0.2750 0.3928 0.5689 -0.0647 -0.1230 0.1691  38  ARG F N     
302  C  CA    . ARG A 39  ? 0.2903 0.4140 0.5823 -0.0585 -0.1122 0.1762  38  ARG F CA    
303  C  C     . ARG A 39  ? 0.2668 0.3859 0.5416 -0.0503 -0.1071 0.1642  38  ARG F C     
304  O  O     . ARG A 39  ? 0.2319 0.3585 0.4959 -0.0429 -0.0962 0.1660  38  ARG F O     
305  C  CB    . ARG A 39  ? 0.2790 0.4200 0.5731 -0.0562 -0.1023 0.1888  38  ARG F CB    
306  C  CG    . ARG A 39  ? 0.2572 0.4033 0.5700 -0.0640 -0.1075 0.2015  38  ARG F CG    
307  C  CD    . ARG A 39  ? 0.2830 0.4454 0.6025 -0.0615 -0.0970 0.2173  38  ARG F CD    
308  N  NE    . ARG A 39  ? 0.2933 0.4681 0.6063 -0.0570 -0.0902 0.2165  38  ARG F NE    
309  C  CZ    . ARG A 39  ? 0.3026 0.4929 0.6218 -0.0545 -0.0817 0.2288  38  ARG F CZ    
310  N  NH1   . ARG A 39  ? 0.3461 0.5423 0.6773 -0.0560 -0.0787 0.2434  38  ARG F NH1   
311  N  NH2   . ARG A 39  ? 0.2639 0.4637 0.5773 -0.0501 -0.0766 0.2264  38  ARG F NH2   
312  N  N     . GLY A 40  ? 0.2582 0.3642 0.5301 -0.0515 -0.1152 0.1515  39  GLY F N     
313  C  CA    . GLY A 40  ? 0.2577 0.3595 0.5140 -0.0441 -0.1116 0.1392  39  GLY F CA    
314  C  C     . GLY A 40  ? 0.2473 0.3420 0.5029 -0.0387 -0.1078 0.1386  39  GLY F C     
315  O  O     . GLY A 40  ? 0.2349 0.3261 0.5024 -0.0415 -0.1095 0.1471  39  GLY F O     
316  N  N     . VAL A 41  ? 0.2435 0.3355 0.4843 -0.0309 -0.1029 0.1288  40  VAL F N     
317  C  CA    . VAL A 41  ? 0.2780 0.3599 0.5168 -0.0254 -0.1010 0.1243  40  VAL F CA    
318  C  C     . VAL A 41  ? 0.2123 0.2854 0.4485 -0.0237 -0.1066 0.1089  40  VAL F C     
319  O  O     . VAL A 41  ? 0.2531 0.3286 0.4832 -0.0261 -0.1093 0.1015  40  VAL F O     
320  C  CB    . VAL A 41  ? 0.3991 0.4850 0.6223 -0.0170 -0.0884 0.1269  40  VAL F CB    
321  C  CG1   . VAL A 41  ? 0.2338 0.3314 0.4585 -0.0184 -0.0819 0.1404  40  VAL F CG1   
322  C  CG2   . VAL A 41  ? 0.4346 0.5231 0.6407 -0.0108 -0.0835 0.1172  40  VAL F CG2   
323  N  N     . ILE A 42  ? 0.1784 0.2394 0.4166 -0.0199 -0.1068 0.1031  41  ILE F N     
324  C  CA    . ILE A 42  ? 0.1885 0.2362 0.4188 -0.0179 -0.1066 0.0854  41  ILE F CA    
325  C  C     . ILE A 42  ? 0.2151 0.2683 0.4293 -0.0098 -0.0980 0.0805  41  ILE F C     
326  O  O     . ILE A 42  ? 0.1950 0.2526 0.4067 -0.0030 -0.0929 0.0874  41  ILE F O     
327  C  CB    . ILE A 42  ? 0.1808 0.2125 0.4208 -0.0168 -0.1095 0.0807  41  ILE F CB    
328  C  CG1   . ILE A 42  ? 0.2398 0.2647 0.4963 -0.0254 -0.1192 0.0858  41  ILE F CG1   
329  C  CG2   . ILE A 42  ? 0.2371 0.2569 0.4701 -0.0138 -0.1076 0.0622  41  ILE F CG2   
330  C  CD1   . ILE A 42  ? 0.2914 0.3132 0.5479 -0.0333 -0.1257 0.0783  41  ILE F CD1   
331  N  N     . SER A 43  ? 0.2200 0.2720 0.4221 -0.0108 -0.0970 0.0689  42  SER F N     
332  C  CA    . SER A 43  ? 0.2119 0.2665 0.3992 -0.0038 -0.0894 0.0626  42  SER F CA    
333  C  C     . SER A 43  ? 0.1909 0.2326 0.3794 0.0007  -0.0866 0.0513  42  SER F C     
334  O  O     . SER A 43  ? 0.2029 0.2461 0.3876 0.0081  -0.0812 0.0523  42  SER F O     
335  C  CB    . SER A 43  ? 0.1987 0.2562 0.3718 -0.0071 -0.0892 0.0550  42  SER F CB    
336  O  OG    . SER A 43  ? 0.2109 0.2815 0.3845 -0.0102 -0.0920 0.0661  42  SER F OG    
337  N  N     . THR A 44  ? 0.1871 0.2161 0.3809 -0.0034 -0.0904 0.0401  43  THR F N     
338  C  CA    . THR A 44  ? 0.2124 0.2289 0.4125 0.0006  -0.0886 0.0297  43  THR F CA    
339  C  C     . THR A 44  ? 0.2324 0.2354 0.4419 -0.0052 -0.0952 0.0207  43  THR F C     
340  O  O     . THR A 44  ? 0.2387 0.2417 0.4465 -0.0124 -0.1006 0.0209  43  THR F O     
341  C  CB    . THR A 44  ? 0.2072 0.2234 0.3950 0.0055  -0.0806 0.0178  43  THR F CB    
342  O  OG1   . THR A 44  ? 0.2324 0.2394 0.4300 0.0109  -0.0785 0.0110  43  THR F OG1   
343  C  CG2   . THR A 44  ? 0.2490 0.2608 0.4259 0.0001  -0.0802 0.0047  43  THR F CG2   
344  N  N     . ALA A 45  ? 0.2154 0.2064 0.4351 -0.0019 -0.0952 0.0124  44  ALA F N     
345  C  CA    . ALA A 45  ? 0.2252 0.2016 0.4555 -0.0061 -0.1017 0.0029  44  ALA F CA    
346  C  C     . ALA A 45  ? 0.2533 0.2196 0.4850 -0.0011 -0.0964 -0.0144 44  ALA F C     
347  O  O     . ALA A 45  ? 0.2717 0.2417 0.5019 0.0057  -0.0894 -0.0160 44  ALA F O     
348  C  CB    . ALA A 45  ? 0.3318 0.3027 0.5803 -0.0079 -0.1100 0.0140  44  ALA F CB    
349  N  N     . ASN A 46  ? 0.2474 0.2006 0.4825 -0.0044 -0.0999 -0.0277 45  ASN F N     
350  C  CA    . ASN A 46  ? 0.3394 0.2830 0.5792 0.0008  -0.0945 -0.0443 45  ASN F CA    
351  C  C     . ASN A 46  ? 0.2875 0.2214 0.5501 0.0045  -0.1000 -0.0423 45  ASN F C     
352  O  O     . ASN A 46  ? 0.3192 0.2530 0.5914 0.0022  -0.1079 -0.0282 45  ASN F O     
353  C  CB    . ASN A 46  ? 0.3140 0.2474 0.5451 -0.0033 -0.0944 -0.0611 45  ASN F CB    
354  C  CG    . ASN A 46  ? 0.3432 0.2634 0.5847 -0.0093 -0.1064 -0.0620 45  ASN F CG    
355  O  OD1   . ASN A 46  ? 0.3486 0.2685 0.6040 -0.0113 -0.1149 -0.0488 45  ASN F OD1   
356  N  ND2   . ASN A 46  ? 0.3775 0.2863 0.6113 -0.0124 -0.1072 -0.0776 45  ASN F ND2   
357  N  N     . TYR A 47  ? 0.2737 0.1997 0.5453 0.0104  -0.0955 -0.0562 46  TYR F N     
358  C  CA    . TYR A 47  ? 0.2703 0.1872 0.5642 0.0147  -0.1009 -0.0542 46  TYR F CA    
359  C  C     . TYR A 47  ? 0.3113 0.2144 0.6183 0.0095  -0.1132 -0.0533 46  TYR F C     
360  O  O     . TYR A 47  ? 0.2966 0.1961 0.6172 0.0096  -0.1211 -0.0414 46  TYR F O     
361  C  CB    . TYR A 47  ? 0.2509 0.1632 0.5543 0.0223  -0.0935 -0.0696 46  TYR F CB    
362  C  CG    . TYR A 47  ? 0.2521 0.1763 0.5519 0.0282  -0.0860 -0.0633 46  TYR F CG    
363  C  CD1   . TYR A 47  ? 0.3022 0.2315 0.6079 0.0300  -0.0900 -0.0489 46  TYR F CD1   
364  C  CD2   . TYR A 47  ? 0.2964 0.2306 0.5806 0.0297  -0.0746 -0.0698 46  TYR F CD2   
365  C  CE1   . TYR A 47  ? 0.2956 0.2359 0.5933 0.0336  -0.0837 -0.0426 46  TYR F CE1   
366  C  CE2   . TYR A 47  ? 0.2910 0.2353 0.5720 0.0346  -0.0690 -0.0635 46  TYR F CE2   
367  C  CZ    . TYR A 47  ? 0.2824 0.2286 0.5711 0.0370  -0.0742 -0.0501 46  TYR F CZ    
368  O  OH    . TYR A 47  ? 0.2959 0.2526 0.5751 0.0397  -0.0684 -0.0436 46  TYR F OH    
369  N  N     . PRO A 48  ? 0.3229 0.2177 0.6253 0.0047  -0.1157 -0.0646 47  PRO F N     
370  C  CA    . PRO A 48  ? 0.3813 0.2642 0.6951 -0.0009 -0.1285 -0.0614 47  PRO F CA    
371  C  C     . PRO A 48  ? 0.3907 0.2796 0.7067 -0.0072 -0.1368 -0.0401 47  PRO F C     
372  O  O     . PRO A 48  ? 0.3530 0.2371 0.6817 -0.0087 -0.1455 -0.0315 47  PRO F O     
373  C  CB    . PRO A 48  ? 0.3831 0.2583 0.6850 -0.0057 -0.1289 -0.0762 47  PRO F CB    
374  C  CG    . PRO A 48  ? 0.3802 0.2566 0.6736 0.0005  -0.1161 -0.0931 47  PRO F CG    
375  C  CD    . PRO A 48  ? 0.3480 0.2414 0.6354 0.0047  -0.1074 -0.0824 47  PRO F CD    
376  N  N     . ALA A 49  ? 0.3574 0.2624 0.6575 -0.0095 -0.1320 -0.0298 48  ALA F N     
377  C  CA    . ALA A 49  ? 0.3061 0.2201 0.6083 -0.0144 -0.1375 -0.0089 48  ALA F CA    
378  C  C     . ALA A 49  ? 0.2773 0.1962 0.5860 -0.0088 -0.1355 0.0036  48  ALA F C     
379  O  O     . ALA A 49  ? 0.2782 0.1965 0.5960 -0.0120 -0.1424 0.0188  48  ALA F O     
380  C  CB    . ALA A 49  ? 0.2794 0.2090 0.5636 -0.0183 -0.1332 -0.0028 48  ALA F CB    
381  N  N     . ARG A 50  ? 0.2978 0.2216 0.6008 -0.0008 -0.1262 -0.0018 49  ARG F N     
382  C  CA    . ARG A 50  ? 0.2393 0.1660 0.5469 0.0049  -0.1251 0.0091  49  ARG F CA    
383  C  C     . ARG A 50  ? 0.2589 0.1741 0.5834 0.0052  -0.1330 0.0098  49  ARG F C     
384  O  O     . ARG A 50  ? 0.2476 0.1689 0.5705 0.0044  -0.1338 0.0221  49  ARG F O     
385  C  CB    . ARG A 50  ? 0.2635 0.1959 0.5637 0.0130  -0.1148 0.0008  49  ARG F CB    
386  C  CG    . ARG A 50  ? 0.2151 0.1637 0.4950 0.0127  -0.1065 0.0041  49  ARG F CG    
387  C  CD    . ARG A 50  ? 0.1995 0.1528 0.4730 0.0201  -0.0969 -0.0042 49  ARG F CD    
388  N  NE    . ARG A 50  ? 0.2345 0.2014 0.4884 0.0187  -0.0902 -0.0025 49  ARG F NE    
389  C  CZ    . ARG A 50  ? 0.3805 0.3558 0.6240 0.0237  -0.0822 -0.0036 49  ARG F CZ    
390  N  NH1   . ARG A 50  ? 0.4260 0.3982 0.6772 0.0306  -0.0797 -0.0066 49  ARG F NH1   
391  N  NH2   . ARG A 50  ? 0.3689 0.3552 0.5950 0.0216  -0.0777 -0.0018 49  ARG F NH2   
392  N  N     . LYS A 51  ? 0.3022 0.2080 0.6354 0.0048  -0.1361 -0.0044 50  LYS F N     
393  C  CA    . LYS A 51  ? 0.3237 0.2259 0.6686 0.0046  -0.1427 -0.0038 50  LYS F CA    
394  C  C     . LYS A 51  ? 0.3339 0.2358 0.6830 -0.0023 -0.1523 0.0132  50  LYS F C     
395  O  O     . LYS A 51  ? 0.2803 0.1829 0.6349 -0.0029 -0.1565 0.0201  50  LYS F O     
396  C  CB    . LYS A 51  ? 0.3613 0.2541 0.7130 0.0058  -0.1443 -0.0211 50  LYS F CB    
397  C  CG    . LYS A 51  ? 0.4019 0.2902 0.7670 0.0066  -0.1515 -0.0219 50  LYS F CG    
398  C  CD    . LYS A 51  ? 0.3384 0.2176 0.7082 0.0084  -0.1518 -0.0393 50  LYS F CD    
399  C  CE    . LYS A 51  ? 0.4580 0.3292 0.8219 0.0023  -0.1565 -0.0412 50  LYS F CE    
400  N  NZ    . LYS A 51  ? 0.4859 0.3470 0.8532 0.0040  -0.1577 -0.0575 50  LYS F NZ    
401  N  N     . PHE A 52  ? 0.2912 0.1925 0.6375 -0.0085 -0.1556 0.0204  51  PHE F N     
402  C  CA    . PHE A 52  ? 0.3257 0.2292 0.6763 -0.0158 -0.1634 0.0378  51  PHE F CA    
403  C  C     . PHE A 52  ? 0.3832 0.2990 0.7255 -0.0165 -0.1585 0.0548  51  PHE F C     
404  O  O     . PHE A 52  ? 0.3023 0.2226 0.6468 -0.0227 -0.1628 0.0700  51  PHE F O     
405  C  CB    . PHE A 52  ? 0.3129 0.2134 0.6634 -0.0236 -0.1685 0.0390  51  PHE F CB    
406  C  CG    . PHE A 52  ? 0.3261 0.2149 0.6805 -0.0240 -0.1735 0.0234  51  PHE F CG    
407  C  CD1   . PHE A 52  ? 0.3351 0.2190 0.6829 -0.0203 -0.1677 0.0041  51  PHE F CD1   
408  C  CD2   . PHE A 52  ? 0.3137 0.1963 0.6773 -0.0282 -0.1838 0.0280  51  PHE F CD2   
409  C  CE1   . PHE A 52  ? 0.3196 0.1927 0.6687 -0.0204 -0.1712 -0.0105 51  PHE F CE1   
410  C  CE2   . PHE A 52  ? 0.3828 0.2539 0.7487 -0.0280 -0.1883 0.0137  51  PHE F CE2   
411  C  CZ    . PHE A 52  ? 0.3349 0.2012 0.6931 -0.0240 -0.1817 -0.0057 51  PHE F CZ    
412  N  N     . GLY A 53  ? 0.3598 0.2825 0.6904 -0.0104 -0.1486 0.0524  52  GLY F N     
413  C  CA    . GLY A 53  ? 0.2646 0.2000 0.5812 -0.0103 -0.1414 0.0662  52  GLY F CA    
414  C  C     . GLY A 53  ? 0.2794 0.2263 0.5858 -0.0097 -0.1359 0.0720  52  GLY F C     
415  O  O     . GLY A 53  ? 0.3312 0.2905 0.6234 -0.0093 -0.1283 0.0824  52  GLY F O     
416  N  N     . VAL A 54  ? 0.2351 0.1807 0.5438 -0.0107 -0.1378 0.0632  53  VAL F N     
417  C  CA    . VAL A 54  ? 0.2176 0.1798 0.5119 -0.0122 -0.1312 0.0659  53  VAL F CA    
418  C  C     . VAL A 54  ? 0.2945 0.2647 0.5751 -0.0036 -0.1211 0.0618  53  VAL F C     
419  O  O     . VAL A 54  ? 0.2796 0.2422 0.5607 0.0019  -0.1184 0.0484  53  VAL F O     
420  C  CB    . VAL A 54  ? 0.2571 0.2168 0.5495 -0.0178 -0.1336 0.0538  53  VAL F CB    
421  C  CG1   . VAL A 54  ? 0.2421 0.2185 0.5195 -0.0192 -0.1276 0.0566  53  VAL F CG1   
422  C  CG2   . VAL A 54  ? 0.2911 0.2421 0.5977 -0.0268 -0.1449 0.0583  53  VAL F CG2   
423  N  N     . ARG A 55  ? 0.2482 0.2337 0.5176 -0.0022 -0.1155 0.0733  54  ARG F N     
424  C  CA    . ARG A 55  ? 0.2745 0.2671 0.5279 0.0050  -0.1057 0.0712  54  ARG F CA    
425  C  C     . ARG A 55  ? 0.2233 0.2325 0.4647 0.0045  -0.1009 0.0762  54  ARG F C     
426  O  O     . ARG A 55  ? 0.2372 0.2541 0.4822 -0.0014 -0.1041 0.0854  54  ARG F O     
427  C  CB    . ARG A 55  ? 0.2364 0.2281 0.4783 0.0061  -0.0996 0.0784  54  ARG F CB    
428  C  CG    . ARG A 55  ? 0.3687 0.3464 0.6190 0.0063  -0.1035 0.0738  54  ARG F CG    
429  C  CD    . ARG A 55  ? 0.5104 0.4816 0.7621 0.0120  -0.1015 0.0587  54  ARG F CD    
430  N  NE    . ARG A 55  ? 0.5271 0.4873 0.7868 0.0119  -0.1050 0.0540  54  ARG F NE    
431  C  CZ    . ARG A 55  ? 0.5433 0.4930 0.8216 0.0096  -0.1132 0.0475  54  ARG F CZ    
432  N  NH1   . ARG A 55  ? 0.2933 0.2398 0.5833 0.0073  -0.1190 0.0445  54  ARG F NH1   
433  N  NH2   . ARG A 55  ? 0.5528 0.4953 0.8376 0.0097  -0.1162 0.0434  54  ARG F NH2   
434  N  N     . SER A 56  ? 0.2138 0.2287 0.4407 0.0103  -0.0931 0.0704  55  SER F N     
435  C  CA    . SER A 56  ? 0.1552 0.1850 0.3676 0.0102  -0.0874 0.0757  55  SER F CA    
436  C  C     . SER A 56  ? 0.1877 0.2235 0.3911 0.0087  -0.0820 0.0887  55  SER F C     
437  O  O     . SER A 56  ? 0.2111 0.2407 0.4117 0.0101  -0.0798 0.0917  55  SER F O     
438  C  CB    . SER A 56  ? 0.2074 0.2404 0.4045 0.0169  -0.0798 0.0681  55  SER F CB    
439  O  OG    . SER A 56  ? 0.2387 0.2659 0.4409 0.0180  -0.0813 0.0540  55  SER F OG    
440  N  N     . ALA A 57  ? 0.2091 0.2574 0.4087 0.0057  -0.0804 0.0957  56  ALA F N     
441  C  CA    . ALA A 57  ? 0.2557 0.3132 0.4493 0.0043  -0.0748 0.1074  56  ALA F CA    
442  C  C     . ALA A 57  ? 0.2789 0.3345 0.4883 -0.0023 -0.0801 0.1178  56  ALA F C     
443  O  O     . ALA A 57  ? 0.3136 0.3776 0.5213 -0.0039 -0.0755 0.1286  56  ALA F O     
444  C  CB    . ALA A 57  ? 0.2830 0.3403 0.4588 0.0108  -0.0655 0.1071  56  ALA F CB    
445  N  N     . MET A 58  ? 0.1933 0.2380 0.4187 -0.0061 -0.0898 0.1149  57  MET F N     
446  C  CA    . MET A 58  ? 0.2231 0.2647 0.4645 -0.0132 -0.0964 0.1248  57  MET F CA    
447  C  C     . MET A 58  ? 0.2468 0.2991 0.4980 -0.0203 -0.1007 0.1319  57  MET F C     
448  O  O     . MET A 58  ? 0.2747 0.3281 0.5283 -0.0218 -0.1057 0.1241  57  MET F O     
449  C  CB    . MET A 58  ? 0.2316 0.2561 0.4872 -0.0147 -0.1064 0.1177  57  MET F CB    
450  C  CG    . MET A 58  ? 0.2911 0.3103 0.5654 -0.0232 -0.1160 0.1269  57  MET F CG    
451  S  SD    . MET A 58  ? 0.3104 0.3066 0.5994 -0.0231 -0.1270 0.1162  57  MET F SD    
452  C  CE    . MET A 58  ? 0.3276 0.3194 0.6027 -0.0172 -0.1183 0.1150  57  MET F CE    
453  N  N     . PRO A 59  ? 0.2465 0.3073 0.5037 -0.0252 -0.0990 0.1461  58  PRO F N     
454  C  CA    . PRO A 59  ? 0.2337 0.3037 0.5031 -0.0330 -0.1041 0.1534  58  PRO F CA    
455  C  C     . PRO A 59  ? 0.2042 0.2626 0.4893 -0.0393 -0.1180 0.1472  58  PRO F C     
456  O  O     . PRO A 59  ? 0.2723 0.3166 0.5662 -0.0400 -0.1246 0.1448  58  PRO F O     
457  C  CB    . PRO A 59  ? 0.2931 0.3716 0.5707 -0.0373 -0.1007 0.1703  58  PRO F CB    
458  C  CG    . PRO A 59  ? 0.3217 0.4017 0.5829 -0.0296 -0.0897 0.1702  58  PRO F CG    
459  C  CD    . PRO A 59  ? 0.2782 0.3422 0.5307 -0.0238 -0.0918 0.1557  58  PRO F CD    
460  N  N     . THR A 60  ? 0.2552 0.3184 0.5422 -0.0438 -0.1225 0.1427  59  THR F N     
461  C  CA    . THR A 60  ? 0.3084 0.3594 0.6055 -0.0501 -0.1349 0.1324  59  THR F CA    
462  C  C     . THR A 60  ? 0.3052 0.3474 0.6200 -0.0580 -0.1435 0.1409  59  THR F C     
463  O  O     . THR A 60  ? 0.3330 0.3585 0.6552 -0.0607 -0.1520 0.1318  59  THR F O     
464  C  CB    . THR A 60  ? 0.2914 0.3479 0.5825 -0.0540 -0.1372 0.1264  59  THR F CB    
465  O  OG1   . THR A 60  ? 0.2851 0.3475 0.5601 -0.0467 -0.1305 0.1177  59  THR F OG1   
466  C  CG2   . THR A 60  ? 0.3023 0.3437 0.5994 -0.0614 -0.1492 0.1146  59  THR F CG2   
467  N  N     . GLY A 61  ? 0.3051 0.3572 0.6260 -0.0616 -0.1405 0.1580  60  GLY F N     
468  C  CA    . GLY A 61  ? 0.2832 0.3272 0.6202 -0.0688 -0.1482 0.1680  60  GLY F CA    
469  C  C     . GLY A 61  ? 0.3456 0.3767 0.6882 -0.0665 -0.1514 0.1676  60  GLY F C     
470  O  O     . GLY A 61  ? 0.3540 0.3700 0.7072 -0.0712 -0.1611 0.1671  60  GLY F O     
471  N  N     . MET A 62  ? 0.2927 0.3266 0.6239 -0.0576 -0.1427 0.1665  61  MET F N     
472  C  CA    . MET A 62  ? 0.3030 0.3211 0.6341 -0.0540 -0.1444 0.1633  61  MET F CA    
473  C  C     . MET A 62  ? 0.3450 0.3454 0.6764 -0.0511 -0.1510 0.1440  61  MET F C     
474  O  O     . MET A 62  ? 0.3165 0.2993 0.6574 -0.0528 -0.1589 0.1406  61  MET F O     
475  C  CB    . MET A 62  ? 0.2956 0.3205 0.6072 -0.0460 -0.1301 0.1633  61  MET F CB    
476  C  CG    . MET A 62  ? 0.4185 0.4315 0.7287 -0.0443 -0.1308 0.1611  61  MET F CG    
477  S  SD    . MET A 62  ? 0.5397 0.5556 0.8253 -0.0338 -0.1171 0.1560  61  MET F SD    
478  C  CE    . MET A 62  ? 0.7177 0.7562 0.9914 -0.0320 -0.1047 0.1656  61  MET F CE    
479  N  N     . ALA A 63  ? 0.3042 0.3083 0.6236 -0.0470 -0.1465 0.1303  62  ALA F N     
480  C  CA    . ALA A 63  ? 0.3297 0.3180 0.6461 -0.0444 -0.1494 0.1102  62  ALA F CA    
481  C  C     . ALA A 63  ? 0.3668 0.3415 0.6964 -0.0531 -0.1615 0.1048  62  ALA F C     
482  O  O     . ALA A 63  ? 0.3402 0.2969 0.6748 -0.0519 -0.1667 0.0927  62  ALA F O     
483  C  CB    . ALA A 63  ? 0.2475 0.2439 0.5475 -0.0400 -0.1421 0.0984  62  ALA F CB    
484  N  N     . LEU A 64  ? 0.3269 0.3096 0.6630 -0.0618 -0.1665 0.1134  63  LEU F N     
485  C  CA    . LEU A 64  ? 0.3194 0.2881 0.6630 -0.0686 -0.1774 0.1084  63  LEU F CA    
486  C  C     . LEU A 64  ? 0.3853 0.3439 0.7407 -0.0699 -0.1838 0.1178  63  LEU F C     
487  O  O     . LEU A 64  ? 0.3686 0.3117 0.7282 -0.0712 -0.1924 0.1096  63  LEU F O     
488  C  CB    . LEU A 64  ? 0.3562 0.3356 0.6974 -0.0747 -0.1791 0.1146  63  LEU F CB    
489  C  CG    . LEU A 64  ? 0.3729 0.3554 0.7012 -0.0748 -0.1778 0.1009  63  LEU F CG    
490  C  CD1   . LEU A 64  ? 0.4367 0.4329 0.7636 -0.0798 -0.1782 0.1112  63  LEU F CD1   
491  C  CD2   . LEU A 64  ? 0.4354 0.3972 0.7601 -0.0761 -0.1854 0.0819  63  LEU F CD2   
492  N  N     . LYS A 65  ? 0.3943 0.3625 0.7541 -0.0693 -0.1800 0.1348  64  LYS F N     
493  C  CA    . LYS A 65  ? 0.3891 0.3498 0.7584 -0.0698 -0.1862 0.1424  64  LYS F CA    
494  C  C     . LYS A 65  ? 0.4256 0.3713 0.7946 -0.0631 -0.1878 0.1292  64  LYS F C     
495  O  O     . LYS A 65  ? 0.3852 0.3194 0.7615 -0.0634 -0.1960 0.1258  64  LYS F O     
496  C  CB    . LYS A 65  ? 0.5023 0.4804 0.8741 -0.0711 -0.1808 0.1626  64  LYS F CB    
497  N  N     . LEU A 66  ? 0.3276 0.2738 0.6884 -0.0567 -0.1799 0.1216  65  LEU F N     
498  C  CA    . LEU A 66  ? 0.3041 0.2373 0.6643 -0.0493 -0.1802 0.1073  65  LEU F CA    
499  C  C     . LEU A 66  ? 0.3271 0.2460 0.6878 -0.0481 -0.1845 0.0875  65  LEU F C     
500  O  O     . LEU A 66  ? 0.3874 0.2946 0.7529 -0.0439 -0.1885 0.0770  65  LEU F O     
501  C  CB    . LEU A 66  ? 0.3347 0.2732 0.6836 -0.0417 -0.1694 0.1051  65  LEU F CB    
502  C  CG    . LEU A 66  ? 0.3363 0.2884 0.6769 -0.0412 -0.1617 0.1195  65  LEU F CG    
503  C  CD1   . LEU A 66  ? 0.2931 0.2532 0.6159 -0.0332 -0.1490 0.1160  65  LEU F CD1   
504  C  CD2   . LEU A 66  ? 0.3447 0.2901 0.6894 -0.0413 -0.1657 0.1196  65  LEU F CD2   
505  N  N     . CYS A 67  ? 0.3949 0.3166 0.7497 -0.0519 -0.1833 0.0815  66  CYS F N     
506  C  CA    . CYS A 67  ? 0.3044 0.2146 0.6546 -0.0506 -0.1849 0.0607  66  CYS F CA    
507  C  C     . CYS A 67  ? 0.3102 0.2219 0.6577 -0.0586 -0.1905 0.0613  66  CYS F C     
508  O  O     . CYS A 67  ? 0.3380 0.2589 0.6762 -0.0615 -0.1870 0.0589  66  CYS F O     
509  C  CB    . CYS A 67  ? 0.3309 0.2436 0.6713 -0.0455 -0.1755 0.0480  66  CYS F CB    
510  S  SG    . CYS A 67  ? 0.4043 0.3045 0.7356 -0.0434 -0.1747 0.0219  66  CYS F SG    
511  N  N     . PRO A 68  ? 0.3587 0.2621 0.7141 -0.0622 -0.2000 0.0649  67  PRO F N     
512  C  CA    . PRO A 68  ? 0.4007 0.3057 0.7547 -0.0701 -0.2062 0.0682  67  PRO F CA    
513  C  C     . PRO A 68  ? 0.4057 0.3042 0.7472 -0.0709 -0.2063 0.0500  67  PRO F C     
514  O  O     . PRO A 68  ? 0.4004 0.3049 0.7366 -0.0769 -0.2087 0.0531  67  PRO F O     
515  C  CB    . PRO A 68  ? 0.4185 0.3126 0.7842 -0.0724 -0.2168 0.0728  67  PRO F CB    
516  C  CG    . PRO A 68  ? 0.4590 0.3535 0.8329 -0.0676 -0.2154 0.0803  67  PRO F CG    
517  C  CD    . PRO A 68  ? 0.4627 0.3572 0.8296 -0.0599 -0.2060 0.0686  67  PRO F CD    
518  N  N     . HIS A 69  ? 0.4150 0.3015 0.7511 -0.0649 -0.2035 0.0310  68  HIS F N     
519  C  CA    . HIS A 69  ? 0.4141 0.2931 0.7360 -0.0656 -0.2028 0.0125  68  HIS F CA    
520  C  C     . HIS A 69  ? 0.3740 0.2637 0.6833 -0.0642 -0.1934 0.0074  68  HIS F C     
521  O  O     . HIS A 69  ? 0.4544 0.3376 0.7495 -0.0641 -0.1915 -0.0090 68  HIS F O     
522  C  CB    . HIS A 69  ? 0.4544 0.3159 0.7758 -0.0595 -0.2030 -0.0064 68  HIS F CB    
523  C  CG    . HIS A 69  ? 0.5180 0.3672 0.8486 -0.0616 -0.2138 -0.0056 68  HIS F CG    
524  N  ND1   . HIS A 69  ? 0.5396 0.3874 0.8861 -0.0596 -0.2183 0.0048  68  HIS F ND1   
525  C  CD2   . HIS A 69  ? 0.6026 0.4399 0.9283 -0.0657 -0.2217 -0.0139 68  HIS F CD2   
526  C  CE1   . HIS A 69  ? 0.6050 0.4412 0.9570 -0.0623 -0.2285 0.0029  68  HIS F CE1   
527  N  NE2   . HIS A 69  ? 0.7038 0.5332 1.0436 -0.0659 -0.2308 -0.0084 68  HIS F NE2   
528  N  N     . LEU A 70  ? 0.3645 0.2700 0.6776 -0.0630 -0.1875 0.0209  69  LEU F N     
529  C  CA    . LEU A 70  ? 0.3727 0.2911 0.6718 -0.0596 -0.1772 0.0175  69  LEU F CA    
530  C  C     . LEU A 70  ? 0.3993 0.3215 0.6833 -0.0651 -0.1790 0.0126  69  LEU F C     
531  O  O     . LEU A 70  ? 0.3732 0.3005 0.6630 -0.0733 -0.1874 0.0235  69  LEU F O     
532  C  CB    . LEU A 70  ? 0.3084 0.2461 0.6102 -0.0570 -0.1706 0.0366  69  LEU F CB    
533  C  CG    . LEU A 70  ? 0.2878 0.2399 0.5723 -0.0497 -0.1575 0.0349  69  LEU F CG    
534  C  CD1   . LEU A 70  ? 0.3860 0.3299 0.6657 -0.0405 -0.1497 0.0204  69  LEU F CD1   
535  C  CD2   . LEU A 70  ? 0.3158 0.2865 0.6026 -0.0481 -0.1526 0.0544  69  LEU F CD2   
536  N  N     . THR A 71  ? 0.3783 0.2974 0.6434 -0.0608 -0.1716 -0.0035 70  THR F N     
537  C  CA    . THR A 71  ? 0.4634 0.3861 0.7101 -0.0651 -0.1722 -0.0083 70  THR F CA    
538  C  C     . THR A 71  ? 0.4454 0.3889 0.6815 -0.0613 -0.1621 0.0009  70  THR F C     
539  O  O     . THR A 71  ? 0.3822 0.3299 0.6109 -0.0531 -0.1508 -0.0037 70  THR F O     
540  C  CB    . THR A 71  ? 0.5195 0.4264 0.7491 -0.0634 -0.1697 -0.0309 70  THR F CB    
541  O  OG1   . THR A 71  ? 0.4671 0.3540 0.7053 -0.0679 -0.1811 -0.0395 70  THR F OG1   
542  C  CG2   . THR A 71  ? 0.4627 0.3743 0.6694 -0.0671 -0.1688 -0.0348 70  THR F CG2   
543  N  N     . LEU A 72  ? 0.4089 0.3649 0.6451 -0.0671 -0.1666 0.0136  71  LEU F N     
544  C  CA    . LEU A 72  ? 0.4289 0.4051 0.6585 -0.0636 -0.1584 0.0245  71  LEU F CA    
545  C  C     . LEU A 72  ? 0.4159 0.3940 0.6234 -0.0652 -0.1570 0.0162  71  LEU F C     
546  O  O     . LEU A 72  ? 0.3667 0.3374 0.5696 -0.0729 -0.1666 0.0122  71  LEU F O     
547  C  CB    . LEU A 72  ? 0.4342 0.4251 0.6807 -0.0682 -0.1633 0.0451  71  LEU F CB    
548  C  CG    . LEU A 72  ? 0.4995 0.5094 0.7489 -0.0619 -0.1538 0.0594  71  LEU F CG    
549  C  CD1   . LEU A 72  ? 0.4248 0.4300 0.6767 -0.0536 -0.1462 0.0573  71  LEU F CD1   
550  C  CD2   . LEU A 72  ? 0.6231 0.6446 0.8912 -0.0679 -0.1596 0.0781  71  LEU F CD2   
551  N  N     . LEU A 73  ? 0.4014 0.3884 0.5949 -0.0583 -0.1458 0.0141  72  LEU F N     
552  C  CA    . LEU A 73  ? 0.3930 0.3812 0.5637 -0.0591 -0.1432 0.0062  72  LEU F CA    
553  C  C     . LEU A 73  ? 0.3442 0.3523 0.5119 -0.0569 -0.1392 0.0196  72  LEU F C     
554  O  O     . LEU A 73  ? 0.3448 0.3642 0.5213 -0.0506 -0.1325 0.0293  72  LEU F O     
555  C  CB    . LEU A 73  ? 0.3683 0.3475 0.5229 -0.0531 -0.1330 -0.0106 72  LEU F CB    
556  C  CG    . LEU A 73  ? 0.6187 0.5771 0.7658 -0.0558 -0.1359 -0.0290 72  LEU F CG    
557  C  CD1   . LEU A 73  ? 0.6164 0.5640 0.7844 -0.0570 -0.1427 -0.0292 72  LEU F CD1   
558  C  CD2   . LEU A 73  ? 0.7395 0.6932 0.8724 -0.0492 -0.1235 -0.0437 72  LEU F CD2   
559  N  N     . PRO A 74  ? 0.3282 0.3402 0.4831 -0.0616 -0.1435 0.0200  73  PRO F N     
560  C  CA    . PRO A 74  ? 0.3198 0.3508 0.4741 -0.0594 -0.1408 0.0330  73  PRO F CA    
561  C  C     . PRO A 74  ? 0.3964 0.4328 0.5339 -0.0517 -0.1295 0.0290  73  PRO F C     
562  O  O     . PRO A 74  ? 0.4351 0.4870 0.5741 -0.0478 -0.1261 0.0399  73  PRO F O     
563  C  CB    . PRO A 74  ? 0.3759 0.4064 0.5239 -0.0680 -0.1519 0.0341  73  PRO F CB    
564  C  CG    . PRO A 74  ? 0.3478 0.3576 0.4781 -0.0720 -0.1550 0.0162  73  PRO F CG    
565  C  CD    . PRO A 74  ? 0.3941 0.3927 0.5368 -0.0699 -0.1531 0.0102  73  PRO F CD    
566  N  N     . GLY A 75  ? 0.3152 0.3395 0.4372 -0.0494 -0.1237 0.0137  74  GLY F N     
567  C  CA    . GLY A 75  ? 0.4445 0.4743 0.5516 -0.0429 -0.1134 0.0108  74  GLY F CA    
568  C  C     . GLY A 75  ? 0.3647 0.3928 0.4484 -0.0468 -0.1148 0.0052  74  GLY F C     
569  O  O     . GLY A 75  ? 0.4150 0.4468 0.4970 -0.0527 -0.1239 0.0114  74  GLY F O     
570  N  N     . ARG A 76  ? 0.3290 0.3512 0.3949 -0.0439 -0.1063 -0.0062 75  ARG F N     
571  C  CA    . ARG A 76  ? 0.3062 0.3250 0.3467 -0.0477 -0.1064 -0.0124 75  ARG F CA    
572  C  C     . ARG A 76  ? 0.3484 0.3762 0.3807 -0.0408 -0.0962 -0.0104 75  ARG F C     
573  O  O     . ARG A 76  ? 0.3689 0.3912 0.3929 -0.0374 -0.0867 -0.0205 75  ARG F O     
574  C  CB    . ARG A 76  ? 0.3167 0.3173 0.3411 -0.0522 -0.1058 -0.0295 75  ARG F CB    
575  C  CG    . ARG A 76  ? 0.3756 0.3654 0.4051 -0.0598 -0.1177 -0.0319 75  ARG F CG    
576  C  CD    . ARG A 76  ? 0.4174 0.3881 0.4280 -0.0636 -0.1166 -0.0499 75  ARG F CD    
577  N  NE    . ARG A 76  ? 0.4362 0.4018 0.4519 -0.0570 -0.1050 -0.0606 75  ARG F NE    
578  C  CZ    . ARG A 76  ? 0.5629 0.5237 0.5608 -0.0546 -0.0938 -0.0726 75  ARG F CZ    
579  N  NH1   . ARG A 76  ? 0.6100 0.5692 0.5814 -0.0587 -0.0928 -0.0753 75  ARG F NH1   
580  N  NH2   . ARG A 76  ? 0.5447 0.5020 0.5517 -0.0484 -0.0838 -0.0815 75  ARG F NH2   
581  N  N     . PHE A 77  ? 0.2999 0.4173 0.2814 -0.0037 -0.0296 0.0056  76  PHE F N     
582  C  CA    . PHE A 77  ? 0.3126 0.4277 0.3029 0.0057  -0.0215 0.0096  76  PHE F CA    
583  C  C     . PHE A 77  ? 0.2975 0.3962 0.2744 0.0170  -0.0148 0.0115  76  PHE F C     
584  O  O     . PHE A 77  ? 0.3305 0.4172 0.3127 0.0217  -0.0063 0.0139  76  PHE F O     
585  C  CB    . PHE A 77  ? 0.2633 0.4052 0.2671 0.0086  -0.0251 0.0122  76  PHE F CB    
586  C  CG    . PHE A 77  ? 0.3210 0.4751 0.3399 -0.0018 -0.0266 0.0122  76  PHE F CG    
587  C  CD1   . PHE A 77  ? 0.3469 0.4920 0.3751 -0.0014 -0.0205 0.0136  76  PHE F CD1   
588  C  CD2   . PHE A 77  ? 0.3604 0.5340 0.3833 -0.0132 -0.0344 0.0112  76  PHE F CD2   
589  C  CE1   . PHE A 77  ? 0.3262 0.4804 0.3649 -0.0111 -0.0222 0.0145  76  PHE F CE1   
590  C  CE2   . PHE A 77  ? 0.3353 0.5185 0.3698 -0.0242 -0.0351 0.0126  76  PHE F CE2   
591  C  CZ    . PHE A 77  ? 0.2715 0.4441 0.3125 -0.0226 -0.0289 0.0144  76  PHE F CZ    
592  N  N     . ASP A 78  ? 0.3235 0.4210 0.2825 0.0208  -0.0186 0.0109  77  ASP F N     
593  C  CA    . ASP A 78  ? 0.4076 0.4867 0.3506 0.0300  -0.0112 0.0138  77  ASP F CA    
594  C  C     . ASP A 78  ? 0.4009 0.4578 0.3397 0.0272  -0.0012 0.0113  77  ASP F C     
595  O  O     . ASP A 78  ? 0.3458 0.3893 0.2822 0.0329  0.0089  0.0148  77  ASP F O     
596  C  CB    . ASP A 78  ? 0.4270 0.5082 0.3484 0.0346  -0.0181 0.0138  77  ASP F CB    
597  C  CG    . ASP A 78  ? 0.5372 0.6351 0.4612 0.0438  -0.0247 0.0184  77  ASP F CG    
598  O  OD1   . ASP A 78  ? 0.3812 0.4873 0.3226 0.0473  -0.0226 0.0210  77  ASP F OD1   
599  O  OD2   . ASP A 78  ? 0.5642 0.6668 0.4724 0.0484  -0.0325 0.0189  77  ASP F OD2   
600  N  N     . ALA A 79  ? 0.3646 0.4174 0.3032 0.0185  -0.0041 0.0053  78  ALA F N     
601  C  CA    . ALA A 79  ? 0.3389 0.3721 0.2762 0.0173  0.0050  0.0018  78  ALA F CA    
602  C  C     . ALA A 79  ? 0.3079 0.3396 0.2670 0.0178  0.0121  0.0047  78  ALA F C     
603  O  O     . ALA A 79  ? 0.3584 0.3777 0.3191 0.0216  0.0228  0.0052  78  ALA F O     
604  C  CB    . ALA A 79  ? 0.3879 0.4151 0.3211 0.0085  -0.0016 -0.0056 78  ALA F CB    
605  N  N     . TYR A 80  ? 0.3292 0.3746 0.3053 0.0137  0.0065  0.0066  79  TYR F N     
606  C  CA    . TYR A 80  ? 0.2860 0.3298 0.2811 0.0142  0.0117  0.0089  79  TYR F CA    
607  C  C     . TYR A 80  ? 0.3016 0.3445 0.2988 0.0225  0.0183  0.0141  79  TYR F C     
608  O  O     . TYR A 80  ? 0.3176 0.3514 0.3243 0.0243  0.0263  0.0154  79  TYR F O     
609  C  CB    . TYR A 80  ? 0.2583 0.3169 0.2675 0.0078  0.0041  0.0096  79  TYR F CB    
610  C  CG    . TYR A 80  ? 0.2945 0.3554 0.3002 -0.0023 -0.0041 0.0061  79  TYR F CG    
611  C  CD1   . TYR A 80  ? 0.3019 0.3452 0.2984 -0.0054 -0.0038 0.0012  79  TYR F CD1   
612  C  CD2   . TYR A 80  ? 0.3071 0.3875 0.3188 -0.0090 -0.0121 0.0075  79  TYR F CD2   
613  C  CE1   . TYR A 80  ? 0.2351 0.2770 0.2275 -0.0155 -0.0125 -0.0020 79  TYR F CE1   
614  C  CE2   . TYR A 80  ? 0.2927 0.3746 0.3017 -0.0205 -0.0199 0.0053  79  TYR F CE2   
615  C  CZ    . TYR A 80  ? 0.3204 0.3813 0.3193 -0.0240 -0.0207 0.0007  79  TYR F CZ    
616  O  OH    . TYR A 80  ? 0.3664 0.4259 0.3620 -0.0364 -0.0296 -0.0015 79  TYR F OH    
617  N  N     . LYS A 81  ? 0.2899 0.3417 0.2789 0.0275  0.0143  0.0171  80  LYS F N     
618  C  CA    . LYS A 81  ? 0.2879 0.3347 0.2760 0.0357  0.0194  0.0224  80  LYS F CA    
619  C  C     . LYS A 81  ? 0.2916 0.3203 0.2681 0.0383  0.0298  0.0245  80  LYS F C     
620  O  O     . LYS A 81  ? 0.3303 0.3501 0.3130 0.0407  0.0374  0.0286  80  LYS F O     
621  C  CB    . LYS A 81  ? 0.3325 0.3909 0.3118 0.0421  0.0118  0.0249  80  LYS F CB    
622  C  CG    . LYS A 81  ? 0.4384 0.4870 0.4131 0.0513  0.0156  0.0308  80  LYS F CG    
623  C  CD    . LYS A 81  ? 0.6079 0.6684 0.5755 0.0598  0.0066  0.0328  80  LYS F CD    
624  C  CE    . LYS A 81  ? 0.7467 0.8078 0.6932 0.0613  0.0020  0.0330  80  LYS F CE    
625  N  NZ    . LYS A 81  ? 0.8649 0.9401 0.8061 0.0703  -0.0082 0.0346  80  LYS F NZ    
626  N  N     . GLU A 82  ? 0.2815 0.3048 0.2406 0.0371  0.0306  0.0216  81  GLU F N     
627  C  CA    . GLU A 82  ? 0.3586 0.3666 0.3047 0.0397  0.0420  0.0232  81  GLU F CA    
628  C  C     . GLU A 82  ? 0.3704 0.3725 0.3337 0.0366  0.0516  0.0210  81  GLU F C     
629  O  O     . GLU A 82  ? 0.3769 0.3713 0.3425 0.0384  0.0627  0.0251  81  GLU F O     
630  C  CB    . GLU A 82  ? 0.4516 0.4555 0.3734 0.0398  0.0400  0.0190  81  GLU F CB    
631  C  CG    . GLU A 82  ? 0.5862 0.5760 0.4956 0.0413  0.0531  0.0179  81  GLU F CG    
632  C  CD    . GLU A 82  ? 0.8961 0.8803 0.7770 0.0424  0.0505  0.0131  81  GLU F CD    
633  O  OE1   . GLU A 82  ? 1.0080 0.9872 0.8660 0.0472  0.0522  0.0181  81  GLU F OE1   
634  O  OE2   . GLU A 82  ? 0.9570 0.9403 0.8369 0.0385  0.0458  0.0044  81  GLU F OE2   
635  N  N     . ALA A 83  ? 0.4009 0.4068 0.3769 0.0316  0.0473  0.0150  82  ALA F N     
636  C  CA    . ALA A 83  ? 0.3383 0.3404 0.3335 0.0299  0.0541  0.0130  82  ALA F CA    
637  C  C     . ALA A 83  ? 0.3629 0.3683 0.3775 0.0302  0.0562  0.0182  82  ALA F C     
638  O  O     . ALA A 83  ? 0.3309 0.3321 0.3569 0.0306  0.0657  0.0197  82  ALA F O     
639  C  CB    . ALA A 83  ? 0.3394 0.3429 0.3429 0.0249  0.0464  0.0067  82  ALA F CB    
640  N  N     . SER A 84  ? 0.3213 0.3351 0.3400 0.0299  0.0473  0.0204  83  SER F N     
641  C  CA    . SER A 84  ? 0.2992 0.3144 0.3335 0.0307  0.0477  0.0241  83  SER F CA    
642  C  C     . SER A 84  ? 0.3089 0.3143 0.3379 0.0342  0.0565  0.0301  83  SER F C     
643  O  O     . SER A 84  ? 0.2989 0.2999 0.3428 0.0326  0.0626  0.0321  83  SER F O     
644  C  CB    . SER A 84  ? 0.3391 0.3654 0.3740 0.0317  0.0373  0.0245  83  SER F CB    
645  O  OG    . SER A 84  ? 0.2643 0.2898 0.3116 0.0335  0.0373  0.0269  83  SER F OG    
646  N  N     . ASN A 85  ? 0.3407 0.3422 0.3481 0.0384  0.0567  0.0336  84  ASN F N     
647  C  CA    . ASN A 85  ? 0.3466 0.3359 0.3453 0.0410  0.0650  0.0409  84  ASN F CA    
648  C  C     . ASN A 85  ? 0.3590 0.3424 0.3630 0.0375  0.0786  0.0413  84  ASN F C     
649  O  O     . ASN A 85  ? 0.3494 0.3262 0.3621 0.0355  0.0864  0.0466  84  ASN F O     
650  C  CB    . ASN A 85  ? 0.3797 0.3649 0.3511 0.0464  0.0624  0.0446  84  ASN F CB    
651  C  CG    . ASN A 85  ? 0.3518 0.3442 0.3205 0.0518  0.0499  0.0453  84  ASN F CG    
652  O  OD1   . ASN A 85  ? 0.3887 0.3849 0.3732 0.0524  0.0456  0.0448  84  ASN F OD1   
653  N  ND2   . ASN A 85  ? 0.4537 0.4488 0.4021 0.0562  0.0439  0.0459  84  ASN F ND2   
654  N  N     . HIS A 86  ? 0.3364 0.3227 0.3365 0.0364  0.0815  0.0352  85  HIS F N     
655  C  CA    . HIS A 86  ? 0.3533 0.3366 0.3573 0.0350  0.0954  0.0344  85  HIS F CA    
656  C  C     . HIS A 86  ? 0.3461 0.3346 0.3815 0.0312  0.0987  0.0331  85  HIS F C     
657  O  O     . HIS A 86  ? 0.3562 0.3436 0.4014 0.0291  0.1104  0.0368  85  HIS F O     
658  C  CB    . HIS A 86  ? 0.3438 0.3275 0.3347 0.0365  0.0961  0.0265  85  HIS F CB    
659  C  CG    . HIS A 86  ? 0.4521 0.4329 0.4391 0.0376  0.1117  0.0251  85  HIS F CG    
660  N  ND1   . HIS A 86  ? 0.4892 0.4661 0.4551 0.0407  0.1148  0.0188  85  HIS F ND1   
661  C  CD2   . HIS A 86  ? 0.4604 0.4430 0.4624 0.0360  0.1253  0.0287  85  HIS F CD2   
662  C  CE1   . HIS A 86  ? 0.5047 0.4817 0.4718 0.0421  0.1306  0.0182  85  HIS F CE1   
663  N  NE2   . HIS A 86  ? 0.4638 0.4456 0.4539 0.0388  0.1375  0.0246  85  HIS F NE2   
664  N  N     . ILE A 87  ? 0.3094 0.3044 0.3611 0.0298  0.0883  0.0284  86  ILE F N     
665  C  CA    . ILE A 87  ? 0.3116 0.3115 0.3921 0.0268  0.0900  0.0270  86  ILE F CA    
666  C  C     . ILE A 87  ? 0.3062 0.3034 0.3971 0.0243  0.0902  0.0334  86  ILE F C     
667  O  O     . ILE A 87  ? 0.3111 0.3107 0.4231 0.0208  0.0960  0.0345  86  ILE F O     
668  C  CB    . ILE A 87  ? 0.3045 0.3101 0.3975 0.0257  0.0786  0.0210  86  ILE F CB    
669  C  CG1   . ILE A 87  ? 0.3369 0.3451 0.4279 0.0248  0.0662  0.0223  86  ILE F CG1   
670  C  CG2   . ILE A 87  ? 0.2391 0.2430 0.3201 0.0275  0.0775  0.0147  86  ILE F CG2   
671  C  CD1   . ILE A 87  ? 0.2904 0.3040 0.3915 0.0225  0.0559  0.0176  86  ILE F CD1   
672  N  N     . ARG A 88  ? 0.3231 0.3154 0.4003 0.0262  0.0834  0.0371  87  ARG F N     
673  C  CA    . ARG A 88  ? 0.3282 0.3138 0.4126 0.0246  0.0830  0.0426  87  ARG F CA    
674  C  C     . ARG A 88  ? 0.3385 0.3149 0.4175 0.0222  0.0960  0.0500  87  ARG F C     
675  O  O     . ARG A 88  ? 0.3196 0.2912 0.4132 0.0174  0.0993  0.0540  87  ARG F O     
676  C  CB    . ARG A 88  ? 0.2394 0.2216 0.3097 0.0294  0.0724  0.0439  87  ARG F CB    
677  C  CG    . ARG A 88  ? 0.2338 0.2270 0.3125 0.0302  0.0606  0.0376  87  ARG F CG    
678  C  CD    . ARG A 88  ? 0.3253 0.3198 0.3908 0.0361  0.0515  0.0381  87  ARG F CD    
679  N  NE    . ARG A 88  ? 0.2838 0.2917 0.3558 0.0358  0.0422  0.0325  87  ARG F NE    
680  C  CZ    . ARG A 88  ? 0.2846 0.3004 0.3494 0.0406  0.0342  0.0312  87  ARG F CZ    
681  N  NH1   . ARG A 88  ? 0.2884 0.2988 0.3398 0.0476  0.0331  0.0346  87  ARG F NH1   
682  N  NH2   . ARG A 88  ? 0.2524 0.2819 0.3234 0.0386  0.0275  0.0267  87  ARG F NH2   
683  N  N     . GLU A 89  ? 0.3215 0.2949 0.3788 0.0247  0.1033  0.0521  88  GLU F N     
684  C  CA    . GLU A 89  ? 0.3557 0.3219 0.4065 0.0215  0.1177  0.0596  88  GLU F CA    
685  C  C     . GLU A 89  ? 0.3573 0.3340 0.4329 0.0164  0.1290  0.0569  88  GLU F C     
686  O  O     . GLU A 89  ? 0.3985 0.3731 0.4848 0.0103  0.1390  0.0632  88  GLU F O     
687  C  CB    . GLU A 89  ? 0.3973 0.3581 0.4156 0.0261  0.1222  0.0618  88  GLU F CB    
688  C  CG    . GLU A 89  ? 0.4671 0.4193 0.4720 0.0230  0.1378  0.0709  88  GLU F CG    
689  C  CD    . GLU A 89  ? 0.5629 0.5261 0.5771 0.0205  0.1530  0.0670  88  GLU F CD    
690  O  OE1   . GLU A 89  ? 0.6172 0.5817 0.6437 0.0141  0.1662  0.0729  88  GLU F OE1   
691  O  OE2   . GLU A 89  ? 0.6230 0.5938 0.6329 0.0250  0.1517  0.0578  88  GLU F OE2   
692  N  N     . ILE A 90  ? 0.3186 0.3069 0.4053 0.0186  0.1269  0.0478  89  ILE F N     
693  C  CA    . ILE A 90  ? 0.3681 0.3684 0.4818 0.0158  0.1359  0.0442  89  ILE F CA    
694  C  C     . ILE A 90  ? 0.3448 0.3490 0.4885 0.0099  0.1309  0.0455  89  ILE F C     
695  O  O     . ILE A 90  ? 0.3576 0.3692 0.5230 0.0045  0.1406  0.0477  89  ILE F O     
696  C  CB    . ILE A 90  ? 0.3353 0.3435 0.4524 0.0210  0.1324  0.0339  89  ILE F CB    
697  C  CG1   . ILE A 90  ? 0.3179 0.3221 0.4070 0.0259  0.1401  0.0317  89  ILE F CG1   
698  C  CG2   . ILE A 90  ? 0.3099 0.3315 0.4593 0.0199  0.1378  0.0294  89  ILE F CG2   
699  C  CD1   . ILE A 90  ? 0.3945 0.4003 0.4803 0.0310  0.1333  0.0214  89  ILE F CD1   
700  N  N     . PHE A 91  ? 0.2855 0.2860 0.4312 0.0106  0.1157  0.0437  90  PHE F N     
701  C  CA    . PHE A 91  ? 0.3371 0.3388 0.5072 0.0052  0.1096  0.0444  90  PHE F CA    
702  C  C     . PHE A 91  ? 0.2889 0.2809 0.4598 -0.0014 0.1172  0.0533  90  PHE F C     
703  O  O     . PHE A 91  ? 0.3163 0.3129 0.5126 -0.0086 0.1197  0.0545  90  PHE F O     
704  C  CB    . PHE A 91  ? 0.2838 0.2812 0.4493 0.0079  0.0932  0.0413  90  PHE F CB    
705  C  CG    . PHE A 91  ? 0.2585 0.2639 0.4223 0.0123  0.0846  0.0341  90  PHE F CG    
706  C  CD1   . PHE A 91  ? 0.2019 0.2167 0.3782 0.0131  0.0880  0.0292  90  PHE F CD1   
707  C  CD2   . PHE A 91  ? 0.2721 0.2752 0.4221 0.0155  0.0729  0.0323  90  PHE F CD2   
708  C  CE1   . PHE A 91  ? 0.2686 0.2867 0.4414 0.0164  0.0791  0.0234  90  PHE F CE1   
709  C  CE2   . PHE A 91  ? 0.2850 0.2947 0.4327 0.0175  0.0652  0.0270  90  PHE F CE2   
710  C  CZ    . PHE A 91  ? 0.2616 0.2769 0.4199 0.0175  0.0678  0.0229  90  PHE F CZ    
711  N  N     . SER A 92  ? 0.3105 0.2883 0.4535 0.0006  0.1200  0.0599  91  SER F N     
712  C  CA    . SER A 92  ? 0.3142 0.2775 0.4530 -0.0055 0.1257  0.0698  91  SER F CA    
713  C  C     . SER A 92  ? 0.3808 0.3512 0.5327 -0.0137 0.1431  0.0749  91  SER F C     
714  O  O     . SER A 92  ? 0.3754 0.3376 0.5361 -0.0227 0.1474  0.0824  91  SER F O     
715  C  CB    . SER A 92  ? 0.3371 0.2833 0.4405 0.0002  0.1242  0.0760  91  SER F CB    
716  O  OG    . SER A 92  ? 0.4086 0.3572 0.4921 0.0026  0.1358  0.0786  91  SER F OG    
717  N  N     . ARG A 93  ? 0.3647 0.3505 0.5190 -0.0109 0.1531  0.0707  92  ARG F N     
718  C  CA    . ARG A 93  ? 0.4163 0.4144 0.5866 -0.0177 0.1708  0.0742  92  ARG F CA    
719  C  C     . ARG A 93  ? 0.3909 0.4030 0.6024 -0.0256 0.1694  0.0717  92  ARG F C     
720  O  O     . ARG A 93  ? 0.3857 0.4079 0.6152 -0.0343 0.1832  0.0767  92  ARG F O     
721  C  CB    . ARG A 93  ? 0.3951 0.4069 0.5588 -0.0105 0.1807  0.0677  92  ARG F CB    
722  C  CG    . ARG A 93  ? 0.4387 0.4379 0.5616 -0.0028 0.1805  0.0686  92  ARG F CG    
723  C  CD    . ARG A 93  ? 0.3922 0.4028 0.5080 0.0043  0.1893  0.0605  92  ARG F CD    
724  N  NE    . ARG A 93  ? 0.4055 0.4047 0.4849 0.0120  0.1834  0.0583  92  ARG F NE    
725  C  CZ    . ARG A 93  ? 0.4734 0.4772 0.5415 0.0193  0.1853  0.0492  92  ARG F CZ    
726  N  NH1   . ARG A 93  ? 0.4510 0.4699 0.5409 0.0213  0.1934  0.0415  92  ARG F NH1   
727  N  NH2   . ARG A 93  ? 0.4421 0.4353 0.4777 0.0249  0.1783  0.0473  92  ARG F NH2   
728  N  N     . TYR A 94  ? 0.3567 0.3711 0.5836 -0.0233 0.1531  0.0644  93  TYR F N     
729  C  CA    . TYR A 94  ? 0.3757 0.4038 0.6409 -0.0300 0.1492  0.0611  93  TYR F CA    
730  C  C     . TYR A 94  ? 0.4063 0.4199 0.6777 -0.0373 0.1374  0.0642  93  TYR F C     
731  O  O     . TYR A 94  ? 0.4137 0.4344 0.7136 -0.0474 0.1386  0.0658  93  TYR F O     
732  C  CB    . TYR A 94  ? 0.3249 0.3674 0.6052 -0.0221 0.1392  0.0500  93  TYR F CB    
733  C  CG    . TYR A 94  ? 0.3456 0.4037 0.6282 -0.0157 0.1512  0.0456  93  TYR F CG    
734  C  CD1   . TYR A 94  ? 0.3464 0.3972 0.5984 -0.0068 0.1529  0.0431  93  TYR F CD1   
735  C  CD2   . TYR A 94  ? 0.3254 0.4031 0.6349 -0.0175 0.1577  0.0424  93  TYR F CD2   
736  C  CE1   . TYR A 94  ? 0.3870 0.4491 0.6388 -0.0002 0.1635  0.0378  93  TYR F CE1   
737  C  CE2   . TYR A 94  ? 0.3794 0.4685 0.6860 -0.0096 0.1666  0.0368  93  TYR F CE2   
738  C  CZ    . TYR A 94  ? 0.3684 0.4501 0.6488 -0.0011 0.1713  0.0346  93  TYR F CZ    
739  O  OH    . TYR A 94  ? 0.4618 0.5524 0.7377 0.0070  0.1794  0.0278  93  TYR F OH    
740  N  N     . THR A 95  ? 0.3480 0.3417 0.5937 -0.0323 0.1262  0.0647  94  THR F N     
741  C  CA    . THR A 95  ? 0.3849 0.3619 0.6325 -0.0369 0.1142  0.0660  94  THR F CA    
742  C  C     . THR A 95  ? 0.3837 0.3391 0.5964 -0.0292 0.1077  0.0686  94  THR F C     
743  O  O     . THR A 95  ? 0.3800 0.3379 0.5721 -0.0197 0.1075  0.0665  94  THR F O     
744  C  CB    . THR A 95  ? 0.3232 0.3093 0.5923 -0.0360 0.0989  0.0564  94  THR F CB    
745  O  OG1   . THR A 95  ? 0.4246 0.3925 0.6922 -0.0398 0.0874  0.0566  94  THR F OG1   
746  C  CG2   . THR A 95  ? 0.3303 0.3217 0.5851 -0.0243 0.0906  0.0492  94  THR F CG2   
747  N  N     . SER A 96  ? 0.3575 0.2915 0.5643 -0.0330 0.1017  0.0729  95  SER F N     
748  C  CA    . SER A 96  ? 0.3654 0.2805 0.5437 -0.0235 0.0920  0.0731  95  SER F CA    
749  C  C     . SER A 96  ? 0.3559 0.2729 0.5393 -0.0177 0.0757  0.0629  95  SER F C     
750  O  O     . SER A 96  ? 0.3615 0.2685 0.5240 -0.0081 0.0672  0.0609  95  SER F O     
751  C  CB    . SER A 96  ? 0.3963 0.2834 0.5615 -0.0283 0.0932  0.0827  95  SER F CB    
752  O  OG    . SER A 96  ? 0.5044 0.3840 0.6916 -0.0385 0.0877  0.0815  95  SER F OG    
753  N  N     . ARG A 97  ? 0.3064 0.2375 0.5166 -0.0229 0.0712  0.0564  96  ARG F N     
754  C  CA    . ARG A 97  ? 0.3065 0.2391 0.5212 -0.0188 0.0559  0.0471  96  ARG F CA    
755  C  C     . ARG A 97  ? 0.3011 0.2512 0.5095 -0.0100 0.0528  0.0413  96  ARG F C     
756  O  O     . ARG A 97  ? 0.2840 0.2508 0.5103 -0.0117 0.0508  0.0365  96  ARG F O     
757  C  CB    . ARG A 97  ? 0.2912 0.2297 0.5361 -0.0288 0.0512  0.0435  96  ARG F CB    
758  C  CG    . ARG A 97  ? 0.3449 0.2640 0.5965 -0.0393 0.0522  0.0489  96  ARG F CG    
759  C  CD    . ARG A 97  ? 0.3281 0.2297 0.5736 -0.0369 0.0365  0.0423  96  ARG F CD    
760  N  NE    . ARG A 97  ? 0.5378 0.4462 0.8106 -0.0461 0.0284  0.0366  96  ARG F NE    
761  C  CZ    . ARG A 97  ? 0.4548 0.3634 0.7287 -0.0423 0.0137  0.0268  96  ARG F CZ    
762  N  NH1   . ARG A 97  ? 0.5344 0.4491 0.8333 -0.0515 0.0056  0.0220  96  ARG F NH1   
763  N  NH2   . ARG A 97  ? 0.2895 0.1938 0.5395 -0.0297 0.0071  0.0217  96  ARG F NH2   
764  N  N     . ILE A 98  ? 0.2729 0.2185 0.4556 -0.0008 0.0519  0.0421  97  ILE F N     
765  C  CA    . ILE A 98  ? 0.2430 0.2035 0.4163 0.0061  0.0504  0.0383  97  ILE F CA    
766  C  C     . ILE A 98  ? 0.2765 0.2351 0.4347 0.0142  0.0392  0.0336  97  ILE F C     
767  O  O     . ILE A 98  ? 0.3094 0.2551 0.4508 0.0197  0.0377  0.0360  97  ILE F O     
768  C  CB    . ILE A 98  ? 0.2546 0.2160 0.4113 0.0088  0.0609  0.0436  97  ILE F CB    
769  C  CG1   . ILE A 98  ? 0.2689 0.2340 0.4387 0.0017  0.0741  0.0480  97  ILE F CG1   
770  C  CG2   . ILE A 98  ? 0.2228 0.1980 0.3700 0.0146  0.0577  0.0390  97  ILE F CG2   
771  C  CD1   . ILE A 98  ? 0.3724 0.3312 0.5206 0.0037  0.0851  0.0550  97  ILE F CD1   
772  N  N     . GLU A 99  ? 0.2326 0.2043 0.3964 0.0155  0.0316  0.0271  98  GLU F N     
773  C  CA    . GLU A 99  ? 0.2599 0.2353 0.4096 0.0230  0.0229  0.0226  98  GLU F CA    
774  C  C     . GLU A 99  ? 0.2266 0.2182 0.3698 0.0250  0.0232  0.0215  98  GLU F C     
775  O  O     . GLU A 99  ? 0.2149 0.2168 0.3676 0.0218  0.0194  0.0183  98  GLU F O     
776  C  CB    . GLU A 99  ? 0.2308 0.2059 0.3888 0.0222  0.0129  0.0162  98  GLU F CB    
777  C  CG    . GLU A 99  ? 0.2176 0.1984 0.3606 0.0303  0.0056  0.0112  98  GLU F CG    
778  C  CD    . GLU A 99  ? 0.3038 0.2818 0.4509 0.0303  -0.0039 0.0043  98  GLU F CD    
779  O  OE1   . GLU A 99  ? 0.3104 0.2785 0.4714 0.0241  -0.0061 0.0035  98  GLU F OE1   
780  O  OE2   . GLU A 99  ? 0.3377 0.3247 0.4740 0.0361  -0.0091 -0.0004 98  GLU F OE2   
781  N  N     . PRO A 100 ? 0.2307 0.2240 0.3575 0.0297  0.0266  0.0243  99  PRO F N     
782  C  CA    . PRO A 100 ? 0.2753 0.2834 0.3953 0.0305  0.0252  0.0227  99  PRO F CA    
783  C  C     . PRO A 100 ? 0.2730 0.2921 0.3906 0.0328  0.0163  0.0180  99  PRO F C     
784  O  O     . PRO A 100 ? 0.2739 0.2903 0.3866 0.0382  0.0121  0.0159  99  PRO F O     
785  C  CB    . PRO A 100 ? 0.3459 0.3520 0.4481 0.0354  0.0291  0.0266  99  PRO F CB    
786  C  CG    . PRO A 100 ? 0.3826 0.3714 0.4830 0.0360  0.0349  0.0317  99  PRO F CG    
787  C  CD    . PRO A 100 ? 0.2587 0.2395 0.3713 0.0344  0.0305  0.0293  99  PRO F CD    
788  N  N     . LEU A 101 ? 0.2269 0.2575 0.3473 0.0288  0.0135  0.0163  100 LEU F N     
789  C  CA    . LEU A 101 ? 0.2849 0.3276 0.4015 0.0296  0.0064  0.0129  100 LEU F CA    
790  C  C     . LEU A 101 ? 0.2921 0.3490 0.3978 0.0296  0.0057  0.0136  100 LEU F C     
791  O  O     . LEU A 101 ? 0.2864 0.3564 0.3873 0.0308  0.0013  0.0116  100 LEU F O     
792  C  CB    . LEU A 101 ? 0.3048 0.3490 0.4322 0.0237  0.0017  0.0111  100 LEU F CB    
793  C  CG    . LEU A 101 ? 0.3183 0.3511 0.4599 0.0221  0.0011  0.0100  100 LEU F CG    
794  C  CD1   . LEU A 101 ? 0.4414 0.4768 0.5944 0.0168  -0.0042 0.0089  100 LEU F CD1   
795  C  CD2   . LEU A 101 ? 0.2905 0.3177 0.4286 0.0267  -0.0029 0.0066  100 LEU F CD2   
796  N  N     . SER A 102 ? 0.2243 0.2795 0.3261 0.0279  0.0099  0.0162  101 SER F N     
797  C  CA    . SER A 102 ? 0.2836 0.3505 0.3755 0.0266  0.0087  0.0168  101 SER F CA    
798  C  C     . SER A 102 ? 0.2461 0.3033 0.3334 0.0262  0.0145  0.0188  101 SER F C     
799  O  O     . SER A 102 ? 0.2275 0.2718 0.3198 0.0271  0.0201  0.0202  101 SER F O     
800  C  CB    . SER A 102 ? 0.2854 0.3615 0.3794 0.0190  0.0040  0.0160  101 SER F CB    
801  O  OG    . SER A 102 ? 0.2962 0.3614 0.3981 0.0141  0.0049  0.0162  101 SER F OG    
802  N  N     . LEU A 103 ? 0.2634 0.3272 0.3409 0.0243  0.0134  0.0189  102 LEU F N     
803  C  CA    . LEU A 103 ? 0.2175 0.2718 0.2870 0.0246  0.0187  0.0199  102 LEU F CA    
804  C  C     . LEU A 103 ? 0.2232 0.2655 0.3020 0.0216  0.0241  0.0192  102 LEU F C     
805  O  O     . LEU A 103 ? 0.2726 0.3050 0.3499 0.0239  0.0318  0.0207  102 LEU F O     
806  C  CB    . LEU A 103 ? 0.2011 0.2635 0.2597 0.0210  0.0146  0.0186  102 LEU F CB    
807  C  CG    . LEU A 103 ? 0.2608 0.3371 0.3098 0.0251  0.0101  0.0193  102 LEU F CG    
808  C  CD1   . LEU A 103 ? 0.3173 0.4013 0.3577 0.0191  0.0053  0.0176  102 LEU F CD1   
809  C  CD2   . LEU A 103 ? 0.2930 0.3606 0.3327 0.0339  0.0141  0.0222  102 LEU F CD2   
810  N  N     . ASP A 104 ? 0.1995 0.2431 0.2879 0.0165  0.0203  0.0172  103 ASP F N     
811  C  CA    . ASP A 104 ? 0.2239 0.2582 0.3202 0.0147  0.0240  0.0155  103 ASP F CA    
812  C  C     . ASP A 104 ? 0.2642 0.2955 0.3793 0.0148  0.0251  0.0155  103 ASP F C     
813  O  O     . ASP A 104 ? 0.2136 0.2403 0.3389 0.0138  0.0263  0.0137  103 ASP F O     
814  C  CB    . ASP A 104 ? 0.1886 0.2228 0.2816 0.0094  0.0179  0.0133  103 ASP F CB    
815  C  CG    . ASP A 104 ? 0.2808 0.3174 0.3842 0.0054  0.0107  0.0137  103 ASP F CG    
816  O  OD1   . ASP A 104 ? 0.2201 0.2637 0.3283 0.0059  0.0080  0.0151  103 ASP F OD1   
817  O  OD2   . ASP A 104 ? 0.2425 0.2723 0.3478 0.0021  0.0072  0.0124  103 ASP F OD2   
818  N  N     . GLU A 105 ? 0.2314 0.2649 0.3517 0.0163  0.0237  0.0169  104 GLU F N     
819  C  CA    . GLU A 105 ? 0.1978 0.2287 0.3363 0.0153  0.0231  0.0164  104 GLU F CA    
820  C  C     . GLU A 105 ? 0.2091 0.2364 0.3509 0.0175  0.0255  0.0180  104 GLU F C     
821  O  O     . GLU A 105 ? 0.1868 0.2140 0.3162 0.0209  0.0253  0.0193  104 GLU F O     
822  C  CB    . GLU A 105 ? 0.2276 0.2632 0.3714 0.0123  0.0132  0.0149  104 GLU F CB    
823  C  CG    . GLU A 105 ? 0.3198 0.3622 0.4559 0.0128  0.0073  0.0148  104 GLU F CG    
824  C  CD    . GLU A 105 ? 0.3562 0.4035 0.4931 0.0089  -0.0015 0.0142  104 GLU F CD    
825  O  OE1   . GLU A 105 ? 0.3373 0.3849 0.4799 0.0091  -0.0063 0.0130  104 GLU F OE1   
826  O  OE2   . GLU A 105 ? 0.4541 0.5033 0.5844 0.0050  -0.0041 0.0153  104 GLU F OE2   
827  N  N     . ALA A 106 ? 0.1801 0.2040 0.3397 0.0156  0.0270  0.0177  105 ALA F N     
828  C  CA    . ALA A 106 ? 0.1470 0.1645 0.3114 0.0159  0.0285  0.0192  105 ALA F CA    
829  C  C     . ALA A 106 ? 0.1653 0.1831 0.3522 0.0119  0.0256  0.0174  105 ALA F C     
830  O  O     . ALA A 106 ? 0.1936 0.2162 0.3944 0.0101  0.0266  0.0163  105 ALA F O     
831  C  CB    . ALA A 106 ? 0.2214 0.2316 0.3801 0.0167  0.0393  0.0236  105 ALA F CB    
832  N  N     . TYR A 107 ? 0.1874 0.1996 0.3780 0.0112  0.0211  0.0166  106 TYR F N     
833  C  CA    . TYR A 107 ? 0.1939 0.2047 0.4064 0.0063  0.0190  0.0155  106 TYR F CA    
834  C  C     . TYR A 107 ? 0.2084 0.2125 0.4280 0.0030  0.0296  0.0200  106 TYR F C     
835  O  O     . TYR A 107 ? 0.2397 0.2339 0.4439 0.0050  0.0341  0.0235  106 TYR F O     
836  C  CB    . TYR A 107 ? 0.1897 0.1952 0.4011 0.0062  0.0085  0.0118  106 TYR F CB    
837  C  CG    . TYR A 107 ? 0.1917 0.2045 0.3992 0.0077  -0.0022 0.0076  106 TYR F CG    
838  C  CD1   . TYR A 107 ? 0.1652 0.1857 0.3873 0.0049  -0.0069 0.0064  106 TYR F CD1   
839  C  CD2   . TYR A 107 ? 0.2443 0.2567 0.4330 0.0121  -0.0075 0.0051  106 TYR F CD2   
840  C  CE1   . TYR A 107 ? 0.1880 0.2131 0.4033 0.0057  -0.0171 0.0039  106 TYR F CE1   
841  C  CE2   . TYR A 107 ? 0.2696 0.2893 0.4526 0.0125  -0.0162 0.0021  106 TYR F CE2   
842  C  CZ    . TYR A 107 ? 0.2829 0.3077 0.4780 0.0088  -0.0210 0.0021  106 TYR F CZ    
843  O  OH    . TYR A 107 ? 0.2387 0.2688 0.4256 0.0086  -0.0298 0.0005  106 TYR F OH    
844  N  N     . LEU A 108 ? 0.1845 0.1944 0.4282 -0.0022 0.0330  0.0202  107 LEU F N     
845  C  CA    . LEU A 108 ? 0.2298 0.2359 0.4854 -0.0081 0.0430  0.0247  107 LEU F CA    
846  C  C     . LEU A 108 ? 0.2254 0.2327 0.5056 -0.0151 0.0361  0.0225  107 LEU F C     
847  O  O     . LEU A 108 ? 0.2226 0.2408 0.5193 -0.0154 0.0282  0.0179  107 LEU F O     
848  C  CB    . LEU A 108 ? 0.2411 0.2578 0.5057 -0.0083 0.0559  0.0269  107 LEU F CB    
849  C  CG    . LEU A 108 ? 0.4000 0.4126 0.6409 -0.0040 0.0665  0.0306  107 LEU F CG    
850  C  CD1   . LEU A 108 ? 0.4362 0.4479 0.6554 0.0029  0.0596  0.0277  107 LEU F CD1   
851  C  CD2   . LEU A 108 ? 0.4292 0.4530 0.6822 -0.0045 0.0795  0.0312  107 LEU F CD2   
852  N  N     . ASP A 109 ? 0.1943 0.1889 0.4762 -0.0209 0.0375  0.0256  108 ASP F N     
853  C  CA    . ASP A 109 ? 0.2485 0.2445 0.5566 -0.0300 0.0322  0.0240  108 ASP F CA    
854  C  C     . ASP A 109 ? 0.3352 0.3387 0.6632 -0.0383 0.0466  0.0301  108 ASP F C     
855  O  O     . ASP A 109 ? 0.2581 0.2488 0.5762 -0.0423 0.0558  0.0370  108 ASP F O     
856  C  CB    . ASP A 109 ? 0.2248 0.2003 0.5229 -0.0323 0.0227  0.0224  108 ASP F CB    
857  C  CG    . ASP A 109 ? 0.3299 0.3063 0.6539 -0.0419 0.0135  0.0188  108 ASP F CG    
858  O  OD1   . ASP A 109 ? 0.2756 0.2655 0.6272 -0.0503 0.0197  0.0213  108 ASP F OD1   
859  O  OD2   . ASP A 109 ? 0.3481 0.3129 0.6652 -0.0411 0.0000  0.0128  108 ASP F OD2   
860  N  N     . VAL A 110 ? 0.2214 0.2462 0.5773 -0.0405 0.0485  0.0279  109 VAL F N     
861  C  CA    . VAL A 110 ? 0.2187 0.2566 0.5966 -0.0476 0.0630  0.0326  109 VAL F CA    
862  C  C     . VAL A 110 ? 0.2883 0.3328 0.6880 -0.0552 0.0554  0.0300  109 VAL F C     
863  O  O     . VAL A 110 ? 0.2822 0.3430 0.6981 -0.0578 0.0630  0.0308  109 VAL F O     
864  C  CB    . VAL A 110 ? 0.3149 0.3711 0.6959 -0.0395 0.0719  0.0307  109 VAL F CB    
865  C  CG1   . VAL A 110 ? 0.2846 0.3314 0.6343 -0.0315 0.0791  0.0330  109 VAL F CG1   
866  C  CG2   . VAL A 110 ? 0.3067 0.3748 0.6996 -0.0331 0.0585  0.0227  109 VAL F CG2   
867  N  N     . THR A 111 ? 0.2864 0.3188 0.6861 -0.0587 0.0402  0.0264  110 THR F N     
868  C  CA    . THR A 111 ? 0.3404 0.3771 0.7588 -0.0669 0.0319  0.0240  110 THR F CA    
869  C  C     . THR A 111 ? 0.3535 0.3915 0.7793 -0.0774 0.0447  0.0310  110 THR F C     
870  O  O     . THR A 111 ? 0.3433 0.3993 0.7911 -0.0825 0.0461  0.0303  110 THR F O     
871  C  CB    . THR A 111 ? 0.3313 0.3482 0.7410 -0.0696 0.0156  0.0196  110 THR F CB    
872  O  OG1   . THR A 111 ? 0.2876 0.3033 0.6875 -0.0605 0.0047  0.0136  110 THR F OG1   
873  C  CG2   . THR A 111 ? 0.3653 0.3876 0.7940 -0.0778 0.0049  0.0158  110 THR F CG2   
874  N  N     . ASP A 112 ? 0.3365 0.3552 0.7431 -0.0808 0.0538  0.0383  111 ASP F N     
875  C  CA    . ASP A 112 ? 0.6141 0.6294 1.0221 -0.0920 0.0655  0.0465  111 ASP F CA    
876  C  C     . ASP A 112 ? 0.6391 0.6660 1.0421 -0.0896 0.0851  0.0529  111 ASP F C     
877  O  O     . ASP A 112 ? 0.5925 0.6116 0.9868 -0.0976 0.0968  0.0616  111 ASP F O     
878  C  CB    . ASP A 112 ? 0.6642 0.6465 1.0505 -0.0974 0.0620  0.0514  111 ASP F CB    
879  C  CG    . ASP A 112 ? 0.7046 0.6731 1.0933 -0.1001 0.0428  0.0441  111 ASP F CG    
880  O  OD1   . ASP A 112 ? 0.6869 0.6716 1.0982 -0.1044 0.0345  0.0384  111 ASP F OD1   
881  O  OD2   . ASP A 112 ? 0.6878 0.6287 1.0546 -0.0970 0.0357  0.0436  111 ASP F OD2   
882  N  N     . SER A 113 ? 0.5209 0.5648 0.9266 -0.0788 0.0887  0.0487  112 SER F N     
883  C  CA    . SER A 113 ? 0.4430 0.4983 0.8427 -0.0755 0.1068  0.0529  112 SER F CA    
884  C  C     . SER A 113 ? 0.4855 0.5659 0.9095 -0.0808 0.1144  0.0524  112 SER F C     
885  O  O     . SER A 113 ? 0.5647 0.6607 1.0125 -0.0809 0.1045  0.0459  112 SER F O     
886  C  CB    . SER A 113 ? 0.5544 0.6159 0.9454 -0.0617 0.1072  0.0479  112 SER F CB    
887  O  OG    . SER A 113 ? 0.5138 0.5837 0.8953 -0.0581 0.1244  0.0511  112 SER F OG    
888  N  N     . VAL A 114 ? 0.4338 0.5186 0.8509 -0.0853 0.1319  0.0596  113 VAL F N     
889  C  CA    . VAL A 114 ? 0.5077 0.6196 0.9458 -0.0893 0.1425  0.0594  113 VAL F CA    
890  C  C     . VAL A 114 ? 0.5224 0.6501 0.9555 -0.0772 0.1544  0.0559  113 VAL F C     
891  O  O     . VAL A 114 ? 0.5228 0.6749 0.9725 -0.0780 0.1640  0.0545  113 VAL F O     
892  C  CB    . VAL A 114 ? 0.6340 0.7424 1.0691 -0.1046 0.1541  0.0698  113 VAL F CB    
893  C  CG1   . VAL A 114 ? 0.5709 0.6696 0.9763 -0.1023 0.1709  0.0776  113 VAL F CG1   
894  C  CG2   . VAL A 114 ? 0.7152 0.8537 1.1813 -0.1131 0.1592  0.0688  113 VAL F CG2   
895  N  N     . HIS A 115 ? 0.4051 0.5198 0.8154 -0.0662 0.1538  0.0541  114 HIS F N     
896  C  CA    . HIS A 115 ? 0.3301 0.4571 0.7342 -0.0542 0.1626  0.0492  114 HIS F CA    
897  C  C     . HIS A 115 ? 0.4143 0.5616 0.8443 -0.0469 0.1539  0.0393  114 HIS F C     
898  O  O     . HIS A 115 ? 0.3780 0.5244 0.8232 -0.0479 0.1376  0.0354  114 HIS F O     
899  C  CB    . HIS A 115 ? 0.3541 0.4624 0.7298 -0.0447 0.1608  0.0485  114 HIS F CB    
900  C  CG    . HIS A 115 ? 0.5632 0.6527 0.9093 -0.0485 0.1713  0.0581  114 HIS F CG    
901  N  ND1   . HIS A 115 ? 0.5797 0.6471 0.9151 -0.0556 0.1650  0.0650  114 HIS F ND1   
902  C  CD2   . HIS A 115 ? 0.6549 0.7427 0.9773 -0.0453 0.1866  0.0619  114 HIS F CD2   
903  C  CE1   . HIS A 115 ? 0.5602 0.6126 0.8668 -0.0565 0.1758  0.0735  114 HIS F CE1   
904  N  NE2   . HIS A 115 ? 0.7307 0.7955 1.0283 -0.0506 0.1891  0.0719  114 HIS F NE2   
905  N  N     . CYS A 116 ? 0.3676 0.5322 0.8004 -0.0390 0.1643  0.0350  115 CYS F N     
906  C  CA    . CYS A 116 ? 0.3880 0.5697 0.8409 -0.0292 0.1569  0.0255  115 CYS F CA    
907  C  C     . CYS A 116 ? 0.4207 0.6162 0.9052 -0.0357 0.1453  0.0238  115 CYS F C     
908  O  O     . CYS A 116 ? 0.4300 0.6272 0.9261 -0.0296 0.1300  0.0175  115 CYS F O     
909  C  CB    . CYS A 116 ? 0.4690 0.6360 0.9075 -0.0179 0.1451  0.0198  115 CYS F CB    
910  S  SG    . CYS A 116 ? 0.4715 0.6233 0.8732 -0.0096 0.1567  0.0204  115 CYS F SG    
911  N  N     . HIS A 117 ? 0.4489 0.6538 0.9460 -0.0488 0.1523  0.0297  116 HIS F N     
912  C  CA    . HIS A 117 ? 0.5096 0.7294 1.0372 -0.0571 0.1425  0.0286  116 HIS F CA    
913  C  C     . HIS A 117 ? 0.5474 0.7492 1.0749 -0.0583 0.1215  0.0264  116 HIS F C     
914  O  O     . HIS A 117 ? 0.5763 0.7890 1.1257 -0.0580 0.1082  0.0215  116 HIS F O     
915  C  CB    . HIS A 117 ? 0.5154 0.7650 1.0695 -0.0493 0.1430  0.0215  116 HIS F CB    
916  C  CG    . HIS A 117 ? 0.6104 0.8776 1.1616 -0.0436 0.1626  0.0211  116 HIS F CG    
917  N  ND1   . HIS A 117 ? 0.6363 0.9277 1.2029 -0.0525 0.1775  0.0251  116 HIS F ND1   
918  C  CD2   . HIS A 117 ? 0.6206 0.8846 1.1538 -0.0301 0.1697  0.0168  116 HIS F CD2   
919  C  CE1   . HIS A 117 ? 0.6592 0.9626 1.2171 -0.0438 0.1933  0.0230  116 HIS F CE1   
920  N  NE2   . HIS A 117 ? 0.6720 0.9581 1.2093 -0.0299 0.1886  0.0176  116 HIS F NE2   
921  N  N     . GLY A 118 ? 0.5072 0.6822 1.0093 -0.0592 0.1185  0.0298  117 GLY F N     
922  C  CA    . GLY A 118 ? 0.4423 0.6004 0.9413 -0.0598 0.0996  0.0274  117 GLY F CA    
923  C  C     . GLY A 118 ? 0.4356 0.5927 0.9329 -0.0471 0.0864  0.0199  117 GLY F C     
924  O  O     . GLY A 118 ? 0.4087 0.5546 0.9042 -0.0472 0.0700  0.0173  117 GLY F O     
925  N  N     . SER A 119 ? 0.3410 0.5084 0.8372 -0.0363 0.0928  0.0163  118 SER F N     
926  C  CA    . SER A 119 ? 0.3166 0.4816 0.8102 -0.0248 0.0800  0.0098  118 SER F CA    
927  C  C     . SER A 119 ? 0.2707 0.4143 0.7355 -0.0200 0.0781  0.0107  118 SER F C     
928  O  O     . SER A 119 ? 0.2487 0.3888 0.6970 -0.0159 0.0909  0.0123  118 SER F O     
929  C  CB    . SER A 119 ? 0.3075 0.4907 0.8116 -0.0150 0.0869  0.0051  118 SER F CB    
930  O  OG    . SER A 119 ? 0.2759 0.4505 0.7699 -0.0040 0.0764  0.0002  118 SER F OG    
931  N  N     . ALA A 120 ? 0.2044 0.3351 0.6627 -0.0202 0.0619  0.0093  119 ALA F N     
932  C  CA    . ALA A 120 ? 0.2155 0.3298 0.6487 -0.0154 0.0593  0.0098  119 ALA F CA    
933  C  C     . ALA A 120 ? 0.2765 0.3928 0.7027 -0.0042 0.0585  0.0056  119 ALA F C     
934  O  O     . ALA A 120 ? 0.2404 0.3475 0.6461 0.0002  0.0632  0.0063  119 ALA F O     
935  C  CB    . ALA A 120 ? 0.2012 0.3036 0.6292 -0.0182 0.0423  0.0090  119 ALA F CB    
936  N  N     . THR A 121 ? 0.2297 0.3576 0.6729 0.0006  0.0524  0.0010  120 THR F N     
937  C  CA    . THR A 121 ? 0.2247 0.3531 0.6625 0.0115  0.0517  -0.0032 120 THR F CA    
938  C  C     . THR A 121 ? 0.2935 0.4253 0.7227 0.0155  0.0703  -0.0032 120 THR F C     
939  O  O     . THR A 121 ? 0.2414 0.3635 0.6519 0.0222  0.0723  -0.0049 120 THR F O     
940  C  CB    . THR A 121 ? 0.2242 0.3659 0.6846 0.0161  0.0430  -0.0077 120 THR F CB    
941  O  OG1   . THR A 121 ? 0.3120 0.4487 0.7762 0.0130  0.0249  -0.0078 120 THR F OG1   
942  C  CG2   . THR A 121 ? 0.2655 0.4062 0.7210 0.0283  0.0422  -0.0123 120 THR F CG2   
943  N  N     . LEU A 122 ? 0.2273 0.3726 0.6687 0.0111  0.0839  -0.0013 121 LEU F N     
944  C  CA    . LEU A 122 ? 0.2801 0.4302 0.7122 0.0147  0.1023  -0.0013 121 LEU F CA    
945  C  C     . LEU A 122 ? 0.2839 0.4189 0.6900 0.0109  0.1110  0.0040  121 LEU F C     
946  O  O     . LEU A 122 ? 0.3159 0.4465 0.7036 0.0170  0.1210  0.0026  121 LEU F O     
947  C  CB    . LEU A 122 ? 0.3185 0.4898 0.7713 0.0102  0.1144  -0.0002 121 LEU F CB    
948  C  CG    . LEU A 122 ? 0.3733 0.5648 0.8503 0.0178  0.1119  -0.0066 121 LEU F CG    
949  C  CD1   . LEU A 122 ? 0.3656 0.5805 0.8598 0.0132  0.1277  -0.0049 121 LEU F CD1   
950  C  CD2   . LEU A 122 ? 0.3575 0.5447 0.8234 0.0322  0.1115  -0.0134 121 LEU F CD2   
951  N  N     . ILE A 123 ? 0.2791 0.4057 0.6830 0.0013  0.1073  0.0098  122 ILE F N     
952  C  CA    . ILE A 123 ? 0.2304 0.3416 0.6094 -0.0012 0.1133  0.0152  122 ILE F CA    
953  C  C     . ILE A 123 ? 0.2220 0.3221 0.5822 0.0070  0.1062  0.0118  122 ILE F C     
954  O  O     . ILE A 123 ? 0.2818 0.3750 0.6204 0.0106  0.1156  0.0128  122 ILE F O     
955  C  CB    . ILE A 123 ? 0.2209 0.3235 0.6023 -0.0117 0.1075  0.0210  122 ILE F CB    
956  C  CG1   . ILE A 123 ? 0.2763 0.3873 0.6721 -0.0213 0.1168  0.0256  122 ILE F CG1   
957  C  CG2   . ILE A 123 ? 0.1986 0.2844 0.5544 -0.0122 0.1102  0.0259  122 ILE F CG2   
958  C  CD1   . ILE A 123 ? 0.2793 0.3804 0.6800 -0.0319 0.1091  0.0301  122 ILE F CD1   
959  N  N     . ALA A 124 ? 0.1773 0.2755 0.5442 0.0097  0.0894  0.0079  123 ALA F N     
960  C  CA    . ALA A 124 ? 0.2404 0.3285 0.5903 0.0165  0.0817  0.0052  123 ALA F CA    
961  C  C     . ALA A 124 ? 0.2487 0.3376 0.5909 0.0257  0.0895  0.0003  123 ALA F C     
962  O  O     . ALA A 124 ? 0.2470 0.3246 0.5641 0.0292  0.0918  -0.0003 123 ALA F O     
963  C  CB    . ALA A 124 ? 0.2307 0.3170 0.5888 0.0172  0.0624  0.0027  123 ALA F CB    
964  N  N     . GLN A 125 ? 0.2300 0.3302 0.5890 0.0295  0.0921  -0.0039 124 GLN F N     
965  C  CA    . GLN A 125 ? 0.2233 0.3239 0.5756 0.0395  0.0993  -0.0100 124 GLN F CA    
966  C  C     . GLN A 125 ? 0.2966 0.3960 0.6305 0.0396  0.1178  -0.0084 124 GLN F C     
967  O  O     . GLN A 125 ? 0.3129 0.4028 0.6270 0.0465  0.1220  -0.0125 124 GLN F O     
968  C  CB    . GLN A 125 ? 0.2584 0.3744 0.6343 0.0442  0.0990  -0.0147 124 GLN F CB    
969  C  CG    . GLN A 125 ? 0.5614 0.6755 0.9321 0.0569  0.1017  -0.0227 124 GLN F CG    
970  C  CD    . GLN A 125 ? 0.7531 0.8540 1.1218 0.0631  0.0839  -0.0262 124 GLN F CD    
971  O  OE1   . GLN A 125 ? 0.7781 0.8809 1.1606 0.0603  0.0697  -0.0244 124 GLN F OE1   
972  N  NE2   . GLN A 125 ? 0.8433 0.9292 1.1932 0.0711  0.0843  -0.0311 124 GLN F NE2   
973  N  N     . GLU A 126 ? 0.2348 0.3418 0.5728 0.0315  0.1284  -0.0024 125 GLU F N     
974  C  CA    . GLU A 126 ? 0.3069 0.4120 0.6248 0.0308  0.1460  0.0005  125 GLU F CA    
975  C  C     . GLU A 126 ? 0.3246 0.4126 0.6147 0.0305  0.1455  0.0038  125 GLU F C     
976  O  O     . GLU A 126 ? 0.3171 0.3971 0.5805 0.0351  0.1534  0.0019  125 GLU F O     
977  C  CB    . GLU A 126 ? 0.3538 0.4687 0.6822 0.0208  0.1559  0.0077  125 GLU F CB    
978  C  CG    . GLU A 126 ? 0.5538 0.6780 0.8744 0.0223  0.1747  0.0078  125 GLU F CG    
979  C  CD    . GLU A 126 ? 0.5934 0.7293 0.9286 0.0113  0.1831  0.0151  125 GLU F CD    
980  O  OE1   . GLU A 126 ? 0.5810 0.7365 0.9420 0.0111  0.1844  0.0121  125 GLU F OE1   
981  O  OE2   . GLU A 126 ? 0.4701 0.5952 0.7913 0.0028  0.1877  0.0241  125 GLU F OE2   
982  N  N     . ILE A 127 ? 0.2936 0.3729 0.5814 0.0245  0.1320  0.0082  126 ILE F N     
983  C  CA    . ILE A 127 ? 0.3095 0.3706 0.5630 0.0237  0.1245  0.0108  126 ILE F CA    
984  C  C     . ILE A 127 ? 0.2283 0.2810 0.4645 0.0312  0.1172  0.0038  126 ILE F C     
985  O  O     . ILE A 127 ? 0.2797 0.3221 0.4864 0.0332  0.1196  0.0035  126 ILE F O     
986  C  CB    . ILE A 127 ? 0.2382 0.2938 0.4951 0.0175  0.1104  0.0149  126 ILE F CB    
987  C  CG1   . ILE A 127 ? 0.2952 0.3522 0.5606 0.0093  0.1176  0.0224  126 ILE F CG1   
988  C  CG2   . ILE A 127 ? 0.2271 0.2682 0.4531 0.0187  0.1003  0.0156  126 ILE F CG2   
989  C  CD1   . ILE A 127 ? 0.3025 0.3544 0.5751 0.0039  0.1042  0.0246  126 ILE F CD1   
990  N  N     . ARG A 128 ? 0.2532 0.3089 0.5069 0.0350  0.1070  -0.0016 127 ARG F N     
991  C  CA    . ARG A 128 ? 0.3120 0.3563 0.5491 0.0408  0.0986  -0.0075 127 ARG F CA    
992  C  C     . ARG A 128 ? 0.3511 0.3936 0.5761 0.0481  0.1110  -0.0135 127 ARG F C     
993  O  O     . ARG A 128 ? 0.3411 0.3701 0.5384 0.0501  0.1082  -0.0165 127 ARG F O     
994  C  CB    . ARG A 128 ? 0.2395 0.2855 0.4977 0.0437  0.0852  -0.0111 127 ARG F CB    
995  C  CG    . ARG A 128 ? 0.2525 0.2966 0.5142 0.0370  0.0704  -0.0063 127 ARG F CG    
996  C  CD    . ARG A 128 ? 0.2637 0.3101 0.5462 0.0399  0.0576  -0.0089 127 ARG F CD    
997  N  NE    . ARG A 128 ? 0.3094 0.3459 0.5848 0.0474  0.0542  -0.0147 127 ARG F NE    
998  C  CZ    . ARG A 128 ? 0.4408 0.4827 0.7360 0.0562  0.0569  -0.0204 127 ARG F CZ    
999  N  NH1   . ARG A 128 ? 0.3674 0.3956 0.6520 0.0634  0.0527  -0.0260 127 ARG F NH1   
1000 N  NH2   . ARG A 128 ? 0.4591 0.5199 0.7852 0.0579  0.0632  -0.0208 127 ARG F NH2   
1001 N  N     . GLN A 129 ? 0.3287 0.3856 0.5739 0.0519  0.1250  -0.0158 128 GLN F N     
1002 C  CA    . GLN A 129 ? 0.3414 0.3979 0.5744 0.0600  0.1385  -0.0225 128 GLN F CA    
1003 C  C     . GLN A 129 ? 0.3933 0.4422 0.5933 0.0566  0.1482  -0.0184 128 GLN F C     
1004 O  O     . GLN A 129 ? 0.3939 0.4313 0.5668 0.0617  0.1503  -0.0239 128 GLN F O     
1005 C  CB    . GLN A 129 ? 0.3348 0.4124 0.5976 0.0643  0.1519  -0.0253 128 GLN F CB    
1006 C  CG    . GLN A 129 ? 0.4171 0.4957 0.6651 0.0733  0.1653  -0.0330 128 GLN F CG    
1007 C  CD    . GLN A 129 ? 0.5057 0.5697 0.7457 0.0847  0.1570  -0.0442 128 GLN F CD    
1008 O  OE1   . GLN A 129 ? 0.5505 0.6132 0.8090 0.0880  0.1430  -0.0470 128 GLN F OE1   
1009 N  NE2   . GLN A 129 ? 0.5949 0.6453 0.8037 0.0901  0.1636  -0.0503 128 GLN F NE2   
1010 N  N     . THR A 130 ? 0.3378 0.3915 0.5388 0.0481  0.1535  -0.0086 129 THR F N     
1011 C  CA    . THR A 130 ? 0.3338 0.3787 0.5024 0.0452  0.1610  -0.0032 129 THR F CA    
1012 C  C     . THR A 130 ? 0.3243 0.3521 0.4632 0.0452  0.1468  -0.0042 129 THR F C     
1013 O  O     . THR A 130 ? 0.4539 0.4726 0.5624 0.0478  0.1506  -0.0059 129 THR F O     
1014 C  CB    . THR A 130 ? 0.3341 0.3829 0.5096 0.0359  0.1658  0.0081  129 THR F CB    
1015 O  OG1   . THR A 130 ? 0.3905 0.4574 0.5957 0.0339  0.1795  0.0094  129 THR F OG1   
1016 C  CG2   . THR A 130 ? 0.3369 0.3747 0.4775 0.0340  0.1728  0.0145  129 THR F CG2   
1017 N  N     . ILE A 131 ? 0.3034 0.3279 0.4506 0.0420  0.1303  -0.0031 130 ILE F N     
1018 C  CA    . ILE A 131 ? 0.3263 0.3386 0.4493 0.0409  0.1169  -0.0038 130 ILE F CA    
1019 C  C     . ILE A 131 ? 0.4288 0.4320 0.5361 0.0467  0.1149  -0.0132 130 ILE F C     
1020 O  O     . ILE A 131 ? 0.3716 0.3655 0.4501 0.0469  0.1128  -0.0147 130 ILE F O     
1021 C  CB    . ILE A 131 ? 0.3033 0.3163 0.4406 0.0365  0.1013  -0.0015 130 ILE F CB    
1022 C  CG1   . ILE A 131 ? 0.2381 0.2547 0.3801 0.0310  0.1016  0.0072  130 ILE F CG1   
1023 C  CG2   . ILE A 131 ? 0.3216 0.3253 0.4396 0.0355  0.0874  -0.0041 130 ILE F CG2   
1024 C  CD1   . ILE A 131 ? 0.3172 0.3360 0.4737 0.0273  0.0879  0.0089  130 ILE F CD1   
1025 N  N     . PHE A 132 ? 0.3455 0.3509 0.4717 0.0520  0.1151  -0.0202 131 PHE F N     
1026 C  CA    . PHE A 132 ? 0.3536 0.3473 0.4651 0.0586  0.1133  -0.0302 131 PHE F CA    
1027 C  C     . PHE A 132 ? 0.4246 0.4169 0.5144 0.0636  0.1286  -0.0340 131 PHE F C     
1028 O  O     . PHE A 132 ? 0.4543 0.4330 0.5160 0.0655  0.1253  -0.0397 131 PHE F O     
1029 C  CB    . PHE A 132 ? 0.3332 0.3289 0.4706 0.0652  0.1107  -0.0368 131 PHE F CB    
1030 C  CG    . PHE A 132 ? 0.4280 0.4079 0.5505 0.0730  0.1077  -0.0479 131 PHE F CG    
1031 C  CD1   . PHE A 132 ? 0.4413 0.4032 0.5427 0.0689  0.0930  -0.0497 131 PHE F CD1   
1032 C  CD2   . PHE A 132 ? 0.5213 0.5045 0.6508 0.0841  0.1199  -0.0568 131 PHE F CD2   
1033 C  CE1   . PHE A 132 ? 0.4740 0.4177 0.5606 0.0751  0.0889  -0.0602 131 PHE F CE1   
1034 C  CE2   . PHE A 132 ? 0.6367 0.6023 0.7508 0.0922  0.1164  -0.0682 131 PHE F CE2   
1035 C  CZ    . PHE A 132 ? 0.5285 0.4726 0.6205 0.0874  0.1003  -0.0698 131 PHE F CZ    
1036 N  N     . ASN A 133 ? 0.4345 0.4407 0.5362 0.0649  0.1453  -0.0308 132 ASN F N     
1037 C  CA    . ASN A 133 ? 0.4529 0.4594 0.5336 0.0699  0.1619  -0.0341 132 ASN F CA    
1038 C  C     . ASN A 133 ? 0.4623 0.4584 0.5064 0.0655  0.1604  -0.0290 132 ASN F C     
1039 O  O     . ASN A 133 ? 0.4844 0.4714 0.4992 0.0701  0.1650  -0.0351 132 ASN F O     
1040 C  CB    . ASN A 133 ? 0.5068 0.5328 0.6095 0.0698  0.1808  -0.0296 132 ASN F CB    
1041 C  CG    . ASN A 133 ? 0.4593 0.4989 0.5961 0.0774  0.1856  -0.0373 132 ASN F CG    
1042 O  OD1   . ASN A 133 ? 0.5077 0.5390 0.6461 0.0853  0.1773  -0.0475 132 ASN F OD1   
1043 N  ND2   . ASN A 133 ? 0.4808 0.5413 0.6457 0.0749  0.1986  -0.0323 132 ASN F ND2   
1044 N  N     . GLU A 134 ? 0.4133 0.4101 0.4577 0.0574  0.1534  -0.0184 133 GLU F N     
1045 C  CA    . GLU A 134 ? 0.4426 0.4317 0.4550 0.0545  0.1526  -0.0123 133 GLU F CA    
1046 C  C     . GLU A 134 ? 0.4322 0.4110 0.4274 0.0521  0.1340  -0.0140 133 GLU F C     
1047 O  O     . GLU A 134 ? 0.5409 0.5127 0.5060 0.0521  0.1319  -0.0127 133 GLU F O     
1048 C  CB    . GLU A 134 ? 0.3673 0.3622 0.3875 0.0483  0.1574  0.0008  133 GLU F CB    
1049 C  CG    . GLU A 134 ? 0.4564 0.4620 0.4900 0.0479  0.1772  0.0046  133 GLU F CG    
1050 C  CD    . GLU A 134 ? 0.4758 0.4822 0.5120 0.0405  0.1816  0.0182  133 GLU F CD    
1051 O  OE1   . GLU A 134 ? 0.4224 0.4203 0.4488 0.0375  0.1692  0.0240  133 GLU F OE1   
1052 O  OE2   . GLU A 134 ? 0.5016 0.5173 0.5508 0.0377  0.1975  0.0229  133 GLU F OE2   
1053 N  N     . LEU A 135 ? 0.3758 0.3548 0.3891 0.0497  0.1204  -0.0163 134 LEU F N     
1054 C  CA    . LEU A 135 ? 0.3751 0.3473 0.3749 0.0459  0.1036  -0.0175 134 LEU F CA    
1055 C  C     . LEU A 135 ? 0.3900 0.3524 0.3880 0.0474  0.0948  -0.0278 134 LEU F C     
1056 O  O     . LEU A 135 ? 0.4172 0.3733 0.4010 0.0431  0.0818  -0.0296 134 LEU F O     
1057 C  CB    . LEU A 135 ? 0.4328 0.4123 0.4504 0.0401  0.0934  -0.0100 134 LEU F CB    
1058 C  CG    . LEU A 135 ? 0.4401 0.4247 0.4546 0.0379  0.0959  0.0001  134 LEU F CG    
1059 C  CD1   . LEU A 135 ? 0.4065 0.3975 0.4437 0.0376  0.1070  0.0052  134 LEU F CD1   
1060 C  CD2   . LEU A 135 ? 0.4423 0.4307 0.4600 0.0337  0.0813  0.0034  134 LEU F CD2   
1061 N  N     . GLN A 136 ? 0.4083 0.3692 0.4209 0.0532  0.1012  -0.0346 135 GLN F N     
1062 C  CA    . GLN A 136 ? 0.5001 0.4483 0.5133 0.0553  0.0917  -0.0441 135 GLN F CA    
1063 C  C     . GLN A 136 ? 0.4722 0.4189 0.4964 0.0475  0.0748  -0.0401 135 GLN F C     
1064 O  O     . GLN A 136 ? 0.4638 0.3979 0.4761 0.0438  0.0624  -0.0443 135 GLN F O     
1065 C  CB    . GLN A 136 ? 0.5788 0.5118 0.5594 0.0576  0.0899  -0.0531 135 GLN F CB    
1066 C  CG    . GLN A 136 ? 0.7657 0.6998 0.7307 0.0657  0.1073  -0.0574 135 GLN F CG    
1067 C  CD    . GLN A 136 ? 1.0035 0.9311 0.9321 0.0637  0.1058  -0.0578 135 GLN F CD    
1068 O  OE1   . GLN A 136 ? 1.0857 0.9986 0.9935 0.0625  0.0951  -0.0657 135 GLN F OE1   
1069 N  NE2   . GLN A 136 ? 1.0198 0.9570 0.9401 0.0628  0.1153  -0.0489 135 GLN F NE2   
1070 N  N     . LEU A 137 ? 0.3973 0.3568 0.4433 0.0442  0.0744  -0.0318 136 LEU F N     
1071 C  CA    . LEU A 137 ? 0.3370 0.2978 0.3964 0.0378  0.0607  -0.0276 136 LEU F CA    
1072 C  C     . LEU A 137 ? 0.3784 0.3475 0.4681 0.0408  0.0638  -0.0256 136 LEU F C     
1073 O  O     . LEU A 137 ? 0.3699 0.3489 0.4713 0.0446  0.0763  -0.0241 136 LEU F O     
1074 C  CB    . LEU A 137 ? 0.3603 0.3303 0.4130 0.0306  0.0554  -0.0193 136 LEU F CB    
1075 C  CG    . LEU A 137 ? 0.4003 0.3674 0.4255 0.0279  0.0522  -0.0199 136 LEU F CG    
1076 C  CD1   . LEU A 137 ? 0.3474 0.3267 0.3708 0.0242  0.0495  -0.0116 136 LEU F CD1   
1077 C  CD2   . LEU A 137 ? 0.3420 0.2986 0.3571 0.0226  0.0394  -0.0247 136 LEU F CD2   
1078 N  N     . THR A 138 ? 0.3519 0.3172 0.4543 0.0386  0.0522  -0.0253 137 THR F N     
1079 C  CA    . THR A 138 ? 0.3655 0.3394 0.4967 0.0414  0.0530  -0.0234 137 THR F CA    
1080 C  C     . THR A 138 ? 0.3363 0.3199 0.4764 0.0344  0.0463  -0.0153 137 THR F C     
1081 O  O     . THR A 138 ? 0.2676 0.2498 0.3936 0.0277  0.0384  -0.0117 137 THR F O     
1082 C  CB    . THR A 138 ? 0.3252 0.2880 0.4667 0.0459  0.0444  -0.0284 137 THR F CB    
1083 O  OG1   . THR A 138 ? 0.3333 0.2856 0.4648 0.0384  0.0292  -0.0254 137 THR F OG1   
1084 C  CG2   . THR A 138 ? 0.3555 0.3069 0.4879 0.0547  0.0507  -0.0382 137 THR F CG2   
1085 N  N     . ALA A 139 ? 0.2779 0.2723 0.4423 0.0361  0.0497  -0.0130 138 ALA F N     
1086 C  CA    . ALA A 139 ? 0.2454 0.2478 0.4195 0.0305  0.0432  -0.0068 138 ALA F CA    
1087 C  C     . ALA A 139 ? 0.2632 0.2698 0.4634 0.0329  0.0376  -0.0074 138 ALA F C     
1088 O  O     . ALA A 139 ? 0.2864 0.2947 0.5023 0.0396  0.0423  -0.0119 138 ALA F O     
1089 C  CB    . ALA A 139 ? 0.2392 0.2507 0.4137 0.0285  0.0525  -0.0024 138 ALA F CB    
1090 N  N     . SER A 140 ? 0.2346 0.2436 0.4389 0.0280  0.0271  -0.0033 139 SER F N     
1091 C  CA    . SER A 140 ? 0.1802 0.1945 0.4083 0.0294  0.0202  -0.0030 139 SER F CA    
1092 C  C     . SER A 140 ? 0.2280 0.2532 0.4674 0.0255  0.0219  0.0004  139 SER F C     
1093 O  O     . SER A 140 ? 0.2177 0.2437 0.4437 0.0218  0.0261  0.0032  139 SER F O     
1094 C  CB    . SER A 140 ? 0.2312 0.2364 0.4525 0.0270  0.0048  -0.0013 139 SER F CB    
1095 O  OG    . SER A 140 ? 0.2180 0.2093 0.4296 0.0304  0.0022  -0.0046 139 SER F OG    
1096 N  N     . ALA A 141 ? 0.1832 0.2162 0.4476 0.0266  0.0180  -0.0001 140 ALA F N     
1097 C  CA    . ALA A 141 ? 0.1760 0.2175 0.4520 0.0221  0.0190  0.0023  140 ALA F CA    
1098 C  C     . ALA A 141 ? 0.2370 0.2828 0.5314 0.0213  0.0060  0.0021  140 ALA F C     
1099 O  O     . ALA A 141 ? 0.1933 0.2394 0.4998 0.0259  -0.0007 0.0000  140 ALA F O     
1100 C  CB    . ALA A 141 ? 0.1499 0.2005 0.4415 0.0225  0.0340  0.0020  140 ALA F CB    
1101 N  N     . GLY A 142 ? 0.2097 0.2577 0.5047 0.0162  0.0016  0.0039  141 GLY F N     
1102 C  CA    . GLY A 142 ? 0.1588 0.2114 0.4705 0.0148  -0.0109 0.0031  141 GLY F CA    
1103 C  C     . GLY A 142 ? 0.1736 0.2338 0.5035 0.0102  -0.0067 0.0029  141 GLY F C     
1104 O  O     . GLY A 142 ? 0.1827 0.2392 0.5019 0.0069  0.0014  0.0048  141 GLY F O     
1105 N  N     . VAL A 143 ? 0.1238 0.1927 0.4790 0.0097  -0.0130 0.0009  142 VAL F N     
1106 C  CA    . VAL A 143 ? 0.1795 0.2532 0.5501 0.0035  -0.0104 0.0006  142 VAL F CA    
1107 C  C     . VAL A 143 ? 0.1793 0.2519 0.5540 0.0009  -0.0271 -0.0015 142 VAL F C     
1108 O  O     . VAL A 143 ? 0.1742 0.2479 0.5523 0.0046  -0.0373 -0.0030 142 VAL F O     
1109 C  CB    . VAL A 143 ? 0.1790 0.2631 0.5693 0.0042  0.0000  -0.0003 142 VAL F CB    
1110 C  CG1   . VAL A 143 ? 0.1739 0.2633 0.5804 -0.0037 0.0030  0.0004  142 VAL F CG1   
1111 C  CG2   . VAL A 143 ? 0.1988 0.2837 0.5820 0.0080  0.0163  0.0009  142 VAL F CG2   
1112 N  N     . ALA A 144 ? 0.1556 0.2246 0.5293 -0.0051 -0.0305 -0.0017 143 ALA F N     
1113 C  CA    . ALA A 144 ? 0.1634 0.2299 0.5373 -0.0074 -0.0469 -0.0047 143 ALA F CA    
1114 C  C     . ALA A 144 ? 0.1897 0.2525 0.5695 -0.0149 -0.0468 -0.0059 143 ALA F C     
1115 O  O     . ALA A 144 ? 0.1909 0.2516 0.5722 -0.0182 -0.0344 -0.0034 143 ALA F O     
1116 C  CB    . ALA A 144 ? 0.1556 0.2156 0.5071 -0.0043 -0.0579 -0.0048 143 ALA F CB    
1117 N  N     . PRO A 145 ? 0.1736 0.2337 0.5558 -0.0179 -0.0609 -0.0097 144 PRO F N     
1118 C  CA    . PRO A 145 ? 0.1589 0.2123 0.5463 -0.0256 -0.0624 -0.0117 144 PRO F CA    
1119 C  C     . PRO A 145 ? 0.1840 0.2236 0.5501 -0.0264 -0.0643 -0.0133 144 PRO F C     
1120 O  O     . PRO A 145 ? 0.2069 0.2354 0.5724 -0.0319 -0.0638 -0.0148 144 PRO F O     
1121 C  CB    . PRO A 145 ? 0.1713 0.2263 0.5661 -0.0273 -0.0782 -0.0162 144 PRO F CB    
1122 C  CG    . PRO A 145 ? 0.2358 0.3015 0.6376 -0.0211 -0.0808 -0.0151 144 PRO F CG    
1123 C  CD    . PRO A 145 ? 0.2072 0.2705 0.5915 -0.0150 -0.0752 -0.0121 144 PRO F CD    
1124 N  N     . VAL A 146 ? 0.1875 0.2231 0.5259 -0.0191 -0.0653 -0.0128 145 VAL F N     
1125 C  CA    . VAL A 146 ? 0.1619 0.1840 0.4688 -0.0159 -0.0651 -0.0144 145 VAL F CA    
1126 C  C     . VAL A 146 ? 0.1703 0.1943 0.4568 -0.0097 -0.0559 -0.0102 145 VAL F C     
1127 O  O     . VAL A 146 ? 0.1854 0.2181 0.4781 -0.0077 -0.0535 -0.0071 145 VAL F O     
1128 C  CB    . VAL A 146 ? 0.1915 0.2086 0.4833 -0.0147 -0.0812 -0.0205 145 VAL F CB    
1129 C  CG1   . VAL A 146 ? 0.2186 0.2334 0.5302 -0.0214 -0.0931 -0.0259 145 VAL F CG1   
1130 C  CG2   . VAL A 146 ? 0.2383 0.2640 0.5222 -0.0106 -0.0882 -0.0189 145 VAL F CG2   
1131 N  N     . LYS A 147 ? 0.1926 0.2079 0.4544 -0.0063 -0.0519 -0.0106 146 LYS F N     
1132 C  CA    . LYS A 147 ? 0.1775 0.1957 0.4210 -0.0014 -0.0433 -0.0067 146 LYS F CA    
1133 C  C     . LYS A 147 ? 0.1783 0.2042 0.4133 0.0005  -0.0490 -0.0056 146 LYS F C     
1134 O  O     . LYS A 147 ? 0.1729 0.2035 0.4096 0.0013  -0.0432 -0.0017 146 LYS F O     
1135 C  CB    . LYS A 147 ? 0.2117 0.2223 0.4314 0.0029  -0.0410 -0.0085 146 LYS F CB    
1136 C  CG    . LYS A 147 ? 0.1842 0.1847 0.4055 0.0027  -0.0323 -0.0067 146 LYS F CG    
1137 C  CD    . LYS A 147 ? 0.1945 0.1882 0.3913 0.0096  -0.0326 -0.0093 146 LYS F CD    
1138 C  CE    . LYS A 147 ? 0.2699 0.2522 0.4627 0.0114  -0.0237 -0.0059 146 LYS F CE    
1139 N  NZ    . LYS A 147 ? 0.3215 0.3001 0.4919 0.0204  -0.0249 -0.0090 146 LYS F NZ    
1140 N  N     . PHE A 148 ? 0.2088 0.2343 0.4309 0.0012  -0.0600 -0.0089 147 PHE F N     
1141 C  CA    . PHE A 148 ? 0.1712 0.2021 0.3787 0.0024  -0.0634 -0.0060 147 PHE F CA    
1142 C  C     . PHE A 148 ? 0.2293 0.2635 0.4535 0.0010  -0.0673 -0.0029 147 PHE F C     
1143 O  O     . PHE A 148 ? 0.1865 0.2222 0.4037 0.0016  -0.0649 0.0012  147 PHE F O     
1144 C  CB    . PHE A 148 ? 0.1766 0.2073 0.3641 0.0032  -0.0733 -0.0094 147 PHE F CB    
1145 C  CG    . PHE A 148 ? 0.2824 0.3119 0.4774 0.0012  -0.0875 -0.0117 147 PHE F CG    
1146 C  CD1   . PHE A 148 ? 0.2140 0.2388 0.4233 -0.0004 -0.0940 -0.0173 147 PHE F CD1   
1147 C  CD2   . PHE A 148 ? 0.2381 0.2701 0.4245 0.0004  -0.0954 -0.0079 147 PHE F CD2   
1148 C  CE1   . PHE A 148 ? 0.2666 0.2914 0.4823 -0.0023 -0.1085 -0.0198 147 PHE F CE1   
1149 C  CE2   . PHE A 148 ? 0.2303 0.2609 0.4216 -0.0006 -0.1097 -0.0096 147 PHE F CE2   
1150 C  CZ    . PHE A 148 ? 0.2610 0.2890 0.4674 -0.0017 -0.1167 -0.0159 147 PHE F CZ    
1151 N  N     . LEU A 149 ? 0.2007 0.2359 0.4489 -0.0007 -0.0730 -0.0051 148 LEU F N     
1152 C  CA    . LEU A 149 ? 0.1598 0.1997 0.4264 0.0000  -0.0768 -0.0029 148 LEU F CA    
1153 C  C     . LEU A 149 ? 0.1939 0.2365 0.4716 0.0016  -0.0633 -0.0002 148 LEU F C     
1154 O  O     . LEU A 149 ? 0.1858 0.2293 0.4667 0.0043  -0.0640 0.0022  148 LEU F O     
1155 C  CB    . LEU A 149 ? 0.1474 0.1915 0.4395 -0.0019 -0.0870 -0.0064 148 LEU F CB    
1156 C  CG    . LEU A 149 ? 0.2236 0.2650 0.5052 -0.0027 -0.1039 -0.0092 148 LEU F CG    
1157 C  CD1   . LEU A 149 ? 0.2025 0.2479 0.5093 -0.0054 -0.1136 -0.0134 148 LEU F CD1   
1158 C  CD2   . LEU A 149 ? 0.2053 0.2451 0.4723 0.0001  -0.1121 -0.0049 148 LEU F CD2   
1159 N  N     . ALA A 150 ? 0.1810 0.2233 0.4631 0.0003  -0.0515 -0.0005 149 ALA F N     
1160 C  CA    . ALA A 150 ? 0.1537 0.1980 0.4408 0.0021  -0.0378 0.0019  149 ALA F CA    
1161 C  C     . ALA A 150 ? 0.1854 0.2257 0.4480 0.0045  -0.0345 0.0045  149 ALA F C     
1162 O  O     . ALA A 150 ? 0.1811 0.2218 0.4461 0.0069  -0.0298 0.0057  149 ALA F O     
1163 C  CB    . ALA A 150 ? 0.1600 0.2026 0.4511 -0.0004 -0.0263 0.0023  149 ALA F CB    
1164 N  N     . LYS A 151 ? 0.1649 0.2021 0.4044 0.0038  -0.0371 0.0047  150 LYS F N     
1165 C  CA    . LYS A 151 ? 0.1573 0.1933 0.3751 0.0045  -0.0344 0.0074  150 LYS F CA    
1166 C  C     . LYS A 151 ? 0.2227 0.2571 0.4368 0.0039  -0.0433 0.0094  150 LYS F C     
1167 O  O     . LYS A 151 ? 0.1981 0.2296 0.4058 0.0041  -0.0402 0.0116  150 LYS F O     
1168 C  CB    . LYS A 151 ? 0.1820 0.2190 0.3792 0.0044  -0.0347 0.0068  150 LYS F CB    
1169 C  CG    . LYS A 151 ? 0.2341 0.2740 0.4108 0.0036  -0.0329 0.0095  150 LYS F CG    
1170 C  CD    . LYS A 151 ? 0.2471 0.2914 0.4087 0.0056  -0.0290 0.0083  150 LYS F CD    
1171 C  CE    . LYS A 151 ? 0.3877 0.4395 0.5317 0.0037  -0.0282 0.0110  150 LYS F CE    
1172 N  NZ    . LYS A 151 ? 0.3935 0.4440 0.5369 0.0031  -0.0213 0.0132  150 LYS F NZ    
1173 N  N     . ILE A 152 ? 0.1735 0.2078 0.3902 0.0031  -0.0552 0.0089  151 ILE F N     
1174 C  CA    . ILE A 152 ? 0.1754 0.2053 0.3893 0.0029  -0.0647 0.0120  151 ILE F CA    
1175 C  C     . ILE A 152 ? 0.2103 0.2382 0.4442 0.0067  -0.0623 0.0117  151 ILE F C     
1176 O  O     . ILE A 152 ? 0.2133 0.2342 0.4406 0.0076  -0.0636 0.0142  151 ILE F O     
1177 C  CB    . ILE A 152 ? 0.1902 0.2200 0.4037 0.0021  -0.0788 0.0114  151 ILE F CB    
1178 C  CG1   . ILE A 152 ? 0.2502 0.2819 0.4390 -0.0007 -0.0804 0.0114  151 ILE F CG1   
1179 C  CG2   . ILE A 152 ? 0.2434 0.2666 0.4569 0.0030  -0.0899 0.0154  151 ILE F CG2   
1180 C  CD1   . ILE A 152 ? 0.2076 0.2393 0.3936 -0.0011 -0.0929 0.0088  151 ILE F CD1   
1181 N  N     . ALA A 153 ? 0.1866 0.2207 0.4456 0.0089  -0.0590 0.0083  152 ALA F N     
1182 C  CA    . ALA A 153 ? 0.2375 0.2737 0.5188 0.0138  -0.0563 0.0070  152 ALA F CA    
1183 C  C     . ALA A 153 ? 0.2405 0.2723 0.5136 0.0159  -0.0444 0.0072  152 ALA F C     
1184 O  O     . ALA A 153 ? 0.2270 0.2551 0.5077 0.0209  -0.0450 0.0064  152 ALA F O     
1185 C  CB    . ALA A 153 ? 0.1742 0.2218 0.4847 0.0140  -0.0524 0.0036  152 ALA F CB    
1186 N  N     . SER A 154 ? 0.1768 0.2082 0.4338 0.0131  -0.0345 0.0079  153 SER F N     
1187 C  CA    . SER A 154 ? 0.1654 0.1929 0.4143 0.0150  -0.0238 0.0075  153 SER F CA    
1188 C  C     . SER A 154 ? 0.2300 0.2466 0.4607 0.0145  -0.0299 0.0093  153 SER F C     
1189 O  O     . SER A 154 ? 0.2733 0.2839 0.5005 0.0173  -0.0244 0.0076  153 SER F O     
1190 C  CB    . SER A 154 ? 0.1980 0.2276 0.4335 0.0125  -0.0134 0.0081  153 SER F CB    
1191 O  OG    . SER A 154 ? 0.2392 0.2673 0.4530 0.0088  -0.0181 0.0104  153 SER F OG    
1192 N  N     . ASP A 155 ? 0.2554 0.2686 0.4740 0.0105  -0.0413 0.0127  154 ASP F N     
1193 C  CA    . ASP A 155 ? 0.3710 0.3723 0.5732 0.0082  -0.0484 0.0159  154 ASP F CA    
1194 C  C     . ASP A 155 ? 0.4970 0.4886 0.7110 0.0133  -0.0574 0.0157  154 ASP F C     
1195 O  O     . ASP A 155 ? 0.5271 0.5044 0.7290 0.0125  -0.0621 0.0178  154 ASP F O     
1196 C  CB    . ASP A 155 ? 0.3493 0.3515 0.5327 0.0012  -0.0562 0.0207  154 ASP F CB    
1197 C  CG    . ASP A 155 ? 0.4746 0.4830 0.6404 -0.0038 -0.0490 0.0216  154 ASP F CG    
1198 O  OD1   . ASP A 155 ? 0.6442 0.6528 0.8091 -0.0024 -0.0397 0.0193  154 ASP F OD1   
1199 O  OD2   . ASP A 155 ? 0.6221 0.6363 0.7747 -0.0085 -0.0527 0.0244  154 ASP F OD2   
1200 N  N     . MET A 156 ? 0.3586 0.3570 0.5964 0.0187  -0.0607 0.0133  155 MET F N     
1201 C  CA    . MET A 156 ? 0.3869 0.3775 0.6355 0.0243  -0.0728 0.0139  155 MET F CA    
1202 C  C     . MET A 156 ? 0.3974 0.3791 0.6537 0.0322  -0.0689 0.0102  155 MET F C     
1203 O  O     . MET A 156 ? 0.4184 0.3853 0.6722 0.0362  -0.0795 0.0118  155 MET F O     
1204 C  CB    . MET A 156 ? 0.4531 0.4569 0.7275 0.0277  -0.0782 0.0118  155 MET F CB    
1205 C  CG    . MET A 156 ? 0.5593 0.5588 0.8271 0.0257  -0.0952 0.0160  155 MET F CG    
1206 S  SD    . MET A 156 ? 0.5518 0.5657 0.8233 0.0203  -0.0975 0.0147  155 MET F SD    
1207 C  CE    . MET A 156 ? 0.7439 0.7463 0.9794 0.0134  -0.1086 0.0217  155 MET F CE    
1208 N  N     . ASN A 157 ? 0.3140 0.3030 0.5781 0.0351  -0.0541 0.0052  156 ASN F N     
1209 C  CA    . ASN A 157 ? 0.3580 0.3412 0.6305 0.0440  -0.0482 -0.0002 156 ASN F CA    
1210 C  C     . ASN A 157 ? 0.3358 0.3117 0.5873 0.0412  -0.0372 -0.0021 156 ASN F C     
1211 O  O     . ASN A 157 ? 0.4074 0.3851 0.6656 0.0478  -0.0262 -0.0079 156 ASN F O     
1212 C  CB    . ASN A 157 ? 0.4561 0.4581 0.7610 0.0515  -0.0400 -0.0054 156 ASN F CB    
1213 C  CG    . ASN A 157 ? 0.4665 0.4661 0.7888 0.0627  -0.0451 -0.0098 156 ASN F CG    
1214 O  OD1   . ASN A 157 ? 0.3989 0.3812 0.7118 0.0656  -0.0585 -0.0079 156 ASN F OD1   
1215 N  ND2   . ASN A 157 ? 0.4003 0.4170 0.7410 0.0670  -0.0336 -0.0151 156 ASN F ND2   
1216 N  N     . LYS A 158 ? 0.2989 0.2681 0.5251 0.0316  -0.0399 0.0026  157 LYS F N     
1217 C  CA    . LYS A 158 ? 0.2971 0.2592 0.5026 0.0282  -0.0321 0.0010  157 LYS F CA    
1218 C  C     . LYS A 158 ? 0.2674 0.2070 0.4608 0.0301  -0.0391 -0.0006 157 LYS F C     
1219 O  O     . LYS A 158 ? 0.3294 0.2572 0.5223 0.0299  -0.0519 0.0030  157 LYS F O     
1220 C  CB    A LYS A 158 ? 0.3182 0.2866 0.5052 0.0177  -0.0314 0.0059  157 LYS F CB    
1221 C  CB    B LYS A 158 ? 0.3223 0.2883 0.5076 0.0172  -0.0334 0.0064  157 LYS F CB    
1222 C  CG    A LYS A 158 ? 0.3641 0.3248 0.5342 0.0090  -0.0432 0.0123  157 LYS F CG    
1223 C  CG    B LYS A 158 ? 0.3587 0.3421 0.5472 0.0149  -0.0253 0.0072  157 LYS F CG    
1224 C  CD    A LYS A 158 ? 0.2677 0.2417 0.4251 0.0012  -0.0392 0.0154  157 LYS F CD    
1225 C  CD    B LYS A 158 ? 0.3151 0.3012 0.4821 0.0060  -0.0268 0.0113  157 LYS F CD    
1226 C  CE    A LYS A 158 ? 0.4050 0.3756 0.5441 -0.0089 -0.0480 0.0218  157 LYS F CE    
1227 C  CE    B LYS A 158 ? 0.3792 0.3777 0.5439 0.0059  -0.0164 0.0105  157 LYS F CE    
1228 N  NZ    A LYS A 158 ? 0.3398 0.3082 0.4822 -0.0097 -0.0586 0.0263  157 LYS F NZ    
1229 N  NZ    B LYS A 158 ? 0.1605 0.1557 0.3187 0.0087  -0.0069 0.0068  157 LYS F NZ    
1230 N  N     . PRO A 159 ? 0.2824 0.2139 0.4644 0.0318  -0.0316 -0.0059 158 PRO F N     
1231 C  CA    . PRO A 159 ? 0.3089 0.2517 0.4885 0.0330  -0.0166 -0.0101 158 PRO F CA    
1232 C  C     . PRO A 159 ? 0.2842 0.2357 0.4847 0.0446  -0.0058 -0.0166 158 PRO F C     
1233 O  O     . PRO A 159 ? 0.2772 0.2233 0.4929 0.0535  -0.0100 -0.0202 158 PRO F O     
1234 C  CB    . PRO A 159 ? 0.3261 0.2522 0.4812 0.0296  -0.0171 -0.0130 158 PRO F CB    
1235 C  CG    . PRO A 159 ? 0.3117 0.2155 0.4661 0.0335  -0.0281 -0.0149 158 PRO F CG    
1236 C  CD    . PRO A 159 ? 0.2805 0.1868 0.4470 0.0319  -0.0392 -0.0079 158 PRO F CD    
1237 N  N     . ASN A 160 ? 0.2992 0.2643 0.5001 0.0445  0.0081  -0.0179 159 ASN F N     
1238 C  CA    . ASN A 160 ? 0.3122 0.2872 0.5289 0.0538  0.0217  -0.0238 159 ASN F CA    
1239 C  C     . ASN A 160 ? 0.3420 0.3292 0.5910 0.0598  0.0195  -0.0241 159 ASN F C     
1240 O  O     . ASN A 160 ? 0.2984 0.2879 0.5636 0.0704  0.0238  -0.0304 159 ASN F O     
1241 C  CB    . ASN A 160 ? 0.3856 0.3455 0.5895 0.0614  0.0257  -0.0322 159 ASN F CB    
1242 C  CG    . ASN A 160 ? 0.4238 0.3959 0.6357 0.0693  0.0437  -0.0380 159 ASN F CG    
1243 O  OD1   . ASN A 160 ? 0.3404 0.3313 0.5654 0.0671  0.0535  -0.0345 159 ASN F OD1   
1244 N  ND2   . ASN A 160 ? 0.4649 0.4255 0.6678 0.0783  0.0481  -0.0471 159 ASN F ND2   
1245 N  N     . GLY A 161 ? 0.2821 0.2785 0.5411 0.0535  0.0126  -0.0179 160 GLY F N     
1246 C  CA    . GLY A 161 ? 0.2844 0.2936 0.5741 0.0578  0.0084  -0.0180 160 GLY F CA    
1247 C  C     . GLY A 161 ? 0.3257 0.3493 0.6245 0.0498  0.0085  -0.0127 160 GLY F C     
1248 O  O     . GLY A 161 ? 0.2197 0.2420 0.5003 0.0420  0.0112  -0.0089 160 GLY F O     
1249 N  N     . GLN A 162 ? 0.2822 0.3193 0.6098 0.0520  0.0044  -0.0129 161 GLN F N     
1250 C  CA    . GLN A 162 ? 0.2138 0.2620 0.5501 0.0441  0.0025  -0.0088 161 GLN F CA    
1251 C  C     . GLN A 162 ? 0.2224 0.2745 0.5736 0.0440  -0.0121 -0.0084 161 GLN F C     
1252 O  O     . GLN A 162 ? 0.2599 0.3092 0.6176 0.0507  -0.0186 -0.0111 161 GLN F O     
1253 C  CB    . GLN A 162 ? 0.2058 0.2681 0.5529 0.0412  0.0189  -0.0092 161 GLN F CB    
1254 C  CG    . GLN A 162 ? 0.2665 0.3405 0.6314 0.0460  0.0270  -0.0134 161 GLN F CG    
1255 C  CD    . GLN A 162 ? 0.2908 0.3771 0.6624 0.0410  0.0433  -0.0119 161 GLN F CD    
1256 O  OE1   . GLN A 162 ? 0.2675 0.3508 0.6254 0.0407  0.0560  -0.0111 161 GLN F OE1   
1257 N  NE2   . GLN A 162 ? 0.3041 0.4034 0.6963 0.0366  0.0425  -0.0112 161 GLN F NE2   
1258 N  N     . PHE A 163 ? 0.1730 0.2300 0.5265 0.0366  -0.0179 -0.0054 162 PHE F N     
1259 C  CA    . PHE A 163 ? 0.1635 0.2224 0.5260 0.0354  -0.0328 -0.0050 162 PHE F CA    
1260 C  C     . PHE A 163 ? 0.2085 0.2771 0.5807 0.0277  -0.0314 -0.0045 162 PHE F C     
1261 O  O     . PHE A 163 ? 0.2053 0.2723 0.5676 0.0224  -0.0268 -0.0024 162 PHE F O     
1262 C  CB    . PHE A 163 ? 0.2131 0.2591 0.5583 0.0348  -0.0484 -0.0013 162 PHE F CB    
1263 C  CG    . PHE A 163 ? 0.2979 0.3433 0.6487 0.0353  -0.0645 -0.0009 162 PHE F CG    
1264 C  CD1   . PHE A 163 ? 0.3703 0.4135 0.7301 0.0426  -0.0704 -0.0029 162 PHE F CD1   
1265 C  CD2   . PHE A 163 ? 0.3372 0.3837 0.6829 0.0292  -0.0742 0.0010  162 PHE F CD2   
1266 C  CE1   . PHE A 163 ? 0.4663 0.5090 0.8307 0.0435  -0.0856 -0.0022 162 PHE F CE1   
1267 C  CE2   . PHE A 163 ? 0.3450 0.3903 0.6940 0.0299  -0.0893 0.0011  162 PHE F CE2   
1268 C  CZ    . PHE A 163 ? 0.4271 0.4706 0.7856 0.0369  -0.0950 -0.0001 162 PHE F CZ    
1269 N  N     . VAL A 164 ? 0.1816 0.2592 0.5728 0.0276  -0.0363 -0.0066 163 VAL F N     
1270 C  CA    . VAL A 164 ? 0.1910 0.2768 0.5945 0.0203  -0.0356 -0.0068 163 VAL F CA    
1271 C  C     . VAL A 164 ? 0.2522 0.3360 0.6571 0.0186  -0.0536 -0.0072 163 VAL F C     
1272 O  O     . VAL A 164 ? 0.2219 0.3073 0.6343 0.0237  -0.0631 -0.0085 163 VAL F O     
1273 C  CB    . VAL A 164 ? 0.1906 0.2916 0.6178 0.0206  -0.0243 -0.0089 163 VAL F CB    
1274 C  CG1   . VAL A 164 ? 0.1974 0.3049 0.6370 0.0117  -0.0240 -0.0084 163 VAL F CG1   
1275 C  CG2   . VAL A 164 ? 0.2572 0.3600 0.6801 0.0233  -0.0062 -0.0088 163 VAL F CG2   
1276 N  N     . ILE A 165 ? 0.1982 0.2784 0.5959 0.0120  -0.0584 -0.0065 164 ILE F N     
1277 C  CA    . ILE A 165 ? 0.1739 0.2524 0.5716 0.0097  -0.0749 -0.0078 164 ILE F CA    
1278 C  C     . ILE A 165 ? 0.2466 0.3329 0.6620 0.0031  -0.0728 -0.0099 164 ILE F C     
1279 O  O     . ILE A 165 ? 0.1858 0.2694 0.5974 -0.0024 -0.0656 -0.0093 164 ILE F O     
1280 C  CB    . ILE A 165 ? 0.1744 0.2414 0.5463 0.0080  -0.0842 -0.0061 164 ILE F CB    
1281 C  CG1   . ILE A 165 ? 0.2059 0.2654 0.5609 0.0132  -0.0861 -0.0029 164 ILE F CG1   
1282 C  CG2   . ILE A 165 ? 0.2134 0.2781 0.5822 0.0062  -0.1012 -0.0079 164 ILE F CG2   
1283 C  CD1   . ILE A 165 ? 0.2028 0.2546 0.5322 0.0107  -0.0910 -0.0004 164 ILE F CD1   
1284 N  N     . THR A 166 ? 0.2176 0.3185 0.6105 0.0153  -0.0829 -0.0378 165 THR F N     
1285 C  CA    . THR A 166 ? 0.1641 0.2712 0.5609 0.0130  -0.0806 -0.0355 165 THR F CA    
1286 C  C     . THR A 166 ? 0.1909 0.2817 0.5808 0.0106  -0.0890 -0.0284 165 THR F C     
1287 O  O     . THR A 166 ? 0.2065 0.2811 0.5917 0.0110  -0.0986 -0.0262 165 THR F O     
1288 C  CB    . THR A 166 ? 0.2066 0.3201 0.6226 0.0156  -0.0834 -0.0430 165 THR F CB    
1289 O  OG1   . THR A 166 ? 0.2562 0.3526 0.6789 0.0180  -0.0968 -0.0445 165 THR F OG1   
1290 C  CG2   . THR A 166 ? 0.2097 0.3403 0.6345 0.0181  -0.0753 -0.0514 165 THR F CG2   
1291 N  N     . PRO A 167 ? 0.2616 0.3562 0.6516 0.0075  -0.0865 -0.0248 166 PRO F N     
1292 C  CA    . PRO A 167 ? 0.1906 0.2698 0.5756 0.0051  -0.0954 -0.0192 166 PRO F CA    
1293 C  C     . PRO A 167 ? 0.1838 0.2494 0.5760 0.0067  -0.1096 -0.0209 166 PRO F C     
1294 O  O     . PRO A 167 ? 0.2346 0.2846 0.6184 0.0051  -0.1192 -0.0163 166 PRO F O     
1295 C  CB    . PRO A 167 ? 0.2750 0.3629 0.6641 0.0019  -0.0901 -0.0171 166 PRO F CB    
1296 C  CG    . PRO A 167 ? 0.3100 0.4161 0.6978 0.0015  -0.0764 -0.0179 166 PRO F CG    
1297 C  CD    . PRO A 167 ? 0.2438 0.3564 0.6368 0.0054  -0.0753 -0.0246 166 PRO F CD    
1298 N  N     . ALA A 168 ? 0.2470 0.3185 0.6548 0.0096  -0.1116 -0.0273 167 ALA F N     
1299 C  CA    . ALA A 168 ? 0.2577 0.3160 0.6737 0.0114  -0.1259 -0.0287 167 ALA F CA    
1300 C  C     . ALA A 168 ? 0.2577 0.3016 0.6666 0.0129  -0.1334 -0.0275 167 ALA F C     
1301 O  O     . ALA A 168 ? 0.2909 0.3183 0.6974 0.0122  -0.1470 -0.0239 167 ALA F O     
1302 C  CB    . ALA A 168 ? 0.3141 0.3833 0.7509 0.0147  -0.1256 -0.0365 167 ALA F CB    
1303 N  N     . GLU A 169 ? 0.2193 0.2689 0.6238 0.0144  -0.1254 -0.0297 168 GLU F N     
1304 C  CA    . GLU A 169 ? 0.2590 0.2962 0.6582 0.0155  -0.1317 -0.0289 168 GLU F CA    
1305 C  C     . GLU A 169 ? 0.2333 0.2605 0.6135 0.0118  -0.1332 -0.0204 168 GLU F C     
1306 O  O     . GLU A 169 ? 0.2292 0.2444 0.6041 0.0118  -0.1402 -0.0182 168 GLU F O     
1307 C  CB    . GLU A 169 ? 0.2867 0.3355 0.6914 0.0186  -0.1228 -0.0360 168 GLU F CB    
1308 C  CG    . GLU A 169 ? 0.3482 0.4055 0.7733 0.0226  -0.1228 -0.0456 168 GLU F CG    
1309 C  CD    . GLU A 169 ? 0.5427 0.6153 0.9720 0.0249  -0.1119 -0.0532 168 GLU F CD    
1310 O  OE1   . GLU A 169 ? 0.4899 0.5729 0.9071 0.0228  -0.1011 -0.0505 168 GLU F OE1   
1311 O  OE2   . GLU A 169 ? 0.5921 0.6663 1.0373 0.0288  -0.1145 -0.0620 168 GLU F OE2   
1312 N  N     . VAL A 170 ? 0.1944 0.2261 0.5654 0.0086  -0.1272 -0.0157 169 VAL F N     
1313 C  CA    . VAL A 170 ? 0.2094 0.2345 0.5643 0.0053  -0.1269 -0.0086 169 VAL F CA    
1314 C  C     . VAL A 170 ? 0.2003 0.2063 0.5475 0.0029  -0.1420 -0.0030 169 VAL F C     
1315 O  O     . VAL A 170 ? 0.2728 0.2713 0.6101 0.0014  -0.1449 0.0012  169 VAL F O     
1316 C  CB    . VAL A 170 ? 0.2151 0.2493 0.5651 0.0026  -0.1173 -0.0057 169 VAL F CB    
1317 C  CG1   . VAL A 170 ? 0.2053 0.2311 0.5416 -0.0011 -0.1195 0.0014  169 VAL F CG1   
1318 C  CG2   . VAL A 170 ? 0.1635 0.2155 0.5154 0.0040  -0.1024 -0.0087 169 VAL F CG2   
1319 N  N     . PRO A 171 ? 0.2365 0.2341 0.5863 0.0017  -0.1526 -0.0018 170 PRO F N     
1320 C  CA    . PRO A 171 ? 0.2424 0.2214 0.5812 -0.0017 -0.1681 0.0047  170 PRO F CA    
1321 C  C     . PRO A 171 ? 0.2384 0.2063 0.5772 -0.0006 -0.1765 0.0057  170 PRO F C     
1322 O  O     . PRO A 171 ? 0.2752 0.2318 0.5996 -0.0042 -0.1830 0.0124  170 PRO F O     
1323 C  CB    . PRO A 171 ? 0.2481 0.2228 0.5933 -0.0023 -0.1774 0.0042  170 PRO F CB    
1324 C  CG    . PRO A 171 ? 0.2821 0.2722 0.6341 -0.0019 -0.1654 0.0006  170 PRO F CG    
1325 C  CD    . PRO A 171 ? 0.2925 0.2974 0.6520 0.0018  -0.1510 -0.0046 170 PRO F CD    
1326 N  N     . ALA A 172 ? 0.2710 0.2413 0.6260 0.0039  -0.1773 -0.0008 171 ALA F N     
1327 C  CA    . ALA A 172 ? 0.2855 0.2444 0.6433 0.0048  -0.1859 -0.0007 171 ALA F CA    
1328 C  C     . ALA A 172 ? 0.2873 0.2496 0.6378 0.0046  -0.1779 0.0001  171 ALA F C     
1329 O  O     . ALA A 172 ? 0.3183 0.2676 0.6613 0.0022  -0.1863 0.0052  171 ALA F O     
1330 C  CB    . ALA A 172 ? 0.3154 0.2784 0.6951 0.0099  -0.1870 -0.0096 171 ALA F CB    
1331 N  N     . PHE A 173 ? 0.2604 0.2402 0.6122 0.0064  -0.1622 -0.0041 172 PHE F N     
1332 C  CA    . PHE A 173 ? 0.3199 0.3047 0.6656 0.0061  -0.1544 -0.0036 172 PHE F CA    
1333 C  C     . PHE A 173 ? 0.3310 0.3076 0.6588 0.0009  -0.1577 0.0063  172 PHE F C     
1334 O  O     . PHE A 173 ? 0.2797 0.2497 0.6020 -0.0008 -0.1611 0.0099  172 PHE F O     
1335 C  CB    . PHE A 173 ? 0.2696 0.2750 0.6187 0.0083  -0.1375 -0.0091 172 PHE F CB    
1336 C  CG    . PHE A 173 ? 0.2613 0.2733 0.6059 0.0084  -0.1296 -0.0096 172 PHE F CG    
1337 C  CD1   . PHE A 173 ? 0.3343 0.3471 0.6885 0.0116  -0.1303 -0.0163 172 PHE F CD1   
1338 C  CD2   . PHE A 173 ? 0.2424 0.2595 0.5745 0.0053  -0.1224 -0.0036 172 PHE F CD2   
1339 C  CE1   . PHE A 173 ? 0.3451 0.3641 0.6953 0.0113  -0.1240 -0.0169 172 PHE F CE1   
1340 C  CE2   . PHE A 173 ? 0.2476 0.2712 0.5760 0.0051  -0.1157 -0.0037 172 PHE F CE2   
1341 C  CZ    . PHE A 173 ? 0.2389 0.2635 0.5758 0.0079  -0.1167 -0.0102 172 PHE F CZ    
1342 N  N     . LEU A 174 ? 0.2752 0.2526 0.5950 -0.0022 -0.1573 0.0105  173 LEU F N     
1343 C  CA    . LEU A 174 ? 0.2385 0.2103 0.5420 -0.0078 -0.1600 0.0189  173 LEU F CA    
1344 C  C     . LEU A 174 ? 0.2860 0.2383 0.5785 -0.0122 -0.1766 0.0262  173 LEU F C     
1345 O  O     . LEU A 174 ? 0.2822 0.2300 0.5611 -0.0174 -0.1789 0.0330  173 LEU F O     
1346 C  CB    . LEU A 174 ? 0.2214 0.1969 0.5206 -0.0104 -0.1578 0.0203  173 LEU F CB    
1347 C  CG    . LEU A 174 ? 0.2620 0.2550 0.5677 -0.0084 -0.1419 0.0164  173 LEU F CG    
1348 C  CD1   . LEU A 174 ? 0.2543 0.2464 0.5595 -0.0109 -0.1442 0.0168  173 LEU F CD1   
1349 C  CD2   . LEU A 174 ? 0.1999 0.2007 0.4992 -0.0102 -0.1320 0.0199  173 LEU F CD2   
1350 N  N     . GLN A 175 ? 0.3394 0.2801 0.6366 -0.0112 -0.1885 0.0255  174 GLN F N     
1351 C  CA    . GLN A 175 ? 0.3546 0.2758 0.6371 -0.0171 -0.2054 0.0342  174 GLN F CA    
1352 C  C     . GLN A 175 ? 0.3485 0.2606 0.6219 -0.0206 -0.2101 0.0405  174 GLN F C     
1353 O  O     . GLN A 175 ? 0.4057 0.3073 0.6587 -0.0282 -0.2181 0.0498  174 GLN F O     
1354 C  CB    . GLN A 175 ? 0.3855 0.2965 0.6781 -0.0151 -0.2170 0.0322  174 GLN F CB    
1355 C  CG    . GLN A 175 ? 0.3844 0.2752 0.6594 -0.0221 -0.2349 0.0419  174 GLN F CG    
1356 C  CD    . GLN A 175 ? 0.4722 0.3622 0.7287 -0.0276 -0.2371 0.0461  174 GLN F CD    
1357 O  OE1   . GLN A 175 ? 0.4545 0.3570 0.7183 -0.0250 -0.2286 0.0405  174 GLN F OE1   
1358 N  NE2   . GLN A 175 ? 0.5211 0.3959 0.7524 -0.0364 -0.2487 0.0558  174 GLN F NE2   
1359 N  N     . THR A 176 ? 0.3226 0.2382 0.6099 -0.0162 -0.2056 0.0354  175 THR F N     
1360 C  CA    . THR A 176 ? 0.3183 0.2254 0.5999 -0.0195 -0.2102 0.0408  175 THR F CA    
1361 C  C     . THR A 176 ? 0.2833 0.2059 0.5673 -0.0178 -0.1958 0.0382  175 THR F C     
1362 O  O     . THR A 176 ? 0.3004 0.2190 0.5842 -0.0194 -0.1977 0.0407  175 THR F O     
1363 C  CB    . THR A 176 ? 0.4544 0.3506 0.7502 -0.0172 -0.2197 0.0373  175 THR F CB    
1364 O  OG1   . THR A 176 ? 0.4747 0.3848 0.7915 -0.0093 -0.2089 0.0250  175 THR F OG1   
1365 C  CG2   . THR A 176 ? 0.4741 0.3561 0.7698 -0.0194 -0.2344 0.0397  175 THR F CG2   
1366 N  N     . LEU A 177 ? 0.2552 0.1954 0.5420 -0.0153 -0.1818 0.0336  176 LEU F N     
1367 C  CA    . LEU A 177 ? 0.2629 0.2188 0.5514 -0.0144 -0.1677 0.0315  176 LEU F CA    
1368 C  C     . LEU A 177 ? 0.3077 0.2609 0.5807 -0.0226 -0.1691 0.0409  176 LEU F C     
1369 O  O     . LEU A 177 ? 0.3035 0.2516 0.5568 -0.0274 -0.1656 0.0454  176 LEU F O     
1370 C  CB    . LEU A 177 ? 0.2649 0.2381 0.5582 -0.0112 -0.1536 0.0260  176 LEU F CB    
1371 C  CG    . LEU A 177 ? 0.3226 0.3126 0.6152 -0.0114 -0.1385 0.0255  176 LEU F CG    
1372 C  CD1   . LEU A 177 ? 0.3371 0.3331 0.6376 -0.0079 -0.1335 0.0199  176 LEU F CD1   
1373 C  CD2   . LEU A 177 ? 0.2856 0.2889 0.5812 -0.0092 -0.1270 0.0222  176 LEU F CD2   
1374 N  N     . PRO A 178 ? 0.2967 0.2481 0.5673 -0.0244 -0.1672 0.0428  177 PRO F N     
1375 C  CA    . PRO A 178 ? 0.2391 0.1842 0.4846 -0.0322 -0.1602 0.0509  177 PRO F CA    
1376 C  C     . PRO A 178 ? 0.2643 0.2239 0.5025 -0.0324 -0.1427 0.0499  177 PRO F C     
1377 O  O     . PRO A 178 ? 0.2783 0.2554 0.5320 -0.0270 -0.1336 0.0438  177 PRO F O     
1378 C  CB    . PRO A 178 ? 0.3230 0.2682 0.5752 -0.0327 -0.1608 0.0508  177 PRO F CB    
1379 C  CG    . PRO A 178 ? 0.3302 0.2730 0.6065 -0.0263 -0.1732 0.0442  177 PRO F CG    
1380 C  CD    . PRO A 178 ? 0.2507 0.2027 0.5374 -0.0194 -0.1693 0.0369  177 PRO F CD    
1381 N  N     . LEU A 179 ? 0.2798 0.2317 0.4941 -0.0389 -0.1382 0.0562  178 LEU F N     
1382 C  CA    . LEU A 179 ? 0.2763 0.2402 0.4844 -0.0389 -0.1218 0.0554  178 LEU F CA    
1383 C  C     . LEU A 179 ? 0.2286 0.2078 0.4451 -0.0373 -0.1104 0.0545  178 LEU F C     
1384 O  O     . LEU A 179 ? 0.2547 0.2495 0.4794 -0.0334 -0.0990 0.0514  178 LEU F O     
1385 C  CB    . LEU A 179 ? 0.3099 0.2622 0.4908 -0.0466 -0.1188 0.0614  178 LEU F CB    
1386 C  CG    . LEU A 179 ? 0.2785 0.2173 0.4506 -0.0483 -0.1300 0.0614  178 LEU F CG    
1387 C  CD1   . LEU A 179 ? 0.3474 0.2725 0.4892 -0.0575 -0.1292 0.0673  178 LEU F CD1   
1388 C  CD2   . LEU A 179 ? 0.2749 0.2238 0.4588 -0.0428 -0.1247 0.0547  178 LEU F CD2   
1389 N  N     . ALA A 180 ? 0.2479 0.2228 0.4629 -0.0405 -0.1141 0.0576  179 ALA F N     
1390 C  CA    . ALA A 180 ? 0.2930 0.2823 0.5149 -0.0401 -0.1043 0.0571  179 ALA F CA    
1391 C  C     . ALA A 180 ? 0.2444 0.2504 0.4887 -0.0326 -0.1017 0.0492  179 ALA F C     
1392 O  O     . ALA A 180 ? 0.2843 0.3056 0.5342 -0.0316 -0.0920 0.0483  179 ALA F O     
1393 C  CB    . ALA A 180 ? 0.3595 0.3391 0.5766 -0.0457 -0.1108 0.0615  179 ALA F CB    
1394 N  N     . LYS A 181 ? 0.2414 0.2458 0.4988 -0.0277 -0.1101 0.0435  180 LYS F N     
1395 C  CA    . LYS A 181 ? 0.1925 0.2142 0.4703 -0.0213 -0.1064 0.0354  180 LYS F CA    
1396 C  C     . LYS A 181 ? 0.1909 0.2269 0.4702 -0.0190 -0.0947 0.0350  180 LYS F C     
1397 O  O     . LYS A 181 ? 0.2497 0.2999 0.5359 -0.0150 -0.0865 0.0302  180 LYS F O     
1398 C  CB    . LYS A 181 ? 0.2373 0.2525 0.5273 -0.0164 -0.1170 0.0289  180 LYS F CB    
1399 C  CG    . LYS A 181 ? 0.3715 0.3748 0.6660 -0.0164 -0.1276 0.0269  180 LYS F CG    
1400 C  CD    . LYS A 181 ? 0.5047 0.5189 0.8045 -0.0148 -0.1201 0.0215  180 LYS F CD    
1401 C  CE    . LYS A 181 ? 0.6417 0.6451 0.9510 -0.0125 -0.1300 0.0158  180 LYS F CE    
1402 N  NZ    . LYS A 181 ? 0.6753 0.6872 0.9966 -0.0053 -0.1252 0.0035  180 LYS F NZ    
1403 N  N     . ILE A 182 ? 0.2400 0.2690 0.5061 -0.0213 -0.0918 0.0394  181 ILE F N     
1404 C  CA    . ILE A 182 ? 0.1844 0.2249 0.4527 -0.0192 -0.0809 0.0394  181 ILE F CA    
1405 C  C     . ILE A 182 ? 0.1657 0.2189 0.4326 -0.0199 -0.0693 0.0427  181 ILE F C     
1406 O  O     . ILE A 182 ? 0.1991 0.2468 0.4537 -0.0242 -0.0671 0.0474  181 ILE F O     
1407 C  CB    . ILE A 182 ? 0.2028 0.2308 0.4568 -0.0217 -0.0809 0.0423  181 ILE F CB    
1408 C  CG1   . ILE A 182 ? 0.3000 0.3160 0.5560 -0.0214 -0.0941 0.0396  181 ILE F CG1   
1409 C  CG2   . ILE A 182 ? 0.2022 0.2405 0.4600 -0.0195 -0.0700 0.0421  181 ILE F CG2   
1410 C  CD1   . ILE A 182 ? 0.2622 0.2626 0.4991 -0.0259 -0.0968 0.0426  181 ILE F CD1   
1411 N  N     . PRO A 183 ? 0.2081 0.2790 0.4873 -0.0166 -0.0621 0.0409  182 PRO F N     
1412 C  CA    . PRO A 183 ? 0.2583 0.3412 0.5357 -0.0172 -0.0517 0.0450  182 PRO F CA    
1413 C  C     . PRO A 183 ? 0.1691 0.2471 0.4368 -0.0188 -0.0447 0.0503  182 PRO F C     
1414 O  O     . PRO A 183 ? 0.2425 0.3163 0.5095 -0.0173 -0.0431 0.0497  182 PRO F O     
1415 C  CB    . PRO A 183 ? 0.3221 0.4146 0.5977 -0.0127 -0.0444 0.0409  182 PRO F CB    
1416 C  CG    . PRO A 183 ? 0.2810 0.3691 0.5600 -0.0104 -0.0509 0.0334  182 PRO F CG    
1417 C  CD    . PRO A 183 ? 0.2566 0.3312 0.5388 -0.0118 -0.0605 0.0343  182 PRO F CD    
1418 N  N     . GLY A 184 ? 0.1543 0.2327 0.4144 -0.0219 -0.0401 0.0547  183 GLY F N     
1419 C  CA    . GLY A 184 ? 0.2471 0.3203 0.4968 -0.0236 -0.0326 0.0584  183 GLY F CA    
1420 C  C     . GLY A 184 ? 0.2492 0.3055 0.4814 -0.0291 -0.0367 0.0597  183 GLY F C     
1421 O  O     . GLY A 184 ? 0.2363 0.2902 0.4587 -0.0318 -0.0293 0.0625  183 GLY F O     
1422 N  N     . VAL A 185 ? 0.2381 0.2830 0.4667 -0.0309 -0.0482 0.0578  184 VAL F N     
1423 C  CA    . VAL A 185 ? 0.2354 0.2640 0.4470 -0.0371 -0.0542 0.0606  184 VAL F CA    
1424 C  C     . VAL A 185 ? 0.2046 0.2364 0.4190 -0.0401 -0.0569 0.0629  184 VAL F C     
1425 O  O     . VAL A 185 ? 0.2436 0.2746 0.4673 -0.0386 -0.0658 0.0601  184 VAL F O     
1426 C  CB    . VAL A 185 ? 0.2393 0.2525 0.4464 -0.0374 -0.0668 0.0582  184 VAL F CB    
1427 C  CG1   . VAL A 185 ? 0.2925 0.2884 0.4808 -0.0449 -0.0742 0.0628  184 VAL F CG1   
1428 C  CG2   . VAL A 185 ? 0.2711 0.2824 0.4769 -0.0348 -0.0640 0.0553  184 VAL F CG2   
1429 N  N     . GLY A 186 ? 0.2119 0.2480 0.4198 -0.0444 -0.0489 0.0675  185 GLY F N     
1430 C  CA    . GLY A 186 ? 0.2834 0.3232 0.4941 -0.0483 -0.0507 0.0702  185 GLY F CA    
1431 C  C     . GLY A 186 ? 0.2389 0.2623 0.4330 -0.0566 -0.0566 0.0751  185 GLY F C     
1432 O  O     . GLY A 186 ? 0.2848 0.2928 0.4650 -0.0592 -0.0619 0.0761  185 GLY F O     
1433 N  N     . LYS A 187 ? 0.2935 0.3205 0.4887 -0.0617 -0.0561 0.0787  186 LYS F N     
1434 C  CA    . LYS A 187 ? 0.3189 0.3304 0.4999 -0.0706 -0.0628 0.0845  186 LYS F CA    
1435 C  C     . LYS A 187 ? 0.3336 0.3376 0.4939 -0.0765 -0.0565 0.0890  186 LYS F C     
1436 O  O     . LYS A 187 ? 0.3463 0.3325 0.4903 -0.0822 -0.0648 0.0925  186 LYS F O     
1437 C  CB    . LYS A 187 ? 0.4440 0.4633 0.6312 -0.0757 -0.0612 0.0877  186 LYS F CB    
1438 C  CG    . LYS A 187 ? 0.7195 0.7450 0.9248 -0.0715 -0.0679 0.0826  186 LYS F CG    
1439 C  CD    . LYS A 187 ? 0.9006 0.9094 1.1042 -0.0768 -0.0814 0.0843  186 LYS F CD    
1440 C  CE    . LYS A 187 ? 0.9196 0.9222 1.1352 -0.0698 -0.0926 0.0767  186 LYS F CE    
1441 N  NZ    . LYS A 187 ? 0.8687 0.8908 1.1009 -0.0619 -0.0870 0.0687  186 LYS F NZ    
1442 N  N     . VAL A 188 ? 0.2791 0.2967 0.4396 -0.0757 -0.0420 0.0889  187 VAL F N     
1443 C  CA    . VAL A 188 ? 0.3903 0.4031 0.5317 -0.0813 -0.0336 0.0915  187 VAL F CA    
1444 C  C     . VAL A 188 ? 0.3894 0.3887 0.5185 -0.0794 -0.0379 0.0882  187 VAL F C     
1445 O  O     . VAL A 188 ? 0.3820 0.3667 0.4894 -0.0867 -0.0412 0.0914  187 VAL F O     
1446 C  CB    . VAL A 188 ? 0.3922 0.4238 0.5417 -0.0789 -0.0168 0.0905  187 VAL F CB    
1447 C  CG1   . VAL A 188 ? 0.4966 0.5238 0.6270 -0.0841 -0.0067 0.0909  187 VAL F CG1   
1448 C  CG2   . VAL A 188 ? 0.3614 0.4067 0.5228 -0.0821 -0.0135 0.0944  187 VAL F CG2   
1449 N  N     . SER A 189 ? 0.2671 0.2713 0.4094 -0.0702 -0.0385 0.0823  188 SER F N     
1450 C  CA    . SER A 189 ? 0.2819 0.2742 0.4145 -0.0685 -0.0431 0.0788  188 SER F CA    
1451 C  C     . SER A 189 ? 0.3522 0.3268 0.4769 -0.0718 -0.0602 0.0809  188 SER F C     
1452 O  O     . SER A 189 ? 0.3855 0.3457 0.4914 -0.0763 -0.0653 0.0820  188 SER F O     
1453 C  CB    . SER A 189 ? 0.2546 0.2568 0.4052 -0.0587 -0.0403 0.0727  188 SER F CB    
1454 O  OG    . SER A 189 ? 0.3262 0.3441 0.4858 -0.0553 -0.0257 0.0718  188 SER F OG    
1455 N  N     . ALA A 190 ? 0.2964 0.2716 0.4353 -0.0697 -0.0697 0.0814  189 ALA F N     
1456 C  CA    . ALA A 190 ? 0.4054 0.3637 0.5407 -0.0717 -0.0868 0.0832  189 ALA F CA    
1457 C  C     . ALA A 190 ? 0.4558 0.3985 0.5681 -0.0828 -0.0918 0.0916  189 ALA F C     
1458 O  O     . ALA A 190 ? 0.4240 0.3499 0.5241 -0.0862 -0.1043 0.0945  189 ALA F O     
1459 C  CB    . ALA A 190 ? 0.2816 0.2440 0.4385 -0.0670 -0.0948 0.0807  189 ALA F CB    
1460 N  N     . ALA A 191 ? 0.4202 0.3689 0.5265 -0.0889 -0.0823 0.0961  190 ALA F N     
1461 C  CA    . ALA A 191 ? 0.4419 0.3778 0.5251 -0.1009 -0.0848 0.1048  190 ALA F CA    
1462 C  C     . ALA A 191 ? 0.4628 0.3923 0.5213 -0.1058 -0.0795 0.1052  190 ALA F C     
1463 O  O     . ALA A 191 ? 0.4909 0.4035 0.5280 -0.1140 -0.0890 0.1112  190 ALA F O     
1464 C  CB    . ALA A 191 ? 0.4331 0.3803 0.5189 -0.1062 -0.0745 0.1089  190 ALA F CB    
1465 N  N     . LYS A 192 ? 0.4629 0.4053 0.5238 -0.1010 -0.0647 0.0987  191 LYS F N     
1466 C  CA    . LYS A 192 ? 0.4869 0.4230 0.5249 -0.1052 -0.0590 0.0968  191 LYS F CA    
1467 C  C     . LYS A 192 ? 0.5382 0.4597 0.5701 -0.1032 -0.0733 0.0947  191 LYS F C     
1468 O  O     . LYS A 192 ? 0.5677 0.4759 0.5742 -0.1108 -0.0775 0.0970  191 LYS F O     
1469 C  CB    . LYS A 192 ? 0.5618 0.5140 0.6076 -0.0992 -0.0407 0.0894  191 LYS F CB    
1470 C  CG    . LYS A 192 ? 0.6878 0.6572 0.7440 -0.0999 -0.0264 0.0911  191 LYS F CG    
1471 C  CD    . LYS A 192 ? 0.7428 0.7073 0.7842 -0.1119 -0.0280 0.1000  191 LYS F CD    
1472 C  CE    . LYS A 192 ? 0.6431 0.6253 0.7020 -0.1118 -0.0185 0.1024  191 LYS F CE    
1473 N  NZ    . LYS A 192 ? 0.6340 0.6319 0.6941 -0.1110 0.0012  0.0985  191 LYS F NZ    
1474 N  N     . LEU A 193 ? 0.3559 0.2807 0.4109 -0.0934 -0.0807 0.0902  192 LEU F N     
1475 C  CA    . LEU A 193 ? 0.3434 0.2562 0.3969 -0.0911 -0.0951 0.0881  192 LEU F CA    
1476 C  C     . LEU A 193 ? 0.4597 0.3548 0.5029 -0.0978 -0.1134 0.0963  192 LEU F C     
1477 O  O     . LEU A 193 ? 0.4802 0.3608 0.5058 -0.1027 -0.1242 0.0987  192 LEU F O     
1478 C  CB    . LEU A 193 ? 0.3157 0.2390 0.3986 -0.0794 -0.0971 0.0812  192 LEU F CB    
1479 C  CG    . LEU A 193 ? 0.3521 0.2896 0.4440 -0.0729 -0.0818 0.0739  192 LEU F CG    
1480 C  CD1   . LEU A 193 ? 0.3536 0.3054 0.4749 -0.0628 -0.0811 0.0692  192 LEU F CD1   
1481 C  CD2   . LEU A 193 ? 0.4260 0.3549 0.5039 -0.0742 -0.0828 0.0698  192 LEU F CD2   
1482 N  N     . GLU A 194 ? 0.4048 0.3004 0.4591 -0.0985 -0.1179 0.1010  193 GLU F N     
1483 C  CA    . GLU A 194 ? 0.4599 0.3374 0.5062 -0.1049 -0.1356 0.1097  193 GLU F CA    
1484 C  C     . GLU A 194 ? 0.6049 0.4694 0.6167 -0.1183 -0.1362 0.1183  193 GLU F C     
1485 O  O     . GLU A 194 ? 0.6020 0.4490 0.5998 -0.1239 -0.1524 0.1247  193 GLU F O     
1486 C  CB    . GLU A 194 ? 0.4444 0.3249 0.5077 -0.1043 -0.1379 0.1127  193 GLU F CB    
1487 C  CG    . GLU A 194 ? 0.6654 0.5260 0.7248 -0.1102 -0.1572 0.1218  193 GLU F CG    
1488 C  CD    . GLU A 194 ? 0.9210 0.7759 1.0032 -0.1009 -0.1734 0.1174  193 GLU F CD    
1489 O  OE1   . GLU A 194 ? 0.9654 0.8348 1.0703 -0.0902 -0.1680 0.1071  193 GLU F OE1   
1490 O  OE2   . GLU A 194 ? 1.0553 0.8918 1.1334 -0.1045 -0.1916 0.1243  193 GLU F OE2   
1491 N  N     . ALA A 195 ? 0.5752 0.4488 0.5732 -0.1240 -0.1187 0.1187  194 ALA F N     
1492 C  CA    . ALA A 195 ? 0.6571 0.5205 0.6213 -0.1378 -0.1171 0.1265  194 ALA F CA    
1493 C  C     . ALA A 195 ? 0.6959 0.5507 0.6375 -0.1406 -0.1197 0.1235  194 ALA F C     
1494 O  O     . ALA A 195 ? 0.8669 0.7091 0.7780 -0.1527 -0.1240 0.1309  194 ALA F O     
1495 C  CB    . ALA A 195 ? 0.5723 0.4503 0.5305 -0.1425 -0.0962 0.1263  194 ALA F CB    
1496 N  N     . MET A 196 ? 0.5373 0.3983 0.4919 -0.1306 -0.1174 0.1133  195 MET F N     
1497 C  CA    . MET A 196 ? 0.6201 0.4710 0.5555 -0.1333 -0.1234 0.1103  195 MET F CA    
1498 C  C     . MET A 196 ? 0.6396 0.4793 0.5868 -0.1288 -0.1455 0.1117  195 MET F C     
1499 O  O     . MET A 196 ? 0.6668 0.5018 0.6083 -0.1275 -0.1511 0.1069  195 MET F O     
1500 C  CB    . MET A 196 ? 0.6562 0.5192 0.5952 -0.1271 -0.1069 0.0981  195 MET F CB    
1501 C  CG    . MET A 196 ? 0.7123 0.5924 0.6857 -0.1140 -0.0978 0.0909  195 MET F CG    
1502 S  SD    . MET A 196 ? 0.7187 0.6102 0.6937 -0.1084 -0.0785 0.0785  195 MET F SD    
1503 C  CE    . MET A 196 ? 0.8052 0.6996 0.7532 -0.1190 -0.0608 0.0803  195 MET F CE    
1504 N  N     . GLY A 197 ? 0.5597 0.3951 0.5244 -0.1264 -0.1583 0.1178  196 GLY F N     
1505 C  CA    . GLY A 197 ? 0.6385 0.4639 0.6176 -0.1216 -0.1794 0.1191  196 GLY F CA    
1506 C  C     . GLY A 197 ? 0.5645 0.4020 0.5756 -0.1079 -0.1786 0.1083  196 GLY F C     
1507 O  O     . GLY A 197 ? 0.5798 0.4108 0.6005 -0.1042 -0.1941 0.1072  196 GLY F O     
1508 N  N     . LEU A 198 ? 0.4805 0.3359 0.5089 -0.1006 -0.1614 0.1007  197 LEU F N     
1509 C  CA    . LEU A 198 ? 0.4927 0.3610 0.5503 -0.0885 -0.1593 0.0911  197 LEU F CA    
1510 C  C     . LEU A 198 ? 0.5138 0.3922 0.5985 -0.0816 -0.1578 0.0898  197 LEU F C     
1511 O  O     . LEU A 198 ? 0.4605 0.3503 0.5478 -0.0814 -0.1434 0.0891  197 LEU F O     
1512 C  CB    . LEU A 198 ? 0.4138 0.2944 0.4691 -0.0858 -0.1412 0.0831  197 LEU F CB    
1513 C  CG    . LEU A 198 ? 0.4756 0.3466 0.5029 -0.0929 -0.1404 0.0822  197 LEU F CG    
1514 C  CD1   . LEU A 198 ? 0.5506 0.4333 0.5789 -0.0893 -0.1218 0.0737  197 LEU F CD1   
1515 C  CD2   . LEU A 198 ? 0.4758 0.3355 0.5032 -0.0929 -0.1592 0.0820  197 LEU F CD2   
1516 N  N     . ARG A 199 ? 0.4472 0.3224 0.5530 -0.0759 -0.1724 0.0887  198 ARG F N     
1517 C  CA    . ARG A 199 ? 0.3749 0.2585 0.5064 -0.0694 -0.1725 0.0860  198 ARG F CA    
1518 C  C     . ARG A 199 ? 0.3237 0.2214 0.4842 -0.0583 -0.1713 0.0760  198 ARG F C     
1519 O  O     . ARG A 199 ? 0.3495 0.2615 0.5277 -0.0529 -0.1626 0.0711  198 ARG F O     
1520 C  CB    . ARG A 199 ? 0.3498 0.2169 0.4838 -0.0724 -0.1907 0.0930  198 ARG F CB    
1521 C  CG    . ARG A 199 ? 0.3640 0.2379 0.5222 -0.0670 -0.1905 0.0897  198 ARG F CG    
1522 C  CD    . ARG A 199 ? 0.4096 0.2649 0.5737 -0.0690 -0.2101 0.0958  198 ARG F CD    
1523 N  NE    . ARG A 199 ? 0.4578 0.3072 0.6380 -0.0628 -0.2260 0.0929  198 ARG F NE    
1524 C  CZ    . ARG A 199 ? 0.4463 0.3054 0.6579 -0.0522 -0.2285 0.0829  198 ARG F CZ    
1525 N  NH1   . ARG A 199 ? 0.4559 0.3302 0.6834 -0.0471 -0.2167 0.0751  198 ARG F NH1   
1526 N  NH2   . ARG A 199 ? 0.5080 0.3661 0.7337 -0.0474 -0.2410 0.0788  198 ARG F NH2   
1527 N  N     . THR A 200 ? 0.3340 0.2291 0.4994 -0.0555 -0.1797 0.0729  199 THR F N     
1528 C  CA    . THR A 200 ? 0.3610 0.2690 0.5548 -0.0459 -0.1804 0.0640  199 THR F CA    
1529 C  C     . THR A 200 ? 0.2990 0.2142 0.4891 -0.0449 -0.1722 0.0596  199 THR F C     
1530 O  O     . THR A 200 ? 0.3216 0.2285 0.4873 -0.0514 -0.1698 0.0629  199 THR F O     
1531 C  CB    . THR A 200 ? 0.3440 0.2430 0.5541 -0.0427 -0.2003 0.0638  199 THR F CB    
1532 O  OG1   . THR A 200 ? 0.3899 0.2756 0.5835 -0.0478 -0.2113 0.0682  199 THR F OG1   
1533 C  CG2   . THR A 200 ? 0.3969 0.2842 0.6095 -0.0444 -0.2107 0.0691  199 THR F CG2   
1534 N  N     . CYS A 201 ? 0.2632 0.1936 0.4780 -0.0371 -0.1684 0.0518  200 CYS F N     
1535 C  CA    . CYS A 201 ? 0.2876 0.2236 0.5022 -0.0362 -0.1629 0.0477  200 CYS F CA    
1536 C  C     . CYS A 201 ? 0.3080 0.2300 0.5142 -0.0399 -0.1781 0.0495  200 CYS F C     
1537 O  O     . CYS A 201 ? 0.3256 0.2441 0.5172 -0.0436 -0.1749 0.0488  200 CYS F O     
1538 C  CB    . CYS A 201 ? 0.2621 0.2171 0.5054 -0.0282 -0.1569 0.0401  200 CYS F CB    
1539 S  SG    . CYS A 201 ? 0.3017 0.2745 0.5513 -0.0251 -0.1382 0.0384  200 CYS F SG    
1540 N  N     . GLY A 202 ? 0.3560 0.2695 0.5716 -0.0390 -0.1955 0.0518  201 GLY F N     
1541 C  CA    . GLY A 202 ? 0.4025 0.3016 0.6088 -0.0432 -0.2124 0.0552  201 GLY F CA    
1542 C  C     . GLY A 202 ? 0.3796 0.2628 0.5482 -0.0536 -0.2126 0.0622  201 GLY F C     
1543 O  O     . GLY A 202 ? 0.4772 0.3531 0.6316 -0.0583 -0.2183 0.0623  201 GLY F O     
1544 N  N     . ASP A 203 ? 0.3970 0.2756 0.5490 -0.0580 -0.2062 0.0677  202 ASP F N     
1545 C  CA    . ASP A 203 ? 0.4930 0.3590 0.6085 -0.0685 -0.2034 0.0738  202 ASP F CA    
1546 C  C     . ASP A 203 ? 0.5340 0.4069 0.6376 -0.0697 -0.1869 0.0679  202 ASP F C     
1547 O  O     . ASP A 203 ? 0.5700 0.4329 0.6487 -0.0769 -0.1889 0.0687  202 ASP F O     
1548 C  CB    . ASP A 203 ? 0.4550 0.3178 0.5589 -0.0727 -0.1975 0.0803  202 ASP F CB    
1549 C  CG    . ASP A 203 ? 0.5159 0.3693 0.6307 -0.0723 -0.2138 0.0866  202 ASP F CG    
1550 O  OD1   . ASP A 203 ? 0.4865 0.3299 0.6074 -0.0718 -0.2327 0.0890  202 ASP F OD1   
1551 O  OD2   . ASP A 203 ? 0.4978 0.3533 0.6153 -0.0726 -0.2082 0.0892  202 ASP F OD2   
1552 N  N     . VAL A 204 ? 0.3968 0.2863 0.5171 -0.0631 -0.1706 0.0620  203 VAL F N     
1553 C  CA    . VAL A 204 ? 0.3280 0.2236 0.4400 -0.0634 -0.1548 0.0567  203 VAL F CA    
1554 C  C     . VAL A 204 ? 0.4347 0.3288 0.5516 -0.0625 -0.1609 0.0513  203 VAL F C     
1555 O  O     . VAL A 204 ? 0.5085 0.3991 0.6094 -0.0661 -0.1537 0.0477  203 VAL F O     
1556 C  CB    . VAL A 204 ? 0.3001 0.2137 0.4309 -0.0565 -0.1380 0.0532  203 VAL F CB    
1557 C  CG1   . VAL A 204 ? 0.3654 0.2856 0.4944 -0.0551 -0.1232 0.0475  203 VAL F CG1   
1558 C  CG2   . VAL A 204 ? 0.3020 0.2161 0.4228 -0.0596 -0.1309 0.0585  203 VAL F CG2   
1559 N  N     . GLN A 205 ? 0.3951 0.2918 0.5349 -0.0577 -0.1742 0.0499  204 GLN F N     
1560 C  CA    . GLN A 205 ? 0.4248 0.3206 0.5709 -0.0576 -0.1813 0.0452  204 GLN F CA    
1561 C  C     . GLN A 205 ? 0.5247 0.4027 0.6408 -0.0671 -0.1918 0.0479  204 GLN F C     
1562 O  O     . GLN A 205 ? 0.5563 0.4318 0.6674 -0.0694 -0.1926 0.0430  204 GLN F O     
1563 C  CB    . GLN A 205 ? 0.3930 0.2955 0.5702 -0.0513 -0.1946 0.0437  204 GLN F CB    
1564 C  CG    . GLN A 205 ? 0.3807 0.3029 0.5878 -0.0425 -0.1833 0.0386  204 GLN F CG    
1565 C  CD    . GLN A 205 ? 0.3907 0.3200 0.6279 -0.0363 -0.1955 0.0367  204 GLN F CD    
1566 O  OE1   . GLN A 205 ? 0.4604 0.3795 0.6971 -0.0371 -0.2110 0.0387  204 GLN F OE1   
1567 N  NE2   . GLN A 205 ? 0.3386 0.2844 0.5984 -0.0290 -0.1854 0.0326  204 GLN F NE2   
1568 N  N     . LYS A 206 ? 0.5583 0.4235 0.6534 -0.0733 -0.2003 0.0557  205 LYS F N     
1569 C  CA    . LYS A 206 ? 0.6741 0.5223 0.7359 -0.0839 -0.2099 0.0594  205 LYS F CA    
1570 C  C     . LYS A 206 ? 0.7287 0.5739 0.7604 -0.0904 -0.1928 0.0570  205 LYS F C     
1571 O  O     . LYS A 206 ? 0.7604 0.5919 0.7597 -0.1004 -0.1982 0.0601  205 LYS F O     
1572 C  CB    . LYS A 206 ? 0.6795 0.5149 0.7303 -0.0889 -0.2264 0.0702  205 LYS F CB    
1573 C  CG    . LYS A 206 ? 0.6989 0.5348 0.7790 -0.0828 -0.2455 0.0725  205 LYS F CG    
1574 C  CD    . LYS A 206 ? 0.8127 0.6375 0.8873 -0.0858 -0.2576 0.0832  205 LYS F CD    
1575 C  CE    . LYS A 206 ? 0.8575 0.6842 0.9667 -0.0777 -0.2744 0.0841  205 LYS F CE    
1576 N  NZ    . LYS A 206 ? 0.8806 0.6955 0.9872 -0.0799 -0.2856 0.0941  205 LYS F NZ    
1577 N  N     . CYS A 207 ? 0.6129 0.4707 0.6546 -0.0850 -0.1728 0.0516  206 CYS F N     
1578 C  CA    . CYS A 207 ? 0.6020 0.4587 0.6200 -0.0897 -0.1554 0.0485  206 CYS F CA    
1579 C  C     . CYS A 207 ? 0.5119 0.3717 0.5335 -0.0875 -0.1461 0.0385  206 CYS F C     
1580 O  O     . CYS A 207 ? 0.6576 0.5254 0.7056 -0.0807 -0.1480 0.0343  206 CYS F O     
1581 C  CB    . CYS A 207 ? 0.5502 0.4184 0.5766 -0.0857 -0.1392 0.0504  206 CYS F CB    
1582 S  SG    . CYS A 207 ? 0.6236 0.4859 0.6387 -0.0910 -0.1463 0.0618  206 CYS F SG    
1583 N  N     . ASP A 208 ? 0.4760 0.3297 0.4708 -0.0937 -0.1351 0.0344  207 ASP F N     
1584 C  CA    . ASP A 208 ? 0.4987 0.3529 0.4932 -0.0925 -0.1243 0.0241  207 ASP F CA    
1585 C  C     . ASP A 208 ? 0.4376 0.3059 0.4514 -0.0844 -0.1045 0.0210  207 ASP F C     
1586 O  O     . ASP A 208 ? 0.4706 0.3436 0.4783 -0.0847 -0.0937 0.0244  207 ASP F O     
1587 C  CB    . ASP A 208 ? 0.5992 0.4401 0.5554 -0.1031 -0.1214 0.0200  207 ASP F CB    
1588 C  CG    . ASP A 208 ? 0.9345 0.7726 0.8887 -0.1027 -0.1126 0.0080  207 ASP F CG    
1589 O  OD1   . ASP A 208 ? 0.9622 0.8099 0.9374 -0.0948 -0.0980 0.0030  207 ASP F OD1   
1590 O  OD2   . ASP A 208 ? 1.1166 0.9419 1.0475 -0.1108 -0.1211 0.0037  207 ASP F OD2   
1591 N  N     . LEU A 209 ? 0.5298 0.4047 0.5668 -0.0777 -0.1000 0.0152  208 LEU F N     
1592 C  CA    . LEU A 209 ? 0.4134 0.3007 0.4681 -0.0704 -0.0820 0.0129  208 LEU F CA    
1593 C  C     . LEU A 209 ? 0.4210 0.3049 0.4548 -0.0738 -0.0662 0.0085  208 LEU F C     
1594 O  O     . LEU A 209 ? 0.4762 0.3703 0.5171 -0.0700 -0.0530 0.0106  208 LEU F O     
1595 C  CB    . LEU A 209 ? 0.3514 0.2434 0.4303 -0.0647 -0.0805 0.0075  208 LEU F CB    
1596 C  CG    . LEU A 209 ? 0.3848 0.2876 0.4820 -0.0575 -0.0631 0.0053  208 LEU F CG    
1597 C  CD1   . LEU A 209 ? 0.3904 0.3089 0.5061 -0.0515 -0.0587 0.0127  208 LEU F CD1   
1598 C  CD2   . LEU A 209 ? 0.3384 0.2419 0.4554 -0.0541 -0.0635 0.0004  208 LEU F CD2   
1599 N  N     . VAL A 210 ? 0.4951 0.3655 0.5033 -0.0810 -0.0671 0.0018  209 VAL F N     
1600 C  CA    . VAL A 210 ? 0.5619 0.4298 0.5511 -0.0840 -0.0504 -0.0046 209 VAL F CA    
1601 C  C     . VAL A 210 ? 0.5685 0.4405 0.5432 -0.0879 -0.0451 0.0024  209 VAL F C     
1602 O  O     . VAL A 210 ? 0.5834 0.4641 0.5616 -0.0851 -0.0284 0.0009  209 VAL F O     
1603 C  CB    . VAL A 210 ? 0.5879 0.4400 0.5488 -0.0924 -0.0533 -0.0138 209 VAL F CB    
1604 C  CG1   . VAL A 210 ? 0.6061 0.4569 0.5479 -0.0954 -0.0347 -0.0217 209 VAL F CG1   
1605 C  CG2   . VAL A 210 ? 0.5110 0.3590 0.4882 -0.0889 -0.0577 -0.0212 209 VAL F CG2   
1606 N  N     . MET A 211 ? 0.5920 0.4580 0.5516 -0.0945 -0.0597 0.0106  210 MET F N     
1607 C  CA    . MET A 211 ? 0.6397 0.5085 0.5855 -0.0993 -0.0558 0.0183  210 MET F CA    
1608 C  C     . MET A 211 ? 0.6323 0.5174 0.6065 -0.0907 -0.0476 0.0233  210 MET F C     
1609 O  O     . MET A 211 ? 0.6036 0.4965 0.5747 -0.0914 -0.0335 0.0243  210 MET F O     
1610 C  CB    . MET A 211 ? 0.7136 0.5716 0.6418 -0.1074 -0.0755 0.0274  210 MET F CB    
1611 C  CG    . MET A 211 ? 0.8217 0.6807 0.7353 -0.1137 -0.0736 0.0369  210 MET F CG    
1612 S  SD    . MET A 211 ? 0.7766 0.6489 0.7235 -0.1052 -0.0758 0.0460  210 MET F SD    
1613 C  CE    . MET A 211 ? 0.7982 0.6620 0.7572 -0.1033 -0.1015 0.0510  210 MET F CE    
1614 N  N     . LEU A 212 ? 0.5490 0.4404 0.5513 -0.0830 -0.0560 0.0261  211 LEU F N     
1615 C  CA    . LEU A 212 ? 0.4837 0.3908 0.5120 -0.0753 -0.0493 0.0304  211 LEU F CA    
1616 C  C     . LEU A 212 ? 0.5418 0.4595 0.5822 -0.0695 -0.0302 0.0249  211 LEU F C     
1617 O  O     . LEU A 212 ? 0.6190 0.5486 0.6689 -0.0669 -0.0203 0.0284  211 LEU F O     
1618 C  CB    . LEU A 212 ? 0.4299 0.3421 0.4846 -0.0686 -0.0610 0.0327  211 LEU F CB    
1619 C  CG    . LEU A 212 ? 0.4748 0.3790 0.5250 -0.0723 -0.0801 0.0389  211 LEU F CG    
1620 C  CD1   . LEU A 212 ? 0.4429 0.3524 0.5201 -0.0653 -0.0904 0.0380  211 LEU F CD1   
1621 C  CD2   . LEU A 212 ? 0.4612 0.3682 0.5082 -0.0748 -0.0806 0.0470  211 LEU F CD2   
1622 N  N     . LEU A 213 ? 0.4953 0.4086 0.5371 -0.0674 -0.0256 0.0164  212 LEU F N     
1623 C  CA    . LEU A 213 ? 0.5270 0.4487 0.5820 -0.0614 -0.0084 0.0110  212 LEU F CA    
1624 C  C     . LEU A 213 ? 0.5552 0.4779 0.5919 -0.0659 0.0058  0.0086  212 LEU F C     
1625 O  O     . LEU A 213 ? 0.5986 0.5340 0.6502 -0.0609 0.0191  0.0093  212 LEU F O     
1626 C  CB    . LEU A 213 ? 0.4516 0.3655 0.5111 -0.0590 -0.0078 0.0020  212 LEU F CB    
1627 C  CG    . LEU A 213 ? 0.4703 0.3890 0.5570 -0.0524 -0.0156 0.0039  212 LEU F CG    
1628 C  CD1   . LEU A 213 ? 0.4816 0.3898 0.5686 -0.0526 -0.0169 -0.0048 212 LEU F CD1   
1629 C  CD2   . LEU A 213 ? 0.5480 0.4833 0.6623 -0.0438 -0.0059 0.0082  212 LEU F CD2   
1630 N  N     . LYS A 214 ? 0.6114 0.5217 0.6163 -0.0756 0.0034  0.0060  213 LYS F N     
1631 C  CA    . LYS A 214 ? 0.7126 0.6254 0.6989 -0.0811 0.0176  0.0038  213 LYS F CA    
1632 C  C     . LYS A 214 ? 0.6698 0.5930 0.6589 -0.0831 0.0184  0.0144  213 LYS F C     
1633 O  O     . LYS A 214 ? 0.7511 0.6856 0.7446 -0.0822 0.0334  0.0140  213 LYS F O     
1634 C  CB    . LYS A 214 ? 0.8073 0.7045 0.7558 -0.0926 0.0140  -0.0010 213 LYS F CB    
1635 C  CG    . LYS A 214 ? 0.8392 0.7270 0.7807 -0.0922 0.0188  -0.0144 213 LYS F CG    
1636 C  CD    . LYS A 214 ? 0.9288 0.8052 0.8303 -0.1043 0.0216  -0.0205 213 LYS F CD    
1637 C  CE    . LYS A 214 ? 0.9996 0.8858 0.8911 -0.1076 0.0406  -0.0220 213 LYS F CE    
1638 N  NZ    . LYS A 214 ? 0.9564 0.8526 0.8706 -0.0981 0.0601  -0.0320 213 LYS F NZ    
1639 N  N     . ARG A 215 ? 0.6512 0.5710 0.6399 -0.0855 0.0021  0.0235  214 ARG F N     
1640 C  CA    . ARG A 215 ? 0.6567 0.5827 0.6449 -0.0890 0.0003  0.0335  214 ARG F CA    
1641 C  C     . ARG A 215 ? 0.6345 0.5775 0.6552 -0.0798 0.0051  0.0374  214 ARG F C     
1642 O  O     . ARG A 215 ? 0.6628 0.6143 0.6854 -0.0823 0.0093  0.0436  214 ARG F O     
1643 C  CB    . ARG A 215 ? 0.7434 0.6571 0.7193 -0.0951 -0.0200 0.0412  214 ARG F CB    
1644 C  CG    . ARG A 215 ? 0.8472 0.7633 0.8205 -0.1000 -0.0247 0.0520  214 ARG F CG    
1645 C  CD    . ARG A 215 ? 0.9719 0.8853 0.9165 -0.1115 -0.0162 0.0545  214 ARG F CD    
1646 N  NE    . ARG A 215 ? 1.0036 0.9336 0.9605 -0.1096 0.0008  0.0550  214 ARG F NE    
1647 C  CZ    . ARG A 215 ? 1.0436 0.9762 0.9828 -0.1189 0.0096  0.0588  214 ARG F CZ    
1648 N  NH1   . ARG A 215 ? 1.0695 0.9886 0.9760 -0.1313 0.0030  0.0631  214 ARG F NH1   
1649 N  NH2   . ARG A 215 ? 1.0356 0.9851 0.9902 -0.1164 0.0248  0.0589  214 ARG F NH2   
1650 N  N     . PHE A 216 ? 0.5301 0.4786 0.5757 -0.0701 0.0045  0.0341  215 PHE F N     
1651 C  CA    . PHE A 216 ? 0.4640 0.4285 0.5385 -0.0622 0.0072  0.0384  215 PHE F CA    
1652 C  C     . PHE A 216 ? 0.4841 0.4577 0.5813 -0.0529 0.0172  0.0334  215 PHE F C     
1653 O  O     . PHE A 216 ? 0.4993 0.4869 0.6199 -0.0466 0.0195  0.0373  215 PHE F O     
1654 C  CB    . PHE A 216 ? 0.4918 0.4553 0.5775 -0.0602 -0.0091 0.0436  215 PHE F CB    
1655 C  CG    . PHE A 216 ? 0.4524 0.4075 0.5219 -0.0680 -0.0204 0.0501  215 PHE F CG    
1656 C  CD1   . PHE A 216 ? 0.6382 0.6008 0.7089 -0.0709 -0.0173 0.0564  215 PHE F CD1   
1657 C  CD2   . PHE A 216 ? 0.4778 0.4175 0.5323 -0.0727 -0.0351 0.0505  215 PHE F CD2   
1658 C  CE1   . PHE A 216 ? 0.6429 0.5963 0.6997 -0.0784 -0.0284 0.0631  215 PHE F CE1   
1659 C  CE2   . PHE A 216 ? 0.6405 0.5713 0.6814 -0.0798 -0.0469 0.0577  215 PHE F CE2   
1660 C  CZ    . PHE A 216 ? 0.6914 0.6285 0.7334 -0.0827 -0.0434 0.0641  215 PHE F CZ    
1661 N  N     . GLY A 217 ? 0.4599 0.4257 0.5514 -0.0520 0.0225  0.0251  216 GLY F N     
1662 C  CA    . GLY A 217 ? 0.4733 0.4458 0.5882 -0.0431 0.0301  0.0213  216 GLY F CA    
1663 C  C     . GLY A 217 ? 0.5395 0.5144 0.6736 -0.0379 0.0192  0.0245  216 GLY F C     
1664 O  O     . GLY A 217 ? 0.5214 0.4880 0.6484 -0.0411 0.0057  0.0254  216 GLY F O     
1665 N  N     . LYS A 218 ? 0.4405 0.4278 0.6001 -0.0302 0.0251  0.0264  217 LYS F N     
1666 C  CA    . LYS A 218 ? 0.4401 0.4316 0.6186 -0.0256 0.0169  0.0292  217 LYS F CA    
1667 C  C     . LYS A 218 ? 0.4013 0.3966 0.5800 -0.0277 0.0050  0.0348  217 LYS F C     
1668 O  O     . LYS A 218 ? 0.3590 0.3522 0.5441 -0.0269 -0.0050 0.0348  217 LYS F O     
1669 C  CB    . LYS A 218 ? 0.5456 0.5511 0.7493 -0.0180 0.0254  0.0324  217 LYS F CB    
1670 C  CG    . LYS A 218 ? 0.6667 0.6683 0.8744 -0.0148 0.0374  0.0266  217 LYS F CG    
1671 C  CD    . LYS A 218 ? 0.6169 0.6304 0.8518 -0.0070 0.0429  0.0311  217 LYS F CD    
1672 C  CE    . LYS A 218 ? 0.6975 0.7066 0.9387 -0.0030 0.0548  0.0252  217 LYS F CE    
1673 N  NZ    . LYS A 218 ? 0.7957 0.8084 1.0280 -0.0044 0.0653  0.0223  217 LYS F NZ    
1674 N  N     . PHE A 219 ? 0.4002 0.4013 0.5734 -0.0304 0.0059  0.0393  218 PHE F N     
1675 C  CA    . PHE A 219 ? 0.3607 0.3629 0.5329 -0.0328 -0.0057 0.0437  218 PHE F CA    
1676 C  C     . PHE A 219 ? 0.3197 0.3059 0.4761 -0.0376 -0.0184 0.0414  218 PHE F C     
1677 O  O     . PHE A 219 ? 0.3336 0.3197 0.4968 -0.0370 -0.0300 0.0430  218 PHE F O     
1678 C  CB    . PHE A 219 ? 0.2944 0.3017 0.4595 -0.0366 -0.0021 0.0483  218 PHE F CB    
1679 C  CG    . PHE A 219 ? 0.3659 0.3732 0.5309 -0.0392 -0.0136 0.0526  218 PHE F CG    
1680 C  CD1   . PHE A 219 ? 0.5454 0.5654 0.7300 -0.0346 -0.0165 0.0550  218 PHE F CD1   
1681 C  CD2   . PHE A 219 ? 0.4043 0.3988 0.5491 -0.0465 -0.0213 0.0544  218 PHE F CD2   
1682 C  CE1   . PHE A 219 ? 0.5000 0.5193 0.6855 -0.0367 -0.0267 0.0575  218 PHE F CE1   
1683 C  CE2   . PHE A 219 ? 0.4549 0.4479 0.6014 -0.0486 -0.0324 0.0584  218 PHE F CE2   
1684 C  CZ    . PHE A 219 ? 0.4245 0.4297 0.5921 -0.0433 -0.0348 0.0592  218 PHE F CZ    
1685 N  N     . GLY A 220 ? 0.2963 0.2694 0.4318 -0.0426 -0.0166 0.0374  219 GLY F N     
1686 C  CA    . GLY A 220 ? 0.3587 0.3164 0.4778 -0.0479 -0.0296 0.0357  219 GLY F CA    
1687 C  C     . GLY A 220 ? 0.3487 0.3044 0.4810 -0.0443 -0.0373 0.0322  219 GLY F C     
1688 O  O     . GLY A 220 ? 0.3616 0.3108 0.4923 -0.0463 -0.0513 0.0330  219 GLY F O     
1689 N  N     . ARG A 221 ? 0.3226 0.2839 0.4695 -0.0391 -0.0286 0.0287  220 ARG F N     
1690 C  CA    . ARG A 221 ? 0.2967 0.2583 0.4593 -0.0359 -0.0351 0.0264  220 ARG F CA    
1691 C  C     . ARG A 221 ? 0.2802 0.2548 0.4634 -0.0319 -0.0412 0.0309  220 ARG F C     
1692 O  O     . ARG A 221 ? 0.2445 0.2179 0.4355 -0.0318 -0.0520 0.0299  220 ARG F O     
1693 C  CB    . ARG A 221 ? 0.2928 0.2568 0.4668 -0.0318 -0.0242 0.0227  220 ARG F CB    
1694 C  CG    . ARG A 221 ? 0.2779 0.2442 0.4706 -0.0291 -0.0298 0.0216  220 ARG F CG    
1695 C  CD    . ARG A 221 ? 0.2711 0.2374 0.4754 -0.0256 -0.0199 0.0188  220 ARG F CD    
1696 N  NE    . ARG A 221 ? 0.2751 0.2258 0.4618 -0.0290 -0.0162 0.0112  220 ARG F NE    
1697 C  CZ    . ARG A 221 ? 0.2712 0.2088 0.4489 -0.0333 -0.0242 0.0055  220 ARG F CZ    
1698 N  NH1   . ARG A 221 ? 0.3321 0.2711 0.5185 -0.0345 -0.0364 0.0070  220 ARG F NH1   
1699 N  NH2   . ARG A 221 ? 0.3030 0.2268 0.4630 -0.0368 -0.0200 -0.0024 220 ARG F NH2   
1700 N  N     . ILE A 222 ? 0.2585 0.2462 0.4513 -0.0287 -0.0343 0.0353  221 ILE F N     
1701 C  CA    . ILE A 222 ? 0.2418 0.2421 0.4524 -0.0254 -0.0395 0.0383  221 ILE F CA    
1702 C  C     . ILE A 222 ? 0.2315 0.2250 0.4350 -0.0286 -0.0530 0.0389  221 ILE F C     
1703 O  O     . ILE A 222 ? 0.2549 0.2520 0.4715 -0.0266 -0.0617 0.0378  221 ILE F O     
1704 C  CB    . ILE A 222 ? 0.2765 0.2919 0.4966 -0.0223 -0.0300 0.0426  221 ILE F CB    
1705 C  CG1   . ILE A 222 ? 0.3753 0.4010 0.6117 -0.0176 -0.0207 0.0434  221 ILE F CG1   
1706 C  CG2   . ILE A 222 ? 0.2975 0.3232 0.5285 -0.0209 -0.0362 0.0448  221 ILE F CG2   
1707 C  CD1   . ILE A 222 ? 0.6229 0.6398 0.8542 -0.0174 -0.0132 0.0404  221 ILE F CD1   
1708 N  N     . LEU A 223 ? 0.2532 0.2365 0.4366 -0.0338 -0.0550 0.0407  222 LEU F N     
1709 C  CA    . LEU A 223 ? 0.2657 0.2399 0.4419 -0.0372 -0.0691 0.0425  222 LEU F CA    
1710 C  C     . LEU A 223 ? 0.2764 0.2408 0.4519 -0.0384 -0.0810 0.0392  222 LEU F C     
1711 O  O     . LEU A 223 ? 0.2869 0.2515 0.4734 -0.0369 -0.0929 0.0391  222 LEU F O     
1712 C  CB    . LEU A 223 ? 0.3139 0.2773 0.4656 -0.0442 -0.0688 0.0460  222 LEU F CB    
1713 C  CG    . LEU A 223 ? 0.5058 0.4755 0.6567 -0.0454 -0.0642 0.0509  222 LEU F CG    
1714 C  CD1   . LEU A 223 ? 0.4654 0.4238 0.5897 -0.0536 -0.0619 0.0538  222 LEU F CD1   
1715 C  CD2   . LEU A 223 ? 0.3842 0.3546 0.5464 -0.0442 -0.0764 0.0530  222 LEU F CD2   
1716 N  N     . TRP A 224 ? 0.3165 0.2722 0.4796 -0.0411 -0.0781 0.0359  223 TRP F N     
1717 C  CA    . TRP A 224 ? 0.3230 0.2696 0.4852 -0.0429 -0.0894 0.0325  223 TRP F CA    
1718 C  C     . TRP A 224 ? 0.3293 0.2878 0.5195 -0.0371 -0.0924 0.0303  223 TRP F C     
1719 O  O     . TRP A 224 ? 0.2998 0.2567 0.4987 -0.0369 -0.1056 0.0297  223 TRP F O     
1720 C  CB    . TRP A 224 ? 0.3470 0.2839 0.4928 -0.0465 -0.0832 0.0279  223 TRP F CB    
1721 C  CG    . TRP A 224 ? 0.3640 0.2906 0.5059 -0.0498 -0.0953 0.0243  223 TRP F CG    
1722 C  CD1   . TRP A 224 ? 0.4046 0.3166 0.5256 -0.0566 -0.1082 0.0251  223 TRP F CD1   
1723 C  CD2   . TRP A 224 ? 0.3757 0.3058 0.5353 -0.0471 -0.0968 0.0200  223 TRP F CD2   
1724 N  NE1   . TRP A 224 ? 0.4112 0.3180 0.5364 -0.0581 -0.1180 0.0211  223 TRP F NE1   
1725 C  CE2   . TRP A 224 ? 0.4062 0.3239 0.5554 -0.0524 -0.1109 0.0176  223 TRP F CE2   
1726 C  CE3   . TRP A 224 ? 0.3469 0.2895 0.5298 -0.0414 -0.0880 0.0185  223 TRP F CE3   
1727 C  CZ2   . TRP A 224 ? 0.4448 0.3628 0.6075 -0.0521 -0.1161 0.0133  223 TRP F CZ2   
1728 C  CZ3   . TRP A 224 ? 0.3744 0.3168 0.5701 -0.0415 -0.0929 0.0147  223 TRP F CZ3   
1729 C  CH2   . TRP A 224 ? 0.3997 0.3301 0.5860 -0.0468 -0.1066 0.0118  223 TRP F CH2   
1730 N  N     . GLU A 225 ? 0.2956 0.2671 0.5010 -0.0325 -0.0802 0.0296  224 GLU F N     
1731 C  CA    . GLU A 225 ? 0.2275 0.2117 0.4581 -0.0280 -0.0813 0.0281  224 GLU F CA    
1732 C  C     . GLU A 225 ? 0.2438 0.2377 0.4889 -0.0251 -0.0882 0.0293  224 GLU F C     
1733 O  O     . GLU A 225 ? 0.2416 0.2376 0.5000 -0.0241 -0.0980 0.0269  224 GLU F O     
1734 C  CB    . GLU A 225 ? 0.2356 0.2314 0.4774 -0.0244 -0.0671 0.0290  224 GLU F CB    
1735 C  CG    . GLU A 225 ? 0.2398 0.2271 0.4752 -0.0260 -0.0609 0.0263  224 GLU F CG    
1736 C  CD    . GLU A 225 ? 0.4041 0.4020 0.6520 -0.0220 -0.0477 0.0285  224 GLU F CD    
1737 O  OE1   . GLU A 225 ? 0.3768 0.3897 0.6374 -0.0187 -0.0441 0.0325  224 GLU F OE1   
1738 O  OE2   . GLU A 225 ? 0.3946 0.3855 0.6397 -0.0224 -0.0414 0.0263  224 GLU F OE2   
1739 N  N     . ARG A 226 ? 0.2546 0.2545 0.4981 -0.0238 -0.0830 0.0324  225 ARG F N     
1740 C  CA    . ARG A 226 ? 0.2232 0.2329 0.4814 -0.0207 -0.0879 0.0323  225 ARG F CA    
1741 C  C     . ARG A 226 ? 0.2296 0.2284 0.4859 -0.0222 -0.1037 0.0314  225 ARG F C     
1742 O  O     . ARG A 226 ? 0.3034 0.3095 0.5782 -0.0188 -0.1104 0.0286  225 ARG F O     
1743 C  CB    . ARG A 226 ? 0.2043 0.2198 0.4580 -0.0203 -0.0806 0.0357  225 ARG F CB    
1744 C  CG    . ARG A 226 ? 0.1956 0.2233 0.4536 -0.0183 -0.0660 0.0375  225 ARG F CG    
1745 C  CD    . ARG A 226 ? 0.2126 0.2569 0.4917 -0.0144 -0.0626 0.0358  225 ARG F CD    
1746 N  NE    . ARG A 226 ? 0.2394 0.2932 0.5204 -0.0131 -0.0501 0.0393  225 ARG F NE    
1747 C  CZ    . ARG A 226 ? 0.2294 0.2805 0.5103 -0.0130 -0.0443 0.0400  225 ARG F CZ    
1748 N  NH1   . ARG A 226 ? 0.1937 0.2338 0.4721 -0.0147 -0.0497 0.0368  225 ARG F NH1   
1749 N  NH2   . ARG A 226 ? 0.3007 0.3597 0.5850 -0.0114 -0.0339 0.0439  225 ARG F NH2   
1750 N  N     . SER A 227 ? 0.2459 0.2274 0.4806 -0.0274 -0.1099 0.0338  226 SER F N     
1751 C  CA    . SER A 227 ? 0.3005 0.2706 0.5328 -0.0293 -0.1265 0.0347  226 SER F CA    
1752 C  C     . SER A 227 ? 0.3489 0.3190 0.5952 -0.0280 -0.1368 0.0309  226 SER F C     
1753 O  O     . SER A 227 ? 0.4393 0.4027 0.6904 -0.0281 -0.1516 0.0313  226 SER F O     
1754 C  CB    . SER A 227 ? 0.2634 0.2153 0.4664 -0.0366 -0.1307 0.0393  226 SER F CB    
1755 O  OG    . SER A 227 ? 0.3566 0.3097 0.5495 -0.0381 -0.1220 0.0432  226 SER F OG    
1756 N  N     . GLN A 228 ? 0.3386 0.3158 0.5929 -0.0270 -0.1301 0.0274  227 GLN F N     
1757 C  CA    . GLN A 228 ? 0.4093 0.3905 0.6825 -0.0254 -0.1393 0.0235  227 GLN F CA    
1758 C  C     . GLN A 228 ? 0.2623 0.2642 0.5620 -0.0201 -0.1307 0.0200  227 GLN F C     
1759 O  O     . GLN A 228 ? 0.3152 0.3196 0.6230 -0.0184 -0.1305 0.0167  227 GLN F O     
1760 C  CB    . GLN A 228 ? 0.5079 0.4781 0.7689 -0.0303 -0.1428 0.0224  227 GLN F CB    
1761 C  CG    . GLN A 228 ? 0.4108 0.3786 0.6572 -0.0325 -0.1290 0.0223  227 GLN F CG    
1762 C  CD    . GLN A 228 ? 0.5570 0.5064 0.7775 -0.0392 -0.1343 0.0222  227 GLN F CD    
1763 O  OE1   . GLN A 228 ? 0.7084 0.6482 0.9243 -0.0425 -0.1494 0.0221  227 GLN F OE1   
1764 N  NE2   . GLN A 228 ? 0.5307 0.4751 0.7335 -0.0414 -0.1222 0.0219  227 GLN F NE2   
1765 N  N     . GLY A 229 ? 0.2518 0.2639 0.5540 -0.0167 -0.1198 0.0208  228 GLY F N     
1766 C  CA    . GLY A 229 ? 0.2429 0.2684 0.5539 -0.0116 -0.1074 0.0175  228 GLY F CA    
1767 C  C     . GLY A 229 ? 0.2547 0.2893 0.5696 -0.0124 -0.0962 0.0186  228 GLY F C     
1768 O  O     . GLY A 229 ? 0.2129 0.2579 0.5329 -0.0097 -0.0870 0.0166  228 GLY F O     
1769 N  N     . ILE A 230 ? 0.2592 0.2886 0.5696 -0.0167 -0.0961 0.0216  229 ILE F N     
1770 C  CA    . ILE A 230 ? 0.1896 0.2239 0.5024 -0.0171 -0.0848 0.0229  229 ILE F CA    
1771 C  C     . ILE A 230 ? 0.1640 0.2080 0.4751 -0.0149 -0.0726 0.0268  229 ILE F C     
1772 O  O     . ILE A 230 ? 0.2201 0.2576 0.5160 -0.0154 -0.0706 0.0290  229 ILE F O     
1773 C  CB    . ILE A 230 ? 0.1991 0.2160 0.4942 -0.0211 -0.0853 0.0227  229 ILE F CB    
1774 C  CG1   . ILE A 230 ? 0.2800 0.2883 0.5774 -0.0241 -0.0982 0.0190  229 ILE F CG1   
1775 C  CG2   . ILE A 230 ? 0.1860 0.2065 0.4845 -0.0208 -0.0728 0.0242  229 ILE F CG2   
1776 C  CD1   . ILE A 230 ? 0.3264 0.3159 0.6026 -0.0289 -0.1003 0.0176  229 ILE F CD1   
1873 N  N     . LYS A 242 ? 0.2994 0.3171 0.3593 0.0177  0.1077  0.0656  241 LYS F N     
1874 C  CA    . LYS A 242 ? 0.2652 0.2905 0.3230 0.0232  0.1098  0.0675  241 LYS F CA    
1875 C  C     . LYS A 242 ? 0.3263 0.3682 0.3851 0.0304  0.1026  0.0761  241 LYS F C     
1876 O  O     . LYS A 242 ? 0.3199 0.3671 0.3752 0.0369  0.1048  0.0781  241 LYS F O     
1877 C  CB    . LYS A 242 ? 0.2567 0.2972 0.3216 0.0183  0.1091  0.0611  241 LYS F CB    
1878 C  CG    . LYS A 242 ? 0.3617 0.3871 0.4266 0.0125  0.1172  0.0521  241 LYS F CG    
1879 C  CD    . LYS A 242 ? 0.3984 0.4426 0.4713 0.0080  0.1158  0.0449  241 LYS F CD    
1880 C  CE    . LYS A 242 ? 0.4427 0.4706 0.5177 0.0024  0.1239  0.0356  241 LYS F CE    
1881 N  NZ    . LYS A 242 ? 0.5410 0.5888 0.6246 -0.0012 0.1226  0.0277  241 LYS F NZ    
1882 N  N     . SER A 243 ? 0.2440 0.2948 0.3083 0.0298  0.0943  0.0809  242 SER F N     
1883 C  CA    . SER A 243 ? 0.2002 0.2696 0.2687 0.0357  0.0864  0.0893  242 SER F CA    
1884 C  C     . SER A 243 ? 0.2857 0.3544 0.3567 0.0361  0.0812  0.0936  242 SER F C     
1885 O  O     . SER A 243 ? 0.2749 0.3331 0.3463 0.0306  0.0819  0.0897  242 SER F O     
1886 C  CB    . SER A 243 ? 0.2613 0.3528 0.3387 0.0332  0.0790  0.0909  242 SER F CB    
1887 O  OG    . SER A 243 ? 0.2579 0.3515 0.3419 0.0262  0.0736  0.0895  242 SER F OG    
1888 N  N     . VAL A 244 ? 0.2291 0.3101 0.3018 0.0426  0.0761  0.1012  243 VAL F N     
1889 C  CA    . VAL A 244 ? 0.2917 0.3769 0.3687 0.0431  0.0702  0.1056  243 VAL F CA    
1890 C  C     . VAL A 244 ? 0.3108 0.4197 0.3965 0.0451  0.0605  0.1137  243 VAL F C     
1891 O  O     . VAL A 244 ? 0.2716 0.3902 0.3544 0.0511  0.0610  0.1173  243 VAL F O     
1892 C  CB    . VAL A 244 ? 0.2585 0.3310 0.3250 0.0498  0.0760  0.1066  243 VAL F CB    
1893 C  CG1   . VAL A 244 ? 0.2526 0.3314 0.3244 0.0491  0.0700  0.1097  243 VAL F CG1   
1894 C  CG2   . VAL A 244 ? 0.3058 0.3517 0.3594 0.0482  0.0868  0.1000  243 VAL F CG2   
1895 N  N     . GLY A 245 ? 0.2350 0.3523 0.3294 0.0401  0.0521  0.1167  244 GLY F N     
1896 C  CA    . GLY A 245 ? 0.2422 0.3789 0.3422 0.0402  0.0434  0.1254  244 GLY F CA    
1897 C  C     . GLY A 245 ? 0.3239 0.4636 0.4292 0.0383  0.0370  0.1299  244 GLY F C     
1898 O  O     . GLY A 245 ? 0.2389 0.3686 0.3466 0.0350  0.0369  0.1259  244 GLY F O     
1899 N  N     . VAL A 246 ? 0.2391 0.3923 0.3448 0.0390  0.0326  0.1369  245 VAL F N     
1900 C  CA    . VAL A 246 ? 0.1601 0.3157 0.2693 0.0337  0.0278  0.1381  245 VAL F CA    
1901 C  C     . VAL A 246 ? 0.1954 0.3660 0.3081 0.0293  0.0233  0.1447  245 VAL F C     
1902 O  O     . VAL A 246 ? 0.2261 0.4093 0.3362 0.0327  0.0251  0.1488  245 VAL F O     
1903 C  CB    . VAL A 246 ? 0.2112 0.3670 0.3162 0.0382  0.0309  0.1380  245 VAL F CB    
1904 C  CG1   . VAL A 246 ? 0.3249 0.4842 0.4357 0.0323  0.0263  0.1408  245 VAL F CG1   
1905 C  CG2   . VAL A 246 ? 0.2679 0.4113 0.3699 0.0456  0.0381  0.1349  245 VAL F CG2   
1906 N  N     . GLU A 247 ? 0.2123 0.3823 0.3314 0.0226  0.0181  0.1467  246 GLU F N     
1907 C  CA    . GLU A 247 ? 0.1693 0.3532 0.2933 0.0188  0.0147  0.1545  246 GLU F CA    
1908 C  C     . GLU A 247 ? 0.1997 0.3811 0.3322 0.0123  0.0097  0.1575  246 GLU F C     
1909 O  O     . GLU A 247 ? 0.1753 0.3436 0.3088 0.0104  0.0083  0.1524  246 GLU F O     
1910 C  CB    . GLU A 247 ? 0.2036 0.3919 0.3267 0.0188  0.0144  0.1555  246 GLU F CB    
1911 C  CG    . GLU A 247 ? 0.2473 0.4250 0.3726 0.0156  0.0120  0.1520  246 GLU F CG    
1912 C  CD    . GLU A 247 ? 0.3249 0.5055 0.4468 0.0179  0.0139  0.1512  246 GLU F CD    
1913 O  OE1   . GLU A 247 ? 0.3485 0.5311 0.4654 0.0232  0.0183  0.1495  246 GLU F OE1   
1914 O  OE2   . GLU A 247 ? 0.3209 0.5019 0.4453 0.0148  0.0113  0.1524  246 GLU F OE2   
1915 N  N     . ARG A 248 ? 0.2218 0.4173 0.3615 0.0091  0.0073  0.1668  247 ARG F N     
1916 C  CA    . ARG A 248 ? 0.3041 0.4996 0.4548 0.0030  0.0024  0.1724  247 ARG F CA    
1917 C  C     . ARG A 248 ? 0.1941 0.4031 0.3527 -0.0003 -0.0004 0.1824  247 ARG F C     
1918 O  O     . ARG A 248 ? 0.2153 0.4406 0.3740 0.0011  0.0018  0.1868  247 ARG F O     
1919 C  CB    . ARG A 248 ? 0.3695 0.5703 0.5265 0.0015  0.0027  0.1720  247 ARG F CB    
1920 C  CG    . ARG A 248 ? 0.5950 0.7825 0.7561 -0.0015 0.0002  0.1673  247 ARG F CG    
1921 C  CD    . ARG A 248 ? 0.5646 0.7366 0.7142 0.0027  0.0024  0.1609  247 ARG F CD    
1922 N  NE    . ARG A 248 ? 0.5073 0.6658 0.6585 0.0008  0.0006  0.1553  247 ARG F NE    
1923 C  CZ    . ARG A 248 ? 0.5628 0.7093 0.7060 0.0039  0.0032  0.1463  247 ARG F CZ    
1924 N  NH1   . ARG A 248 ? 0.3930 0.5393 0.5285 0.0085  0.0072  0.1429  247 ARG F NH1   
1925 N  NH2   . ARG A 248 ? 0.5706 0.7070 0.7155 0.0025  0.0020  0.1418  247 ARG F NH2   
1926 N  N     . THR A 249 ? 0.1733 0.3762 0.3392 -0.0048 -0.0047 0.1844  248 THR F N     
1927 C  CA    . THR A 249 ? 0.1999 0.4151 0.3768 -0.0087 -0.0080 0.1958  248 THR F CA    
1928 C  C     . THR A 249 ? 0.1722 0.3899 0.3641 -0.0145 -0.0106 0.1976  248 THR F C     
1929 O  O     . THR A 249 ? 0.2281 0.4327 0.4237 -0.0165 -0.0131 0.1929  248 THR F O     
1930 C  CB    . THR A 249 ? 0.2460 0.4536 0.4239 -0.0103 -0.0103 0.1942  248 THR F CB    
1931 O  OG1   . THR A 249 ? 0.2010 0.4078 0.3672 -0.0063 -0.0070 0.1880  248 THR F OG1   
1932 C  CG2   . THR A 249 ? 0.1835 0.4039 0.3746 -0.0144 -0.0140 0.2072  248 THR F CG2   
1933 N  N     . MET A 250 ? 0.2594 0.4952 0.4615 -0.0173 -0.0098 0.2019  249 MET F N     
1934 C  CA    . MET A 250 ? 0.2210 0.4631 0.4411 -0.0230 -0.0121 0.2005  249 MET F CA    
1935 C  C     . MET A 250 ? 0.3001 0.5395 0.5349 -0.0289 -0.0173 0.2079  249 MET F C     
1936 O  O     . MET A 250 ? 0.2021 0.4425 0.4351 -0.0286 -0.0184 0.2165  249 MET F O     
1937 C  CB    . MET A 250 ? 0.2212 0.4864 0.4490 -0.0233 -0.0091 0.2002  249 MET F CB    
1938 C  CG    . MET A 250 ? 0.4403 0.7100 0.6645 -0.0189 -0.0063 0.1896  249 MET F CG    
1939 S  SD    . MET A 250 ? 0.5281 0.7865 0.7268 -0.0103 -0.0013 0.1863  249 MET F SD    
1940 C  CE    . MET A 250 ? 0.2268 0.4998 0.4200 -0.0083 0.0013  0.1951  249 MET F CE    
1941 N  N     . ALA A 251 ? 0.2257 0.4628 0.4765 -0.0341 -0.0208 0.2040  250 ALA F N     
1942 C  CA    . ALA A 251 ? 0.2845 0.5179 0.5513 -0.0397 -0.0260 0.2105  250 ALA F CA    
1943 C  C     . ALA A 251 ? 0.2638 0.5162 0.5432 -0.0435 -0.0254 0.2208  250 ALA F C     
1944 O  O     . ALA A 251 ? 0.3016 0.5525 0.5887 -0.0461 -0.0285 0.2301  250 ALA F O     
1945 C  CB    . ALA A 251 ? 0.2933 0.5218 0.5763 -0.0444 -0.0303 0.2023  250 ALA F CB    
1946 N  N     . GLU A 252 ? 0.2568 0.5285 0.5395 -0.0436 -0.0215 0.2190  251 GLU F N     
1947 C  CA    . GLU A 252 ? 0.2330 0.5261 0.5261 -0.0467 -0.0193 0.2279  251 GLU F CA    
1948 C  C     . GLU A 252 ? 0.1837 0.4890 0.4606 -0.0404 -0.0136 0.2275  251 GLU F C     
1949 O  O     . GLU A 252 ? 0.2206 0.5232 0.4863 -0.0355 -0.0113 0.2181  251 GLU F O     
1950 C  CB    . GLU A 252 ? 0.2348 0.5449 0.5532 -0.0535 -0.0200 0.2242  251 GLU F CB    
1951 C  CG    . GLU A 252 ? 0.5020 0.8015 0.8386 -0.0594 -0.0261 0.2205  251 GLU F CG    
1952 C  CD    . GLU A 252 ? 0.6596 0.9541 1.0079 -0.0648 -0.0293 0.2326  251 GLU F CD    
1953 O  OE1   . GLU A 252 ? 0.8350 1.1168 1.1956 -0.0686 -0.0347 0.2303  251 GLU F OE1   
1954 O  OE2   . GLU A 252 ? 0.6680 0.9723 1.0138 -0.0648 -0.0266 0.2441  251 GLU F OE2   
1955 N  N     . ASP A 253 ? 0.2182 0.5381 0.4948 -0.0405 -0.0113 0.2372  252 ASP F N     
1956 C  CA    . ASP A 253 ? 0.2011 0.5354 0.4646 -0.0347 -0.0060 0.2360  252 ASP F CA    
1957 C  C     . ASP A 253 ? 0.3818 0.7335 0.6553 -0.0352 -0.0030 0.2277  252 ASP F C     
1958 O  O     . ASP A 253 ? 0.2846 0.6462 0.5800 -0.0416 -0.0045 0.2263  252 ASP F O     
1959 C  CB    . ASP A 253 ? 0.1969 0.5481 0.4615 -0.0352 -0.0041 0.2476  252 ASP F CB    
1960 C  CG    . ASP A 253 ? 0.3828 0.7218 0.6401 -0.0338 -0.0076 0.2554  252 ASP F CG    
1961 O  OD1   . ASP A 253 ? 0.3209 0.6382 0.5677 -0.0308 -0.0107 0.2508  252 ASP F OD1   
1962 O  OD2   . ASP A 253 ? 0.3683 0.7217 0.6317 -0.0357 -0.0072 0.2658  252 ASP F OD2   
1963 N  N     . ILE A 254 ? 0.2472 0.6039 0.5063 -0.0279 0.0009  0.2213  253 ILE F N     
1964 C  CA    . ILE A 254 ? 0.2135 0.5907 0.4819 -0.0262 0.0036  0.2131  253 ILE F CA    
1965 C  C     . ILE A 254 ? 0.1940 0.5952 0.4627 -0.0248 0.0082  0.2189  253 ILE F C     
1966 O  O     . ILE A 254 ? 0.2289 0.6283 0.4834 -0.0221 0.0097  0.2261  253 ILE F O     
1967 C  CB    . ILE A 254 ? 0.2345 0.6036 0.4892 -0.0182 0.0047  0.2014  253 ILE F CB    
1968 C  CG1   . ILE A 254 ? 0.2351 0.5982 0.4659 -0.0108 0.0085  0.2031  253 ILE F CG1   
1969 C  CG2   . ILE A 254 ? 0.3235 0.6699 0.5778 -0.0197 0.0005  0.1959  253 ILE F CG2   
1970 C  CD1   . ILE A 254 ? 0.2641 0.6201 0.4821 -0.0027 0.0105  0.1926  253 ILE F CD1   
1971 N  N     . HIS A 255 ? 0.2002 0.6260 0.4869 -0.0265 0.0099  0.2147  254 HIS F N     
1972 C  CA    . HIS A 255 ? 0.2308 0.6829 0.5212 -0.0258 0.0147  0.2193  254 HIS F CA    
1973 C  C     . HIS A 255 ? 0.2735 0.7458 0.5672 -0.0191 0.0174  0.2081  254 HIS F C     
1974 O  O     . HIS A 255 ? 0.2160 0.7124 0.5135 -0.0177 0.0217  0.2103  254 HIS F O     
1975 C  CB    . HIS A 255 ? 0.2267 0.6948 0.5414 -0.0360 0.0148  0.2278  254 HIS F CB    
1976 C  CG    . HIS A 255 ? 0.2637 0.7170 0.5754 -0.0410 0.0125  0.2408  254 HIS F CG    
1977 N  ND1   . HIS A 255 ? 0.2649 0.6965 0.5824 -0.0459 0.0072  0.2416  254 HIS F ND1   
1978 C  CD2   . HIS A 255 ? 0.3071 0.7651 0.6112 -0.0409 0.0142  0.2527  254 HIS F CD2   
1979 C  CE1   . HIS A 255 ? 0.2779 0.7015 0.5923 -0.0483 0.0056  0.2537  254 HIS F CE1   
1980 N  NE2   . HIS A 255 ? 0.3800 0.8197 0.6864 -0.0453 0.0097  0.2606  254 HIS F NE2   
1981 N  N     . HIS A 256 ? 0.2008 0.6649 0.4936 -0.0142 0.0149  0.1961  255 HIS F N     
1982 C  CA    . HIS A 256 ? 0.2486 0.7325 0.5486 -0.0068 0.0156  0.1842  255 HIS F CA    
1983 C  C     . HIS A 256 ? 0.2092 0.6769 0.4874 0.0039  0.0155  0.1766  255 HIS F C     
1984 O  O     . HIS A 256 ? 0.2178 0.6605 0.4857 0.0037  0.0130  0.1756  255 HIS F O     
1985 C  CB    . HIS A 256 ? 0.2125 0.7084 0.5408 -0.0106 0.0107  0.1748  255 HIS F CB    
1986 C  CG    . HIS A 256 ? 0.2307 0.7424 0.5836 -0.0221 0.0112  0.1815  255 HIS F CG    
1987 N  ND1   . HIS A 256 ? 0.2292 0.7686 0.5936 -0.0242 0.0160  0.1855  255 HIS F ND1   
1988 C  CD2   . HIS A 256 ? 0.2885 0.7920 0.6570 -0.0324 0.0077  0.1851  255 HIS F CD2   
1989 C  CE1   . HIS A 256 ? 0.2809 0.8287 0.6676 -0.0356 0.0160  0.1916  255 HIS F CE1   
1990 N  NE2   . HIS A 256 ? 0.3017 0.8275 0.6913 -0.0407 0.0108  0.1914  255 HIS F NE2   
1991 N  N     . TRP A 257 ? 0.2356 0.7184 0.5077 0.0134  0.0184  0.1710  256 TRP F N     
1992 C  CA    . TRP A 257 ? 0.1891 0.6579 0.4417 0.0244  0.0188  0.1637  256 TRP F CA    
1993 C  C     . TRP A 257 ? 0.1834 0.6412 0.4417 0.0276  0.0132  0.1538  256 TRP F C     
1994 O  O     . TRP A 257 ? 0.1768 0.6122 0.4181 0.0322  0.0131  0.1516  256 TRP F O     
1995 C  CB    . TRP A 257 ? 0.1943 0.6838 0.4438 0.0349  0.0218  0.1579  256 TRP F CB    
1996 C  CG    . TRP A 257 ? 0.1904 0.6669 0.4253 0.0471  0.0209  0.1487  256 TRP F CG    
1997 C  CD1   . TRP A 257 ? 0.2085 0.6944 0.4509 0.0575  0.0169  0.1372  256 TRP F CD1   
1998 C  CD2   . TRP A 257 ? 0.1840 0.6343 0.3951 0.0506  0.0233  0.1504  256 TRP F CD2   
1999 N  NE1   . TRP A 257 ? 0.1908 0.6573 0.4138 0.0677  0.0171  0.1326  256 TRP F NE1   
2000 C  CE2   . TRP A 257 ? 0.2255 0.6704 0.4301 0.0630  0.0217  0.1403  256 TRP F CE2   
2001 C  CE3   . TRP A 257 ? 0.1793 0.6107 0.3749 0.0451  0.0261  0.1590  256 TRP F CE3   
2002 C  CZ2   . TRP A 257 ? 0.2222 0.6436 0.4060 0.0691  0.0241  0.1391  256 TRP F CZ2   
2003 C  CZ3   . TRP A 257 ? 0.2525 0.6615 0.4289 0.0509  0.0280  0.1567  256 TRP F CZ3   
2004 C  CH2   . TRP A 257 ? 0.1744 0.5786 0.3453 0.0622  0.0277  0.1471  256 TRP F CH2   
2005 N  N     . SER A 258 ? 0.1870 0.6615 0.4704 0.0257  0.0082  0.1471  257 SER F N     
2006 C  CA    . SER A 258 ? 0.1992 0.6649 0.4892 0.0298  0.0010  0.1366  257 SER F CA    
2007 C  C     . SER A 258 ? 0.1756 0.6127 0.4553 0.0233  0.0000  0.1412  257 SER F C     
2008 O  O     . SER A 258 ? 0.1708 0.5919 0.4411 0.0296  -0.0031 0.1349  257 SER F O     
2009 C  CB    . SER A 258 ? 0.2079 0.6966 0.5298 0.0268  -0.0054 0.1287  257 SER F CB    
2010 O  OG    . SER A 258 ? 0.2307 0.7238 0.5675 0.0127  -0.0038 0.1371  257 SER F OG    
2011 N  N     . GLU A 259 ? 0.1757 0.6063 0.4573 0.0116  0.0022  0.1522  258 GLU F N     
2012 C  CA    . GLU A 259 ? 0.1695 0.5731 0.4422 0.0058  0.0008  0.1566  258 GLU F CA    
2013 C  C     . GLU A 259 ? 0.2505 0.6323 0.4951 0.0110  0.0052  0.1599  258 GLU F C     
2014 O  O     . GLU A 259 ? 0.2174 0.5783 0.4529 0.0117  0.0037  0.1575  258 GLU F O     
2015 C  CB    . GLU A 259 ? 0.1737 0.5758 0.4555 -0.0061 0.0010  0.1681  258 GLU F CB    
2016 C  CG    . GLU A 259 ? 0.1953 0.6199 0.5067 -0.0125 -0.0022 0.1656  258 GLU F CG    
2017 C  CD    . GLU A 259 ? 0.3708 0.7938 0.6899 -0.0234 -0.0011 0.1786  258 GLU F CD    
2018 O  OE1   . GLU A 259 ? 0.5440 0.9584 0.8765 -0.0307 -0.0056 0.1788  258 GLU F OE1   
2019 O  OE2   . GLU A 259 ? 0.3345 0.7646 0.6459 -0.0240 0.0037  0.1885  258 GLU F OE2   
2020 N  N     . CYS A 260 ? 0.1651 0.5527 0.3972 0.0145  0.0105  0.1648  259 CYS F N     
2021 C  CA    . CYS A 260 ? 0.1599 0.5288 0.3676 0.0197  0.0144  0.1665  259 CYS F CA    
2022 C  C     . CYS A 260 ? 0.1566 0.5192 0.3564 0.0300  0.0144  0.1562  259 CYS F C     
2023 O  O     . CYS A 260 ? 0.1556 0.4963 0.3425 0.0314  0.0152  0.1552  259 CYS F O     
2024 C  CB    . CYS A 260 ? 0.1855 0.5659 0.3842 0.0225  0.0190  0.1715  259 CYS F CB    
2025 S  SG    . CYS A 260 ? 0.2274 0.5856 0.4000 0.0274  0.0227  0.1735  259 CYS F SG    
2026 N  N     . GLU A 261 ? 0.1619 0.5440 0.3699 0.0382  0.0131  0.1483  260 GLU F N     
2027 C  CA    . GLU A 261 ? 0.1621 0.5390 0.3631 0.0504  0.0114  0.1386  260 GLU F CA    
2028 C  C     . GLU A 261 ? 0.1579 0.5204 0.3628 0.0492  0.0060  0.1341  260 GLU F C     
2029 O  O     . GLU A 261 ? 0.1894 0.5345 0.3801 0.0561  0.0065  0.1309  260 GLU F O     
2030 C  CB    . GLU A 261 ? 0.1710 0.5730 0.3842 0.0597  0.0081  0.1306  260 GLU F CB    
2031 C  CG    . GLU A 261 ? 0.1858 0.5840 0.3854 0.0758  0.0080  0.1232  260 GLU F CG    
2032 C  CD    . GLU A 261 ? 0.4204 0.8045 0.6173 0.0837  0.0014  0.1160  260 GLU F CD    
2033 O  OE1   . GLU A 261 ? 0.6038 0.9728 0.7809 0.0937  0.0042  0.1164  260 GLU F OE1   
2034 O  OE2   . GLU A 261 ? 0.4913 0.8819 0.7053 0.0809  -0.0063 0.1116  260 GLU F OE2   
2035 N  N     . ALA A 262 ? 0.2038 0.5731 0.4280 0.0407  0.0007  0.1338  261 ALA F N     
2036 C  CA    . ALA A 262 ? 0.2008 0.5583 0.4300 0.0399  -0.0057 0.1282  261 ALA F CA    
2037 C  C     . ALA A 262 ? 0.1919 0.5227 0.4048 0.0346  -0.0016 0.1341  261 ALA F C     
2038 O  O     . ALA A 262 ? 0.2059 0.5227 0.4119 0.0393  -0.0041 0.1289  261 ALA F O     
2039 C  CB    . ALA A 262 ? 0.2274 0.5983 0.4825 0.0311  -0.0121 0.1261  261 ALA F CB    
2040 N  N     . ILE A 263 ? 0.1568 0.4805 0.3634 0.0258  0.0036  0.1448  262 ILE F N     
2041 C  CA    . ILE A 263 ? 0.1510 0.4498 0.3429 0.0215  0.0066  0.1501  262 ILE F CA    
2042 C  C     . ILE A 263 ? 0.2093 0.4962 0.3816 0.0307  0.0117  0.1475  262 ILE F C     
2043 O  O     . ILE A 263 ? 0.1781 0.4474 0.3421 0.0317  0.0124  0.1454  262 ILE F O     
2044 C  CB    . ILE A 263 ? 0.1384 0.4335 0.3280 0.0132  0.0085  0.1614  262 ILE F CB    
2045 C  CG1   . ILE A 263 ? 0.2186 0.5201 0.4275 0.0040  0.0034  0.1648  262 ILE F CG1   
2046 C  CG2   . ILE A 263 ? 0.1474 0.4181 0.3208 0.0121  0.0105  0.1651  262 ILE F CG2   
2047 C  CD1   . ILE A 263 ? 0.2827 0.5932 0.4946 -0.0008 0.0045  0.1749  262 ILE F CD1   
2048 N  N     . ILE A 264 ? 0.1932 0.4900 0.3586 0.0376  0.0156  0.1474  263 ILE F N     
2049 C  CA    . ILE A 264 ? 0.1382 0.4240 0.2863 0.0473  0.0206  0.1445  263 ILE F CA    
2050 C  C     . ILE A 264 ? 0.1496 0.4343 0.2961 0.0576  0.0186  0.1399  263 ILE F C     
2051 O  O     . ILE A 264 ? 0.1716 0.4423 0.3044 0.0633  0.0234  0.1426  263 ILE F O     
2052 C  CB    . ILE A 264 ? 0.1854 0.4857 0.3294 0.0543  0.0239  0.1442  263 ILE F CB    
2053 C  CG1   . ILE A 264 ? 0.1668 0.4686 0.3080 0.0469  0.0262  0.1525  263 ILE F CG1   
2054 C  CG2   . ILE A 264 ? 0.1903 0.4845 0.3184 0.0676  0.0291  0.1433  263 ILE F CG2   
2055 C  CD1   . ILE A 264 ? 0.2238 0.5444 0.3641 0.0529  0.0285  0.1516  263 ILE F CD1   
2056 N  N     . GLU A 265 ? 0.2006 0.5002 0.3609 0.0618  0.0109  0.1329  264 GLU F N     
2057 C  CA    . GLU A 265 ? 0.2106 0.5074 0.3672 0.0738  0.0059  0.1278  264 GLU F CA    
2058 C  C     . GLU A 265 ? 0.2125 0.4921 0.3662 0.0688  0.0055  0.1297  264 GLU F C     
2059 O  O     . GLU A 265 ? 0.2270 0.4963 0.3680 0.0798  0.0053  0.1285  264 GLU F O     
2060 C  CB    . GLU A 265 ? 0.1794 0.4942 0.3539 0.0779  -0.0052 0.1186  264 GLU F CB    
2061 C  CG    . GLU A 265 ? 0.2531 0.5859 0.4302 0.0865  -0.0057 0.1154  264 GLU F CG    
2062 C  CD    . GLU A 265 ? 0.2906 0.6176 0.4472 0.1053  -0.0047 0.1140  264 GLU F CD    
2063 O  OE1   . GLU A 265 ? 0.3472 0.6557 0.4877 0.1123  -0.0041 0.1151  264 GLU F OE1   
2064 O  OE2   . GLU A 265 ? 0.3914 0.7310 0.5467 0.1138  -0.0042 0.1115  264 GLU F OE2   
2065 N  N     . ARG A 266 ? 0.1871 0.4615 0.3505 0.0536  0.0051  0.1321  265 ARG F N     
2066 C  CA    . ARG A 266 ? 0.2163 0.4746 0.3775 0.0485  0.0050  0.1337  265 ARG F CA    
2067 C  C     . ARG A 266 ? 0.2649 0.5061 0.4094 0.0470  0.0152  0.1419  265 ARG F C     
2068 O  O     . ARG A 266 ? 0.2893 0.5186 0.4262 0.0505  0.0179  0.1432  265 ARG F O     
2069 C  CB    . ARG A 266 ? 0.2365 0.4934 0.4134 0.0344  -0.0002 0.1321  265 ARG F CB    
2070 C  CG    . ARG A 266 ? 0.2541 0.5281 0.4509 0.0351  -0.0100 0.1232  265 ARG F CG    
2071 C  CD    . ARG A 266 ? 0.3781 0.6518 0.5903 0.0215  -0.0129 0.1267  265 ARG F CD    
2072 N  NE    . ARG A 266 ? 0.4209 0.7128 0.6554 0.0214  -0.0221 0.1190  265 ARG F NE    
2073 C  CZ    . ARG A 266 ? 0.4765 0.7749 0.7284 0.0108  -0.0243 0.1225  265 ARG F CZ    
2074 N  NH1   . ARG A 266 ? 0.4347 0.7212 0.6820 0.0009  -0.0192 0.1342  265 ARG F NH1   
2075 N  NH2   . ARG A 266 ? 0.4752 0.7916 0.7492 0.0112  -0.0326 0.1139  265 ARG F NH2   
2076 N  N     . LEU A 267 ? 0.2326 0.4722 0.3714 0.0430  0.0202  0.1466  266 LEU F N     
2077 C  CA    . LEU A 267 ? 0.2398 0.4620 0.3644 0.0422  0.0272  0.1527  266 LEU F CA    
2078 C  C     . LEU A 267 ? 0.2138 0.4335 0.3248 0.0559  0.0355  0.1545  266 LEU F C     
2079 O  O     . LEU A 267 ? 0.2205 0.4241 0.3220 0.0577  0.0418  0.1586  266 LEU F O     
2080 C  CB    . LEU A 267 ? 0.1983 0.4190 0.3201 0.0374  0.0267  0.1541  266 LEU F CB    
2081 C  CG    . LEU A 267 ? 0.2793 0.5016 0.4112 0.0268  0.0207  0.1560  266 LEU F CG    
2082 C  CD1   . LEU A 267 ? 0.1949 0.4236 0.3232 0.0272  0.0215  0.1608  266 LEU F CD1   
2083 C  CD2   . LEU A 267 ? 0.3126 0.5172 0.4452 0.0207  0.0175  0.1573  266 LEU F CD2   
2084 N  N     . TYR A 268 ? 0.1884 0.4218 0.2974 0.0672  0.0355  0.1508  267 TYR F N     
2085 C  CA    . TYR A 268 ? 0.2127 0.4393 0.3049 0.0824  0.0438  0.1515  267 TYR F CA    
2086 C  C     . TYR A 268 ? 0.2367 0.4471 0.3186 0.0912  0.0476  0.1506  267 TYR F C     
2087 O  O     . TYR A 268 ? 0.2599 0.4540 0.3294 0.0962  0.0590  0.1536  267 TYR F O     
2088 C  CB    . TYR A 268 ? 0.1959 0.4369 0.2863 0.0950  0.0399  0.1458  267 TYR F CB    
2089 C  CG    . TYR A 268 ? 0.2171 0.4443 0.2865 0.1122  0.0476  0.1455  267 TYR F CG    
2090 C  CD1   . TYR A 268 ? 0.1977 0.4197 0.2589 0.1136  0.0565  0.1491  267 TYR F CD1   
2091 C  CD2   . TYR A 268 ? 0.2471 0.4603 0.3015 0.1273  0.0451  0.1412  267 TYR F CD2   
2092 C  CE1   . TYR A 268 ? 0.2486 0.4532 0.2901 0.1295  0.0643  0.1481  267 TYR F CE1   
2093 C  CE2   . TYR A 268 ? 0.3234 0.5152 0.3540 0.1428  0.0522  0.1406  267 TYR F CE2   
2094 C  CZ    . TYR A 268 ? 0.2926 0.4805 0.3182 0.1437  0.0624  0.1438  267 TYR F CZ    
2095 O  OH    . TYR A 268 ? 0.3354 0.4980 0.3372 0.1589  0.0696  0.1424  267 TYR F OH    
2096 N  N     . PRO A 269 ? 0.3040 0.5149 0.3888 0.0946  0.0382  0.1454  268 PRO F N     
2097 C  CA    . PRO A 269 ? 0.3549 0.5440 0.4232 0.1040  0.0404  0.1441  268 PRO F CA    
2098 C  C     . PRO A 269 ? 0.2728 0.4499 0.3443 0.0938  0.0499  0.1488  268 PRO F C     
2099 O  O     . PRO A 269 ? 0.3043 0.4575 0.3584 0.1015  0.0574  0.1474  268 PRO F O     
2100 C  CB    . PRO A 269 ? 0.3853 0.5806 0.4599 0.1058  0.0257  0.1378  268 PRO F CB    
2101 C  CG    . PRO A 269 ? 0.3481 0.5673 0.4403 0.1023  0.0172  0.1340  268 PRO F CG    
2102 C  CD    . PRO A 269 ? 0.2416 0.4695 0.3433 0.0901  0.0249  0.1397  268 PRO F CD    
2103 N  N     . GLU A 270 ? 0.2454 0.4336 0.3360 0.0761  0.0490  0.1532  269 GLU F N     
2104 C  CA    . GLU A 270 ? 0.2535 0.4258 0.3480 0.0662  0.0526  0.1519  269 GLU F CA    
2105 C  C     . GLU A 270 ? 0.1900 0.3480 0.2819 0.0705  0.0573  0.1437  269 GLU F C     
2106 O  O     . GLU A 270 ? 0.2404 0.3787 0.3279 0.0747  0.0616  0.1411  269 GLU F O     
2107 C  CB    . GLU A 270 ? 0.2696 0.4413 0.3760 0.0496  0.0409  0.1515  269 GLU F CB    
2108 C  CG    . GLU A 270 ? 0.4189 0.6035 0.5369 0.0455  0.0351  0.1550  269 GLU F CG    
2109 C  CD    . GLU A 270 ? 0.5900 0.7675 0.7054 0.0518  0.0375  0.1525  269 GLU F CD    
2110 O  OE1   . GLU A 270 ? 0.5211 0.6858 0.6394 0.0441  0.0385  0.1516  269 GLU F OE1   
2111 O  OE2   . GLU A 270 ? 0.6813 0.8567 0.7849 0.0668  0.0338  0.1472  269 GLU F OE2   
2112 N  N     . LEU A 271 ? 0.2270 0.3843 0.3095 0.0702  0.0542  0.1474  270 LEU F N     
2113 C  CA    . LEU A 271 ? 0.2257 0.3726 0.3076 0.0774  0.0585  0.1427  270 LEU F CA    
2114 C  C     . LEU A 271 ? 0.2360 0.3706 0.3038 0.0931  0.0729  0.1421  270 LEU F C     
2115 O  O     . LEU A 271 ? 0.2395 0.3509 0.3009 0.0961  0.0802  0.1391  270 LEU F O     
2116 C  CB    . LEU A 271 ? 0.2514 0.4093 0.3300 0.0761  0.0560  0.1459  270 LEU F CB    
2117 C  CG    . LEU A 271 ? 0.2677 0.4157 0.3414 0.0827  0.0620  0.1436  270 LEU F CG    
2118 C  CD1   . LEU A 271 ? 0.3034 0.4362 0.3837 0.0756  0.0621  0.1382  270 LEU F CD1   
2119 C  CD2   . LEU A 271 ? 0.2664 0.4311 0.3386 0.0825  0.0594  0.1470  270 LEU F CD2   
2120 N  N     . GLU A 272 ? 0.2284 0.3729 0.2834 0.1043  0.0779  0.1468  271 GLU F N     
2121 C  CA    . GLU A 272 ? 0.2791 0.3955 0.3051 0.1202  0.0852  0.1448  271 GLU F CA    
2122 C  C     . GLU A 272 ? 0.3150 0.3997 0.3282 0.1159  0.0867  0.1401  271 GLU F C     
2123 O  O     . GLU A 272 ? 0.3262 0.3780 0.3192 0.1183  0.0943  0.1359  271 GLU F O     
2124 C  CB    . GLU A 272 ? 0.2906 0.4115 0.3006 0.1314  0.0762  0.1449  271 GLU F CB    
2125 C  CG    . GLU A 272 ? 0.3928 0.4801 0.3693 0.1469  0.0788  0.1413  271 GLU F CG    
2126 C  CD    . GLU A 272 ? 0.6790 0.7734 0.6451 0.1590  0.0665  0.1388  271 GLU F CD    
2127 O  OE1   . GLU A 272 ? 0.7937 0.9067 0.7737 0.1542  0.0555  0.1378  271 GLU F OE1   
2128 O  OE2   . GLU A 272 ? 0.7109 0.7925 0.6569 0.1732  0.0671  0.1368  271 GLU F OE2   
2129 N  N     . ARG A 273 ? 0.2639 0.3581 0.2874 0.1081  0.0800  0.1409  272 ARG F N     
2130 C  CA    . ARG A 273 ? 0.2937 0.3606 0.3027 0.1040  0.0814  0.1366  272 ARG F CA    
2131 C  C     . ARG A 273 ? 0.3415 0.3906 0.3549 0.0920  0.0869  0.1301  272 ARG F C     
2132 O  O     . ARG A 273 ? 0.3351 0.3536 0.3277 0.0909  0.0932  0.1250  272 ARG F O     
2133 C  CB    . ARG A 273 ? 0.3113 0.3956 0.3337 0.0982  0.0724  0.1391  272 ARG F CB    
2134 C  CG    . ARG A 273 ? 0.3466 0.4094 0.3611 0.0909  0.0742  0.1349  272 ARG F CG    
2135 C  CD    . ARG A 273 ? 0.3485 0.4308 0.3800 0.0854  0.0647  0.1383  272 ARG F CD    
2136 N  NE    . ARG A 273 ? 0.3874 0.4517 0.4137 0.0777  0.0672  0.1342  272 ARG F NE    
2137 C  CZ    . ARG A 273 ? 0.3831 0.4511 0.4293 0.0637  0.0671  0.1302  272 ARG F CZ    
2138 N  NH1   . ARG A 273 ? 0.3163 0.4034 0.3873 0.0571  0.0629  0.1300  272 ARG F NH1   
2139 N  NH2   . ARG A 273 ? 0.4187 0.4701 0.4575 0.0572  0.0694  0.1250  272 ARG F NH2   
2140 N  N     . ARG A 274 ? 0.2495 0.3171 0.2884 0.0824  0.0825  0.1291  273 ARG F N     
2141 C  CA    . ARG A 274 ? 0.2573 0.3075 0.2967 0.0696  0.0837  0.1199  273 ARG F CA    
2142 C  C     . ARG A 274 ? 0.3220 0.3522 0.3472 0.0730  0.0924  0.1166  273 ARG F C     
2143 O  O     . ARG A 274 ? 0.2872 0.2942 0.3016 0.0659  0.0977  0.1091  273 ARG F O     
2144 C  CB    . ARG A 274 ? 0.2674 0.3382 0.3305 0.0590  0.0733  0.1184  273 ARG F CB    
2145 C  CG    . ARG A 274 ? 0.3159 0.3966 0.3903 0.0527  0.0659  0.1194  273 ARG F CG    
2146 C  CD    . ARG A 274 ? 0.2962 0.3960 0.3899 0.0458  0.0539  0.1209  273 ARG F CD    
2147 N  NE    . ARG A 274 ? 0.4054 0.4974 0.4960 0.0391  0.0534  0.1131  273 ARG F NE    
2148 C  CZ    . ARG A 274 ? 0.4003 0.5039 0.5020 0.0349  0.0453  0.1159  273 ARG F CZ    
2149 N  NH1   . ARG A 274 ? 0.2190 0.3351 0.3297 0.0326  0.0358  0.1220  273 ARG F NH1   
2150 N  NH2   . ARG A 274 ? 0.3169 0.4171 0.4177 0.0326  0.0473  0.1129  273 ARG F NH2   
2151 N  N     . LEU A 275 ? 0.3116 0.3519 0.3370 0.0846  0.0945  0.1225  274 LEU F N     
2152 C  CA    . LEU A 275 ? 0.3219 0.3417 0.3328 0.0902  0.1039  0.1206  274 LEU F CA    
2153 C  C     . LEU A 275 ? 0.2832 0.2709 0.2661 0.0970  0.1129  0.1192  274 LEU F C     
2154 O  O     . LEU A 275 ? 0.3823 0.3444 0.3542 0.0932  0.1208  0.1140  274 LEU F O     
2155 C  CB    . LEU A 275 ? 0.3285 0.3673 0.3437 0.1036  0.1042  0.1278  274 LEU F CB    
2156 C  CG    . LEU A 275 ? 0.3517 0.3684 0.3504 0.1123  0.1148  0.1269  274 LEU F CG    
2157 C  CD1   . LEU A 275 ? 0.3194 0.3253 0.3246 0.0987  0.1165  0.1197  274 LEU F CD1   
2158 C  CD2   . LEU A 275 ? 0.3452 0.3839 0.3458 0.1285  0.1146  0.1344  274 LEU F CD2   
2159 N  N     . ALA A 276 ? 0.3945 0.3833 0.3648 0.1067  0.1109  0.1237  275 ALA F N     
2160 C  CA    . ALA A 276 ? 0.4886 0.4460 0.4285 0.1146  0.1172  0.1229  275 ALA F CA    
2161 C  C     . ALA A 276 ? 0.5551 0.4911 0.4897 0.1025  0.1211  0.1168  275 ALA F C     
2162 O  O     . ALA A 276 ? 0.5138 0.4207 0.4267 0.1057  0.1297  0.1151  275 ALA F O     
2163 C  CB    . ALA A 276 ? 0.4232 0.3882 0.3507 0.1263  0.1104  0.1276  275 ALA F CB    
2164 N  N     . LYS A 277 ? 0.4319 0.3825 0.3857 0.0888  0.1150  0.1135  276 LYS F N     
2165 C  CA    . LYS A 277 ? 0.4808 0.4151 0.4308 0.0772  0.1181  0.1069  276 LYS F CA    
2166 C  C     . LYS A 277 ? 0.5611 0.4776 0.5088 0.0716  0.1264  0.1010  276 LYS F C     
2167 O  O     . LYS A 277 ? 0.5545 0.4494 0.4897 0.0682  0.1334  0.0973  276 LYS F O     
2168 C  CB    . LYS A 277 ? 0.4244 0.3791 0.3957 0.0643  0.1091  0.1036  276 LYS F CB    
2169 C  CG    . LYS A 277 ? 0.5003 0.4671 0.4723 0.0682  0.1029  0.1087  276 LYS F CG    
2170 C  CD    . LYS A 277 ? 0.5504 0.5316 0.5416 0.0549  0.0960  0.1045  276 LYS F CD    
2171 C  CE    . LYS A 277 ? 0.6077 0.5986 0.5999 0.0584  0.0911  0.1098  276 LYS F CE    
2172 N  NZ    . LYS A 277 ? 0.5005 0.5018 0.5106 0.0454  0.0855  0.1051  276 LYS F NZ    
2173 N  N     . VAL A 278 ? 0.4290 0.3550 0.3892 0.0708  0.1261  0.1003  277 VAL F N     
2174 C  CA    . VAL A 278 ? 0.4653 0.3766 0.4256 0.0654  0.1336  0.0945  277 VAL F CA    
2175 C  C     . VAL A 278 ? 0.5473 0.4410 0.4930 0.0784  0.1437  0.0984  277 VAL F C     
2176 O  O     . VAL A 278 ? 0.5839 0.4562 0.5230 0.0763  0.1538  0.0942  277 VAL F O     
2177 C  CB    . VAL A 278 ? 0.5705 0.5033 0.5537 0.0538  0.1258  0.0894  277 VAL F CB    
2178 C  CG1   . VAL A 278 ? 0.6707 0.5908 0.6550 0.0506  0.1338  0.0842  277 VAL F CG1   
2179 C  CG2   . VAL A 278 ? 0.6617 0.6022 0.6554 0.0445  0.1213  0.0857  277 VAL F CG2   
2180 N  N     . LYS A 279 ? 0.5038 0.4049 0.4429 0.0924  0.1420  0.1060  278 LYS F N     
2181 C  CA    . LYS A 279 ? 0.4497 0.3366 0.3740 0.1066  0.1506  0.1098  278 LYS F CA    
2182 C  C     . LYS A 279 ? 0.5243 0.4109 0.4297 0.1221  0.1480  0.1165  278 LYS F C     
2183 O  O     . LYS A 279 ? 0.4783 0.3885 0.3900 0.1312  0.1416  0.1215  278 LYS F O     
2184 C  CB    . LYS A 279 ? 0.5522 0.4592 0.4946 0.1078  0.1485  0.1113  278 LYS F CB    
2185 C  CG    . LYS A 279 ? 0.7499 0.6370 0.6901 0.1060  0.1593  0.1072  278 LYS F CG    
2186 C  CD    . LYS A 279 ? 0.7328 0.5971 0.6486 0.1231  0.1700  0.1115  278 LYS F CD    
2187 C  CE    . LYS A 279 ? 0.7783 0.6146 0.6869 0.1219  0.1841  0.1071  278 LYS F CE    
2188 N  NZ    . LYS A 279 ? 0.6656 0.4786 0.5449 0.1384  0.1930  0.1116  278 LYS F NZ    
2189 N  N     . PRO A 280 ? 0.5526 0.4143 0.4342 0.1257  0.1520  0.1164  279 PRO F N     
2190 C  CA    . PRO A 280 ? 0.6005 0.4630 0.4634 0.1395  0.1463  0.1216  279 PRO F CA    
2191 C  C     . PRO A 280 ? 0.6018 0.4687 0.4541 0.1562  0.1448  0.1259  279 PRO F C     
2192 O  O     . PRO A 280 ? 0.6132 0.4953 0.4605 0.1663  0.1352  0.1291  279 PRO F O     
2193 C  CB    . PRO A 280 ? 0.6701 0.4986 0.5065 0.1409  0.1539  0.1206  279 PRO F CB    
2194 C  CG    . PRO A 280 ? 0.7484 0.5715 0.5985 0.1234  0.1589  0.1145  279 PRO F CG    
2195 C  CD    . PRO A 280 ? 0.6486 0.4843 0.5214 0.1162  0.1603  0.1114  279 PRO F CD    
2196 N  N     . ASP A 281 ? 0.4788 0.3332 0.3269 0.1600  0.1534  0.1255  280 ASP F N     
2197 C  CA    . ASP A 281 ? 0.5867 0.4440 0.4223 0.1767  0.1515  0.1291  280 ASP F CA    
2198 C  C     . ASP A 281 ? 0.4701 0.3655 0.3305 0.1779  0.1453  0.1311  280 ASP F C     
2199 O  O     . ASP A 281 ? 0.4861 0.3891 0.3387 0.1912  0.1424  0.1334  280 ASP F O     
2200 C  CB    . ASP A 281 ? 0.7847 0.6071 0.5992 0.1820  0.1639  0.1285  280 ASP F CB    
2201 C  CG    . ASP A 281 ? 0.7406 0.5562 0.5713 0.1689  0.1749  0.1244  280 ASP F CG    
2202 O  OD1   . ASP A 281 ? 0.5734 0.4145 0.4324 0.1583  0.1711  0.1226  280 ASP F OD1   
2203 O  OD2   . ASP A 281 ? 0.7283 0.5128 0.5435 0.1693  0.1866  0.1228  280 ASP F OD2   
2204 N  N     . LEU A 282 ? 0.4593 0.3798 0.3493 0.1642  0.1420  0.1303  281 LEU F N     
2205 C  CA    . LEU A 282 ? 0.3595 0.3205 0.2772 0.1629  0.1360  0.1331  281 LEU F CA    
2206 C  C     . LEU A 282 ? 0.4185 0.3815 0.3409 0.1680  0.1435  0.1339  281 LEU F C     
2207 O  O     . LEU A 282 ? 0.3761 0.3741 0.3164 0.1704  0.1384  0.1374  281 LEU F O     
2208 C  CB    . LEU A 282 ? 0.4057 0.3952 0.3230 0.1725  0.1246  0.1368  281 LEU F CB    
2209 C  CG    . LEU A 282 ? 0.4555 0.4437 0.3677 0.1699  0.1163  0.1362  281 LEU F CG    
2210 C  CD1   . LEU A 282 ? 0.4312 0.4486 0.3467 0.1782  0.1031  0.1380  281 LEU F CD1   
2211 C  CD2   . LEU A 282 ? 0.4704 0.4664 0.4046 0.1523  0.1154  0.1349  281 LEU F CD2   
2212 N  N     . LEU A 283 ? 0.4472 0.3744 0.3534 0.1687  0.1551  0.1308  282 LEU F N     
2213 C  CA    . LEU A 283 ? 0.4512 0.3768 0.3595 0.1738  0.1627  0.1314  282 LEU F CA    
2214 C  C     . LEU A 283 ? 0.4269 0.3664 0.3658 0.1581  0.1574  0.1301  282 LEU F C     
2215 O  O     . LEU A 283 ? 0.4654 0.3946 0.4123 0.1416  0.1575  0.1242  282 LEU F O     
2216 C  CB    . LEU A 283 ? 0.5421 0.4222 0.4224 0.1773  0.1768  0.1285  282 LEU F CB    
2217 C  CG    . LEU A 283 ? 0.5904 0.4493 0.4378 0.1905  0.1737  0.1306  282 LEU F CG    
2218 C  CD1   . LEU A 283 ? 0.6283 0.4419 0.4519 0.1914  0.1860  0.1283  282 LEU F CD1   
2219 C  CD2   . LEU A 283 ? 0.5354 0.4196 0.3805 0.2057  0.1623  0.1340  282 LEU F CD2   
2220 N  N     . ILE A 284 ? 0.4265 0.3903 0.3762 0.1591  0.1507  0.1347  283 ILE F N     
2221 C  CA    . ILE A 284 ? 0.4450 0.4352 0.4204 0.1388  0.1424  0.1287  283 ILE F CA    
2222 C  C     . ILE A 284 ? 0.4493 0.4499 0.4267 0.1393  0.1443  0.1234  283 ILE F C     
2223 O  O     . ILE A 284 ? 0.3934 0.3854 0.3545 0.1551  0.1497  0.1248  283 ILE F O     
2224 C  CB    . ILE A 284 ? 0.3734 0.4039 0.3683 0.1330  0.1268  0.1319  283 ILE F CB    
2225 C  CG1   . ILE A 284 ? 0.2890 0.3430 0.2769 0.1489  0.1219  0.1399  283 ILE F CG1   
2226 C  CG2   . ILE A 284 ? 0.3858 0.4104 0.3844 0.1282  0.1242  0.1318  283 ILE F CG2   
2227 C  CD1   . ILE A 284 ? 0.2727 0.3683 0.2802 0.1399  0.1071  0.1421  283 ILE F CD1   
2228 N  N     . ALA A 285 ? 0.3288 0.3502 0.3263 0.1224  0.1381  0.1145  284 ALA F N     
2229 C  CA    . ALA A 285 ? 0.3300 0.3681 0.3338 0.1223  0.1378  0.1060  284 ALA F CA    
2230 C  C     . ALA A 285 ? 0.3357 0.4163 0.3523 0.1225  0.1244  0.1062  284 ALA F C     
2231 O  O     . ALA A 285 ? 0.3495 0.4441 0.3647 0.1321  0.1237  0.1023  284 ALA F O     
2232 C  CB    . ALA A 285 ? 0.3228 0.3564 0.3373 0.1053  0.1403  0.0946  284 ALA F CB    
2233 N  N     . ARG A 286 ? 0.2926 0.3921 0.3211 0.1119  0.1135  0.1096  285 ARG F N     
2234 C  CA    . ARG A 286 ? 0.2603 0.3947 0.2992 0.1097  0.1018  0.1105  285 ARG F CA    
2235 C  C     . ARG A 286 ? 0.2892 0.4320 0.3326 0.1064  0.0935  0.1194  285 ARG F C     
2236 O  O     . ARG A 286 ? 0.2616 0.3871 0.3051 0.1013  0.0946  0.1214  285 ARG F O     
2237 C  CB    . ARG A 286 ? 0.3032 0.4515 0.3538 0.0954  0.0970  0.1009  285 ARG F CB    
2238 C  CG    . ARG A 286 ? 0.2938 0.4329 0.3428 0.0956  0.1056  0.0898  285 ARG F CG    
2239 C  CD    . ARG A 286 ? 0.3104 0.4602 0.3695 0.0813  0.1016  0.0800  285 ARG F CD    
2240 N  NE    . ARG A 286 ? 0.3367 0.5136 0.4019 0.0798  0.0925  0.0808  285 ARG F NE    
2241 C  CZ    . ARG A 286 ? 0.5395 0.7336 0.6058 0.0863  0.0929  0.0761  285 ARG F CZ    
2242 N  NH1   . ARG A 286 ? 0.5201 0.7078 0.5828 0.0955  0.1011  0.0690  285 ARG F NH1   
2243 N  NH2   . ARG A 286 ? 0.5257 0.7441 0.5956 0.0856  0.0856  0.0805  285 ARG F NH2   
2244 N  N     . GLN A 287 ? 0.2372 0.4066 0.2846 0.1086  0.0854  0.1235  286 GLN F N     
2245 C  CA    . GLN A 287 ? 0.2158 0.3962 0.2700 0.1018  0.0767  0.1300  286 GLN F CA    
2246 C  C     . GLN A 287 ? 0.2341 0.4405 0.2965 0.0946  0.0686  0.1286  286 GLN F C     
2247 O  O     . GLN A 287 ? 0.2476 0.4675 0.3092 0.0990  0.0695  0.1244  286 GLN F O     
2248 C  CB    . GLN A 287 ? 0.2496 0.4297 0.2950 0.1140  0.0782  0.1388  286 GLN F CB    
2249 C  CG    . GLN A 287 ? 0.2235 0.4215 0.2616 0.1273  0.0786  0.1387  286 GLN F CG    
2250 C  CD    . GLN A 287 ? 0.2314 0.4308 0.2612 0.1365  0.0788  0.1438  286 GLN F CD    
2251 O  OE1   . GLN A 287 ? 0.2806 0.4611 0.3035 0.1376  0.0830  0.1488  286 GLN F OE1   
2252 N  NE2   . GLN A 287 ? 0.2352 0.4566 0.2664 0.1430  0.0743  0.1404  286 GLN F NE2   
2253 N  N     . GLY A 288 ? 0.1913 0.4032 0.2610 0.0842  0.0611  0.1320  287 GLY F N     
2254 C  CA    . GLY A 288 ? 0.1883 0.4197 0.2639 0.0774  0.0552  0.1317  287 GLY F CA    
2255 C  C     . GLY A 288 ? 0.2081 0.4437 0.2901 0.0688  0.0487  0.1393  287 GLY F C     
2256 O  O     . GLY A 288 ? 0.1775 0.4003 0.2601 0.0667  0.0476  0.1408  287 GLY F O     
2257 N  N     . VAL A 289 ? 0.1759 0.4300 0.2625 0.0642  0.0448  0.1441  288 VAL F N     
2258 C  CA    . VAL A 289 ? 0.1885 0.4489 0.2818 0.0567  0.0393  0.1517  288 VAL F CA    
2259 C  C     . VAL A 289 ? 0.2290 0.4937 0.3258 0.0501  0.0356  0.1560  288 VAL F C     
2260 O  O     . VAL A 289 ? 0.1836 0.4524 0.2778 0.0516  0.0372  0.1533  288 VAL F O     
2261 C  CB    . VAL A 289 ? 0.1458 0.4277 0.2432 0.0582  0.0389  0.1543  288 VAL F CB    
2262 C  CG1   . VAL A 289 ? 0.1809 0.4602 0.2747 0.0668  0.0423  0.1486  288 VAL F CG1   
2263 C  CG2   . VAL A 289 ? 0.1775 0.4811 0.2755 0.0603  0.0397  0.1551  288 VAL F CG2   
2264 N  N     . LYS A 290 ? 0.2071 0.4712 0.3101 0.0432  0.0307  0.1625  289 LYS F N     
2265 C  CA    . LYS A 290 ? 0.1505 0.4191 0.2574 0.0376  0.0267  0.1681  289 LYS F CA    
2266 C  C     . LYS A 290 ? 0.1533 0.4349 0.2684 0.0323  0.0233  0.1769  289 LYS F C     
2267 O  O     . LYS A 290 ? 0.1902 0.4675 0.3096 0.0301  0.0224  0.1774  289 LYS F O     
2268 C  CB    . LYS A 290 ? 0.1408 0.3892 0.2484 0.0343  0.0243  0.1654  289 LYS F CB    
2269 C  CG    . LYS A 290 ? 0.2068 0.4595 0.3184 0.0294  0.0200  0.1712  289 LYS F CG    
2270 C  CD    . LYS A 290 ? 0.3454 0.5823 0.4561 0.0282  0.0197  0.1651  289 LYS F CD    
2271 C  CE    . LYS A 290 ? 0.4882 0.7061 0.6022 0.0252  0.0181  0.1609  289 LYS F CE    
2272 N  NZ    . LYS A 290 ? 0.3948 0.5988 0.5084 0.0244  0.0187  0.1548  289 LYS F NZ    
2273 N  N     . LEU A 291 ? 0.1671 0.4656 0.2852 0.0304  0.0220  0.1832  290 LEU F N     
2274 C  CA    . LEU A 291 ? 0.1712 0.4805 0.2995 0.0243  0.0188  0.1924  290 LEU F CA    
2275 C  C     . LEU A 291 ? 0.1553 0.4645 0.2859 0.0208  0.0151  0.1988  290 LEU F C     
2276 O  O     . LEU A 291 ? 0.1924 0.5076 0.3174 0.0237  0.0161  0.1978  290 LEU F O     
2277 C  CB    . LEU A 291 ? 0.1900 0.5253 0.3231 0.0253  0.0214  0.1956  290 LEU F CB    
2278 C  CG    . LEU A 291 ? 0.1938 0.5344 0.3260 0.0302  0.0252  0.1884  290 LEU F CG    
2279 C  CD1   . LEU A 291 ? 0.2245 0.5936 0.3635 0.0311  0.0273  0.1911  290 LEU F CD1   
2280 C  CD2   . LEU A 291 ? 0.2231 0.5519 0.3615 0.0270  0.0236  0.1865  290 LEU F CD2   
2281 N  N     . LYS A 292 ? 0.2010 0.5045 0.3405 0.0149  0.0108  0.2049  291 LYS F N     
2282 C  CA    . LYS A 292 ? 0.2080 0.5134 0.3524 0.0113  0.0075  0.2109  291 LYS F CA    
2283 C  C     . LYS A 292 ? 0.1845 0.5073 0.3415 0.0066  0.0058  0.2229  291 LYS F C     
2284 O  O     . LYS A 292 ? 0.2233 0.5434 0.3888 0.0028  0.0052  0.2232  291 LYS F O     
2285 C  CB    . LYS A 292 ? 0.1818 0.4634 0.3279 0.0078  0.0049  0.2044  291 LYS F CB    
2286 C  CG    . LYS A 292 ? 0.2074 0.4908 0.3575 0.0050  0.0024  0.2083  291 LYS F CG    
2287 C  CD    . LYS A 292 ? 0.3089 0.5710 0.4612 0.0019  -0.0003 0.2024  291 LYS F CD    
2288 C  CE    . LYS A 292 ? 0.3155 0.5623 0.4579 0.0049  0.0019  0.1903  291 LYS F CE    
2289 N  NZ    . LYS A 292 ? 0.2948 0.5222 0.4400 0.0020  -0.0006 0.1847  291 LYS F NZ    
2290 N  N     . PHE A 293 ? 0.2405 0.5807 0.4003 0.0062  0.0055  0.2309  292 PHE F N     
2291 C  CA    . PHE A 293 ? 0.2160 0.5748 0.3893 0.0014  0.0055  0.2408  292 PHE F CA    
2292 C  C     . PHE A 293 ? 0.2658 0.6192 0.4508 -0.0041 0.0005  0.2499  292 PHE F C     
2293 O  O     . PHE A 293 ? 0.2695 0.6073 0.4512 -0.0036 -0.0028 0.2480  292 PHE F O     
2294 C  CB    . PHE A 293 ? 0.2453 0.6299 0.4158 0.0046  0.0091  0.2446  292 PHE F CB    
2295 C  CG    . PHE A 293 ? 0.2469 0.6373 0.4069 0.0107  0.0139  0.2350  292 PHE F CG    
2296 C  CD1   . PHE A 293 ? 0.2068 0.6026 0.3714 0.0103  0.0167  0.2309  292 PHE F CD1   
2297 C  CD2   . PHE A 293 ? 0.3512 0.7418 0.4979 0.0170  0.0155  0.2293  292 PHE F CD2   
2298 C  CE1   . PHE A 293 ? 0.2892 0.6907 0.4451 0.0169  0.0209  0.2218  292 PHE F CE1   
2299 C  CE2   . PHE A 293 ? 0.2771 0.6725 0.4154 0.0230  0.0199  0.2202  292 PHE F CE2   
2300 C  CZ    . PHE A 293 ? 0.2206 0.6212 0.3631 0.0233  0.0225  0.2168  292 PHE F CZ    
2301 N  N     . ASP A 294 ? 0.3258 0.6931 0.5264 -0.0099 0.0005  0.2583  293 ASP F N     
2302 C  CA    . ASP A 294 ? 0.3361 0.6986 0.5512 -0.0159 -0.0040 0.2671  293 ASP F CA    
2303 C  C     . ASP A 294 ? 0.3880 0.7551 0.6019 -0.0143 -0.0065 0.2748  293 ASP F C     
2304 O  O     . ASP A 294 ? 0.2916 0.6504 0.5154 -0.0177 -0.0110 0.2805  293 ASP F O     
2305 C  CB    . ASP A 294 ? 0.3340 0.7131 0.5680 -0.0229 -0.0023 0.2742  293 ASP F CB    
2306 C  CG    . ASP A 294 ? 0.3848 0.7928 0.6200 -0.0220 0.0029  0.2795  293 ASP F CG    
2307 O  OD1   . ASP A 294 ? 0.2470 0.6632 0.4696 -0.0162 0.0043  0.2801  293 ASP F OD1   
2308 O  OD2   . ASP A 294 ? 0.3165 0.7402 0.5667 -0.0275 0.0058  0.2827  293 ASP F OD2   
2309 N  N     . ASP A 295 ? 0.3067 0.6881 0.5099 -0.0090 -0.0038 0.2748  294 ASP F N     
2310 C  CA    . ASP A 295 ? 0.2731 0.6589 0.4737 -0.0069 -0.0052 0.2786  294 ASP F CA    
2311 C  C     . ASP A 295 ? 0.2335 0.5981 0.4188 -0.0033 -0.0036 0.2614  294 ASP F C     
2312 O  O     . ASP A 295 ? 0.2974 0.6652 0.4779 -0.0013 -0.0028 0.2597  294 ASP F O     
2313 C  CB    . ASP A 295 ? 0.3084 0.7240 0.5082 -0.0044 -0.0018 0.2868  294 ASP F CB    
2314 C  CG    . ASP A 295 ? 0.3273 0.7494 0.5124 0.0015  0.0028  0.2772  294 ASP F CG    
2315 O  OD1   . ASP A 295 ? 0.2819 0.6869 0.4590 0.0033  0.0033  0.2662  294 ASP F OD1   
2316 O  OD2   . ASP A 295 ? 0.4560 0.9010 0.6376 0.0047  0.0061  0.2802  294 ASP F OD2   
2317 N  N     . PHE A 296 ? 0.2138 0.5590 0.3918 -0.0022 -0.0029 0.2496  295 PHE F N     
2318 C  CA    . PHE A 296 ? 0.2457 0.5688 0.4122 0.0001  -0.0018 0.2344  295 PHE F CA    
2319 C  C     . PHE A 296 ? 0.2893 0.6185 0.4424 0.0058  0.0022  0.2270  295 PHE F C     
2320 O  O     . PHE A 296 ? 0.3032 0.6160 0.4481 0.0075  0.0031  0.2159  295 PHE F O     
2321 C  CB    . PHE A 296 ? 0.2393 0.5496 0.4086 -0.0024 -0.0045 0.2324  295 PHE F CB    
2322 C  CG    . PHE A 296 ? 0.2456 0.5365 0.4218 -0.0064 -0.0078 0.2300  295 PHE F CG    
2323 C  CD1   . PHE A 296 ? 0.4525 0.7490 0.6431 -0.0106 -0.0110 0.2410  295 PHE F CD1   
2324 C  CD2   . PHE A 296 ? 0.4141 0.6831 0.5836 -0.0058 -0.0078 0.2174  295 PHE F CD2   
2325 C  CE1   . PHE A 296 ? 0.5942 0.8736 0.7916 -0.0140 -0.0143 0.2386  295 PHE F CE1   
2326 C  CE2   . PHE A 296 ? 0.5333 0.7861 0.7088 -0.0089 -0.0108 0.2149  295 PHE F CE2   
2327 C  CZ    . PHE A 296 ? 0.5931 0.8506 0.7823 -0.0129 -0.0142 0.2250  295 PHE F CZ    
2328 N  N     . GLN A 297 ? 0.3297 0.6825 0.4808 0.0090  0.0045  0.2330  296 GLN F N     
2329 C  CA    . GLN A 297 ? 0.2852 0.6422 0.4238 0.0150  0.0082  0.2248  296 GLN F CA    
2330 C  C     . GLN A 297 ? 0.2383 0.5825 0.3726 0.0167  0.0097  0.2172  296 GLN F C     
2331 O  O     . GLN A 297 ? 0.2480 0.5911 0.3886 0.0143  0.0086  0.2212  296 GLN F O     
2332 C  CB    . GLN A 297 ? 0.3022 0.6896 0.4394 0.0186  0.0104  0.2326  296 GLN F CB    
2333 C  CG    . GLN A 297 ? 0.2188 0.6150 0.3436 0.0257  0.0141  0.2248  296 GLN F CG    
2334 C  CD    . GLN A 297 ? 0.4370 0.8654 0.5615 0.0293  0.0164  0.2324  296 GLN F CD    
2335 O  OE1   . GLN A 297 ? 0.5901 1.0294 0.7228 0.0266  0.0172  0.2388  296 GLN F OE1   
2336 N  NE2   . GLN A 297 ? 0.2706 0.7131 0.3869 0.0345  0.0185  0.2290  296 GLN F NE2   
2337 N  N     . GLN A 298 ? 0.2533 0.5884 0.3777 0.0209  0.0121  0.2067  297 GLN F N     
2338 C  CA    . GLN A 298 ? 0.2257 0.5468 0.3462 0.0231  0.0138  0.1992  297 GLN F CA    
2339 C  C     . GLN A 298 ? 0.2651 0.5961 0.3764 0.0299  0.0180  0.1939  297 GLN F C     
2340 O  O     . GLN A 298 ? 0.2312 0.5711 0.3377 0.0324  0.0195  0.1917  297 GLN F O     
2341 C  CB    . GLN A 298 ? 0.4005 0.6953 0.5205 0.0208  0.0127  0.1907  297 GLN F CB    
2342 C  CG    . GLN A 298 ? 0.5469 0.8279 0.6607 0.0246  0.0155  0.1817  297 GLN F CG    
2343 C  CD    . GLN A 298 ? 0.4794 0.7391 0.5934 0.0224  0.0146  0.1746  297 GLN F CD    
2344 O  OE1   . GLN A 298 ? 0.5062 0.7547 0.6258 0.0177  0.0115  0.1749  297 GLN F OE1   
2345 N  NE2   . GLN A 298 ? 0.4039 0.6584 0.5124 0.0253  0.0179  0.1671  297 GLN F NE2   
2346 N  N     . THR A 299 ? 0.2121 0.5407 0.3220 0.0324  0.0210  0.1892  298 THR F N     
2347 C  CA    . THR A 299 ? 0.1547 0.4886 0.2575 0.0387  0.0260  0.1805  298 THR F CA    
2348 C  C     . THR A 299 ? 0.1733 0.4873 0.2739 0.0407  0.0284  0.1719  298 THR F C     
2349 O  O     . THR A 299 ? 0.2470 0.5517 0.3515 0.0383  0.0267  0.1741  298 THR F O     
2350 C  CB    . THR A 299 ? 0.2103 0.5701 0.3142 0.0416  0.0282  0.1844  298 THR F CB    
2351 O  OG1   . THR A 299 ? 0.2613 0.6269 0.3584 0.0487  0.0328  0.1752  298 THR F OG1   
2352 C  CG2   . THR A 299 ? 0.2441 0.6053 0.3546 0.0392  0.0276  0.1882  298 THR F CG2   
2353 N  N     . THR A 300 ? 0.1813 0.4892 0.2762 0.0454  0.0327  0.1620  299 THR F N     
2354 C  CA    . THR A 300 ? 0.1892 0.4803 0.2819 0.0487  0.0362  0.1541  299 THR F CA    
2355 C  C     . THR A 300 ? 0.2834 0.5853 0.3717 0.0563  0.0412  0.1479  299 THR F C     
2356 O  O     . THR A 300 ? 0.2784 0.5932 0.3642 0.0588  0.0429  0.1453  299 THR F O     
2357 C  CB    . THR A 300 ? 0.2713 0.5395 0.3633 0.0467  0.0378  0.1465  299 THR F CB    
2358 O  OG1   . THR A 300 ? 0.2380 0.5101 0.3273 0.0476  0.0407  0.1403  299 THR F OG1   
2359 C  CG2   . THR A 300 ? 0.1906 0.4481 0.2873 0.0401  0.0325  0.1514  299 THR F CG2   
2360 N  N     . GLN A 301 ? 0.2167 0.5145 0.3039 0.0609  0.0436  0.1452  300 GLN F N     
2361 C  CA    . GLN A 301 ? 0.1807 0.4848 0.2636 0.0696  0.0486  0.1375  300 GLN F CA    
2362 C  C     . GLN A 301 ? 0.1840 0.4685 0.2643 0.0743  0.0523  0.1319  300 GLN F C     
2363 O  O     . GLN A 301 ? 0.2248 0.5045 0.3063 0.0740  0.0507  0.1355  300 GLN F O     
2364 C  CB    . GLN A 301 ? 0.3565 0.6876 0.4404 0.0737  0.0482  0.1405  300 GLN F CB    
2365 C  CG    . GLN A 301 ? 0.5665 0.9045 0.6534 0.0757  0.0475  0.1432  300 GLN F CG    
2366 C  CD    . GLN A 301 ? 0.6770 1.0436 0.7658 0.0807  0.0482  0.1431  300 GLN F CD    
2367 O  OE1   . GLN A 301 ? 0.6791 1.0634 0.7740 0.0759  0.0458  0.1506  300 GLN F OE1   
2368 N  NE2   . GLN A 301 ? 0.6508 1.0221 0.7353 0.0905  0.0517  0.1344  300 GLN F NE2   
2369 N  N     . GLU A 302 ? 0.1610 0.4331 0.2380 0.0779  0.0575  0.1230  301 GLU F N     
2370 C  CA    . GLU A 302 ? 0.1968 0.4458 0.2703 0.0818  0.0626  0.1173  301 GLU F CA    
2371 C  C     . GLU A 302 ? 0.2807 0.5306 0.3502 0.0910  0.0687  0.1080  301 GLU F C     
2372 O  O     . GLU A 302 ? 0.3191 0.5849 0.3896 0.0925  0.0688  0.1046  301 GLU F O     
2373 C  CB    . GLU A 302 ? 0.2827 0.5101 0.3576 0.0743  0.0642  0.1147  301 GLU F CB    
2374 C  CG    . GLU A 302 ? 0.2640 0.4901 0.3437 0.0661  0.0575  0.1227  301 GLU F CG    
2375 C  CD    . GLU A 302 ? 0.4261 0.6411 0.5087 0.0583  0.0573  0.1196  301 GLU F CD    
2376 O  OE1   . GLU A 302 ? 0.4279 0.6438 0.5147 0.0524  0.0512  0.1255  301 GLU F OE1   
2377 O  OE2   . GLU A 302 ? 0.4460 0.6518 0.5268 0.0582  0.0635  0.1106  301 GLU F OE2   
2378 N  N     . HIS A 303 ? 0.2504 0.4856 0.3140 0.1001  0.0742  0.1066  302 HIS F N     
2379 C  CA    . HIS A 303 ? 0.2484 0.4844 0.3067 0.1125  0.0804  0.1000  302 HIS F CA    
2380 C  C     . HIS A 303 ? 0.2525 0.4620 0.3016 0.1215  0.0886  0.1006  302 HIS F C     
2381 O  O     . HIS A 303 ? 0.2342 0.4312 0.2795 0.1219  0.0888  0.1085  302 HIS F O     
2382 C  CB    . HIS A 303 ? 0.2295 0.4891 0.2864 0.1232  0.0771  0.1012  302 HIS F CB    
2383 C  CG    . HIS A 303 ? 0.2379 0.5013 0.2925 0.1273  0.0738  0.1097  302 HIS F CG    
2384 N  ND1   . HIS A 303 ? 0.3363 0.6175 0.3978 0.1192  0.0672  0.1149  302 HIS F ND1   
2385 C  CD2   . HIS A 303 ? 0.2835 0.5334 0.3290 0.1385  0.0769  0.1133  302 HIS F CD2   
2386 C  CE1   . HIS A 303 ? 0.3988 0.6801 0.4578 0.1245  0.0660  0.1201  302 HIS F CE1   
2387 N  NE2   . HIS A 303 ? 0.3295 0.5923 0.3778 0.1368  0.0715  0.1194  302 HIS F NE2   
2388 N  N     . VAL A 304 ? 0.2823 0.4815 0.3267 0.1293  0.0961  0.0922  303 VAL F N     
2389 C  CA    . VAL A 304 ? 0.3329 0.5033 0.3639 0.1420  0.1055  0.0928  303 VAL F CA    
2390 C  C     . VAL A 304 ? 0.2991 0.4690 0.3198 0.1553  0.1033  0.1020  303 VAL F C     
2391 O  O     . VAL A 304 ? 0.2935 0.4872 0.3154 0.1624  0.0968  0.1018  303 VAL F O     
2392 C  CB    . VAL A 304 ? 0.3734 0.5381 0.4004 0.1523  0.1116  0.0815  303 VAL F CB    
2393 C  CG1   . VAL A 304 ? 0.4790 0.6087 0.4879 0.1678  0.1209  0.0829  303 VAL F CG1   
2394 C  CG2   . VAL A 304 ? 0.3338 0.4961 0.3702 0.1391  0.1152  0.0713  303 VAL F CG2   
2395 N  N     . TRP A 305 ? 0.2765 0.4190 0.2861 0.1584  0.1090  0.1093  304 TRP F N     
2396 C  CA    . TRP A 305 ? 0.3279 0.4667 0.3249 0.1713  0.1074  0.1175  304 TRP F CA    
2397 C  C     . TRP A 305 ? 0.3172 0.4140 0.2963 0.1763  0.1182  0.1229  304 TRP F C     
2398 O  O     . TRP A 305 ? 0.3239 0.4055 0.3083 0.1633  0.1228  0.1243  304 TRP F O     
2399 C  CB    . TRP A 305 ? 0.3298 0.4960 0.3388 0.1617  0.0973  0.1239  304 TRP F CB    
2400 C  CG    . TRP A 305 ? 0.3090 0.4797 0.3075 0.1747  0.0941  0.1279  304 TRP F CG    
2401 C  CD1   . TRP A 305 ? 0.3156 0.4680 0.3018 0.1795  0.0970  0.1342  304 TRP F CD1   
2402 C  CD2   . TRP A 305 ? 0.3077 0.5026 0.3072 0.1840  0.0871  0.1233  304 TRP F CD2   
2403 N  NE1   . TRP A 305 ? 0.2956 0.4594 0.2758 0.1911  0.0908  0.1320  304 TRP F NE1   
2404 C  CE2   . TRP A 305 ? 0.3334 0.5231 0.3224 0.1940  0.0845  0.1256  304 TRP F CE2   
2405 C  CE3   . TRP A 305 ? 0.3068 0.5270 0.3155 0.1848  0.0824  0.1162  304 TRP F CE3   
2406 C  CZ2   . TRP A 305 ? 0.3283 0.5373 0.3177 0.2042  0.0765  0.1204  304 TRP F CZ2   
2407 C  CZ3   . TRP A 305 ? 0.3477 0.5872 0.3560 0.1953  0.0760  0.1124  304 TRP F CZ3   
2408 C  CH2   . TRP A 305 ? 0.3463 0.5801 0.3458 0.2047  0.0727  0.1143  304 TRP F CH2   
2409 N  N     . PRO A 306 ? 0.3666 0.4412 0.3232 0.1940  0.1220  0.1246  305 PRO F N     
2410 C  CA    . PRO A 306 ? 0.3536 0.3798 0.2877 0.1984  0.1348  0.1281  305 PRO F CA    
2411 C  C     . PRO A 306 ? 0.3544 0.3687 0.2786 0.1962  0.1371  0.1372  305 PRO F C     
2412 O  O     . PRO A 306 ? 0.3890 0.3652 0.2969 0.1941  0.1495  0.1396  305 PRO F O     
2413 C  CB    . PRO A 306 ? 0.4073 0.4125 0.3190 0.2179  0.1352  0.1233  305 PRO F CB    
2414 C  CG    . PRO A 306 ? 0.4909 0.5354 0.4107 0.2255  0.1209  0.1214  305 PRO F CG    
2415 C  CD    . PRO A 306 ? 0.3624 0.4502 0.3119 0.2102  0.1148  0.1200  305 PRO F CD    
2416 N  N     . ARG A 307 ? 0.4301 0.4766 0.3638 0.1951  0.1264  0.1399  306 ARG F N     
2417 C  CA    . ARG A 307 ? 0.3852 0.4241 0.3109 0.1945  0.1275  0.1427  306 ARG F CA    
2418 C  C     . ARG A 307 ? 0.3596 0.4407 0.3077 0.1859  0.1153  0.1448  306 ARG F C     
2419 O  O     . ARG A 307 ? 0.3865 0.4968 0.3444 0.1887  0.1046  0.1419  306 ARG F O     
2420 C  CB    . ARG A 307 ? 0.4068 0.4204 0.3060 0.2109  0.1248  0.1384  306 ARG F CB    
2421 C  CG    . ARG A 307 ? 0.4263 0.4273 0.3163 0.2099  0.1219  0.1380  306 ARG F CG    
2422 C  CD    . ARG A 307 ? 0.5116 0.4870 0.3724 0.2264  0.1171  0.1351  306 ARG F CD    
2423 N  NE    . ARG A 307 ? 0.6500 0.6061 0.4977 0.2246  0.1159  0.1349  306 ARG F NE    
2424 C  CZ    . ARG A 307 ? 0.5923 0.5687 0.4463 0.2248  0.1042  0.1343  306 ARG F CZ    
2425 N  NH1   . ARG A 307 ? 0.5384 0.5549 0.4130 0.2255  0.0932  0.1334  306 ARG F NH1   
2426 N  NH2   . ARG A 307 ? 0.5403 0.4974 0.3807 0.2235  0.1035  0.1341  306 ARG F NH2   
2427 N  N     . LEU A 308 ? 0.3734 0.4561 0.3327 0.1741  0.1159  0.1464  307 LEU F N     
2428 C  CA    . LEU A 308 ? 0.3123 0.4298 0.2933 0.1624  0.1046  0.1488  307 LEU F CA    
2429 C  C     . LEU A 308 ? 0.2774 0.4145 0.2562 0.1725  0.0936  0.1452  307 LEU F C     
2430 O  O     . LEU A 308 ? 0.3323 0.4504 0.2926 0.1859  0.0915  0.1413  307 LEU F O     
2431 C  CB    . LEU A 308 ? 0.2907 0.3998 0.2826 0.1520  0.1042  0.1464  307 LEU F CB    
2432 C  CG    . LEU A 308 ? 0.2835 0.4230 0.2965 0.1376  0.0926  0.1490  307 LEU F CG    
2433 C  CD1   . LEU A 308 ? 0.2601 0.4094 0.2900 0.1224  0.0831  0.1501  307 LEU F CD1   
2434 C  CD2   . LEU A 308 ? 0.3094 0.4410 0.3287 0.1328  0.0926  0.1472  307 LEU F CD2   
2435 N  N     . ASN A 309 ? 0.2644 0.4352 0.2619 0.1649  0.0843  0.1447  308 ASN F N     
2436 C  CA    . ASN A 309 ? 0.2593 0.4491 0.2591 0.1736  0.0737  0.1387  308 ASN F CA    
2437 C  C     . ASN A 309 ? 0.2351 0.4575 0.2595 0.1585  0.0646  0.1387  308 ASN F C     
2438 O  O     . ASN A 309 ? 0.2406 0.4780 0.2772 0.1470  0.0641  0.1401  308 ASN F O     
2439 C  CB    . ASN A 309 ? 0.3147 0.5060 0.3060 0.1866  0.0740  0.1339  308 ASN F CB    
2440 C  CG    . ASN A 309 ? 0.2850 0.4970 0.2798 0.1960  0.0632  0.1272  308 ASN F CG    
2441 O  OD1   . ASN A 309 ? 0.2887 0.5315 0.3035 0.1868  0.0570  0.1254  308 ASN F OD1   
2442 N  ND2   . ASN A 309 ? 0.3148 0.5075 0.2890 0.2142  0.0611  0.1232  308 ASN F ND2   
2443 N  N     . LYS A 310 ? 0.2614 0.4912 0.2916 0.1589  0.0562  0.1360  309 LYS F N     
2444 C  CA    . LYS A 310 ? 0.2235 0.4779 0.2770 0.1433  0.0485  0.1359  309 LYS F CA    
2445 C  C     . LYS A 310 ? 0.2143 0.4942 0.2792 0.1427  0.0439  0.1318  309 LYS F C     
2446 O  O     . LYS A 310 ? 0.2192 0.5127 0.2981 0.1280  0.0431  0.1339  309 LYS F O     
2447 C  CB    . LYS A 310 ? 0.2744 0.5293 0.3320 0.1454  0.0396  0.1324  309 LYS F CB    
2448 C  CG    . LYS A 310 ? 0.2276 0.5012 0.3093 0.1283  0.0327  0.1324  309 LYS F CG    
2449 C  CD    . LYS A 310 ? 0.5091 0.7953 0.6008 0.1335  0.0208  0.1251  309 LYS F CD    
2450 C  CE    . LYS A 310 ? 0.5515 0.8194 0.6300 0.1434  0.0166  0.1230  309 LYS F CE    
2451 N  NZ    . LYS A 310 ? 0.3421 0.6239 0.4317 0.1485  0.0034  0.1151  309 LYS F NZ    
2452 N  N     . ALA A 311 ? 0.2330 0.5177 0.2906 0.1591  0.0405  0.1256  310 ALA F N     
2453 C  CA    . ALA A 311 ? 0.2330 0.5442 0.3031 0.1595  0.0360  0.1208  310 ALA F CA    
2454 C  C     . ALA A 311 ? 0.2246 0.5418 0.2961 0.1524  0.0421  0.1232  310 ALA F C     
2455 O  O     . ALA A 311 ? 0.2157 0.5538 0.3019 0.1427  0.0398  0.1224  310 ALA F O     
2456 C  CB    . ALA A 311 ? 0.2573 0.5693 0.3165 0.1802  0.0315  0.1135  310 ALA F CB    
2457 N  N     . ASP A 312 ? 0.3012 0.5984 0.3572 0.1574  0.0496  0.1256  311 ASP F N     
2458 C  CA    . ASP A 312 ? 0.3333 0.6350 0.3909 0.1512  0.0536  0.1263  311 ASP F CA    
2459 C  C     . ASP A 312 ? 0.2019 0.5055 0.2711 0.1306  0.0530  0.1316  311 ASP F C     
2460 O  O     . ASP A 312 ? 0.1957 0.5123 0.2721 0.1227  0.0518  0.1308  311 ASP F O     
2461 C  CB    . ASP A 312 ? 0.2345 0.5120 0.2747 0.1617  0.0612  0.1263  311 ASP F CB    
2462 C  CG    . ASP A 312 ? 0.2392 0.5197 0.2830 0.1546  0.0639  0.1251  311 ASP F CG    
2463 O  OD1   . ASP A 312 ? 0.3052 0.6034 0.3522 0.1592  0.0620  0.1195  311 ASP F OD1   
2464 O  OD2   . ASP A 312 ? 0.2942 0.5595 0.3383 0.1446  0.0672  0.1287  311 ASP F OD2   
2465 N  N     . LEU A 313 ? 0.1935 0.4830 0.2633 0.1227  0.0532  0.1366  312 LEU F N     
2466 C  CA    . LEU A 313 ? 0.1769 0.4655 0.2568 0.1045  0.0505  0.1407  312 LEU F CA    
2467 C  C     . LEU A 313 ? 0.2085 0.5186 0.3038 0.0966  0.0444  0.1393  312 LEU F C     
2468 O  O     . LEU A 313 ? 0.2164 0.5320 0.3180 0.0860  0.0427  0.1404  312 LEU F O     
2469 C  CB    . LEU A 313 ? 0.2025 0.4714 0.2801 0.0991  0.0514  0.1454  312 LEU F CB    
2470 C  CG    . LEU A 313 ? 0.2302 0.4749 0.2948 0.1045  0.0583  0.1478  312 LEU F CG    
2471 C  CD1   . LEU A 313 ? 0.1907 0.4179 0.2520 0.1029  0.0605  0.1524  312 LEU F CD1   
2472 C  CD2   . LEU A 313 ? 0.2860 0.5236 0.3532 0.0960  0.0576  0.1462  312 LEU F CD2   
2473 N  N     . ILE A 314 ? 0.1787 0.5005 0.2805 0.1028  0.0407  0.1359  313 ILE F N     
2474 C  CA    . ILE A 314 ? 0.1829 0.5260 0.3020 0.0964  0.0352  0.1336  313 ILE F CA    
2475 C  C     . ILE A 314 ? 0.2170 0.5782 0.3382 0.0987  0.0365  0.1312  313 ILE F C     
2476 O  O     . ILE A 314 ? 0.1919 0.5668 0.3225 0.0890  0.0358  0.1350  313 ILE F O     
2477 C  CB    . ILE A 314 ? 0.1985 0.5508 0.3255 0.1049  0.0292  0.1281  313 ILE F CB    
2478 C  CG1   . ILE A 314 ? 0.2410 0.5776 0.3681 0.1015  0.0267  0.1297  313 ILE F CG1   
2479 C  CG2   . ILE A 314 ? 0.1947 0.5718 0.3419 0.1002  0.0240  0.1244  313 ILE F CG2   
2480 C  CD1   . ILE A 314 ? 0.2653 0.6055 0.3934 0.1150  0.0198  0.1230  313 ILE F CD1   
2481 N  N     . ALA A 315 ? 0.2213 0.5859 0.3327 0.1135  0.0388  0.1270  314 ALA F N     
2482 C  CA    . ALA A 315 ? 0.2336 0.6162 0.3464 0.1172  0.0400  0