data_5YWB
# 
_entry.id   5YWB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5YWB         
WWPDB D_1300005954 
EMDB  EMD-6851     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
'Structure of pancreatic ATP-sensitive potassium channel bound with Mg-ADP (CTD class2 at 5.2A)' 
_pdbx_database_related.db_id          EMD-6851 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5YWB 
_pdbx_database_status.recvd_initial_deposition_date   2017-11-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chen, L.' 1 0000-0002-7619-8311 
'Wu, J.X.' 2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CN 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Cell' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1674-8018 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                553 
_citation.page_last                 567 
_citation.title                     
'Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1007/s13238-018-0530-y 
_citation.pdbx_database_id_PubMed   29594720 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, J.X.' 1 ? 
primary 'Ding, D.' 2 ? 
primary 'Wang, M.' 3 ? 
primary 'Kang, Y.' 4 ? 
primary 'Zeng, X.' 5 ? 
primary 'Chen, L.' 6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5YWB 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5YWB 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-sensitive inward rectifier potassium channel 11'   43615.734  4  ? ? ? ? 
2 polymer     man 'ATP-binding cassette sub-family C member 8 isoform X2' 177295.516 4  ? ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                              427.201    12 ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                         24.305     8  ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Inward rectifier K(+) channel Kir6.2,Potassium channel,inwardly rectifying subfamily J member 11' 
2 SUR1                                                                                               
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
;MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
A,C,E,G ? 
2 'polypeptide(L)' no no 
;MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFI
LLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLLGFAGPLCI
FGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HLSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFV
GHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQA
VPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFESPFNKQRYK
MVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAGILELLRDD
KRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEPSQGLPRAM
SSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDS
ALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGS
ILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
LSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAATSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKP
VLKHVNALISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENIL
QKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
;MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFI
LLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLLGFAGPLCI
FGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HLSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFV
GHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQA
VPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFESPFNKQRYK
MVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAGILELLRDD
KRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEPSQGLPRAM
SSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDS
ALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGS
ILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
LSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAATSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKP
VLKHVNALISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENIL
QKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    SER n 
1 4    ARG n 
1 5    LYS n 
1 6    GLY n 
1 7    ILE n 
1 8    ILE n 
1 9    PRO n 
1 10   GLU n 
1 11   GLU n 
1 12   TYR n 
1 13   VAL n 
1 14   LEU n 
1 15   THR n 
1 16   ARG n 
1 17   LEU n 
1 18   ALA n 
1 19   GLU n 
1 20   ASP n 
1 21   PRO n 
1 22   ALA n 
1 23   GLU n 
1 24   PRO n 
1 25   ARG n 
1 26   TYR n 
1 27   ARG n 
1 28   THR n 
1 29   ARG n 
1 30   GLU n 
1 31   ARG n 
1 32   ARG n 
1 33   ALA n 
1 34   ARG n 
1 35   PHE n 
1 36   VAL n 
1 37   SER n 
1 38   LYS n 
1 39   LYS n 
1 40   GLY n 
1 41   ASN n 
1 42   CYS n 
1 43   ASN n 
1 44   VAL n 
1 45   ALA n 
1 46   HIS n 
1 47   LYS n 
1 48   ASN n 
1 49   ILE n 
1 50   ARG n 
1 51   GLU n 
1 52   GLN n 
1 53   GLY n 
1 54   ARG n 
1 55   PHE n 
1 56   LEU n 
1 57   GLN n 
1 58   ASP n 
1 59   VAL n 
1 60   PHE n 
1 61   THR n 
1 62   THR n 
1 63   LEU n 
1 64   VAL n 
1 65   ASP n 
1 66   LEU n 
1 67   LYS n 
1 68   TRP n 
1 69   PRO n 
1 70   HIS n 
1 71   THR n 
1 72   LEU n 
1 73   LEU n 
1 74   ILE n 
1 75   PHE n 
1 76   THR n 
1 77   MET n 
1 78   SER n 
1 79   PHE n 
1 80   LEU n 
1 81   CYS n 
1 82   SER n 
1 83   TRP n 
1 84   LEU n 
1 85   LEU n 
1 86   PHE n 
1 87   ALA n 
1 88   MET n 
1 89   VAL n 
1 90   TRP n 
1 91   TRP n 
1 92   LEU n 
1 93   ILE n 
1 94   ALA n 
1 95   PHE n 
1 96   ALA n 
1 97   HIS n 
1 98   GLY n 
1 99   ASP n 
1 100  LEU n 
1 101  ALA n 
1 102  PRO n 
1 103  GLY n 
1 104  GLU n 
1 105  GLY n 
1 106  THR n 
1 107  ASN n 
1 108  VAL n 
1 109  PRO n 
1 110  CYS n 
1 111  VAL n 
1 112  THR n 
1 113  SER n 
1 114  ILE n 
1 115  HIS n 
1 116  SER n 
1 117  PHE n 
1 118  SER n 
1 119  SER n 
1 120  ALA n 
1 121  PHE n 
1 122  LEU n 
1 123  PHE n 
1 124  SER n 
1 125  ILE n 
1 126  GLU n 
1 127  VAL n 
1 128  GLN n 
1 129  VAL n 
1 130  THR n 
1 131  ILE n 
1 132  GLY n 
1 133  PHE n 
1 134  GLY n 
1 135  GLY n 
1 136  ARG n 
1 137  MET n 
1 138  VAL n 
1 139  THR n 
1 140  GLU n 
1 141  GLU n 
1 142  CYS n 
1 143  PRO n 
1 144  LEU n 
1 145  ALA n 
1 146  ILE n 
1 147  LEU n 
1 148  ILE n 
1 149  LEU n 
1 150  ILE n 
1 151  VAL n 
1 152  GLN n 
1 153  ASN n 
1 154  ILE n 
1 155  VAL n 
1 156  GLY n 
1 157  LEU n 
1 158  MET n 
1 159  ILE n 
1 160  ASN n 
1 161  ALA n 
1 162  ILE n 
1 163  MET n 
1 164  LEU n 
1 165  GLY n 
1 166  CYS n 
1 167  ILE n 
1 168  PHE n 
1 169  MET n 
1 170  LYS n 
1 171  THR n 
1 172  ALA n 
1 173  GLN n 
1 174  ALA n 
1 175  HIS n 
1 176  ARG n 
1 177  ARG n 
1 178  ALA n 
1 179  GLU n 
1 180  THR n 
1 181  LEU n 
1 182  ILE n 
1 183  PHE n 
1 184  SER n 
1 185  LYS n 
1 186  HIS n 
1 187  ALA n 
1 188  VAL n 
1 189  ILE n 
1 190  THR n 
1 191  LEU n 
1 192  ARG n 
1 193  HIS n 
1 194  GLY n 
1 195  ARG n 
1 196  LEU n 
1 197  CYS n 
1 198  PHE n 
1 199  MET n 
1 200  LEU n 
1 201  ARG n 
1 202  VAL n 
1 203  GLY n 
1 204  ASP n 
1 205  LEU n 
1 206  ARG n 
1 207  LYS n 
1 208  SER n 
1 209  MET n 
1 210  ILE n 
1 211  ILE n 
1 212  SER n 
1 213  ALA n 
1 214  THR n 
1 215  ILE n 
1 216  HIS n 
1 217  MET n 
1 218  GLN n 
1 219  VAL n 
1 220  VAL n 
1 221  ARG n 
1 222  LYS n 
1 223  THR n 
1 224  THR n 
1 225  SER n 
1 226  PRO n 
1 227  GLU n 
1 228  GLY n 
1 229  GLU n 
1 230  VAL n 
1 231  VAL n 
1 232  PRO n 
1 233  LEU n 
1 234  HIS n 
1 235  GLN n 
1 236  VAL n 
1 237  ASP n 
1 238  ILE n 
1 239  PRO n 
1 240  MET n 
1 241  GLU n 
1 242  ASN n 
1 243  GLY n 
1 244  VAL n 
1 245  GLY n 
1 246  GLY n 
1 247  ASN n 
1 248  GLY n 
1 249  ILE n 
1 250  PHE n 
1 251  LEU n 
1 252  VAL n 
1 253  ALA n 
1 254  PRO n 
1 255  LEU n 
1 256  ILE n 
1 257  ILE n 
1 258  TYR n 
1 259  HIS n 
1 260  VAL n 
1 261  ILE n 
1 262  ASP n 
1 263  SER n 
1 264  ASN n 
1 265  SER n 
1 266  PRO n 
1 267  LEU n 
1 268  TYR n 
1 269  ASP n 
1 270  LEU n 
1 271  ALA n 
1 272  PRO n 
1 273  SER n 
1 274  ASP n 
1 275  LEU n 
1 276  HIS n 
1 277  HIS n 
1 278  HIS n 
1 279  GLN n 
1 280  ASP n 
1 281  LEU n 
1 282  GLU n 
1 283  ILE n 
1 284  ILE n 
1 285  VAL n 
1 286  ILE n 
1 287  LEU n 
1 288  GLU n 
1 289  GLY n 
1 290  VAL n 
1 291  VAL n 
1 292  GLU n 
1 293  THR n 
1 294  THR n 
1 295  GLY n 
1 296  ILE n 
1 297  THR n 
1 298  THR n 
1 299  GLN n 
1 300  ALA n 
1 301  ARG n 
1 302  THR n 
1 303  SER n 
1 304  TYR n 
1 305  LEU n 
1 306  ALA n 
1 307  ASP n 
1 308  GLU n 
1 309  ILE n 
1 310  LEU n 
1 311  TRP n 
1 312  GLY n 
1 313  GLN n 
1 314  ARG n 
1 315  PHE n 
1 316  VAL n 
1 317  PRO n 
1 318  ILE n 
1 319  VAL n 
1 320  ALA n 
1 321  GLU n 
1 322  GLU n 
1 323  ASP n 
1 324  GLY n 
1 325  ARG n 
1 326  TYR n 
1 327  SER n 
1 328  VAL n 
1 329  ASP n 
1 330  TYR n 
1 331  SER n 
1 332  LYS n 
1 333  PHE n 
1 334  GLY n 
1 335  ASN n 
1 336  THR n 
1 337  ILE n 
1 338  LYS n 
1 339  VAL n 
1 340  PRO n 
1 341  THR n 
1 342  PRO n 
1 343  LEU n 
1 344  CYS n 
1 345  THR n 
1 346  ALA n 
1 347  ARG n 
1 348  GLN n 
1 349  LEU n 
1 350  ASP n 
1 351  GLU n 
1 352  ASP n 
1 353  ARG n 
1 354  SER n 
1 355  LEU n 
1 356  LEU n 
1 357  ASP n 
1 358  ALA n 
1 359  LEU n 
1 360  THR n 
1 361  LEU n 
1 362  ALA n 
1 363  SER n 
1 364  SER n 
1 365  ARG n 
1 366  GLY n 
1 367  PRO n 
1 368  LEU n 
1 369  ARG n 
1 370  LYS n 
1 371  ARG n 
1 372  SER n 
1 373  VAL n 
1 374  ALA n 
1 375  VAL n 
1 376  ALA n 
1 377  LYS n 
1 378  ALA n 
1 379  LYS n 
1 380  PRO n 
1 381  LYS n 
1 382  PHE n 
1 383  SER n 
1 384  ILE n 
1 385  SER n 
1 386  PRO n 
1 387  ASP n 
1 388  SER n 
1 389  LEU n 
1 390  SER n 
2 1    MET n 
2 2    PRO n 
2 3    LEU n 
2 4    ALA n 
2 5    PHE n 
2 6    CYS n 
2 7    GLY n 
2 8    THR n 
2 9    GLU n 
2 10   ASN n 
2 11   HIS n 
2 12   SER n 
2 13   ALA n 
2 14   ALA n 
2 15   TYR n 
2 16   ARG n 
2 17   VAL n 
2 18   ASP n 
2 19   GLN n 
2 20   GLY n 
2 21   VAL n 
2 22   LEU n 
2 23   ASN n 
2 24   ASN n 
2 25   GLY n 
2 26   CYS n 
2 27   PHE n 
2 28   VAL n 
2 29   ASP n 
2 30   ALA n 
2 31   LEU n 
2 32   ASN n 
2 33   VAL n 
2 34   VAL n 
2 35   PRO n 
2 36   HIS n 
2 37   VAL n 
2 38   PHE n 
2 39   LEU n 
2 40   LEU n 
2 41   PHE n 
2 42   ILE n 
2 43   THR n 
2 44   PHE n 
2 45   PRO n 
2 46   ILE n 
2 47   LEU n 
2 48   PHE n 
2 49   ILE n 
2 50   GLY n 
2 51   TRP n 
2 52   GLY n 
2 53   SER n 
2 54   GLN n 
2 55   SER n 
2 56   SER n 
2 57   LYS n 
2 58   VAL n 
2 59   HIS n 
2 60   ILE n 
2 61   HIS n 
2 62   HIS n 
2 63   SER n 
2 64   THR n 
2 65   TRP n 
2 66   LEU n 
2 67   HIS n 
2 68   PHE n 
2 69   PRO n 
2 70   GLY n 
2 71   HIS n 
2 72   ASN n 
2 73   LEU n 
2 74   ARG n 
2 75   TRP n 
2 76   ILE n 
2 77   LEU n 
2 78   THR n 
2 79   PHE n 
2 80   ILE n 
2 81   LEU n 
2 82   LEU n 
2 83   PHE n 
2 84   VAL n 
2 85   LEU n 
2 86   VAL n 
2 87   CYS n 
2 88   GLU n 
2 89   ILE n 
2 90   ALA n 
2 91   GLU n 
2 92   GLY n 
2 93   ILE n 
2 94   LEU n 
2 95   SER n 
2 96   ASP n 
2 97   GLY n 
2 98   VAL n 
2 99   THR n 
2 100  GLU n 
2 101  SER n 
2 102  ARG n 
2 103  HIS n 
2 104  LEU n 
2 105  HIS n 
2 106  LEU n 
2 107  TYR n 
2 108  MET n 
2 109  PRO n 
2 110  ALA n 
2 111  GLY n 
2 112  MET n 
2 113  ALA n 
2 114  PHE n 
2 115  MET n 
2 116  ALA n 
2 117  ALA n 
2 118  ILE n 
2 119  THR n 
2 120  SER n 
2 121  VAL n 
2 122  VAL n 
2 123  TYR n 
2 124  TYR n 
2 125  HIS n 
2 126  ASN n 
2 127  ILE n 
2 128  GLU n 
2 129  THR n 
2 130  SER n 
2 131  ASN n 
2 132  PHE n 
2 133  PRO n 
2 134  LYS n 
2 135  LEU n 
2 136  LEU n 
2 137  ILE n 
2 138  ALA n 
2 139  LEU n 
2 140  LEU n 
2 141  ILE n 
2 142  TYR n 
2 143  TRP n 
2 144  THR n 
2 145  LEU n 
2 146  ALA n 
2 147  PHE n 
2 148  ILE n 
2 149  THR n 
2 150  LYS n 
2 151  THR n 
2 152  ILE n 
2 153  LYS n 
2 154  PHE n 
2 155  VAL n 
2 156  LYS n 
2 157  PHE n 
2 158  TYR n 
2 159  ASP n 
2 160  HIS n 
2 161  ALA n 
2 162  ILE n 
2 163  GLY n 
2 164  PHE n 
2 165  SER n 
2 166  GLN n 
2 167  LEU n 
2 168  ARG n 
2 169  PHE n 
2 170  CYS n 
2 171  LEU n 
2 172  THR n 
2 173  GLY n 
2 174  LEU n 
2 175  LEU n 
2 176  VAL n 
2 177  ILE n 
2 178  LEU n 
2 179  TYR n 
2 180  GLY n 
2 181  MET n 
2 182  LEU n 
2 183  LEU n 
2 184  LEU n 
2 185  VAL n 
2 186  GLU n 
2 187  VAL n 
2 188  ASN n 
2 189  VAL n 
2 190  ILE n 
2 191  ARG n 
2 192  VAL n 
2 193  ARG n 
2 194  ARG n 
2 195  TYR n 
2 196  ILE n 
2 197  PHE n 
2 198  PHE n 
2 199  LYS n 
2 200  THR n 
2 201  PRO n 
2 202  ARG n 
2 203  GLU n 
2 204  VAL n 
2 205  LYS n 
2 206  PRO n 
2 207  PRO n 
2 208  GLU n 
2 209  ASP n 
2 210  LEU n 
2 211  GLN n 
2 212  ASP n 
2 213  LEU n 
2 214  GLY n 
2 215  VAL n 
2 216  ARG n 
2 217  PHE n 
2 218  LEU n 
2 219  GLN n 
2 220  PRO n 
2 221  PHE n 
2 222  VAL n 
2 223  ASN n 
2 224  LEU n 
2 225  LEU n 
2 226  SER n 
2 227  LYS n 
2 228  GLY n 
2 229  THR n 
2 230  TYR n 
2 231  TRP n 
2 232  TRP n 
2 233  MET n 
2 234  ASN n 
2 235  ALA n 
2 236  PHE n 
2 237  ILE n 
2 238  LYS n 
2 239  THR n 
2 240  ALA n 
2 241  HIS n 
2 242  LYS n 
2 243  LYS n 
2 244  PRO n 
2 245  ILE n 
2 246  ASP n 
2 247  LEU n 
2 248  ARG n 
2 249  ALA n 
2 250  ILE n 
2 251  GLY n 
2 252  LYS n 
2 253  LEU n 
2 254  PRO n 
2 255  ILE n 
2 256  ALA n 
2 257  MET n 
2 258  ARG n 
2 259  ALA n 
2 260  LEU n 
2 261  THR n 
2 262  ASN n 
2 263  TYR n 
2 264  GLN n 
2 265  ARG n 
2 266  LEU n 
2 267  CYS n 
2 268  VAL n 
2 269  ALA n 
2 270  PHE n 
2 271  ASP n 
2 272  ALA n 
2 273  GLN n 
2 274  ALA n 
2 275  ARG n 
2 276  LYS n 
2 277  ASP n 
2 278  THR n 
2 279  GLN n 
2 280  SER n 
2 281  PRO n 
2 282  GLN n 
2 283  GLY n 
2 284  ALA n 
2 285  ARG n 
2 286  ALA n 
2 287  ILE n 
2 288  TRP n 
2 289  ARG n 
2 290  ALA n 
2 291  LEU n 
2 292  CYS n 
2 293  HIS n 
2 294  ALA n 
2 295  PHE n 
2 296  GLY n 
2 297  ARG n 
2 298  ARG n 
2 299  LEU n 
2 300  ILE n 
2 301  LEU n 
2 302  SER n 
2 303  SER n 
2 304  THR n 
2 305  PHE n 
2 306  ARG n 
2 307  ILE n 
2 308  LEU n 
2 309  ALA n 
2 310  ASP n 
2 311  LEU n 
2 312  LEU n 
2 313  GLY n 
2 314  PHE n 
2 315  ALA n 
2 316  GLY n 
2 317  PRO n 
2 318  LEU n 
2 319  CYS n 
2 320  ILE n 
2 321  PHE n 
2 322  GLY n 
2 323  ILE n 
2 324  VAL n 
2 325  ASP n 
2 326  HIS n 
2 327  LEU n 
2 328  GLY n 
2 329  LYS n 
2 330  GLU n 
2 331  ASN n 
2 332  HIS n 
2 333  VAL n 
2 334  PHE n 
2 335  GLN n 
2 336  PRO n 
2 337  LYS n 
2 338  THR n 
2 339  GLN n 
2 340  PHE n 
2 341  LEU n 
2 342  GLY n 
2 343  VAL n 
2 344  TYR n 
2 345  PHE n 
2 346  VAL n 
2 347  SER n 
2 348  SER n 
2 349  GLN n 
2 350  GLU n 
2 351  PHE n 
2 352  LEU n 
2 353  GLY n 
2 354  ASN n 
2 355  ALA n 
2 356  TYR n 
2 357  VAL n 
2 358  LEU n 
2 359  ALA n 
2 360  VAL n 
2 361  LEU n 
2 362  LEU n 
2 363  PHE n 
2 364  LEU n 
2 365  ALA n 
2 366  LEU n 
2 367  LEU n 
2 368  LEU n 
2 369  GLN n 
2 370  ARG n 
2 371  THR n 
2 372  PHE n 
2 373  LEU n 
2 374  GLN n 
2 375  ALA n 
2 376  SER n 
2 377  TYR n 
2 378  TYR n 
2 379  VAL n 
2 380  ALA n 
2 381  ILE n 
2 382  GLU n 
2 383  THR n 
2 384  GLY n 
2 385  ILE n 
2 386  ASN n 
2 387  LEU n 
2 388  ARG n 
2 389  GLY n 
2 390  ALA n 
2 391  ILE n 
2 392  GLN n 
2 393  THR n 
2 394  LYS n 
2 395  ILE n 
2 396  TYR n 
2 397  ASN n 
2 398  LYS n 
2 399  ILE n 
2 400  MET n 
2 401  HIS n 
2 402  LEU n 
2 403  SER n 
2 404  THR n 
2 405  SER n 
2 406  ASN n 
2 407  LEU n 
2 408  SER n 
2 409  MET n 
2 410  GLY n 
2 411  GLU n 
2 412  MET n 
2 413  THR n 
2 414  ALA n 
2 415  GLY n 
2 416  GLN n 
2 417  ILE n 
2 418  CYS n 
2 419  ASN n 
2 420  LEU n 
2 421  VAL n 
2 422  ALA n 
2 423  ILE n 
2 424  ASP n 
2 425  THR n 
2 426  ASN n 
2 427  GLN n 
2 428  LEU n 
2 429  MET n 
2 430  TRP n 
2 431  PHE n 
2 432  PHE n 
2 433  PHE n 
2 434  LEU n 
2 435  CYS n 
2 436  PRO n 
2 437  ASN n 
2 438  LEU n 
2 439  TRP n 
2 440  ALA n 
2 441  MET n 
2 442  PRO n 
2 443  VAL n 
2 444  GLN n 
2 445  ILE n 
2 446  ILE n 
2 447  VAL n 
2 448  GLY n 
2 449  VAL n 
2 450  ILE n 
2 451  LEU n 
2 452  LEU n 
2 453  TYR n 
2 454  TYR n 
2 455  ILE n 
2 456  LEU n 
2 457  GLY n 
2 458  VAL n 
2 459  SER n 
2 460  ALA n 
2 461  LEU n 
2 462  ILE n 
2 463  GLY n 
2 464  ALA n 
2 465  ALA n 
2 466  VAL n 
2 467  ILE n 
2 468  ILE n 
2 469  LEU n 
2 470  LEU n 
2 471  ALA n 
2 472  PRO n 
2 473  VAL n 
2 474  GLN n 
2 475  TYR n 
2 476  PHE n 
2 477  VAL n 
2 478  ALA n 
2 479  THR n 
2 480  LYS n 
2 481  LEU n 
2 482  SER n 
2 483  GLN n 
2 484  ALA n 
2 485  GLN n 
2 486  ARG n 
2 487  SER n 
2 488  THR n 
2 489  LEU n 
2 490  GLU n 
2 491  HIS n 
2 492  SER n 
2 493  ASN n 
2 494  GLU n 
2 495  ARG n 
2 496  LEU n 
2 497  LYS n 
2 498  GLN n 
2 499  THR n 
2 500  ASN n 
2 501  GLU n 
2 502  MET n 
2 503  LEU n 
2 504  ARG n 
2 505  GLY n 
2 506  MET n 
2 507  LYS n 
2 508  LEU n 
2 509  LEU n 
2 510  LYS n 
2 511  LEU n 
2 512  TYR n 
2 513  ALA n 
2 514  TRP n 
2 515  GLU n 
2 516  SER n 
2 517  ILE n 
2 518  PHE n 
2 519  CYS n 
2 520  SER n 
2 521  ARG n 
2 522  VAL n 
2 523  GLU n 
2 524  VAL n 
2 525  THR n 
2 526  ARG n 
2 527  ARG n 
2 528  LYS n 
2 529  GLU n 
2 530  MET n 
2 531  THR n 
2 532  SER n 
2 533  LEU n 
2 534  ARG n 
2 535  ALA n 
2 536  PHE n 
2 537  ALA n 
2 538  VAL n 
2 539  TYR n 
2 540  THR n 
2 541  SER n 
2 542  ILE n 
2 543  SER n 
2 544  ILE n 
2 545  PHE n 
2 546  MET n 
2 547  ASN n 
2 548  THR n 
2 549  ALA n 
2 550  ILE n 
2 551  PRO n 
2 552  ILE n 
2 553  ALA n 
2 554  ALA n 
2 555  VAL n 
2 556  LEU n 
2 557  ILE n 
2 558  THR n 
2 559  PHE n 
2 560  VAL n 
2 561  GLY n 
2 562  HIS n 
2 563  VAL n 
2 564  SER n 
2 565  PHE n 
2 566  PHE n 
2 567  LYS n 
2 568  GLU n 
2 569  SER n 
2 570  ASP n 
2 571  LEU n 
2 572  SER n 
2 573  PRO n 
2 574  SER n 
2 575  VAL n 
2 576  ALA n 
2 577  PHE n 
2 578  ALA n 
2 579  SER n 
2 580  LEU n 
2 581  SER n 
2 582  LEU n 
2 583  PHE n 
2 584  HIS n 
2 585  ILE n 
2 586  LEU n 
2 587  VAL n 
2 588  THR n 
2 589  PRO n 
2 590  LEU n 
2 591  PHE n 
2 592  LEU n 
2 593  LEU n 
2 594  SER n 
2 595  SER n 
2 596  VAL n 
2 597  VAL n 
2 598  ARG n 
2 599  SER n 
2 600  THR n 
2 601  VAL n 
2 602  LYS n 
2 603  ALA n 
2 604  LEU n 
2 605  VAL n 
2 606  SER n 
2 607  VAL n 
2 608  GLN n 
2 609  LYS n 
2 610  LEU n 
2 611  SER n 
2 612  GLU n 
2 613  PHE n 
2 614  LEU n 
2 615  SER n 
2 616  SER n 
2 617  ALA n 
2 618  GLU n 
2 619  ILE n 
2 620  ARG n 
2 621  GLU n 
2 622  GLU n 
2 623  GLN n 
2 624  CYS n 
2 625  ALA n 
2 626  PRO n 
2 627  ARG n 
2 628  GLU n 
2 629  PRO n 
2 630  ALA n 
2 631  PRO n 
2 632  GLN n 
2 633  GLY n 
2 634  GLN n 
2 635  ALA n 
2 636  GLY n 
2 637  LYS n 
2 638  TYR n 
2 639  GLN n 
2 640  ALA n 
2 641  VAL n 
2 642  PRO n 
2 643  LEU n 
2 644  LYS n 
2 645  VAL n 
2 646  VAL n 
2 647  ASN n 
2 648  ARG n 
2 649  LYS n 
2 650  ARG n 
2 651  PRO n 
2 652  ALA n 
2 653  ARG n 
2 654  GLU n 
2 655  GLU n 
2 656  VAL n 
2 657  ARG n 
2 658  ASP n 
2 659  LEU n 
2 660  LEU n 
2 661  GLY n 
2 662  PRO n 
2 663  LEU n 
2 664  GLN n 
2 665  ARG n 
2 666  LEU n 
2 667  ALA n 
2 668  PRO n 
2 669  SER n 
2 670  MET n 
2 671  ASP n 
2 672  GLY n 
2 673  ASP n 
2 674  ALA n 
2 675  ASP n 
2 676  ASN n 
2 677  PHE n 
2 678  CYS n 
2 679  VAL n 
2 680  GLN n 
2 681  ILE n 
2 682  ILE n 
2 683  GLY n 
2 684  GLY n 
2 685  PHE n 
2 686  PHE n 
2 687  THR n 
2 688  TRP n 
2 689  THR n 
2 690  PRO n 
2 691  ASP n 
2 692  GLY n 
2 693  ILE n 
2 694  PRO n 
2 695  THR n 
2 696  LEU n 
2 697  SER n 
2 698  ASN n 
2 699  ILE n 
2 700  THR n 
2 701  ILE n 
2 702  ARG n 
2 703  ILE n 
2 704  PRO n 
2 705  ARG n 
2 706  GLY n 
2 707  GLN n 
2 708  LEU n 
2 709  THR n 
2 710  MET n 
2 711  ILE n 
2 712  VAL n 
2 713  GLY n 
2 714  GLN n 
2 715  VAL n 
2 716  GLY n 
2 717  CYS n 
2 718  GLY n 
2 719  LYS n 
2 720  SER n 
2 721  SER n 
2 722  LEU n 
2 723  LEU n 
2 724  LEU n 
2 725  ALA n 
2 726  THR n 
2 727  LEU n 
2 728  GLY n 
2 729  GLU n 
2 730  MET n 
2 731  GLN n 
2 732  LYS n 
2 733  VAL n 
2 734  SER n 
2 735  GLY n 
2 736  ALA n 
2 737  VAL n 
2 738  PHE n 
2 739  TRP n 
2 740  ASN n 
2 741  SER n 
2 742  ASN n 
2 743  LEU n 
2 744  PRO n 
2 745  ASP n 
2 746  SER n 
2 747  GLU n 
2 748  GLY n 
2 749  GLU n 
2 750  ASP n 
2 751  PRO n 
2 752  SER n 
2 753  SER n 
2 754  PRO n 
2 755  GLU n 
2 756  ARG n 
2 757  GLU n 
2 758  THR n 
2 759  ALA n 
2 760  ALA n 
2 761  GLY n 
2 762  SER n 
2 763  ASP n 
2 764  ILE n 
2 765  ARG n 
2 766  SER n 
2 767  ARG n 
2 768  GLY n 
2 769  PRO n 
2 770  VAL n 
2 771  ALA n 
2 772  TYR n 
2 773  ALA n 
2 774  SER n 
2 775  GLN n 
2 776  LYS n 
2 777  PRO n 
2 778  TRP n 
2 779  LEU n 
2 780  LEU n 
2 781  ASN n 
2 782  ALA n 
2 783  THR n 
2 784  VAL n 
2 785  GLU n 
2 786  GLU n 
2 787  ASN n 
2 788  ILE n 
2 789  THR n 
2 790  PHE n 
2 791  GLU n 
2 792  SER n 
2 793  PRO n 
2 794  PHE n 
2 795  ASN n 
2 796  LYS n 
2 797  GLN n 
2 798  ARG n 
2 799  TYR n 
2 800  LYS n 
2 801  MET n 
2 802  VAL n 
2 803  ILE n 
2 804  GLU n 
2 805  ALA n 
2 806  CYS n 
2 807  SER n 
2 808  LEU n 
2 809  GLN n 
2 810  PRO n 
2 811  ASP n 
2 812  ILE n 
2 813  ASP n 
2 814  ILE n 
2 815  LEU n 
2 816  PRO n 
2 817  HIS n 
2 818  GLY n 
2 819  ASP n 
2 820  GLN n 
2 821  THR n 
2 822  GLN n 
2 823  ILE n 
2 824  GLY n 
2 825  GLU n 
2 826  ARG n 
2 827  GLY n 
2 828  ILE n 
2 829  ASN n 
2 830  LEU n 
2 831  SER n 
2 832  GLY n 
2 833  GLY n 
2 834  GLN n 
2 835  ARG n 
2 836  GLN n 
2 837  ARG n 
2 838  ILE n 
2 839  SER n 
2 840  VAL n 
2 841  ALA n 
2 842  ARG n 
2 843  ALA n 
2 844  LEU n 
2 845  TYR n 
2 846  GLN n 
2 847  GLN n 
2 848  THR n 
2 849  ASN n 
2 850  VAL n 
2 851  VAL n 
2 852  PHE n 
2 853  LEU n 
2 854  ASP n 
2 855  ASP n 
2 856  PRO n 
2 857  PHE n 
2 858  SER n 
2 859  ALA n 
2 860  LEU n 
2 861  ASP n 
2 862  VAL n 
2 863  HIS n 
2 864  LEU n 
2 865  SER n 
2 866  ASP n 
2 867  HIS n 
2 868  LEU n 
2 869  MET n 
2 870  GLN n 
2 871  ALA n 
2 872  GLY n 
2 873  ILE n 
2 874  LEU n 
2 875  GLU n 
2 876  LEU n 
2 877  LEU n 
2 878  ARG n 
2 879  ASP n 
2 880  ASP n 
2 881  LYS n 
2 882  ARG n 
2 883  THR n 
2 884  VAL n 
2 885  VAL n 
2 886  LEU n 
2 887  VAL n 
2 888  THR n 
2 889  HIS n 
2 890  LYS n 
2 891  LEU n 
2 892  GLN n 
2 893  TYR n 
2 894  LEU n 
2 895  PRO n 
2 896  HIS n 
2 897  ALA n 
2 898  ASP n 
2 899  TRP n 
2 900  ILE n 
2 901  ILE n 
2 902  ALA n 
2 903  MET n 
2 904  LYS n 
2 905  ASP n 
2 906  GLY n 
2 907  THR n 
2 908  ILE n 
2 909  GLN n 
2 910  ARG n 
2 911  GLU n 
2 912  GLY n 
2 913  THR n 
2 914  LEU n 
2 915  LYS n 
2 916  ASP n 
2 917  PHE n 
2 918  GLN n 
2 919  ARG n 
2 920  SER n 
2 921  GLU n 
2 922  CYS n 
2 923  GLN n 
2 924  LEU n 
2 925  PHE n 
2 926  GLU n 
2 927  HIS n 
2 928  TRP n 
2 929  LYS n 
2 930  THR n 
2 931  LEU n 
2 932  MET n 
2 933  ASN n 
2 934  ARG n 
2 935  GLN n 
2 936  ASP n 
2 937  GLN n 
2 938  GLU n 
2 939  LEU n 
2 940  GLU n 
2 941  LYS n 
2 942  GLU n 
2 943  THR n 
2 944  VAL n 
2 945  MET n 
2 946  GLU n 
2 947  ARG n 
2 948  LYS n 
2 949  ALA n 
2 950  SER n 
2 951  GLU n 
2 952  PRO n 
2 953  SER n 
2 954  GLN n 
2 955  GLY n 
2 956  LEU n 
2 957  PRO n 
2 958  ARG n 
2 959  ALA n 
2 960  MET n 
2 961  SER n 
2 962  SER n 
2 963  ARG n 
2 964  ASP n 
2 965  GLY n 
2 966  LEU n 
2 967  LEU n 
2 968  LEU n 
2 969  ASP n 
2 970  GLU n 
2 971  GLU n 
2 972  GLU n 
2 973  GLU n 
2 974  GLU n 
2 975  GLU n 
2 976  GLU n 
2 977  ALA n 
2 978  ALA n 
2 979  GLU n 
2 980  SER n 
2 981  GLU n 
2 982  GLU n 
2 983  ASP n 
2 984  ASP n 
2 985  ASN n 
2 986  LEU n 
2 987  SER n 
2 988  SER n 
2 989  VAL n 
2 990  LEU n 
2 991  HIS n 
2 992  GLN n 
2 993  ARG n 
2 994  ALA n 
2 995  LYS n 
2 996  ILE n 
2 997  PRO n 
2 998  TRP n 
2 999  ARG n 
2 1000 ALA n 
2 1001 CYS n 
2 1002 THR n 
2 1003 LYS n 
2 1004 TYR n 
2 1005 LEU n 
2 1006 SER n 
2 1007 SER n 
2 1008 ALA n 
2 1009 GLY n 
2 1010 ILE n 
2 1011 LEU n 
2 1012 LEU n 
2 1013 LEU n 
2 1014 SER n 
2 1015 LEU n 
2 1016 LEU n 
2 1017 VAL n 
2 1018 PHE n 
2 1019 SER n 
2 1020 GLN n 
2 1021 LEU n 
2 1022 LEU n 
2 1023 LYS n 
2 1024 HIS n 
2 1025 MET n 
2 1026 VAL n 
2 1027 LEU n 
2 1028 VAL n 
2 1029 ALA n 
2 1030 ILE n 
2 1031 ASP n 
2 1032 TYR n 
2 1033 TRP n 
2 1034 LEU n 
2 1035 ALA n 
2 1036 LYS n 
2 1037 TRP n 
2 1038 THR n 
2 1039 ASP n 
2 1040 SER n 
2 1041 ALA n 
2 1042 LEU n 
2 1043 VAL n 
2 1044 LEU n 
2 1045 SER n 
2 1046 PRO n 
2 1047 ALA n 
2 1048 ALA n 
2 1049 ARG n 
2 1050 ASN n 
2 1051 CYS n 
2 1052 SER n 
2 1053 LEU n 
2 1054 SER n 
2 1055 GLN n 
2 1056 GLU n 
2 1057 CYS n 
2 1058 ASP n 
2 1059 LEU n 
2 1060 ASP n 
2 1061 GLN n 
2 1062 SER n 
2 1063 VAL n 
2 1064 TYR n 
2 1065 ALA n 
2 1066 MET n 
2 1067 VAL n 
2 1068 PHE n 
2 1069 THR n 
2 1070 LEU n 
2 1071 LEU n 
2 1072 CYS n 
2 1073 SER n 
2 1074 LEU n 
2 1075 GLY n 
2 1076 ILE n 
2 1077 VAL n 
2 1078 LEU n 
2 1079 CYS n 
2 1080 LEU n 
2 1081 VAL n 
2 1082 THR n 
2 1083 SER n 
2 1084 VAL n 
2 1085 THR n 
2 1086 VAL n 
2 1087 GLU n 
2 1088 TRP n 
2 1089 THR n 
2 1090 GLY n 
2 1091 LEU n 
2 1092 LYS n 
2 1093 VAL n 
2 1094 ALA n 
2 1095 LYS n 
2 1096 ARG n 
2 1097 LEU n 
2 1098 HIS n 
2 1099 ARG n 
2 1100 SER n 
2 1101 LEU n 
2 1102 LEU n 
2 1103 ASN n 
2 1104 ARG n 
2 1105 ILE n 
2 1106 ILE n 
2 1107 LEU n 
2 1108 ALA n 
2 1109 PRO n 
2 1110 MET n 
2 1111 ARG n 
2 1112 PHE n 
2 1113 PHE n 
2 1114 GLU n 
2 1115 THR n 
2 1116 THR n 
2 1117 PRO n 
2 1118 LEU n 
2 1119 GLY n 
2 1120 SER n 
2 1121 ILE n 
2 1122 LEU n 
2 1123 ASN n 
2 1124 ARG n 
2 1125 PHE n 
2 1126 SER n 
2 1127 SER n 
2 1128 ASP n 
2 1129 CYS n 
2 1130 ASN n 
2 1131 THR n 
2 1132 ILE n 
2 1133 ASP n 
2 1134 GLN n 
2 1135 HIS n 
2 1136 ILE n 
2 1137 PRO n 
2 1138 SER n 
2 1139 THR n 
2 1140 LEU n 
2 1141 GLU n 
2 1142 CYS n 
2 1143 LEU n 
2 1144 SER n 
2 1145 ARG n 
2 1146 SER n 
2 1147 THR n 
2 1148 LEU n 
2 1149 LEU n 
2 1150 CYS n 
2 1151 VAL n 
2 1152 SER n 
2 1153 ALA n 
2 1154 LEU n 
2 1155 THR n 
2 1156 VAL n 
2 1157 ILE n 
2 1158 SER n 
2 1159 TYR n 
2 1160 VAL n 
2 1161 THR n 
2 1162 PRO n 
2 1163 VAL n 
2 1164 PHE n 
2 1165 LEU n 
2 1166 VAL n 
2 1167 ALA n 
2 1168 LEU n 
2 1169 LEU n 
2 1170 PRO n 
2 1171 LEU n 
2 1172 ALA n 
2 1173 VAL n 
2 1174 VAL n 
2 1175 CYS n 
2 1176 TYR n 
2 1177 PHE n 
2 1178 ILE n 
2 1179 GLN n 
2 1180 LYS n 
2 1181 TYR n 
2 1182 PHE n 
2 1183 ARG n 
2 1184 VAL n 
2 1185 ALA n 
2 1186 SER n 
2 1187 ARG n 
2 1188 ASP n 
2 1189 LEU n 
2 1190 GLN n 
2 1191 GLN n 
2 1192 LEU n 
2 1193 ASP n 
2 1194 ASP n 
2 1195 THR n 
2 1196 THR n 
2 1197 GLN n 
2 1198 LEU n 
2 1199 PRO n 
2 1200 LEU n 
2 1201 LEU n 
2 1202 SER n 
2 1203 HIS n 
2 1204 PHE n 
2 1205 ALA n 
2 1206 GLU n 
2 1207 THR n 
2 1208 VAL n 
2 1209 GLU n 
2 1210 GLY n 
2 1211 LEU n 
2 1212 THR n 
2 1213 THR n 
2 1214 ILE n 
2 1215 ARG n 
2 1216 ALA n 
2 1217 PHE n 
2 1218 ARG n 
2 1219 TYR n 
2 1220 GLU n 
2 1221 ALA n 
2 1222 ARG n 
2 1223 PHE n 
2 1224 GLN n 
2 1225 GLN n 
2 1226 LYS n 
2 1227 LEU n 
2 1228 LEU n 
2 1229 GLU n 
2 1230 TYR n 
2 1231 THR n 
2 1232 ASP n 
2 1233 SER n 
2 1234 ASN n 
2 1235 ASN n 
2 1236 ILE n 
2 1237 ALA n 
2 1238 SER n 
2 1239 LEU n 
2 1240 PHE n 
2 1241 LEU n 
2 1242 THR n 
2 1243 ALA n 
2 1244 ALA n 
2 1245 ASN n 
2 1246 ARG n 
2 1247 TRP n 
2 1248 LEU n 
2 1249 GLU n 
2 1250 VAL n 
2 1251 ARG n 
2 1252 MET n 
2 1253 GLU n 
2 1254 TYR n 
2 1255 ILE n 
2 1256 GLY n 
2 1257 ALA n 
2 1258 CYS n 
2 1259 VAL n 
2 1260 VAL n 
2 1261 LEU n 
2 1262 ILE n 
2 1263 ALA n 
2 1264 ALA n 
2 1265 ALA n 
2 1266 THR n 
2 1267 SER n 
2 1268 ILE n 
2 1269 SER n 
2 1270 ASN n 
2 1271 SER n 
2 1272 LEU n 
2 1273 HIS n 
2 1274 ARG n 
2 1275 GLU n 
2 1276 LEU n 
2 1277 SER n 
2 1278 ALA n 
2 1279 GLY n 
2 1280 LEU n 
2 1281 VAL n 
2 1282 GLY n 
2 1283 LEU n 
2 1284 GLY n 
2 1285 LEU n 
2 1286 THR n 
2 1287 TYR n 
2 1288 ALA n 
2 1289 LEU n 
2 1290 MET n 
2 1291 VAL n 
2 1292 SER n 
2 1293 ASN n 
2 1294 TYR n 
2 1295 LEU n 
2 1296 ASN n 
2 1297 TRP n 
2 1298 MET n 
2 1299 VAL n 
2 1300 ARG n 
2 1301 ASN n 
2 1302 LEU n 
2 1303 ALA n 
2 1304 ASP n 
2 1305 MET n 
2 1306 GLU n 
2 1307 ILE n 
2 1308 GLN n 
2 1309 LEU n 
2 1310 GLY n 
2 1311 ALA n 
2 1312 VAL n 
2 1313 LYS n 
2 1314 ARG n 
2 1315 ILE n 
2 1316 HIS n 
2 1317 ALA n 
2 1318 LEU n 
2 1319 LEU n 
2 1320 LYS n 
2 1321 THR n 
2 1322 GLU n 
2 1323 ALA n 
2 1324 GLU n 
2 1325 SER n 
2 1326 TYR n 
2 1327 GLU n 
2 1328 GLY n 
2 1329 LEU n 
2 1330 LEU n 
2 1331 ALA n 
2 1332 PRO n 
2 1333 SER n 
2 1334 LEU n 
2 1335 ILE n 
2 1336 PRO n 
2 1337 LYS n 
2 1338 ASN n 
2 1339 TRP n 
2 1340 PRO n 
2 1341 ASP n 
2 1342 GLN n 
2 1343 GLY n 
2 1344 LYS n 
2 1345 ILE n 
2 1346 GLN n 
2 1347 ILE n 
2 1348 GLN n 
2 1349 ASN n 
2 1350 LEU n 
2 1351 SER n 
2 1352 VAL n 
2 1353 ARG n 
2 1354 TYR n 
2 1355 ASP n 
2 1356 SER n 
2 1357 SER n 
2 1358 LEU n 
2 1359 LYS n 
2 1360 PRO n 
2 1361 VAL n 
2 1362 LEU n 
2 1363 LYS n 
2 1364 HIS n 
2 1365 VAL n 
2 1366 ASN n 
2 1367 ALA n 
2 1368 LEU n 
2 1369 ILE n 
2 1370 SER n 
2 1371 PRO n 
2 1372 GLY n 
2 1373 GLN n 
2 1374 LYS n 
2 1375 ILE n 
2 1376 GLY n 
2 1377 ILE n 
2 1378 CYS n 
2 1379 GLY n 
2 1380 ARG n 
2 1381 THR n 
2 1382 GLY n 
2 1383 SER n 
2 1384 GLY n 
2 1385 LYS n 
2 1386 SER n 
2 1387 SER n 
2 1388 PHE n 
2 1389 SER n 
2 1390 LEU n 
2 1391 ALA n 
2 1392 PHE n 
2 1393 PHE n 
2 1394 ARG n 
2 1395 MET n 
2 1396 VAL n 
2 1397 ASP n 
2 1398 MET n 
2 1399 PHE n 
2 1400 GLU n 
2 1401 GLY n 
2 1402 ARG n 
2 1403 ILE n 
2 1404 ILE n 
2 1405 ILE n 
2 1406 ASP n 
2 1407 GLY n 
2 1408 ILE n 
2 1409 ASP n 
2 1410 ILE n 
2 1411 ALA n 
2 1412 LYS n 
2 1413 LEU n 
2 1414 PRO n 
2 1415 LEU n 
2 1416 HIS n 
2 1417 THR n 
2 1418 LEU n 
2 1419 ARG n 
2 1420 SER n 
2 1421 ARG n 
2 1422 LEU n 
2 1423 SER n 
2 1424 ILE n 
2 1425 ILE n 
2 1426 LEU n 
2 1427 GLN n 
2 1428 ASP n 
2 1429 PRO n 
2 1430 VAL n 
2 1431 LEU n 
2 1432 PHE n 
2 1433 SER n 
2 1434 GLY n 
2 1435 THR n 
2 1436 ILE n 
2 1437 ARG n 
2 1438 PHE n 
2 1439 ASN n 
2 1440 LEU n 
2 1441 ASP n 
2 1442 PRO n 
2 1443 GLU n 
2 1444 LYS n 
2 1445 LYS n 
2 1446 CYS n 
2 1447 SER n 
2 1448 ASP n 
2 1449 SER n 
2 1450 THR n 
2 1451 LEU n 
2 1452 TRP n 
2 1453 GLU n 
2 1454 ALA n 
2 1455 LEU n 
2 1456 GLU n 
2 1457 ILE n 
2 1458 ALA n 
2 1459 GLN n 
2 1460 LEU n 
2 1461 LYS n 
2 1462 LEU n 
2 1463 VAL n 
2 1464 VAL n 
2 1465 LYS n 
2 1466 ALA n 
2 1467 LEU n 
2 1468 PRO n 
2 1469 GLY n 
2 1470 GLY n 
2 1471 LEU n 
2 1472 ASP n 
2 1473 ALA n 
2 1474 ILE n 
2 1475 ILE n 
2 1476 THR n 
2 1477 GLU n 
2 1478 GLY n 
2 1479 GLY n 
2 1480 GLU n 
2 1481 ASN n 
2 1482 PHE n 
2 1483 SER n 
2 1484 GLN n 
2 1485 GLY n 
2 1486 GLN n 
2 1487 ARG n 
2 1488 GLN n 
2 1489 LEU n 
2 1490 PHE n 
2 1491 CYS n 
2 1492 LEU n 
2 1493 ALA n 
2 1494 ARG n 
2 1495 ALA n 
2 1496 PHE n 
2 1497 VAL n 
2 1498 ARG n 
2 1499 LYS n 
2 1500 THR n 
2 1501 SER n 
2 1502 ILE n 
2 1503 PHE n 
2 1504 ILE n 
2 1505 MET n 
2 1506 ASP n 
2 1507 GLU n 
2 1508 ALA n 
2 1509 THR n 
2 1510 ALA n 
2 1511 SER n 
2 1512 ILE n 
2 1513 ASP n 
2 1514 MET n 
2 1515 ALA n 
2 1516 THR n 
2 1517 GLU n 
2 1518 ASN n 
2 1519 ILE n 
2 1520 LEU n 
2 1521 GLN n 
2 1522 LYS n 
2 1523 VAL n 
2 1524 VAL n 
2 1525 MET n 
2 1526 THR n 
2 1527 ALA n 
2 1528 PHE n 
2 1529 ALA n 
2 1530 ASP n 
2 1531 ARG n 
2 1532 THR n 
2 1533 VAL n 
2 1534 VAL n 
2 1535 THR n 
2 1536 ILE n 
2 1537 ALA n 
2 1538 HIS n 
2 1539 ARG n 
2 1540 VAL n 
2 1541 HIS n 
2 1542 THR n 
2 1543 ILE n 
2 1544 LEU n 
2 1545 SER n 
2 1546 ALA n 
2 1547 ASP n 
2 1548 LEU n 
2 1549 VAL n 
2 1550 MET n 
2 1551 VAL n 
2 1552 LEU n 
2 1553 LYS n 
2 1554 ARG n 
2 1555 GLY n 
2 1556 ALA n 
2 1557 ILE n 
2 1558 LEU n 
2 1559 GLU n 
2 1560 PHE n 
2 1561 ASP n 
2 1562 LYS n 
2 1563 PRO n 
2 1564 GLU n 
2 1565 THR n 
2 1566 LEU n 
2 1567 LEU n 
2 1568 SER n 
2 1569 GLN n 
2 1570 LYS n 
2 1571 ASP n 
2 1572 SER n 
2 1573 VAL n 
2 1574 PHE n 
2 1575 ALA n 
2 1576 SER n 
2 1577 PHE n 
2 1578 VAL n 
2 1579 ARG n 
2 1580 ALA n 
2 1581 ASP n 
2 1582 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 390  Mouse            ? Kcnj11 ? ? ? ? ? ? 'Mus musculus'         10090 ? ? ? ? ? ? ? ? 
'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1582 'Golden hamster' ? Abcc8  ? ? ? ? ? ? 'Mesocricetus auratus' 10036 ? ? ? ? ? ? ? ? 
'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP KCJ11_MOUSE      Q61743     ? 1 
;MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
1 
2 UNP A0A1U7R319_MESAU A0A1U7R319 ? 2 
;MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFI
LLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIGKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLLGFAGPLCI
FGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HLSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRSTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFV
GHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQA
VPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFESPFNKQRYK
MVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAGILELLRDD
KRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEPSQGLPRAM
SSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDS
ALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGS
ILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
LSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAATSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKP
VLKHVNALISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENIL
QKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5YWB A 1 ? 390  ? Q61743     1 ? 390  ? 1 390  
2 2 5YWB B 1 ? 1582 ? A0A1U7R319 1 ? 1582 ? 1 1582 
3 1 5YWB C 1 ? 390  ? Q61743     1 ? 390  ? 1 390  
4 2 5YWB D 1 ? 1582 ? A0A1U7R319 1 ? 1582 ? 1 1582 
5 1 5YWB E 1 ? 390  ? Q61743     1 ? 390  ? 1 390  
6 2 5YWB F 1 ? 1582 ? A0A1U7R319 1 ? 1582 ? 1 1582 
7 1 5YWB G 1 ? 390  ? Q61743     1 ? 390  ? 1 390  
8 2 5YWB H 1 ? 1582 ? A0A1U7R319 1 ? 1582 ? 1 1582 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5YWB 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5YWB 
_struct.title                        
'Structure of pancreatic ATP-sensitive potassium channel bound with Mg-ADP (CTD class2 at 5.2A)' 
_struct.pdbx_descriptor              
'ATP-sensitive inward rectifier potassium channel 11, ATP-binding cassette sub-family C member 8 isoform X2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5YWB 
_struct_keywords.text            'KATP, channel, glibenclamide, sulfonylurea, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 4 ? 
BA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LEU A 56   ? LEU A 66   ? LEU A 56   LEU A 66   1 ? 11 
HELX_P HELX_P2   AA2 LYS A 67   ? GLY A 98   ? LYS A 67   GLY A 98   1 ? 32 
HELX_P HELX_P3   AA3 SER A 116  ? VAL A 129  ? SER A 116  VAL A 129  1 ? 14 
HELX_P HELX_P4   AA4 CYS A 142  ? GLN A 173  ? CYS A 142  GLN A 173  1 ? 32 
HELX_P HELX_P5   AA5 SER A 265  ? LEU A 270  ? SER A 265  LEU A 270  5 ? 6  
HELX_P HELX_P6   AA6 THR A 345  ? LEU A 356  ? THR A 345  LEU A 356  1 ? 12 
HELX_P HELX_P7   AA7 GLY B 25   ? GLY B 52   ? GLY B 25   GLY B 52   1 ? 28 
HELX_P HELX_P8   AA8 GLY B 70   ? ASP B 96   ? GLY B 70   ASP B 96   1 ? 27 
HELX_P HELX_P9   AA9 LEU B 104  ? SER B 130  ? LEU B 104  SER B 130  1 ? 27 
HELX_P HELX_P10  AB1 PRO B 133  ? HIS B 160  ? PRO B 133  HIS B 160  1 ? 28 
HELX_P HELX_P11  AB2 ARG B 168  ? ARG B 193  ? ARG B 168  ARG B 193  1 ? 26 
HELX_P HELX_P12  AB3 PRO B 207  ? ASP B 212  ? PRO B 207  ASP B 212  1 ? 6  
HELX_P HELX_P13  AB4 ASN B 223  ? TYR B 230  ? ASN B 223  TYR B 230  1 ? 8  
HELX_P HELX_P14  AB5 TRP B 232  ? LYS B 243  ? TRP B 232  LYS B 243  1 ? 12 
HELX_P HELX_P15  AB6 PRO B 254  ? MET B 257  ? PRO B 254  MET B 257  5 ? 4  
HELX_P HELX_P16  AB7 ARG B 258  ? LYS B 276  ? ARG B 258  LYS B 276  1 ? 19 
HELX_P HELX_P17  AB8 ALA B 284  ? GLY B 296  ? ALA B 284  GLY B 296  1 ? 13 
HELX_P HELX_P18  AB9 GLY B 296  ? LYS B 329  ? GLY B 296  LYS B 329  1 ? 34 
HELX_P HELX_P19  AC1 ALA B 355  ? LEU B 402  ? ALA B 355  LEU B 402  1 ? 48 
HELX_P HELX_P20  AC2 SER B 403  ? MET B 409  ? SER B 403  MET B 409  1 ? 7  
HELX_P HELX_P21  AC3 GLY B 410  ? MET B 412  ? GLY B 410  MET B 412  5 ? 3  
HELX_P HELX_P22  AC4 THR B 413  ? TRP B 439  ? THR B 413  TRP B 439  1 ? 27 
HELX_P HELX_P23  AC5 ALA B 440  ? GLY B 457  ? ALA B 440  GLY B 457  1 ? 18 
HELX_P HELX_P24  AC6 SER B 459  ? ARG B 504  ? SER B 459  ARG B 504  1 ? 46 
HELX_P HELX_P25  AC7 GLY B 505  ? TYR B 512  ? GLY B 505  TYR B 512  1 ? 8  
HELX_P HELX_P26  AC8 TRP B 514  ? SER B 564  ? TRP B 514  SER B 564  1 ? 51 
HELX_P HELX_P27  AC9 SER B 572  ? SER B 615  ? SER B 572  SER B 615  1 ? 44 
HELX_P HELX_P28  AD1 GLY B 718  ? LEU B 727  ? GLY B 718  LEU B 727  1 ? 10 
HELX_P HELX_P29  AD2 THR B 783  ? PHE B 790  ? THR B 783  PHE B 790  1 ? 8  
HELX_P HELX_P30  AD3 ASN B 795  ? CYS B 806  ? ASN B 795  CYS B 806  1 ? 12 
HELX_P HELX_P31  AD4 LEU B 808  ? LEU B 815  ? LEU B 808  LEU B 815  1 ? 8  
HELX_P HELX_P32  AD5 GLY B 824  ? ILE B 828  ? GLY B 824  ILE B 828  5 ? 5  
HELX_P HELX_P33  AD6 SER B 831  ? GLN B 846  ? SER B 831  GLN B 846  1 ? 16 
HELX_P HELX_P34  AD7 ASP B 861  ? GLY B 872  ? ASP B 861  GLY B 872  1 ? 12 
HELX_P HELX_P35  AD8 TYR B 893  ? ALA B 897  ? TYR B 893  ALA B 897  5 ? 5  
HELX_P HELX_P36  AD9 LEU B 914  ? SER B 920  ? LEU B 914  SER B 920  1 ? 7  
HELX_P HELX_P37  AE1 ALA B 1000 ? GLY B 1009 ? ALA B 1000 GLY B 1009 1 ? 10 
HELX_P HELX_P38  AE2 LEU B 1011 ? ASP B 1039 ? LEU B 1011 ASP B 1039 1 ? 29 
HELX_P HELX_P39  AE3 GLN B 1061 ? LEU B 1107 ? GLN B 1061 LEU B 1107 1 ? 47 
HELX_P HELX_P40  AE4 PRO B 1109 ? THR B 1116 ? PRO B 1109 THR B 1116 1 ? 8  
HELX_P HELX_P41  AE5 PRO B 1117 ? HIS B 1135 ? PRO B 1117 HIS B 1135 1 ? 19 
HELX_P HELX_P42  AE6 HIS B 1135 ? THR B 1161 ? HIS B 1135 THR B 1161 1 ? 27 
HELX_P HELX_P43  AE7 VAL B 1163 ? VAL B 1166 ? VAL B 1163 VAL B 1166 5 ? 4  
HELX_P HELX_P44  AE8 ALA B 1167 ? GLY B 1210 ? ALA B 1167 GLY B 1210 1 ? 44 
HELX_P HELX_P45  AE9 GLY B 1210 ? ARG B 1218 ? GLY B 1210 ARG B 1218 1 ? 9  
HELX_P HELX_P46  AF1 TYR B 1219 ? ARG B 1274 ? TYR B 1219 ARG B 1274 1 ? 56 
HELX_P HELX_P47  AF2 ALA B 1278 ? LYS B 1320 ? ALA B 1278 LYS B 1320 1 ? 43 
HELX_P HELX_P48  AF3 GLY B 1384 ? PHE B 1393 ? GLY B 1384 PHE B 1393 1 ? 10 
HELX_P HELX_P49  AF4 PRO B 1414 ? SER B 1420 ? PRO B 1414 SER B 1420 1 ? 7  
HELX_P HELX_P50  AF5 THR B 1435 ? ASP B 1441 ? THR B 1435 ASP B 1441 1 ? 7  
HELX_P HELX_P51  AF6 SER B 1447 ? ALA B 1458 ? SER B 1447 ALA B 1458 1 ? 12 
HELX_P HELX_P52  AF7 LEU B 1460 ? ALA B 1466 ? LEU B 1460 ALA B 1466 1 ? 7  
HELX_P HELX_P53  AF8 SER B 1483 ? LYS B 1499 ? SER B 1483 LYS B 1499 1 ? 17 
HELX_P HELX_P54  AF9 ASP B 1513 ? PHE B 1528 ? ASP B 1513 PHE B 1528 1 ? 16 
HELX_P HELX_P55  AG1 ARG B 1539 ? ALA B 1546 ? ARG B 1539 ALA B 1546 1 ? 8  
HELX_P HELX_P56  AG2 LEU C 56   ? LEU C 66   ? LEU C 56   LEU C 66   1 ? 11 
HELX_P HELX_P57  AG3 LYS C 67   ? GLY C 98   ? LYS C 67   GLY C 98   1 ? 32 
HELX_P HELX_P58  AG4 SER C 116  ? VAL C 129  ? SER C 116  VAL C 129  1 ? 14 
HELX_P HELX_P59  AG5 CYS C 142  ? GLN C 173  ? CYS C 142  GLN C 173  1 ? 32 
HELX_P HELX_P60  AG6 SER C 265  ? LEU C 270  ? SER C 265  LEU C 270  5 ? 6  
HELX_P HELX_P61  AG7 THR C 345  ? LEU C 356  ? THR C 345  LEU C 356  1 ? 12 
HELX_P HELX_P62  AG8 GLY D 25   ? GLY D 52   ? GLY D 25   GLY D 52   1 ? 28 
HELX_P HELX_P63  AG9 GLY D 70   ? ASP D 96   ? GLY D 70   ASP D 96   1 ? 27 
HELX_P HELX_P64  AH1 LEU D 104  ? SER D 130  ? LEU D 104  SER D 130  1 ? 27 
HELX_P HELX_P65  AH2 PRO D 133  ? HIS D 160  ? PRO D 133  HIS D 160  1 ? 28 
HELX_P HELX_P66  AH3 ARG D 168  ? ARG D 193  ? ARG D 168  ARG D 193  1 ? 26 
HELX_P HELX_P67  AH4 PRO D 207  ? ASP D 212  ? PRO D 207  ASP D 212  1 ? 6  
HELX_P HELX_P68  AH5 ASN D 223  ? TYR D 230  ? ASN D 223  TYR D 230  1 ? 8  
HELX_P HELX_P69  AH6 TRP D 232  ? LYS D 243  ? TRP D 232  LYS D 243  1 ? 12 
HELX_P HELX_P70  AH7 PRO D 254  ? MET D 257  ? PRO D 254  MET D 257  5 ? 4  
HELX_P HELX_P71  AH8 ARG D 258  ? LYS D 276  ? ARG D 258  LYS D 276  1 ? 19 
HELX_P HELX_P72  AH9 ALA D 284  ? GLY D 296  ? ALA D 284  GLY D 296  1 ? 13 
HELX_P HELX_P73  AI1 GLY D 296  ? LYS D 329  ? GLY D 296  LYS D 329  1 ? 34 
HELX_P HELX_P74  AI2 ALA D 355  ? LEU D 402  ? ALA D 355  LEU D 402  1 ? 48 
HELX_P HELX_P75  AI3 SER D 403  ? MET D 409  ? SER D 403  MET D 409  1 ? 7  
HELX_P HELX_P76  AI4 GLY D 410  ? MET D 412  ? GLY D 410  MET D 412  5 ? 3  
HELX_P HELX_P77  AI5 THR D 413  ? TRP D 439  ? THR D 413  TRP D 439  1 ? 27 
HELX_P HELX_P78  AI6 ALA D 440  ? GLY D 457  ? ALA D 440  GLY D 457  1 ? 18 
HELX_P HELX_P79  AI7 SER D 459  ? ARG D 504  ? SER D 459  ARG D 504  1 ? 46 
HELX_P HELX_P80  AI8 GLY D 505  ? TYR D 512  ? GLY D 505  TYR D 512  1 ? 8  
HELX_P HELX_P81  AI9 TRP D 514  ? SER D 564  ? TRP D 514  SER D 564  1 ? 51 
HELX_P HELX_P82  AJ1 SER D 572  ? SER D 615  ? SER D 572  SER D 615  1 ? 44 
HELX_P HELX_P83  AJ2 GLY D 718  ? LEU D 727  ? GLY D 718  LEU D 727  1 ? 10 
HELX_P HELX_P84  AJ3 THR D 783  ? PHE D 790  ? THR D 783  PHE D 790  1 ? 8  
HELX_P HELX_P85  AJ4 ASN D 795  ? CYS D 806  ? ASN D 795  CYS D 806  1 ? 12 
HELX_P HELX_P86  AJ5 LEU D 808  ? LEU D 815  ? LEU D 808  LEU D 815  1 ? 8  
HELX_P HELX_P87  AJ6 GLY D 824  ? ILE D 828  ? GLY D 824  ILE D 828  5 ? 5  
HELX_P HELX_P88  AJ7 SER D 831  ? GLN D 846  ? SER D 831  GLN D 846  1 ? 16 
HELX_P HELX_P89  AJ8 ASP D 861  ? GLY D 872  ? ASP D 861  GLY D 872  1 ? 12 
HELX_P HELX_P90  AJ9 TYR D 893  ? ALA D 897  ? TYR D 893  ALA D 897  5 ? 5  
HELX_P HELX_P91  AK1 LEU D 914  ? SER D 920  ? LEU D 914  SER D 920  1 ? 7  
HELX_P HELX_P92  AK2 ALA D 1000 ? GLY D 1009 ? ALA D 1000 GLY D 1009 1 ? 10 
HELX_P HELX_P93  AK3 LEU D 1011 ? ASP D 1039 ? LEU D 1011 ASP D 1039 1 ? 29 
HELX_P HELX_P94  AK4 GLN D 1061 ? LEU D 1107 ? GLN D 1061 LEU D 1107 1 ? 47 
HELX_P HELX_P95  AK5 PRO D 1109 ? THR D 1116 ? PRO D 1109 THR D 1116 1 ? 8  
HELX_P HELX_P96  AK6 PRO D 1117 ? HIS D 1135 ? PRO D 1117 HIS D 1135 1 ? 19 
HELX_P HELX_P97  AK7 HIS D 1135 ? THR D 1161 ? HIS D 1135 THR D 1161 1 ? 27 
HELX_P HELX_P98  AK8 VAL D 1163 ? VAL D 1166 ? VAL D 1163 VAL D 1166 5 ? 4  
HELX_P HELX_P99  AK9 ALA D 1167 ? GLY D 1210 ? ALA D 1167 GLY D 1210 1 ? 44 
HELX_P HELX_P100 AL1 GLY D 1210 ? ARG D 1218 ? GLY D 1210 ARG D 1218 1 ? 9  
HELX_P HELX_P101 AL2 TYR D 1219 ? ARG D 1274 ? TYR D 1219 ARG D 1274 1 ? 56 
HELX_P HELX_P102 AL3 ALA D 1278 ? LYS D 1320 ? ALA D 1278 LYS D 1320 1 ? 43 
HELX_P HELX_P103 AL4 GLY D 1384 ? PHE D 1393 ? GLY D 1384 PHE D 1393 1 ? 10 
HELX_P HELX_P104 AL5 PRO D 1414 ? SER D 1420 ? PRO D 1414 SER D 1420 1 ? 7  
HELX_P HELX_P105 AL6 THR D 1435 ? ASP D 1441 ? THR D 1435 ASP D 1441 1 ? 7  
HELX_P HELX_P106 AL7 SER D 1447 ? ALA D 1458 ? SER D 1447 ALA D 1458 1 ? 12 
HELX_P HELX_P107 AL8 LEU D 1460 ? ALA D 1466 ? LEU D 1460 ALA D 1466 1 ? 7  
HELX_P HELX_P108 AL9 SER D 1483 ? LYS D 1499 ? SER D 1483 LYS D 1499 1 ? 17 
HELX_P HELX_P109 AM1 ASP D 1513 ? PHE D 1528 ? ASP D 1513 PHE D 1528 1 ? 16 
HELX_P HELX_P110 AM2 ARG D 1539 ? ALA D 1546 ? ARG D 1539 ALA D 1546 1 ? 8  
HELX_P HELX_P111 AM3 LEU E 56   ? LEU E 66   ? LEU E 56   LEU E 66   1 ? 11 
HELX_P HELX_P112 AM4 LYS E 67   ? GLY E 98   ? LYS E 67   GLY E 98   1 ? 32 
HELX_P HELX_P113 AM5 SER E 116  ? VAL E 129  ? SER E 116  VAL E 129  1 ? 14 
HELX_P HELX_P114 AM6 CYS E 142  ? GLN E 173  ? CYS E 142  GLN E 173  1 ? 32 
HELX_P HELX_P115 AM7 SER E 265  ? LEU E 270  ? SER E 265  LEU E 270  5 ? 6  
HELX_P HELX_P116 AM8 THR E 345  ? LEU E 356  ? THR E 345  LEU E 356  1 ? 12 
HELX_P HELX_P117 AM9 GLY F 25   ? GLY F 52   ? GLY F 25   GLY F 52   1 ? 28 
HELX_P HELX_P118 AN1 GLY F 70   ? ASP F 96   ? GLY F 70   ASP F 96   1 ? 27 
HELX_P HELX_P119 AN2 LEU F 104  ? SER F 130  ? LEU F 104  SER F 130  1 ? 27 
HELX_P HELX_P120 AN3 PRO F 133  ? HIS F 160  ? PRO F 133  HIS F 160  1 ? 28 
HELX_P HELX_P121 AN4 ARG F 168  ? ARG F 193  ? ARG F 168  ARG F 193  1 ? 26 
HELX_P HELX_P122 AN5 PRO F 207  ? ASP F 212  ? PRO F 207  ASP F 212  1 ? 6  
HELX_P HELX_P123 AN6 ASN F 223  ? TYR F 230  ? ASN F 223  TYR F 230  1 ? 8  
HELX_P HELX_P124 AN7 TRP F 232  ? LYS F 243  ? TRP F 232  LYS F 243  1 ? 12 
HELX_P HELX_P125 AN8 PRO F 254  ? MET F 257  ? PRO F 254  MET F 257  5 ? 4  
HELX_P HELX_P126 AN9 ARG F 258  ? LYS F 276  ? ARG F 258  LYS F 276  1 ? 19 
HELX_P HELX_P127 AO1 ALA F 284  ? GLY F 296  ? ALA F 284  GLY F 296  1 ? 13 
HELX_P HELX_P128 AO2 GLY F 296  ? LYS F 329  ? GLY F 296  LYS F 329  1 ? 34 
HELX_P HELX_P129 AO3 ALA F 355  ? LEU F 402  ? ALA F 355  LEU F 402  1 ? 48 
HELX_P HELX_P130 AO4 SER F 403  ? MET F 409  ? SER F 403  MET F 409  1 ? 7  
HELX_P HELX_P131 AO5 GLY F 410  ? MET F 412  ? GLY F 410  MET F 412  5 ? 3  
HELX_P HELX_P132 AO6 THR F 413  ? TRP F 439  ? THR F 413  TRP F 439  1 ? 27 
HELX_P HELX_P133 AO7 ALA F 440  ? GLY F 457  ? ALA F 440  GLY F 457  1 ? 18 
HELX_P HELX_P134 AO8 SER F 459  ? ARG F 504  ? SER F 459  ARG F 504  1 ? 46 
HELX_P HELX_P135 AO9 GLY F 505  ? TYR F 512  ? GLY F 505  TYR F 512  1 ? 8  
HELX_P HELX_P136 AP1 TRP F 514  ? SER F 564  ? TRP F 514  SER F 564  1 ? 51 
HELX_P HELX_P137 AP2 SER F 572  ? SER F 615  ? SER F 572  SER F 615  1 ? 44 
HELX_P HELX_P138 AP3 GLY F 718  ? LEU F 727  ? GLY F 718  LEU F 727  1 ? 10 
HELX_P HELX_P139 AP4 THR F 783  ? PHE F 790  ? THR F 783  PHE F 790  1 ? 8  
HELX_P HELX_P140 AP5 ASN F 795  ? CYS F 806  ? ASN F 795  CYS F 806  1 ? 12 
HELX_P HELX_P141 AP6 LEU F 808  ? LEU F 815  ? LEU F 808  LEU F 815  1 ? 8  
HELX_P HELX_P142 AP7 GLY F 824  ? ILE F 828  ? GLY F 824  ILE F 828  5 ? 5  
HELX_P HELX_P143 AP8 SER F 831  ? GLN F 846  ? SER F 831  GLN F 846  1 ? 16 
HELX_P HELX_P144 AP9 ASP F 861  ? GLY F 872  ? ASP F 861  GLY F 872  1 ? 12 
HELX_P HELX_P145 AQ1 TYR F 893  ? ALA F 897  ? TYR F 893  ALA F 897  5 ? 5  
HELX_P HELX_P146 AQ2 LEU F 914  ? SER F 920  ? LEU F 914  SER F 920  1 ? 7  
HELX_P HELX_P147 AQ3 ALA F 1000 ? GLY F 1009 ? ALA F 1000 GLY F 1009 1 ? 10 
HELX_P HELX_P148 AQ4 LEU F 1011 ? ASP F 1039 ? LEU F 1011 ASP F 1039 1 ? 29 
HELX_P HELX_P149 AQ5 GLN F 1061 ? LEU F 1107 ? GLN F 1061 LEU F 1107 1 ? 47 
HELX_P HELX_P150 AQ6 PRO F 1109 ? THR F 1116 ? PRO F 1109 THR F 1116 1 ? 8  
HELX_P HELX_P151 AQ7 PRO F 1117 ? HIS F 1135 ? PRO F 1117 HIS F 1135 1 ? 19 
HELX_P HELX_P152 AQ8 HIS F 1135 ? THR F 1161 ? HIS F 1135 THR F 1161 1 ? 27 
HELX_P HELX_P153 AQ9 VAL F 1163 ? VAL F 1166 ? VAL F 1163 VAL F 1166 5 ? 4  
HELX_P HELX_P154 AR1 ALA F 1167 ? GLY F 1210 ? ALA F 1167 GLY F 1210 1 ? 44 
HELX_P HELX_P155 AR2 GLY F 1210 ? ARG F 1218 ? GLY F 1210 ARG F 1218 1 ? 9  
HELX_P HELX_P156 AR3 TYR F 1219 ? ARG F 1274 ? TYR F 1219 ARG F 1274 1 ? 56 
HELX_P HELX_P157 AR4 ALA F 1278 ? LYS F 1320 ? ALA F 1278 LYS F 1320 1 ? 43 
HELX_P HELX_P158 AR5 GLY F 1384 ? PHE F 1393 ? GLY F 1384 PHE F 1393 1 ? 10 
HELX_P HELX_P159 AR6 PRO F 1414 ? SER F 1420 ? PRO F 1414 SER F 1420 1 ? 7  
HELX_P HELX_P160 AR7 THR F 1435 ? ASP F 1441 ? THR F 1435 ASP F 1441 1 ? 7  
HELX_P HELX_P161 AR8 SER F 1447 ? ALA F 1458 ? SER F 1447 ALA F 1458 1 ? 12 
HELX_P HELX_P162 AR9 LEU F 1460 ? ALA F 1466 ? LEU F 1460 ALA F 1466 1 ? 7  
HELX_P HELX_P163 AS1 SER F 1483 ? LYS F 1499 ? SER F 1483 LYS F 1499 1 ? 17 
HELX_P HELX_P164 AS2 ASP F 1513 ? PHE F 1528 ? ASP F 1513 PHE F 1528 1 ? 16 
HELX_P HELX_P165 AS3 ARG F 1539 ? ALA F 1546 ? ARG F 1539 ALA F 1546 1 ? 8  
HELX_P HELX_P166 AS4 LEU G 56   ? LEU G 66   ? LEU G 56   LEU G 66   1 ? 11 
HELX_P HELX_P167 AS5 LYS G 67   ? GLY G 98   ? LYS G 67   GLY G 98   1 ? 32 
HELX_P HELX_P168 AS6 SER G 116  ? VAL G 129  ? SER G 116  VAL G 129  1 ? 14 
HELX_P HELX_P169 AS7 CYS G 142  ? GLN G 173  ? CYS G 142  GLN G 173  1 ? 32 
HELX_P HELX_P170 AS8 SER G 265  ? LEU G 270  ? SER G 265  LEU G 270  5 ? 6  
HELX_P HELX_P171 AS9 THR G 345  ? LEU G 356  ? THR G 345  LEU G 356  1 ? 12 
HELX_P HELX_P172 AT1 GLY H 25   ? GLY H 52   ? GLY H 25   GLY H 52   1 ? 28 
HELX_P HELX_P173 AT2 GLY H 70   ? ASP H 96   ? GLY H 70   ASP H 96   1 ? 27 
HELX_P HELX_P174 AT3 LEU H 104  ? SER H 130  ? LEU H 104  SER H 130  1 ? 27 
HELX_P HELX_P175 AT4 PRO H 133  ? HIS H 160  ? PRO H 133  HIS H 160  1 ? 28 
HELX_P HELX_P176 AT5 ARG H 168  ? ARG H 193  ? ARG H 168  ARG H 193  1 ? 26 
HELX_P HELX_P177 AT6 PRO H 207  ? ASP H 212  ? PRO H 207  ASP H 212  1 ? 6  
HELX_P HELX_P178 AT7 ASN H 223  ? TYR H 230  ? ASN H 223  TYR H 230  1 ? 8  
HELX_P HELX_P179 AT8 TRP H 232  ? LYS H 243  ? TRP H 232  LYS H 243  1 ? 12 
HELX_P HELX_P180 AT9 PRO H 254  ? MET H 257  ? PRO H 254  MET H 257  5 ? 4  
HELX_P HELX_P181 AU1 ARG H 258  ? LYS H 276  ? ARG H 258  LYS H 276  1 ? 19 
HELX_P HELX_P182 AU2 ALA H 284  ? GLY H 296  ? ALA H 284  GLY H 296  1 ? 13 
HELX_P HELX_P183 AU3 GLY H 296  ? LYS H 329  ? GLY H 296  LYS H 329  1 ? 34 
HELX_P HELX_P184 AU4 ALA H 355  ? LEU H 402  ? ALA H 355  LEU H 402  1 ? 48 
HELX_P HELX_P185 AU5 SER H 403  ? MET H 409  ? SER H 403  MET H 409  1 ? 7  
HELX_P HELX_P186 AU6 GLY H 410  ? MET H 412  ? GLY H 410  MET H 412  5 ? 3  
HELX_P HELX_P187 AU7 THR H 413  ? TRP H 439  ? THR H 413  TRP H 439  1 ? 27 
HELX_P HELX_P188 AU8 ALA H 440  ? GLY H 457  ? ALA H 440  GLY H 457  1 ? 18 
HELX_P HELX_P189 AU9 SER H 459  ? ARG H 504  ? SER H 459  ARG H 504  1 ? 46 
HELX_P HELX_P190 AV1 GLY H 505  ? TYR H 512  ? GLY H 505  TYR H 512  1 ? 8  
HELX_P HELX_P191 AV2 TRP H 514  ? SER H 564  ? TRP H 514  SER H 564  1 ? 51 
HELX_P HELX_P192 AV3 SER H 572  ? SER H 615  ? SER H 572  SER H 615  1 ? 44 
HELX_P HELX_P193 AV4 GLY H 718  ? LEU H 727  ? GLY H 718  LEU H 727  1 ? 10 
HELX_P HELX_P194 AV5 THR H 783  ? PHE H 790  ? THR H 783  PHE H 790  1 ? 8  
HELX_P HELX_P195 AV6 ASN H 795  ? CYS H 806  ? ASN H 795  CYS H 806  1 ? 12 
HELX_P HELX_P196 AV7 LEU H 808  ? LEU H 815  ? LEU H 808  LEU H 815  1 ? 8  
HELX_P HELX_P197 AV8 GLY H 824  ? ILE H 828  ? GLY H 824  ILE H 828  5 ? 5  
HELX_P HELX_P198 AV9 SER H 831  ? GLN H 846  ? SER H 831  GLN H 846  1 ? 16 
HELX_P HELX_P199 AW1 ASP H 861  ? GLY H 872  ? ASP H 861  GLY H 872  1 ? 12 
HELX_P HELX_P200 AW2 TYR H 893  ? ALA H 897  ? TYR H 893  ALA H 897  5 ? 5  
HELX_P HELX_P201 AW3 LEU H 914  ? SER H 920  ? LEU H 914  SER H 920  1 ? 7  
HELX_P HELX_P202 AW4 ALA H 1000 ? GLY H 1009 ? ALA H 1000 GLY H 1009 1 ? 10 
HELX_P HELX_P203 AW5 LEU H 1011 ? ASP H 1039 ? LEU H 1011 ASP H 1039 1 ? 29 
HELX_P HELX_P204 AW6 GLN H 1061 ? LEU H 1107 ? GLN H 1061 LEU H 1107 1 ? 47 
HELX_P HELX_P205 AW7 PRO H 1109 ? THR H 1116 ? PRO H 1109 THR H 1116 1 ? 8  
HELX_P HELX_P206 AW8 PRO H 1117 ? HIS H 1135 ? PRO H 1117 HIS H 1135 1 ? 19 
HELX_P HELX_P207 AW9 HIS H 1135 ? THR H 1161 ? HIS H 1135 THR H 1161 1 ? 27 
HELX_P HELX_P208 AX1 VAL H 1163 ? VAL H 1166 ? VAL H 1163 VAL H 1166 5 ? 4  
HELX_P HELX_P209 AX2 ALA H 1167 ? GLY H 1210 ? ALA H 1167 GLY H 1210 1 ? 44 
HELX_P HELX_P210 AX3 GLY H 1210 ? ARG H 1218 ? GLY H 1210 ARG H 1218 1 ? 9  
HELX_P HELX_P211 AX4 TYR H 1219 ? ARG H 1274 ? TYR H 1219 ARG H 1274 1 ? 56 
HELX_P HELX_P212 AX5 ALA H 1278 ? LYS H 1320 ? ALA H 1278 LYS H 1320 1 ? 43 
HELX_P HELX_P213 AX6 GLY H 1384 ? PHE H 1393 ? GLY H 1384 PHE H 1393 1 ? 10 
HELX_P HELX_P214 AX7 PRO H 1414 ? SER H 1420 ? PRO H 1414 SER H 1420 1 ? 7  
HELX_P HELX_P215 AX8 THR H 1435 ? ASP H 1441 ? THR H 1435 ASP H 1441 1 ? 7  
HELX_P HELX_P216 AX9 SER H 1447 ? ALA H 1458 ? SER H 1447 ALA H 1458 1 ? 12 
HELX_P HELX_P217 AY1 LEU H 1460 ? ALA H 1466 ? LEU H 1460 ALA H 1466 1 ? 7  
HELX_P HELX_P218 AY2 SER H 1483 ? LYS H 1499 ? SER H 1483 LYS H 1499 1 ? 17 
HELX_P HELX_P219 AY3 ASP H 1513 ? PHE H 1528 ? ASP H 1513 PHE H 1528 1 ? 16 
HELX_P HELX_P220 AY4 ARG H 1539 ? ALA H 1546 ? ARG H 1539 ALA H 1546 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 110 SG  ? ? ? 1_555 A  CYS 142 SG ? ? A CYS 110  A CYS 142  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2  disulf ? ? C CYS 110 SG  ? ? ? 1_555 C  CYS 142 SG ? ? C CYS 110  C CYS 142  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3  disulf ? ? E CYS 110 SG  ? ? ? 1_555 E  CYS 142 SG ? ? E CYS 110  E CYS 142  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf4  disulf ? ? G CYS 110 SG  ? ? ? 1_555 G  CYS 142 SG ? ? G CYS 110  G CYS 142  1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1  metalc ? ? B SER 720 OG  ? ? ? 1_555 L  MG  .   MG ? ? B SER 720  B MG  2503 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc2  metalc ? ? B GLN 775 OE1 ? ? ? 1_555 L  MG  .   MG ? ? B GLN 775  B MG  2503 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc3  metalc ? ? D SER 720 OG  ? ? ? 1_555 Q  MG  .   MG ? ? D SER 720  D MG  2503 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc4  metalc ? ? D GLN 775 OE1 ? ? ? 1_555 Q  MG  .   MG ? ? D GLN 775  D MG  2503 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc5  metalc ? ? F SER 720 OG  ? ? ? 1_555 V  MG  .   MG ? ? F SER 720  F MG  2503 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc6  metalc ? ? F GLN 775 OE1 ? ? ? 1_555 V  MG  .   MG ? ? F GLN 775  F MG  2503 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc7  metalc ? ? H SER 720 OG  ? ? ? 1_555 AA MG  .   MG ? ? H SER 720  H MG  2503 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc8  metalc ? ? H GLN 775 OE1 ? ? ? 1_555 AA MG  .   MG ? ? H GLN 775  H MG  2503 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc9  metalc ? ? J ADP .   O2B ? ? ? 1_555 L  MG  .   MG ? ? B ADP 2501 B MG  2503 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc10 metalc ? ? J ADP .   O3B ? ? ? 1_555 L  MG  .   MG ? ? B ADP 2501 B MG  2503 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc11 metalc ? ? K ADP .   O2B ? ? ? 1_555 M  MG  .   MG ? ? B ADP 2502 B MG  2504 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc12 metalc ? ? O ADP .   O2B ? ? ? 1_555 Q  MG  .   MG ? ? D ADP 2501 D MG  2503 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc13 metalc ? ? O ADP .   O3B ? ? ? 1_555 Q  MG  .   MG ? ? D ADP 2501 D MG  2503 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc14 metalc ? ? P ADP .   O2B ? ? ? 1_555 R  MG  .   MG ? ? D ADP 2502 D MG  2504 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc15 metalc ? ? T ADP .   O2B ? ? ? 1_555 V  MG  .   MG ? ? F ADP 2501 F MG  2503 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc16 metalc ? ? T ADP .   O3B ? ? ? 1_555 V  MG  .   MG ? ? F ADP 2501 F MG  2503 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc17 metalc ? ? U ADP .   O2B ? ? ? 1_555 W  MG  .   MG ? ? F ADP 2502 F MG  2504 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc18 metalc ? ? Y ADP .   O2B ? ? ? 1_555 AA MG  .   MG ? ? H ADP 2501 H MG  2503 1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc19 metalc ? ? Y ADP .   O3B ? ? ? 1_555 AA MG  .   MG ? ? H ADP 2501 H MG  2503 1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc20 metalc ? ? Z ADP .   O2B ? ? ? 1_555 BA MG  .   MG ? ? H ADP 2502 H MG  2504 1_555 ? ? ? ? ? ? ? 2.788 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 6 ? 
AB1 ? 3 ? 
AB2 ? 6 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 2 ? 
AC1 ? 6 ? 
AC2 ? 3 ? 
AC3 ? 6 ? 
AC4 ? 3 ? 
AC5 ? 3 ? 
AC6 ? 4 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 3 ? 
AD1 ? 2 ? 
AD2 ? 6 ? 
AD3 ? 3 ? 
AD4 ? 6 ? 
AD5 ? 3 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 6 ? 
AE3 ? 3 ? 
AE4 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AA9 5 6 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? parallel      
AC1 2 3 ? parallel      
AC1 3 4 ? parallel      
AC1 4 5 ? parallel      
AC1 5 6 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? parallel      
AC3 2 3 ? parallel      
AC3 3 4 ? parallel      
AC3 4 5 ? parallel      
AC3 5 6 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD2 3 4 ? parallel      
AD2 4 5 ? parallel      
AD2 5 6 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? parallel      
AD4 3 4 ? parallel      
AD4 4 5 ? parallel      
AD4 5 6 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? parallel      
AE2 2 3 ? parallel      
AE2 3 4 ? parallel      
AE2 4 5 ? parallel      
AE2 5 6 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? parallel      
AE4 2 3 ? parallel      
AE4 3 4 ? parallel      
AE4 4 5 ? parallel      
AE4 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 45   ? LYS A 47   ? ALA A 45   LYS A 47   
AA1 2 TYR C 326  ? ASP C 329  ? TYR C 326  ASP C 329  
AA1 3 VAL C 319  ? GLU C 321  ? VAL C 319  GLU C 321  
AA2 1 VAL A 188  ? ARG A 192  ? VAL A 188  ARG A 192  
AA2 2 ARG A 195  ? LEU A 200  ? ARG A 195  LEU A 200  
AA2 3 ILE A 257  ? VAL A 260  ? ILE A 257  VAL A 260  
AA3 1 VAL A 236  ? ILE A 238  ? VAL A 236  ILE A 238  
AA3 2 ILE A 210  ? VAL A 220  ? ILE A 210  VAL A 220  
AA3 3 GLU A 282  ? VAL A 291  ? GLU A 282  VAL A 291  
AA3 4 THR A 297  ? TYR A 304  ? THR A 297  TYR A 304  
AA4 1 THR A 223  ? THR A 224  ? THR A 223  THR A 224  
AA4 2 VAL A 230  ? VAL A 231  ? VAL A 230  VAL A 231  
AA5 1 GLN A 313  ? PHE A 315  ? GLN A 313  PHE A 315  
AA5 2 THR A 336  ? LYS A 338  ? THR A 336  LYS A 338  
AA6 1 VAL A 319  ? GLU A 321  ? VAL A 319  GLU A 321  
AA6 2 TYR A 326  ? ASP A 329  ? TYR A 326  ASP A 329  
AA6 3 ALA G 45   ? LYS G 47   ? ALA G 45   LYS G 47   
AA7 1 ILE B 701  ? ILE B 703  ? ILE B 701  ILE B 703  
AA7 2 VAL B 679  ? ILE B 682  ? VAL B 679  ILE B 682  
AA7 3 ALA B 736  ? PHE B 738  ? ALA B 736  PHE B 738  
AA8 1 PHE B 685  ? PHE B 686  ? PHE B 685  PHE B 686  
AA8 2 LEU B 696  ? SER B 697  ? LEU B 696  SER B 697  
AA9 1 ALA B 771  ? ALA B 773  ? ALA B 771  ALA B 773  
AA9 2 VAL B 850  ? ASP B 854  ? VAL B 850  ASP B 854  
AA9 3 THR B 883  ? VAL B 887  ? THR B 883  VAL B 887  
AA9 4 LEU B 708  ? GLY B 713  ? LEU B 708  GLY B 713  
AA9 5 TRP B 899  ? LYS B 904  ? TRP B 899  LYS B 904  
AA9 6 THR B 907  ? THR B 913  ? THR B 907  THR B 913  
AB1 1 LEU B 1362 ? ILE B 1369 ? LEU B 1362 ILE B 1369 
AB1 2 ILE B 1345 ? VAL B 1352 ? ILE B 1345 VAL B 1352 
AB1 3 GLU B 1400 ? ILE B 1405 ? GLU B 1400 ILE B 1405 
AB2 1 LEU B 1422 ? ILE B 1425 ? LEU B 1422 ILE B 1425 
AB2 2 ILE B 1502 ? ASP B 1506 ? ILE B 1502 ASP B 1506 
AB2 3 THR B 1532 ? ILE B 1536 ? THR B 1532 ILE B 1536 
AB2 4 LYS B 1374 ? CYS B 1378 ? LYS B 1374 CYS B 1378 
AB2 5 LEU B 1548 ? LEU B 1552 ? LEU B 1548 LEU B 1552 
AB2 6 ILE B 1557 ? PHE B 1560 ? ILE B 1557 PHE B 1560 
AB3 1 ALA C 45   ? LYS C 47   ? ALA C 45   LYS C 47   
AB3 2 TYR E 326  ? ASP E 329  ? TYR E 326  ASP E 329  
AB3 3 VAL E 319  ? GLU E 321  ? VAL E 319  GLU E 321  
AB4 1 VAL C 188  ? ARG C 192  ? VAL C 188  ARG C 192  
AB4 2 ARG C 195  ? LEU C 200  ? ARG C 195  LEU C 200  
AB4 3 ILE C 257  ? VAL C 260  ? ILE C 257  VAL C 260  
AB5 1 VAL C 236  ? ILE C 238  ? VAL C 236  ILE C 238  
AB5 2 ILE C 210  ? VAL C 220  ? ILE C 210  VAL C 220  
AB5 3 GLU C 282  ? VAL C 291  ? GLU C 282  VAL C 291  
AB5 4 THR C 297  ? TYR C 304  ? THR C 297  TYR C 304  
AB6 1 THR C 223  ? THR C 224  ? THR C 223  THR C 224  
AB6 2 VAL C 230  ? VAL C 231  ? VAL C 230  VAL C 231  
AB7 1 GLN C 313  ? PHE C 315  ? GLN C 313  PHE C 315  
AB7 2 THR C 336  ? LYS C 338  ? THR C 336  LYS C 338  
AB8 1 ILE D 701  ? ILE D 703  ? ILE D 701  ILE D 703  
AB8 2 VAL D 679  ? ILE D 682  ? VAL D 679  ILE D 682  
AB8 3 ALA D 736  ? PHE D 738  ? ALA D 736  PHE D 738  
AB9 1 PHE D 685  ? PHE D 686  ? PHE D 685  PHE D 686  
AB9 2 LEU D 696  ? SER D 697  ? LEU D 696  SER D 697  
AC1 1 ALA D 771  ? ALA D 773  ? ALA D 771  ALA D 773  
AC1 2 VAL D 850  ? ASP D 854  ? VAL D 850  ASP D 854  
AC1 3 THR D 883  ? VAL D 887  ? THR D 883  VAL D 887  
AC1 4 LEU D 708  ? GLY D 713  ? LEU D 708  GLY D 713  
AC1 5 TRP D 899  ? LYS D 904  ? TRP D 899  LYS D 904  
AC1 6 THR D 907  ? THR D 913  ? THR D 907  THR D 913  
AC2 1 LEU D 1362 ? ILE D 1369 ? LEU D 1362 ILE D 1369 
AC2 2 ILE D 1345 ? VAL D 1352 ? ILE D 1345 VAL D 1352 
AC2 3 GLU D 1400 ? ILE D 1405 ? GLU D 1400 ILE D 1405 
AC3 1 LEU D 1422 ? ILE D 1425 ? LEU D 1422 ILE D 1425 
AC3 2 ILE D 1502 ? ASP D 1506 ? ILE D 1502 ASP D 1506 
AC3 3 THR D 1532 ? ILE D 1536 ? THR D 1532 ILE D 1536 
AC3 4 LYS D 1374 ? CYS D 1378 ? LYS D 1374 CYS D 1378 
AC3 5 LEU D 1548 ? LEU D 1552 ? LEU D 1548 LEU D 1552 
AC3 6 ILE D 1557 ? PHE D 1560 ? ILE D 1557 PHE D 1560 
AC4 1 ALA E 45   ? LYS E 47   ? ALA E 45   LYS E 47   
AC4 2 TYR G 326  ? ASP G 329  ? TYR G 326  ASP G 329  
AC4 3 VAL G 319  ? GLU G 321  ? VAL G 319  GLU G 321  
AC5 1 VAL E 188  ? ARG E 192  ? VAL E 188  ARG E 192  
AC5 2 ARG E 195  ? LEU E 200  ? ARG E 195  LEU E 200  
AC5 3 ILE E 257  ? VAL E 260  ? ILE E 257  VAL E 260  
AC6 1 VAL E 236  ? ILE E 238  ? VAL E 236  ILE E 238  
AC6 2 ILE E 210  ? VAL E 220  ? ILE E 210  VAL E 220  
AC6 3 GLU E 282  ? VAL E 291  ? GLU E 282  VAL E 291  
AC6 4 THR E 297  ? TYR E 304  ? THR E 297  TYR E 304  
AC7 1 THR E 223  ? THR E 224  ? THR E 223  THR E 224  
AC7 2 VAL E 230  ? VAL E 231  ? VAL E 230  VAL E 231  
AC8 1 GLN E 313  ? PHE E 315  ? GLN E 313  PHE E 315  
AC8 2 THR E 336  ? LYS E 338  ? THR E 336  LYS E 338  
AC9 1 ILE F 701  ? ILE F 703  ? ILE F 701  ILE F 703  
AC9 2 VAL F 679  ? ILE F 682  ? VAL F 679  ILE F 682  
AC9 3 ALA F 736  ? PHE F 738  ? ALA F 736  PHE F 738  
AD1 1 PHE F 685  ? PHE F 686  ? PHE F 685  PHE F 686  
AD1 2 LEU F 696  ? SER F 697  ? LEU F 696  SER F 697  
AD2 1 ALA F 771  ? ALA F 773  ? ALA F 771  ALA F 773  
AD2 2 VAL F 850  ? ASP F 854  ? VAL F 850  ASP F 854  
AD2 3 THR F 883  ? VAL F 887  ? THR F 883  VAL F 887  
AD2 4 LEU F 708  ? GLY F 713  ? LEU F 708  GLY F 713  
AD2 5 TRP F 899  ? LYS F 904  ? TRP F 899  LYS F 904  
AD2 6 THR F 907  ? THR F 913  ? THR F 907  THR F 913  
AD3 1 LEU F 1362 ? ILE F 1369 ? LEU F 1362 ILE F 1369 
AD3 2 ILE F 1345 ? VAL F 1352 ? ILE F 1345 VAL F 1352 
AD3 3 GLU F 1400 ? ILE F 1405 ? GLU F 1400 ILE F 1405 
AD4 1 LEU F 1422 ? ILE F 1425 ? LEU F 1422 ILE F 1425 
AD4 2 ILE F 1502 ? ASP F 1506 ? ILE F 1502 ASP F 1506 
AD4 3 THR F 1532 ? ILE F 1536 ? THR F 1532 ILE F 1536 
AD4 4 LYS F 1374 ? CYS F 1378 ? LYS F 1374 CYS F 1378 
AD4 5 LEU F 1548 ? LEU F 1552 ? LEU F 1548 LEU F 1552 
AD4 6 ILE F 1557 ? PHE F 1560 ? ILE F 1557 PHE F 1560 
AD5 1 VAL G 188  ? ARG G 192  ? VAL G 188  ARG G 192  
AD5 2 ARG G 195  ? LEU G 200  ? ARG G 195  LEU G 200  
AD5 3 ILE G 257  ? VAL G 260  ? ILE G 257  VAL G 260  
AD6 1 VAL G 236  ? ILE G 238  ? VAL G 236  ILE G 238  
AD6 2 ILE G 210  ? VAL G 220  ? ILE G 210  VAL G 220  
AD6 3 GLU G 282  ? VAL G 291  ? GLU G 282  VAL G 291  
AD6 4 THR G 297  ? TYR G 304  ? THR G 297  TYR G 304  
AD7 1 THR G 223  ? THR G 224  ? THR G 223  THR G 224  
AD7 2 VAL G 230  ? VAL G 231  ? VAL G 230  VAL G 231  
AD8 1 GLN G 313  ? PHE G 315  ? GLN G 313  PHE G 315  
AD8 2 THR G 336  ? LYS G 338  ? THR G 336  LYS G 338  
AD9 1 ILE H 701  ? ILE H 703  ? ILE H 701  ILE H 703  
AD9 2 VAL H 679  ? ILE H 682  ? VAL H 679  ILE H 682  
AD9 3 ALA H 736  ? PHE H 738  ? ALA H 736  PHE H 738  
AE1 1 PHE H 685  ? PHE H 686  ? PHE H 685  PHE H 686  
AE1 2 LEU H 696  ? SER H 697  ? LEU H 696  SER H 697  
AE2 1 ALA H 771  ? ALA H 773  ? ALA H 771  ALA H 773  
AE2 2 VAL H 850  ? ASP H 854  ? VAL H 850  ASP H 854  
AE2 3 THR H 883  ? VAL H 887  ? THR H 883  VAL H 887  
AE2 4 LEU H 708  ? GLY H 713  ? LEU H 708  GLY H 713  
AE2 5 TRP H 899  ? LYS H 904  ? TRP H 899  LYS H 904  
AE2 6 THR H 907  ? THR H 913  ? THR H 907  THR H 913  
AE3 1 LEU H 1362 ? ILE H 1369 ? LEU H 1362 ILE H 1369 
AE3 2 ILE H 1345 ? VAL H 1352 ? ILE H 1345 VAL H 1352 
AE3 3 GLU H 1400 ? ILE H 1405 ? GLU H 1400 ILE H 1405 
AE4 1 LEU H 1422 ? ILE H 1425 ? LEU H 1422 ILE H 1425 
AE4 2 ILE H 1502 ? ASP H 1506 ? ILE H 1502 ASP H 1506 
AE4 3 THR H 1532 ? ILE H 1536 ? THR H 1532 ILE H 1536 
AE4 4 LYS H 1374 ? CYS H 1378 ? LYS H 1374 CYS H 1378 
AE4 5 LEU H 1548 ? LEU H 1552 ? LEU H 1548 LEU H 1552 
AE4 6 ILE H 1557 ? PHE H 1560 ? ILE H 1557 PHE H 1560 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 47   ? N LYS A 47   O VAL C 328  ? O VAL C 328  
AA1 2 3 O SER C 327  ? O SER C 327  N ALA C 320  ? N ALA C 320  
AA2 1 2 N VAL A 188  ? N VAL A 188  O MET A 199  ? O MET A 199  
AA2 2 3 N PHE A 198  ? N PHE A 198  O HIS A 259  ? O HIS A 259  
AA3 1 2 O ILE A 238  ? O ILE A 238  N MET A 217  ? N MET A 217  
AA3 2 3 N ILE A 211  ? N ILE A 211  O VAL A 290  ? O VAL A 290  
AA3 3 4 N LEU A 287  ? N LEU A 287  O ALA A 300  ? O ALA A 300  
AA4 1 2 N THR A 223  ? N THR A 223  O VAL A 231  ? O VAL A 231  
AA5 1 2 N ARG A 314  ? N ARG A 314  O ILE A 337  ? O ILE A 337  
AA6 1 2 N ALA A 320  ? N ALA A 320  O SER A 327  ? O SER A 327  
AA6 2 3 N VAL A 328  ? N VAL A 328  O LYS G 47   ? O LYS G 47   
AA7 1 2 O ILE B 701  ? O ILE B 701  N ILE B 681  ? N ILE B 681  
AA7 2 3 N ILE B 682  ? N ILE B 682  O ALA B 736  ? O ALA B 736  
AA8 1 2 N PHE B 686  ? N PHE B 686  O LEU B 696  ? O LEU B 696  
AA9 1 2 N ALA B 773  ? N ALA B 773  O PHE B 852  ? O PHE B 852  
AA9 2 3 N VAL B 851  ? N VAL B 851  O VAL B 885  ? O VAL B 885  
AA9 3 4 O LEU B 886  ? O LEU B 886  N THR B 709  ? N THR B 709  
AA9 4 5 N VAL B 712  ? N VAL B 712  O ILE B 901  ? O ILE B 901  
AA9 5 6 N LYS B 904  ? N LYS B 904  O THR B 907  ? O THR B 907  
AB1 1 2 O ILE B 1369 ? O ILE B 1369 N ILE B 1345 ? N ILE B 1345 
AB1 2 3 N GLN B 1346 ? N GLN B 1346 O ILE B 1404 ? O ILE B 1404 
AB2 1 2 N ILE B 1425 ? N ILE B 1425 O ASP B 1506 ? O ASP B 1506 
AB2 2 3 N PHE B 1503 ? N PHE B 1503 O VAL B 1534 ? O VAL B 1534 
AB2 3 4 O VAL B 1533 ? O VAL B 1533 N ILE B 1375 ? N ILE B 1375 
AB2 4 5 N CYS B 1378 ? N CYS B 1378 O LEU B 1552 ? O LEU B 1552 
AB2 5 6 N VAL B 1549 ? N VAL B 1549 O PHE B 1560 ? O PHE B 1560 
AB3 1 2 N LYS C 47   ? N LYS C 47   O VAL E 328  ? O VAL E 328  
AB3 2 3 O SER E 327  ? O SER E 327  N ALA E 320  ? N ALA E 320  
AB4 1 2 N VAL C 188  ? N VAL C 188  O MET C 199  ? O MET C 199  
AB4 2 3 N PHE C 198  ? N PHE C 198  O HIS C 259  ? O HIS C 259  
AB5 1 2 O ILE C 238  ? O ILE C 238  N MET C 217  ? N MET C 217  
AB5 2 3 N ILE C 211  ? N ILE C 211  O VAL C 290  ? O VAL C 290  
AB5 3 4 N LEU C 287  ? N LEU C 287  O ALA C 300  ? O ALA C 300  
AB6 1 2 N THR C 223  ? N THR C 223  O VAL C 231  ? O VAL C 231  
AB7 1 2 N ARG C 314  ? N ARG C 314  O ILE C 337  ? O ILE C 337  
AB8 1 2 O ILE D 701  ? O ILE D 701  N ILE D 681  ? N ILE D 681  
AB8 2 3 N ILE D 682  ? N ILE D 682  O ALA D 736  ? O ALA D 736  
AB9 1 2 N PHE D 686  ? N PHE D 686  O LEU D 696  ? O LEU D 696  
AC1 1 2 N ALA D 773  ? N ALA D 773  O PHE D 852  ? O PHE D 852  
AC1 2 3 N VAL D 851  ? N VAL D 851  O VAL D 885  ? O VAL D 885  
AC1 3 4 O LEU D 886  ? O LEU D 886  N THR D 709  ? N THR D 709  
AC1 4 5 N VAL D 712  ? N VAL D 712  O ILE D 901  ? O ILE D 901  
AC1 5 6 N LYS D 904  ? N LYS D 904  O THR D 907  ? O THR D 907  
AC2 1 2 O ILE D 1369 ? O ILE D 1369 N ILE D 1345 ? N ILE D 1345 
AC2 2 3 N GLN D 1346 ? N GLN D 1346 O ILE D 1404 ? O ILE D 1404 
AC3 1 2 N ILE D 1425 ? N ILE D 1425 O ASP D 1506 ? O ASP D 1506 
AC3 2 3 N PHE D 1503 ? N PHE D 1503 O VAL D 1534 ? O VAL D 1534 
AC3 3 4 O VAL D 1533 ? O VAL D 1533 N ILE D 1375 ? N ILE D 1375 
AC3 4 5 N CYS D 1378 ? N CYS D 1378 O LEU D 1552 ? O LEU D 1552 
AC3 5 6 N VAL D 1549 ? N VAL D 1549 O PHE D 1560 ? O PHE D 1560 
AC4 1 2 N LYS E 47   ? N LYS E 47   O VAL G 328  ? O VAL G 328  
AC4 2 3 O SER G 327  ? O SER G 327  N ALA G 320  ? N ALA G 320  
AC5 1 2 N VAL E 188  ? N VAL E 188  O MET E 199  ? O MET E 199  
AC5 2 3 N PHE E 198  ? N PHE E 198  O HIS E 259  ? O HIS E 259  
AC6 1 2 O ILE E 238  ? O ILE E 238  N MET E 217  ? N MET E 217  
AC6 2 3 N ILE E 211  ? N ILE E 211  O VAL E 290  ? O VAL E 290  
AC6 3 4 N LEU E 287  ? N LEU E 287  O ALA E 300  ? O ALA E 300  
AC7 1 2 N THR E 223  ? N THR E 223  O VAL E 231  ? O VAL E 231  
AC8 1 2 N ARG E 314  ? N ARG E 314  O ILE E 337  ? O ILE E 337  
AC9 1 2 O ILE F 701  ? O ILE F 701  N ILE F 681  ? N ILE F 681  
AC9 2 3 N ILE F 682  ? N ILE F 682  O ALA F 736  ? O ALA F 736  
AD1 1 2 N PHE F 686  ? N PHE F 686  O LEU F 696  ? O LEU F 696  
AD2 1 2 N ALA F 773  ? N ALA F 773  O PHE F 852  ? O PHE F 852  
AD2 2 3 N VAL F 851  ? N VAL F 851  O VAL F 885  ? O VAL F 885  
AD2 3 4 O LEU F 886  ? O LEU F 886  N THR F 709  ? N THR F 709  
AD2 4 5 N VAL F 712  ? N VAL F 712  O ILE F 901  ? O ILE F 901  
AD2 5 6 N LYS F 904  ? N LYS F 904  O THR F 907  ? O THR F 907  
AD3 1 2 O ILE F 1369 ? O ILE F 1369 N ILE F 1345 ? N ILE F 1345 
AD3 2 3 N GLN F 1346 ? N GLN F 1346 O ILE F 1404 ? O ILE F 1404 
AD4 1 2 N ILE F 1425 ? N ILE F 1425 O ASP F 1506 ? O ASP F 1506 
AD4 2 3 N PHE F 1503 ? N PHE F 1503 O VAL F 1534 ? O VAL F 1534 
AD4 3 4 O VAL F 1533 ? O VAL F 1533 N ILE F 1375 ? N ILE F 1375 
AD4 4 5 N CYS F 1378 ? N CYS F 1378 O LEU F 1552 ? O LEU F 1552 
AD4 5 6 N VAL F 1549 ? N VAL F 1549 O PHE F 1560 ? O PHE F 1560 
AD5 1 2 N VAL G 188  ? N VAL G 188  O MET G 199  ? O MET G 199  
AD5 2 3 N PHE G 198  ? N PHE G 198  O HIS G 259  ? O HIS G 259  
AD6 1 2 O ILE G 238  ? O ILE G 238  N MET G 217  ? N MET G 217  
AD6 2 3 N ILE G 211  ? N ILE G 211  O VAL G 290  ? O VAL G 290  
AD6 3 4 N LEU G 287  ? N LEU G 287  O ALA G 300  ? O ALA G 300  
AD7 1 2 N THR G 223  ? N THR G 223  O VAL G 231  ? O VAL G 231  
AD8 1 2 N ARG G 314  ? N ARG G 314  O ILE G 337  ? O ILE G 337  
AD9 1 2 O ILE H 701  ? O ILE H 701  N ILE H 681  ? N ILE H 681  
AD9 2 3 N ILE H 682  ? N ILE H 682  O ALA H 736  ? O ALA H 736  
AE1 1 2 N PHE H 686  ? N PHE H 686  O LEU H 696  ? O LEU H 696  
AE2 1 2 N ALA H 773  ? N ALA H 773  O PHE H 852  ? O PHE H 852  
AE2 2 3 N VAL H 851  ? N VAL H 851  O VAL H 885  ? O VAL H 885  
AE2 3 4 O LEU H 886  ? O LEU H 886  N THR H 709  ? N THR H 709  
AE2 4 5 N VAL H 712  ? N VAL H 712  O ILE H 901  ? O ILE H 901  
AE2 5 6 N LYS H 904  ? N LYS H 904  O THR H 907  ? O THR H 907  
AE3 1 2 O ILE H 1369 ? O ILE H 1369 N ILE H 1345 ? N ILE H 1345 
AE3 2 3 N GLN H 1346 ? N GLN H 1346 O ILE H 1404 ? O ILE H 1404 
AE4 1 2 N ILE H 1425 ? N ILE H 1425 O ASP H 1506 ? O ASP H 1506 
AE4 2 3 N PHE H 1503 ? N PHE H 1503 O VAL H 1534 ? O VAL H 1534 
AE4 3 4 O VAL H 1533 ? O VAL H 1533 N ILE H 1375 ? N ILE H 1375 
AE4 4 5 N CYS H 1378 ? N CYS H 1378 O LEU H 1552 ? O LEU H 1552 
AE4 5 6 N VAL H 1549 ? N VAL H 1549 O PHE H 1560 ? O PHE H 1560 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ADP 401  ? 7  'binding site for residue ADP A 401'  
AC2 Software B ADP 2501 ? 10 'binding site for residue ADP B 2501' 
AC3 Software B ADP 2502 ? 10 'binding site for residue ADP B 2502' 
AC4 Software B MG  2503 ? 3  'binding site for residue MG B 2503'  
AC5 Software B MG  2504 ? 3  'binding site for residue MG B 2504'  
AC6 Software C ADP 401  ? 7  'binding site for residue ADP C 401'  
AC7 Software D ADP 2501 ? 10 'binding site for residue ADP D 2501' 
AC8 Software D ADP 2502 ? 10 'binding site for residue ADP D 2502' 
AC9 Software D MG  2503 ? 3  'binding site for residue MG D 2503'  
AD1 Software D MG  2504 ? 3  'binding site for residue MG D 2504'  
AD2 Software E ADP 401  ? 7  'binding site for residue ADP E 401'  
AD3 Software F ADP 2501 ? 10 'binding site for residue ADP F 2501' 
AD4 Software F ADP 2502 ? 10 'binding site for residue ADP F 2502' 
AD5 Software F MG  2503 ? 3  'binding site for residue MG F 2503'  
AD6 Software F MG  2504 ? 3  'binding site for residue MG F 2504'  
AD7 Software G ADP 401  ? 7  'binding site for residue ADP G 401'  
AD8 Software H ADP 2501 ? 10 'binding site for residue ADP H 2501' 
AD9 Software H ADP 2502 ? 10 'binding site for residue ADP H 2502' 
AE1 Software H MG  2503 ? 3  'binding site for residue MG H 2503'  
AE2 Software H MG  2504 ? 3  'binding site for residue MG H 2504'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7  ILE A  182  ? ILE A 182  . ? 1_555 ? 
2   AC1 7  LYS A  185  ? LYS A 185  . ? 1_555 ? 
3   AC1 7  TYR A  330  ? TYR A 330  . ? 1_555 ? 
4   AC1 7  PHE A  333  ? PHE A 333  . ? 1_555 ? 
5   AC1 7  GLY A  334  ? GLY A 334  . ? 1_555 ? 
6   AC1 7  ASN G  48   ? ASN G 48   . ? 1_555 ? 
7   AC1 7  ARG G  50   ? ARG G 50   . ? 1_555 ? 
8   AC2 10 TRP B  688  ? TRP B 688  . ? 1_555 ? 
9   AC2 10 GLY B  716  ? GLY B 716  . ? 1_555 ? 
10  AC2 10 GLY B  718  ? GLY B 718  . ? 1_555 ? 
11  AC2 10 LYS B  719  ? LYS B 719  . ? 1_555 ? 
12  AC2 10 SER B  720  ? SER B 720  . ? 1_555 ? 
13  AC2 10 SER B  721  ? SER B 721  . ? 1_555 ? 
14  AC2 10 GLN B  775  ? GLN B 775  . ? 1_555 ? 
15  AC2 10 GLU B  1480 ? GLU B 1480 . ? 1_555 ? 
16  AC2 10 SER B  1483 ? SER B 1483 . ? 1_555 ? 
17  AC2 10 MG  L  .    ? MG  B 2503 . ? 1_555 ? 
18  AC3 10 ARG B  1111 ? ARG B 1111 . ? 1_555 ? 
19  AC3 10 GLU B  1114 ? GLU B 1114 . ? 1_555 ? 
20  AC3 10 TYR B  1354 ? TYR B 1354 . ? 1_555 ? 
21  AC3 10 GLY B  1382 ? GLY B 1382 . ? 1_555 ? 
22  AC3 10 SER B  1383 ? SER B 1383 . ? 1_555 ? 
23  AC3 10 GLY B  1384 ? GLY B 1384 . ? 1_555 ? 
24  AC3 10 LYS B  1385 ? LYS B 1385 . ? 1_555 ? 
25  AC3 10 SER B  1386 ? SER B 1386 . ? 1_555 ? 
26  AC3 10 SER B  1387 ? SER B 1387 . ? 1_555 ? 
27  AC3 10 MG  M  .    ? MG  B 2504 . ? 1_555 ? 
28  AC4 3  SER B  720  ? SER B 720  . ? 1_555 ? 
29  AC4 3  GLN B  775  ? GLN B 775  . ? 1_555 ? 
30  AC4 3  ADP J  .    ? ADP B 2501 . ? 1_555 ? 
31  AC5 3  SER B  1386 ? SER B 1386 . ? 1_555 ? 
32  AC5 3  GLN B  1427 ? GLN B 1427 . ? 1_555 ? 
33  AC5 3  ADP K  .    ? ADP B 2502 . ? 1_555 ? 
34  AC6 7  ASN A  48   ? ASN A 48   . ? 1_555 ? 
35  AC6 7  ARG A  50   ? ARG A 50   . ? 1_555 ? 
36  AC6 7  ILE C  182  ? ILE C 182  . ? 1_555 ? 
37  AC6 7  LYS C  185  ? LYS C 185  . ? 1_555 ? 
38  AC6 7  TYR C  330  ? TYR C 330  . ? 1_555 ? 
39  AC6 7  PHE C  333  ? PHE C 333  . ? 1_555 ? 
40  AC6 7  GLY C  334  ? GLY C 334  . ? 1_555 ? 
41  AC7 10 TRP D  688  ? TRP D 688  . ? 1_555 ? 
42  AC7 10 GLY D  716  ? GLY D 716  . ? 1_555 ? 
43  AC7 10 GLY D  718  ? GLY D 718  . ? 1_555 ? 
44  AC7 10 LYS D  719  ? LYS D 719  . ? 1_555 ? 
45  AC7 10 SER D  720  ? SER D 720  . ? 1_555 ? 
46  AC7 10 SER D  721  ? SER D 721  . ? 1_555 ? 
47  AC7 10 GLN D  775  ? GLN D 775  . ? 1_555 ? 
48  AC7 10 GLU D  1480 ? GLU D 1480 . ? 1_555 ? 
49  AC7 10 SER D  1483 ? SER D 1483 . ? 1_555 ? 
50  AC7 10 MG  Q  .    ? MG  D 2503 . ? 1_555 ? 
51  AC8 10 ARG D  1111 ? ARG D 1111 . ? 1_555 ? 
52  AC8 10 GLU D  1114 ? GLU D 1114 . ? 1_555 ? 
53  AC8 10 TYR D  1354 ? TYR D 1354 . ? 1_555 ? 
54  AC8 10 GLY D  1382 ? GLY D 1382 . ? 1_555 ? 
55  AC8 10 SER D  1383 ? SER D 1383 . ? 1_555 ? 
56  AC8 10 GLY D  1384 ? GLY D 1384 . ? 1_555 ? 
57  AC8 10 LYS D  1385 ? LYS D 1385 . ? 1_555 ? 
58  AC8 10 SER D  1386 ? SER D 1386 . ? 1_555 ? 
59  AC8 10 SER D  1387 ? SER D 1387 . ? 1_555 ? 
60  AC8 10 MG  R  .    ? MG  D 2504 . ? 1_555 ? 
61  AC9 3  SER D  720  ? SER D 720  . ? 1_555 ? 
62  AC9 3  GLN D  775  ? GLN D 775  . ? 1_555 ? 
63  AC9 3  ADP O  .    ? ADP D 2501 . ? 1_555 ? 
64  AD1 3  SER D  1386 ? SER D 1386 . ? 1_555 ? 
65  AD1 3  GLN D  1427 ? GLN D 1427 . ? 1_555 ? 
66  AD1 3  ADP P  .    ? ADP D 2502 . ? 1_555 ? 
67  AD2 7  ASN C  48   ? ASN C 48   . ? 1_555 ? 
68  AD2 7  ARG C  50   ? ARG C 50   . ? 1_555 ? 
69  AD2 7  ILE E  182  ? ILE E 182  . ? 1_555 ? 
70  AD2 7  LYS E  185  ? LYS E 185  . ? 1_555 ? 
71  AD2 7  TYR E  330  ? TYR E 330  . ? 1_555 ? 
72  AD2 7  PHE E  333  ? PHE E 333  . ? 1_555 ? 
73  AD2 7  GLY E  334  ? GLY E 334  . ? 1_555 ? 
74  AD3 10 TRP F  688  ? TRP F 688  . ? 1_555 ? 
75  AD3 10 GLY F  716  ? GLY F 716  . ? 1_555 ? 
76  AD3 10 GLY F  718  ? GLY F 718  . ? 1_555 ? 
77  AD3 10 LYS F  719  ? LYS F 719  . ? 1_555 ? 
78  AD3 10 SER F  720  ? SER F 720  . ? 1_555 ? 
79  AD3 10 SER F  721  ? SER F 721  . ? 1_555 ? 
80  AD3 10 GLN F  775  ? GLN F 775  . ? 1_555 ? 
81  AD3 10 GLU F  1480 ? GLU F 1480 . ? 1_555 ? 
82  AD3 10 SER F  1483 ? SER F 1483 . ? 1_555 ? 
83  AD3 10 MG  V  .    ? MG  F 2503 . ? 1_555 ? 
84  AD4 10 ARG F  1111 ? ARG F 1111 . ? 1_555 ? 
85  AD4 10 GLU F  1114 ? GLU F 1114 . ? 1_555 ? 
86  AD4 10 TYR F  1354 ? TYR F 1354 . ? 1_555 ? 
87  AD4 10 GLY F  1382 ? GLY F 1382 . ? 1_555 ? 
88  AD4 10 SER F  1383 ? SER F 1383 . ? 1_555 ? 
89  AD4 10 GLY F  1384 ? GLY F 1384 . ? 1_555 ? 
90  AD4 10 LYS F  1385 ? LYS F 1385 . ? 1_555 ? 
91  AD4 10 SER F  1386 ? SER F 1386 . ? 1_555 ? 
92  AD4 10 SER F  1387 ? SER F 1387 . ? 1_555 ? 
93  AD4 10 MG  W  .    ? MG  F 2504 . ? 1_555 ? 
94  AD5 3  SER F  720  ? SER F 720  . ? 1_555 ? 
95  AD5 3  GLN F  775  ? GLN F 775  . ? 1_555 ? 
96  AD5 3  ADP T  .    ? ADP F 2501 . ? 1_555 ? 
97  AD6 3  SER F  1386 ? SER F 1386 . ? 1_555 ? 
98  AD6 3  GLN F  1427 ? GLN F 1427 . ? 1_555 ? 
99  AD6 3  ADP U  .    ? ADP F 2502 . ? 1_555 ? 
100 AD7 7  ASN E  48   ? ASN E 48   . ? 1_555 ? 
101 AD7 7  ARG E  50   ? ARG E 50   . ? 1_555 ? 
102 AD7 7  ILE G  182  ? ILE G 182  . ? 1_555 ? 
103 AD7 7  LYS G  185  ? LYS G 185  . ? 1_555 ? 
104 AD7 7  TYR G  330  ? TYR G 330  . ? 1_555 ? 
105 AD7 7  PHE G  333  ? PHE G 333  . ? 1_555 ? 
106 AD7 7  GLY G  334  ? GLY G 334  . ? 1_555 ? 
107 AD8 10 TRP H  688  ? TRP H 688  . ? 1_555 ? 
108 AD8 10 GLY H  716  ? GLY H 716  . ? 1_555 ? 
109 AD8 10 GLY H  718  ? GLY H 718  . ? 1_555 ? 
110 AD8 10 LYS H  719  ? LYS H 719  . ? 1_555 ? 
111 AD8 10 SER H  720  ? SER H 720  . ? 1_555 ? 
112 AD8 10 SER H  721  ? SER H 721  . ? 1_555 ? 
113 AD8 10 GLN H  775  ? GLN H 775  . ? 1_555 ? 
114 AD8 10 GLU H  1480 ? GLU H 1480 . ? 1_555 ? 
115 AD8 10 SER H  1483 ? SER H 1483 . ? 1_555 ? 
116 AD8 10 MG  AA .    ? MG  H 2503 . ? 1_555 ? 
117 AD9 10 ARG H  1111 ? ARG H 1111 . ? 1_555 ? 
118 AD9 10 GLU H  1114 ? GLU H 1114 . ? 1_555 ? 
119 AD9 10 TYR H  1354 ? TYR H 1354 . ? 1_555 ? 
120 AD9 10 GLY H  1382 ? GLY H 1382 . ? 1_555 ? 
121 AD9 10 SER H  1383 ? SER H 1383 . ? 1_555 ? 
122 AD9 10 GLY H  1384 ? GLY H 1384 . ? 1_555 ? 
123 AD9 10 LYS H  1385 ? LYS H 1385 . ? 1_555 ? 
124 AD9 10 SER H  1386 ? SER H 1386 . ? 1_555 ? 
125 AD9 10 SER H  1387 ? SER H 1387 . ? 1_555 ? 
126 AD9 10 MG  BA .    ? MG  H 2504 . ? 1_555 ? 
127 AE1 3  SER H  720  ? SER H 720  . ? 1_555 ? 
128 AE1 3  GLN H  775  ? GLN H 775  . ? 1_555 ? 
129 AE1 3  ADP Y  .    ? ADP H 2501 . ? 1_555 ? 
130 AE2 3  SER H  1386 ? SER H 1386 . ? 1_555 ? 
131 AE2 3  GLN H  1427 ? GLN H 1427 . ? 1_555 ? 
132 AE2 3  ADP Z  .    ? ADP H 2502 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5YWB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A  1 32   ? 135.594 141.486 150.303 1.00 295.98 ? 32   ARG A N     1 
ATOM   2     C  CA    . ARG A  1 32   ? 136.918 140.918 150.069 1.00 296.24 ? 32   ARG A CA    1 
ATOM   3     C  C     . ARG A  1 32   ? 137.949 141.512 151.027 1.00 292.69 ? 32   ARG A C     1 
ATOM   4     O  O     . ARG A  1 32   ? 137.618 142.353 151.865 1.00 290.73 ? 32   ARG A O     1 
ATOM   5     C  CB    . ARG A  1 32   ? 137.343 141.142 148.616 1.00 295.29 ? 32   ARG A CB    1 
ATOM   6     C  CG    . ARG A  1 32   ? 136.526 140.348 147.604 1.00 295.62 ? 32   ARG A CG    1 
ATOM   7     C  CD    . ARG A  1 32   ? 136.991 140.605 146.178 1.00 292.84 ? 32   ARG A CD    1 
ATOM   8     N  NE    . ARG A  1 32   ? 136.635 141.943 145.713 1.00 291.62 ? 32   ARG A NE    1 
ATOM   9     C  CZ    . ARG A  1 32   ? 135.518 142.229 145.051 1.00 286.75 ? 32   ARG A CZ    1 
ATOM   10    N  NH1   . ARG A  1 32   ? 135.274 143.474 144.665 1.00 279.73 ? 32   ARG A NH1   1 
ATOM   11    N  NH2   . ARG A  1 32   ? 134.645 141.271 144.774 1.00 288.16 ? 32   ARG A NH2   1 
ATOM   12    N  N     . ALA A  1 33   ? 139.199 141.071 150.896 1.00 300.91 ? 33   ALA A N     1 
ATOM   13    C  CA    . ALA A  1 33   ? 140.255 141.475 151.816 1.00 279.12 ? 33   ALA A CA    1 
ATOM   14    C  C     . ALA A  1 33   ? 140.856 142.817 151.415 1.00 274.74 ? 33   ALA A C     1 
ATOM   15    O  O     . ALA A  1 33   ? 141.060 143.094 150.230 1.00 280.49 ? 33   ALA A O     1 
ATOM   16    C  CB    . ALA A  1 33   ? 141.348 140.408 151.865 1.00 274.82 ? 33   ALA A CB    1 
ATOM   17    N  N     . ARG A  1 34   ? 141.140 143.649 152.414 1.00 258.11 ? 34   ARG A N     1 
ATOM   18    C  CA    . ARG A  1 34   ? 141.744 144.958 152.217 1.00 256.42 ? 34   ARG A CA    1 
ATOM   19    C  C     . ARG A  1 34   ? 143.219 144.929 152.601 1.00 245.78 ? 34   ARG A C     1 
ATOM   20    O  O     . ARG A  1 34   ? 143.671 144.068 153.358 1.00 240.06 ? 34   ARG A O     1 
ATOM   21    C  CB    . ARG A  1 34   ? 141.016 146.027 153.036 1.00 254.25 ? 34   ARG A CB    1 
ATOM   22    C  CG    . ARG A  1 34   ? 139.623 146.345 152.536 1.00 261.37 ? 34   ARG A CG    1 
ATOM   23    C  CD    . ARG A  1 34   ? 138.946 147.369 153.426 1.00 262.78 ? 34   ARG A CD    1 
ATOM   24    N  NE    . ARG A  1 34   ? 138.738 146.855 154.775 1.00 278.80 ? 34   ARG A NE    1 
ATOM   25    C  CZ    . ARG A  1 34   ? 138.072 147.503 155.725 1.00 284.38 ? 34   ARG A CZ    1 
ATOM   26    N  NH1   . ARG A  1 34   ? 137.544 148.693 155.476 1.00 277.34 ? 34   ARG A NH1   1 
ATOM   27    N  NH2   . ARG A  1 34   ? 137.931 146.959 156.926 1.00 296.59 ? 34   ARG A NH2   1 
ATOM   28    N  N     . PHE A  1 35   ? 143.968 145.894 152.070 1.00 275.20 ? 35   PHE A N     1 
ATOM   29    C  CA    . PHE A  1 35   ? 145.410 145.897 152.291 1.00 260.46 ? 35   PHE A CA    1 
ATOM   30    C  C     . PHE A  1 35   ? 145.769 146.611 153.592 1.00 261.46 ? 35   PHE A C     1 
ATOM   31    O  O     . PHE A  1 35   ? 146.422 146.032 154.467 1.00 266.54 ? 35   PHE A O     1 
ATOM   32    C  CB    . PHE A  1 35   ? 146.117 146.543 151.101 1.00 265.80 ? 35   PHE A CB    1 
ATOM   33    C  CG    . PHE A  1 35   ? 147.604 146.382 151.128 1.00 257.38 ? 35   PHE A CG    1 
ATOM   34    C  CD1   . PHE A  1 35   ? 148.180 145.177 151.494 1.00 258.22 ? 35   PHE A CD1   1 
ATOM   35    C  CD2   . PHE A  1 35   ? 148.429 147.433 150.775 1.00 258.83 ? 35   PHE A CD2   1 
ATOM   36    C  CE1   . PHE A  1 35   ? 149.556 145.029 151.518 1.00 261.60 ? 35   PHE A CE1   1 
ATOM   37    C  CE2   . PHE A  1 35   ? 149.801 147.292 150.795 1.00 255.29 ? 35   PHE A CE2   1 
ATOM   38    C  CZ    . PHE A  1 35   ? 150.366 146.089 151.165 1.00 255.60 ? 35   PHE A CZ    1 
ATOM   39    N  N     . VAL A  1 36   ? 145.366 147.873 153.728 1.00 242.87 ? 36   VAL A N     1 
ATOM   40    C  CA    . VAL A  1 36   ? 145.487 148.614 154.977 1.00 239.43 ? 36   VAL A CA    1 
ATOM   41    C  C     . VAL A  1 36   ? 144.166 149.324 155.230 1.00 236.71 ? 36   VAL A C     1 
ATOM   42    O  O     . VAL A  1 36   ? 143.574 149.904 154.313 1.00 236.57 ? 36   VAL A O     1 
ATOM   43    C  CB    . VAL A  1 36   ? 146.662 149.615 154.951 1.00 230.75 ? 36   VAL A CB    1 
ATOM   44    C  CG1   . VAL A  1 36   ? 147.945 148.930 155.377 1.00 235.76 ? 36   VAL A CG1   1 
ATOM   45    C  CG2   . VAL A  1 36   ? 146.836 150.207 153.570 1.00 229.66 ? 36   VAL A CG2   1 
ATOM   46    N  N     . SER A  1 37   ? 143.703 149.273 156.476 1.00 235.21 ? 37   SER A N     1 
ATOM   47    C  CA    . SER A  1 37   ? 142.369 149.739 156.816 1.00 238.97 ? 37   SER A CA    1 
ATOM   48    C  C     . SER A  1 37   ? 142.270 151.261 156.696 1.00 235.84 ? 37   SER A C     1 
ATOM   49    O  O     . SER A  1 37   ? 143.270 151.976 156.569 1.00 233.64 ? 37   SER A O     1 
ATOM   50    C  CB    . SER A  1 37   ? 141.993 149.287 158.227 1.00 247.15 ? 37   SER A CB    1 
ATOM   51    O  OG    . SER A  1 37   ? 142.955 149.722 159.172 1.00 245.54 ? 37   SER A OG    1 
ATOM   52    N  N     . LYS A  1 38   ? 141.026 151.748 156.744 1.00 240.80 ? 38   LYS A N     1 
ATOM   53    C  CA    . LYS A  1 38   ? 140.767 153.177 156.591 1.00 240.11 ? 38   LYS A CA    1 
ATOM   54    C  C     . LYS A  1 38   ? 141.388 153.986 157.724 1.00 239.62 ? 38   LYS A C     1 
ATOM   55    O  O     . LYS A  1 38   ? 141.933 155.072 157.494 1.00 237.64 ? 38   LYS A O     1 
ATOM   56    C  CB    . LYS A  1 38   ? 139.261 153.423 156.523 1.00 233.52 ? 38   LYS A CB    1 
ATOM   57    C  CG    . LYS A  1 38   ? 138.607 152.968 155.230 1.00 230.35 ? 38   LYS A CG    1 
ATOM   58    C  CD    . LYS A  1 38   ? 138.823 153.982 154.120 1.00 229.58 ? 38   LYS A CD    1 
ATOM   59    C  CE    . LYS A  1 38   ? 137.928 153.692 152.925 1.00 231.44 ? 38   LYS A CE    1 
ATOM   60    N  NZ    . LYS A  1 38   ? 137.917 154.815 151.946 1.00 243.15 ? 38   LYS A NZ    1 
ATOM   61    N  N     . LYS A  1 39   ? 141.312 153.476 158.955 1.00 242.27 ? 39   LYS A N     1 
ATOM   62    C  CA    . LYS A  1 39   ? 141.849 154.193 160.107 1.00 245.38 ? 39   LYS A CA    1 
ATOM   63    C  C     . LYS A  1 39   ? 143.358 154.387 160.037 1.00 236.90 ? 39   LYS A C     1 
ATOM   64    O  O     . LYS A  1 39   ? 143.902 155.161 160.832 1.00 241.92 ? 39   LYS A O     1 
ATOM   65    C  CB    . LYS A  1 39   ? 141.487 153.460 161.403 1.00 244.75 ? 39   LYS A CB    1 
ATOM   66    C  CG    . LYS A  1 39   ? 139.999 153.432 161.723 1.00 238.98 ? 39   LYS A CG    1 
ATOM   67    C  CD    . LYS A  1 39   ? 139.738 152.721 163.045 1.00 230.31 ? 39   LYS A CD    1 
ATOM   68    C  CE    . LYS A  1 39   ? 138.256 152.716 163.399 1.00 234.93 ? 39   LYS A CE    1 
ATOM   69    N  NZ    . LYS A  1 39   ? 137.985 152.050 164.705 1.00 231.42 ? 39   LYS A NZ    1 
ATOM   70    N  N     . GLY A  1 40   ? 144.046 153.715 159.117 1.00 242.32 ? 40   GLY A N     1 
ATOM   71    C  CA    . GLY A  1 40   ? 145.479 153.828 158.969 1.00 240.66 ? 40   GLY A CA    1 
ATOM   72    C  C     . GLY A  1 40   ? 146.250 152.619 159.446 1.00 241.96 ? 40   GLY A C     1 
ATOM   73    O  O     . GLY A  1 40   ? 147.404 152.436 159.035 1.00 243.57 ? 40   GLY A O     1 
ATOM   74    N  N     . ASN A  1 41   ? 145.653 151.792 160.301 1.00 218.07 ? 41   ASN A N     1 
ATOM   75    C  CA    . ASN A  1 41   ? 146.319 150.588 160.770 1.00 219.07 ? 41   ASN A CA    1 
ATOM   76    C  C     . ASN A  1 41   ? 146.507 149.605 159.618 1.00 225.30 ? 41   ASN A C     1 
ATOM   77    O  O     . ASN A  1 41   ? 145.808 149.653 158.602 1.00 226.15 ? 41   ASN A O     1 
ATOM   78    C  CB    . ASN A  1 41   ? 145.517 149.930 161.894 1.00 219.28 ? 41   ASN A CB    1 
ATOM   79    C  CG    . ASN A  1 41   ? 145.424 150.799 163.133 1.00 224.03 ? 41   ASN A CG    1 
ATOM   80    O  OD1   . ASN A  1 41   ? 144.331 151.158 163.573 1.00 228.88 ? 41   ASN A OD1   1 
ATOM   81    N  ND2   . ASN A  1 41   ? 146.573 151.140 163.705 1.00 224.42 ? 41   ASN A ND2   1 
ATOM   82    N  N     . CYS A  1 42   ? 147.475 148.706 159.787 1.00 246.31 ? 42   CYS A N     1 
ATOM   83    C  CA    . CYS A  1 42   ? 147.776 147.696 158.781 1.00 244.96 ? 42   CYS A CA    1 
ATOM   84    C  C     . CYS A  1 42   ? 146.869 146.485 158.965 1.00 249.13 ? 42   CYS A C     1 
ATOM   85    O  O     . CYS A  1 42   ? 146.496 146.137 160.089 1.00 256.29 ? 42   CYS A O     1 
ATOM   86    C  CB    . CYS A  1 42   ? 149.248 147.277 158.856 1.00 243.71 ? 42   CYS A CB    1 
ATOM   87    S  SG    . CYS A  1 42   ? 149.919 146.613 157.308 1.00 251.52 ? 42   CYS A SG    1 
ATOM   88    N  N     . ASN A  1 43   ? 146.508 145.854 157.848 1.00 255.95 ? 43   ASN A N     1 
ATOM   89    C  CA    . ASN A  1 43   ? 145.620 144.697 157.844 1.00 257.33 ? 43   ASN A CA    1 
ATOM   90    C  C     . ASN A  1 43   ? 146.356 143.376 157.676 1.00 258.01 ? 43   ASN A C     1 
ATOM   91    O  O     . ASN A  1 43   ? 145.897 142.352 158.194 1.00 263.04 ? 43   ASN A O     1 
ATOM   92    C  CB    . ASN A  1 43   ? 144.582 144.845 156.725 1.00 263.80 ? 43   ASN A CB    1 
ATOM   93    C  CG    . ASN A  1 43   ? 143.359 143.971 156.930 1.00 282.13 ? 43   ASN A CG    1 
ATOM   94    O  OD1   . ASN A  1 43   ? 143.359 143.056 157.752 1.00 292.50 ? 43   ASN A OD1   1 
ATOM   95    N  ND2   . ASN A  1 43   ? 142.308 144.249 156.170 1.00 288.20 ? 43   ASN A ND2   1 
ATOM   96    N  N     . VAL A  1 44   ? 147.486 143.373 156.967 1.00 271.36 ? 44   VAL A N     1 
ATOM   97    C  CA    . VAL A  1 44   ? 148.204 142.131 156.693 1.00 267.87 ? 44   VAL A CA    1 
ATOM   98    C  C     . VAL A  1 44   ? 148.705 141.531 157.998 1.00 267.07 ? 44   VAL A C     1 
ATOM   99    O  O     . VAL A  1 44   ? 149.511 142.142 158.712 1.00 272.13 ? 44   VAL A O     1 
ATOM   100   C  CB    . VAL A  1 44   ? 149.356 142.379 155.716 1.00 262.19 ? 44   VAL A CB    1 
ATOM   101   C  CG1   . VAL A  1 44   ? 150.186 141.113 155.547 1.00 269.66 ? 44   VAL A CG1   1 
ATOM   102   C  CG2   . VAL A  1 44   ? 148.814 142.848 154.377 1.00 268.29 ? 44   VAL A CG2   1 
ATOM   103   N  N     . ALA A  1 45   ? 148.304 140.294 158.278 1.00 269.67 ? 45   ALA A N     1 
ATOM   104   C  CA    . ALA A  1 45   ? 148.740 139.622 159.500 1.00 263.94 ? 45   ALA A CA    1 
ATOM   105   C  C     . ALA A  1 45   ? 149.876 138.640 159.211 1.00 267.08 ? 45   ALA A C     1 
ATOM   106   O  O     . ALA A  1 45   ? 149.737 137.732 158.391 1.00 270.10 ? 45   ALA A O     1 
ATOM   107   C  CB    . ALA A  1 45   ? 147.571 138.907 160.158 1.00 263.28 ? 45   ALA A CB    1 
ATOM   108   N  N     . HIS A  1 46   ? 151.000 138.837 159.895 1.00 260.54 ? 46   HIS A N     1 
ATOM   109   C  CA    . HIS A  1 46   ? 152.189 138.000 159.731 1.00 271.59 ? 46   HIS A CA    1 
ATOM   110   C  C     . HIS A  1 46   ? 152.072 136.589 160.312 1.00 270.31 ? 46   HIS A C     1 
ATOM   111   O  O     . HIS A  1 46   ? 151.396 136.371 161.317 1.00 275.83 ? 46   HIS A O     1 
ATOM   112   C  CB    . HIS A  1 46   ? 153.416 138.702 160.320 1.00 271.94 ? 46   HIS A CB    1 
ATOM   113   C  CG    . HIS A  1 46   ? 153.730 140.013 159.672 1.00 276.16 ? 46   HIS A CG    1 
ATOM   114   N  ND1   . HIS A  1 46   ? 153.206 141.208 160.116 1.00 274.47 ? 46   HIS A ND1   1 
ATOM   115   C  CD2   . HIS A  1 46   ? 154.515 140.318 158.611 1.00 270.92 ? 46   HIS A CD2   1 
ATOM   116   C  CE1   . HIS A  1 46   ? 153.654 142.192 159.358 1.00 272.26 ? 46   HIS A CE1   1 
ATOM   117   N  NE2   . HIS A  1 46   ? 154.450 141.679 158.437 1.00 274.56 ? 46   HIS A NE2   1 
ATOM   118   N  N     . LYS A  1 47   ? 152.741 135.639 159.663 1.00 260.37 ? 47   LYS A N     1 
ATOM   119   C  CA    . LYS A  1 47   ? 152.755 134.246 160.102 1.00 258.99 ? 47   LYS A CA    1 
ATOM   120   C  C     . LYS A  1 47   ? 154.170 133.678 159.991 1.00 261.02 ? 47   LYS A C     1 
ATOM   121   O  O     . LYS A  1 47   ? 154.952 134.119 159.149 1.00 261.74 ? 47   LYS A O     1 
ATOM   122   C  CB    . LYS A  1 47   ? 151.784 133.410 159.268 1.00 257.32 ? 47   LYS A CB    1 
ATOM   123   C  CG    . LYS A  1 47   ? 151.767 131.935 159.633 1.00 260.08 ? 47   LYS A CG    1 
ATOM   124   C  CD    . LYS A  1 47   ? 151.381 131.731 161.089 1.00 269.64 ? 47   LYS A CD    1 
ATOM   125   C  CE    . LYS A  1 47   ? 151.361 130.255 161.453 1.00 275.73 ? 47   LYS A CE    1 
ATOM   126   N  NZ    . LYS A  1 47   ? 150.977 130.039 162.875 1.00 275.62 ? 47   LYS A NZ    1 
ATOM   127   N  N     . ASN A  1 48   ? 154.500 132.702 160.834 1.00 242.68 ? 48   ASN A N     1 
ATOM   128   C  CA    . ASN A  1 48   ? 155.831 132.099 160.796 1.00 244.37 ? 48   ASN A CA    1 
ATOM   129   C  C     . ASN A  1 48   ? 156.924 133.117 161.120 1.00 245.52 ? 48   ASN A C     1 
ATOM   130   O  O     . ASN A  1 48   ? 157.990 133.132 160.502 1.00 246.99 ? 48   ASN A O     1 
ATOM   131   C  CB    . ASN A  1 48   ? 156.088 131.425 159.450 1.00 244.14 ? 48   ASN A CB    1 
ATOM   132   C  CG    . ASN A  1 48   ? 155.277 130.169 159.268 1.00 244.90 ? 48   ASN A CG    1 
ATOM   133   O  OD1   . ASN A  1 48   ? 155.592 129.126 159.843 1.00 246.29 ? 48   ASN A OD1   1 
ATOM   134   N  ND2   . ASN A  1 48   ? 154.219 130.258 158.473 1.00 257.61 ? 48   ASN A ND2   1 
ATOM   135   N  N     . ILE A  1 49   ? 156.653 133.971 162.103 1.00 257.48 ? 49   ILE A N     1 
ATOM   136   C  CA    . ILE A  1 49   ? 157.696 134.813 162.665 1.00 257.07 ? 49   ILE A CA    1 
ATOM   137   C  C     . ILE A  1 49   ? 158.642 133.949 163.495 1.00 262.32 ? 49   ILE A C     1 
ATOM   138   O  O     . ILE A  1 49   ? 158.237 132.933 164.077 1.00 270.75 ? 49   ILE A O     1 
ATOM   139   C  CB    . ILE A  1 49   ? 157.059 135.944 163.493 1.00 257.48 ? 49   ILE A CB    1 
ATOM   140   C  CG1   . ILE A  1 49   ? 155.888 135.413 164.335 1.00 261.62 ? 49   ILE A CG1   1 
ATOM   141   C  CG2   . ILE A  1 49   ? 156.574 137.049 162.566 1.00 260.79 ? 49   ILE A CG2   1 
ATOM   142   C  CD1   . ILE A  1 49   ? 156.276 134.868 165.704 1.00 264.46 ? 49   ILE A CD1   1 
ATOM   143   N  N     . ARG A  1 50   ? 159.893 134.388 163.613 1.00 267.09 ? 50   ARG A N     1 
ATOM   144   C  CA    . ARG A  1 50   ? 160.886 133.630 164.372 1.00 267.81 ? 50   ARG A CA    1 
ATOM   145   C  C     . ARG A  1 50   ? 160.627 133.592 165.887 1.00 266.96 ? 50   ARG A C     1 
ATOM   146   O  O     . ARG A  1 50   ? 159.566 133.138 166.318 1.00 266.72 ? 50   ARG A O     1 
ATOM   147   C  CB    . ARG A  1 50   ? 162.294 134.160 164.081 1.00 273.20 ? 50   ARG A CB    1 
ATOM   148   N  N     . GLU A  1 51   ? 161.580 134.088 166.680 1.00 271.94 ? 51   GLU A N     1 
ATOM   149   C  CA    . GLU A  1 51   ? 161.468 134.069 168.144 1.00 271.35 ? 51   GLU A CA    1 
ATOM   150   C  C     . GLU A  1 51   ? 162.402 135.030 168.892 1.00 267.08 ? 51   GLU A C     1 
ATOM   151   O  O     . GLU A  1 51   ? 163.303 135.631 168.306 1.00 272.49 ? 51   GLU A O     1 
ATOM   152   C  CB    . GLU A  1 51   ? 161.694 132.649 168.677 1.00 269.76 ? 51   GLU A CB    1 
ATOM   153   N  N     . GLN A  1 52   ? 162.160 135.159 170.196 1.00 267.72 ? 52   GLN A N     1 
ATOM   154   C  CA    . GLN A  1 52   ? 162.982 135.968 171.107 1.00 263.36 ? 52   GLN A CA    1 
ATOM   155   C  C     . GLN A  1 52   ? 163.201 137.458 170.811 1.00 267.61 ? 52   GLN A C     1 
ATOM   156   O  O     . GLN A  1 52   ? 164.326 137.950 170.914 1.00 275.95 ? 52   GLN A O     1 
ATOM   157   C  CB    . GLN A  1 52   ? 164.337 135.284 171.334 1.00 263.72 ? 52   GLN A CB    1 
ATOM   158   N  N     . GLY A  1 53   ? 162.145 138.177 170.449 1.00 279.40 ? 53   GLY A N     1 
ATOM   159   C  CA    . GLY A  1 53   ? 162.283 139.598 170.177 1.00 282.24 ? 53   GLY A CA    1 
ATOM   160   C  C     . GLY A  1 53   ? 161.670 140.481 171.253 1.00 283.63 ? 53   GLY A C     1 
ATOM   161   O  O     . GLY A  1 53   ? 160.499 140.327 171.600 1.00 284.43 ? 53   GLY A O     1 
ATOM   162   N  N     . ARG A  1 54   ? 162.466 141.410 171.782 1.00 265.48 ? 54   ARG A N     1 
ATOM   163   C  CA    . ARG A  1 54   ? 162.000 142.338 172.817 1.00 265.54 ? 54   ARG A CA    1 
ATOM   164   C  C     . ARG A  1 54   ? 162.499 141.942 174.206 1.00 266.77 ? 54   ARG A C     1 
ATOM   165   O  O     . ARG A  1 54   ? 161.735 141.881 175.172 1.00 265.15 ? 54   ARG A O     1 
ATOM   166   C  CB    . ARG A  1 54   ? 160.471 142.439 172.798 1.00 260.43 ? 54   ARG A CB    1 
ATOM   167   N  N     . PHE A  1 55   ? 163.804 141.691 174.310 1.00 263.57 ? 55   PHE A N     1 
ATOM   168   C  CA    . PHE A  1 55   ? 164.394 141.183 175.552 1.00 263.57 ? 55   PHE A CA    1 
ATOM   169   C  C     . PHE A  1 55   ? 164.493 142.314 176.579 1.00 263.57 ? 55   PHE A C     1 
ATOM   170   O  O     . PHE A  1 55   ? 165.564 142.850 176.875 1.00 263.57 ? 55   PHE A O     1 
ATOM   171   C  CB    . PHE A  1 55   ? 165.748 140.544 175.272 1.00 263.57 ? 55   PHE A CB    1 
ATOM   172   N  N     . LEU A  1 56   ? 163.328 142.670 177.127 1.00 246.09 ? 56   LEU A N     1 
ATOM   173   C  CA    . LEU A  1 56   ? 163.111 143.625 178.215 1.00 249.56 ? 56   LEU A CA    1 
ATOM   174   C  C     . LEU A  1 56   ? 163.269 145.088 177.803 1.00 252.50 ? 56   LEU A C     1 
ATOM   175   O  O     . LEU A  1 56   ? 162.673 145.968 178.433 1.00 253.51 ? 56   LEU A O     1 
ATOM   176   C  CB    . LEU A  1 56   ? 164.050 143.316 179.391 1.00 253.24 ? 56   LEU A CB    1 
ATOM   177   N  N     . GLN A  1 57   ? 163.888 145.366 176.656 1.00 254.00 ? 57   GLN A N     1 
ATOM   178   C  CA    . GLN A  1 57   ? 163.982 146.765 176.240 1.00 247.85 ? 57   GLN A CA    1 
ATOM   179   C  C     . GLN A  1 57   ? 162.704 147.205 175.529 1.00 245.01 ? 57   GLN A C     1 
ATOM   180   O  O     . GLN A  1 57   ? 162.116 148.252 175.854 1.00 244.37 ? 57   GLN A O     1 
ATOM   181   C  CB    . GLN A  1 57   ? 165.211 146.974 175.352 1.00 247.27 ? 57   GLN A CB    1 
ATOM   182   N  N     . ASP A  1 58   ? 162.235 146.394 174.579 1.00 254.06 ? 58   ASP A N     1 
ATOM   183   C  CA    . ASP A  1 58   ? 160.939 146.662 173.981 1.00 251.68 ? 58   ASP A CA    1 
ATOM   184   C  C     . ASP A  1 58   ? 159.806 146.503 174.988 1.00 248.68 ? 58   ASP A C     1 
ATOM   185   O  O     . ASP A  1 58   ? 158.727 147.053 174.767 1.00 249.45 ? 58   ASP A O     1 
ATOM   186   C  CB    . ASP A  1 58   ? 160.716 145.765 172.764 1.00 248.62 ? 58   ASP A CB    1 
ATOM   187   N  N     . VAL A  1 59   ? 160.032 145.827 176.119 1.00 217.89 ? 59   VAL A N     1 
ATOM   188   C  CA    . VAL A  1 59   ? 159.015 145.881 177.166 1.00 217.10 ? 59   VAL A CA    1 
ATOM   189   C  C     . VAL A  1 59   ? 159.117 147.198 177.944 1.00 215.24 ? 59   VAL A C     1 
ATOM   190   O  O     . VAL A  1 59   ? 158.090 147.763 178.341 1.00 211.85 ? 59   VAL A O     1 
ATOM   191   C  CB    . VAL A  1 59   ? 159.088 144.642 178.086 1.00 223.33 ? 59   VAL A CB    1 
ATOM   192   C  CG1   . VAL A  1 59   ? 159.625 143.429 177.323 1.00 228.37 ? 59   VAL A CG1   1 
ATOM   193   C  CG2   . VAL A  1 59   ? 159.880 144.904 179.364 1.00 221.56 ? 59   VAL A CG2   1 
ATOM   194   N  N     . PHE A  1 60   ? 160.334 147.737 178.127 1.00 205.39 ? 60   PHE A N     1 
ATOM   195   C  CA    . PHE A  1 60   ? 160.471 149.065 178.723 1.00 204.10 ? 60   PHE A CA    1 
ATOM   196   C  C     . PHE A  1 60   ? 159.773 150.129 177.886 1.00 202.23 ? 60   PHE A C     1 
ATOM   197   O  O     . PHE A  1 60   ? 159.334 151.151 178.424 1.00 200.44 ? 60   PHE A O     1 
ATOM   198   C  CB    . PHE A  1 60   ? 161.947 149.421 178.903 1.00 202.62 ? 60   PHE A CB    1 
ATOM   199   N  N     . THR A  1 61   ? 159.679 149.920 176.572 1.00 214.11 ? 61   THR A N     1 
ATOM   200   C  CA    . THR A  1 61   ? 158.946 150.880 175.739 1.00 219.10 ? 61   THR A CA    1 
ATOM   201   C  C     . THR A  1 61   ? 157.461 150.537 175.576 1.00 216.45 ? 61   THR A C     1 
ATOM   202   O  O     . THR A  1 61   ? 156.624 151.448 175.470 1.00 212.22 ? 61   THR A O     1 
ATOM   203   C  CB    . THR A  1 61   ? 159.597 151.021 174.353 1.00 228.10 ? 61   THR A CB    1 
ATOM   204   O  OG1   . THR A  1 61   ? 159.553 149.774 173.646 1.00 226.94 ? 61   THR A OG1   1 
ATOM   205   C  CG2   . THR A  1 61   ? 161.045 151.495 174.480 1.00 226.47 ? 61   THR A CG2   1 
ATOM   206   N  N     . THR A  1 62   ? 157.108 149.248 175.548 1.00 216.76 ? 62   THR A N     1 
ATOM   207   C  CA    . THR A  1 62   ? 155.703 148.860 175.549 1.00 214.12 ? 62   THR A CA    1 
ATOM   208   C  C     . THR A  1 62   ? 155.018 149.334 176.818 1.00 214.81 ? 62   THR A C     1 
ATOM   209   O  O     . THR A  1 62   ? 153.810 149.596 176.817 1.00 214.75 ? 62   THR A O     1 
ATOM   210   C  CB    . THR A  1 62   ? 155.582 147.338 175.394 1.00 218.56 ? 62   THR A CB    1 
ATOM   211   O  OG1   . THR A  1 62   ? 156.116 146.938 174.124 1.00 226.88 ? 62   THR A OG1   1 
ATOM   212   C  CG2   . THR A  1 62   ? 154.127 146.872 175.487 1.00 220.55 ? 62   THR A CG2   1 
ATOM   213   N  N     . LEU A  1 63   ? 155.777 149.479 177.903 1.00 213.14 ? 63   LEU A N     1 
ATOM   214   C  CA    . LEU A  1 63   ? 155.206 150.038 179.119 1.00 205.34 ? 63   LEU A CA    1 
ATOM   215   C  C     . LEU A  1 63   ? 154.761 151.486 178.899 1.00 212.54 ? 63   LEU A C     1 
ATOM   216   O  O     . LEU A  1 63   ? 153.631 151.853 179.245 1.00 217.98 ? 63   LEU A O     1 
ATOM   217   C  CB    . LEU A  1 63   ? 156.215 149.899 180.263 1.00 206.56 ? 63   LEU A CB    1 
ATOM   218   C  CG    . LEU A  1 63   ? 156.997 151.070 180.854 1.00 205.59 ? 63   LEU A CG    1 
ATOM   219   C  CD1   . LEU A  1 63   ? 156.182 151.743 181.939 1.00 209.65 ? 63   LEU A CD1   1 
ATOM   220   C  CD2   . LEU A  1 63   ? 158.328 150.597 181.409 1.00 216.44 ? 63   LEU A CD2   1 
ATOM   221   N  N     . VAL A  1 64   ? 155.598 152.264 178.224 1.00 214.25 ? 64   VAL A N     1 
ATOM   222   C  CA    . VAL A  1 64   ? 155.297 153.660 177.919 1.00 209.13 ? 64   VAL A CA    1 
ATOM   223   C  C     . VAL A  1 64   ? 154.045 153.767 177.043 1.00 209.85 ? 64   VAL A C     1 
ATOM   224   O  O     . VAL A  1 64   ? 153.256 154.702 177.175 1.00 210.07 ? 64   VAL A O     1 
ATOM   225   C  CB    . VAL A  1 64   ? 156.483 154.364 177.231 1.00 208.92 ? 64   VAL A CB    1 
ATOM   226   C  CG1   . VAL A  1 64   ? 156.093 155.775 176.818 1.00 213.64 ? 64   VAL A CG1   1 
ATOM   227   C  CG2   . VAL A  1 64   ? 157.698 154.386 178.147 1.00 214.77 ? 64   VAL A CG2   1 
ATOM   228   N  N     . ASP A  1 65   ? 153.881 152.796 176.151 1.00 216.76 ? 65   ASP A N     1 
ATOM   229   C  CA    . ASP A  1 65   ? 152.762 152.739 175.212 1.00 217.30 ? 65   ASP A CA    1 
ATOM   230   C  C     . ASP A  1 65   ? 151.388 152.666 175.885 1.00 219.27 ? 65   ASP A C     1 
ATOM   231   O  O     . ASP A  1 65   ? 150.416 153.228 175.380 1.00 221.27 ? 65   ASP A O     1 
ATOM   232   C  CB    . ASP A  1 65   ? 152.936 151.556 174.255 1.00 218.84 ? 65   ASP A CB    1 
ATOM   233   C  CG    . ASP A  1 65   ? 151.858 151.505 173.190 1.00 226.39 ? 65   ASP A CG    1 
ATOM   234   O  OD1   . ASP A  1 65   ? 151.122 152.503 173.037 1.00 231.65 ? 65   ASP A OD1   1 
ATOM   235   O  OD2   . ASP A  1 65   ? 151.748 150.468 172.503 1.00 226.68 ? 65   ASP A OD2   1 
ATOM   236   N  N     . LEU A  1 66   ? 151.308 151.979 177.020 1.00 218.08 ? 66   LEU A N     1 
ATOM   237   C  CA    . LEU A  1 66   ? 150.041 151.805 177.730 1.00 217.26 ? 66   LEU A CA    1 
ATOM   238   C  C     . LEU A  1 66   ? 149.408 153.132 178.156 1.00 213.49 ? 66   LEU A C     1 
ATOM   239   O  O     . LEU A  1 66   ? 150.104 154.100 178.465 1.00 213.33 ? 66   LEU A O     1 
ATOM   240   C  CB    . LEU A  1 66   ? 150.232 150.901 178.949 1.00 215.92 ? 66   LEU A CB    1 
ATOM   241   C  CG    . LEU A  1 66   ? 150.732 149.483 178.664 1.00 215.79 ? 66   LEU A CG    1 
ATOM   242   C  CD1   . LEU A  1 66   ? 150.946 148.718 179.960 1.00 214.97 ? 66   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A  1 66   ? 149.761 148.745 177.755 1.00 216.30 ? 66   LEU A CD2   1 
ATOM   244   N  N     . LYS A  1 67   ? 148.077 153.155 178.168 1.00 209.52 ? 67   LYS A N     1 
ATOM   245   C  CA    . LYS A  1 67   ? 147.302 154.353 178.495 1.00 212.41 ? 67   LYS A CA    1 
ATOM   246   C  C     . LYS A  1 67   ? 147.567 154.902 179.894 1.00 212.49 ? 67   LYS A C     1 
ATOM   247   O  O     . LYS A  1 67   ? 147.761 154.154 180.852 1.00 216.99 ? 67   LYS A O     1 
ATOM   248   C  CB    . LYS A  1 67   ? 145.805 154.084 178.316 1.00 215.15 ? 67   LYS A CB    1 
ATOM   249   C  CG    . LYS A  1 67   ? 145.408 153.704 176.898 1.00 215.62 ? 67   LYS A CG    1 
ATOM   250   C  CD    . LYS A  1 67   ? 143.906 153.506 176.779 1.00 215.64 ? 67   LYS A CD    1 
ATOM   251   C  CE    . LYS A  1 67   ? 143.421 152.388 177.689 1.00 214.09 ? 67   LYS A CE    1 
ATOM   252   N  NZ    . LYS A  1 67   ? 144.047 151.081 177.345 1.00 218.61 ? 67   LYS A NZ    1 
ATOM   253   N  N     . TRP A  1 68   ? 147.571 156.229 179.983 1.00 215.97 ? 68   TRP A N     1 
ATOM   254   C  CA    . TRP A  1 68   ? 147.855 156.947 181.223 1.00 214.01 ? 68   TRP A CA    1 
ATOM   255   C  C     . TRP A  1 68   ? 147.242 156.293 182.459 1.00 212.84 ? 68   TRP A C     1 
ATOM   256   O  O     . TRP A  1 68   ? 147.949 156.200 183.478 1.00 214.77 ? 68   TRP A O     1 
ATOM   257   C  CB    . TRP A  1 68   ? 147.402 158.407 181.090 1.00 216.06 ? 68   TRP A CB    1 
ATOM   258   C  CG    . TRP A  1 68   ? 148.548 159.355 180.945 1.00 219.91 ? 68   TRP A CG    1 
ATOM   259   C  CD1   . TRP A  1 68   ? 149.084 159.825 179.781 1.00 222.33 ? 68   TRP A CD1   1 
ATOM   260   C  CD2   . TRP A  1 68   ? 149.314 159.941 182.005 1.00 217.43 ? 68   TRP A CD2   1 
ATOM   261   N  NE1   . TRP A  1 68   ? 150.133 160.671 180.050 1.00 228.02 ? 68   TRP A NE1   1 
ATOM   262   C  CE2   . TRP A  1 68   ? 150.294 160.759 181.409 1.00 218.03 ? 68   TRP A CE2   1 
ATOM   263   C  CE3   . TRP A  1 68   ? 149.264 159.854 183.402 1.00 211.42 ? 68   TRP A CE3   1 
ATOM   264   C  CZ2   . TRP A  1 68   ? 151.218 161.486 182.161 1.00 212.35 ? 68   TRP A CZ2   1 
ATOM   265   C  CZ3   . TRP A  1 68   ? 150.181 160.576 184.145 1.00 208.28 ? 68   TRP A CZ3   1 
ATOM   266   C  CH2   . TRP A  1 68   ? 151.144 161.381 183.523 1.00 211.66 ? 68   TRP A CH2   1 
ATOM   267   N  N     . PRO A  1 69   ? 145.984 155.828 182.456 1.00 197.66 ? 69   PRO A N     1 
ATOM   268   C  CA    . PRO A  1 69   ? 145.489 155.109 183.646 1.00 197.66 ? 69   PRO A CA    1 
ATOM   269   C  C     . PRO A  1 69   ? 146.245 153.820 183.928 1.00 198.50 ? 69   PRO A C     1 
ATOM   270   O  O     . PRO A  1 69   ? 146.638 153.574 185.077 1.00 197.12 ? 69   PRO A O     1 
ATOM   271   C  CB    . PRO A  1 69   ? 144.008 154.856 183.313 1.00 201.18 ? 69   PRO A CB    1 
ATOM   272   C  CG    . PRO A  1 69   ? 143.911 154.970 181.830 1.00 203.98 ? 69   PRO A CG    1 
ATOM   273   C  CD    . PRO A  1 69   ? 144.907 156.034 181.469 1.00 200.33 ? 69   PRO A CD    1 
ATOM   274   N  N     . HIS A  1 70   ? 146.467 152.987 182.907 1.00 190.89 ? 70   HIS A N     1 
ATOM   275   C  CA    . HIS A  1 70   ? 147.214 151.750 183.121 1.00 190.49 ? 70   HIS A CA    1 
ATOM   276   C  C     . HIS A  1 70   ? 148.644 152.036 183.554 1.00 187.10 ? 70   HIS A C     1 
ATOM   277   O  O     . HIS A  1 70   ? 149.202 151.323 184.400 1.00 186.57 ? 70   HIS A O     1 
ATOM   278   C  CB    . HIS A  1 70   ? 147.202 150.899 181.853 1.00 191.36 ? 70   HIS A CB    1 
ATOM   279   C  CG    . HIS A  1 70   ? 145.907 150.193 181.617 1.00 198.71 ? 70   HIS A CG    1 
ATOM   280   N  ND1   . HIS A  1 70   ? 144.923 150.101 182.577 1.00 202.00 ? 70   HIS A ND1   1 
ATOM   281   C  CD2   . HIS A  1 70   ? 145.433 149.540 180.529 1.00 209.85 ? 70   HIS A CD2   1 
ATOM   282   C  CE1   . HIS A  1 70   ? 143.898 149.426 182.091 1.00 211.68 ? 70   HIS A CE1   1 
ATOM   283   N  NE2   . HIS A  1 70   ? 144.180 149.074 180.850 1.00 219.57 ? 70   HIS A NE2   1 
ATOM   284   N  N     . THR A  1 71   ? 149.256 153.077 182.988 1.00 176.42 ? 71   THR A N     1 
ATOM   285   C  CA    . THR A  1 71   ? 150.634 153.390 183.349 1.00 176.39 ? 71   THR A CA    1 
ATOM   286   C  C     . THR A  1 71   ? 150.717 153.894 184.787 1.00 176.84 ? 71   THR A C     1 
ATOM   287   O  O     . THR A  1 71   ? 151.624 153.506 185.531 1.00 185.97 ? 71   THR A O     1 
ATOM   288   C  CB    . THR A  1 71   ? 151.228 154.386 182.341 1.00 175.36 ? 71   THR A CB    1 
ATOM   289   O  OG1   . THR A  1 71   ? 152.616 154.099 182.148 1.00 175.28 ? 71   THR A OG1   1 
ATOM   290   C  CG2   . THR A  1 71   ? 151.078 155.836 182.790 1.00 178.31 ? 71   THR A CG2   1 
ATOM   291   N  N     . LEU A  1 72   ? 149.747 154.704 185.220 1.00 183.47 ? 72   LEU A N     1 
ATOM   292   C  CA    . LEU A  1 72   ? 149.728 155.139 186.612 1.00 182.78 ? 72   LEU A CA    1 
ATOM   293   C  C     . LEU A  1 72   ? 149.516 153.953 187.544 1.00 183.83 ? 72   LEU A C     1 
ATOM   294   O  O     . LEU A  1 72   ? 150.131 153.873 188.617 1.00 185.94 ? 72   LEU A O     1 
ATOM   295   C  CB    . LEU A  1 72   ? 148.641 156.196 186.803 1.00 184.14 ? 72   LEU A CB    1 
ATOM   296   C  CG    . LEU A  1 72   ? 148.566 156.991 188.108 1.00 181.58 ? 72   LEU A CG    1 
ATOM   297   C  CD1   . LEU A  1 72   ? 147.952 158.352 187.833 1.00 186.99 ? 72   LEU A CD1   1 
ATOM   298   C  CD2   . LEU A  1 72   ? 147.756 156.253 189.161 1.00 175.82 ? 72   LEU A CD2   1 
ATOM   299   N  N     . LEU A  1 73   ? 148.658 153.013 187.137 1.00 180.16 ? 73   LEU A N     1 
ATOM   300   C  CA    . LEU A  1 73   ? 148.425 151.813 187.931 1.00 179.65 ? 73   LEU A CA    1 
ATOM   301   C  C     . LEU A  1 73   ? 149.707 151.009 188.105 1.00 186.00 ? 73   LEU A C     1 
ATOM   302   O  O     . LEU A  1 73   ? 150.050 150.596 189.219 1.00 190.06 ? 73   LEU A O     1 
ATOM   303   C  CB    . LEU A  1 73   ? 147.338 150.959 187.277 1.00 178.64 ? 73   LEU A CB    1 
ATOM   304   C  CG    . LEU A  1 73   ? 147.075 149.588 187.899 1.00 182.47 ? 73   LEU A CG    1 
ATOM   305   C  CD1   . LEU A  1 73   ? 146.597 149.737 189.334 1.00 180.09 ? 73   LEU A CD1   1 
ATOM   306   C  CD2   . LEU A  1 73   ? 146.067 148.796 187.070 1.00 187.57 ? 73   LEU A CD2   1 
ATOM   307   N  N     . ILE A  1 74   ? 150.444 150.785 187.015 1.00 188.68 ? 74   ILE A N     1 
ATOM   308   C  CA    . ILE A  1 74   ? 151.649 149.967 187.143 1.00 181.83 ? 74   ILE A CA    1 
ATOM   309   C  C     . ILE A  1 74   ? 152.741 150.718 187.901 1.00 186.21 ? 74   ILE A C     1 
ATOM   310   O  O     . ILE A  1 74   ? 153.561 150.099 188.591 1.00 191.03 ? 74   ILE A O     1 
ATOM   311   C  CB    . ILE A  1 74   ? 152.142 149.482 185.769 1.00 177.95 ? 74   ILE A CB    1 
ATOM   312   C  CG1   . ILE A  1 74   ? 153.239 148.434 185.956 1.00 182.69 ? 74   ILE A CG1   1 
ATOM   313   C  CG2   . ILE A  1 74   ? 152.658 150.636 184.936 1.00 181.78 ? 74   ILE A CG2   1 
ATOM   314   C  CD1   . ILE A  1 74   ? 153.778 147.881 184.673 1.00 187.47 ? 74   ILE A CD1   1 
ATOM   315   N  N     . PHE A  1 75   ? 152.756 152.052 187.829 1.00 196.20 ? 75   PHE A N     1 
ATOM   316   C  CA    . PHE A  1 75   ? 153.759 152.810 188.573 1.00 199.08 ? 75   PHE A CA    1 
ATOM   317   C  C     . PHE A  1 75   ? 153.513 152.725 190.075 1.00 203.14 ? 75   PHE A C     1 
ATOM   318   O  O     . PHE A  1 75   ? 154.433 152.423 190.854 1.00 208.40 ? 75   PHE A O     1 
ATOM   319   C  CB    . PHE A  1 75   ? 153.766 154.264 188.104 1.00 200.23 ? 75   PHE A CB    1 
ATOM   320   C  CG    . PHE A  1 75   ? 154.188 154.427 186.677 1.00 205.88 ? 75   PHE A CG    1 
ATOM   321   C  CD1   . PHE A  1 75   ? 155.019 153.494 186.077 1.00 207.35 ? 75   PHE A CD1   1 
ATOM   322   C  CD2   . PHE A  1 75   ? 153.747 155.507 185.927 1.00 217.45 ? 75   PHE A CD2   1 
ATOM   323   C  CE1   . PHE A  1 75   ? 155.404 153.634 184.761 1.00 210.64 ? 75   PHE A CE1   1 
ATOM   324   C  CE2   . PHE A  1 75   ? 154.122 155.646 184.607 1.00 218.66 ? 75   PHE A CE2   1 
ATOM   325   C  CZ    . PHE A  1 75   ? 154.956 154.713 184.025 1.00 211.77 ? 75   PHE A CZ    1 
ATOM   326   N  N     . THR A  1 76   ? 152.276 152.993 190.507 1.00 174.92 ? 76   THR A N     1 
ATOM   327   C  CA    . THR A  1 76   ? 151.983 152.834 191.928 1.00 171.89 ? 76   THR A CA    1 
ATOM   328   C  C     . THR A  1 76   ? 152.165 151.387 192.366 1.00 172.62 ? 76   THR A C     1 
ATOM   329   O  O     . THR A  1 76   ? 152.563 151.135 193.510 1.00 171.27 ? 76   THR A O     1 
ATOM   330   C  CB    . THR A  1 76   ? 150.571 153.319 192.267 1.00 171.53 ? 76   THR A CB    1 
ATOM   331   O  OG1   . THR A  1 76   ? 150.316 153.087 193.658 1.00 172.86 ? 76   THR A OG1   1 
ATOM   332   C  CG2   . THR A  1 76   ? 149.521 152.590 191.453 1.00 171.99 ? 76   THR A CG2   1 
ATOM   333   N  N     . MET A  1 77   ? 151.928 150.429 191.464 1.00 203.47 ? 77   MET A N     1 
ATOM   334   C  CA    . MET A  1 77   ? 152.132 149.025 191.803 1.00 203.33 ? 77   MET A CA    1 
ATOM   335   C  C     . MET A  1 77   ? 153.601 148.731 192.087 1.00 205.97 ? 77   MET A C     1 
ATOM   336   O  O     . MET A  1 77   ? 153.931 148.077 193.083 1.00 208.01 ? 77   MET A O     1 
ATOM   337   C  CB    . MET A  1 77   ? 151.613 148.137 190.673 1.00 204.22 ? 77   MET A CB    1 
ATOM   338   C  CG    . MET A  1 77   ? 151.749 146.665 190.970 1.00 206.30 ? 77   MET A CG    1 
ATOM   339   S  SD    . MET A  1 77   ? 151.118 146.314 192.617 1.00 215.96 ? 77   MET A SD    1 
ATOM   340   C  CE    . MET A  1 77   ? 149.406 146.815 192.441 1.00 208.89 ? 77   MET A CE    1 
ATOM   341   N  N     . SER A  1 78   ? 154.499 149.198 191.214 1.00 174.69 ? 78   SER A N     1 
ATOM   342   C  CA    . SER A  1 78   ? 155.930 148.999 191.442 1.00 169.53 ? 78   SER A CA    1 
ATOM   343   C  C     . SER A  1 78   ? 156.371 149.638 192.752 1.00 172.84 ? 78   SER A C     1 
ATOM   344   O  O     . SER A  1 78   ? 157.104 149.027 193.548 1.00 184.05 ? 78   SER A O     1 
ATOM   345   C  CB    . SER A  1 78   ? 156.735 149.567 190.273 1.00 165.54 ? 78   SER A CB    1 
ATOM   346   O  OG    . SER A  1 78   ? 156.578 148.778 189.107 1.00 166.17 ? 78   SER A OG    1 
ATOM   347   N  N     . PHE A  1 79   ? 155.936 150.879 192.992 1.00 145.43 ? 79   PHE A N     1 
ATOM   348   C  CA    . PHE A  1 79   ? 156.352 151.567 194.211 1.00 148.25 ? 79   PHE A CA    1 
ATOM   349   C  C     . PHE A  1 79   ? 155.887 150.821 195.458 1.00 156.16 ? 79   PHE A C     1 
ATOM   350   O  O     . PHE A  1 79   ? 156.677 150.576 196.380 1.00 165.18 ? 79   PHE A O     1 
ATOM   351   C  CB    . PHE A  1 79   ? 155.835 153.003 194.211 1.00 154.30 ? 79   PHE A CB    1 
ATOM   352   C  CG    . PHE A  1 79   ? 156.782 153.983 193.585 1.00 159.87 ? 79   PHE A CG    1 
ATOM   353   C  CD1   . PHE A  1 79   ? 158.071 153.600 193.246 1.00 155.12 ? 79   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A  1 79   ? 156.391 155.287 193.345 1.00 156.05 ? 79   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A  1 79   ? 158.947 154.502 192.671 1.00 153.10 ? 79   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A  1 79   ? 157.259 156.191 192.773 1.00 147.67 ? 79   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A  1 79   ? 158.540 155.800 192.435 1.00 152.26 ? 79   PHE A CZ    1 
ATOM   358   N  N     . LEU A  1 80   ? 154.607 150.444 195.500 1.00 149.53 ? 80   LEU A N     1 
ATOM   359   C  CA    . LEU A  1 80   ? 154.088 149.743 196.670 1.00 149.79 ? 80   LEU A CA    1 
ATOM   360   C  C     . LEU A  1 80   ? 154.759 148.386 196.846 1.00 151.76 ? 80   LEU A C     1 
ATOM   361   O  O     . LEU A  1 80   ? 155.007 147.955 197.977 1.00 153.22 ? 80   LEU A O     1 
ATOM   362   C  CB    . LEU A  1 80   ? 152.573 149.580 196.562 1.00 147.87 ? 80   LEU A CB    1 
ATOM   363   C  CG    . LEU A  1 80   ? 151.704 150.685 197.165 1.00 147.21 ? 80   LEU A CG    1 
ATOM   364   C  CD1   . LEU A  1 80   ? 152.043 152.048 196.578 1.00 145.94 ? 80   LEU A CD1   1 
ATOM   365   C  CD2   . LEU A  1 80   ? 150.237 150.359 196.947 1.00 149.87 ? 80   LEU A CD2   1 
ATOM   366   N  N     . CYS A  1 81   ? 155.059 147.699 195.740 1.00 178.09 ? 81   CYS A N     1 
ATOM   367   C  CA    . CYS A  1 81   ? 155.744 146.414 195.831 1.00 180.70 ? 81   CYS A CA    1 
ATOM   368   C  C     . CYS A  1 81   ? 157.095 146.562 196.520 1.00 183.00 ? 81   CYS A C     1 
ATOM   369   O  O     . CYS A  1 81   ? 157.405 145.832 197.471 1.00 192.60 ? 81   CYS A O     1 
ATOM   370   C  CB    . CYS A  1 81   ? 155.900 145.808 194.435 1.00 192.89 ? 81   CYS A CB    1 
ATOM   371   S  SG    . CYS A  1 81   ? 157.569 145.247 194.014 1.00 205.79 ? 81   CYS A SG    1 
ATOM   372   N  N     . SER A  1 82   ? 157.914 147.513 196.056 1.00 139.94 ? 82   SER A N     1 
ATOM   373   C  CA    . SER A  1 82   ? 159.225 147.707 196.676 1.00 141.39 ? 82   SER A CA    1 
ATOM   374   C  C     . SER A  1 82   ? 159.093 148.109 198.144 1.00 142.32 ? 82   SER A C     1 
ATOM   375   O  O     . SER A  1 82   ? 159.827 147.602 199.010 1.00 148.78 ? 82   SER A O     1 
ATOM   376   C  CB    . SER A  1 82   ? 160.027 148.753 195.904 1.00 141.25 ? 82   SER A CB    1 
ATOM   377   O  OG    . SER A  1 82   ? 159.333 149.986 195.841 1.00 147.34 ? 82   SER A OG    1 
ATOM   378   N  N     . TRP A  1 83   ? 158.153 149.015 198.441 1.00 140.05 ? 83   TRP A N     1 
ATOM   379   C  CA    . TRP A  1 83   ? 157.977 149.477 199.815 1.00 142.13 ? 83   TRP A CA    1 
ATOM   380   C  C     . TRP A  1 83   ? 157.619 148.322 200.741 1.00 148.29 ? 83   TRP A C     1 
ATOM   381   O  O     . TRP A  1 83   ? 158.208 148.169 201.818 1.00 148.61 ? 83   TRP A O     1 
ATOM   382   C  CB    . TRP A  1 83   ? 156.904 150.565 199.872 1.00 141.65 ? 83   TRP A CB    1 
ATOM   383   C  CG    . TRP A  1 83   ? 157.236 151.785 199.071 1.00 145.03 ? 83   TRP A CG    1 
ATOM   384   C  CD1   . TRP A  1 83   ? 158.447 152.107 198.533 1.00 148.93 ? 83   TRP A CD1   1 
ATOM   385   C  CD2   . TRP A  1 83   ? 156.342 152.843 198.703 1.00 134.44 ? 83   TRP A CD2   1 
ATOM   386   N  NE1   . TRP A  1 83   ? 158.366 153.302 197.859 1.00 140.31 ? 83   TRP A NE1   1 
ATOM   387   C  CE2   . TRP A  1 83   ? 157.083 153.774 197.949 1.00 137.41 ? 83   TRP A CE2   1 
ATOM   388   C  CE3   . TRP A  1 83   ? 154.987 153.093 198.942 1.00 139.41 ? 83   TRP A CE3   1 
ATOM   389   C  CZ2   . TRP A  1 83   ? 156.516 154.937 197.431 1.00 145.84 ? 83   TRP A CZ2   1 
ATOM   390   C  CZ3   . TRP A  1 83   ? 154.426 154.249 198.428 1.00 155.06 ? 83   TRP A CZ3   1 
ATOM   391   C  CH2   . TRP A  1 83   ? 155.189 155.155 197.681 1.00 157.28 ? 83   TRP A CH2   1 
ATOM   392   N  N     . LEU A  1 84   ? 156.657 147.489 200.335 1.00 148.38 ? 84   LEU A N     1 
ATOM   393   C  CA    . LEU A  1 84   ? 156.241 146.377 201.182 1.00 149.60 ? 84   LEU A CA    1 
ATOM   394   C  C     . LEU A  1 84   ? 157.348 145.341 201.327 1.00 150.95 ? 84   LEU A C     1 
ATOM   395   O  O     . LEU A  1 84   ? 157.532 144.776 202.413 1.00 163.82 ? 84   LEU A O     1 
ATOM   396   C  CB    . LEU A  1 84   ? 154.974 145.734 200.626 1.00 154.33 ? 84   LEU A CB    1 
ATOM   397   C  CG    . LEU A  1 84   ? 153.644 146.269 201.154 1.00 159.65 ? 84   LEU A CG    1 
ATOM   398   C  CD1   . LEU A  1 84   ? 152.481 145.668 200.379 1.00 170.20 ? 84   LEU A CD1   1 
ATOM   399   C  CD2   . LEU A  1 84   ? 153.509 145.969 202.635 1.00 157.49 ? 84   LEU A CD2   1 
ATOM   400   N  N     . LEU A  1 85   ? 158.094 145.075 200.252 1.00 143.92 ? 85   LEU A N     1 
ATOM   401   C  CA    . LEU A  1 85   ? 159.202 144.128 200.341 1.00 145.09 ? 85   LEU A CA    1 
ATOM   402   C  C     . LEU A  1 85   ? 160.202 144.562 201.409 1.00 147.58 ? 85   LEU A C     1 
ATOM   403   O  O     . LEU A  1 85   ? 160.569 143.778 202.301 1.00 154.07 ? 85   LEU A O     1 
ATOM   404   C  CB    . LEU A  1 85   ? 159.879 144.000 198.976 1.00 146.19 ? 85   LEU A CB    1 
ATOM   405   C  CG    . LEU A  1 85   ? 160.609 142.713 198.583 1.00 148.31 ? 85   LEU A CG    1 
ATOM   406   C  CD1   . LEU A  1 85   ? 160.916 142.731 197.090 1.00 154.09 ? 85   LEU A CD1   1 
ATOM   407   C  CD2   . LEU A  1 85   ? 161.888 142.519 199.385 1.00 146.83 ? 85   LEU A CD2   1 
ATOM   408   N  N     . PHE A  1 86   ? 160.644 145.820 201.348 1.00 138.91 ? 86   PHE A N     1 
ATOM   409   C  CA    . PHE A  1 86   ? 161.657 146.247 202.309 1.00 139.76 ? 86   PHE A CA    1 
ATOM   410   C  C     . PHE A  1 86   ? 161.080 146.435 203.711 1.00 144.37 ? 86   PHE A C     1 
ATOM   411   O  O     . PHE A  1 86   ? 161.796 146.240 204.701 1.00 151.24 ? 86   PHE A O     1 
ATOM   412   C  CB    . PHE A  1 86   ? 162.355 147.509 201.812 1.00 139.08 ? 86   PHE A CB    1 
ATOM   413   C  CG    . PHE A  1 86   ? 163.306 147.247 200.684 1.00 134.12 ? 86   PHE A CG    1 
ATOM   414   C  CD1   . PHE A  1 86   ? 164.550 146.695 200.930 1.00 134.59 ? 86   PHE A CD1   1 
ATOM   415   C  CD2   . PHE A  1 86   ? 162.946 147.524 199.379 1.00 135.44 ? 86   PHE A CD2   1 
ATOM   416   C  CE1   . PHE A  1 86   ? 165.427 146.439 199.895 1.00 138.04 ? 86   PHE A CE1   1 
ATOM   417   C  CE2   . PHE A  1 86   ? 163.818 147.272 198.338 1.00 136.23 ? 86   PHE A CE2   1 
ATOM   418   C  CZ    . PHE A  1 86   ? 165.061 146.727 198.598 1.00 140.44 ? 86   PHE A CZ    1 
ATOM   419   N  N     . ALA A  1 87   ? 159.792 146.772 203.826 1.00 156.75 ? 87   ALA A N     1 
ATOM   420   C  CA    . ALA A  1 87   ? 159.170 146.812 205.145 1.00 159.54 ? 87   ALA A CA    1 
ATOM   421   C  C     . ALA A  1 87   ? 159.151 145.432 205.783 1.00 160.08 ? 87   ALA A C     1 
ATOM   422   O  O     . ALA A  1 87   ? 159.427 145.285 206.982 1.00 166.64 ? 87   ALA A O     1 
ATOM   423   C  CB    . ALA A  1 87   ? 157.753 147.370 205.045 1.00 161.25 ? 87   ALA A CB    1 
ATOM   424   N  N     . MET A  1 88   ? 158.824 144.406 204.995 1.00 164.25 ? 88   MET A N     1 
ATOM   425   C  CA    . MET A  1 88   ? 158.848 143.039 205.500 1.00 163.47 ? 88   MET A CA    1 
ATOM   426   C  C     . MET A  1 88   ? 160.248 142.647 205.952 1.00 159.53 ? 88   MET A C     1 
ATOM   427   O  O     . MET A  1 88   ? 160.426 142.067 207.031 1.00 161.98 ? 88   MET A O     1 
ATOM   428   C  CB    . MET A  1 88   ? 158.341 142.074 204.429 1.00 166.04 ? 88   MET A CB    1 
ATOM   429   C  CG    . MET A  1 88   ? 158.706 140.618 204.676 1.00 179.50 ? 88   MET A CG    1 
ATOM   430   S  SD    . MET A  1 88   ? 157.314 139.605 205.208 1.00 214.28 ? 88   MET A SD    1 
ATOM   431   C  CE    . MET A  1 88   ? 156.959 140.297 206.821 1.00 195.00 ? 88   MET A CE    1 
ATOM   432   N  N     . VAL A  1 89   ? 161.264 142.960 205.139 1.00 136.08 ? 89   VAL A N     1 
ATOM   433   C  CA    . VAL A  1 89   ? 162.612 142.546 205.529 1.00 136.85 ? 89   VAL A CA    1 
ATOM   434   C  C     . VAL A  1 89   ? 163.082 143.303 206.772 1.00 137.74 ? 89   VAL A C     1 
ATOM   435   O  O     . VAL A  1 89   ? 163.813 142.748 207.604 1.00 138.01 ? 89   VAL A O     1 
ATOM   436   C  CB    . VAL A  1 89   ? 163.601 142.690 204.354 1.00 134.01 ? 89   VAL A CB    1 
ATOM   437   C  CG1   . VAL A  1 89   ? 164.017 144.134 204.148 1.00 135.91 ? 89   VAL A CG1   1 
ATOM   438   C  CG2   . VAL A  1 89   ? 164.817 141.809 204.587 1.00 129.74 ? 89   VAL A CG2   1 
ATOM   439   N  N     . TRP A  1 90   ? 162.641 144.554 206.954 1.00 127.03 ? 90   TRP A N     1 
ATOM   440   C  CA    . TRP A  1 90   ? 163.049 145.296 208.145 1.00 121.87 ? 90   TRP A CA    1 
ATOM   441   C  C     . TRP A  1 90   ? 162.347 144.779 209.394 1.00 124.53 ? 90   TRP A C     1 
ATOM   442   O  O     . TRP A  1 90   ? 162.967 144.666 210.461 1.00 131.25 ? 90   TRP A O     1 
ATOM   443   C  CB    . TRP A  1 90   ? 162.781 146.785 207.968 1.00 117.56 ? 90   TRP A CB    1 
ATOM   444   C  CG    . TRP A  1 90   ? 164.009 147.596 208.155 1.00 113.76 ? 90   TRP A CG    1 
ATOM   445   C  CD1   . TRP A  1 90   ? 164.802 147.635 209.262 1.00 112.01 ? 90   TRP A CD1   1 
ATOM   446   C  CD2   . TRP A  1 90   ? 164.597 148.487 207.204 1.00 117.56 ? 90   TRP A CD2   1 
ATOM   447   N  NE1   . TRP A  1 90   ? 165.853 148.497 209.060 1.00 117.51 ? 90   TRP A NE1   1 
ATOM   448   C  CE2   . TRP A  1 90   ? 165.749 149.034 207.803 1.00 122.11 ? 90   TRP A CE2   1 
ATOM   449   C  CE3   . TRP A  1 90   ? 164.263 148.876 205.903 1.00 121.93 ? 90   TRP A CE3   1 
ATOM   450   C  CZ2   . TRP A  1 90   ? 166.567 149.951 207.146 1.00 126.73 ? 90   TRP A CZ2   1 
ATOM   451   C  CZ3   . TRP A  1 90   ? 165.074 149.787 205.254 1.00 121.67 ? 90   TRP A CZ3   1 
ATOM   452   C  CH2   . TRP A  1 90   ? 166.213 150.315 205.875 1.00 121.43 ? 90   TRP A CH2   1 
ATOM   453   N  N     . TRP A  1 91   ? 161.051 144.482 209.294 1.00 132.52 ? 91   TRP A N     1 
ATOM   454   C  CA    . TRP A  1 91   ? 160.371 143.841 210.413 1.00 133.28 ? 91   TRP A CA    1 
ATOM   455   C  C     . TRP A  1 91   ? 161.047 142.525 210.767 1.00 133.82 ? 91   TRP A C     1 
ATOM   456   O  O     . TRP A  1 91   ? 161.236 142.212 211.949 1.00 145.22 ? 91   TRP A O     1 
ATOM   457   C  CB    . TRP A  1 91   ? 158.896 143.623 210.079 1.00 136.69 ? 91   TRP A CB    1 
ATOM   458   C  CG    . TRP A  1 91   ? 158.131 142.945 211.165 1.00 130.37 ? 91   TRP A CG    1 
ATOM   459   C  CD1   . TRP A  1 91   ? 157.523 143.532 212.235 1.00 135.47 ? 91   TRP A CD1   1 
ATOM   460   C  CD2   . TRP A  1 91   ? 157.888 141.540 211.286 1.00 133.85 ? 91   TRP A CD2   1 
ATOM   461   N  NE1   . TRP A  1 91   ? 156.916 142.580 213.017 1.00 152.59 ? 91   TRP A NE1   1 
ATOM   462   C  CE2   . TRP A  1 91   ? 157.126 141.348 212.456 1.00 145.24 ? 91   TRP A CE2   1 
ATOM   463   C  CE3   . TRP A  1 91   ? 158.242 140.429 210.520 1.00 139.06 ? 91   TRP A CE3   1 
ATOM   464   C  CZ2   . TRP A  1 91   ? 156.713 140.086 212.875 1.00 151.36 ? 91   TRP A CZ2   1 
ATOM   465   C  CZ3   . TRP A  1 91   ? 157.832 139.182 210.936 1.00 147.91 ? 91   TRP A CZ3   1 
ATOM   466   C  CH2   . TRP A  1 91   ? 157.075 139.018 212.104 1.00 148.81 ? 91   TRP A CH2   1 
ATOM   467   N  N     . LEU A  1 92   ? 161.455 141.758 209.753 1.00 138.09 ? 92   LEU A N     1 
ATOM   468   C  CA    . LEU A  1 92   ? 162.121 140.486 210.004 1.00 141.73 ? 92   LEU A CA    1 
ATOM   469   C  C     . LEU A  1 92   ? 163.442 140.683 210.736 1.00 140.04 ? 92   LEU A C     1 
ATOM   470   O  O     . LEU A  1 92   ? 163.745 139.958 211.687 1.00 141.74 ? 92   LEU A O     1 
ATOM   471   C  CB    . LEU A  1 92   ? 162.350 139.741 208.689 1.00 144.68 ? 92   LEU A CB    1 
ATOM   472   C  CG    . LEU A  1 92   ? 163.328 138.565 208.763 1.00 149.70 ? 92   LEU A CG    1 
ATOM   473   C  CD1   . LEU A  1 92   ? 162.804 137.479 209.691 1.00 149.31 ? 92   LEU A CD1   1 
ATOM   474   C  CD2   . LEU A  1 92   ? 163.608 138.005 207.376 1.00 146.72 ? 92   LEU A CD2   1 
ATOM   475   N  N     . ILE A  1 93   ? 164.253 141.650 210.298 1.00 116.07 ? 93   ILE A N     1 
ATOM   476   C  CA    . ILE A  1 93   ? 165.563 141.820 210.921 1.00 117.99 ? 93   ILE A CA    1 
ATOM   477   C  C     . ILE A  1 93   ? 165.419 142.350 212.345 1.00 120.33 ? 93   ILE A C     1 
ATOM   478   O  O     . ILE A  1 93   ? 166.165 141.947 213.250 1.00 127.49 ? 93   ILE A O     1 
ATOM   479   C  CB    . ILE A  1 93   ? 166.473 142.713 210.054 1.00 118.92 ? 93   ILE A CB    1 
ATOM   480   C  CG1   . ILE A  1 93   ? 167.895 142.715 210.609 1.00 127.66 ? 93   ILE A CG1   1 
ATOM   481   C  CG2   . ILE A  1 93   ? 165.954 144.136 209.972 1.00 122.41 ? 93   ILE A CG2   1 
ATOM   482   C  CD1   . ILE A  1 93   ? 168.820 143.656 209.881 1.00 113.19 ? 93   ILE A CD1   1 
ATOM   483   N  N     . ALA A  1 94   ? 164.449 143.242 212.579 1.00 133.06 ? 94   ALA A N     1 
ATOM   484   C  CA    . ALA A  1 94   ? 164.213 143.714 213.939 1.00 134.48 ? 94   ALA A CA    1 
ATOM   485   C  C     . ALA A  1 94   ? 163.704 142.595 214.835 1.00 146.73 ? 94   ALA A C     1 
ATOM   486   O  O     . ALA A  1 94   ? 164.035 142.555 216.026 1.00 158.11 ? 94   ALA A O     1 
ATOM   487   C  CB    . ALA A  1 94   ? 163.227 144.881 213.933 1.00 136.22 ? 94   ALA A CB    1 
ATOM   488   N  N     . PHE A  1 95   ? 162.904 141.680 214.284 1.00 156.83 ? 95   PHE A N     1 
ATOM   489   C  CA    . PHE A  1 95   ? 162.471 140.513 215.044 1.00 156.06 ? 95   PHE A CA    1 
ATOM   490   C  C     . PHE A  1 95   ? 163.642 139.587 215.342 1.00 158.24 ? 95   PHE A C     1 
ATOM   491   O  O     . PHE A  1 95   ? 163.739 139.027 216.440 1.00 160.86 ? 95   PHE A O     1 
ATOM   492   C  CB    . PHE A  1 95   ? 161.381 139.781 214.263 1.00 155.38 ? 95   PHE A CB    1 
ATOM   493   C  CG    . PHE A  1 95   ? 160.757 138.638 215.005 1.00 161.13 ? 95   PHE A CG    1 
ATOM   494   C  CD1   . PHE A  1 95   ? 159.659 138.843 215.822 1.00 167.33 ? 95   PHE A CD1   1 
ATOM   495   C  CD2   . PHE A  1 95   ? 161.253 137.353 214.868 1.00 170.25 ? 95   PHE A CD2   1 
ATOM   496   C  CE1   . PHE A  1 95   ? 159.076 137.791 216.499 1.00 176.96 ? 95   PHE A CE1   1 
ATOM   497   C  CE2   . PHE A  1 95   ? 160.676 136.298 215.544 1.00 182.10 ? 95   PHE A CE2   1 
ATOM   498   C  CZ    . PHE A  1 95   ? 159.585 136.516 216.360 1.00 182.69 ? 95   PHE A CZ    1 
ATOM   499   N  N     . ALA A  1 96   ? 164.546 139.429 214.374 1.00 158.23 ? 96   ALA A N     1 
ATOM   500   C  CA    . ALA A  1 96   ? 165.626 138.455 214.500 1.00 165.06 ? 96   ALA A CA    1 
ATOM   501   C  C     . ALA A  1 96   ? 166.675 138.908 215.505 1.00 159.71 ? 96   ALA A C     1 
ATOM   502   O  O     . ALA A  1 96   ? 167.147 138.106 216.317 1.00 169.09 ? 96   ALA A O     1 
ATOM   503   C  CB    . ALA A  1 96   ? 166.269 138.210 213.136 1.00 175.83 ? 96   ALA A CB    1 
ATOM   504   N  N     . HIS A  1 97   ? 167.063 140.187 215.460 1.00 163.07 ? 97   HIS A N     1 
ATOM   505   C  CA    . HIS A  1 97   ? 168.053 140.672 216.416 1.00 165.07 ? 97   HIS A CA    1 
ATOM   506   C  C     . HIS A  1 97   ? 167.572 140.542 217.857 1.00 169.13 ? 97   HIS A C     1 
ATOM   507   O  O     . HIS A  1 97   ? 168.394 140.554 218.780 1.00 178.47 ? 97   HIS A O     1 
ATOM   508   C  CB    . HIS A  1 97   ? 168.414 142.130 216.117 1.00 166.95 ? 97   HIS A CB    1 
ATOM   509   C  CG    . HIS A  1 97   ? 169.305 142.751 217.147 1.00 173.90 ? 97   HIS A CG    1 
ATOM   510   N  ND1   . HIS A  1 97   ? 168.817 143.465 218.220 1.00 172.11 ? 97   HIS A ND1   1 
ATOM   511   C  CD2   . HIS A  1 97   ? 170.654 142.752 217.279 1.00 178.26 ? 97   HIS A CD2   1 
ATOM   512   C  CE1   . HIS A  1 97   ? 169.825 143.886 218.963 1.00 174.22 ? 97   HIS A CE1   1 
ATOM   513   N  NE2   . HIS A  1 97   ? 170.950 143.466 218.414 1.00 175.06 ? 97   HIS A NE2   1 
ATOM   514   N  N     . GLY A  1 98   ? 166.267 140.389 218.068 1.00 168.23 ? 98   GLY A N     1 
ATOM   515   C  CA    . GLY A  1 98   ? 165.698 140.426 219.393 1.00 171.49 ? 98   GLY A CA    1 
ATOM   516   C  C     . GLY A  1 98   ? 165.302 141.807 219.855 1.00 176.43 ? 98   GLY A C     1 
ATOM   517   O  O     . GLY A  1 98   ? 164.667 141.935 220.908 1.00 180.89 ? 98   GLY A O     1 
ATOM   518   N  N     . ASP A  1 99   ? 165.663 142.847 219.096 1.00 180.20 ? 99   ASP A N     1 
ATOM   519   C  CA    . ASP A  1 99   ? 165.260 144.205 219.432 1.00 184.84 ? 99   ASP A CA    1 
ATOM   520   C  C     . ASP A  1 99   ? 163.752 144.389 219.369 1.00 180.82 ? 99   ASP A C     1 
ATOM   521   O  O     . ASP A  1 99   ? 163.226 145.307 220.006 1.00 180.79 ? 99   ASP A O     1 
ATOM   522   C  CB    . ASP A  1 99   ? 165.943 145.199 218.493 1.00 174.59 ? 99   ASP A CB    1 
ATOM   523   N  N     . LEU A  1 100  ? 163.044 143.543 218.614 1.00 161.44 ? 100  LEU A N     1 
ATOM   524   C  CA    . LEU A  1 100  ? 161.591 143.636 218.568 1.00 159.39 ? 100  LEU A CA    1 
ATOM   525   C  C     . LEU A  1 100  ? 160.961 143.138 219.859 1.00 162.90 ? 100  LEU A C     1 
ATOM   526   O  O     . LEU A  1 100  ? 159.894 143.623 220.252 1.00 161.28 ? 100  LEU A O     1 
ATOM   527   C  CB    . LEU A  1 100  ? 161.042 142.850 217.380 1.00 149.70 ? 100  LEU A CB    1 
ATOM   528   C  CG    . LEU A  1 100  ? 159.588 143.153 217.027 1.00 148.84 ? 100  LEU A CG    1 
ATOM   529   C  CD1   . LEU A  1 100  ? 159.430 144.628 216.699 1.00 160.93 ? 100  LEU A CD1   1 
ATOM   530   C  CD2   . LEU A  1 100  ? 159.129 142.295 215.867 1.00 145.91 ? 100  LEU A CD2   1 
ATOM   531   N  N     . ALA A  1 101  ? 161.593 142.180 220.523 1.00 200.34 ? 101  ALA A N     1 
ATOM   532   C  CA    . ALA A  1 101  ? 161.136 141.762 221.839 1.00 210.48 ? 101  ALA A CA    1 
ATOM   533   C  C     . ALA A  1 101  ? 161.224 142.946 222.801 1.00 209.83 ? 101  ALA A C     1 
ATOM   534   O  O     . ALA A  1 101  ? 162.338 143.432 223.067 1.00 204.90 ? 101  ALA A O     1 
ATOM   535   C  CB    . ALA A  1 101  ? 161.989 140.593 222.345 1.00 209.56 ? 101  ALA A CB    1 
ATOM   536   N  N     . PRO A  1 102  ? 160.093 143.464 223.318 1.00 199.23 ? 102  PRO A N     1 
ATOM   537   C  CA    . PRO A  1 102  ? 160.170 144.656 224.176 1.00 197.25 ? 102  PRO A CA    1 
ATOM   538   C  C     . PRO A  1 102  ? 160.960 144.418 225.452 1.00 205.90 ? 102  PRO A C     1 
ATOM   539   O  O     . PRO A  1 102  ? 160.533 143.671 226.339 1.00 209.99 ? 102  PRO A O     1 
ATOM   540   C  CB    . PRO A  1 102  ? 158.699 144.974 224.475 1.00 202.01 ? 102  PRO A CB    1 
ATOM   541   C  CG    . PRO A  1 102  ? 157.985 143.688 224.302 1.00 203.76 ? 102  PRO A CG    1 
ATOM   542   C  CD    . PRO A  1 102  ? 158.712 142.967 223.193 1.00 201.68 ? 102  PRO A CD    1 
ATOM   543   N  N     . GLY A  1 103  ? 162.121 145.062 225.558 1.00 227.88 ? 103  GLY A N     1 
ATOM   544   C  CA    . GLY A  1 103  ? 162.963 144.922 226.732 1.00 236.71 ? 103  GLY A CA    1 
ATOM   545   C  C     . GLY A  1 103  ? 163.761 146.173 227.034 1.00 242.67 ? 103  GLY A C     1 
ATOM   546   O  O     . GLY A  1 103  ? 164.223 146.857 226.117 1.00 234.92 ? 103  GLY A O     1 
ATOM   547   N  N     . GLU A  1 104  ? 163.929 146.482 228.317 1.00 259.93 ? 104  GLU A N     1 
ATOM   548   C  CA    . GLU A  1 104  ? 164.660 147.664 228.753 1.00 264.96 ? 104  GLU A CA    1 
ATOM   549   C  C     . GLU A  1 104  ? 166.048 147.248 229.223 1.00 264.67 ? 104  GLU A C     1 
ATOM   550   O  O     . GLU A  1 104  ? 166.178 146.406 230.120 1.00 264.02 ? 104  GLU A O     1 
ATOM   551   C  CB    . GLU A  1 104  ? 163.906 148.392 229.868 1.00 265.61 ? 104  GLU A CB    1 
ATOM   552   N  N     . GLY A  1 105  ? 167.078 147.823 228.611 1.00 278.67 ? 105  GLY A N     1 
ATOM   553   C  CA    . GLY A  1 105  ? 168.446 147.553 228.995 1.00 274.94 ? 105  GLY A CA    1 
ATOM   554   C  C     . GLY A  1 105  ? 169.011 146.310 228.333 1.00 266.93 ? 105  GLY A C     1 
ATOM   555   O  O     . GLY A  1 105  ? 168.320 145.549 227.650 1.00 265.54 ? 105  GLY A O     1 
ATOM   556   N  N     . THR A  1 106  ? 170.313 146.117 228.540 1.00 270.76 ? 106  THR A N     1 
ATOM   557   C  CA    . THR A  1 106  ? 171.098 145.003 228.011 1.00 267.54 ? 106  THR A CA    1 
ATOM   558   C  C     . THR A  1 106  ? 171.139 144.974 226.487 1.00 271.12 ? 106  THR A C     1 
ATOM   559   O  O     . THR A  1 106  ? 171.678 144.023 225.905 1.00 271.61 ? 106  THR A O     1 
ATOM   560   C  CB    . THR A  1 106  ? 170.595 143.651 228.538 1.00 267.07 ? 106  THR A CB    1 
ATOM   561   N  N     . ASN A  1 107  ? 170.595 145.992 225.825 1.00 257.01 ? 107  ASN A N     1 
ATOM   562   C  CA    . ASN A  1 107  ? 170.615 146.056 224.372 1.00 246.00 ? 107  ASN A CA    1 
ATOM   563   C  C     . ASN A  1 107  ? 170.285 147.473 223.932 1.00 241.94 ? 107  ASN A C     1 
ATOM   564   O  O     . ASN A  1 107  ? 169.794 148.293 224.713 1.00 245.18 ? 107  ASN A O     1 
ATOM   565   C  CB    . ASN A  1 107  ? 169.632 145.058 223.740 1.00 242.60 ? 107  ASN A CB    1 
ATOM   566   C  CG    . ASN A  1 107  ? 168.182 145.308 224.146 1.00 245.99 ? 107  ASN A CG    1 
ATOM   567   O  OD1   . ASN A  1 107  ? 167.877 146.233 224.898 1.00 251.90 ? 107  ASN A OD1   1 
ATOM   568   N  ND2   . ASN A  1 107  ? 167.280 144.477 223.638 1.00 247.32 ? 107  ASN A ND2   1 
ATOM   569   N  N     . VAL A  1 108  ? 170.574 147.745 222.666 1.00 200.52 ? 108  VAL A N     1 
ATOM   570   C  CA    . VAL A  1 108  ? 170.058 148.924 221.983 1.00 192.89 ? 108  VAL A CA    1 
ATOM   571   C  C     . VAL A  1 108  ? 169.467 148.418 220.675 1.00 185.27 ? 108  VAL A C     1 
ATOM   572   O  O     . VAL A  1 108  ? 170.137 147.677 219.942 1.00 181.40 ? 108  VAL A O     1 
ATOM   573   C  CB    . VAL A  1 108  ? 171.149 149.988 221.767 1.00 194.79 ? 108  VAL A CB    1 
ATOM   574   C  CG1   . VAL A  1 108  ? 172.442 149.350 221.276 1.00 194.86 ? 108  VAL A CG1   1 
ATOM   575   C  CG2   . VAL A  1 108  ? 170.668 151.053 220.790 1.00 187.76 ? 108  VAL A CG2   1 
ATOM   576   N  N     . PRO A  1 109  ? 168.214 148.738 220.363 1.00 179.31 ? 109  PRO A N     1 
ATOM   577   C  CA    . PRO A  1 109  ? 167.632 148.246 219.112 1.00 170.53 ? 109  PRO A CA    1 
ATOM   578   C  C     . PRO A  1 109  ? 168.398 148.785 217.916 1.00 167.42 ? 109  PRO A C     1 
ATOM   579   O  O     . PRO A  1 109  ? 168.817 149.944 217.897 1.00 168.04 ? 109  PRO A O     1 
ATOM   580   C  CB    . PRO A  1 109  ? 166.193 148.772 219.153 1.00 172.05 ? 109  PRO A CB    1 
ATOM   581   C  CG    . PRO A  1 109  ? 166.224 149.909 220.124 1.00 173.46 ? 109  PRO A CG    1 
ATOM   582   C  CD    . PRO A  1 109  ? 167.268 149.560 221.135 1.00 180.79 ? 109  PRO A CD    1 
ATOM   583   N  N     . CYS A  1 110  ? 168.604 147.915 216.922 1.00 174.42 ? 110  CYS A N     1 
ATOM   584   C  CA    . CYS A  1 110  ? 169.261 148.351 215.693 1.00 171.52 ? 110  CYS A CA    1 
ATOM   585   C  C     . CYS A  1 110  ? 168.539 149.549 215.099 1.00 159.77 ? 110  CYS A C     1 
ATOM   586   O  O     . CYS A  1 110  ? 169.169 150.453 214.543 1.00 158.43 ? 110  CYS A O     1 
ATOM   587   C  CB    . CYS A  1 110  ? 169.323 147.202 214.685 1.00 179.69 ? 110  CYS A CB    1 
ATOM   588   S  SG    . CYS A  1 110  ? 170.160 145.703 215.268 1.00 206.31 ? 110  CYS A SG    1 
ATOM   589   N  N     . VAL A  1 111  ? 167.216 149.579 215.226 1.00 149.28 ? 111  VAL A N     1 
ATOM   590   C  CA    . VAL A  1 111  ? 166.403 150.744 214.901 1.00 148.32 ? 111  VAL A CA    1 
ATOM   591   C  C     . VAL A  1 111  ? 165.662 151.136 216.172 1.00 148.40 ? 111  VAL A C     1 
ATOM   592   O  O     . VAL A  1 111  ? 164.770 150.409 216.628 1.00 148.64 ? 111  VAL A O     1 
ATOM   593   C  CB    . VAL A  1 111  ? 165.427 150.466 213.749 1.00 147.77 ? 111  VAL A CB    1 
ATOM   594   C  CG1   . VAL A  1 111  ? 166.122 150.675 212.418 1.00 150.07 ? 111  VAL A CG1   1 
ATOM   595   C  CG2   . VAL A  1 111  ? 164.888 149.046 213.837 1.00 146.31 ? 111  VAL A CG2   1 
ATOM   596   N  N     . THR A  1 112  ? 166.039 152.273 216.754 1.00 159.96 ? 112  THR A N     1 
ATOM   597   C  CA    . THR A  1 112  ? 165.445 152.686 218.019 1.00 162.21 ? 112  THR A CA    1 
ATOM   598   C  C     . THR A  1 112  ? 163.947 152.903 217.858 1.00 162.78 ? 112  THR A C     1 
ATOM   599   O  O     . THR A  1 112  ? 163.464 153.291 216.794 1.00 161.90 ? 112  THR A O     1 
ATOM   600   C  CB    . THR A  1 112  ? 166.103 153.966 218.536 1.00 159.95 ? 112  THR A CB    1 
ATOM   601   O  OG1   . THR A  1 112  ? 165.773 155.059 217.672 1.00 163.45 ? 112  THR A OG1   1 
ATOM   602   C  CG2   . THR A  1 112  ? 167.616 153.807 218.596 1.00 153.94 ? 112  THR A CG2   1 
ATOM   603   N  N     . SER A  1 113  ? 163.210 152.624 218.931 1.00 177.23 ? 113  SER A N     1 
ATOM   604   C  CA    . SER A  1 113  ? 161.767 152.841 218.990 1.00 173.49 ? 113  SER A CA    1 
ATOM   605   C  C     . SER A  1 113  ? 161.048 152.145 217.833 1.00 167.05 ? 113  SER A C     1 
ATOM   606   O  O     . SER A  1 113  ? 160.384 152.770 217.006 1.00 168.84 ? 113  SER A O     1 
ATOM   607   C  CB    . SER A  1 113  ? 161.440 154.336 219.012 1.00 171.62 ? 113  SER A CB    1 
ATOM   608   O  OG    . SER A  1 113  ? 160.038 154.547 218.983 1.00 179.70 ? 113  SER A OG    1 
ATOM   609   N  N     . ILE A  1 114  ? 161.200 150.825 217.785 1.00 168.24 ? 114  ILE A N     1 
ATOM   610   C  CA    . ILE A  1 114  ? 160.455 149.983 216.857 1.00 170.36 ? 114  ILE A CA    1 
ATOM   611   C  C     . ILE A  1 114  ? 159.666 148.975 217.683 1.00 175.41 ? 114  ILE A C     1 
ATOM   612   O  O     . ILE A  1 114  ? 160.210 148.356 218.607 1.00 176.55 ? 114  ILE A O     1 
ATOM   613   C  CB    . ILE A  1 114  ? 161.382 149.304 215.824 1.00 169.61 ? 114  ILE A CB    1 
ATOM   614   C  CG1   . ILE A  1 114  ? 160.582 148.880 214.594 1.00 161.28 ? 114  ILE A CG1   1 
ATOM   615   C  CG2   . ILE A  1 114  ? 162.155 148.129 216.416 1.00 179.74 ? 114  ILE A CG2   1 
ATOM   616   C  CD1   . ILE A  1 114  ? 160.052 150.047 213.798 1.00 163.28 ? 114  ILE A CD1   1 
ATOM   617   N  N     . HIS A  1 115  ? 158.370 148.868 217.405 1.00 197.89 ? 115  HIS A N     1 
ATOM   618   C  CA    . HIS A  1 115  ? 157.484 148.073 218.245 1.00 200.40 ? 115  HIS A CA    1 
ATOM   619   C  C     . HIS A  1 115  ? 156.757 146.971 217.495 1.00 197.75 ? 115  HIS A C     1 
ATOM   620   O  O     . HIS A  1 115  ? 156.738 145.826 217.958 1.00 209.51 ? 115  HIS A O     1 
ATOM   621   C  CB    . HIS A  1 115  ? 156.469 148.987 218.943 1.00 209.98 ? 115  HIS A CB    1 
ATOM   622   C  CG    . HIS A  1 115  ? 157.042 149.740 220.100 1.00 211.72 ? 115  HIS A CG    1 
ATOM   623   N  ND1   . HIS A  1 115  ? 157.538 149.112 221.220 1.00 206.37 ? 115  HIS A ND1   1 
ATOM   624   C  CD2   . HIS A  1 115  ? 157.203 151.069 220.309 1.00 217.29 ? 115  HIS A CD2   1 
ATOM   625   C  CE1   . HIS A  1 115  ? 157.981 150.021 222.073 1.00 212.96 ? 115  HIS A CE1   1 
ATOM   626   N  NE2   . HIS A  1 115  ? 157.788 151.215 221.543 1.00 224.37 ? 115  HIS A NE2   1 
ATOM   627   N  N     . SER A  1 116  ? 156.145 147.279 216.357 1.00 177.75 ? 116  SER A N     1 
ATOM   628   C  CA    . SER A  1 116  ? 155.318 146.303 215.667 1.00 180.75 ? 116  SER A CA    1 
ATOM   629   C  C     . SER A  1 116  ? 155.556 146.440 214.169 1.00 180.75 ? 116  SER A C     1 
ATOM   630   O  O     . SER A  1 116  ? 156.423 147.195 213.720 1.00 182.70 ? 116  SER A O     1 
ATOM   631   C  CB    . SER A  1 116  ? 153.840 146.484 216.041 1.00 191.57 ? 116  SER A CB    1 
ATOM   632   O  OG    . SER A  1 116  ? 153.020 145.552 215.357 1.00 200.90 ? 116  SER A OG    1 
ATOM   633   N  N     . PHE A  1 117  ? 154.776 145.689 213.392 1.00 150.03 ? 117  PHE A N     1 
ATOM   634   C  CA    . PHE A  1 117  ? 154.898 145.751 211.943 1.00 146.29 ? 117  PHE A CA    1 
ATOM   635   C  C     . PHE A  1 117  ? 154.472 147.108 211.403 1.00 141.84 ? 117  PHE A C     1 
ATOM   636   O  O     . PHE A  1 117  ? 154.978 147.546 210.365 1.00 144.00 ? 117  PHE A O     1 
ATOM   637   C  CB    . PHE A  1 117  ? 154.073 144.633 211.306 1.00 150.81 ? 117  PHE A CB    1 
ATOM   638   C  CG    . PHE A  1 117  ? 154.209 144.554 209.816 1.00 145.59 ? 117  PHE A CG    1 
ATOM   639   C  CD1   . PHE A  1 117  ? 155.318 143.961 209.239 1.00 145.36 ? 117  PHE A CD1   1 
ATOM   640   C  CD2   . PHE A  1 117  ? 153.224 145.064 208.990 1.00 147.92 ? 117  PHE A CD2   1 
ATOM   641   C  CE1   . PHE A  1 117  ? 155.446 143.884 207.866 1.00 147.48 ? 117  PHE A CE1   1 
ATOM   642   C  CE2   . PHE A  1 117  ? 153.344 144.991 207.617 1.00 152.19 ? 117  PHE A CE2   1 
ATOM   643   C  CZ    . PHE A  1 117  ? 154.457 144.399 207.053 1.00 149.61 ? 117  PHE A CZ    1 
ATOM   644   N  N     . SER A  1 118  ? 153.551 147.789 212.087 1.00 149.75 ? 118  SER A N     1 
ATOM   645   C  CA    . SER A  1 118  ? 153.104 149.100 211.624 1.00 151.75 ? 118  SER A CA    1 
ATOM   646   C  C     . SER A  1 118  ? 154.237 150.117 211.687 1.00 152.09 ? 118  SER A C     1 
ATOM   647   O  O     . SER A  1 118  ? 154.495 150.837 210.713 1.00 155.53 ? 118  SER A O     1 
ATOM   648   C  CB    . SER A  1 118  ? 151.909 149.565 212.454 1.00 161.48 ? 118  SER A CB    1 
ATOM   649   O  OG    . SER A  1 118  ? 150.857 148.617 212.409 1.00 169.60 ? 118  SER A OG    1 
ATOM   650   N  N     . SER A  1 119  ? 154.928 150.191 212.826 1.00 172.12 ? 119  SER A N     1 
ATOM   651   C  CA    . SER A  1 119  ? 156.065 151.097 212.928 1.00 170.32 ? 119  SER A CA    1 
ATOM   652   C  C     . SER A  1 119  ? 157.194 150.674 212.000 1.00 171.13 ? 119  SER A C     1 
ATOM   653   O  O     . SER A  1 119  ? 157.952 151.524 211.523 1.00 176.88 ? 119  SER A O     1 
ATOM   654   C  CB    . SER A  1 119  ? 156.556 151.171 214.372 1.00 169.70 ? 119  SER A CB    1 
ATOM   655   O  OG    . SER A  1 119  ? 157.507 152.208 214.531 1.00 165.80 ? 119  SER A OG    1 
ATOM   656   N  N     . ALA A  1 120  ? 157.310 149.377 211.711 1.00 159.21 ? 120  ALA A N     1 
ATOM   657   C  CA    . ALA A  1 120  ? 158.320 148.924 210.761 1.00 154.92 ? 120  ALA A CA    1 
ATOM   658   C  C     . ALA A  1 120  ? 158.016 149.430 209.356 1.00 159.48 ? 120  ALA A C     1 
ATOM   659   O  O     . ALA A  1 120  ? 158.911 149.910 208.651 1.00 161.79 ? 120  ALA A O     1 
ATOM   660   C  CB    . ALA A  1 120  ? 158.413 147.400 210.778 1.00 158.71 ? 120  ALA A CB    1 
ATOM   661   N  N     . PHE A  1 121  ? 156.755 149.329 208.927 1.00 131.22 ? 121  PHE A N     1 
ATOM   662   C  CA    . PHE A  1 121  ? 156.378 149.860 207.620 1.00 132.54 ? 121  PHE A CA    1 
ATOM   663   C  C     . PHE A  1 121  ? 156.533 151.374 207.583 1.00 132.82 ? 121  PHE A C     1 
ATOM   664   O  O     . PHE A  1 121  ? 156.903 151.947 206.549 1.00 134.04 ? 121  PHE A O     1 
ATOM   665   C  CB    . PHE A  1 121  ? 154.943 149.456 207.276 1.00 132.01 ? 121  PHE A CB    1 
ATOM   666   C  CG    . PHE A  1 121  ? 154.520 149.858 205.893 1.00 131.81 ? 121  PHE A CG    1 
ATOM   667   C  CD1   . PHE A  1 121  ? 153.928 151.086 205.660 1.00 133.89 ? 121  PHE A CD1   1 
ATOM   668   C  CD2   . PHE A  1 121  ? 154.717 149.006 204.820 1.00 131.00 ? 121  PHE A CD2   1 
ATOM   669   C  CE1   . PHE A  1 121  ? 153.544 151.457 204.388 1.00 141.83 ? 121  PHE A CE1   1 
ATOM   670   C  CE2   . PHE A  1 121  ? 154.336 149.370 203.542 1.00 133.13 ? 121  PHE A CE2   1 
ATOM   671   C  CZ    . PHE A  1 121  ? 153.747 150.597 203.327 1.00 136.11 ? 121  PHE A CZ    1 
ATOM   672   N  N     . LEU A  1 122  ? 156.249 152.041 208.703 1.00 134.36 ? 122  LEU A N     1 
ATOM   673   C  CA    . LEU A  1 122  ? 156.456 153.484 208.766 1.00 136.38 ? 122  LEU A CA    1 
ATOM   674   C  C     . LEU A  1 122  ? 157.932 153.833 208.607 1.00 142.26 ? 122  LEU A C     1 
ATOM   675   O  O     . LEU A  1 122  ? 158.277 154.782 207.899 1.00 146.90 ? 122  LEU A O     1 
ATOM   676   C  CB    . LEU A  1 122  ? 155.903 154.031 210.079 1.00 134.45 ? 122  LEU A CB    1 
ATOM   677   C  CG    . LEU A  1 122  ? 155.119 155.338 209.973 1.00 138.17 ? 122  LEU A CG    1 
ATOM   678   C  CD1   . LEU A  1 122  ? 154.445 155.648 211.295 1.00 148.07 ? 122  LEU A CD1   1 
ATOM   679   C  CD2   . LEU A  1 122  ? 156.030 156.477 209.549 1.00 141.55 ? 122  LEU A CD2   1 
ATOM   680   N  N     . PHE A  1 123  ? 158.818 153.066 209.246 1.00 133.61 ? 123  PHE A N     1 
ATOM   681   C  CA    . PHE A  1 123  ? 160.251 153.286 209.070 1.00 126.93 ? 123  PHE A CA    1 
ATOM   682   C  C     . PHE A  1 123  ? 160.674 153.020 207.633 1.00 127.21 ? 123  PHE A C     1 
ATOM   683   O  O     . PHE A  1 123  ? 161.532 153.726 207.086 1.00 135.44 ? 123  PHE A O     1 
ATOM   684   C  CB    . PHE A  1 123  ? 161.042 152.396 210.029 1.00 124.32 ? 123  PHE A CB    1 
ATOM   685   C  CG    . PHE A  1 123  ? 162.528 152.609 209.969 1.00 124.83 ? 123  PHE A CG    1 
ATOM   686   C  CD1   . PHE A  1 123  ? 163.312 151.896 209.079 1.00 126.96 ? 123  PHE A CD1   1 
ATOM   687   C  CD2   . PHE A  1 123  ? 163.141 153.520 210.809 1.00 134.51 ? 123  PHE A CD2   1 
ATOM   688   C  CE1   . PHE A  1 123  ? 164.676 152.094 209.026 1.00 125.30 ? 123  PHE A CE1   1 
ATOM   689   C  CE2   . PHE A  1 123  ? 164.505 153.721 210.763 1.00 139.16 ? 123  PHE A CE2   1 
ATOM   690   C  CZ    . PHE A  1 123  ? 165.275 153.007 209.870 1.00 133.68 ? 123  PHE A CZ    1 
ATOM   691   N  N     . SER A  1 124  ? 160.089 151.997 207.010 1.00 133.28 ? 124  SER A N     1 
ATOM   692   C  CA    . SER A  1 124  ? 160.429 151.680 205.626 1.00 127.15 ? 124  SER A CA    1 
ATOM   693   C  C     . SER A  1 124  ? 160.050 152.823 204.696 1.00 129.97 ? 124  SER A C     1 
ATOM   694   O  O     . SER A  1 124  ? 160.838 153.225 203.833 1.00 137.71 ? 124  SER A O     1 
ATOM   695   C  CB    . SER A  1 124  ? 159.740 150.389 205.196 1.00 140.10 ? 124  SER A CB    1 
ATOM   696   O  OG    . SER A  1 124  ? 159.926 150.160 203.811 1.00 128.30 ? 124  SER A OG    1 
ATOM   697   N  N     . ILE A  1 125  ? 158.838 153.362 204.853 1.00 115.86 ? 125  ILE A N     1 
ATOM   698   C  CA    . ILE A  1 125  ? 158.428 154.473 204.003 1.00 113.21 ? 125  ILE A CA    1 
ATOM   699   C  C     . ILE A  1 125  ? 159.141 155.764 204.394 1.00 108.53 ? 125  ILE A C     1 
ATOM   700   O  O     . ILE A  1 125  ? 159.246 156.683 203.573 1.00 104.68 ? 125  ILE A O     1 
ATOM   701   C  CB    . ILE A  1 125  ? 156.897 154.647 204.037 1.00 116.14 ? 125  ILE A CB    1 
ATOM   702   C  CG1   . ILE A  1 125  ? 156.429 155.474 202.836 1.00 107.16 ? 125  ILE A CG1   1 
ATOM   703   C  CG2   . ILE A  1 125  ? 156.452 155.302 205.331 1.00 119.50 ? 125  ILE A CG2   1 
ATOM   704   C  CD1   . ILE A  1 125  ? 156.838 154.894 201.500 1.00 114.08 ? 125  ILE A CD1   1 
ATOM   705   N  N     . GLU A  1 126  ? 159.656 155.852 205.622 1.00 133.48 ? 126  GLU A N     1 
ATOM   706   C  CA    . GLU A  1 126  ? 160.401 157.036 206.036 1.00 130.57 ? 126  GLU A CA    1 
ATOM   707   C  C     . GLU A  1 126  ? 161.801 157.054 205.440 1.00 122.57 ? 126  GLU A C     1 
ATOM   708   O  O     . GLU A  1 126  ? 162.318 158.123 205.101 1.00 122.77 ? 126  GLU A O     1 
ATOM   709   C  CB    . GLU A  1 126  ? 160.473 157.106 207.562 1.00 131.31 ? 126  GLU A CB    1 
ATOM   710   N  N     . VAL A  1 127  ? 162.430 155.890 205.311 1.00 133.37 ? 127  VAL A N     1 
ATOM   711   C  CA    . VAL A  1 127  ? 163.782 155.848 204.768 1.00 127.80 ? 127  VAL A CA    1 
ATOM   712   C  C     . VAL A  1 127  ? 163.788 155.685 203.249 1.00 126.23 ? 127  VAL A C     1 
ATOM   713   O  O     . VAL A  1 127  ? 164.735 156.119 202.587 1.00 135.24 ? 127  VAL A O     1 
ATOM   714   C  CB    . VAL A  1 127  ? 164.602 154.736 205.443 1.00 129.15 ? 127  VAL A CB    1 
ATOM   715   C  CG1   . VAL A  1 127  ? 164.111 153.366 205.009 1.00 131.80 ? 127  VAL A CG1   1 
ATOM   716   C  CG2   . VAL A  1 127  ? 166.080 154.899 205.133 1.00 126.49 ? 127  VAL A CG2   1 
ATOM   717   N  N     . GLN A  1 128  ? 162.745 155.082 202.675 1.00 149.36 ? 128  GLN A N     1 
ATOM   718   C  CA    . GLN A  1 128  ? 162.757 154.796 201.244 1.00 136.13 ? 128  GLN A CA    1 
ATOM   719   C  C     . GLN A  1 128  ? 162.540 156.062 200.423 1.00 138.15 ? 128  GLN A C     1 
ATOM   720   O  O     . GLN A  1 128  ? 163.371 156.419 199.579 1.00 140.90 ? 128  GLN A O     1 
ATOM   721   C  CB    . GLN A  1 128  ? 161.697 153.744 200.913 1.00 137.91 ? 128  GLN A CB    1 
ATOM   722   C  CG    . GLN A  1 128  ? 161.236 153.745 199.460 1.00 133.95 ? 128  GLN A CG    1 
ATOM   723   C  CD    . GLN A  1 128  ? 162.306 153.291 198.488 1.00 133.72 ? 128  GLN A CD    1 
ATOM   724   O  OE1   . GLN A  1 128  ? 162.256 153.612 197.302 1.00 124.36 ? 128  GLN A OE1   1 
ATOM   725   N  NE2   . GLN A  1 128  ? 163.276 152.533 198.982 1.00 137.11 ? 128  GLN A NE2   1 
ATOM   726   N  N     . VAL A  1 129  ? 161.431 156.759 200.660 1.00 146.72 ? 129  VAL A N     1 
ATOM   727   C  CA    . VAL A  1 129  ? 161.054 157.887 199.815 1.00 139.86 ? 129  VAL A CA    1 
ATOM   728   C  C     . VAL A  1 129  ? 161.763 159.145 200.305 1.00 138.75 ? 129  VAL A C     1 
ATOM   729   O  O     . VAL A  1 129  ? 161.485 160.254 199.834 1.00 140.01 ? 129  VAL A O     1 
ATOM   730   C  CB    . VAL A  1 129  ? 159.525 158.062 199.785 1.00 137.58 ? 129  VAL A CB    1 
ATOM   731   C  CG1   . VAL A  1 129  ? 159.038 158.775 201.039 1.00 144.06 ? 129  VAL A CG1   1 
ATOM   732   C  CG2   . VAL A  1 129  ? 159.092 158.784 198.513 1.00 133.09 ? 129  VAL A CG2   1 
ATOM   733   N  N     . THR A  1 130  ? 162.688 158.971 201.250 1.00 166.24 ? 130  THR A N     1 
ATOM   734   C  CA    . THR A  1 130  ? 163.611 160.021 201.691 1.00 172.31 ? 130  THR A CA    1 
ATOM   735   C  C     . THR A  1 130  ? 162.876 161.207 202.316 1.00 174.93 ? 130  THR A C     1 
ATOM   736   O  O     . THR A  1 130  ? 163.062 162.362 201.925 1.00 171.62 ? 130  THR A O     1 
ATOM   737   C  CB    . THR A  1 130  ? 164.520 160.486 200.547 1.00 172.96 ? 130  THR A CB    1 
ATOM   738   O  OG1   . THR A  1 130  ? 163.766 161.274 199.619 1.00 182.27 ? 130  THR A OG1   1 
ATOM   739   C  CG2   . THR A  1 130  ? 165.133 159.292 199.822 1.00 172.66 ? 130  THR A CG2   1 
ATOM   740   N  N     . ILE A  1 131  ? 162.039 160.914 203.306 1.00 164.80 ? 131  ILE A N     1 
ATOM   741   C  CA    . ILE A  1 131  ? 161.482 161.942 204.171 1.00 158.97 ? 131  ILE A CA    1 
ATOM   742   C  C     . ILE A  1 131  ? 162.242 162.028 205.488 1.00 162.08 ? 131  ILE A C     1 
ATOM   743   O  O     . ILE A  1 131  ? 162.492 163.122 205.992 1.00 166.24 ? 131  ILE A O     1 
ATOM   744   C  CB    . ILE A  1 131  ? 159.974 161.704 204.406 1.00 160.74 ? 131  ILE A CB    1 
ATOM   745   C  CG1   . ILE A  1 131  ? 159.705 160.264 204.835 1.00 162.39 ? 131  ILE A CG1   1 
ATOM   746   C  CG2   . ILE A  1 131  ? 159.180 162.024 203.151 1.00 159.23 ? 131  ILE A CG2   1 
ATOM   747   C  CD1   . ILE A  1 131  ? 158.238 159.959 205.069 1.00 159.72 ? 131  ILE A CD1   1 
ATOM   748   N  N     . GLY A  1 132  ? 162.628 160.883 206.053 1.00 157.77 ? 132  GLY A N     1 
ATOM   749   C  CA    . GLY A  1 132  ? 163.489 160.847 207.223 1.00 160.47 ? 132  GLY A CA    1 
ATOM   750   C  C     . GLY A  1 132  ? 162.934 161.521 208.462 1.00 174.66 ? 132  GLY A C     1 
ATOM   751   O  O     . GLY A  1 132  ? 163.435 162.570 208.879 1.00 173.36 ? 132  GLY A O     1 
ATOM   752   N  N     . PHE A  1 133  ? 161.895 160.930 209.059 1.00 171.17 ? 133  PHE A N     1 
ATOM   753   C  CA    . PHE A  1 133  ? 161.282 161.529 210.242 1.00 164.10 ? 133  PHE A CA    1 
ATOM   754   C  C     . PHE A  1 133  ? 162.237 161.524 211.428 1.00 155.22 ? 133  PHE A C     1 
ATOM   755   O  O     . PHE A  1 133  ? 162.278 162.487 212.201 1.00 153.95 ? 133  PHE A O     1 
ATOM   756   C  CB    . PHE A  1 133  ? 159.988 160.798 210.590 1.00 157.73 ? 133  PHE A CB    1 
ATOM   757   C  CG    . PHE A  1 133  ? 158.757 161.468 210.060 1.00 151.87 ? 133  PHE A CG    1 
ATOM   758   C  CD1   . PHE A  1 133  ? 158.677 162.850 210.008 1.00 149.36 ? 133  PHE A CD1   1 
ATOM   759   C  CD2   . PHE A  1 133  ? 157.686 160.723 209.602 1.00 162.15 ? 133  PHE A CD2   1 
ATOM   760   C  CE1   . PHE A  1 133  ? 157.550 163.475 209.518 1.00 142.89 ? 133  PHE A CE1   1 
ATOM   761   C  CE2   . PHE A  1 133  ? 156.558 161.342 209.111 1.00 163.11 ? 133  PHE A CE2   1 
ATOM   762   C  CZ    . PHE A  1 133  ? 156.488 162.719 209.069 1.00 157.89 ? 133  PHE A CZ    1 
ATOM   763   N  N     . GLY A  1 134  ? 163.006 160.455 211.592 1.00 157.15 ? 134  GLY A N     1 
ATOM   764   C  CA    . GLY A  1 134  ? 163.981 160.402 212.659 1.00 173.57 ? 134  GLY A CA    1 
ATOM   765   C  C     . GLY A  1 134  ? 163.425 160.163 214.043 1.00 169.21 ? 134  GLY A C     1 
ATOM   766   O  O     . GLY A  1 134  ? 164.159 160.335 215.023 1.00 168.41 ? 134  GLY A O     1 
ATOM   767   N  N     . GLY A  1 135  ? 162.152 159.784 214.163 1.00 166.04 ? 135  GLY A N     1 
ATOM   768   C  CA    . GLY A  1 135  ? 161.655 159.338 215.453 1.00 159.15 ? 135  GLY A CA    1 
ATOM   769   C  C     . GLY A  1 135  ? 162.185 157.966 215.813 1.00 155.61 ? 135  GLY A C     1 
ATOM   770   O  O     . GLY A  1 135  ? 162.474 157.685 216.979 1.00 157.73 ? 135  GLY A O     1 
ATOM   771   N  N     . ARG A  1 136  ? 162.324 157.100 214.818 1.00 136.32 ? 136  ARG A N     1 
ATOM   772   C  CA    . ARG A  1 136  ? 162.954 155.798 214.971 1.00 140.00 ? 136  ARG A CA    1 
ATOM   773   C  C     . ARG A  1 136  ? 164.311 155.850 214.283 1.00 136.74 ? 136  ARG A C     1 
ATOM   774   O  O     . ARG A  1 136  ? 164.389 156.085 213.073 1.00 134.09 ? 136  ARG A O     1 
ATOM   775   C  CB    . ARG A  1 136  ? 162.071 154.697 214.388 1.00 136.57 ? 136  ARG A CB    1 
ATOM   776   C  CG    . ARG A  1 136  ? 161.286 155.125 213.168 1.00 132.77 ? 136  ARG A CG    1 
ATOM   777   C  CD    . ARG A  1 136  ? 160.019 154.303 213.022 1.00 137.44 ? 136  ARG A CD    1 
ATOM   778   N  NE    . ARG A  1 136  ? 158.927 154.841 213.826 1.00 134.40 ? 136  ARG A NE    1 
ATOM   779   C  CZ    . ARG A  1 136  ? 158.058 155.744 213.387 1.00 136.15 ? 136  ARG A CZ    1 
ATOM   780   N  NH1   . ARG A  1 136  ? 158.157 156.209 212.149 1.00 141.09 ? 136  ARG A NH1   1 
ATOM   781   N  NH2   . ARG A  1 136  ? 157.091 156.185 214.181 1.00 136.72 ? 136  ARG A NH2   1 
ATOM   782   N  N     . MET A  1 137  ? 165.372 155.643 215.057 1.00 168.42 ? 137  MET A N     1 
ATOM   783   C  CA    . MET A  1 137  ? 166.736 155.887 214.611 1.00 164.65 ? 137  MET A CA    1 
ATOM   784   C  C     . MET A  1 137  ? 167.474 154.569 214.435 1.00 164.21 ? 137  MET A C     1 
ATOM   785   O  O     . MET A  1 137  ? 167.509 153.746 215.355 1.00 164.71 ? 137  MET A O     1 
ATOM   786   C  CB    . MET A  1 137  ? 167.480 156.771 215.616 1.00 174.14 ? 137  MET A CB    1 
ATOM   787   C  CG    . MET A  1 137  ? 168.775 157.352 215.095 1.00 169.97 ? 137  MET A CG    1 
ATOM   788   S  SD    . MET A  1 137  ? 168.469 158.436 213.695 1.00 162.48 ? 137  MET A SD    1 
ATOM   789   C  CE    . MET A  1 137  ? 167.121 159.432 214.328 1.00 161.42 ? 137  MET A CE    1 
ATOM   790   N  N     . VAL A  1 138  ? 168.061 154.373 213.259 1.00 134.94 ? 138  VAL A N     1 
ATOM   791   C  CA    . VAL A  1 138  ? 168.973 153.259 213.044 1.00 136.15 ? 138  VAL A CA    1 
ATOM   792   C  C     . VAL A  1 138  ? 170.300 153.592 213.714 1.00 139.89 ? 138  VAL A C     1 
ATOM   793   O  O     . VAL A  1 138  ? 170.800 154.719 213.607 1.00 135.50 ? 138  VAL A O     1 
ATOM   794   C  CB    . VAL A  1 138  ? 169.140 152.970 211.541 1.00 133.03 ? 138  VAL A CB    1 
ATOM   795   C  CG1   . VAL A  1 138  ? 169.448 154.243 210.777 1.00 134.07 ? 138  VAL A CG1   1 
ATOM   796   C  CG2   . VAL A  1 138  ? 170.219 151.923 211.305 1.00 143.28 ? 138  VAL A CG2   1 
ATOM   797   N  N     . THR A  1 139  ? 170.862 152.624 214.431 1.00 158.75 ? 139  THR A N     1 
ATOM   798   C  CA    . THR A  1 139  ? 172.023 152.854 215.275 1.00 158.67 ? 139  THR A CA    1 
ATOM   799   C  C     . THR A  1 139  ? 173.267 152.215 214.669 1.00 163.92 ? 139  THR A C     1 
ATOM   800   O  O     . THR A  1 139  ? 173.200 151.420 213.728 1.00 165.26 ? 139  THR A O     1 
ATOM   801   C  CB    . THR A  1 139  ? 171.780 152.308 216.688 1.00 157.06 ? 139  THR A CB    1 
ATOM   802   O  OG1   . THR A  1 139  ? 172.810 152.773 217.569 1.00 160.37 ? 139  THR A OG1   1 
ATOM   803   C  CG2   . THR A  1 139  ? 171.782 150.789 216.678 1.00 162.18 ? 139  THR A CG2   1 
ATOM   804   N  N     . GLU A  1 140  ? 174.419 152.582 215.235 1.00 168.23 ? 140  GLU A N     1 
ATOM   805   C  CA    . GLU A  1 140  ? 175.719 152.098 214.795 1.00 164.93 ? 140  GLU A CA    1 
ATOM   806   C  C     . GLU A  1 140  ? 176.141 150.814 215.505 1.00 166.59 ? 140  GLU A C     1 
ATOM   807   O  O     . GLU A  1 140  ? 177.342 150.544 215.616 1.00 171.23 ? 140  GLU A O     1 
ATOM   808   C  CB    . GLU A  1 140  ? 176.781 153.181 215.003 1.00 163.28 ? 140  GLU A CB    1 
ATOM   809   N  N     . GLU A  1 141  ? 175.184 150.033 215.999 1.00 200.20 ? 141  GLU A N     1 
ATOM   810   C  CA    . GLU A  1 141  ? 175.493 148.778 216.667 1.00 201.19 ? 141  GLU A CA    1 
ATOM   811   C  C     . GLU A  1 141  ? 175.433 147.581 215.728 1.00 205.27 ? 141  GLU A C     1 
ATOM   812   O  O     . GLU A  1 141  ? 176.198 146.625 215.904 1.00 207.54 ? 141  GLU A O     1 
ATOM   813   C  CB    . GLU A  1 141  ? 174.530 148.558 217.838 1.00 201.71 ? 141  GLU A CB    1 
ATOM   814   C  CG    . GLU A  1 141  ? 174.810 147.309 218.657 1.00 203.42 ? 141  GLU A CG    1 
ATOM   815   C  CD    . GLU A  1 141  ? 173.542 146.687 219.207 1.00 206.69 ? 141  GLU A CD    1 
ATOM   816   O  OE1   . GLU A  1 141  ? 172.456 146.993 218.675 1.00 204.66 ? 141  GLU A OE1   1 
ATOM   817   O  OE2   . GLU A  1 141  ? 173.633 145.894 220.167 1.00 221.61 ? 141  GLU A OE2   1 
ATOM   818   N  N     . CYS A  1 142  ? 174.558 147.618 214.730 1.00 197.19 ? 142  CYS A N     1 
ATOM   819   C  CA    . CYS A  1 142  ? 174.326 146.478 213.843 1.00 188.71 ? 142  CYS A CA    1 
ATOM   820   C  C     . CYS A  1 142  ? 174.720 146.833 212.419 1.00 184.81 ? 142  CYS A C     1 
ATOM   821   O  O     . CYS A  1 142  ? 174.031 147.651 211.778 1.00 183.25 ? 142  CYS A O     1 
ATOM   822   C  CB    . CYS A  1 142  ? 172.858 146.055 213.899 1.00 189.25 ? 142  CYS A CB    1 
ATOM   823   S  SG    . CYS A  1 142  ? 172.096 146.260 215.527 1.00 212.38 ? 142  CYS A SG    1 
ATOM   824   N  N     . PRO A  1 143  ? 175.806 146.271 211.879 1.00 191.57 ? 143  PRO A N     1 
ATOM   825   C  CA    . PRO A  1 143  ? 176.157 146.555 210.475 1.00 189.72 ? 143  PRO A CA    1 
ATOM   826   C  C     . PRO A  1 143  ? 175.185 145.961 209.467 1.00 185.89 ? 143  PRO A C     1 
ATOM   827   O  O     . PRO A  1 143  ? 175.166 146.405 208.308 1.00 186.84 ? 143  PRO A O     1 
ATOM   828   C  CB    . PRO A  1 143  ? 177.555 145.936 210.329 1.00 190.78 ? 143  PRO A CB    1 
ATOM   829   C  CG    . PRO A  1 143  ? 178.074 145.816 211.733 1.00 193.06 ? 143  PRO A CG    1 
ATOM   830   C  CD    . PRO A  1 143  ? 176.868 145.526 212.572 1.00 193.11 ? 143  PRO A CD    1 
ATOM   831   N  N     . LEU A  1 144  ? 174.377 144.975 209.863 1.00 167.11 ? 144  LEU A N     1 
ATOM   832   C  CA    . LEU A  1 144  ? 173.418 144.392 208.931 1.00 160.98 ? 144  LEU A CA    1 
ATOM   833   C  C     . LEU A  1 144  ? 172.337 145.400 208.551 1.00 160.11 ? 144  LEU A C     1 
ATOM   834   O  O     . LEU A  1 144  ? 171.912 145.458 207.388 1.00 159.43 ? 144  LEU A O     1 
ATOM   835   C  CB    . LEU A  1 144  ? 172.803 143.136 209.543 1.00 159.43 ? 144  LEU A CB    1 
ATOM   836   C  CG    . LEU A  1 144  ? 171.983 142.267 208.594 1.00 174.71 ? 144  LEU A CG    1 
ATOM   837   C  CD1   . LEU A  1 144  ? 172.800 141.909 207.365 1.00 170.95 ? 144  LEU A CD1   1 
ATOM   838   C  CD2   . LEU A  1 144  ? 171.516 141.014 209.314 1.00 189.38 ? 144  LEU A CD2   1 
ATOM   839   N  N     . ALA A  1 145  ? 171.882 146.202 209.517 1.00 184.71 ? 145  ALA A N     1 
ATOM   840   C  CA    . ALA A  1 145  ? 170.958 147.285 209.201 1.00 181.73 ? 145  ALA A CA    1 
ATOM   841   C  C     . ALA A  1 145  ? 171.610 148.306 208.276 1.00 179.89 ? 145  ALA A C     1 
ATOM   842   O  O     . ALA A  1 145  ? 170.950 148.863 207.390 1.00 179.55 ? 145  ALA A O     1 
ATOM   843   C  CB    . ALA A  1 145  ? 170.471 147.957 210.484 1.00 181.52 ? 145  ALA A CB    1 
ATOM   844   N  N     . ILE A  1 146  ? 172.907 148.554 208.459 1.00 164.99 ? 146  ILE A N     1 
ATOM   845   C  CA    . ILE A  1 146  ? 173.626 149.452 207.560 1.00 162.43 ? 146  ILE A CA    1 
ATOM   846   C  C     . ILE A  1 146  ? 173.593 148.915 206.134 1.00 159.41 ? 146  ILE A C     1 
ATOM   847   O  O     . ILE A  1 146  ? 173.359 149.665 205.178 1.00 157.87 ? 146  ILE A O     1 
ATOM   848   C  CB    . ILE A  1 146  ? 175.070 149.660 208.053 1.00 164.70 ? 146  ILE A CB    1 
ATOM   849   C  CG1   . ILE A  1 146  ? 175.085 150.036 209.538 1.00 174.95 ? 146  ILE A CG1   1 
ATOM   850   C  CG2   . ILE A  1 146  ? 175.767 150.722 207.220 1.00 162.22 ? 146  ILE A CG2   1 
ATOM   851   C  CD1   . ILE A  1 146  ? 174.346 151.315 209.859 1.00 175.70 ? 146  ILE A CD1   1 
ATOM   852   N  N     . LEU A  1 147  ? 173.811 147.607 205.969 1.00 159.70 ? 147  LEU A N     1 
ATOM   853   C  CA    . LEU A  1 147  ? 173.782 147.022 204.628 1.00 156.24 ? 147  LEU A CA    1 
ATOM   854   C  C     . LEU A  1 147  ? 172.386 147.091 204.014 1.00 154.34 ? 147  LEU A C     1 
ATOM   855   O  O     . LEU A  1 147  ? 172.237 147.411 202.824 1.00 156.08 ? 147  LEU A O     1 
ATOM   856   C  CB    . LEU A  1 147  ? 174.270 145.574 204.671 1.00 157.12 ? 147  LEU A CB    1 
ATOM   857   C  CG    . LEU A  1 147  ? 174.067 144.764 203.388 1.00 152.87 ? 147  LEU A CG    1 
ATOM   858   C  CD1   . LEU A  1 147  ? 174.809 145.387 202.213 1.00 149.26 ? 147  LEU A CD1   1 
ATOM   859   C  CD2   . LEU A  1 147  ? 174.497 143.322 203.591 1.00 160.46 ? 147  LEU A CD2   1 
ATOM   860   N  N     . ILE A  1 148  ? 171.352 146.777 204.800 1.00 151.83 ? 148  ILE A N     1 
ATOM   861   C  CA    . ILE A  1 148  ? 170.001 146.801 204.246 1.00 150.46 ? 148  ILE A CA    1 
ATOM   862   C  C     . ILE A  1 148  ? 169.610 148.221 203.857 1.00 152.13 ? 148  ILE A C     1 
ATOM   863   O  O     . ILE A  1 148  ? 168.935 148.431 202.842 1.00 154.67 ? 148  ILE A O     1 
ATOM   864   C  CB    . ILE A  1 148  ? 168.985 146.165 205.218 1.00 149.79 ? 148  ILE A CB    1 
ATOM   865   C  CG1   . ILE A  1 148  ? 167.687 145.853 204.479 1.00 152.63 ? 148  ILE A CG1   1 
ATOM   866   C  CG2   . ILE A  1 148  ? 168.673 147.075 206.385 1.00 161.89 ? 148  ILE A CG2   1 
ATOM   867   C  CD1   . ILE A  1 148  ? 167.880 144.980 203.270 1.00 145.74 ? 148  ILE A CD1   1 
ATOM   868   N  N     . LEU A  1 149  ? 170.070 149.220 204.615 1.00 131.28 ? 149  LEU A N     1 
ATOM   869   C  CA    . LEU A  1 149  ? 169.814 150.606 204.242 1.00 130.39 ? 149  LEU A CA    1 
ATOM   870   C  C     . LEU A  1 149  ? 170.578 150.985 202.977 1.00 128.42 ? 149  LEU A C     1 
ATOM   871   O  O     . LEU A  1 149  ? 170.037 151.674 202.098 1.00 131.61 ? 149  LEU A O     1 
ATOM   872   C  CB    . LEU A  1 149  ? 170.186 151.525 205.405 1.00 125.86 ? 149  LEU A CB    1 
ATOM   873   C  CG    . LEU A  1 149  ? 169.738 152.985 205.379 1.00 117.50 ? 149  LEU A CG    1 
ATOM   874   C  CD1   . LEU A  1 149  ? 169.543 153.485 206.799 1.00 126.61 ? 149  LEU A CD1   1 
ATOM   875   C  CD2   . LEU A  1 149  ? 170.751 153.853 204.653 1.00 117.29 ? 149  LEU A CD2   1 
ATOM   876   N  N     . ILE A  1 150  ? 171.834 150.541 202.865 1.00 143.87 ? 150  ILE A N     1 
ATOM   877   C  CA    . ILE A  1 150  ? 172.662 150.922 201.726 1.00 139.48 ? 150  ILE A CA    1 
ATOM   878   C  C     . ILE A  1 150  ? 172.200 150.256 200.436 1.00 140.18 ? 150  ILE A C     1 
ATOM   879   O  O     . ILE A  1 150  ? 172.529 150.739 199.348 1.00 135.50 ? 150  ILE A O     1 
ATOM   880   C  CB    . ILE A  1 150  ? 174.145 150.605 202.006 1.00 143.17 ? 150  ILE A CB    1 
ATOM   881   C  CG1   . ILE A  1 150  ? 175.044 151.653 201.348 1.00 143.95 ? 150  ILE A CG1   1 
ATOM   882   C  CG2   . ILE A  1 150  ? 174.517 149.217 201.507 1.00 149.91 ? 150  ILE A CG2   1 
ATOM   883   C  CD1   . ILE A  1 150  ? 174.881 153.042 201.923 1.00 145.26 ? 150  ILE A CD1   1 
ATOM   884   N  N     . VAL A  1 151  ? 171.458 149.153 200.520 1.00 143.43 ? 151  VAL A N     1 
ATOM   885   C  CA    . VAL A  1 151  ? 170.862 148.592 199.307 1.00 143.43 ? 151  VAL A CA    1 
ATOM   886   C  C     . VAL A  1 151  ? 169.471 149.169 199.055 1.00 144.19 ? 151  VAL A C     1 
ATOM   887   O  O     . VAL A  1 151  ? 169.080 149.386 197.900 1.00 147.76 ? 151  VAL A O     1 
ATOM   888   C  CB    . VAL A  1 151  ? 170.836 147.051 199.367 1.00 143.59 ? 151  VAL A CB    1 
ATOM   889   C  CG1   . VAL A  1 151  ? 169.951 146.559 200.497 1.00 146.68 ? 151  VAL A CG1   1 
ATOM   890   C  CG2   . VAL A  1 151  ? 170.375 146.476 198.035 1.00 137.53 ? 151  VAL A CG2   1 
ATOM   891   N  N     . GLN A  1 152  ? 168.723 149.443 200.128 1.00 132.31 ? 152  GLN A N     1 
ATOM   892   C  CA    . GLN A  1 152  ? 167.413 150.067 200.000 1.00 132.68 ? 152  GLN A CA    1 
ATOM   893   C  C     . GLN A  1 152  ? 167.508 151.395 199.266 1.00 127.03 ? 152  GLN A C     1 
ATOM   894   O  O     . GLN A  1 152  ? 166.736 151.662 198.336 1.00 127.13 ? 152  GLN A O     1 
ATOM   895   C  CB    . GLN A  1 152  ? 166.809 150.260 201.391 1.00 133.30 ? 152  GLN A CB    1 
ATOM   896   C  CG    . GLN A  1 152  ? 165.739 151.327 201.482 1.00 135.40 ? 152  GLN A CG    1 
ATOM   897   C  CD    . GLN A  1 152  ? 164.352 150.773 201.267 1.00 136.46 ? 152  GLN A CD    1 
ATOM   898   O  OE1   . GLN A  1 152  ? 163.966 150.461 200.142 1.00 144.19 ? 152  GLN A OE1   1 
ATOM   899   N  NE2   . GLN A  1 152  ? 163.592 150.644 202.347 1.00 146.95 ? 152  GLN A NE2   1 
ATOM   900   N  N     . ASN A  1 153  ? 168.467 152.235 199.658 1.00 135.65 ? 153  ASN A N     1 
ATOM   901   C  CA    . ASN A  1 153  ? 168.533 153.569 199.071 1.00 139.65 ? 153  ASN A CA    1 
ATOM   902   C  C     . ASN A  1 153  ? 168.899 153.520 197.590 1.00 151.27 ? 153  ASN A C     1 
ATOM   903   O  O     . ASN A  1 153  ? 168.305 154.242 196.781 1.00 159.76 ? 153  ASN A O     1 
ATOM   904   C  CB    . ASN A  1 153  ? 169.518 154.437 199.846 1.00 140.14 ? 153  ASN A CB    1 
ATOM   905   C  CG    . ASN A  1 153  ? 168.827 155.561 200.582 1.00 140.41 ? 153  ASN A CG    1 
ATOM   906   O  OD1   . ASN A  1 153  ? 167.852 156.128 200.090 1.00 138.60 ? 153  ASN A OD1   1 
ATOM   907   N  ND2   . ASN A  1 153  ? 169.316 155.880 201.772 1.00 144.83 ? 153  ASN A ND2   1 
ATOM   908   N  N     . ILE A  1 154  ? 169.853 152.669 197.209 1.00 146.13 ? 154  ILE A N     1 
ATOM   909   C  CA    . ILE A  1 154  ? 170.264 152.626 195.807 1.00 137.54 ? 154  ILE A CA    1 
ATOM   910   C  C     . ILE A  1 154  ? 169.161 152.031 194.936 1.00 143.10 ? 154  ILE A C     1 
ATOM   911   O  O     . ILE A  1 154  ? 168.906 152.520 193.827 1.00 155.72 ? 154  ILE A O     1 
ATOM   912   C  CB    . ILE A  1 154  ? 171.599 151.871 195.646 1.00 134.47 ? 154  ILE A CB    1 
ATOM   913   C  CG1   . ILE A  1 154  ? 171.997 151.800 194.170 1.00 134.30 ? 154  ILE A CG1   1 
ATOM   914   C  CG2   . ILE A  1 154  ? 171.519 150.475 196.226 1.00 148.12 ? 154  ILE A CG2   1 
ATOM   915   C  CD1   . ILE A  1 154  ? 172.209 153.149 193.524 1.00 142.46 ? 154  ILE A CD1   1 
ATOM   916   N  N     . VAL A  1 155  ? 168.471 150.986 195.413 1.00 155.28 ? 155  VAL A N     1 
ATOM   917   C  CA    . VAL A  1 155  ? 167.393 150.437 194.594 1.00 152.92 ? 155  VAL A CA    1 
ATOM   918   C  C     . VAL A  1 155  ? 166.249 151.440 194.481 1.00 150.21 ? 155  VAL A C     1 
ATOM   919   O  O     . VAL A  1 155  ? 165.629 151.578 193.416 1.00 154.59 ? 155  VAL A O     1 
ATOM   920   C  CB    . VAL A  1 155  ? 166.920 149.073 195.137 1.00 154.73 ? 155  VAL A CB    1 
ATOM   921   C  CG1   . VAL A  1 155  ? 166.200 149.221 196.457 1.00 157.85 ? 155  VAL A CG1   1 
ATOM   922   C  CG2   . VAL A  1 155  ? 166.025 148.384 194.119 1.00 153.14 ? 155  VAL A CG2   1 
ATOM   923   N  N     . GLY A  1 156  ? 165.974 152.182 195.557 1.00 168.03 ? 156  GLY A N     1 
ATOM   924   C  CA    . GLY A  1 156  ? 164.952 153.210 195.484 1.00 168.86 ? 156  GLY A CA    1 
ATOM   925   C  C     . GLY A  1 156  ? 165.311 154.308 194.504 1.00 169.22 ? 156  GLY A C     1 
ATOM   926   O  O     . GLY A  1 156  ? 164.465 154.764 193.731 1.00 184.80 ? 156  GLY A O     1 
ATOM   927   N  N     . LEU A  1 157  ? 166.575 154.734 194.508 1.00 157.17 ? 157  LEU A N     1 
ATOM   928   C  CA    . LEU A  1 157  ? 166.999 155.773 193.580 1.00 160.32 ? 157  LEU A CA    1 
ATOM   929   C  C     . LEU A  1 157  ? 166.918 155.292 192.137 1.00 160.78 ? 157  LEU A C     1 
ATOM   930   O  O     . LEU A  1 157  ? 166.502 156.046 191.250 1.00 167.81 ? 157  LEU A O     1 
ATOM   931   C  CB    . LEU A  1 157  ? 168.415 156.232 193.922 1.00 160.45 ? 157  LEU A CB    1 
ATOM   932   C  CG    . LEU A  1 157  ? 168.782 157.634 193.437 1.00 159.46 ? 157  LEU A CG    1 
ATOM   933   C  CD1   . LEU A  1 157  ? 169.790 158.258 194.383 1.00 172.96 ? 157  LEU A CD1   1 
ATOM   934   C  CD2   . LEU A  1 157  ? 169.325 157.601 192.016 1.00 155.74 ? 157  LEU A CD2   1 
ATOM   935   N  N     . MET A  1 158  ? 167.289 154.036 191.881 1.00 164.41 ? 158  MET A N     1 
ATOM   936   C  CA    . MET A  1 158  ? 167.231 153.537 190.511 1.00 163.69 ? 158  MET A CA    1 
ATOM   937   C  C     . MET A  1 158  ? 165.788 153.430 190.023 1.00 164.70 ? 158  MET A C     1 
ATOM   938   O  O     . MET A  1 158  ? 165.479 153.824 188.887 1.00 162.51 ? 158  MET A O     1 
ATOM   939   C  CB    . MET A  1 158  ? 167.942 152.189 190.406 1.00 173.22 ? 158  MET A CB    1 
ATOM   940   C  CG    . MET A  1 158  ? 168.543 151.917 189.034 1.00 181.02 ? 158  MET A CG    1 
ATOM   941   S  SD    . MET A  1 158  ? 169.920 153.011 188.611 1.00 220.18 ? 158  MET A SD    1 
ATOM   942   C  CE    . MET A  1 158  ? 170.215 152.531 186.910 1.00 196.91 ? 158  MET A CE    1 
ATOM   943   N  N     . ILE A  1 159  ? 164.887 152.920 190.869 1.00 154.30 ? 159  ILE A N     1 
ATOM   944   C  CA    . ILE A  1 159  ? 163.497 152.798 190.437 1.00 153.45 ? 159  ILE A CA    1 
ATOM   945   C  C     . ILE A  1 159  ? 162.857 154.176 190.284 1.00 158.05 ? 159  ILE A C     1 
ATOM   946   O  O     . ILE A  1 159  ? 162.044 154.392 189.375 1.00 160.09 ? 159  ILE A O     1 
ATOM   947   C  CB    . ILE A  1 159  ? 162.699 151.888 191.393 1.00 152.19 ? 159  ILE A CB    1 
ATOM   948   C  CG1   . ILE A  1 159  ? 161.344 151.529 190.778 1.00 160.49 ? 159  ILE A CG1   1 
ATOM   949   C  CG2   . ILE A  1 159  ? 162.503 152.540 192.746 1.00 160.79 ? 159  ILE A CG2   1 
ATOM   950   C  CD1   . ILE A  1 159  ? 161.445 150.731 189.495 1.00 163.68 ? 159  ILE A CD1   1 
ATOM   951   N  N     . ASN A  1 160  ? 163.234 155.138 191.129 1.00 146.28 ? 160  ASN A N     1 
ATOM   952   C  CA    . ASN A  1 160  ? 162.738 156.500 190.970 1.00 144.35 ? 160  ASN A CA    1 
ATOM   953   C  C     . ASN A  1 160  ? 163.221 157.105 189.659 1.00 141.55 ? 160  ASN A C     1 
ATOM   954   O  O     . ASN A  1 160  ? 162.451 157.759 188.945 1.00 151.81 ? 160  ASN A O     1 
ATOM   955   C  CB    . ASN A  1 160  ? 163.187 157.344 192.163 1.00 143.40 ? 160  ASN A CB    1 
ATOM   956   C  CG    . ASN A  1 160  ? 162.518 158.700 192.212 1.00 148.26 ? 160  ASN A CG    1 
ATOM   957   O  OD1   . ASN A  1 160  ? 162.456 159.418 191.217 1.00 145.91 ? 160  ASN A OD1   1 
ATOM   958   N  ND2   . ASN A  1 160  ? 162.016 159.061 193.385 1.00 169.01 ? 160  ASN A ND2   1 
ATOM   959   N  N     . ALA A  1 161  ? 164.493 156.885 189.319 1.00 162.33 ? 161  ALA A N     1 
ATOM   960   C  CA    . ALA A  1 161  ? 165.037 157.446 188.089 1.00 164.46 ? 161  ALA A CA    1 
ATOM   961   C  C     . ALA A  1 161  ? 164.347 156.866 186.859 1.00 164.19 ? 161  ALA A C     1 
ATOM   962   O  O     . ALA A  1 161  ? 163.994 157.609 185.930 1.00 171.38 ? 161  ALA A O     1 
ATOM   963   C  CB    . ALA A  1 161  ? 166.545 157.206 188.029 1.00 178.31 ? 161  ALA A CB    1 
ATOM   964   N  N     . ILE A  1 162  ? 164.140 155.547 186.827 1.00 150.77 ? 162  ILE A N     1 
ATOM   965   C  CA    . ILE A  1 162  ? 163.461 154.968 185.668 1.00 151.60 ? 162  ILE A CA    1 
ATOM   966   C  C     . ILE A  1 162  ? 162.008 155.436 185.607 1.00 152.98 ? 162  ILE A C     1 
ATOM   967   O  O     . ILE A  1 162  ? 161.499 155.764 184.529 1.00 154.11 ? 162  ILE A O     1 
ATOM   968   C  CB    . ILE A  1 162  ? 163.579 153.429 185.652 1.00 153.14 ? 162  ILE A CB    1 
ATOM   969   C  CG1   . ILE A  1 162  ? 162.691 152.826 184.561 1.00 153.27 ? 162  ILE A CG1   1 
ATOM   970   C  CG2   . ILE A  1 162  ? 163.188 152.833 186.966 1.00 161.09 ? 162  ILE A CG2   1 
ATOM   971   C  CD1   . ILE A  1 162  ? 163.117 153.161 183.159 1.00 156.35 ? 162  ILE A CD1   1 
ATOM   972   N  N     . MET A  1 163  ? 161.323 155.511 186.758 1.00 157.12 ? 163  MET A N     1 
ATOM   973   C  CA    . MET A  1 163  ? 159.926 155.932 186.744 1.00 162.95 ? 163  MET A CA    1 
ATOM   974   C  C     . MET A  1 163  ? 159.752 157.423 186.488 1.00 155.18 ? 163  MET A C     1 
ATOM   975   O  O     . MET A  1 163  ? 158.625 157.861 186.246 1.00 156.24 ? 163  MET A O     1 
ATOM   976   C  CB    . MET A  1 163  ? 159.240 155.562 188.060 1.00 166.45 ? 163  MET A CB    1 
ATOM   977   C  CG    . MET A  1 163  ? 157.773 155.191 187.892 1.00 193.25 ? 163  MET A CG    1 
ATOM   978   S  SD    . MET A  1 163  ? 156.822 155.229 189.425 1.00 246.44 ? 163  MET A SD    1 
ATOM   979   C  CE    . MET A  1 163  ? 156.221 156.918 189.424 1.00 203.14 ? 163  MET A CE    1 
ATOM   980   N  N     . LEU A  1 164  ? 160.821 158.214 186.567 1.00 157.30 ? 164  LEU A N     1 
ATOM   981   C  CA    . LEU A  1 164  ? 160.732 159.603 186.131 1.00 164.39 ? 164  LEU A CA    1 
ATOM   982   C  C     . LEU A  1 164  ? 161.045 159.742 184.645 1.00 169.63 ? 164  LEU A C     1 
ATOM   983   O  O     . LEU A  1 164  ? 160.309 160.415 183.907 1.00 176.16 ? 164  LEU A O     1 
ATOM   984   C  CB    . LEU A  1 164  ? 161.676 160.485 186.956 1.00 167.97 ? 164  LEU A CB    1 
ATOM   985   C  CG    . LEU A  1 164  ? 161.688 161.981 186.634 1.00 161.76 ? 164  LEU A CG    1 
ATOM   986   C  CD1   . LEU A  1 164  ? 161.774 162.789 187.916 1.00 163.55 ? 164  LEU A CD1   1 
ATOM   987   C  CD2   . LEU A  1 164  ? 162.845 162.332 185.710 1.00 168.83 ? 164  LEU A CD2   1 
ATOM   988   N  N     . GLY A  1 165  ? 162.143 159.126 184.202 1.00 170.85 ? 165  GLY A N     1 
ATOM   989   C  CA    . GLY A  1 165  ? 162.479 159.171 182.790 1.00 163.18 ? 165  GLY A CA    1 
ATOM   990   C  C     . GLY A  1 165  ? 161.369 158.625 181.913 1.00 159.32 ? 165  GLY A C     1 
ATOM   991   O  O     . GLY A  1 165  ? 161.074 159.182 180.851 1.00 160.47 ? 165  GLY A O     1 
ATOM   992   N  N     . CYS A  1 166  ? 160.713 157.554 182.360 1.00 159.66 ? 166  CYS A N     1 
ATOM   993   C  CA    . CYS A  1 166  ? 159.678 156.941 181.539 1.00 162.76 ? 166  CYS A CA    1 
ATOM   994   C  C     . CYS A  1 166  ? 158.442 157.827 181.445 1.00 167.61 ? 166  CYS A C     1 
ATOM   995   O  O     . CYS A  1 166  ? 157.851 157.956 180.367 1.00 182.86 ? 166  CYS A O     1 
ATOM   996   C  CB    . CYS A  1 166  ? 159.316 155.570 182.100 1.00 167.07 ? 166  CYS A CB    1 
ATOM   997   S  SG    . CYS A  1 166  ? 158.187 155.616 183.498 1.00 211.00 ? 166  CYS A SG    1 
ATOM   998   N  N     . ILE A  1 167  ? 158.033 158.455 182.551 1.00 176.03 ? 167  ILE A N     1 
ATOM   999   C  CA    . ILE A  1 167  ? 156.856 159.315 182.463 1.00 178.44 ? 167  ILE A CA    1 
ATOM   1000  C  C     . ILE A  1 167  ? 157.162 160.559 181.642 1.00 174.98 ? 167  ILE A C     1 
ATOM   1001  O  O     . ILE A  1 167  ? 156.277 161.078 180.948 1.00 176.69 ? 167  ILE A O     1 
ATOM   1002  C  CB    . ILE A  1 167  ? 156.298 159.680 183.854 1.00 176.45 ? 167  ILE A CB    1 
ATOM   1003  C  CG1   . ILE A  1 167  ? 157.214 160.657 184.599 1.00 177.72 ? 167  ILE A CG1   1 
ATOM   1004  C  CG2   . ILE A  1 167  ? 156.032 158.435 184.668 1.00 171.83 ? 167  ILE A CG2   1 
ATOM   1005  C  CD1   . ILE A  1 167  ? 156.786 162.112 184.475 1.00 170.19 ? 167  ILE A CD1   1 
ATOM   1006  N  N     . PHE A  1 168  ? 158.398 161.069 181.694 1.00 161.68 ? 168  PHE A N     1 
ATOM   1007  C  CA    . PHE A  1 168  ? 158.699 162.203 180.826 1.00 159.07 ? 168  PHE A CA    1 
ATOM   1008  C  C     . PHE A  1 168  ? 158.697 161.781 179.363 1.00 161.77 ? 168  PHE A C     1 
ATOM   1009  O  O     . PHE A  1 168  ? 158.153 162.491 178.508 1.00 173.55 ? 168  PHE A O     1 
ATOM   1010  C  CB    . PHE A  1 168  ? 160.033 162.852 181.173 1.00 154.62 ? 168  PHE A CB    1 
ATOM   1011  C  CG    . PHE A  1 168  ? 160.523 163.768 180.091 1.00 157.60 ? 168  PHE A CG    1 
ATOM   1012  C  CD1   . PHE A  1 168  ? 159.779 164.875 179.718 1.00 160.05 ? 168  PHE A CD1   1 
ATOM   1013  C  CD2   . PHE A  1 168  ? 161.692 163.499 179.412 1.00 162.66 ? 168  PHE A CD2   1 
ATOM   1014  C  CE1   . PHE A  1 168  ? 160.208 165.710 178.702 1.00 167.08 ? 168  PHE A CE1   1 
ATOM   1015  C  CE2   . PHE A  1 168  ? 162.127 164.327 178.397 1.00 164.95 ? 168  PHE A CE2   1 
ATOM   1016  C  CZ    . PHE A  1 168  ? 161.381 165.431 178.038 1.00 168.09 ? 168  PHE A CZ    1 
ATOM   1017  N  N     . MET A  1 169  ? 159.268 160.619 179.066 1.00 155.06 ? 169  MET A N     1 
ATOM   1018  C  CA    . MET A  1 169  ? 159.319 160.151 177.686 1.00 152.57 ? 169  MET A CA    1 
ATOM   1019  C  C     . MET A  1 169  ? 157.916 159.946 177.123 1.00 154.70 ? 169  MET A C     1 
ATOM   1020  O  O     . MET A  1 169  ? 157.639 160.308 175.980 1.00 155.75 ? 169  MET A O     1 
ATOM   1021  C  CB    . MET A  1 169  ? 160.122 158.853 177.586 1.00 159.93 ? 169  MET A CB    1 
ATOM   1022  C  CG    . MET A  1 169  ? 160.254 158.314 176.171 1.00 166.41 ? 169  MET A CG    1 
ATOM   1023  S  SD    . MET A  1 169  ? 161.247 156.811 176.084 1.00 193.48 ? 169  MET A SD    1 
ATOM   1024  C  CE    . MET A  1 169  ? 162.814 157.403 176.717 1.00 161.68 ? 169  MET A CE    1 
ATOM   1025  N  N     . LYS A  1 170  ? 157.032 159.367 177.930 1.00 159.01 ? 170  LYS A N     1 
ATOM   1026  C  CA    . LYS A  1 170  ? 155.652 159.139 177.517 1.00 161.13 ? 170  LYS A CA    1 
ATOM   1027  C  C     . LYS A  1 170  ? 154.941 160.468 177.278 1.00 162.84 ? 170  LYS A C     1 
ATOM   1028  O  O     . LYS A  1 170  ? 154.172 160.620 176.330 1.00 169.87 ? 170  LYS A O     1 
ATOM   1029  C  CB    . LYS A  1 170  ? 154.903 158.323 178.572 1.00 157.13 ? 170  LYS A CB    1 
ATOM   1030  N  N     . THR A  1 171  ? 155.215 161.426 178.158 1.00 156.52 ? 171  THR A N     1 
ATOM   1031  C  CA    . THR A  1 171  ? 154.628 162.760 178.095 1.00 160.66 ? 171  THR A CA    1 
ATOM   1032  C  C     . THR A  1 171  ? 155.010 163.533 176.835 1.00 160.43 ? 171  THR A C     1 
ATOM   1033  O  O     . THR A  1 171  ? 154.193 164.265 176.276 1.00 165.78 ? 171  THR A O     1 
ATOM   1034  C  CB    . THR A  1 171  ? 154.996 163.597 179.337 1.00 159.87 ? 171  THR A CB    1 
ATOM   1035  O  OG1   . THR A  1 171  ? 154.647 164.968 179.112 1.00 164.98 ? 171  THR A OG1   1 
ATOM   1036  C  CG2   . THR A  1 171  ? 156.487 163.499 179.629 1.00 159.63 ? 171  THR A CG2   1 
ATOM   1037  N  N     . ALA A  1 172  ? 156.251 163.368 176.391 1.00 172.99 ? 172  ALA A N     1 
ATOM   1038  C  CA    . ALA A  1 172  ? 156.748 164.088 175.224 1.00 174.57 ? 172  ALA A CA    1 
ATOM   1039  C  C     . ALA A  1 172  ? 155.973 163.787 173.943 1.00 175.21 ? 172  ALA A C     1 
ATOM   1040  O  O     . ALA A  1 172  ? 155.706 164.696 173.157 1.00 175.99 ? 172  ALA A O     1 
ATOM   1041  C  CB    . ALA A  1 172  ? 158.231 163.806 175.024 1.00 179.88 ? 172  ALA A CB    1 
ATOM   1042  N  N     . GLN A  1 173  ? 155.610 162.528 173.724 1.00 193.38 ? 173  GLN A N     1 
ATOM   1043  C  CA    . GLN A  1 173  ? 154.871 162.187 172.523 1.00 190.95 ? 173  GLN A CA    1 
ATOM   1044  C  C     . GLN A  1 173  ? 153.556 162.960 172.465 1.00 193.06 ? 173  GLN A C     1 
ATOM   1045  O  O     . GLN A  1 173  ? 153.101 163.547 173.446 1.00 186.76 ? 173  GLN A O     1 
ATOM   1046  C  CB    . GLN A  1 173  ? 154.605 160.682 172.478 1.00 190.21 ? 173  GLN A CB    1 
ATOM   1047  C  CG    . GLN A  1 173  ? 153.401 160.273 173.307 1.00 190.08 ? 173  GLN A CG    1 
ATOM   1048  C  CD    . GLN A  1 173  ? 153.614 158.984 174.071 1.00 190.61 ? 173  GLN A CD    1 
ATOM   1049  O  OE1   . GLN A  1 173  ? 154.323 158.086 173.616 1.00 195.17 ? 173  GLN A OE1   1 
ATOM   1050  N  NE2   . GLN A  1 173  ? 153.005 158.890 175.248 1.00 181.10 ? 173  GLN A NE2   1 
ATOM   1051  N  N     . ALA A  1 174  ? 152.952 162.962 171.278 1.00 198.29 ? 174  ALA A N     1 
ATOM   1052  C  CA    . ALA A  1 174  ? 151.576 163.429 171.108 1.00 203.87 ? 174  ALA A CA    1 
ATOM   1053  C  C     . ALA A  1 174  ? 150.960 162.583 169.990 1.00 205.16 ? 174  ALA A C     1 
ATOM   1054  O  O     . ALA A  1 174  ? 151.143 162.866 168.803 1.00 197.81 ? 174  ALA A O     1 
ATOM   1055  C  CB    . ALA A  1 174  ? 151.505 164.918 170.804 1.00 204.57 ? 174  ALA A CB    1 
ATOM   1056  N  N     . HIS A  1 175  ? 150.259 161.520 170.396 1.00 211.22 ? 175  HIS A N     1 
ATOM   1057  C  CA    . HIS A  1 175  ? 149.465 160.721 169.468 1.00 213.66 ? 175  HIS A CA    1 
ATOM   1058  C  C     . HIS A  1 175  ? 148.163 161.425 169.102 1.00 216.40 ? 175  HIS A C     1 
ATOM   1059  O  O     . HIS A  1 175  ? 147.733 161.373 167.944 1.00 223.29 ? 175  HIS A O     1 
ATOM   1060  C  CB    . HIS A  1 175  ? 149.152 159.350 170.077 1.00 214.96 ? 175  HIS A CB    1 
ATOM   1061  C  CG    . HIS A  1 175  ? 150.294 158.383 170.040 1.00 215.77 ? 175  HIS A CG    1 
ATOM   1062  N  ND1   . HIS A  1 175  ? 151.425 158.534 170.813 1.00 222.03 ? 175  HIS A ND1   1 
ATOM   1063  C  CD2   . HIS A  1 175  ? 150.471 157.242 169.332 1.00 219.81 ? 175  HIS A CD2   1 
ATOM   1064  C  CE1   . HIS A  1 175  ? 152.253 157.533 170.576 1.00 219.24 ? 175  HIS A CE1   1 
ATOM   1065  N  NE2   . HIS A  1 175  ? 151.699 156.735 169.681 1.00 219.16 ? 175  HIS A NE2   1 
ATOM   1066  N  N     . ARG A  1 176  ? 147.516 162.065 170.087 1.00 257.42 ? 176  ARG A N     1 
ATOM   1067  C  CA    . ARG A  1 176  ? 146.277 162.800 169.838 1.00 259.49 ? 176  ARG A CA    1 
ATOM   1068  C  C     . ARG A  1 176  ? 146.449 163.811 168.711 1.00 255.95 ? 176  ARG A C     1 
ATOM   1069  O  O     . ARG A  1 176  ? 145.539 164.009 167.896 1.00 255.03 ? 176  ARG A O     1 
ATOM   1070  C  CB    . ARG A  1 176  ? 145.817 163.511 171.117 1.00 264.44 ? 176  ARG A CB    1 
ATOM   1071  C  CG    . ARG A  1 176  ? 145.474 162.596 172.286 1.00 269.72 ? 176  ARG A CG    1 
ATOM   1072  C  CD    . ARG A  1 176  ? 143.997 162.220 172.285 1.00 275.12 ? 176  ARG A CD    1 
ATOM   1073  N  NE    . ARG A  1 176  ? 143.610 161.529 173.515 1.00 283.22 ? 176  ARG A NE    1 
ATOM   1074  C  CZ    . ARG A  1 176  ? 142.384 161.078 173.773 1.00 281.93 ? 176  ARG A CZ    1 
ATOM   1075  N  NH1   . ARG A  1 176  ? 141.410 161.244 172.886 1.00 276.20 ? 176  ARG A NH1   1 
ATOM   1076  N  NH2   . ARG A  1 176  ? 142.127 160.463 174.924 1.00 281.60 ? 176  ARG A NH2   1 
ATOM   1077  N  N     . ARG A  1 177  ? 147.611 164.469 168.658 1.00 257.14 ? 177  ARG A N     1 
ATOM   1078  C  CA    . ARG A  1 177  ? 147.931 165.353 167.543 1.00 256.22 ? 177  ARG A CA    1 
ATOM   1079  C  C     . ARG A  1 177  ? 148.106 164.583 166.234 1.00 255.92 ? 177  ARG A C     1 
ATOM   1080  O  O     . ARG A  1 177  ? 147.943 165.168 165.155 1.00 259.85 ? 177  ARG A O     1 
ATOM   1081  C  CB    . ARG A  1 177  ? 149.203 166.162 167.857 1.00 251.83 ? 177  ARG A CB    1 
ATOM   1082  C  CG    . ARG A  1 177  ? 149.195 166.972 169.170 1.00 256.39 ? 177  ARG A CG    1 
ATOM   1083  C  CD    . ARG A  1 177  ? 148.140 168.072 169.177 1.00 254.60 ? 177  ARG A CD    1 
ATOM   1084  N  NE    . ARG A  1 177  ? 147.928 168.651 167.849 1.00 246.48 ? 177  ARG A NE    1 
ATOM   1085  C  CZ    . ARG A  1 177  ? 148.115 169.930 167.534 1.00 244.02 ? 177  ARG A CZ    1 
ATOM   1086  N  NH1   . ARG A  1 177  ? 148.516 170.798 168.455 1.00 254.70 ? 177  ARG A NH1   1 
ATOM   1087  N  NH2   . ARG A  1 177  ? 147.887 170.344 166.292 1.00 245.41 ? 177  ARG A NH2   1 
ATOM   1088  N  N     . ALA A  1 178  ? 148.411 163.282 166.307 1.00 227.68 ? 178  ALA A N     1 
ATOM   1089  C  CA    . ALA A  1 178  ? 148.795 162.525 165.121 1.00 230.23 ? 178  ALA A CA    1 
ATOM   1090  C  C     . ALA A  1 178  ? 147.591 162.004 164.344 1.00 232.83 ? 178  ALA A C     1 
ATOM   1091  O  O     . ALA A  1 178  ? 147.615 161.977 163.110 1.00 237.62 ? 178  ALA A O     1 
ATOM   1092  C  CB    . ALA A  1 178  ? 149.707 161.364 165.521 1.00 240.79 ? 178  ALA A CB    1 
ATOM   1093  N  N     . GLU A  1 179  ? 146.538 161.578 165.039 1.00 226.60 ? 179  GLU A N     1 
ATOM   1094  C  CA    . GLU A  1 179  ? 145.439 160.826 164.434 1.00 229.11 ? 179  GLU A CA    1 
ATOM   1095  C  C     . GLU A  1 179  ? 144.356 161.711 163.771 1.00 227.96 ? 179  GLU A C     1 
ATOM   1096  O  O     . GLU A  1 179  ? 143.254 161.203 163.512 1.00 224.73 ? 179  GLU A O     1 
ATOM   1097  C  CB    . GLU A  1 179  ? 144.801 159.921 165.495 1.00 231.27 ? 179  GLU A CB    1 
ATOM   1098  C  CG    . GLU A  1 179  ? 145.805 159.333 166.500 1.00 243.63 ? 179  GLU A CG    1 
ATOM   1099  C  CD    . GLU A  1 179  ? 145.207 159.093 167.889 1.00 244.78 ? 179  GLU A CD    1 
ATOM   1100  O  OE1   . GLU A  1 179  ? 144.011 159.393 168.095 1.00 247.67 ? 179  GLU A OE1   1 
ATOM   1101  O  OE2   . GLU A  1 179  ? 145.933 158.605 168.781 1.00 244.21 ? 179  GLU A OE2   1 
ATOM   1102  N  N     . THR A  1 180  ? 144.661 162.986 163.547 1.00 234.85 ? 180  THR A N     1 
ATOM   1103  C  CA    . THR A  1 180  ? 143.702 163.930 162.974 1.00 232.33 ? 180  THR A CA    1 
ATOM   1104  C  C     . THR A  1 180  ? 143.673 164.031 161.448 1.00 227.28 ? 180  THR A C     1 
ATOM   1105  O  O     . THR A  1 180  ? 142.842 164.753 160.897 1.00 231.86 ? 180  THR A O     1 
ATOM   1106  C  CB    . THR A  1 180  ? 143.905 165.345 163.551 1.00 230.32 ? 180  THR A CB    1 
ATOM   1107  O  OG1   . THR A  1 180  ? 145.227 165.806 163.242 1.00 224.56 ? 180  THR A OG1   1 
ATOM   1108  C  CG2   . THR A  1 180  ? 143.716 165.337 165.060 1.00 234.83 ? 180  THR A CG2   1 
ATOM   1109  N  N     . LEU A  1 181  ? 144.562 163.322 160.761 1.00 237.37 ? 181  LEU A N     1 
ATOM   1110  C  CA    . LEU A  1 181  ? 144.577 163.400 159.304 1.00 234.62 ? 181  LEU A CA    1 
ATOM   1111  C  C     . LEU A  1 181  ? 143.259 162.881 158.741 1.00 242.64 ? 181  LEU A C     1 
ATOM   1112  O  O     . LEU A  1 181  ? 142.765 161.834 159.160 1.00 247.24 ? 181  LEU A O     1 
ATOM   1113  C  CB    . LEU A  1 181  ? 145.748 162.597 158.735 1.00 230.95 ? 181  LEU A CB    1 
ATOM   1114  C  CG    . LEU A  1 181  ? 147.147 163.040 159.167 1.00 222.58 ? 181  LEU A CG    1 
ATOM   1115  C  CD1   . LEU A  1 181  ? 147.441 164.449 158.676 1.00 235.34 ? 181  LEU A CD1   1 
ATOM   1116  C  CD2   . LEU A  1 181  ? 147.296 162.952 160.678 1.00 222.71 ? 181  LEU A CD2   1 
ATOM   1117  N  N     . ILE A  1 182  ? 142.692 163.617 157.789 1.00 220.98 ? 182  ILE A N     1 
ATOM   1118  C  CA    . ILE A  1 182  ? 141.424 163.223 157.181 1.00 215.68 ? 182  ILE A CA    1 
ATOM   1119  C  C     . ILE A  1 182  ? 141.434 163.218 155.652 1.00 217.18 ? 182  ILE A C     1 
ATOM   1120  O  O     . ILE A  1 182  ? 141.902 164.163 155.017 1.00 225.01 ? 182  ILE A O     1 
ATOM   1121  C  CB    . ILE A  1 182  ? 140.257 164.096 157.689 1.00 217.61 ? 182  ILE A CB    1 
ATOM   1122  C  CG1   . ILE A  1 182  ? 140.600 165.583 157.571 1.00 217.08 ? 182  ILE A CG1   1 
ATOM   1123  C  CG2   . ILE A  1 182  ? 139.922 163.747 159.131 1.00 230.35 ? 182  ILE A CG2   1 
ATOM   1124  C  CD1   . ILE A  1 182  ? 140.465 166.140 156.171 1.00 218.82 ? 182  ILE A CD1   1 
ATOM   1125  N  N     . PHE A  1 183  ? 140.924 162.137 155.072 1.00 241.51 ? 183  PHE A N     1 
ATOM   1126  C  CA    . PHE A  1 183  ? 140.827 161.998 153.625 1.00 240.79 ? 183  PHE A CA    1 
ATOM   1127  C  C     . PHE A  1 183  ? 139.383 161.656 153.277 1.00 245.52 ? 183  PHE A C     1 
ATOM   1128  O  O     . PHE A  1 183  ? 138.794 160.770 153.897 1.00 259.51 ? 183  PHE A O     1 
ATOM   1129  C  CB    . PHE A  1 183  ? 141.768 160.904 153.122 1.00 238.18 ? 183  PHE A CB    1 
ATOM   1130  C  CG    . PHE A  1 183  ? 143.212 161.145 153.457 1.00 237.71 ? 183  PHE A CG    1 
ATOM   1131  C  CD1   . PHE A  1 183  ? 143.751 160.670 154.641 1.00 238.34 ? 183  PHE A CD1   1 
ATOM   1132  C  CD2   . PHE A  1 183  ? 144.030 161.847 152.588 1.00 238.32 ? 183  PHE A CD2   1 
ATOM   1133  C  CE1   . PHE A  1 183  ? 145.079 160.891 154.952 1.00 235.01 ? 183  PHE A CE1   1 
ATOM   1134  C  CE2   . PHE A  1 183  ? 145.359 162.071 152.893 1.00 232.21 ? 183  PHE A CE2   1 
ATOM   1135  C  CZ    . PHE A  1 183  ? 145.885 161.592 154.077 1.00 229.57 ? 183  PHE A CZ    1 
ATOM   1136  N  N     . SER A  1 184  ? 138.803 162.343 152.297 1.00 241.98 ? 184  SER A N     1 
ATOM   1137  C  CA    . SER A  1 184  ? 137.422 162.053 151.939 1.00 250.18 ? 184  SER A CA    1 
ATOM   1138  C  C     . SER A  1 184  ? 137.219 160.546 151.817 1.00 258.79 ? 184  SER A C     1 
ATOM   1139  O  O     . SER A  1 184  ? 138.139 159.801 151.470 1.00 265.52 ? 184  SER A O     1 
ATOM   1140  C  CB    . SER A  1 184  ? 137.039 162.757 150.637 1.00 258.06 ? 184  SER A CB    1 
ATOM   1141  O  OG    . SER A  1 184  ? 137.896 162.383 149.577 1.00 258.31 ? 184  SER A OG    1 
ATOM   1142  N  N     . LYS A  1 185  ? 135.997 160.098 152.125 1.00 274.39 ? 185  LYS A N     1 
ATOM   1143  C  CA    . LYS A  1 185  ? 135.737 158.661 152.209 1.00 266.67 ? 185  LYS A CA    1 
ATOM   1144  C  C     . LYS A  1 185  ? 135.920 157.978 150.861 1.00 259.18 ? 185  LYS A C     1 
ATOM   1145  O  O     . LYS A  1 185  ? 136.506 156.891 150.782 1.00 250.32 ? 185  LYS A O     1 
ATOM   1146  C  CB    . LYS A  1 185  ? 134.329 158.410 152.745 1.00 271.28 ? 185  LYS A CB    1 
ATOM   1147  C  CG    . LYS A  1 185  ? 133.982 156.937 152.860 1.00 273.03 ? 185  LYS A CG    1 
ATOM   1148  C  CD    . LYS A  1 185  ? 132.531 156.738 153.253 1.00 290.88 ? 185  LYS A CD    1 
ATOM   1149  C  CE    . LYS A  1 185  ? 132.206 155.263 153.395 1.00 301.84 ? 185  LYS A CE    1 
ATOM   1150  N  NZ    . LYS A  1 185  ? 130.784 155.035 153.767 1.00 310.64 ? 185  LYS A NZ    1 
ATOM   1151  N  N     . HIS A  1 186  ? 135.418 158.589 149.790 1.00 260.95 ? 186  HIS A N     1 
ATOM   1152  C  CA    . HIS A  1 186  ? 135.591 158.082 148.439 1.00 262.88 ? 186  HIS A CA    1 
ATOM   1153  C  C     . HIS A  1 186  ? 136.205 159.164 147.562 1.00 259.08 ? 186  HIS A C     1 
ATOM   1154  O  O     . HIS A  1 186  ? 135.915 160.352 147.718 1.00 265.47 ? 186  HIS A O     1 
ATOM   1155  C  CB    . HIS A  1 186  ? 134.257 157.602 147.841 1.00 270.75 ? 186  HIS A CB    1 
ATOM   1156  C  CG    . HIS A  1 186  ? 133.198 158.659 147.783 1.00 272.89 ? 186  HIS A CG    1 
ATOM   1157  N  ND1   . HIS A  1 186  ? 133.218 159.688 146.866 1.00 283.75 ? 186  HIS A ND1   1 
ATOM   1158  C  CD2   . HIS A  1 186  ? 132.075 158.837 148.521 1.00 270.86 ? 186  HIS A CD2   1 
ATOM   1159  C  CE1   . HIS A  1 186  ? 132.161 160.458 147.046 1.00 286.49 ? 186  HIS A CE1   1 
ATOM   1160  N  NE2   . HIS A  1 186  ? 131.450 159.965 148.044 1.00 279.80 ? 186  HIS A NE2   1 
ATOM   1161  N  N     . ALA A  1 187  ? 137.067 158.742 146.643 1.00 256.17 ? 187  ALA A N     1 
ATOM   1162  C  CA    . ALA A  1 187  ? 137.740 159.641 145.721 1.00 263.71 ? 187  ALA A CA    1 
ATOM   1163  C  C     . ALA A  1 187  ? 137.059 159.583 144.360 1.00 278.55 ? 187  ALA A C     1 
ATOM   1164  O  O     . ALA A  1 187  ? 136.441 158.576 144.002 1.00 285.55 ? 187  ALA A O     1 
ATOM   1165  C  CB    . ALA A  1 187  ? 139.219 159.280 145.587 1.00 275.55 ? 187  ALA A CB    1 
ATOM   1166  N  N     . VAL A  1 188  ? 137.167 160.672 143.601 1.00 263.59 ? 188  VAL A N     1 
ATOM   1167  C  CA    . VAL A  1 188  ? 136.460 160.788 142.333 1.00 267.63 ? 188  VAL A CA    1 
ATOM   1168  C  C     . VAL A  1 188  ? 137.472 160.945 141.204 1.00 263.59 ? 188  VAL A C     1 
ATOM   1169  O  O     . VAL A  1 188  ? 138.656 161.204 141.422 1.00 267.30 ? 188  VAL A O     1 
ATOM   1170  C  CB    . VAL A  1 188  ? 135.450 161.954 142.323 1.00 268.77 ? 188  VAL A CB    1 
ATOM   1171  C  CG1   . VAL A  1 188  ? 134.489 161.845 143.501 1.00 276.31 ? 188  VAL A CG1   1 
ATOM   1172  C  CG2   . VAL A  1 188  ? 136.178 163.287 142.340 1.00 269.62 ? 188  VAL A CG2   1 
ATOM   1173  N  N     . ILE A  1 189  ? 136.984 160.766 139.980 1.00 255.14 ? 189  ILE A N     1 
ATOM   1174  C  CA    . ILE A  1 189  ? 137.757 161.064 138.784 1.00 258.69 ? 189  ILE A CA    1 
ATOM   1175  C  C     . ILE A  1 189  ? 136.946 162.025 137.927 1.00 268.86 ? 189  ILE A C     1 
ATOM   1176  O  O     . ILE A  1 189  ? 135.712 161.990 137.914 1.00 277.09 ? 189  ILE A O     1 
ATOM   1177  C  CB    . ILE A  1 189  ? 138.138 159.788 137.995 1.00 258.17 ? 189  ILE A CB    1 
ATOM   1178  C  CG1   . ILE A  1 189  ? 136.922 159.188 137.289 1.00 276.89 ? 189  ILE A CG1   1 
ATOM   1179  C  CG2   . ILE A  1 189  ? 138.780 158.757 138.912 1.00 250.42 ? 189  ILE A CG2   1 
ATOM   1180  C  CD1   . ILE A  1 189  ? 136.908 159.441 135.795 1.00 290.73 ? 189  ILE A CD1   1 
ATOM   1181  N  N     . THR A  1 190  ? 137.652 162.902 137.219 1.00 258.20 ? 190  THR A N     1 
ATOM   1182  C  CA    . THR A  1 190  ? 137.007 163.921 136.397 1.00 260.95 ? 190  THR A CA    1 
ATOM   1183  C  C     . THR A  1 190  ? 137.830 164.108 135.125 1.00 264.25 ? 190  THR A C     1 
ATOM   1184  O  O     . THR A  1 190  ? 138.794 163.382 134.870 1.00 266.75 ? 190  THR A O     1 
ATOM   1185  C  CB    . THR A  1 190  ? 136.841 165.233 137.179 1.00 262.49 ? 190  THR A CB    1 
ATOM   1186  O  OG1   . THR A  1 190  ? 136.728 164.952 138.580 1.00 266.56 ? 190  THR A OG1   1 
ATOM   1187  C  CG2   . THR A  1 190  ? 135.586 165.973 136.728 1.00 263.33 ? 190  THR A CG2   1 
ATOM   1188  N  N     . LEU A  1 191  ? 137.439 165.089 134.316 1.00 265.81 ? 191  LEU A N     1 
ATOM   1189  C  CA    . LEU A  1 191  ? 138.125 165.425 133.073 1.00 266.84 ? 191  LEU A CA    1 
ATOM   1190  C  C     . LEU A  1 191  ? 138.615 166.861 133.183 1.00 266.98 ? 191  LEU A C     1 
ATOM   1191  O  O     . LEU A  1 191  ? 137.818 167.804 133.104 1.00 267.16 ? 191  LEU A O     1 
ATOM   1192  C  CB    . LEU A  1 191  ? 137.198 165.247 131.871 1.00 270.80 ? 191  LEU A CB    1 
ATOM   1193  C  CG    . LEU A  1 191  ? 137.771 165.600 130.500 1.00 268.81 ? 191  LEU A CG    1 
ATOM   1194  C  CD1   . LEU A  1 191  ? 138.889 164.642 130.125 1.00 264.27 ? 191  LEU A CD1   1 
ATOM   1195  C  CD2   . LEU A  1 191  ? 136.678 165.597 129.441 1.00 279.95 ? 191  LEU A CD2   1 
ATOM   1196  N  N     . ARG A  1 192  ? 139.920 167.031 133.371 1.00 261.86 ? 192  ARG A N     1 
ATOM   1197  C  CA    . ARG A  1 192  ? 140.530 168.345 133.506 1.00 260.23 ? 192  ARG A CA    1 
ATOM   1198  C  C     . ARG A  1 192  ? 141.547 168.536 132.391 1.00 264.72 ? 192  ARG A C     1 
ATOM   1199  O  O     . ARG A  1 192  ? 142.354 167.639 132.122 1.00 265.04 ? 192  ARG A O     1 
ATOM   1200  C  CB    . ARG A  1 192  ? 141.199 168.504 134.875 1.00 246.62 ? 192  ARG A CB    1 
ATOM   1201  N  N     . HIS A  1 193  ? 141.490 169.700 131.740 1.00 263.10 ? 193  HIS A N     1 
ATOM   1202  C  CA    . HIS A  1 193  ? 142.431 170.061 130.678 1.00 263.68 ? 193  HIS A CA    1 
ATOM   1203  C  C     . HIS A  1 193  ? 142.448 169.015 129.565 1.00 261.18 ? 193  HIS A C     1 
ATOM   1204  O  O     . HIS A  1 193  ? 143.489 168.731 128.969 1.00 261.78 ? 193  HIS A O     1 
ATOM   1205  C  CB    . HIS A  1 193  ? 143.837 170.280 131.242 1.00 262.83 ? 193  HIS A CB    1 
ATOM   1206  C  CG    . HIS A  1 193  ? 143.925 171.410 132.220 1.00 264.15 ? 193  HIS A CG    1 
ATOM   1207  N  ND1   . HIS A  1 193  ? 144.995 171.573 133.073 1.00 259.42 ? 193  HIS A ND1   1 
ATOM   1208  C  CD2   . HIS A  1 193  ? 143.079 172.436 132.477 1.00 265.92 ? 193  HIS A CD2   1 
ATOM   1209  C  CE1   . HIS A  1 193  ? 144.803 172.649 133.817 1.00 260.69 ? 193  HIS A CE1   1 
ATOM   1210  N  NE2   . HIS A  1 193  ? 143.648 173.190 133.475 1.00 260.90 ? 193  HIS A NE2   1 
ATOM   1211  N  N     . GLY A  1 194  ? 141.281 168.436 129.283 1.00 276.36 ? 194  GLY A N     1 
ATOM   1212  C  CA    . GLY A  1 194  ? 141.155 167.435 128.245 1.00 279.04 ? 194  GLY A CA    1 
ATOM   1213  C  C     . GLY A  1 194  ? 141.706 166.070 128.584 1.00 276.40 ? 194  GLY A C     1 
ATOM   1214  O  O     . GLY A  1 194  ? 141.708 165.189 127.714 1.00 275.26 ? 194  GLY A O     1 
ATOM   1215  N  N     . ARG A  1 195  ? 142.168 165.855 129.814 1.00 269.79 ? 195  ARG A N     1 
ATOM   1216  C  CA    . ARG A  1 195  ? 142.718 164.574 130.229 1.00 265.41 ? 195  ARG A CA    1 
ATOM   1217  C  C     . ARG A  1 195  ? 142.007 164.102 131.488 1.00 259.93 ? 195  ARG A C     1 
ATOM   1218  O  O     . ARG A  1 195  ? 141.563 164.910 132.307 1.00 264.55 ? 195  ARG A O     1 
ATOM   1219  C  CB    . ARG A  1 195  ? 144.230 164.666 130.490 1.00 284.01 ? 195  ARG A CB    1 
ATOM   1220  C  CG    . ARG A  1 195  ? 145.027 165.327 129.375 1.00 282.02 ? 195  ARG A CG    1 
ATOM   1221  C  CD    . ARG A  1 195  ? 144.881 164.576 128.063 1.00 264.60 ? 195  ARG A CD    1 
ATOM   1222  N  NE    . ARG A  1 195  ? 145.168 163.152 128.209 1.00 255.02 ? 195  ARG A NE    1 
ATOM   1223  C  CZ    . ARG A  1 195  ? 146.387 162.623 128.154 1.00 257.72 ? 195  ARG A CZ    1 
ATOM   1224  N  NH1   . ARG A  1 195  ? 147.444 163.401 127.960 1.00 242.99 ? 195  ARG A NH1   1 
ATOM   1225  N  NH2   . ARG A  1 195  ? 146.551 161.315 128.297 1.00 277.23 ? 195  ARG A NH2   1 
ATOM   1226  N  N     . LEU A  1 196  ? 141.901 162.785 131.638 1.00 267.84 ? 196  LEU A N     1 
ATOM   1227  C  CA    . LEU A  1 196  ? 141.289 162.225 132.836 1.00 272.27 ? 196  LEU A CA    1 
ATOM   1228  C  C     . LEU A  1 196  ? 142.186 162.459 134.048 1.00 277.67 ? 196  LEU A C     1 
ATOM   1229  O  O     . LEU A  1 196  ? 143.414 162.378 133.957 1.00 272.46 ? 196  LEU A O     1 
ATOM   1230  C  CB    . LEU A  1 196  ? 141.025 160.731 132.650 1.00 276.55 ? 196  LEU A CB    1 
ATOM   1231  C  CG    . LEU A  1 196  ? 139.953 160.370 131.622 1.00 279.81 ? 196  LEU A CG    1 
ATOM   1232  C  CD1   . LEU A  1 196  ? 139.757 158.866 131.574 1.00 289.71 ? 196  LEU A CD1   1 
ATOM   1233  C  CD2   . LEU A  1 196  ? 138.647 161.076 131.952 1.00 282.63 ? 196  LEU A CD2   1 
ATOM   1234  N  N     . CYS A  1 197  ? 141.566 162.748 135.191 1.00 273.98 ? 197  CYS A N     1 
ATOM   1235  C  CA    . CYS A  1 197  ? 142.305 163.128 136.385 1.00 256.07 ? 197  CYS A CA    1 
ATOM   1236  C  C     . CYS A  1 197  ? 141.656 162.540 137.631 1.00 250.51 ? 197  CYS A C     1 
ATOM   1237  O  O     . CYS A  1 197  ? 140.455 162.256 137.665 1.00 254.58 ? 197  CYS A O     1 
ATOM   1238  C  CB    . CYS A  1 197  ? 142.407 164.654 136.518 1.00 258.81 ? 197  CYS A CB    1 
ATOM   1239  N  N     . PHE A  1 198  ? 142.483 162.395 138.664 1.00 238.46 ? 198  PHE A N     1 
ATOM   1240  C  CA    . PHE A  1 198  ? 142.124 161.837 139.962 1.00 238.59 ? 198  PHE A CA    1 
ATOM   1241  C  C     . PHE A  1 198  ? 142.001 162.982 140.958 1.00 239.70 ? 198  PHE A C     1 
ATOM   1242  O  O     . PHE A  1 198  ? 142.928 163.787 141.095 1.00 242.63 ? 198  PHE A O     1 
ATOM   1243  C  CB    . PHE A  1 198  ? 143.207 160.840 140.403 1.00 231.37 ? 198  PHE A CB    1 
ATOM   1244  C  CG    . PHE A  1 198  ? 142.865 160.023 141.627 1.00 228.35 ? 198  PHE A CG    1 
ATOM   1245  C  CD1   . PHE A  1 198  ? 142.402 160.617 142.793 1.00 234.38 ? 198  PHE A CD1   1 
ATOM   1246  C  CD2   . PHE A  1 198  ? 143.049 158.650 141.614 1.00 233.21 ? 198  PHE A CD2   1 
ATOM   1247  C  CE1   . PHE A  1 198  ? 142.108 159.861 143.907 1.00 232.36 ? 198  PHE A CE1   1 
ATOM   1248  C  CE2   . PHE A  1 198  ? 142.757 157.884 142.730 1.00 240.81 ? 198  PHE A CE2   1 
ATOM   1249  C  CZ    . PHE A  1 198  ? 142.284 158.492 143.879 1.00 233.80 ? 198  PHE A CZ    1 
ATOM   1250  N  N     . MET A  1 199  ? 140.872 163.054 141.661 1.00 259.89 ? 199  MET A N     1 
ATOM   1251  C  CA    . MET A  1 199  ? 140.627 164.104 142.638 1.00 260.10 ? 199  MET A CA    1 
ATOM   1252  C  C     . MET A  1 199  ? 140.266 163.476 143.976 1.00 261.12 ? 199  MET A C     1 
ATOM   1253  O  O     . MET A  1 199  ? 139.374 162.619 144.052 1.00 264.69 ? 199  MET A O     1 
ATOM   1254  C  CB    . MET A  1 199  ? 139.527 165.055 142.161 1.00 261.12 ? 199  MET A CB    1 
ATOM   1255  C  CG    . MET A  1 199  ? 139.986 165.967 141.025 1.00 261.97 ? 199  MET A CG    1 
ATOM   1256  S  SD    . MET A  1 199  ? 138.680 166.930 140.234 1.00 266.90 ? 199  MET A SD    1 
ATOM   1257  C  CE    . MET A  1 199  ? 139.635 167.907 139.070 1.00 280.78 ? 199  MET A CE    1 
ATOM   1258  N  N     . LEU A  1 200  ? 140.965 163.909 145.021 1.00 236.75 ? 200  LEU A N     1 
ATOM   1259  C  CA    . LEU A  1 200  ? 140.827 163.350 146.356 1.00 228.40 ? 200  LEU A CA    1 
ATOM   1260  C  C     . LEU A  1 200  ? 141.210 164.427 147.360 1.00 234.92 ? 200  LEU A C     1 
ATOM   1261  O  O     . LEU A  1 200  ? 142.223 165.108 147.180 1.00 238.02 ? 200  LEU A O     1 
ATOM   1262  C  CB    . LEU A  1 200  ? 141.710 162.105 146.503 1.00 226.02 ? 200  LEU A CB    1 
ATOM   1263  C  CG    . LEU A  1 200  ? 141.970 161.502 147.881 1.00 222.64 ? 200  LEU A CG    1 
ATOM   1264  C  CD1   . LEU A  1 200  ? 140.660 161.299 148.596 1.00 224.74 ? 200  LEU A CD1   1 
ATOM   1265  C  CD2   . LEU A  1 200  ? 142.725 160.181 147.763 1.00 221.77 ? 200  LEU A CD2   1 
ATOM   1266  N  N     . ARG A  1 201  ? 140.399 164.592 148.401 1.00 244.17 ? 201  ARG A N     1 
ATOM   1267  C  CA    . ARG A  1 201  ? 140.585 165.682 149.351 1.00 238.73 ? 201  ARG A CA    1 
ATOM   1268  C  C     . ARG A  1 201  ? 141.423 165.243 150.542 1.00 232.61 ? 201  ARG A C     1 
ATOM   1269  O  O     . ARG A  1 201  ? 141.254 164.140 151.068 1.00 235.51 ? 201  ARG A O     1 
ATOM   1270  C  CB    . ARG A  1 201  ? 139.241 166.210 149.855 1.00 236.50 ? 201  ARG A CB    1 
ATOM   1271  C  CG    . ARG A  1 201  ? 138.458 167.012 148.842 1.00 243.38 ? 201  ARG A CG    1 
ATOM   1272  C  CD    . ARG A  1 201  ? 137.231 167.647 149.472 1.00 247.09 ? 201  ARG A CD    1 
ATOM   1273  N  NE    . ARG A  1 201  ? 136.532 168.520 148.535 1.00 240.94 ? 201  ARG A NE    1 
ATOM   1274  C  CZ    . ARG A  1 201  ? 136.828 169.801 148.350 1.00 238.12 ? 201  ARG A CZ    1 
ATOM   1275  N  NH1   . ARG A  1 201  ? 137.812 170.361 149.041 1.00 242.13 ? 201  ARG A NH1   1 
ATOM   1276  N  NH2   . ARG A  1 201  ? 136.142 170.524 147.476 1.00 246.19 ? 201  ARG A NH2   1 
ATOM   1277  N  N     . VAL A  1 202  ? 142.320 166.129 150.966 1.00 224.27 ? 202  VAL A N     1 
ATOM   1278  C  CA    . VAL A  1 202  ? 143.062 165.983 152.212 1.00 220.64 ? 202  VAL A CA    1 
ATOM   1279  C  C     . VAL A  1 202  ? 142.760 167.207 153.059 1.00 226.76 ? 202  VAL A C     1 
ATOM   1280  O  O     . VAL A  1 202  ? 141.975 168.071 152.652 1.00 242.00 ? 202  VAL A O     1 
ATOM   1281  C  CB    . VAL A  1 202  ? 144.574 165.831 151.965 1.00 220.56 ? 202  VAL A CB    1 
ATOM   1282  C  CG1   . VAL A  1 202  ? 144.852 164.618 151.100 1.00 218.88 ? 202  VAL A CG1   1 
ATOM   1283  C  CG2   . VAL A  1 202  ? 145.130 167.085 151.317 1.00 228.56 ? 202  VAL A CG2   1 
ATOM   1284  N  N     . GLY A  1 203  ? 143.364 167.297 154.240 1.00 234.78 ? 203  GLY A N     1 
ATOM   1285  C  CA    . GLY A  1 203  ? 143.133 168.458 155.075 1.00 237.63 ? 203  GLY A CA    1 
ATOM   1286  C  C     . GLY A  1 203  ? 143.670 168.365 156.486 1.00 235.58 ? 203  GLY A C     1 
ATOM   1287  O  O     . GLY A  1 203  ? 143.972 167.276 156.988 1.00 236.84 ? 203  GLY A O     1 
ATOM   1288  N  N     . ASP A  1 204  ? 143.790 169.522 157.131 1.00 271.35 ? 204  ASP A N     1 
ATOM   1289  C  CA    . ASP A  1 204  ? 144.214 169.651 158.515 1.00 268.92 ? 204  ASP A CA    1 
ATOM   1290  C  C     . ASP A  1 204  ? 142.997 169.810 159.417 1.00 272.67 ? 204  ASP A C     1 
ATOM   1291  O  O     . ASP A  1 204  ? 141.911 170.197 158.976 1.00 275.75 ? 204  ASP A O     1 
ATOM   1292  C  CB    . ASP A  1 204  ? 145.152 170.851 158.685 1.00 270.34 ? 204  ASP A CB    1 
ATOM   1293  C  CG    . ASP A  1 204  ? 146.496 170.470 159.278 1.00 266.12 ? 204  ASP A CG    1 
ATOM   1294  O  OD1   . ASP A  1 204  ? 146.671 169.297 159.672 1.00 265.20 ? 204  ASP A OD1   1 
ATOM   1295  O  OD2   . ASP A  1 204  ? 147.383 171.347 159.344 1.00 270.42 ? 204  ASP A OD2   1 
ATOM   1296  N  N     . LEU A  1 205  ? 143.195 169.505 160.698 1.00 250.06 ? 205  LEU A N     1 
ATOM   1297  C  CA    . LEU A  1 205  ? 142.131 169.596 161.684 1.00 253.94 ? 205  LEU A CA    1 
ATOM   1298  C  C     . LEU A  1 205  ? 142.509 170.433 162.899 1.00 245.90 ? 205  LEU A C     1 
ATOM   1299  O  O     . LEU A  1 205  ? 141.689 170.573 163.815 1.00 256.99 ? 205  LEU A O     1 
ATOM   1300  C  CB    . LEU A  1 205  ? 141.706 168.190 162.133 1.00 255.34 ? 205  LEU A CB    1 
ATOM   1301  C  CG    . LEU A  1 205  ? 140.234 167.857 161.880 1.00 248.48 ? 205  LEU A CG    1 
ATOM   1302  C  CD1   . LEU A  1 205  ? 139.888 168.021 160.405 1.00 253.75 ? 205  LEU A CD1   1 
ATOM   1303  C  CD2   . LEU A  1 205  ? 139.888 166.452 162.361 1.00 253.99 ? 205  LEU A CD2   1 
ATOM   1304  N  N     . ARG A  1 206  ? 143.711 171.003 162.932 1.00 251.68 ? 206  ARG A N     1 
ATOM   1305  C  CA    . ARG A  1 206  ? 144.143 171.834 164.045 1.00 253.52 ? 206  ARG A CA    1 
ATOM   1306  C  C     . ARG A  1 206  ? 144.923 173.026 163.513 1.00 250.52 ? 206  ARG A C     1 
ATOM   1307  O  O     . ARG A  1 206  ? 145.250 173.112 162.326 1.00 256.88 ? 206  ARG A O     1 
ATOM   1308  C  CB    . ARG A  1 206  ? 144.997 171.046 165.047 1.00 256.60 ? 206  ARG A CB    1 
ATOM   1309  C  CG    . ARG A  1 206  ? 144.238 169.976 165.809 1.00 262.73 ? 206  ARG A CG    1 
ATOM   1310  C  CD    . ARG A  1 206  ? 145.066 169.426 166.956 1.00 261.40 ? 206  ARG A CD    1 
ATOM   1311  N  NE    . ARG A  1 206  ? 144.366 168.369 167.681 1.00 266.94 ? 206  ARG A NE    1 
ATOM   1312  C  CZ    . ARG A  1 206  ? 143.515 168.582 168.681 1.00 269.77 ? 206  ARG A CZ    1 
ATOM   1313  N  NH1   . ARG A  1 206  ? 143.255 169.820 169.079 1.00 270.25 ? 206  ARG A NH1   1 
ATOM   1314  N  NH2   . ARG A  1 206  ? 142.924 167.557 169.282 1.00 276.41 ? 206  ARG A NH2   1 
ATOM   1315  N  N     . LYS A  1 207  ? 145.218 173.957 164.423 1.00 256.56 ? 207  LYS A N     1 
ATOM   1316  C  CA    . LYS A  1 207  ? 146.022 175.122 164.067 1.00 260.29 ? 207  LYS A CA    1 
ATOM   1317  C  C     . LYS A  1 207  ? 147.454 174.733 163.729 1.00 271.23 ? 207  LYS A C     1 
ATOM   1318  O  O     . LYS A  1 207  ? 148.087 175.372 162.880 1.00 275.79 ? 207  LYS A O     1 
ATOM   1319  C  CB    . LYS A  1 207  ? 146.002 176.136 165.214 1.00 255.05 ? 207  LYS A CB    1 
ATOM   1320  C  CG    . LYS A  1 207  ? 146.755 177.430 164.928 1.00 253.07 ? 207  LYS A CG    1 
ATOM   1321  C  CD    . LYS A  1 207  ? 146.748 178.358 166.134 1.00 251.94 ? 207  LYS A CD    1 
ATOM   1322  C  CE    . LYS A  1 207  ? 147.433 179.683 165.826 1.00 244.42 ? 207  LYS A CE    1 
ATOM   1323  N  NZ    . LYS A  1 207  ? 146.735 180.447 164.754 1.00 244.42 ? 207  LYS A NZ    1 
ATOM   1324  N  N     . SER A  1 208  ? 147.976 173.689 164.370 1.00 257.04 ? 208  SER A N     1 
ATOM   1325  C  CA    . SER A  1 208  ? 149.363 173.291 164.166 1.00 255.62 ? 208  SER A CA    1 
ATOM   1326  C  C     . SER A  1 208  ? 149.565 172.740 162.758 1.00 251.87 ? 208  SER A C     1 
ATOM   1327  O  O     . SER A  1 208  ? 148.813 171.870 162.303 1.00 251.41 ? 208  SER A O     1 
ATOM   1328  C  CB    . SER A  1 208  ? 149.769 172.253 165.210 1.00 252.42 ? 208  SER A CB    1 
ATOM   1329  O  OG    . SER A  1 208  ? 149.751 172.812 166.512 1.00 249.86 ? 208  SER A OG    1 
ATOM   1330  N  N     . MET A  1 209  ? 150.584 173.252 162.070 1.00 219.23 ? 209  MET A N     1 
ATOM   1331  C  CA    . MET A  1 209  ? 150.904 172.843 160.711 1.00 227.86 ? 209  MET A CA    1 
ATOM   1332  C  C     . MET A  1 209  ? 151.717 171.550 160.714 1.00 221.47 ? 209  MET A C     1 
ATOM   1333  O  O     . MET A  1 209  ? 152.083 171.004 161.760 1.00 217.43 ? 209  MET A O     1 
ATOM   1334  C  CB    . MET A  1 209  ? 151.663 173.957 159.986 1.00 241.88 ? 209  MET A CB    1 
ATOM   1335  C  CG    . MET A  1 209  ? 150.820 175.160 159.597 1.00 250.57 ? 209  MET A CG    1 
ATOM   1336  S  SD    . MET A  1 209  ? 150.097 174.969 157.959 1.00 250.12 ? 209  MET A SD    1 
ATOM   1337  C  CE    . MET A  1 209  ? 151.557 174.589 156.995 1.00 223.02 ? 209  MET A CE    1 
ATOM   1338  N  N     . ILE A  1 210  ? 152.001 171.053 159.511 1.00 190.51 ? 210  ILE A N     1 
ATOM   1339  C  CA    . ILE A  1 210  ? 152.838 169.878 159.310 1.00 183.46 ? 210  ILE A CA    1 
ATOM   1340  C  C     . ILE A  1 210  ? 153.884 170.235 158.257 1.00 179.47 ? 210  ILE A C     1 
ATOM   1341  O  O     . ILE A  1 210  ? 153.539 170.660 157.147 1.00 180.87 ? 210  ILE A O     1 
ATOM   1342  C  CB    . ILE A  1 210  ? 152.007 168.644 158.905 1.00 181.80 ? 210  ILE A CB    1 
ATOM   1343  C  CG1   . ILE A  1 210  ? 152.902 167.429 158.655 1.00 177.09 ? 210  ILE A CG1   1 
ATOM   1344  C  CG2   . ILE A  1 210  ? 151.102 168.942 157.713 1.00 182.37 ? 210  ILE A CG2   1 
ATOM   1345  C  CD1   . ILE A  1 210  ? 152.135 166.119 158.604 1.00 168.03 ? 210  ILE A CD1   1 
ATOM   1346  N  N     . ILE A  1 211  ? 155.157 170.090 158.615 1.00 164.89 ? 211  ILE A N     1 
ATOM   1347  C  CA    . ILE A  1 211  ? 156.255 170.627 157.818 1.00 162.37 ? 211  ILE A CA    1 
ATOM   1348  C  C     . ILE A  1 211  ? 156.674 169.614 156.763 1.00 164.86 ? 211  ILE A C     1 
ATOM   1349  O  O     . ILE A  1 211  ? 156.890 168.435 157.066 1.00 169.12 ? 211  ILE A O     1 
ATOM   1350  C  CB    . ILE A  1 211  ? 157.443 171.013 158.716 1.00 160.04 ? 211  ILE A CB    1 
ATOM   1351  N  N     . SER A  1 212  ? 156.782 170.082 155.516 1.00 188.87 ? 212  SER A N     1 
ATOM   1352  C  CA    . SER A  1 212  ? 157.328 169.299 154.402 1.00 190.87 ? 212  SER A CA    1 
ATOM   1353  C  C     . SER A  1 212  ? 156.570 167.989 154.209 1.00 189.63 ? 212  SER A C     1 
ATOM   1354  O  O     . SER A  1 212  ? 157.165 166.921 154.048 1.00 187.00 ? 212  SER A O     1 
ATOM   1355  C  CB    . SER A  1 212  ? 158.823 169.030 154.591 1.00 197.26 ? 212  SER A CB    1 
ATOM   1356  O  OG    . SER A  1 212  ? 159.043 167.934 155.465 1.00 193.55 ? 212  SER A OG    1 
ATOM   1357  N  N     . ALA A  1 213  ? 155.245 168.074 154.228 1.00 191.44 ? 213  ALA A N     1 
ATOM   1358  C  CA    . ALA A  1 213  ? 154.421 166.896 154.001 1.00 189.81 ? 213  ALA A CA    1 
ATOM   1359  C  C     . ALA A  1 213  ? 154.558 166.424 152.558 1.00 191.94 ? 213  ALA A C     1 
ATOM   1360  O  O     . ALA A  1 213  ? 154.324 167.189 151.619 1.00 209.39 ? 213  ALA A O     1 
ATOM   1361  C  CB    . ALA A  1 213  ? 152.962 167.204 154.320 1.00 187.85 ? 213  ALA A CB    1 
ATOM   1362  N  N     . THR A  1 214  ? 154.936 165.161 152.386 1.00 202.47 ? 214  THR A N     1 
ATOM   1363  C  CA    . THR A  1 214  ? 155.101 164.557 151.073 1.00 205.19 ? 214  THR A CA    1 
ATOM   1364  C  C     . THR A  1 214  ? 154.051 163.475 150.879 1.00 206.37 ? 214  THR A C     1 
ATOM   1365  O  O     . THR A  1 214  ? 153.565 162.877 151.844 1.00 205.72 ? 214  THR A O     1 
ATOM   1366  C  CB    . THR A  1 214  ? 156.506 163.961 150.895 1.00 209.15 ? 214  THR A CB    1 
ATOM   1367  O  OG1   . THR A  1 214  ? 156.607 163.352 149.602 1.00 218.47 ? 214  THR A OG1   1 
ATOM   1368  C  CG2   . THR A  1 214  ? 156.788 162.915 151.964 1.00 211.54 ? 214  THR A CG2   1 
ATOM   1369  N  N     . ILE A  1 215  ? 153.697 163.231 149.624 1.00 178.27 ? 215  ILE A N     1 
ATOM   1370  C  CA    . ILE A  1 215  ? 152.682 162.247 149.269 1.00 172.86 ? 215  ILE A CA    1 
ATOM   1371  C  C     . ILE A  1 215  ? 153.360 161.110 148.522 1.00 186.02 ? 215  ILE A C     1 
ATOM   1372  O  O     . ILE A  1 215  ? 154.030 161.333 147.506 1.00 189.51 ? 215  ILE A O     1 
ATOM   1373  C  CB    . ILE A  1 215  ? 151.557 162.864 148.426 1.00 169.16 ? 215  ILE A CB    1 
ATOM   1374  C  CG1   . ILE A  1 215  ? 150.558 163.590 149.323 1.00 173.51 ? 215  ILE A CG1   1 
ATOM   1375  C  CG2   . ILE A  1 215  ? 150.842 161.791 147.619 1.00 179.88 ? 215  ILE A CG2   1 
ATOM   1376  C  CD1   . ILE A  1 215  ? 149.727 162.655 150.174 1.00 175.71 ? 215  ILE A CD1   1 
ATOM   1377  N  N     . HIS A  1 216  ? 153.192 159.895 149.027 1.00 183.43 ? 216  HIS A N     1 
ATOM   1378  C  CA    . HIS A  1 216  ? 153.594 158.675 148.337 1.00 176.41 ? 216  HIS A CA    1 
ATOM   1379  C  C     . HIS A  1 216  ? 152.300 157.958 147.975 1.00 176.29 ? 216  HIS A C     1 
ATOM   1380  O  O     . HIS A  1 216  ? 151.656 157.343 148.831 1.00 180.15 ? 216  HIS A O     1 
ATOM   1381  C  CB    . HIS A  1 216  ? 154.498 157.818 149.215 1.00 177.33 ? 216  HIS A CB    1 
ATOM   1382  C  CG    . HIS A  1 216  ? 155.685 158.554 149.757 1.00 200.76 ? 216  HIS A CG    1 
ATOM   1383  N  ND1   . HIS A  1 216  ? 156.830 158.763 149.019 1.00 225.02 ? 216  HIS A ND1   1 
ATOM   1384  C  CD2   . HIS A  1 216  ? 155.902 159.129 150.962 1.00 193.12 ? 216  HIS A CD2   1 
ATOM   1385  C  CE1   . HIS A  1 216  ? 157.702 159.438 149.748 1.00 210.90 ? 216  HIS A CE1   1 
ATOM   1386  N  NE2   . HIS A  1 216  ? 157.164 159.672 150.930 1.00 200.48 ? 216  HIS A NE2   1 
ATOM   1387  N  N     . MET A  1 217  ? 151.900 158.078 146.715 1.00 194.92 ? 217  MET A N     1 
ATOM   1388  C  CA    . MET A  1 217  ? 150.649 157.519 146.226 1.00 195.21 ? 217  MET A CA    1 
ATOM   1389  C  C     . MET A  1 217  ? 150.972 156.221 145.502 1.00 195.53 ? 217  MET A C     1 
ATOM   1390  O  O     . MET A  1 217  ? 151.770 156.219 144.560 1.00 201.60 ? 217  MET A O     1 
ATOM   1391  C  CB    . MET A  1 217  ? 149.946 158.512 145.303 1.00 197.23 ? 217  MET A CB    1 
ATOM   1392  C  CG    . MET A  1 217  ? 148.494 158.200 145.019 1.00 202.13 ? 217  MET A CG    1 
ATOM   1393  S  SD    . MET A  1 217  ? 147.585 159.705 144.613 1.00 231.03 ? 217  MET A SD    1 
ATOM   1394  C  CE    . MET A  1 217  ? 148.698 160.475 143.439 1.00 222.92 ? 217  MET A CE    1 
ATOM   1395  N  N     . GLN A  1 218  ? 150.384 155.117 145.960 1.00 197.09 ? 218  GLN A N     1 
ATOM   1396  C  CA    . GLN A  1 218  ? 150.721 153.798 145.450 1.00 199.93 ? 218  GLN A CA    1 
ATOM   1397  C  C     . GLN A  1 218  ? 149.449 153.016 145.151 1.00 203.38 ? 218  GLN A C     1 
ATOM   1398  O  O     . GLN A  1 218  ? 148.362 153.343 145.632 1.00 205.83 ? 218  GLN A O     1 
ATOM   1399  C  CB    . GLN A  1 218  ? 151.606 153.032 146.444 1.00 201.81 ? 218  GLN A CB    1 
ATOM   1400  C  CG    . GLN A  1 218  ? 152.934 153.723 146.717 1.00 210.86 ? 218  GLN A CG    1 
ATOM   1401  C  CD    . GLN A  1 218  ? 153.727 153.058 147.817 1.00 222.49 ? 218  GLN A CD    1 
ATOM   1402  O  OE1   . GLN A  1 218  ? 153.160 152.450 148.723 1.00 223.25 ? 218  GLN A OE1   1 
ATOM   1403  N  NE2   . GLN A  1 218  ? 155.047 153.168 147.743 1.00 225.84 ? 218  GLN A NE2   1 
ATOM   1404  N  N     . VAL A  1 219  ? 149.604 151.977 144.336 1.00 214.22 ? 219  VAL A N     1 
ATOM   1405  C  CA    . VAL A  1 219  ? 148.501 151.133 143.895 1.00 213.19 ? 219  VAL A CA    1 
ATOM   1406  C  C     . VAL A  1 219  ? 148.951 149.682 143.977 1.00 214.92 ? 219  VAL A C     1 
ATOM   1407  O  O     . VAL A  1 219  ? 150.084 149.355 143.611 1.00 226.54 ? 219  VAL A O     1 
ATOM   1408  C  CB    . VAL A  1 219  ? 148.054 151.500 142.464 1.00 216.19 ? 219  VAL A CB    1 
ATOM   1409  C  CG1   . VAL A  1 219  ? 149.240 151.993 141.652 1.00 219.44 ? 219  VAL A CG1   1 
ATOM   1410  C  CG2   . VAL A  1 219  ? 147.396 150.312 141.776 1.00 220.39 ? 219  VAL A CG2   1 
ATOM   1411  N  N     . VAL A  1 220  ? 148.071 148.809 144.472 1.00 222.63 ? 220  VAL A N     1 
ATOM   1412  C  CA    . VAL A  1 220  ? 148.403 147.394 144.571 1.00 227.99 ? 220  VAL A CA    1 
ATOM   1413  C  C     . VAL A  1 220  ? 147.440 146.590 143.705 1.00 234.12 ? 220  VAL A C     1 
ATOM   1414  O  O     . VAL A  1 220  ? 146.298 146.996 143.464 1.00 244.77 ? 220  VAL A O     1 
ATOM   1415  C  CB    . VAL A  1 220  ? 148.385 146.893 146.032 1.00 227.89 ? 220  VAL A CB    1 
ATOM   1416  C  CG1   . VAL A  1 220  ? 149.212 147.817 146.918 1.00 232.49 ? 220  VAL A CG1   1 
ATOM   1417  C  CG2   . VAL A  1 220  ? 146.967 146.778 146.547 1.00 231.79 ? 220  VAL A CG2   1 
ATOM   1418  N  N     . ARG A  1 221  ? 147.922 145.443 143.228 1.00 229.41 ? 221  ARG A N     1 
ATOM   1419  C  CA    . ARG A  1 221  ? 147.163 144.571 142.341 1.00 234.91 ? 221  ARG A CA    1 
ATOM   1420  C  C     . ARG A  1 221  ? 147.894 143.244 142.207 1.00 235.66 ? 221  ARG A C     1 
ATOM   1421  O  O     . ARG A  1 221  ? 149.126 143.200 142.223 1.00 238.49 ? 221  ARG A O     1 
ATOM   1422  C  CB    . ARG A  1 221  ? 146.975 145.203 140.955 1.00 237.17 ? 221  ARG A CB    1 
ATOM   1423  C  CG    . ARG A  1 221  ? 145.549 145.613 140.639 1.00 242.56 ? 221  ARG A CG    1 
ATOM   1424  C  CD    . ARG A  1 221  ? 145.360 145.853 139.145 1.00 250.77 ? 221  ARG A CD    1 
ATOM   1425  N  NE    . ARG A  1 221  ? 146.291 146.845 138.608 1.00 258.64 ? 221  ARG A NE    1 
ATOM   1426  C  CZ    . ARG A  1 221  ? 147.363 146.549 137.881 1.00 272.29 ? 221  ARG A CZ    1 
ATOM   1427  N  NH1   . ARG A  1 221  ? 147.650 145.286 137.600 1.00 274.58 ? 221  ARG A NH1   1 
ATOM   1428  N  NH2   . ARG A  1 221  ? 148.152 147.518 137.434 1.00 277.54 ? 221  ARG A NH2   1 
ATOM   1429  N  N     . LYS A  1 222  ? 147.123 142.168 142.071 1.00 232.53 ? 222  LYS A N     1 
ATOM   1430  C  CA    . LYS A  1 222  ? 147.688 140.858 141.762 1.00 230.86 ? 222  LYS A CA    1 
ATOM   1431  C  C     . LYS A  1 222  ? 148.066 140.829 140.286 1.00 233.39 ? 222  LYS A C     1 
ATOM   1432  O  O     . LYS A  1 222  ? 147.193 140.863 139.412 1.00 239.36 ? 222  LYS A O     1 
ATOM   1433  C  CB    . LYS A  1 222  ? 146.692 139.755 142.105 1.00 229.69 ? 222  LYS A CB    1 
ATOM   1434  N  N     . THR A  1 223  ? 149.364 140.770 139.999 1.00 253.86 ? 223  THR A N     1 
ATOM   1435  C  CA    . THR A  1 223  ? 149.869 140.928 138.642 1.00 261.15 ? 223  THR A CA    1 
ATOM   1436  C  C     . THR A  1 223  ? 150.562 139.650 138.185 1.00 272.41 ? 223  THR A C     1 
ATOM   1437  O  O     . THR A  1 223  ? 151.185 138.943 138.983 1.00 271.25 ? 223  THR A O     1 
ATOM   1438  C  CB    . THR A  1 223  ? 150.843 142.112 138.551 1.00 264.91 ? 223  THR A CB    1 
ATOM   1439  O  OG1   . THR A  1 223  ? 150.307 143.229 139.271 1.00 270.13 ? 223  THR A OG1   1 
ATOM   1440  C  CG2   . THR A  1 223  ? 151.062 142.519 137.103 1.00 263.68 ? 223  THR A CG2   1 
ATOM   1441  N  N     . THR A  1 224  ? 150.436 139.358 136.890 1.00 303.15 ? 224  THR A N     1 
ATOM   1442  C  CA    . THR A  1 224  ? 151.106 138.232 136.250 1.00 299.86 ? 224  THR A CA    1 
ATOM   1443  C  C     . THR A  1 224  ? 152.027 138.771 135.165 1.00 294.99 ? 224  THR A C     1 
ATOM   1444  O  O     . THR A  1 224  ? 151.563 139.403 134.210 1.00 292.30 ? 224  THR A O     1 
ATOM   1445  C  CB    . THR A  1 224  ? 150.096 137.248 135.654 1.00 296.53 ? 224  THR A CB    1 
ATOM   1446  O  OG1   . THR A  1 224  ? 149.334 136.645 136.708 1.00 292.52 ? 224  THR A OG1   1 
ATOM   1447  C  CG2   . THR A  1 224  ? 150.812 136.161 134.865 1.00 295.79 ? 224  THR A CG2   1 
ATOM   1448  N  N     . SER A  1 225  ? 153.325 138.522 135.314 1.00 300.27 ? 225  SER A N     1 
ATOM   1449  C  CA    . SER A  1 225  ? 154.298 139.010 134.355 1.00 308.56 ? 225  SER A CA    1 
ATOM   1450  C  C     . SER A  1 225  ? 154.217 138.207 133.058 1.00 311.27 ? 225  SER A C     1 
ATOM   1451  O  O     . SER A  1 225  ? 153.676 137.099 133.036 1.00 311.06 ? 225  SER A O     1 
ATOM   1452  C  CB    . SER A  1 225  ? 155.706 138.922 134.941 1.00 312.98 ? 225  SER A CB    1 
ATOM   1453  O  OG    . SER A  1 225  ? 156.169 137.584 134.952 1.00 311.58 ? 225  SER A OG    1 
ATOM   1454  N  N     . PRO A  1 226  ? 154.743 138.751 131.955 1.00 307.75 ? 226  PRO A N     1 
ATOM   1455  C  CA    . PRO A  1 226  ? 154.786 137.973 130.704 1.00 301.48 ? 226  PRO A CA    1 
ATOM   1456  C  C     . PRO A  1 226  ? 155.683 136.746 130.774 1.00 300.80 ? 226  PRO A C     1 
ATOM   1457  O  O     . PRO A  1 226  ? 155.583 135.882 129.895 1.00 303.41 ? 226  PRO A O     1 
ATOM   1458  C  CB    . PRO A  1 226  ? 155.310 138.987 129.676 1.00 303.32 ? 226  PRO A CB    1 
ATOM   1459  C  CG    . PRO A  1 226  ? 155.997 140.040 130.488 1.00 303.96 ? 226  PRO A CG    1 
ATOM   1460  C  CD    . PRO A  1 226  ? 155.211 140.133 131.757 1.00 306.13 ? 226  PRO A CD    1 
ATOM   1461  N  N     . GLU A  1 227  ? 156.547 136.642 131.783 1.00 306.75 ? 227  GLU A N     1 
ATOM   1462  C  CA    . GLU A  1 227  ? 157.413 135.487 131.965 1.00 310.05 ? 227  GLU A CA    1 
ATOM   1463  C  C     . GLU A  1 227  ? 156.753 134.375 132.777 1.00 303.29 ? 227  GLU A C     1 
ATOM   1464  O  O     . GLU A  1 227  ? 157.445 133.455 133.226 1.00 304.90 ? 227  GLU A O     1 
ATOM   1465  C  CB    . GLU A  1 227  ? 158.727 135.914 132.627 1.00 310.41 ? 227  GLU A CB    1 
ATOM   1466  N  N     . GLY A  1 228  ? 155.436 134.440 132.965 1.00 314.79 ? 228  GLY A N     1 
ATOM   1467  C  CA    . GLY A  1 228  ? 154.706 133.430 133.704 1.00 315.55 ? 228  GLY A CA    1 
ATOM   1468  C  C     . GLY A  1 228  ? 154.734 133.590 135.205 1.00 315.16 ? 228  GLY A C     1 
ATOM   1469  O  O     . GLY A  1 228  ? 154.183 132.734 135.913 1.00 315.75 ? 228  GLY A O     1 
ATOM   1470  N  N     . GLU A  1 229  ? 155.359 134.654 135.710 1.00 358.27 ? 229  GLU A N     1 
ATOM   1471  C  CA    . GLU A  1 229  ? 155.430 134.934 137.137 1.00 360.81 ? 229  GLU A CA    1 
ATOM   1472  C  C     . GLU A  1 229  ? 154.182 135.670 137.596 1.00 354.20 ? 229  GLU A C     1 
ATOM   1473  O  O     . GLU A  1 229  ? 153.819 136.701 137.028 1.00 355.48 ? 229  GLU A O     1 
ATOM   1474  C  CB    . GLU A  1 229  ? 156.674 135.764 137.468 1.00 246.89 ? 229  GLU A CB    1 
ATOM   1475  C  CG    . GLU A  1 229  ? 156.714 136.269 138.912 1.00 246.89 ? 229  GLU A CG    1 
ATOM   1476  C  CD    . GLU A  1 229  ? 158.047 136.903 139.289 1.00 246.89 ? 229  GLU A CD    1 
ATOM   1477  O  OE1   . GLU A  1 229  ? 158.870 137.148 138.384 1.00 246.89 ? 229  GLU A OE1   1 
ATOM   1478  O  OE2   . GLU A  1 229  ? 158.267 137.147 140.498 1.00 246.89 ? 229  GLU A OE2   1 
ATOM   1479  N  N     . VAL A  1 230  ? 153.547 135.150 138.642 1.00 282.68 ? 230  VAL A N     1 
ATOM   1480  C  CA    . VAL A  1 230  ? 152.349 135.743 139.221 1.00 285.78 ? 230  VAL A CA    1 
ATOM   1481  C  C     . VAL A  1 230  ? 152.711 136.271 140.603 1.00 278.51 ? 230  VAL A C     1 
ATOM   1482  O  O     . VAL A  1 230  ? 153.159 135.508 141.469 1.00 282.54 ? 230  VAL A O     1 
ATOM   1483  C  CB    . VAL A  1 230  ? 151.204 134.724 139.306 1.00 292.46 ? 230  VAL A CB    1 
ATOM   1484  C  CG1   . VAL A  1 230  ? 149.930 135.393 139.802 1.00 280.15 ? 230  VAL A CG1   1 
ATOM   1485  C  CG2   . VAL A  1 230  ? 150.983 134.060 137.956 1.00 291.69 ? 230  VAL A CG2   1 
ATOM   1486  N  N     . VAL A  1 231  ? 152.519 137.572 140.812 1.00 254.73 ? 231  VAL A N     1 
ATOM   1487  C  CA    . VAL A  1 231  ? 152.738 138.172 142.125 1.00 248.80 ? 231  VAL A CA    1 
ATOM   1488  C  C     . VAL A  1 231  ? 151.384 138.359 142.802 1.00 251.74 ? 231  VAL A C     1 
ATOM   1489  O  O     . VAL A  1 231  ? 150.411 138.770 142.151 1.00 258.73 ? 231  VAL A O     1 
ATOM   1490  C  CB    . VAL A  1 231  ? 153.514 139.497 142.028 1.00 243.60 ? 231  VAL A CB    1 
ATOM   1491  C  CG1   . VAL A  1 231  ? 154.878 139.265 141.400 1.00 250.51 ? 231  VAL A CG1   1 
ATOM   1492  C  CG2   . VAL A  1 231  ? 152.738 140.537 141.239 1.00 246.39 ? 231  VAL A CG2   1 
ATOM   1493  N  N     . PRO A  1 232  ? 151.265 138.041 144.093 1.00 244.52 ? 232  PRO A N     1 
ATOM   1494  C  CA    . PRO A  1 232  ? 149.969 138.192 144.770 1.00 238.63 ? 232  PRO A CA    1 
ATOM   1495  C  C     . PRO A  1 232  ? 149.586 139.638 145.027 1.00 235.48 ? 232  PRO A C     1 
ATOM   1496  O  O     . PRO A  1 232  ? 148.396 139.926 145.198 1.00 234.86 ? 232  PRO A O     1 
ATOM   1497  C  CB    . PRO A  1 232  ? 150.168 137.428 146.088 1.00 241.59 ? 232  PRO A CB    1 
ATOM   1498  C  CG    . PRO A  1 232  ? 151.411 136.592 145.877 1.00 242.66 ? 232  PRO A CG    1 
ATOM   1499  C  CD    . PRO A  1 232  ? 152.262 137.375 144.946 1.00 241.07 ? 232  PRO A CD    1 
ATOM   1500  N  N     . LEU A  1 233  ? 150.553 140.551 145.055 1.00 220.92 ? 233  LEU A N     1 
ATOM   1501  C  CA    . LEU A  1 233  ? 150.296 141.962 145.293 1.00 222.79 ? 233  LEU A CA    1 
ATOM   1502  C  C     . LEU A  1 233  ? 151.497 142.747 144.793 1.00 223.93 ? 233  LEU A C     1 
ATOM   1503  O  O     . LEU A  1 233  ? 152.640 142.358 145.041 1.00 224.65 ? 233  LEU A O     1 
ATOM   1504  C  CB    . LEU A  1 233  ? 150.040 142.235 146.783 1.00 215.28 ? 233  LEU A CB    1 
ATOM   1505  C  CG    . LEU A  1 233  ? 149.590 143.640 147.182 1.00 216.34 ? 233  LEU A CG    1 
ATOM   1506  C  CD1   . LEU A  1 233  ? 148.576 143.562 148.311 1.00 221.44 ? 233  LEU A CD1   1 
ATOM   1507  C  CD2   . LEU A  1 233  ? 150.778 144.492 147.598 1.00 224.25 ? 233  LEU A CD2   1 
ATOM   1508  N  N     . HIS A  1 234  ? 151.231 143.846 144.090 1.00 225.50 ? 234  HIS A N     1 
ATOM   1509  C  CA    . HIS A  1 234  ? 152.273 144.588 143.383 1.00 224.58 ? 234  HIS A CA    1 
ATOM   1510  C  C     . HIS A  1 234  ? 152.104 146.077 143.651 1.00 221.57 ? 234  HIS A C     1 
ATOM   1511  O  O     . HIS A  1 234  ? 151.208 146.711 143.089 1.00 226.70 ? 234  HIS A O     1 
ATOM   1512  C  CB    . HIS A  1 234  ? 152.220 144.306 141.884 1.00 227.84 ? 234  HIS A CB    1 
ATOM   1513  C  CG    . HIS A  1 234  ? 153.437 144.759 141.143 1.00 232.43 ? 234  HIS A CG    1 
ATOM   1514  N  ND1   . HIS A  1 234  ? 154.619 144.049 141.148 1.00 240.82 ? 234  HIS A ND1   1 
ATOM   1515  C  CD2   . HIS A  1 234  ? 153.661 145.854 140.382 1.00 232.66 ? 234  HIS A CD2   1 
ATOM   1516  C  CE1   . HIS A  1 234  ? 155.516 144.684 140.418 1.00 242.79 ? 234  HIS A CE1   1 
ATOM   1517  N  NE2   . HIS A  1 234  ? 154.960 145.784 139.942 1.00 245.03 ? 234  HIS A NE2   1 
ATOM   1518  N  N     . GLN A  1 235  ? 152.969 146.638 144.494 1.00 214.96 ? 235  GLN A N     1 
ATOM   1519  C  CA    . GLN A  1 235  ? 152.965 148.073 144.741 1.00 210.20 ? 235  GLN A CA    1 
ATOM   1520  C  C     . GLN A  1 235  ? 153.711 148.801 143.632 1.00 212.25 ? 235  GLN A C     1 
ATOM   1521  O  O     . GLN A  1 235  ? 154.813 148.399 143.246 1.00 222.37 ? 235  GLN A O     1 
ATOM   1522  C  CB    . GLN A  1 235  ? 153.604 148.394 146.089 1.00 212.53 ? 235  GLN A CB    1 
ATOM   1523  C  CG    . GLN A  1 235  ? 152.850 147.862 147.283 1.00 222.37 ? 235  GLN A CG    1 
ATOM   1524  C  CD    . GLN A  1 235  ? 153.480 148.290 148.591 1.00 227.00 ? 235  GLN A CD    1 
ATOM   1525  O  OE1   . GLN A  1 235  ? 154.454 149.044 148.611 1.00 228.64 ? 235  GLN A OE1   1 
ATOM   1526  N  NE2   . GLN A  1 235  ? 152.926 147.811 149.693 1.00 224.01 ? 235  GLN A NE2   1 
ATOM   1527  N  N     . VAL A  1 236  ? 153.119 149.882 143.133 1.00 204.99 ? 236  VAL A N     1 
ATOM   1528  C  CA    . VAL A  1 236  ? 153.737 150.715 142.110 1.00 201.79 ? 236  VAL A CA    1 
ATOM   1529  C  C     . VAL A  1 236  ? 153.422 152.173 142.414 1.00 202.67 ? 236  VAL A C     1 
ATOM   1530  O  O     . VAL A  1 236  ? 152.304 152.509 142.814 1.00 207.88 ? 236  VAL A O     1 
ATOM   1531  C  CB    . VAL A  1 236  ? 153.264 150.331 140.694 1.00 213.24 ? 236  VAL A CB    1 
ATOM   1532  C  CG1   . VAL A  1 236  ? 154.260 149.382 140.049 1.00 225.67 ? 236  VAL A CG1   1 
ATOM   1533  C  CG2   . VAL A  1 236  ? 151.887 149.697 140.750 1.00 209.16 ? 236  VAL A CG2   1 
ATOM   1534  N  N     . ASP A  1 237  ? 154.414 153.036 142.223 1.00 220.46 ? 237  ASP A N     1 
ATOM   1535  C  CA    . ASP A  1 237  ? 154.265 154.453 142.531 1.00 221.79 ? 237  ASP A CA    1 
ATOM   1536  C  C     . ASP A  1 237  ? 153.493 155.149 141.417 1.00 218.62 ? 237  ASP A C     1 
ATOM   1537  O  O     . ASP A  1 237  ? 153.912 155.133 140.255 1.00 222.18 ? 237  ASP A O     1 
ATOM   1538  C  CB    . ASP A  1 237  ? 155.637 155.099 142.726 1.00 232.52 ? 237  ASP A CB    1 
ATOM   1539  C  CG    . ASP A  1 237  ? 155.562 156.610 142.911 1.00 223.55 ? 237  ASP A CG    1 
ATOM   1540  O  OD1   . ASP A  1 237  ? 154.498 157.123 143.316 1.00 219.77 ? 237  ASP A OD1   1 
ATOM   1541  O  OD2   . ASP A  1 237  ? 156.574 157.291 142.646 1.00 224.48 ? 237  ASP A OD2   1 
ATOM   1542  N  N     . ILE A  1 238  ? 152.373 155.755 141.775 1.00 202.89 ? 238  ILE A N     1 
ATOM   1543  C  CA    . ILE A  1 238  ? 151.638 156.659 140.895 1.00 210.28 ? 238  ILE A CA    1 
ATOM   1544  C  C     . ILE A  1 238  ? 151.957 158.085 141.330 1.00 209.85 ? 238  ILE A C     1 
ATOM   1545  O  O     . ILE A  1 238  ? 151.806 158.404 142.518 1.00 215.33 ? 238  ILE A O     1 
ATOM   1546  C  CB    . ILE A  1 238  ? 150.120 156.388 140.936 1.00 214.29 ? 238  ILE A CB    1 
ATOM   1547  C  CG1   . ILE A  1 238  ? 149.323 157.641 140.571 1.00 215.05 ? 238  ILE A CG1   1 
ATOM   1548  C  CG2   . ILE A  1 238  ? 149.698 155.841 142.290 1.00 207.79 ? 238  ILE A CG2   1 
ATOM   1549  C  CD1   . ILE A  1 238  ? 147.821 157.448 140.653 1.00 213.78 ? 238  ILE A CD1   1 
ATOM   1550  N  N     . PRO A  1 239  ? 152.409 158.952 140.428 1.00 203.81 ? 239  PRO A N     1 
ATOM   1551  C  CA    . PRO A  1 239  ? 152.990 160.228 140.858 1.00 203.96 ? 239  PRO A CA    1 
ATOM   1552  C  C     . PRO A  1 239  ? 151.949 161.186 141.410 1.00 209.97 ? 239  PRO A C     1 
ATOM   1553  O  O     . PRO A  1 239  ? 150.770 161.145 141.052 1.00 216.01 ? 239  PRO A O     1 
ATOM   1554  C  CB    . PRO A  1 239  ? 153.616 160.789 139.573 1.00 210.15 ? 239  PRO A CB    1 
ATOM   1555  C  CG    . PRO A  1 239  ? 153.618 159.648 138.589 1.00 208.22 ? 239  PRO A CG    1 
ATOM   1556  C  CD    . PRO A  1 239  ? 152.476 158.774 138.969 1.00 204.34 ? 239  PRO A CD    1 
ATOM   1557  N  N     . MET A  1 240  ? 152.405 162.064 142.294 1.00 240.85 ? 240  MET A N     1 
ATOM   1558  C  CA    . MET A  1 240  ? 151.617 163.210 142.720 1.00 236.43 ? 240  MET A CA    1 
ATOM   1559  C  C     . MET A  1 240  ? 152.016 164.403 141.861 1.00 241.83 ? 240  MET A C     1 
ATOM   1560  O  O     . MET A  1 240  ? 153.155 164.882 141.947 1.00 256.76 ? 240  MET A O     1 
ATOM   1561  C  CB    . MET A  1 240  ? 151.824 163.510 144.204 1.00 238.25 ? 240  MET A CB    1 
ATOM   1562  N  N     . GLU A  1 241  ? 151.079 164.876 141.039 1.00 240.98 ? 241  GLU A N     1 
ATOM   1563  C  CA    . GLU A  1 241  ? 151.372 165.898 140.041 1.00 241.36 ? 241  GLU A CA    1 
ATOM   1564  C  C     . GLU A  1 241  ? 151.263 167.274 140.685 1.00 242.72 ? 241  GLU A C     1 
ATOM   1565  O  O     . GLU A  1 241  ? 150.158 167.783 140.931 1.00 241.28 ? 241  GLU A O     1 
ATOM   1566  C  CB    . GLU A  1 241  ? 150.453 165.770 138.832 1.00 244.96 ? 241  GLU A CB    1 
ATOM   1567  C  CG    . GLU A  1 241  ? 150.637 164.464 138.114 1.00 251.86 ? 241  GLU A CG    1 
ATOM   1568  C  CD    . GLU A  1 241  ? 150.107 164.502 136.707 1.00 255.05 ? 241  GLU A CD    1 
ATOM   1569  O  OE1   . GLU A  1 241  ? 149.483 165.517 136.334 1.00 264.05 ? 241  GLU A OE1   1 
ATOM   1570  O  OE2   . GLU A  1 241  ? 150.324 163.512 135.976 1.00 248.11 ? 241  GLU A OE2   1 
ATOM   1571  N  N     . ASN A  1 242  ? 152.428 167.872 140.902 1.00 220.34 ? 242  ASN A N     1 
ATOM   1572  C  CA    . ASN A  1 242  ? 152.706 169.186 141.450 1.00 209.27 ? 242  ASN A CA    1 
ATOM   1573  C  C     . ASN A  1 242  ? 153.426 169.993 140.367 1.00 216.29 ? 242  ASN A C     1 
ATOM   1574  O  O     . ASN A  1 242  ? 153.357 169.674 139.172 1.00 232.86 ? 242  ASN A O     1 
ATOM   1575  N  N     . GLY A  1 243  ? 154.079 171.072 140.789 1.00 232.00 ? 243  GLY A N     1 
ATOM   1576  C  CA    . GLY A  1 243  ? 154.863 171.909 139.903 1.00 229.80 ? 243  GLY A CA    1 
ATOM   1577  C  C     . GLY A  1 243  ? 156.056 171.194 139.349 1.00 232.27 ? 243  GLY A C     1 
ATOM   1578  O  O     . GLY A  1 243  ? 156.101 169.967 139.431 1.00 249.52 ? 243  GLY A O     1 
ATOM   1579  N  N     . VAL A  1 244  ? 157.015 171.957 138.802 1.00 236.33 ? 244  VAL A N     1 
ATOM   1580  C  CA    . VAL A  1 244  ? 158.122 171.401 138.010 1.00 250.64 ? 244  VAL A CA    1 
ATOM   1581  C  C     . VAL A  1 244  ? 158.573 170.038 138.538 1.00 260.92 ? 244  VAL A C     1 
ATOM   1582  O  O     . VAL A  1 244  ? 158.952 169.150 137.770 1.00 255.22 ? 244  VAL A O     1 
ATOM   1583  C  CB    . VAL A  1 244  ? 159.306 172.389 137.973 1.00 241.45 ? 244  VAL A CB    1 
ATOM   1584  N  N     . GLY A  1 245  ? 158.518 169.847 139.852 1.00 222.93 ? 245  GLY A N     1 
ATOM   1585  C  CA    . GLY A  1 245  ? 158.961 168.606 140.482 1.00 221.09 ? 245  GLY A CA    1 
ATOM   1586  C  C     . GLY A  1 245  ? 158.285 168.396 141.802 1.00 217.55 ? 245  GLY A C     1 
ATOM   1587  O  O     . GLY A  1 245  ? 157.095 168.712 141.948 1.00 212.60 ? 245  GLY A O     1 
ATOM   1588  N  N     . GLY A  1 246  ? 159.025 167.867 142.772 1.00 221.92 ? 246  GLY A N     1 
ATOM   1589  C  CA    . GLY A  1 246  ? 158.519 167.794 144.119 1.00 222.93 ? 246  GLY A CA    1 
ATOM   1590  C  C     . GLY A  1 246  ? 157.628 166.605 144.420 1.00 224.71 ? 246  GLY A C     1 
ATOM   1591  O  O     . GLY A  1 246  ? 156.667 166.325 143.696 1.00 221.02 ? 246  GLY A O     1 
ATOM   1592  N  N     . ASN A  1 247  ? 157.944 165.890 145.501 1.00 234.36 ? 247  ASN A N     1 
ATOM   1593  C  CA    . ASN A  1 247  ? 157.100 164.823 146.016 1.00 230.88 ? 247  ASN A CA    1 
ATOM   1594  C  C     . ASN A  1 247  ? 156.241 165.295 147.179 1.00 227.73 ? 247  ASN A C     1 
ATOM   1595  O  O     . ASN A  1 247  ? 155.409 164.528 147.677 1.00 218.41 ? 247  ASN A O     1 
ATOM   1596  C  CB    . ASN A  1 247  ? 157.965 163.637 146.438 1.00 226.20 ? 247  ASN A CB    1 
ATOM   1597  C  CG    . ASN A  1 247  ? 157.205 162.329 146.422 1.00 220.83 ? 247  ASN A CG    1 
ATOM   1598  O  OD1   . ASN A  1 247  ? 156.130 162.226 145.834 1.00 215.04 ? 247  ASN A OD1   1 
ATOM   1599  N  ND2   . ASN A  1 247  ? 157.771 161.310 147.063 1.00 227.18 ? 247  ASN A ND2   1 
ATOM   1600  N  N     . GLY A  1 248  ? 156.424 166.543 147.616 1.00 231.37 ? 248  GLY A N     1 
ATOM   1601  C  CA    . GLY A  1 248  ? 155.723 167.087 148.753 1.00 218.51 ? 248  GLY A CA    1 
ATOM   1602  C  C     . GLY A  1 248  ? 154.710 168.151 148.363 1.00 210.58 ? 248  GLY A C     1 
ATOM   1603  O  O     . GLY A  1 248  ? 154.672 168.644 147.237 1.00 217.32 ? 248  GLY A O     1 
ATOM   1604  N  N     . ILE A  1 249  ? 153.877 168.499 149.340 1.00 203.92 ? 249  ILE A N     1 
ATOM   1605  C  CA    . ILE A  1 249  ? 152.820 169.479 149.179 1.00 207.12 ? 249  ILE A CA    1 
ATOM   1606  C  C     . ILE A  1 249  ? 152.838 170.423 150.377 1.00 209.65 ? 249  ILE A C     1 
ATOM   1607  O  O     . ILE A  1 249  ? 153.674 170.311 151.273 1.00 218.14 ? 249  ILE A O     1 
ATOM   1608  C  CB    . ILE A  1 249  ? 151.433 168.822 149.009 1.00 202.55 ? 249  ILE A CB    1 
ATOM   1609  C  CG1   . ILE A  1 249  ? 151.392 167.447 149.687 1.00 200.23 ? 249  ILE A CG1   1 
ATOM   1610  C  CG2   . ILE A  1 249  ? 151.079 168.698 147.538 1.00 215.85 ? 249  ILE A CG2   1 
ATOM   1611  C  CD1   . ILE A  1 249  ? 151.165 167.498 151.178 1.00 197.41 ? 249  ILE A CD1   1 
ATOM   1612  N  N     . PHE A  1 250  ? 151.901 171.368 150.373 1.00 200.31 ? 250  PHE A N     1 
ATOM   1613  C  CA    . PHE A  1 250  ? 151.752 172.345 151.443 1.00 203.00 ? 250  PHE A CA    1 
ATOM   1614  C  C     . PHE A  1 250  ? 150.295 172.358 151.880 1.00 211.69 ? 250  PHE A C     1 
ATOM   1615  O  O     . PHE A  1 250  ? 149.406 172.631 151.067 1.00 210.35 ? 250  PHE A O     1 
ATOM   1616  C  CB    . PHE A  1 250  ? 152.193 173.734 150.985 1.00 213.62 ? 250  PHE A CB    1 
ATOM   1617  C  CG    . PHE A  1 250  ? 152.101 174.786 152.051 1.00 219.34 ? 250  PHE A CG    1 
ATOM   1618  C  CD1   . PHE A  1 250  ? 153.041 174.846 153.066 1.00 219.34 ? 250  PHE A CD1   1 
ATOM   1619  C  CD2   . PHE A  1 250  ? 151.083 175.726 152.030 1.00 215.48 ? 250  PHE A CD2   1 
ATOM   1620  C  CE1   . PHE A  1 250  ? 152.963 175.818 154.045 1.00 217.82 ? 250  PHE A CE1   1 
ATOM   1621  C  CE2   . PHE A  1 250  ? 151.001 176.701 153.007 1.00 211.68 ? 250  PHE A CE2   1 
ATOM   1622  C  CZ    . PHE A  1 250  ? 151.940 176.746 154.016 1.00 214.74 ? 250  PHE A CZ    1 
ATOM   1623  N  N     . LEU A  1 251  ? 150.056 172.072 153.157 1.00 222.39 ? 251  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1 251  ? 148.713 171.882 153.697 1.00 213.72 ? 251  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1 251  ? 148.348 173.059 154.591 1.00 221.16 ? 251  LEU A C     1 
ATOM   1626  O  O     . LEU A  1 251  ? 148.897 173.205 155.688 1.00 232.42 ? 251  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1 251  ? 148.623 170.573 154.474 1.00 208.47 ? 251  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1 251  ? 147.946 169.409 153.759 1.00 204.72 ? 251  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1 251  ? 147.933 168.183 154.653 1.00 195.94 ? 251  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1 251  ? 146.538 169.803 153.351 1.00 208.86 ? 251  LEU A CD2   1 
ATOM   1631  N  N     . VAL A  1 252  ? 147.420 173.893 154.124 1.00 239.40 ? 252  VAL A N     1 
ATOM   1632  C  CA    . VAL A  1 252  ? 146.795 174.911 154.961 1.00 243.14 ? 252  VAL A CA    1 
ATOM   1633  C  C     . VAL A  1 252  ? 145.288 174.698 154.921 1.00 241.74 ? 252  VAL A C     1 
ATOM   1634  O  O     . VAL A  1 252  ? 144.648 174.492 155.958 1.00 238.44 ? 252  VAL A O     1 
ATOM   1635  C  CB    . VAL A  1 252  ? 147.175 176.334 154.509 1.00 238.41 ? 252  VAL A CB    1 
ATOM   1636  C  CG1   . VAL A  1 252  ? 148.362 176.843 155.307 1.00 237.50 ? 252  VAL A CG1   1 
ATOM   1637  C  CG2   . VAL A  1 252  ? 147.492 176.342 153.034 1.00 240.42 ? 252  VAL A CG2   1 
ATOM   1638  N  N     . ALA A  1 253  ? 144.721 174.743 153.728 1.00 214.85 ? 253  ALA A N     1 
ATOM   1639  C  CA    . ALA A  1 253  ? 143.325 174.436 153.478 1.00 214.13 ? 253  ALA A CA    1 
ATOM   1640  C  C     . ALA A  1 253  ? 143.201 173.065 152.834 1.00 213.74 ? 253  ALA A C     1 
ATOM   1641  O  O     . ALA A  1 253  ? 144.188 172.512 152.336 1.00 219.86 ? 253  ALA A O     1 
ATOM   1642  C  CB    . ALA A  1 253  ? 142.703 175.500 152.564 1.00 211.97 ? 253  ALA A CB    1 
ATOM   1643  N  N     . PRO A  1 254  ? 142.003 172.461 152.851 1.00 229.91 ? 254  PRO A N     1 
ATOM   1644  C  CA    . PRO A  1 254  ? 141.808 171.212 152.103 1.00 227.38 ? 254  PRO A CA    1 
ATOM   1645  C  C     . PRO A  1 254  ? 142.170 171.363 150.636 1.00 232.27 ? 254  PRO A C     1 
ATOM   1646  O  O     . PRO A  1 254  ? 141.498 172.079 149.885 1.00 233.21 ? 254  PRO A O     1 
ATOM   1647  C  CB    . PRO A  1 254  ? 140.316 170.922 152.292 1.00 225.02 ? 254  PRO A CB    1 
ATOM   1648  C  CG    . PRO A  1 254  ? 139.995 171.535 153.602 1.00 226.09 ? 254  PRO A CG    1 
ATOM   1649  C  CD    . PRO A  1 254  ? 140.837 172.781 153.692 1.00 236.19 ? 254  PRO A CD    1 
ATOM   1650  N  N     . LEU A  1 255  ? 143.235 170.685 150.222 1.00 210.59 ? 255  LEU A N     1 
ATOM   1651  C  CA    . LEU A  1 255  ? 143.760 170.774 148.868 1.00 205.68 ? 255  LEU A CA    1 
ATOM   1652  C  C     . LEU A  1 255  ? 143.551 169.437 148.174 1.00 202.98 ? 255  LEU A C     1 
ATOM   1653  O  O     . LEU A  1 255  ? 144.123 168.423 148.592 1.00 205.52 ? 255  LEU A O     1 
ATOM   1654  C  CB    . LEU A  1 255  ? 145.242 171.148 148.878 1.00 199.52 ? 255  LEU A CB    1 
ATOM   1655  N  N     . ILE A  1 256  ? 142.733 169.435 147.124 1.00 221.44 ? 256  ILE A N     1 
ATOM   1656  C  CA    . ILE A  1 256  ? 142.524 168.225 146.341 1.00 215.21 ? 256  ILE A CA    1 
ATOM   1657  C  C     . ILE A  1 256  ? 143.833 167.855 145.656 1.00 220.76 ? 256  ILE A C     1 
ATOM   1658  O  O     . ILE A  1 256  ? 144.398 168.646 144.891 1.00 235.90 ? 256  ILE A O     1 
ATOM   1659  C  CB    . ILE A  1 256  ? 141.391 168.416 145.321 1.00 218.31 ? 256  ILE A CB    1 
ATOM   1660  C  CG1   . ILE A  1 256  ? 141.574 169.714 144.530 1.00 220.92 ? 256  ILE A CG1   1 
ATOM   1661  C  CG2   . ILE A  1 256  ? 140.047 168.426 146.018 1.00 227.24 ? 256  ILE A CG2   1 
ATOM   1662  C  CD1   . ILE A  1 256  ? 141.920 169.498 143.071 1.00 219.05 ? 256  ILE A CD1   1 
ATOM   1663  N  N     . ILE A  1 257  ? 144.341 166.661 145.953 1.00 227.13 ? 257  ILE A N     1 
ATOM   1664  C  CA    . ILE A  1 257  ? 145.544 166.195 145.276 1.00 227.69 ? 257  ILE A CA    1 
ATOM   1665  C  C     . ILE A  1 257  ? 145.203 165.921 143.819 1.00 229.94 ? 257  ILE A C     1 
ATOM   1666  O  O     . ILE A  1 257  ? 144.187 165.287 143.506 1.00 233.83 ? 257  ILE A O     1 
ATOM   1667  C  CB    . ILE A  1 257  ? 146.126 164.959 145.979 1.00 226.19 ? 257  ILE A CB    1 
ATOM   1668  C  CG1   . ILE A  1 257  ? 147.432 164.532 145.302 1.00 245.79 ? 257  ILE A CG1   1 
ATOM   1669  C  CG2   . ILE A  1 257  ? 145.113 163.818 146.028 1.00 230.45 ? 257  ILE A CG2   1 
ATOM   1670  C  CD1   . ILE A  1 257  ? 148.491 165.621 145.270 1.00 237.37 ? 257  ILE A CD1   1 
ATOM   1671  N  N     . TYR A  1 258  ? 146.036 166.425 142.918 1.00 247.45 ? 258  TYR A N     1 
ATOM   1672  C  CA    . TYR A  1 258  ? 145.722 166.454 141.494 1.00 245.91 ? 258  TYR A CA    1 
ATOM   1673  C  C     . TYR A  1 258  ? 146.739 165.611 140.742 1.00 247.44 ? 258  TYR A C     1 
ATOM   1674  O  O     . TYR A  1 258  ? 147.897 166.013 140.596 1.00 248.53 ? 258  TYR A O     1 
ATOM   1675  C  CB    . TYR A  1 258  ? 145.707 167.890 140.977 1.00 247.92 ? 258  TYR A CB    1 
ATOM   1676  C  CG    . TYR A  1 258  ? 145.363 168.011 139.514 1.00 252.31 ? 258  TYR A CG    1 
ATOM   1677  C  CD1   . TYR A  1 258  ? 144.039 168.057 139.095 1.00 252.37 ? 258  TYR A CD1   1 
ATOM   1678  C  CD2   . TYR A  1 258  ? 146.362 168.085 138.552 1.00 260.39 ? 258  TYR A CD2   1 
ATOM   1679  C  CE1   . TYR A  1 258  ? 143.720 168.170 137.756 1.00 259.28 ? 258  TYR A CE1   1 
ATOM   1680  C  CE2   . TYR A  1 258  ? 146.053 168.199 137.211 1.00 259.03 ? 258  TYR A CE2   1 
ATOM   1681  C  CZ    . TYR A  1 258  ? 144.731 168.239 136.818 1.00 264.55 ? 258  TYR A CZ    1 
ATOM   1682  O  OH    . TYR A  1 258  ? 144.419 168.352 135.484 1.00 276.72 ? 258  TYR A OH    1 
ATOM   1683  N  N     . HIS A  1 259  ? 146.305 164.446 140.269 1.00 222.49 ? 259  HIS A N     1 
ATOM   1684  C  CA    . HIS A  1 259  ? 147.106 163.599 139.404 1.00 226.16 ? 259  HIS A CA    1 
ATOM   1685  C  C     . HIS A  1 259  ? 146.366 163.373 138.093 1.00 235.21 ? 259  HIS A C     1 
ATOM   1686  O  O     . HIS A  1 259  ? 145.133 163.344 138.059 1.00 240.97 ? 259  HIS A O     1 
ATOM   1687  C  CB    . HIS A  1 259  ? 147.416 162.252 140.067 1.00 217.86 ? 259  HIS A CB    1 
ATOM   1688  C  CG    . HIS A  1 259  ? 148.074 161.273 139.149 1.00 223.17 ? 259  HIS A CG    1 
ATOM   1689  N  ND1   . HIS A  1 259  ? 147.458 160.114 138.730 1.00 224.46 ? 259  HIS A ND1   1 
ATOM   1690  C  CD2   . HIS A  1 259  ? 149.285 161.293 138.546 1.00 229.51 ? 259  HIS A CD2   1 
ATOM   1691  C  CE1   . HIS A  1 259  ? 148.267 159.457 137.919 1.00 228.63 ? 259  HIS A CE1   1 
ATOM   1692  N  NE2   . HIS A  1 259  ? 149.385 160.150 137.794 1.00 229.67 ? 259  HIS A NE2   1 
ATOM   1693  N  N     . VAL A  1 260  ? 147.124 163.235 137.009 1.00 258.20 ? 260  VAL A N     1 
ATOM   1694  C  CA    . VAL A  1 260  ? 146.568 162.971 135.687 1.00 260.00 ? 260  VAL A CA    1 
ATOM   1695  C  C     . VAL A  1 260  ? 147.162 161.667 135.175 1.00 264.80 ? 260  VAL A C     1 
ATOM   1696  O  O     . VAL A  1 260  ? 148.380 161.569 134.971 1.00 268.80 ? 260  VAL A O     1 
ATOM   1697  C  CB    . VAL A  1 260  ? 146.845 164.120 134.705 1.00 255.50 ? 260  VAL A CB    1 
ATOM   1698  C  CG1   . VAL A  1 260  ? 146.477 163.701 133.290 1.00 262.62 ? 260  VAL A CG1   1 
ATOM   1699  C  CG2   . VAL A  1 260  ? 146.062 165.355 135.110 1.00 256.96 ? 260  VAL A CG2   1 
ATOM   1700  N  N     . ILE A  1 261  ? 146.308 160.670 134.967 1.00 269.14 ? 261  ILE A N     1 
ATOM   1701  C  CA    . ILE A  1 261  ? 146.753 159.383 134.445 1.00 269.17 ? 261  ILE A CA    1 
ATOM   1702  C  C     . ILE A  1 261  ? 147.000 159.514 132.949 1.00 272.45 ? 261  ILE A C     1 
ATOM   1703  O  O     . ILE A  1 261  ? 146.142 159.998 132.200 1.00 272.28 ? 261  ILE A O     1 
ATOM   1704  C  CB    . ILE A  1 261  ? 145.725 158.281 134.755 1.00 267.43 ? 261  ILE A CB    1 
ATOM   1705  C  CG1   . ILE A  1 261  ? 144.295 158.791 134.557 1.00 263.57 ? 261  ILE A CG1   1 
ATOM   1706  C  CG2   . ILE A  1 261  ? 145.919 157.748 136.168 1.00 269.35 ? 261  ILE A CG2   1 
ATOM   1707  C  CD1   . ILE A  1 261  ? 143.650 158.314 133.276 1.00 272.71 ? 261  ILE A CD1   1 
ATOM   1708  N  N     . ASP A  1 262  ? 148.183 159.100 132.511 1.00 278.69 ? 262  ASP A N     1 
ATOM   1709  C  CA    . ASP A  1 262  ? 148.569 159.106 131.108 1.00 281.38 ? 262  ASP A CA    1 
ATOM   1710  C  C     . ASP A  1 262  ? 148.875 157.678 130.670 1.00 283.84 ? 262  ASP A C     1 
ATOM   1711  O  O     . ASP A  1 262  ? 148.806 156.737 131.463 1.00 281.08 ? 262  ASP A O     1 
ATOM   1712  C  CB    . ASP A  1 262  ? 149.770 160.027 130.874 1.00 279.84 ? 262  ASP A CB    1 
ATOM   1713  C  CG    . ASP A  1 262  ? 150.975 159.643 131.712 1.00 283.28 ? 262  ASP A CG    1 
ATOM   1714  O  OD1   . ASP A  1 262  ? 150.782 159.054 132.798 1.00 284.07 ? 262  ASP A OD1   1 
ATOM   1715  O  OD2   . ASP A  1 262  ? 152.113 159.931 131.286 1.00 285.11 ? 262  ASP A OD2   1 
ATOM   1716  N  N     . SER A  1 263  ? 149.230 157.527 129.390 1.00 281.29 ? 263  SER A N     1 
ATOM   1717  C  CA    . SER A  1 263  ? 149.519 156.205 128.843 1.00 285.82 ? 263  SER A CA    1 
ATOM   1718  C  C     . SER A  1 263  ? 150.659 155.511 129.579 1.00 285.78 ? 263  SER A C     1 
ATOM   1719  O  O     . SER A  1 263  ? 150.740 154.277 129.560 1.00 287.25 ? 263  SER A O     1 
ATOM   1720  C  CB    . SER A  1 263  ? 149.844 156.317 127.352 1.00 287.03 ? 263  SER A CB    1 
ATOM   1721  O  OG    . SER A  1 263  ? 150.087 155.043 126.784 1.00 287.43 ? 263  SER A OG    1 
ATOM   1722  N  N     . ASN A  1 264  ? 151.540 156.274 130.225 1.00 290.95 ? 264  ASN A N     1 
ATOM   1723  C  CA    . ASN A  1 264  ? 152.634 155.690 130.990 1.00 287.86 ? 264  ASN A CA    1 
ATOM   1724  C  C     . ASN A  1 264  ? 152.209 155.249 132.387 1.00 289.00 ? 264  ASN A C     1 
ATOM   1725  O  O     . ASN A  1 264  ? 152.883 154.402 132.985 1.00 288.51 ? 264  ASN A O     1 
ATOM   1726  C  CB    . ASN A  1 264  ? 153.785 156.693 131.090 1.00 287.60 ? 264  ASN A CB    1 
ATOM   1727  C  CG    . ASN A  1 264  ? 155.043 156.082 131.667 1.00 292.01 ? 264  ASN A CG    1 
ATOM   1728  O  OD1   . ASN A  1 264  ? 155.284 154.882 131.529 1.00 295.84 ? 264  ASN A OD1   1 
ATOM   1729  N  ND2   . ASN A  1 264  ? 155.855 156.905 132.319 1.00 288.19 ? 264  ASN A ND2   1 
ATOM   1730  N  N     . SER A  1 265  ? 151.113 155.793 132.914 1.00 278.30 ? 265  SER A N     1 
ATOM   1731  C  CA    . SER A  1 265  ? 150.684 155.463 134.265 1.00 276.18 ? 265  SER A CA    1 
ATOM   1732  C  C     . SER A  1 265  ? 150.195 154.018 134.344 1.00 278.85 ? 265  SER A C     1 
ATOM   1733  O  O     . SER A  1 265  ? 149.629 153.490 133.384 1.00 281.63 ? 265  SER A O     1 
ATOM   1734  C  CB    . SER A  1 265  ? 149.572 156.407 134.716 1.00 269.66 ? 265  SER A CB    1 
ATOM   1735  O  OG    . SER A  1 265  ? 150.036 157.742 134.800 1.00 269.15 ? 265  SER A OG    1 
ATOM   1736  N  N     . PRO A  1 266  ? 150.402 153.354 135.486 1.00 256.02 ? 266  PRO A N     1 
ATOM   1737  C  CA    . PRO A  1 266  ? 149.963 151.954 135.605 1.00 254.82 ? 266  PRO A CA    1 
ATOM   1738  C  C     . PRO A  1 266  ? 148.454 151.800 135.657 1.00 254.96 ? 266  PRO A C     1 
ATOM   1739  O  O     . PRO A  1 266  ? 147.932 150.762 135.230 1.00 257.44 ? 266  PRO A O     1 
ATOM   1740  C  CB    . PRO A  1 266  ? 150.621 151.486 136.913 1.00 254.72 ? 266  PRO A CB    1 
ATOM   1741  C  CG    . PRO A  1 266  ? 151.681 152.510 137.218 1.00 254.82 ? 266  PRO A CG    1 
ATOM   1742  C  CD    . PRO A  1 266  ? 151.162 153.797 136.666 1.00 253.25 ? 266  PRO A CD    1 
ATOM   1743  N  N     . LEU A  1 267  ? 147.735 152.799 136.166 1.00 253.96 ? 267  LEU A N     1 
ATOM   1744  C  CA    . LEU A  1 267  ? 146.285 152.756 136.299 1.00 256.95 ? 267  LEU A CA    1 
ATOM   1745  C  C     . LEU A  1 267  ? 145.560 153.039 134.987 1.00 259.00 ? 267  LEU A C     1 
ATOM   1746  O  O     . LEU A  1 267  ? 144.328 152.966 134.943 1.00 262.10 ? 267  LEU A O     1 
ATOM   1747  C  CB    . LEU A  1 267  ? 145.851 153.758 137.377 1.00 261.51 ? 267  LEU A CB    1 
ATOM   1748  C  CG    . LEU A  1 267  ? 144.427 153.744 137.938 1.00 261.86 ? 267  LEU A CG    1 
ATOM   1749  C  CD1   . LEU A  1 267  ? 144.452 153.810 139.457 1.00 253.37 ? 267  LEU A CD1   1 
ATOM   1750  C  CD2   . LEU A  1 267  ? 143.623 154.900 137.366 1.00 256.95 ? 267  LEU A CD2   1 
ATOM   1751  N  N     . TYR A  1 268  ? 146.301 153.324 133.917 1.00 268.93 ? 268  TYR A N     1 
ATOM   1752  C  CA    . TYR A  1 268  ? 145.746 153.810 132.659 1.00 266.60 ? 268  TYR A CA    1 
ATOM   1753  C  C     . TYR A  1 268  ? 144.938 152.763 131.893 1.00 270.26 ? 268  TYR A C     1 
ATOM   1754  O  O     . TYR A  1 268  ? 144.237 153.127 130.942 1.00 274.52 ? 268  TYR A O     1 
ATOM   1755  C  CB    . TYR A  1 268  ? 146.905 154.346 131.810 1.00 267.67 ? 268  TYR A CB    1 
ATOM   1756  C  CG    . TYR A  1 268  ? 146.673 154.415 130.320 1.00 275.75 ? 268  TYR A CG    1 
ATOM   1757  C  CD1   . TYR A  1 268  ? 145.986 155.477 129.748 1.00 279.82 ? 268  TYR A CD1   1 
ATOM   1758  C  CD2   . TYR A  1 268  ? 147.164 153.423 129.481 1.00 279.53 ? 268  TYR A CD2   1 
ATOM   1759  C  CE1   . TYR A  1 268  ? 145.781 155.541 128.383 1.00 284.19 ? 268  TYR A CE1   1 
ATOM   1760  C  CE2   . TYR A  1 268  ? 146.966 153.479 128.119 1.00 282.13 ? 268  TYR A CE2   1 
ATOM   1761  C  CZ    . TYR A  1 268  ? 146.275 154.537 127.574 1.00 282.01 ? 268  TYR A CZ    1 
ATOM   1762  O  OH    . TYR A  1 268  ? 146.078 154.591 126.213 1.00 277.05 ? 268  TYR A OH    1 
ATOM   1763  N  N     . ASP A  1 269  ? 144.980 151.492 132.288 1.00 264.36 ? 269  ASP A N     1 
ATOM   1764  C  CA    . ASP A  1 269  ? 144.410 150.427 131.470 1.00 266.52 ? 269  ASP A CA    1 
ATOM   1765  C  C     . ASP A  1 269  ? 143.007 149.989 131.885 1.00 269.62 ? 269  ASP A C     1 
ATOM   1766  O  O     . ASP A  1 269  ? 142.366 149.252 131.130 1.00 266.33 ? 269  ASP A O     1 
ATOM   1767  C  CB    . ASP A  1 269  ? 145.341 149.205 131.476 1.00 265.98 ? 269  ASP A CB    1 
ATOM   1768  C  CG    . ASP A  1 269  ? 146.666 149.473 130.781 1.00 264.91 ? 269  ASP A CG    1 
ATOM   1769  O  OD1   . ASP A  1 269  ? 146.691 150.293 129.837 1.00 269.57 ? 269  ASP A OD1   1 
ATOM   1770  O  OD2   . ASP A  1 269  ? 147.681 148.863 131.176 1.00 260.45 ? 269  ASP A OD2   1 
ATOM   1771  N  N     . LEU A  1 270  ? 142.505 150.423 133.042 1.00 277.01 ? 270  LEU A N     1 
ATOM   1772  C  CA    . LEU A  1 270  ? 141.257 149.873 133.563 1.00 278.57 ? 270  LEU A CA    1 
ATOM   1773  C  C     . LEU A  1 270  ? 140.048 150.430 132.811 1.00 281.40 ? 270  LEU A C     1 
ATOM   1774  O  O     . LEU A  1 270  ? 140.159 151.282 131.924 1.00 283.40 ? 270  LEU A O     1 
ATOM   1775  C  CB    . LEU A  1 270  ? 141.138 150.138 135.062 1.00 273.73 ? 270  LEU A CB    1 
ATOM   1776  C  CG    . LEU A  1 270  ? 141.320 151.558 135.609 1.00 265.10 ? 270  LEU A CG    1 
ATOM   1777  C  CD1   . LEU A  1 270  ? 140.059 152.413 135.467 1.00 265.59 ? 270  LEU A CD1   1 
ATOM   1778  C  CD2   . LEU A  1 270  ? 141.759 151.488 137.061 1.00 264.42 ? 270  LEU A CD2   1 
ATOM   1779  N  N     . ALA A  1 271  ? 138.865 149.932 133.186 1.00 286.19 ? 271  ALA A N     1 
ATOM   1780  C  CA    . ALA A  1 271  ? 137.583 150.262 132.584 1.00 288.79 ? 271  ALA A CA    1 
ATOM   1781  C  C     . ALA A  1 271  ? 136.622 150.822 133.630 1.00 288.74 ? 271  ALA A C     1 
ATOM   1782  O  O     . ALA A  1 271  ? 136.709 150.468 134.811 1.00 291.72 ? 271  ALA A O     1 
ATOM   1783  C  CB    . ALA A  1 271  ? 136.952 149.027 131.923 1.00 294.48 ? 271  ALA A CB    1 
ATOM   1784  N  N     . PRO A  1 272  ? 135.691 151.695 133.229 1.00 282.09 ? 272  PRO A N     1 
ATOM   1785  C  CA    . PRO A  1 272  ? 134.804 152.327 134.217 1.00 283.22 ? 272  PRO A CA    1 
ATOM   1786  C  C     . PRO A  1 272  ? 133.672 151.443 134.715 1.00 282.86 ? 272  PRO A C     1 
ATOM   1787  O  O     . PRO A  1 272  ? 133.155 151.701 135.810 1.00 287.89 ? 272  PRO A O     1 
ATOM   1788  C  CB    . PRO A  1 272  ? 134.250 153.541 133.462 1.00 283.23 ? 272  PRO A CB    1 
ATOM   1789  C  CG    . PRO A  1 272  ? 134.264 153.113 132.035 1.00 292.49 ? 272  PRO A CG    1 
ATOM   1790  C  CD    . PRO A  1 272  ? 135.474 152.229 131.872 1.00 289.27 ? 272  PRO A CD    1 
ATOM   1791  N  N     . SER A  1 273  ? 133.254 150.426 133.961 1.00 293.99 ? 273  SER A N     1 
ATOM   1792  C  CA    . SER A  1 273  ? 132.131 149.597 134.382 1.00 298.29 ? 273  SER A CA    1 
ATOM   1793  C  C     . SER A  1 273  ? 132.553 148.355 135.150 1.00 297.79 ? 273  SER A C     1 
ATOM   1794  O  O     . SER A  1 273  ? 131.706 147.721 135.789 1.00 298.95 ? 273  SER A O     1 
ATOM   1795  C  CB    . SER A  1 273  ? 131.296 149.166 133.172 1.00 308.36 ? 273  SER A CB    1 
ATOM   1796  O  OG    . SER A  1 273  ? 130.642 150.276 132.588 1.00 322.16 ? 273  SER A OG    1 
ATOM   1797  N  N     . ASP A  1 274  ? 133.828 147.987 135.095 1.00 300.39 ? 274  ASP A N     1 
ATOM   1798  C  CA    . ASP A  1 274  ? 134.306 146.790 135.769 1.00 299.25 ? 274  ASP A CA    1 
ATOM   1799  C  C     . ASP A  1 274  ? 134.894 147.075 137.141 1.00 296.87 ? 274  ASP A C     1 
ATOM   1800  O  O     . ASP A  1 274  ? 135.199 146.130 137.877 1.00 300.66 ? 274  ASP A O     1 
ATOM   1801  C  CB    . ASP A  1 274  ? 135.348 146.082 134.899 1.00 305.12 ? 274  ASP A CB    1 
ATOM   1802  N  N     . LEU A  1 275  ? 135.052 148.347 137.508 1.00 301.85 ? 275  LEU A N     1 
ATOM   1803  C  CA    . LEU A  1 275  ? 135.658 148.679 138.791 1.00 303.84 ? 275  LEU A CA    1 
ATOM   1804  C  C     . LEU A  1 275  ? 134.665 148.573 139.940 1.00 307.15 ? 275  LEU A C     1 
ATOM   1805  O  O     . LEU A  1 275  ? 135.068 148.296 141.074 1.00 311.53 ? 275  LEU A O     1 
ATOM   1806  C  CB    . LEU A  1 275  ? 136.260 150.088 138.739 1.00 302.29 ? 275  LEU A CB    1 
ATOM   1807  C  CG    . LEU A  1 275  ? 135.368 151.277 138.357 1.00 296.06 ? 275  LEU A CG    1 
ATOM   1808  C  CD1   . LEU A  1 275  ? 134.655 151.877 139.566 1.00 286.85 ? 275  LEU A CD1   1 
ATOM   1809  C  CD2   . LEU A  1 275  ? 136.181 152.342 137.636 1.00 296.93 ? 275  LEU A CD2   1 
ATOM   1810  N  N     . HIS A  1 276  ? 133.375 148.776 139.670 1.00 309.59 ? 276  HIS A N     1 
ATOM   1811  C  CA    . HIS A  1 276  ? 132.408 148.933 140.752 1.00 307.61 ? 276  HIS A CA    1 
ATOM   1812  C  C     . HIS A  1 276  ? 132.228 147.647 141.548 1.00 307.25 ? 276  HIS A C     1 
ATOM   1813  O  O     . HIS A  1 276  ? 132.061 147.691 142.773 1.00 308.09 ? 276  HIS A O     1 
ATOM   1814  C  CB    . HIS A  1 276  ? 131.069 149.405 140.188 1.00 311.20 ? 276  HIS A CB    1 
ATOM   1815  N  N     . HIS A  1 277  ? 132.247 146.495 140.884 1.00 312.54 ? 277  HIS A N     1 
ATOM   1816  C  CA    . HIS A  1 277  ? 131.872 145.247 141.536 1.00 315.80 ? 277  HIS A CA    1 
ATOM   1817  C  C     . HIS A  1 277  ? 132.990 144.216 141.582 1.00 312.40 ? 277  HIS A C     1 
ATOM   1818  O  O     . HIS A  1 277  ? 133.318 143.718 142.666 1.00 309.76 ? 277  HIS A O     1 
ATOM   1819  C  CB    . HIS A  1 277  ? 130.640 144.656 140.834 1.00 325.08 ? 277  HIS A CB    1 
ATOM   1820  C  CG    . HIS A  1 277  ? 130.686 144.767 139.343 1.00 324.48 ? 277  HIS A CG    1 
ATOM   1821  N  ND1   . HIS A  1 277  ? 131.297 143.824 138.544 1.00 328.82 ? 277  HIS A ND1   1 
ATOM   1822  C  CD2   . HIS A  1 277  ? 130.205 145.715 138.503 1.00 316.76 ? 277  HIS A CD2   1 
ATOM   1823  C  CE1   . HIS A  1 277  ? 131.186 144.184 137.277 1.00 326.25 ? 277  HIS A CE1   1 
ATOM   1824  N  NE2   . HIS A  1 277  ? 130.528 145.328 137.225 1.00 317.79 ? 277  HIS A NE2   1 
ATOM   1825  N  N     . HIS A  1 278  ? 133.595 143.887 140.443 1.00 307.40 ? 278  HIS A N     1 
ATOM   1826  C  CA    . HIS A  1 278  ? 134.412 142.682 140.341 1.00 312.56 ? 278  HIS A CA    1 
ATOM   1827  C  C     . HIS A  1 278  ? 135.878 142.913 140.699 1.00 310.38 ? 278  HIS A C     1 
ATOM   1828  O  O     . HIS A  1 278  ? 136.446 142.159 141.496 1.00 310.16 ? 278  HIS A O     1 
ATOM   1829  C  CB    . HIS A  1 278  ? 134.306 142.104 138.926 1.00 309.93 ? 278  HIS A CB    1 
ATOM   1830  N  N     . GLN A  1 279  ? 136.497 143.936 140.116 1.00 292.82 ? 279  GLN A N     1 
ATOM   1831  C  CA    . GLN A  1 279  ? 137.940 144.107 140.215 1.00 294.11 ? 279  GLN A CA    1 
ATOM   1832  C  C     . GLN A  1 279  ? 138.376 144.344 141.659 1.00 291.02 ? 279  GLN A C     1 
ATOM   1833  O  O     . GLN A  1 279  ? 137.596 144.763 142.519 1.00 286.11 ? 279  GLN A O     1 
ATOM   1834  C  CB    . GLN A  1 279  ? 138.398 145.264 139.331 1.00 295.57 ? 279  GLN A CB    1 
ATOM   1835  C  CG    . GLN A  1 279  ? 138.266 144.985 137.843 1.00 298.99 ? 279  GLN A CG    1 
ATOM   1836  C  CD    . GLN A  1 279  ? 138.539 146.209 136.994 1.00 302.61 ? 279  GLN A CD    1 
ATOM   1837  O  OE1   . GLN A  1 279  ? 138.490 147.339 137.480 1.00 295.23 ? 279  GLN A OE1   1 
ATOM   1838  N  NE2   . GLN A  1 279  ? 138.827 145.991 135.717 1.00 310.58 ? 279  GLN A NE2   1 
ATOM   1839  N  N     . ASP A  1 280  ? 139.652 144.057 141.917 1.00 300.62 ? 280  ASP A N     1 
ATOM   1840  C  CA    . ASP A  1 280  ? 140.269 144.201 143.233 1.00 295.31 ? 280  ASP A CA    1 
ATOM   1841  C  C     . ASP A  1 280  ? 141.483 145.119 143.091 1.00 280.23 ? 280  ASP A C     1 
ATOM   1842  O  O     . ASP A  1 280  ? 142.603 144.661 142.853 1.00 279.06 ? 280  ASP A O     1 
ATOM   1843  C  CB    . ASP A  1 280  ? 140.651 142.829 143.812 1.00 299.46 ? 280  ASP A CB    1 
ATOM   1844  C  CG    . ASP A  1 280  ? 141.381 141.948 142.809 1.00 294.14 ? 280  ASP A CG    1 
ATOM   1845  O  OD1   . ASP A  1 280  ? 141.100 142.064 141.596 1.00 294.94 ? 280  ASP A OD1   1 
ATOM   1846  O  OD2   . ASP A  1 280  ? 142.234 141.140 143.233 1.00 293.59 ? 280  ASP A OD2   1 
ATOM   1847  N  N     . LEU A  1 281  ? 141.252 146.424 143.236 1.00 256.42 ? 281  LEU A N     1 
ATOM   1848  C  CA    . LEU A  1 281  ? 142.302 147.431 143.132 1.00 249.17 ? 281  LEU A CA    1 
ATOM   1849  C  C     . LEU A  1 281  ? 142.267 148.300 144.379 1.00 243.98 ? 281  LEU A C     1 
ATOM   1850  O  O     . LEU A  1 281  ? 141.243 148.920 144.678 1.00 250.51 ? 281  LEU A O     1 
ATOM   1851  C  CB    . LEU A  1 281  ? 142.128 148.297 141.879 1.00 253.68 ? 281  LEU A CB    1 
ATOM   1852  C  CG    . LEU A  1 281  ? 142.625 147.757 140.537 1.00 261.03 ? 281  LEU A CG    1 
ATOM   1853  C  CD1   . LEU A  1 281  ? 141.741 146.632 140.016 1.00 270.08 ? 281  LEU A CD1   1 
ATOM   1854  C  CD2   . LEU A  1 281  ? 142.723 148.882 139.521 1.00 273.14 ? 281  LEU A CD2   1 
ATOM   1855  N  N     . GLU A  1 282  ? 143.381 148.342 145.102 1.00 240.07 ? 282  GLU A N     1 
ATOM   1856  C  CA    . GLU A  1 282  ? 143.516 149.193 146.274 1.00 226.21 ? 282  GLU A CA    1 
ATOM   1857  C  C     . GLU A  1 282  ? 144.503 150.312 145.962 1.00 227.59 ? 282  GLU A C     1 
ATOM   1858  O  O     . GLU A  1 282  ? 145.678 150.053 145.673 1.00 234.52 ? 282  GLU A O     1 
ATOM   1859  C  CB    . GLU A  1 282  ? 143.973 148.388 147.490 1.00 222.61 ? 282  GLU A CB    1 
ATOM   1860  N  N     . ILE A  1 283  ? 144.019 151.549 146.020 1.00 213.49 ? 283  ILE A N     1 
ATOM   1861  C  CA    . ILE A  1 283  ? 144.840 152.738 145.826 1.00 207.03 ? 283  ILE A CA    1 
ATOM   1862  C  C     . ILE A  1 283  ? 145.078 153.345 147.200 1.00 207.59 ? 283  ILE A C     1 
ATOM   1863  O  O     . ILE A  1 283  ? 144.143 153.841 147.834 1.00 212.57 ? 283  ILE A O     1 
ATOM   1864  C  CB    . ILE A  1 283  ? 144.171 153.750 144.889 1.00 209.30 ? 283  ILE A CB    1 
ATOM   1865  C  CG1   . ILE A  1 283  ? 143.567 153.045 143.675 1.00 227.71 ? 283  ILE A CG1   1 
ATOM   1866  C  CG2   . ILE A  1 283  ? 145.166 154.820 144.463 1.00 208.73 ? 283  ILE A CG2   1 
ATOM   1867  C  CD1   . ILE A  1 283  ? 144.572 152.304 142.834 1.00 229.96 ? 283  ILE A CD1   1 
ATOM   1868  N  N     . ILE A  1 284  ? 146.316 153.293 147.672 1.00 208.11 ? 284  ILE A N     1 
ATOM   1869  C  CA    . ILE A  1 284  ? 146.655 153.818 148.986 1.00 202.86 ? 284  ILE A CA    1 
ATOM   1870  C  C     . ILE A  1 284  ? 147.431 155.113 148.810 1.00 201.20 ? 284  ILE A C     1 
ATOM   1871  O  O     . ILE A  1 284  ? 148.165 155.303 147.832 1.00 205.28 ? 284  ILE A O     1 
ATOM   1872  C  CB    . ILE A  1 284  ? 147.458 152.803 149.828 1.00 199.41 ? 284  ILE A CB    1 
ATOM   1873  C  CG1   . ILE A  1 284  ? 148.799 152.485 149.165 1.00 201.98 ? 284  ILE A CG1   1 
ATOM   1874  C  CG2   . ILE A  1 284  ? 146.658 151.526 150.024 1.00 208.98 ? 284  ILE A CG2   1 
ATOM   1875  C  CD1   . ILE A  1 284  ? 149.665 151.553 149.978 1.00 211.60 ? 284  ILE A CD1   1 
ATOM   1876  N  N     . VAL A  1 285  ? 147.237 156.024 149.753 1.00 180.40 ? 285  VAL A N     1 
ATOM   1877  C  CA    . VAL A  1 285  ? 148.041 157.234 149.839 1.00 183.60 ? 285  VAL A CA    1 
ATOM   1878  C  C     . VAL A  1 285  ? 148.728 157.253 151.194 1.00 184.99 ? 285  VAL A C     1 
ATOM   1879  O  O     . VAL A  1 285  ? 148.141 156.858 152.212 1.00 193.33 ? 285  VAL A O     1 
ATOM   1880  C  CB    . VAL A  1 285  ? 147.216 158.521 149.604 1.00 182.92 ? 285  VAL A CB    1 
ATOM   1881  C  CG1   . VAL A  1 285  ? 146.356 158.374 148.361 1.00 186.03 ? 285  VAL A CG1   1 
ATOM   1882  C  CG2   . VAL A  1 285  ? 146.370 158.875 150.810 1.00 191.23 ? 285  VAL A CG2   1 
ATOM   1883  N  N     . ILE A  1 286  ? 149.991 157.676 151.188 1.00 186.13 ? 286  ILE A N     1 
ATOM   1884  C  CA    . ILE A  1 286  ? 150.823 157.772 152.378 1.00 185.92 ? 286  ILE A CA    1 
ATOM   1885  C  C     . ILE A  1 286  ? 151.277 159.222 152.458 1.00 188.09 ? 286  ILE A C     1 
ATOM   1886  O  O     . ILE A  1 286  ? 152.158 159.647 151.704 1.00 194.77 ? 286  ILE A O     1 
ATOM   1887  C  CB    . ILE A  1 286  ? 152.025 156.822 152.320 1.00 188.77 ? 286  ILE A CB    1 
ATOM   1888  C  CG1   . ILE A  1 286  ? 151.667 155.527 151.585 1.00 189.25 ? 286  ILE A CG1   1 
ATOM   1889  C  CG2   . ILE A  1 286  ? 152.538 156.522 153.714 1.00 196.41 ? 286  ILE A CG2   1 
ATOM   1890  C  CD1   . ILE A  1 286  ? 150.691 154.640 152.323 1.00 196.43 ? 286  ILE A CD1   1 
ATOM   1891  N  N     . LEU A  1 287  ? 150.674 159.987 153.356 1.00 182.96 ? 287  LEU A N     1 
ATOM   1892  C  CA    . LEU A  1 287  ? 151.033 161.381 153.560 1.00 182.46 ? 287  LEU A CA    1 
ATOM   1893  C  C     . LEU A  1 287  ? 151.966 161.458 154.760 1.00 181.92 ? 287  LEU A C     1 
ATOM   1894  O  O     . LEU A  1 287  ? 151.566 161.146 155.882 1.00 179.75 ? 287  LEU A O     1 
ATOM   1895  C  CB    . LEU A  1 287  ? 149.774 162.229 153.758 1.00 182.89 ? 287  LEU A CB    1 
ATOM   1896  C  CG    . LEU A  1 287  ? 149.591 163.260 154.873 1.00 179.11 ? 287  LEU A CG    1 
ATOM   1897  C  CD1   . LEU A  1 287  ? 150.479 164.480 154.682 1.00 180.57 ? 287  LEU A CD1   1 
ATOM   1898  C  CD2   . LEU A  1 287  ? 148.130 163.665 154.930 1.00 190.40 ? 287  LEU A CD2   1 
ATOM   1899  N  N     . GLU A  1 288  ? 153.214 161.841 154.514 1.00 206.58 ? 288  GLU A N     1 
ATOM   1900  C  CA    . GLU A  1 288  ? 154.231 161.936 155.547 1.00 201.30 ? 288  GLU A CA    1 
ATOM   1901  C  C     . GLU A  1 288  ? 154.486 163.402 155.870 1.00 200.12 ? 288  GLU A C     1 
ATOM   1902  O  O     . GLU A  1 288  ? 154.271 164.283 155.035 1.00 199.06 ? 288  GLU A O     1 
ATOM   1903  C  CB    . GLU A  1 288  ? 155.528 161.249 155.096 1.00 202.68 ? 288  GLU A CB    1 
ATOM   1904  C  CG    . GLU A  1 288  ? 156.614 161.142 156.164 1.00 204.93 ? 288  GLU A CG    1 
ATOM   1905  C  CD    . GLU A  1 288  ? 157.615 162.286 156.108 1.00 215.36 ? 288  GLU A CD    1 
ATOM   1906  O  OE1   . GLU A  1 288  ? 158.078 162.619 154.995 1.00 216.71 ? 288  GLU A OE1   1 
ATOM   1907  O  OE2   . GLU A  1 288  ? 157.935 162.852 157.173 1.00 222.24 ? 288  GLU A OE2   1 
ATOM   1908  N  N     . GLY A  1 289  ? 154.922 163.665 157.096 1.00 174.89 ? 289  GLY A N     1 
ATOM   1909  C  CA    . GLY A  1 289  ? 155.268 165.019 157.469 1.00 174.20 ? 289  GLY A CA    1 
ATOM   1910  C  C     . GLY A  1 289  ? 155.625 165.148 158.931 1.00 173.73 ? 289  GLY A C     1 
ATOM   1911  O  O     . GLY A  1 289  ? 155.175 164.353 159.758 1.00 173.55 ? 289  GLY A O     1 
ATOM   1912  N  N     . VAL A  1 290  ? 156.435 166.144 159.265 1.00 182.16 ? 290  VAL A N     1 
ATOM   1913  C  CA    . VAL A  1 290  ? 156.905 166.351 160.627 1.00 182.27 ? 290  VAL A CA    1 
ATOM   1914  C  C     . VAL A  1 290  ? 156.070 167.448 161.273 1.00 184.68 ? 290  VAL A C     1 
ATOM   1915  O  O     . VAL A  1 290  ? 155.937 168.548 160.722 1.00 189.61 ? 290  VAL A O     1 
ATOM   1916  C  CB    . VAL A  1 290  ? 158.403 166.699 160.648 1.00 179.46 ? 290  VAL A CB    1 
ATOM   1917  C  CG1   . VAL A  1 290  ? 158.754 167.624 159.497 1.00 194.91 ? 290  VAL A CG1   1 
ATOM   1918  C  CG2   . VAL A  1 290  ? 158.784 167.334 161.969 1.00 181.24 ? 290  VAL A CG2   1 
ATOM   1919  N  N     . VAL A  1 291  ? 155.495 167.144 162.439 1.00 161.87 ? 291  VAL A N     1 
ATOM   1920  C  CA    . VAL A  1 291  ? 154.726 168.148 163.161 1.00 160.41 ? 291  VAL A CA    1 
ATOM   1921  C  C     . VAL A  1 291  ? 155.661 169.208 163.733 1.00 165.87 ? 291  VAL A C     1 
ATOM   1922  O  O     . VAL A  1 291  ? 156.865 168.994 163.917 1.00 163.58 ? 291  VAL A O     1 
ATOM   1923  C  CB    . VAL A  1 291  ? 153.874 167.500 164.264 1.00 158.28 ? 291  VAL A CB    1 
ATOM   1924  C  CG1   . VAL A  1 291  ? 152.759 166.673 163.650 1.00 160.71 ? 291  VAL A CG1   1 
ATOM   1925  C  CG2   . VAL A  1 291  ? 154.742 166.638 165.164 1.00 160.00 ? 291  VAL A CG2   1 
ATOM   1926  N  N     . GLU A  1 292  ? 155.088 170.378 164.021 1.00 200.53 ? 292  GLU A N     1 
ATOM   1927  C  CA    . GLU A  1 292  ? 155.893 171.523 164.434 1.00 204.31 ? 292  GLU A CA    1 
ATOM   1928  C  C     . GLU A  1 292  ? 156.409 171.362 165.860 1.00 199.70 ? 292  GLU A C     1 
ATOM   1929  O  O     . GLU A  1 292  ? 157.622 171.329 166.098 1.00 195.78 ? 292  GLU A O     1 
ATOM   1930  C  CB    . GLU A  1 292  ? 155.073 172.807 164.323 1.00 222.61 ? 292  GLU A CB    1 
ATOM   1931  C  CG    . GLU A  1 292  ? 154.458 173.065 162.967 1.00 227.35 ? 292  GLU A CG    1 
ATOM   1932  C  CD    . GLU A  1 292  ? 153.450 174.193 163.017 1.00 229.81 ? 292  GLU A CD    1 
ATOM   1933  O  OE1   . GLU A  1 292  ? 152.556 174.145 163.889 1.00 225.76 ? 292  GLU A OE1   1 
ATOM   1934  O  OE2   . GLU A  1 292  ? 153.559 175.131 162.202 1.00 227.00 ? 292  GLU A OE2   1 
ATOM   1935  N  N     . THR A  1 293  ? 155.490 171.271 166.824 1.00 215.30 ? 293  THR A N     1 
ATOM   1936  C  CA    . THR A  1 293  ? 155.863 171.425 168.228 1.00 211.26 ? 293  THR A CA    1 
ATOM   1937  C  C     . THR A  1 293  ? 156.777 170.299 168.700 1.00 207.13 ? 293  THR A C     1 
ATOM   1938  O  O     . THR A  1 293  ? 157.738 170.547 169.438 1.00 207.23 ? 293  THR A O     1 
ATOM   1939  C  CB    . THR A  1 293  ? 154.605 171.507 169.095 1.00 205.20 ? 293  THR A CB    1 
ATOM   1940  O  OG1   . THR A  1 293  ? 154.959 171.378 170.479 1.00 200.32 ? 293  THR A OG1   1 
ATOM   1941  C  CG2   . THR A  1 293  ? 153.610 170.415 168.717 1.00 204.83 ? 293  THR A CG2   1 
ATOM   1942  N  N     . THR A  1 294  ? 156.510 169.062 168.279 1.00 188.45 ? 294  THR A N     1 
ATOM   1943  C  CA    . THR A  1 294  ? 157.309 167.931 168.736 1.00 186.25 ? 294  THR A CA    1 
ATOM   1944  C  C     . THR A  1 294  ? 158.487 167.624 167.820 1.00 183.89 ? 294  THR A C     1 
ATOM   1945  O  O     . THR A  1 294  ? 159.520 167.138 168.294 1.00 183.00 ? 294  THR A O     1 
ATOM   1946  C  CB    . THR A  1 294  ? 156.440 166.675 168.873 1.00 186.13 ? 294  THR A CB    1 
ATOM   1947  O  OG1   . THR A  1 294  ? 156.707 165.784 167.781 1.00 186.20 ? 294  THR A OG1   1 
ATOM   1948  C  CG2   . THR A  1 294  ? 154.963 167.040 168.867 1.00 190.63 ? 294  THR A CG2   1 
ATOM   1949  N  N     . GLY A  1 295  ? 158.358 167.892 166.520 1.00 194.18 ? 295  GLY A N     1 
ATOM   1950  C  CA    . GLY A  1 295  ? 159.418 167.609 165.580 1.00 194.05 ? 295  GLY A CA    1 
ATOM   1951  C  C     . GLY A  1 295  ? 159.490 166.178 165.095 1.00 193.42 ? 295  GLY A C     1 
ATOM   1952  O  O     . GLY A  1 295  ? 160.414 165.846 164.341 1.00 193.54 ? 295  GLY A O     1 
ATOM   1953  N  N     . ILE A  1 296  ? 158.549 165.321 165.489 1.00 171.23 ? 296  ILE A N     1 
ATOM   1954  C  CA    . ILE A  1 296  ? 158.551 163.929 165.055 1.00 170.18 ? 296  ILE A CA    1 
ATOM   1955  C  C     . ILE A  1 296  ? 157.867 163.817 163.697 1.00 170.11 ? 296  ILE A C     1 
ATOM   1956  O  O     . ILE A  1 296  ? 157.001 164.626 163.340 1.00 172.08 ? 296  ILE A O     1 
ATOM   1957  C  CB    . ILE A  1 296  ? 157.876 163.029 166.108 1.00 170.70 ? 296  ILE A CB    1 
ATOM   1958  C  CG1   . ILE A  1 296  ? 158.351 161.581 165.965 1.00 173.10 ? 296  ILE A CG1   1 
ATOM   1959  C  CG2   . ILE A  1 296  ? 156.359 163.103 165.997 1.00 170.42 ? 296  ILE A CG2   1 
ATOM   1960  C  CD1   . ILE A  1 296  ? 157.866 160.668 167.075 1.00 184.76 ? 296  ILE A CD1   1 
ATOM   1961  N  N     . THR A  1 297  ? 158.258 162.802 162.926 1.00 190.92 ? 297  THR A N     1 
ATOM   1962  C  CA    . THR A  1 297  ? 157.756 162.612 161.565 1.00 192.77 ? 297  THR A CA    1 
ATOM   1963  C  C     . THR A  1 297  ? 156.633 161.581 161.608 1.00 193.66 ? 297  THR A C     1 
ATOM   1964  O  O     . THR A  1 297  ? 156.881 160.380 161.730 1.00 196.24 ? 297  THR A O     1 
ATOM   1965  C  CB    . THR A  1 297  ? 158.868 162.170 160.617 1.00 192.06 ? 297  THR A CB    1 
ATOM   1966  O  OG1   . THR A  1 297  ? 158.922 160.738 160.571 1.00 197.69 ? 297  THR A OG1   1 
ATOM   1967  C  CG2   . THR A  1 297  ? 160.215 162.708 161.078 1.00 194.81 ? 297  THR A CG2   1 
ATOM   1968  N  N     . THR A  1 298  ? 155.398 162.055 161.498 1.00 184.64 ? 298  THR A N     1 
ATOM   1969  C  CA    . THR A  1 298  ? 154.234 161.187 161.470 1.00 184.59 ? 298  THR A CA    1 
ATOM   1970  C  C     . THR A  1 298  ? 153.760 161.014 160.032 1.00 181.67 ? 298  THR A C     1 
ATOM   1971  O  O     . THR A  1 298  ? 154.257 161.655 159.101 1.00 196.60 ? 298  THR A O     1 
ATOM   1972  C  CB    . THR A  1 298  ? 153.114 161.758 162.346 1.00 187.29 ? 298  THR A CB    1 
ATOM   1973  O  OG1   . THR A  1 298  ? 153.678 162.640 163.325 1.00 186.80 ? 298  THR A OG1   1 
ATOM   1974  C  CG2   . THR A  1 298  ? 152.374 160.639 163.063 1.00 192.25 ? 298  THR A CG2   1 
ATOM   1975  N  N     . GLN A  1 299  ? 152.797 160.115 159.852 1.00 199.11 ? 299  GLN A N     1 
ATOM   1976  C  CA    . GLN A  1 299  ? 152.240 159.889 158.529 1.00 199.33 ? 299  GLN A CA    1 
ATOM   1977  C  C     . GLN A  1 299  ? 150.837 159.322 158.671 1.00 198.24 ? 299  GLN A C     1 
ATOM   1978  O  O     . GLN A  1 299  ? 150.441 158.838 159.735 1.00 210.36 ? 299  GLN A O     1 
ATOM   1979  C  CB    . GLN A  1 299  ? 153.119 158.950 157.696 1.00 203.03 ? 299  GLN A CB    1 
ATOM   1980  C  CG    . GLN A  1 299  ? 152.976 157.482 158.046 1.00 205.74 ? 299  GLN A CG    1 
ATOM   1981  C  CD    . GLN A  1 299  ? 153.703 156.586 157.066 1.00 211.22 ? 299  GLN A CD    1 
ATOM   1982  O  OE1   . GLN A  1 299  ? 153.466 155.381 157.014 1.00 212.60 ? 299  GLN A OE1   1 
ATOM   1983  N  NE2   . GLN A  1 299  ? 154.596 157.175 156.278 1.00 209.40 ? 299  GLN A NE2   1 
ATOM   1984  N  N     . ALA A  1 300  ? 150.094 159.391 157.574 1.00 195.56 ? 300  ALA A N     1 
ATOM   1985  C  CA    . ALA A  1 300  ? 148.735 158.880 157.495 1.00 194.05 ? 300  ALA A CA    1 
ATOM   1986  C  C     . ALA A  1 300  ? 148.594 158.071 156.218 1.00 194.70 ? 300  ALA A C     1 
ATOM   1987  O  O     . ALA A  1 300  ? 148.880 158.570 155.127 1.00 198.32 ? 300  ALA A O     1 
ATOM   1988  C  CB    . ALA A  1 300  ? 147.708 160.014 157.517 1.00 194.51 ? 300  ALA A CB    1 
ATOM   1989  N  N     . ARG A  1 301  ? 148.151 156.829 156.361 1.00 185.44 ? 301  ARG A N     1 
ATOM   1990  C  CA    . ARG A  1 301  ? 147.984 155.909 155.247 1.00 190.56 ? 301  ARG A CA    1 
ATOM   1991  C  C     . ARG A  1 301  ? 146.507 155.579 155.119 1.00 192.33 ? 301  ARG A C     1 
ATOM   1992  O  O     . ARG A  1 301  ? 145.855 155.258 156.118 1.00 198.93 ? 301  ARG A O     1 
ATOM   1993  C  CB    . ARG A  1 301  ? 148.789 154.626 155.470 1.00 192.68 ? 301  ARG A CB    1 
ATOM   1994  C  CG    . ARG A  1 301  ? 150.223 154.862 155.896 1.00 203.03 ? 301  ARG A CG    1 
ATOM   1995  C  CD    . ARG A  1 301  ? 150.575 154.055 157.129 1.00 202.05 ? 301  ARG A CD    1 
ATOM   1996  N  NE    . ARG A  1 301  ? 149.947 154.600 158.327 1.00 201.87 ? 301  ARG A NE    1 
ATOM   1997  C  CZ    . ARG A  1 301  ? 150.150 154.132 159.553 1.00 211.17 ? 301  ARG A CZ    1 
ATOM   1998  N  NH1   . ARG A  1 301  ? 150.967 153.106 159.745 1.00 221.36 ? 301  ARG A NH1   1 
ATOM   1999  N  NH2   . ARG A  1 301  ? 149.536 154.691 160.586 1.00 209.80 ? 301  ARG A NH2   1 
ATOM   2000  N  N     . THR A  1 302  ? 145.977 155.664 153.903 1.00 207.11 ? 302  THR A N     1 
ATOM   2001  C  CA    . THR A  1 302  ? 144.585 155.280 153.700 1.00 205.87 ? 302  THR A CA    1 
ATOM   2002  C  C     . THR A  1 302  ? 144.423 154.583 152.357 1.00 210.51 ? 302  THR A C     1 
ATOM   2003  O  O     . THR A  1 302  ? 145.184 154.822 151.417 1.00 211.32 ? 302  THR A O     1 
ATOM   2004  C  CB    . THR A  1 302  ? 143.628 156.481 153.798 1.00 208.46 ? 302  THR A CB    1 
ATOM   2005  O  OG1   . THR A  1 302  ? 142.277 156.009 153.865 1.00 218.18 ? 302  THR A OG1   1 
ATOM   2006  C  CG2   . THR A  1 302  ? 143.769 157.387 152.596 1.00 206.94 ? 302  THR A CG2   1 
ATOM   2007  N  N     . SER A  1 303  ? 143.421 153.707 152.290 1.00 232.25 ? 303  SER A N     1 
ATOM   2008  C  CA    . SER A  1 303  ? 143.147 152.885 151.122 1.00 233.82 ? 303  SER A CA    1 
ATOM   2009  C  C     . SER A  1 303  ? 141.821 153.273 150.486 1.00 237.72 ? 303  SER A C     1 
ATOM   2010  O  O     . SER A  1 303  ? 140.908 153.765 151.156 1.00 246.16 ? 303  SER A O     1 
ATOM   2011  C  CB    . SER A  1 303  ? 143.099 151.399 151.486 1.00 236.58 ? 303  SER A CB    1 
ATOM   2012  O  OG    . SER A  1 303  ? 144.273 150.999 152.154 1.00 249.07 ? 303  SER A OG    1 
ATOM   2013  N  N     . TYR A  1 304  ? 141.727 153.037 149.180 1.00 232.99 ? 304  TYR A N     1 
ATOM   2014  C  CA    . TYR A  1 304  ? 140.486 153.185 148.434 1.00 238.96 ? 304  TYR A CA    1 
ATOM   2015  C  C     . TYR A  1 304  ? 140.320 151.956 147.558 1.00 253.26 ? 304  TYR A C     1 
ATOM   2016  O  O     . TYR A  1 304  ? 141.183 151.664 146.724 1.00 258.75 ? 304  TYR A O     1 
ATOM   2017  C  CB    . TYR A  1 304  ? 140.494 154.470 147.602 1.00 230.01 ? 304  TYR A CB    1 
ATOM   2018  C  CG    . TYR A  1 304  ? 140.514 155.709 148.464 1.00 226.18 ? 304  TYR A CG    1 
ATOM   2019  C  CD1   . TYR A  1 304  ? 141.712 156.264 148.893 1.00 228.23 ? 304  TYR A CD1   1 
ATOM   2020  C  CD2   . TYR A  1 304  ? 139.331 156.311 148.871 1.00 237.98 ? 304  TYR A CD2   1 
ATOM   2021  C  CE1   . TYR A  1 304  ? 141.731 157.391 149.691 1.00 228.81 ? 304  TYR A CE1   1 
ATOM   2022  C  CE2   . TYR A  1 304  ? 139.342 157.439 149.666 1.00 242.35 ? 304  TYR A CE2   1 
ATOM   2023  C  CZ    . TYR A  1 304  ? 140.543 157.972 150.073 1.00 235.15 ? 304  TYR A CZ    1 
ATOM   2024  O  OH    . TYR A  1 304  ? 140.554 159.095 150.868 1.00 242.90 ? 304  TYR A OH    1 
ATOM   2025  N  N     . LEU A  1 305  ? 139.226 151.228 147.767 1.00 260.30 ? 305  LEU A N     1 
ATOM   2026  C  CA    . LEU A  1 305  ? 138.996 149.972 147.075 1.00 263.99 ? 305  LEU A CA    1 
ATOM   2027  C  C     . LEU A  1 305  ? 138.381 150.226 145.702 1.00 271.73 ? 305  LEU A C     1 
ATOM   2028  O  O     . LEU A  1 305  ? 138.151 151.366 145.290 1.00 271.20 ? 305  LEU A O     1 
ATOM   2029  C  CB    . LEU A  1 305  ? 138.094 149.063 147.908 1.00 265.27 ? 305  LEU A CB    1 
ATOM   2030  C  CG    . LEU A  1 305  ? 138.543 148.736 149.333 1.00 268.50 ? 305  LEU A CG    1 
ATOM   2031  C  CD1   . LEU A  1 305  ? 137.496 147.882 150.029 1.00 280.14 ? 305  LEU A CD1   1 
ATOM   2032  C  CD2   . LEU A  1 305  ? 139.895 148.040 149.326 1.00 269.77 ? 305  LEU A CD2   1 
ATOM   2033  N  N     . ALA A  1 306  ? 138.114 149.136 144.980 1.00 268.93 ? 306  ALA A N     1 
ATOM   2034  C  CA    . ALA A  1 306  ? 137.431 149.252 143.700 1.00 275.64 ? 306  ALA A CA    1 
ATOM   2035  C  C     . ALA A  1 306  ? 135.959 149.597 143.884 1.00 276.25 ? 306  ALA A C     1 
ATOM   2036  O  O     . ALA A  1 306  ? 135.384 150.309 143.056 1.00 279.78 ? 306  ALA A O     1 
ATOM   2037  C  CB    . ALA A  1 306  ? 137.581 147.957 142.904 1.00 281.36 ? 306  ALA A CB    1 
ATOM   2038  N  N     . ASP A  1 307  ? 135.335 149.109 144.956 1.00 286.70 ? 307  ASP A N     1 
ATOM   2039  C  CA    . ASP A  1 307  ? 133.934 149.422 145.204 1.00 291.14 ? 307  ASP A CA    1 
ATOM   2040  C  C     . ASP A  1 307  ? 133.747 150.785 145.858 1.00 286.73 ? 307  ASP A C     1 
ATOM   2041  O  O     . ASP A  1 307  ? 132.622 151.298 145.881 1.00 285.51 ? 307  ASP A O     1 
ATOM   2042  C  CB    . ASP A  1 307  ? 133.292 148.338 146.077 1.00 292.36 ? 307  ASP A CB    1 
ATOM   2043  C  CG    . ASP A  1 307  ? 133.391 146.952 145.461 1.00 300.01 ? 307  ASP A CG    1 
ATOM   2044  O  OD1   . ASP A  1 307  ? 134.125 146.783 144.465 1.00 302.87 ? 307  ASP A OD1   1 
ATOM   2045  O  OD2   . ASP A  1 307  ? 132.729 146.027 145.974 1.00 300.25 ? 307  ASP A OD2   1 
ATOM   2046  N  N     . GLU A  1 308  ? 134.821 151.381 146.386 1.00 273.79 ? 308  GLU A N     1 
ATOM   2047  C  CA    . GLU A  1 308  ? 134.718 152.677 147.051 1.00 265.23 ? 308  GLU A CA    1 
ATOM   2048  C  C     . GLU A  1 308  ? 134.752 153.828 146.053 1.00 260.10 ? 308  GLU A C     1 
ATOM   2049  O  O     . GLU A  1 308  ? 133.996 154.796 146.191 1.00 262.23 ? 308  GLU A O     1 
ATOM   2050  C  CB    . GLU A  1 308  ? 135.853 152.837 148.066 1.00 266.06 ? 308  GLU A CB    1 
ATOM   2051  C  CG    . GLU A  1 308  ? 135.801 151.868 149.235 1.00 269.47 ? 308  GLU A CG    1 
ATOM   2052  C  CD    . GLU A  1 308  ? 134.698 152.202 150.219 1.00 280.64 ? 308  GLU A CD    1 
ATOM   2053  O  OE1   . GLU A  1 308  ? 134.227 153.359 150.220 1.00 281.15 ? 308  GLU A OE1   1 
ATOM   2054  O  OE2   . GLU A  1 308  ? 134.300 151.307 150.994 1.00 292.20 ? 308  GLU A OE2   1 
ATOM   2055  N  N     . ILE A  1 309  ? 135.622 153.741 145.057 1.00 281.92 ? 309  ILE A N     1 
ATOM   2056  C  CA    . ILE A  1 309  ? 135.814 154.822 144.102 1.00 278.79 ? 309  ILE A CA    1 
ATOM   2057  C  C     . ILE A  1 309  ? 134.678 154.819 143.086 1.00 275.03 ? 309  ILE A C     1 
ATOM   2058  O  O     . ILE A  1 309  ? 134.136 153.768 142.724 1.00 278.68 ? 309  ILE A O     1 
ATOM   2059  C  CB    . ILE A  1 309  ? 137.199 154.688 143.431 1.00 282.57 ? 309  ILE A CB    1 
ATOM   2060  C  CG1   . ILE A  1 309  ? 137.531 155.924 142.596 1.00 275.64 ? 309  ILE A CG1   1 
ATOM   2061  C  CG2   . ILE A  1 309  ? 137.277 153.415 142.594 1.00 291.32 ? 309  ILE A CG2   1 
ATOM   2062  C  CD1   . ILE A  1 309  ? 138.991 156.015 142.200 1.00 269.53 ? 309  ILE A CD1   1 
ATOM   2063  N  N     . LEU A  1 310  ? 134.299 156.013 142.633 1.00 272.23 ? 310  LEU A N     1 
ATOM   2064  C  CA    . LEU A  1 310  ? 133.205 156.192 141.688 1.00 277.59 ? 310  LEU A CA    1 
ATOM   2065  C  C     . LEU A  1 310  ? 133.692 157.030 140.510 1.00 278.85 ? 310  LEU A C     1 
ATOM   2066  O  O     . LEU A  1 310  ? 134.859 157.427 140.442 1.00 280.69 ? 310  LEU A O     1 
ATOM   2067  C  CB    . LEU A  1 310  ? 131.985 156.824 142.372 1.00 275.79 ? 310  LEU A CB    1 
ATOM   2068  C  CG    . LEU A  1 310  ? 132.217 158.029 143.286 1.00 272.65 ? 310  LEU A CG    1 
ATOM   2069  C  CD1   . LEU A  1 310  ? 132.091 159.328 142.509 1.00 269.41 ? 310  LEU A CD1   1 
ATOM   2070  C  CD2   . LEU A  1 310  ? 131.244 157.999 144.454 1.00 276.38 ? 310  LEU A CD2   1 
ATOM   2071  N  N     . TRP A  1 311  ? 132.783 157.304 139.573 1.00 266.86 ? 311  TRP A N     1 
ATOM   2072  C  CA    . TRP A  1 311  ? 133.145 157.848 138.272 1.00 267.84 ? 311  TRP A CA    1 
ATOM   2073  C  C     . TRP A  1 311  ? 132.327 159.089 137.942 1.00 266.32 ? 311  TRP A C     1 
ATOM   2074  O  O     . TRP A  1 311  ? 131.138 159.171 138.270 1.00 274.41 ? 311  TRP A O     1 
ATOM   2075  C  CB    . TRP A  1 311  ? 132.942 156.796 137.175 1.00 273.93 ? 311  TRP A CB    1 
ATOM   2076  C  CG    . TRP A  1 311  ? 133.429 157.217 135.826 1.00 282.48 ? 311  TRP A CG    1 
ATOM   2077  C  CD1   . TRP A  1 311  ? 132.780 158.016 134.930 1.00 289.66 ? 311  TRP A CD1   1 
ATOM   2078  C  CD2   . TRP A  1 311  ? 134.671 156.853 135.212 1.00 287.38 ? 311  TRP A CD2   1 
ATOM   2079  N  NE1   . TRP A  1 311  ? 133.543 158.178 133.800 1.00 297.00 ? 311  TRP A NE1   1 
ATOM   2080  C  CE2   . TRP A  1 311  ? 134.708 157.472 133.947 1.00 292.09 ? 311  TRP A CE2   1 
ATOM   2081  C  CE3   . TRP A  1 311  ? 135.756 156.067 135.611 1.00 292.32 ? 311  TRP A CE3   1 
ATOM   2082  C  CZ2   . TRP A  1 311  ? 135.788 157.330 133.079 1.00 293.14 ? 311  TRP A CZ2   1 
ATOM   2083  C  CZ3   . TRP A  1 311  ? 136.826 155.926 134.747 1.00 294.53 ? 311  TRP A CZ3   1 
ATOM   2084  C  CH2   . TRP A  1 311  ? 136.834 156.554 133.496 1.00 293.09 ? 311  TRP A CH2   1 
ATOM   2085  N  N     . GLY A  1 312  ? 132.979 160.054 137.290 1.00 255.32 ? 312  GLY A N     1 
ATOM   2086  C  CA    . GLY A  1 312  ? 132.318 161.191 136.674 1.00 258.82 ? 312  GLY A CA    1 
ATOM   2087  C  C     . GLY A  1 312  ? 131.529 162.098 137.595 1.00 262.40 ? 312  GLY A C     1 
ATOM   2088  O  O     . GLY A  1 312  ? 130.303 162.186 137.478 1.00 268.78 ? 312  GLY A O     1 
ATOM   2089  N  N     . GLN A  1 313  ? 132.217 162.794 138.498 1.00 255.09 ? 313  GLN A N     1 
ATOM   2090  C  CA    . GLN A  1 313  ? 131.567 163.647 139.485 1.00 253.61 ? 313  GLN A CA    1 
ATOM   2091  C  C     . GLN A  1 313  ? 132.458 164.858 139.749 1.00 251.44 ? 313  GLN A C     1 
ATOM   2092  O  O     . GLN A  1 313  ? 133.552 164.981 139.187 1.00 253.30 ? 313  GLN A O     1 
ATOM   2093  C  CB    . GLN A  1 313  ? 131.290 162.867 140.771 1.00 254.33 ? 313  GLN A CB    1 
ATOM   2094  C  CG    . GLN A  1 313  ? 130.211 161.798 140.657 1.00 263.04 ? 313  GLN A CG    1 
ATOM   2095  C  CD    . GLN A  1 313  ? 128.883 162.356 140.189 1.00 264.97 ? 313  GLN A CD    1 
ATOM   2096  O  OE1   . GLN A  1 313  ? 128.211 163.090 140.914 1.00 265.28 ? 313  GLN A OE1   1 
ATOM   2097  N  NE2   . GLN A  1 313  ? 128.497 162.011 138.967 1.00 261.63 ? 313  GLN A NE2   1 
ATOM   2098  N  N     . ARG A  1 314  ? 131.993 165.759 140.617 1.00 255.14 ? 314  ARG A N     1 
ATOM   2099  C  CA    . ARG A  1 314  ? 132.829 166.890 141.007 1.00 256.18 ? 314  ARG A CA    1 
ATOM   2100  C  C     . ARG A  1 314  ? 132.525 167.314 142.435 1.00 259.21 ? 314  ARG A C     1 
ATOM   2101  O  O     . ARG A  1 314  ? 131.362 167.390 142.834 1.00 262.40 ? 314  ARG A O     1 
ATOM   2102  C  CB    . ARG A  1 314  ? 132.646 168.083 140.060 1.00 264.25 ? 314  ARG A CB    1 
ATOM   2103  C  CG    . ARG A  1 314  ? 133.351 169.348 140.523 1.00 267.65 ? 314  ARG A CG    1 
ATOM   2104  C  CD    . ARG A  1 314  ? 133.456 170.401 139.429 1.00 276.45 ? 314  ARG A CD    1 
ATOM   2105  N  NE    . ARG A  1 314  ? 132.158 170.876 138.957 1.00 273.73 ? 314  ARG A NE    1 
ATOM   2106  C  CZ    . ARG A  1 314  ? 131.740 170.769 137.701 1.00 270.22 ? 314  ARG A CZ    1 
ATOM   2107  N  NH1   . ARG A  1 314  ? 132.519 170.209 136.785 1.00 266.40 ? 314  ARG A NH1   1 
ATOM   2108  N  NH2   . ARG A  1 314  ? 130.544 171.224 137.356 1.00 268.28 ? 314  ARG A NH2   1 
ATOM   2109  N  N     . PHE A  1 315  ? 133.577 167.604 143.195 1.00 259.27 ? 315  PHE A N     1 
ATOM   2110  C  CA    . PHE A  1 315  ? 133.408 168.097 144.553 1.00 259.34 ? 315  PHE A CA    1 
ATOM   2111  C  C     . PHE A  1 315  ? 132.832 169.511 144.548 1.00 255.54 ? 315  PHE A C     1 
ATOM   2112  O  O     . PHE A  1 315  ? 132.953 170.260 143.574 1.00 262.46 ? 315  PHE A O     1 
ATOM   2113  C  CB    . PHE A  1 315  ? 134.742 168.079 145.301 1.00 269.18 ? 315  PHE A CB    1 
ATOM   2114  C  CG    . PHE A  1 315  ? 135.246 166.699 145.613 1.00 260.86 ? 315  PHE A CG    1 
ATOM   2115  C  CD1   . PHE A  1 315  ? 134.361 165.652 145.814 1.00 257.48 ? 315  PHE A CD1   1 
ATOM   2116  C  CD2   . PHE A  1 315  ? 136.604 166.448 145.709 1.00 253.04 ? 315  PHE A CD2   1 
ATOM   2117  C  CE1   . PHE A  1 315  ? 134.822 164.382 146.103 1.00 260.31 ? 315  PHE A CE1   1 
ATOM   2118  C  CE2   . PHE A  1 315  ? 137.072 165.180 145.998 1.00 250.19 ? 315  PHE A CE2   1 
ATOM   2119  C  CZ    . PHE A  1 315  ? 136.179 164.145 146.196 1.00 258.60 ? 315  PHE A CZ    1 
ATOM   2120  N  N     . VAL A  1 316  ? 132.205 169.874 145.661 1.00 263.83 ? 316  VAL A N     1 
ATOM   2121  C  CA    . VAL A  1 316  ? 131.619 171.201 145.827 1.00 265.59 ? 316  VAL A CA    1 
ATOM   2122  C  C     . VAL A  1 316  ? 132.690 172.131 146.384 1.00 264.05 ? 316  VAL A C     1 
ATOM   2123  O  O     . VAL A  1 316  ? 133.419 171.741 147.307 1.00 266.52 ? 316  VAL A O     1 
ATOM   2124  C  CB    . VAL A  1 316  ? 130.386 171.150 146.744 1.00 266.97 ? 316  VAL A CB    1 
ATOM   2125  C  CG1   . VAL A  1 316  ? 129.648 172.482 146.731 1.00 269.35 ? 316  VAL A CG1   1 
ATOM   2126  C  CG2   . VAL A  1 316  ? 129.463 170.017 146.327 1.00 276.19 ? 316  VAL A CG2   1 
ATOM   2127  N  N     . PRO A  1 317  ? 132.835 173.348 145.855 1.00 248.00 ? 317  PRO A N     1 
ATOM   2128  C  CA    . PRO A  1 317  ? 133.863 174.270 146.370 1.00 245.61 ? 317  PRO A CA    1 
ATOM   2129  C  C     . PRO A  1 317  ? 133.674 174.558 147.853 1.00 253.65 ? 317  PRO A C     1 
ATOM   2130  O  O     . PRO A  1 317  ? 132.613 175.015 148.289 1.00 257.14 ? 317  PRO A O     1 
ATOM   2131  C  CB    . PRO A  1 317  ? 133.665 175.528 145.516 1.00 247.93 ? 317  PRO A CB    1 
ATOM   2132  C  CG    . PRO A  1 317  ? 133.071 175.022 144.247 1.00 260.09 ? 317  PRO A CG    1 
ATOM   2133  C  CD    . PRO A  1 317  ? 132.183 173.875 144.643 1.00 258.48 ? 317  PRO A CD    1 
ATOM   2134  N  N     . ILE A  1 318  ? 134.723 174.286 148.627 1.00 271.35 ? 318  ILE A N     1 
ATOM   2135  C  CA    . ILE A  1 318  ? 134.671 174.475 150.075 1.00 259.79 ? 318  ILE A CA    1 
ATOM   2136  C  C     . ILE A  1 318  ? 134.942 175.928 150.438 1.00 262.68 ? 318  ILE A C     1 
ATOM   2137  O  O     . ILE A  1 318  ? 134.128 176.585 151.099 1.00 264.73 ? 318  ILE A O     1 
ATOM   2138  C  CB    . ILE A  1 318  ? 135.666 173.532 150.775 1.00 250.96 ? 318  ILE A CB    1 
ATOM   2139  C  CG1   . ILE A  1 318  ? 135.297 172.075 150.505 1.00 253.43 ? 318  ILE A CG1   1 
ATOM   2140  C  CG2   . ILE A  1 318  ? 135.712 173.807 152.270 1.00 248.65 ? 318  ILE A CG2   1 
ATOM   2141  C  CD1   . ILE A  1 318  ? 133.891 171.738 150.897 1.00 257.03 ? 318  ILE A CD1   1 
ATOM   2142  N  N     . VAL A  1 319  ? 136.099 176.446 150.012 1.00 250.93 ? 319  VAL A N     1 
ATOM   2143  C  CA    . VAL A  1 319  ? 136.504 177.796 150.378 1.00 248.72 ? 319  VAL A CA    1 
ATOM   2144  C  C     . VAL A  1 319  ? 135.498 178.804 149.843 1.00 253.98 ? 319  VAL A C     1 
ATOM   2145  O  O     . VAL A  1 319  ? 134.932 178.636 148.756 1.00 262.43 ? 319  VAL A O     1 
ATOM   2146  C  CB    . VAL A  1 319  ? 137.920 178.083 149.850 1.00 244.48 ? 319  VAL A CB    1 
ATOM   2147  C  CG1   . VAL A  1 319  ? 138.421 179.433 150.350 1.00 251.64 ? 319  VAL A CG1   1 
ATOM   2148  C  CG2   . VAL A  1 319  ? 138.873 176.969 150.255 1.00 245.00 ? 319  VAL A CG2   1 
ATOM   2149  N  N     . ALA A  1 320  ? 135.255 179.856 150.620 1.00 241.67 ? 320  ALA A N     1 
ATOM   2150  C  CA    . ALA A  1 320  ? 134.337 180.911 150.224 1.00 255.11 ? 320  ALA A CA    1 
ATOM   2151  C  C     . ALA A  1 320  ? 134.863 182.240 150.737 1.00 262.56 ? 320  ALA A C     1 
ATOM   2152  O  O     . ALA A  1 320  ? 135.430 182.308 151.831 1.00 265.07 ? 320  ALA A O     1 
ATOM   2153  C  CB    . ALA A  1 320  ? 132.922 180.658 150.760 1.00 260.83 ? 320  ALA A CB    1 
ATOM   2154  N  N     . GLU A  1 321  ? 134.677 183.291 149.945 1.00 273.42 ? 321  GLU A N     1 
ATOM   2155  C  CA    . GLU A  1 321  ? 135.128 184.624 150.332 1.00 270.53 ? 321  GLU A CA    1 
ATOM   2156  C  C     . GLU A  1 321  ? 134.203 185.152 151.418 1.00 275.21 ? 321  GLU A C     1 
ATOM   2157  O  O     . GLU A  1 321  ? 133.127 185.682 151.138 1.00 283.56 ? 321  GLU A O     1 
ATOM   2158  C  CB    . GLU A  1 321  ? 135.154 185.553 149.123 1.00 271.59 ? 321  GLU A CB    1 
ATOM   2159  C  CG    . GLU A  1 321  ? 136.022 185.046 147.987 1.00 271.35 ? 321  GLU A CG    1 
ATOM   2160  C  CD    . GLU A  1 321  ? 137.471 184.870 148.395 1.00 269.36 ? 321  GLU A CD    1 
ATOM   2161  O  OE1   . GLU A  1 321  ? 137.949 185.634 149.261 1.00 272.60 ? 321  GLU A OE1   1 
ATOM   2162  O  OE2   . GLU A  1 321  ? 138.132 183.963 147.848 1.00 272.36 ? 321  GLU A OE2   1 
ATOM   2163  N  N     . GLU A  1 322  ? 134.628 185.012 152.670 1.00 263.58 ? 322  GLU A N     1 
ATOM   2164  C  CA    . GLU A  1 322  ? 133.841 185.464 153.809 1.00 272.24 ? 322  GLU A CA    1 
ATOM   2165  C  C     . GLU A  1 322  ? 133.961 186.982 153.939 1.00 281.09 ? 322  GLU A C     1 
ATOM   2166  O  O     . GLU A  1 322  ? 134.389 187.680 153.013 1.00 284.40 ? 322  GLU A O     1 
ATOM   2167  C  CB    . GLU A  1 322  ? 134.281 184.740 155.080 1.00 273.65 ? 322  GLU A CB    1 
ATOM   2168  N  N     . ASP A  1 323  ? 133.545 187.500 155.099 1.00 282.56 ? 323  ASP A N     1 
ATOM   2169  C  CA    . ASP A  1 323  ? 133.542 188.935 155.372 1.00 294.75 ? 323  ASP A CA    1 
ATOM   2170  C  C     . ASP A  1 323  ? 134.875 189.582 155.011 1.00 289.81 ? 323  ASP A C     1 
ATOM   2171  O  O     . ASP A  1 323  ? 134.932 190.534 154.225 1.00 292.67 ? 323  ASP A O     1 
ATOM   2172  C  CB    . ASP A  1 323  ? 133.215 189.173 156.849 1.00 305.55 ? 323  ASP A CB    1 
ATOM   2173  C  CG    . ASP A  1 323  ? 132.294 188.112 157.421 1.00 307.99 ? 323  ASP A CG    1 
ATOM   2174  O  OD1   . ASP A  1 323  ? 131.318 187.728 156.739 1.00 310.68 ? 323  ASP A OD1   1 
ATOM   2175  O  OD2   . ASP A  1 323  ? 132.558 187.654 158.552 1.00 311.53 ? 323  ASP A OD2   1 
ATOM   2176  N  N     . GLY A  1 324  ? 135.962 189.067 155.582 1.00 301.50 ? 324  GLY A N     1 
ATOM   2177  C  CA    . GLY A  1 324  ? 137.290 189.564 155.284 1.00 296.70 ? 324  GLY A CA    1 
ATOM   2178  C  C     . GLY A  1 324  ? 138.331 188.465 155.236 1.00 297.25 ? 324  GLY A C     1 
ATOM   2179  O  O     . GLY A  1 324  ? 139.534 188.742 155.228 1.00 300.75 ? 324  GLY A O     1 
ATOM   2180  N  N     . ARG A  1 325  ? 137.882 187.212 155.208 1.00 301.30 ? 325  ARG A N     1 
ATOM   2181  C  CA    . ARG A  1 325  ? 138.776 186.060 155.218 1.00 281.77 ? 325  ARG A CA    1 
ATOM   2182  C  C     . ARG A  1 325  ? 138.242 185.015 154.245 1.00 282.19 ? 325  ARG A C     1 
ATOM   2183  O  O     . ARG A  1 325  ? 137.385 185.296 153.400 1.00 291.04 ? 325  ARG A O     1 
ATOM   2184  C  CB    . ARG A  1 325  ? 138.912 185.471 156.628 1.00 276.08 ? 325  ARG A CB    1 
ATOM   2185  C  CG    . ARG A  1 325  ? 139.661 186.330 157.625 1.00 273.51 ? 325  ARG A CG    1 
ATOM   2186  C  CD    . ARG A  1 325  ? 139.815 185.579 158.938 1.00 274.30 ? 325  ARG A CD    1 
ATOM   2187  N  NE    . ARG A  1 325  ? 140.551 186.345 159.938 1.00 276.15 ? 325  ARG A NE    1 
ATOM   2188  C  CZ    . ARG A  1 325  ? 140.873 185.882 161.142 1.00 276.38 ? 325  ARG A CZ    1 
ATOM   2189  N  NH1   . ARG A  1 325  ? 140.526 184.651 161.496 1.00 265.00 ? 325  ARG A NH1   1 
ATOM   2190  N  NH2   . ARG A  1 325  ? 141.544 186.646 161.993 1.00 287.84 ? 325  ARG A NH2   1 
ATOM   2191  N  N     . TYR A  1 326  ? 138.764 183.800 154.369 1.00 259.78 ? 326  TYR A N     1 
ATOM   2192  C  CA    . TYR A  1 326  ? 138.316 182.651 153.594 1.00 253.71 ? 326  TYR A CA    1 
ATOM   2193  C  C     . TYR A  1 326  ? 137.662 181.660 154.547 1.00 248.99 ? 326  TYR A C     1 
ATOM   2194  O  O     . TYR A  1 326  ? 138.308 181.171 155.479 1.00 248.91 ? 326  TYR A O     1 
ATOM   2195  C  CB    . TYR A  1 326  ? 139.482 181.995 152.854 1.00 251.73 ? 326  TYR A CB    1 
ATOM   2196  C  CG    . TYR A  1 326  ? 140.259 182.931 151.959 1.00 256.45 ? 326  TYR A CG    1 
ATOM   2197  C  CD1   . TYR A  1 326  ? 141.235 183.770 152.481 1.00 262.92 ? 326  TYR A CD1   1 
ATOM   2198  C  CD2   . TYR A  1 326  ? 140.028 182.967 150.591 1.00 257.07 ? 326  TYR A CD2   1 
ATOM   2199  C  CE1   . TYR A  1 326  ? 141.950 184.625 151.667 1.00 267.76 ? 326  TYR A CE1   1 
ATOM   2200  C  CE2   . TYR A  1 326  ? 140.742 183.819 149.769 1.00 264.14 ? 326  TYR A CE2   1 
ATOM   2201  C  CZ    . TYR A  1 326  ? 141.702 184.646 150.314 1.00 269.65 ? 326  TYR A CZ    1 
ATOM   2202  O  OH    . TYR A  1 326  ? 142.418 185.499 149.505 1.00 278.75 ? 326  TYR A OH    1 
ATOM   2203  N  N     . SER A  1 327  ? 136.386 181.371 154.320 1.00 269.41 ? 327  SER A N     1 
ATOM   2204  C  CA    . SER A  1 327  ? 135.642 180.443 155.156 1.00 262.67 ? 327  SER A CA    1 
ATOM   2205  C  C     . SER A  1 327  ? 135.628 179.068 154.502 1.00 262.30 ? 327  SER A C     1 
ATOM   2206  O  O     . SER A  1 327  ? 135.271 178.939 153.326 1.00 270.06 ? 327  SER A O     1 
ATOM   2207  C  CB    . SER A  1 327  ? 134.213 180.935 155.383 1.00 274.81 ? 327  SER A CB    1 
ATOM   2208  O  OG    . SER A  1 327  ? 133.491 180.992 154.165 1.00 287.58 ? 327  SER A OG    1 
ATOM   2209  N  N     . VAL A  1 328  ? 136.015 178.048 155.261 1.00 246.07 ? 328  VAL A N     1 
ATOM   2210  C  CA    . VAL A  1 328  ? 136.011 176.666 154.799 1.00 246.43 ? 328  VAL A CA    1 
ATOM   2211  C  C     . VAL A  1 328  ? 134.876 175.936 155.503 1.00 249.91 ? 328  VAL A C     1 
ATOM   2212  O  O     . VAL A  1 328  ? 134.815 175.909 156.738 1.00 250.59 ? 328  VAL A O     1 
ATOM   2213  C  CB    . VAL A  1 328  ? 137.362 175.975 155.047 1.00 242.44 ? 328  VAL A CB    1 
ATOM   2214  C  CG1   . VAL A  1 328  ? 138.352 176.352 153.960 1.00 244.08 ? 328  VAL A CG1   1 
ATOM   2215  C  CG2   . VAL A  1 328  ? 137.915 176.354 156.410 1.00 246.58 ? 328  VAL A CG2   1 
ATOM   2216  N  N     . ASP A  1 329  ? 133.973 175.354 154.719 1.00 254.03 ? 329  ASP A N     1 
ATOM   2217  C  CA    . ASP A  1 329  ? 132.829 174.608 155.231 1.00 252.02 ? 329  ASP A CA    1 
ATOM   2218  C  C     . ASP A  1 329  ? 133.100 173.117 155.077 1.00 252.86 ? 329  ASP A C     1 
ATOM   2219  O  O     . ASP A  1 329  ? 133.195 172.613 153.955 1.00 260.16 ? 329  ASP A O     1 
ATOM   2220  C  CB    . ASP A  1 329  ? 131.549 174.997 154.489 1.00 254.28 ? 329  ASP A CB    1 
ATOM   2221  C  CG    . ASP A  1 329  ? 130.320 174.322 155.061 1.00 263.72 ? 329  ASP A CG    1 
ATOM   2222  O  OD1   . ASP A  1 329  ? 130.397 173.816 156.207 1.00 267.86 ? 329  ASP A OD1   1 
ATOM   2223  O  OD2   . ASP A  1 329  ? 129.278 174.287 154.372 1.00 262.82 ? 329  ASP A OD2   1 
ATOM   2224  N  N     . TYR A  1 330  ? 133.211 172.415 156.201 1.00 251.24 ? 330  TYR A N     1 
ATOM   2225  C  CA    . TYR A  1 330  ? 133.494 170.988 156.187 1.00 252.81 ? 330  TYR A CA    1 
ATOM   2226  C  C     . TYR A  1 330  ? 132.244 170.129 156.057 1.00 258.65 ? 330  TYR A C     1 
ATOM   2227  O  O     . TYR A  1 330  ? 132.360 168.900 156.017 1.00 260.58 ? 330  TYR A O     1 
ATOM   2228  C  CB    . TYR A  1 330  ? 134.265 170.596 157.451 1.00 252.10 ? 330  TYR A CB    1 
ATOM   2229  C  CG    . TYR A  1 330  ? 135.704 171.055 157.437 1.00 247.59 ? 330  TYR A CG    1 
ATOM   2230  C  CD1   . TYR A  1 330  ? 136.365 171.281 156.237 1.00 246.69 ? 330  TYR A CD1   1 
ATOM   2231  C  CD2   . TYR A  1 330  ? 136.400 171.261 158.619 1.00 254.07 ? 330  TYR A CD2   1 
ATOM   2232  C  CE1   . TYR A  1 330  ? 137.681 171.698 156.216 1.00 243.97 ? 330  TYR A CE1   1 
ATOM   2233  C  CE2   . TYR A  1 330  ? 137.718 171.680 158.609 1.00 249.44 ? 330  TYR A CE2   1 
ATOM   2234  C  CZ    . TYR A  1 330  ? 138.353 171.895 157.403 1.00 250.55 ? 330  TYR A CZ    1 
ATOM   2235  O  OH    . TYR A  1 330  ? 139.665 172.311 157.384 1.00 263.39 ? 330  TYR A OH    1 
ATOM   2236  N  N     . SER A  1 331  ? 131.056 170.736 155.992 1.00 263.85 ? 331  SER A N     1 
ATOM   2237  C  CA    . SER A  1 331  ? 129.849 169.964 155.714 1.00 267.55 ? 331  SER A CA    1 
ATOM   2238  C  C     . SER A  1 331  ? 129.819 169.506 154.261 1.00 266.29 ? 331  SER A C     1 
ATOM   2239  O  O     . SER A  1 331  ? 129.394 168.381 153.966 1.00 267.32 ? 331  SER A O     1 
ATOM   2240  C  CB    . SER A  1 331  ? 128.604 170.792 156.038 1.00 268.02 ? 331  SER A CB    1 
ATOM   2241  O  OG    . SER A  1 331  ? 128.550 171.125 157.414 1.00 271.56 ? 331  SER A OG    1 
ATOM   2242  N  N     . LYS A  1 332  ? 130.260 170.364 153.345 1.00 278.76 ? 332  LYS A N     1 
ATOM   2243  C  CA    . LYS A  1 332  ? 130.377 170.029 151.932 1.00 273.90 ? 332  LYS A CA    1 
ATOM   2244  C  C     . LYS A  1 332  ? 131.683 169.310 151.603 1.00 274.38 ? 332  LYS A C     1 
ATOM   2245  O  O     . LYS A  1 332  ? 132.008 169.166 150.418 1.00 278.04 ? 332  LYS A O     1 
ATOM   2246  C  CB    . LYS A  1 332  ? 130.259 171.298 151.081 1.00 270.96 ? 332  LYS A CB    1 
ATOM   2247  C  CG    . LYS A  1 332  ? 128.944 172.045 151.242 1.00 270.02 ? 332  LYS A CG    1 
ATOM   2248  C  CD    . LYS A  1 332  ? 127.835 171.405 150.427 1.00 264.88 ? 332  LYS A CD    1 
ATOM   2249  C  CE    . LYS A  1 332  ? 126.521 172.142 150.608 1.00 270.42 ? 332  LYS A CE    1 
ATOM   2250  N  NZ    . LYS A  1 332  ? 126.040 172.052 152.014 1.00 278.19 ? 332  LYS A NZ    1 
ATOM   2251  N  N     . PHE A  1 333  ? 132.432 168.874 152.621 1.00 279.70 ? 333  PHE A N     1 
ATOM   2252  C  CA    . PHE A  1 333  ? 133.720 168.224 152.389 1.00 278.26 ? 333  PHE A CA    1 
ATOM   2253  C  C     . PHE A  1 333  ? 133.558 166.972 151.536 1.00 283.35 ? 333  PHE A C     1 
ATOM   2254  O  O     . PHE A  1 333  ? 134.249 166.800 150.524 1.00 286.72 ? 333  PHE A O     1 
ATOM   2255  C  CB    . PHE A  1 333  ? 134.379 167.884 153.728 1.00 273.90 ? 333  PHE A CB    1 
ATOM   2256  C  CG    . PHE A  1 333  ? 135.776 167.336 153.602 1.00 269.01 ? 333  PHE A CG    1 
ATOM   2257  C  CD1   . PHE A  1 333  ? 136.850 168.184 153.387 1.00 270.70 ? 333  PHE A CD1   1 
ATOM   2258  C  CD2   . PHE A  1 333  ? 136.016 165.978 153.716 1.00 272.03 ? 333  PHE A CD2   1 
ATOM   2259  C  CE1   . PHE A  1 333  ? 138.135 167.686 153.275 1.00 263.85 ? 333  PHE A CE1   1 
ATOM   2260  C  CE2   . PHE A  1 333  ? 137.300 165.475 153.606 1.00 271.71 ? 333  PHE A CE2   1 
ATOM   2261  C  CZ    . PHE A  1 333  ? 138.359 166.330 153.384 1.00 259.75 ? 333  PHE A CZ    1 
ATOM   2262  N  N     . GLY A  1 334  ? 132.651 166.088 151.929 1.00 276.58 ? 334  GLY A N     1 
ATOM   2263  C  CA    . GLY A  1 334  ? 132.362 164.891 151.172 1.00 279.05 ? 334  GLY A CA    1 
ATOM   2264  C  C     . GLY A  1 334  ? 131.185 164.996 150.229 1.00 283.40 ? 334  GLY A C     1 
ATOM   2265  O  O     . GLY A  1 334  ? 130.727 163.967 149.722 1.00 289.87 ? 334  GLY A O     1 
ATOM   2266  N  N     . ASN A  1 335  ? 130.677 166.199 149.976 1.00 275.44 ? 335  ASN A N     1 
ATOM   2267  C  CA    . ASN A  1 335  ? 129.558 166.348 149.061 1.00 279.40 ? 335  ASN A CA    1 
ATOM   2268  C  C     . ASN A  1 335  ? 130.046 166.378 147.617 1.00 286.63 ? 335  ASN A C     1 
ATOM   2269  O  O     . ASN A  1 335  ? 131.196 166.716 147.323 1.00 282.36 ? 335  ASN A O     1 
ATOM   2270  C  CB    . ASN A  1 335  ? 128.756 167.611 149.373 1.00 277.32 ? 335  ASN A CB    1 
ATOM   2271  C  CG    . ASN A  1 335  ? 127.841 167.431 150.566 1.00 276.61 ? 335  ASN A CG    1 
ATOM   2272  O  OD1   . ASN A  1 335  ? 127.213 168.383 151.029 1.00 279.09 ? 335  ASN A OD1   1 
ATOM   2273  N  ND2   . ASN A  1 335  ? 127.767 166.208 151.076 1.00 280.84 ? 335  ASN A ND2   1 
ATOM   2274  N  N     . THR A  1 336  ? 129.141 166.021 146.710 1.00 277.39 ? 336  THR A N     1 
ATOM   2275  C  CA    . THR A  1 336  ? 129.506 165.739 145.331 1.00 272.78 ? 336  THR A CA    1 
ATOM   2276  C  C     . THR A  1 336  ? 128.333 166.064 144.419 1.00 272.90 ? 336  THR A C     1 
ATOM   2277  O  O     . THR A  1 336  ? 127.177 165.801 144.766 1.00 282.64 ? 336  THR A O     1 
ATOM   2278  C  CB    . THR A  1 336  ? 129.920 164.270 145.181 1.00 271.21 ? 336  THR A CB    1 
ATOM   2279  O  OG1   . THR A  1 336  ? 131.052 164.003 146.017 1.00 272.35 ? 336  THR A OG1   1 
ATOM   2280  C  CG2   . THR A  1 336  ? 130.283 163.969 143.764 1.00 272.79 ? 336  THR A CG2   1 
ATOM   2281  N  N     . ILE A  1 337  ? 128.636 166.636 143.253 1.00 272.83 ? 337  ILE A N     1 
ATOM   2282  C  CA    . ILE A  1 337  ? 127.627 167.016 142.275 1.00 277.66 ? 337  ILE A CA    1 
ATOM   2283  C  C     . ILE A  1 337  ? 127.882 166.271 140.972 1.00 277.61 ? 337  ILE A C     1 
ATOM   2284  O  O     . ILE A  1 337  ? 129.023 165.932 140.628 1.00 278.11 ? 337  ILE A O     1 
ATOM   2285  C  CB    . ILE A  1 337  ? 127.600 168.543 142.032 1.00 273.96 ? 337  ILE A CB    1 
ATOM   2286  C  CG1   . ILE A  1 337  ? 128.926 169.018 141.435 1.00 271.06 ? 337  ILE A CG1   1 
ATOM   2287  C  CG2   . ILE A  1 337  ? 127.291 169.283 143.324 1.00 273.74 ? 337  ILE A CG2   1 
ATOM   2288  C  CD1   . ILE A  1 337  ? 128.956 170.497 141.119 1.00 265.29 ? 337  ILE A CD1   1 
ATOM   2289  N  N     . LYS A  1 338  ? 126.793 166.022 140.249 1.00 266.43 ? 338  LYS A N     1 
ATOM   2290  C  CA    . LYS A  1 338  ? 126.860 165.351 138.960 1.00 266.28 ? 338  LYS A CA    1 
ATOM   2291  C  C     . LYS A  1 338  ? 127.457 166.276 137.909 1.00 271.69 ? 338  LYS A C     1 
ATOM   2292  O  O     . LYS A  1 338  ? 127.209 167.486 137.907 1.00 272.89 ? 338  LYS A O     1 
ATOM   2293  C  CB    . LYS A  1 338  ? 125.466 164.902 138.522 1.00 265.69 ? 338  LYS A CB    1 
ATOM   2294  C  CG    . LYS A  1 338  ? 124.764 163.950 139.480 1.00 267.95 ? 338  LYS A CG    1 
ATOM   2295  C  CD    . LYS A  1 338  ? 125.318 162.539 139.364 1.00 272.99 ? 338  LYS A CD    1 
ATOM   2296  C  CE    . LYS A  1 338  ? 125.209 162.022 137.939 1.00 277.02 ? 338  LYS A CE    1 
ATOM   2297  N  NZ    . LYS A  1 338  ? 125.804 160.665 137.791 1.00 276.67 ? 338  LYS A NZ    1 
ATOM   2298  N  N     . VAL A  1 339  ? 128.245 165.700 137.006 1.00 252.95 ? 339  VAL A N     1 
ATOM   2299  C  CA    . VAL A  1 339  ? 128.852 166.455 135.914 1.00 260.37 ? 339  VAL A CA    1 
ATOM   2300  C  C     . VAL A  1 339  ? 128.651 165.690 134.613 1.00 271.65 ? 339  VAL A C     1 
ATOM   2301  O  O     . VAL A  1 339  ? 128.979 164.497 134.539 1.00 268.82 ? 339  VAL A O     1 
ATOM   2302  C  CB    . VAL A  1 339  ? 130.342 166.720 136.175 1.00 256.24 ? 339  VAL A CB    1 
ATOM   2303  C  CG1   . VAL A  1 339  ? 130.994 167.342 134.951 1.00 266.03 ? 339  VAL A CG1   1 
ATOM   2304  C  CG2   . VAL A  1 339  ? 130.502 167.623 137.373 1.00 251.95 ? 339  VAL A CG2   1 
ATOM   2305  N  N     . PRO A  1 340  ? 128.115 166.324 133.570 1.00 282.48 ? 340  PRO A N     1 
ATOM   2306  C  CA    . PRO A  1 340  ? 127.953 165.628 132.287 1.00 285.10 ? 340  PRO A CA    1 
ATOM   2307  C  C     . PRO A  1 340  ? 129.283 165.409 131.584 1.00 289.91 ? 340  PRO A C     1 
ATOM   2308  O  O     . PRO A  1 340  ? 129.632 166.145 130.655 1.00 294.15 ? 340  PRO A O     1 
ATOM   2309  C  CB    . PRO A  1 340  ? 127.041 166.570 131.484 1.00 281.73 ? 340  PRO A CB    1 
ATOM   2310  C  CG    . PRO A  1 340  ? 126.433 167.499 132.501 1.00 279.99 ? 340  PRO A CG    1 
ATOM   2311  C  CD    . PRO A  1 340  ? 127.470 167.647 133.566 1.00 278.99 ? 340  PRO A CD    1 
ATOM   2312  N  N     . THR A  1 341  ? 130.036 164.395 132.028 1.00 283.10 ? 341  THR A N     1 
ATOM   2313  C  CA    . THR A  1 341  ? 131.320 164.037 131.448 1.00 286.06 ? 341  THR A CA    1 
ATOM   2314  C  C     . THR A  1 341  ? 131.241 162.670 130.773 1.00 289.15 ? 341  THR A C     1 
ATOM   2315  O  O     . THR A  1 341  ? 130.516 161.786 131.246 1.00 289.67 ? 341  THR A O     1 
ATOM   2316  C  CB    . THR A  1 341  ? 132.423 164.019 132.518 1.00 282.15 ? 341  THR A CB    1 
ATOM   2317  O  OG1   . THR A  1 341  ? 133.643 163.521 131.957 1.00 281.46 ? 341  THR A OG1   1 
ATOM   2318  C  CG2   . THR A  1 341  ? 132.019 163.149 133.696 1.00 280.06 ? 341  THR A CG2   1 
ATOM   2319  N  N     . PRO A  1 342  ? 131.949 162.471 129.662 1.00 291.23 ? 342  PRO A N     1 
ATOM   2320  C  CA    . PRO A  1 342  ? 131.881 161.178 128.970 1.00 288.43 ? 342  PRO A CA    1 
ATOM   2321  C  C     . PRO A  1 342  ? 132.460 160.051 129.814 1.00 287.03 ? 342  PRO A C     1 
ATOM   2322  O  O     . PRO A  1 342  ? 133.439 160.229 130.542 1.00 287.25 ? 342  PRO A O     1 
ATOM   2323  C  CB    . PRO A  1 342  ? 132.708 161.410 127.700 1.00 289.63 ? 342  PRO A CB    1 
ATOM   2324  C  CG    . PRO A  1 342  ? 133.588 162.578 128.022 1.00 293.65 ? 342  PRO A CG    1 
ATOM   2325  C  CD    . PRO A  1 342  ? 132.778 163.446 128.932 1.00 292.33 ? 342  PRO A CD    1 
ATOM   2326  N  N     . LEU A  1 343  ? 131.837 158.879 129.704 1.00 297.37 ? 343  LEU A N     1 
ATOM   2327  C  CA    . LEU A  1 343  ? 132.220 157.688 130.457 1.00 297.08 ? 343  LEU A CA    1 
ATOM   2328  C  C     . LEU A  1 343  ? 132.849 156.688 129.493 1.00 294.55 ? 343  LEU A C     1 
ATOM   2329  O  O     . LEU A  1 343  ? 132.163 156.143 128.623 1.00 292.54 ? 343  LEU A O     1 
ATOM   2330  C  CB    . LEU A  1 343  ? 131.008 157.093 131.173 1.00 293.90 ? 343  LEU A CB    1 
ATOM   2331  C  CG    . LEU A  1 343  ? 131.191 155.869 132.075 1.00 285.00 ? 343  LEU A CG    1 
ATOM   2332  C  CD1   . LEU A  1 343  ? 130.265 155.962 133.276 1.00 276.17 ? 343  LEU A CD1   1 
ATOM   2333  C  CD2   . LEU A  1 343  ? 130.930 154.578 131.312 1.00 286.67 ? 343  LEU A CD2   1 
ATOM   2334  N  N     . CYS A  1 344  ? 134.148 156.444 129.655 1.00 294.59 ? 344  CYS A N     1 
ATOM   2335  C  CA    . CYS A  1 344  ? 134.873 155.514 128.799 1.00 289.73 ? 344  CYS A CA    1 
ATOM   2336  C  C     . CYS A  1 344  ? 136.184 155.146 129.483 1.00 289.85 ? 344  CYS A C     1 
ATOM   2337  O  O     . CYS A  1 344  ? 136.601 155.781 130.454 1.00 292.18 ? 344  CYS A O     1 
ATOM   2338  C  CB    . CYS A  1 344  ? 135.125 156.114 127.412 1.00 298.35 ? 344  CYS A CB    1 
ATOM   2339  S  SG    . CYS A  1 344  ? 135.665 154.925 126.169 1.00 314.99 ? 344  CYS A SG    1 
ATOM   2340  N  N     . THR A  1 345  ? 136.833 154.107 128.959 1.00 307.15 ? 345  THR A N     1 
ATOM   2341  C  CA    . THR A  1 345  ? 138.086 153.630 129.529 1.00 304.43 ? 345  THR A CA    1 
ATOM   2342  C  C     . THR A  1 345  ? 139.235 154.556 129.148 1.00 298.52 ? 345  THR A C     1 
ATOM   2343  O  O     . THR A  1 345  ? 139.211 155.213 128.104 1.00 300.22 ? 345  THR A O     1 
ATOM   2344  C  CB    . THR A  1 345  ? 138.397 152.207 129.057 1.00 308.54 ? 345  THR A CB    1 
ATOM   2345  O  OG1   . THR A  1 345  ? 139.250 152.258 127.906 1.00 308.62 ? 345  THR A OG1   1 
ATOM   2346  C  CG2   . THR A  1 345  ? 137.113 151.472 128.695 1.00 309.24 ? 345  THR A CG2   1 
ATOM   2347  N  N     . ALA A  1 346  ? 140.256 154.595 130.009 1.00 286.20 ? 346  ALA A N     1 
ATOM   2348  C  CA    . ALA A  1 346  ? 141.366 155.519 129.797 1.00 288.56 ? 346  ALA A CA    1 
ATOM   2349  C  C     . ALA A  1 346  ? 142.176 155.152 128.558 1.00 295.60 ? 346  ALA A C     1 
ATOM   2350  O  O     . ALA A  1 346  ? 142.671 156.039 127.853 1.00 298.21 ? 346  ALA A O     1 
ATOM   2351  C  CB    . ALA A  1 346  ? 142.261 155.559 131.036 1.00 286.88 ? 346  ALA A CB    1 
ATOM   2352  N  N     . ARG A  1 347  ? 142.328 153.856 128.277 1.00 287.79 ? 347  ARG A N     1 
ATOM   2353  C  CA    . ARG A  1 347  ? 142.981 153.440 127.038 1.00 283.08 ? 347  ARG A CA    1 
ATOM   2354  C  C     . ARG A  1 347  ? 142.159 153.860 125.825 1.00 283.96 ? 347  ARG A C     1 
ATOM   2355  O  O     . ARG A  1 347  ? 142.683 154.454 124.873 1.00 282.07 ? 347  ARG A O     1 
ATOM   2356  C  CB    . ARG A  1 347  ? 143.202 151.926 127.048 1.00 280.02 ? 347  ARG A CB    1 
ATOM   2357  C  CG    . ARG A  1 347  ? 143.539 151.332 125.687 1.00 279.01 ? 347  ARG A CG    1 
ATOM   2358  C  CD    . ARG A  1 347  ? 144.944 151.700 125.236 1.00 278.63 ? 347  ARG A CD    1 
ATOM   2359  N  NE    . ARG A  1 347  ? 145.972 151.051 126.046 1.00 280.95 ? 347  ARG A NE    1 
ATOM   2360  C  CZ    . ARG A  1 347  ? 147.274 151.105 125.782 1.00 283.83 ? 347  ARG A CZ    1 
ATOM   2361  N  NH1   . ARG A  1 347  ? 147.711 151.778 124.725 1.00 284.03 ? 347  ARG A NH1   1 
ATOM   2362  N  NH2   . ARG A  1 347  ? 148.139 150.488 126.574 1.00 282.92 ? 347  ARG A NH2   1 
ATOM   2363  N  N     . GLN A  1 348  ? 140.859 153.557 125.845 1.00 304.88 ? 348  GLN A N     1 
ATOM   2364  C  CA    . GLN A  1 348  ? 139.980 153.997 124.769 1.00 306.77 ? 348  GLN A CA    1 
ATOM   2365  C  C     . GLN A  1 348  ? 139.866 155.516 124.726 1.00 303.88 ? 348  GLN A C     1 
ATOM   2366  O  O     . GLN A  1 348  ? 139.713 156.089 123.644 1.00 308.79 ? 348  GLN A O     1 
ATOM   2367  C  CB    . GLN A  1 348  ? 138.599 153.358 124.922 1.00 308.02 ? 348  GLN A CB    1 
ATOM   2368  C  CG    . GLN A  1 348  ? 138.591 151.847 124.753 1.00 306.99 ? 348  GLN A CG    1 
ATOM   2369  C  CD    . GLN A  1 348  ? 138.892 151.416 123.331 1.00 307.75 ? 348  GLN A CD    1 
ATOM   2370  O  OE1   . GLN A  1 348  ? 138.485 152.070 122.372 1.00 315.50 ? 348  GLN A OE1   1 
ATOM   2371  N  NE2   . GLN A  1 348  ? 139.614 150.310 123.189 1.00 302.27 ? 348  GLN A NE2   1 
ATOM   2372  N  N     . LEU A  1 349  ? 139.957 156.183 125.879 1.00 283.01 ? 349  LEU A N     1 
ATOM   2373  C  CA    . LEU A  1 349  ? 139.933 157.643 125.880 1.00 287.09 ? 349  LEU A CA    1 
ATOM   2374  C  C     . LEU A  1 349  ? 141.181 158.211 125.213 1.00 286.87 ? 349  LEU A C     1 
ATOM   2375  O  O     . LEU A  1 349  ? 141.102 159.202 124.480 1.00 289.47 ? 349  LEU A O     1 
ATOM   2376  C  CB    . LEU A  1 349  ? 139.793 158.170 127.310 1.00 292.78 ? 349  LEU A CB    1 
ATOM   2377  C  CG    . LEU A  1 349  ? 139.350 159.623 127.503 1.00 288.07 ? 349  LEU A CG    1 
ATOM   2378  C  CD1   . LEU A  1 349  ? 140.531 160.588 127.463 1.00 288.08 ? 349  LEU A CD1   1 
ATOM   2379  C  CD2   . LEU A  1 349  ? 138.306 160.006 126.463 1.00 286.46 ? 349  LEU A CD2   1 
ATOM   2380  N  N     . ASP A  1 350  ? 142.339 157.590 125.443 1.00 293.52 ? 350  ASP A N     1 
ATOM   2381  C  CA    . ASP A  1 350  ? 143.557 158.036 124.777 1.00 297.76 ? 350  ASP A CA    1 
ATOM   2382  C  C     . ASP A  1 350  ? 143.500 157.748 123.282 1.00 300.99 ? 350  ASP A C     1 
ATOM   2383  O  O     . ASP A  1 350  ? 143.987 158.543 122.469 1.00 306.31 ? 350  ASP A O     1 
ATOM   2384  C  CB    . ASP A  1 350  ? 144.777 157.369 125.411 1.00 300.34 ? 350  ASP A CB    1 
ATOM   2385  C  CG    . ASP A  1 350  ? 146.086 157.984 124.953 1.00 300.72 ? 350  ASP A CG    1 
ATOM   2386  O  OD1   . ASP A  1 350  ? 146.055 159.049 124.302 1.00 304.08 ? 350  ASP A OD1   1 
ATOM   2387  O  OD2   . ASP A  1 350  ? 147.150 157.399 125.247 1.00 296.55 ? 350  ASP A OD2   1 
ATOM   2388  N  N     . GLU A  1 351  ? 142.904 156.617 122.897 1.00 309.42 ? 351  GLU A N     1 
ATOM   2389  C  CA    . GLU A  1 351  ? 142.726 156.332 121.476 1.00 313.07 ? 351  GLU A CA    1 
ATOM   2390  C  C     . GLU A  1 351  ? 141.794 157.351 120.824 1.00 316.03 ? 351  GLU A C     1 
ATOM   2391  O  O     . GLU A  1 351  ? 142.035 157.791 119.691 1.00 317.60 ? 351  GLU A O     1 
ATOM   2392  C  CB    . GLU A  1 351  ? 142.195 154.912 121.287 1.00 310.81 ? 351  GLU A CB    1 
ATOM   2393  C  CG    . GLU A  1 351  ? 143.154 153.830 121.755 1.00 307.88 ? 351  GLU A CG    1 
ATOM   2394  C  CD    . GLU A  1 351  ? 142.568 152.436 121.637 1.00 305.34 ? 351  GLU A CD    1 
ATOM   2395  O  OE1   . GLU A  1 351  ? 141.483 152.293 121.036 1.00 312.36 ? 351  GLU A OE1   1 
ATOM   2396  O  OE2   . GLU A  1 351  ? 143.191 151.483 122.149 1.00 299.50 ? 351  GLU A OE2   1 
ATOM   2397  N  N     . ASP A  1 352  ? 140.731 157.746 121.528 1.00 321.73 ? 352  ASP A N     1 
ATOM   2398  C  CA    . ASP A  1 352  ? 139.832 158.769 121.006 1.00 322.92 ? 352  ASP A CA    1 
ATOM   2399  C  C     . ASP A  1 352  ? 140.507 160.134 120.947 1.00 325.55 ? 352  ASP A C     1 
ATOM   2400  O  O     . ASP A  1 352  ? 140.209 160.931 120.053 1.00 326.28 ? 352  ASP A O     1 
ATOM   2401  C  CB    . ASP A  1 352  ? 138.563 158.842 121.858 1.00 321.93 ? 352  ASP A CB    1 
ATOM   2402  C  CG    . ASP A  1 352  ? 137.784 157.540 121.856 1.00 319.26 ? 352  ASP A CG    1 
ATOM   2403  O  OD1   . ASP A  1 352  ? 137.872 156.793 120.860 1.00 317.15 ? 352  ASP A OD1   1 
ATOM   2404  O  OD2   . ASP A  1 352  ? 137.085 157.265 122.855 1.00 317.53 ? 352  ASP A OD2   1 
ATOM   2405  N  N     . ARG A  1 353  ? 141.404 160.422 121.893 1.00 320.19 ? 353  ARG A N     1 
ATOM   2406  C  CA    . ARG A  1 353  ? 142.178 161.658 121.830 1.00 322.03 ? 353  ARG A CA    1 
ATOM   2407  C  C     . ARG A  1 353  ? 143.130 161.643 120.641 1.00 322.54 ? 353  ARG A C     1 
ATOM   2408  O  O     . ARG A  1 353  ? 143.358 162.680 120.004 1.00 327.49 ? 353  ARG A O     1 
ATOM   2409  C  CB    . ARG A  1 353  ? 142.945 161.867 123.136 1.00 317.85 ? 353  ARG A CB    1 
ATOM   2410  N  N     . SER A  1 354  ? 143.707 160.478 120.336 1.00 321.38 ? 354  SER A N     1 
ATOM   2411  C  CA    . SER A  1 354  ? 144.462 160.326 119.098 1.00 322.54 ? 354  SER A CA    1 
ATOM   2412  C  C     . SER A  1 354  ? 143.565 160.512 117.882 1.00 323.65 ? 354  SER A C     1 
ATOM   2413  O  O     . SER A  1 354  ? 144.026 160.972 116.831 1.00 326.73 ? 354  SER A O     1 
ATOM   2414  C  CB    . SER A  1 354  ? 145.141 158.957 119.056 1.00 319.77 ? 354  SER A CB    1 
ATOM   2415  N  N     . LEU A  1 355  ? 142.286 160.156 118.006 1.00 312.03 ? 355  LEU A N     1 
ATOM   2416  C  CA    . LEU A  1 355  ? 141.301 160.415 116.966 1.00 317.68 ? 355  LEU A CA    1 
ATOM   2417  C  C     . LEU A  1 355  ? 140.613 161.766 117.119 1.00 321.94 ? 355  LEU A C     1 
ATOM   2418  O  O     . LEU A  1 355  ? 139.951 162.216 116.177 1.00 325.06 ? 355  LEU A O     1 
ATOM   2419  C  CB    . LEU A  1 355  ? 140.241 159.305 116.954 1.00 313.55 ? 355  LEU A CB    1 
ATOM   2420  N  N     . LEU A  1 356  ? 140.752 162.420 118.269 1.00 323.77 ? 356  LEU A N     1 
ATOM   2421  C  CA    . LEU A  1 356  ? 140.134 163.723 118.500 1.00 323.63 ? 356  LEU A CA    1 
ATOM   2422  C  C     . LEU A  1 356  ? 140.869 164.495 119.594 1.00 318.03 ? 356  LEU A C     1 
ATOM   2423  O  O     . LEU A  1 356  ? 140.490 164.445 120.764 1.00 311.60 ? 356  LEU A O     1 
ATOM   2424  C  CB    . LEU A  1 356  ? 138.659 163.561 118.876 1.00 326.46 ? 356  LEU A CB    1 
ATOM   2425  N  N     . ASN B  2 24   ? 161.658 129.245 218.735 1.00 194.53 ? 24   ASN B N     1 
ATOM   2426  C  CA    . ASN B  2 24   ? 161.328 130.425 217.943 1.00 193.85 ? 24   ASN B CA    1 
ATOM   2427  C  C     . ASN B  2 24   ? 160.351 130.095 216.823 1.00 192.86 ? 24   ASN B C     1 
ATOM   2428  O  O     . ASN B  2 24   ? 160.656 130.303 215.651 1.00 198.59 ? 24   ASN B O     1 
ATOM   2429  C  CB    . ASN B  2 24   ? 162.596 131.040 217.354 1.00 195.98 ? 24   ASN B CB    1 
ATOM   2430  C  CG    . ASN B  2 24   ? 163.557 131.514 218.416 1.00 204.99 ? 24   ASN B CG    1 
ATOM   2431  O  OD1   . ASN B  2 24   ? 163.143 131.986 219.474 1.00 212.25 ? 24   ASN B OD1   1 
ATOM   2432  N  ND2   . ASN B  2 24   ? 164.852 131.390 218.142 1.00 212.67 ? 24   ASN B ND2   1 
ATOM   2433  N  N     . GLY B  2 25   ? 159.172 129.591 217.191 1.00 205.80 ? 25   GLY B N     1 
ATOM   2434  C  CA    . GLY B  2 25   ? 158.214 129.169 216.180 1.00 205.31 ? 25   GLY B CA    1 
ATOM   2435  C  C     . GLY B  2 25   ? 157.750 130.307 215.293 1.00 206.14 ? 25   GLY B C     1 
ATOM   2436  O  O     . GLY B  2 25   ? 157.718 130.185 214.065 1.00 206.53 ? 25   GLY B O     1 
ATOM   2437  N  N     . CYS B  2 26   ? 157.380 131.436 215.903 1.00 224.09 ? 26   CYS B N     1 
ATOM   2438  C  CA    . CYS B  2 26   ? 156.958 132.584 215.111 1.00 231.21 ? 26   CYS B CA    1 
ATOM   2439  C  C     . CYS B  2 26   ? 158.070 133.056 214.182 1.00 225.33 ? 26   CYS B C     1 
ATOM   2440  O  O     . CYS B  2 26   ? 157.794 133.514 213.065 1.00 232.82 ? 26   CYS B O     1 
ATOM   2441  C  CB    . CYS B  2 26   ? 156.500 133.722 216.028 1.00 241.51 ? 26   CYS B CB    1 
ATOM   2442  S  SG    . CYS B  2 26   ? 155.001 133.366 217.003 1.00 283.65 ? 26   CYS B SG    1 
ATOM   2443  N  N     . PHE B  2 27   ? 159.329 132.937 214.616 1.00 193.11 ? 27   PHE B N     1 
ATOM   2444  C  CA    . PHE B  2 27   ? 160.443 133.326 213.758 1.00 185.90 ? 27   PHE B CA    1 
ATOM   2445  C  C     . PHE B  2 27   ? 160.484 132.486 212.489 1.00 185.89 ? 27   PHE B C     1 
ATOM   2446  O  O     . PHE B  2 27   ? 160.673 133.016 211.386 1.00 186.10 ? 27   PHE B O     1 
ATOM   2447  C  CB    . PHE B  2 27   ? 161.759 133.206 214.521 1.00 183.47 ? 27   PHE B CB    1 
ATOM   2448  C  CG    . PHE B  2 27   ? 162.965 133.530 213.698 1.00 179.66 ? 27   PHE B CG    1 
ATOM   2449  C  CD1   . PHE B  2 27   ? 163.318 134.845 213.450 1.00 168.59 ? 27   PHE B CD1   1 
ATOM   2450  C  CD2   . PHE B  2 27   ? 163.752 132.520 213.175 1.00 194.30 ? 27   PHE B CD2   1 
ATOM   2451  C  CE1   . PHE B  2 27   ? 164.432 135.146 212.693 1.00 169.43 ? 27   PHE B CE1   1 
ATOM   2452  C  CE2   . PHE B  2 27   ? 164.868 132.816 212.416 1.00 199.30 ? 27   PHE B CE2   1 
ATOM   2453  C  CZ    . PHE B  2 27   ? 165.207 134.133 212.174 1.00 178.86 ? 27   PHE B CZ    1 
ATOM   2454  N  N     . VAL B  2 28   ? 160.290 131.173 212.621 1.00 176.90 ? 28   VAL B N     1 
ATOM   2455  C  CA    . VAL B  2 28   ? 160.313 130.315 211.445 1.00 175.97 ? 28   VAL B CA    1 
ATOM   2456  C  C     . VAL B  2 28   ? 159.069 130.537 210.593 1.00 181.25 ? 28   VAL B C     1 
ATOM   2457  O  O     . VAL B  2 28   ? 159.131 130.453 209.357 1.00 185.42 ? 28   VAL B O     1 
ATOM   2458  C  CB    . VAL B  2 28   ? 160.463 128.848 211.868 1.00 165.73 ? 28   VAL B CB    1 
ATOM   2459  C  CG1   . VAL B  2 28   ? 160.895 128.021 210.692 1.00 177.30 ? 28   VAL B CG1   1 
ATOM   2460  C  CG2   . VAL B  2 28   ? 161.471 128.738 212.985 1.00 175.05 ? 28   VAL B CG2   1 
ATOM   2461  N  N     . ASP B  2 29   ? 157.931 130.841 211.218 1.00 191.05 ? 29   ASP B N     1 
ATOM   2462  C  CA    . ASP B  2 29   ? 156.743 131.186 210.441 1.00 194.49 ? 29   ASP B CA    1 
ATOM   2463  C  C     . ASP B  2 29   ? 157.001 132.406 209.562 1.00 186.79 ? 29   ASP B C     1 
ATOM   2464  O  O     . ASP B  2 29   ? 156.675 132.412 208.369 1.00 192.98 ? 29   ASP B O     1 
ATOM   2465  C  CB    . ASP B  2 29   ? 155.559 131.431 211.377 1.00 197.93 ? 29   ASP B CB    1 
ATOM   2466  N  N     . ALA B  2 30   ? 157.608 133.445 210.135 1.00 178.17 ? 30   ALA B N     1 
ATOM   2467  C  CA    . ALA B  2 30   ? 157.934 134.631 209.350 1.00 179.61 ? 30   ALA B CA    1 
ATOM   2468  C  C     . ALA B  2 30   ? 158.934 134.307 208.250 1.00 184.25 ? 30   ALA B C     1 
ATOM   2469  O  O     . ALA B  2 30   ? 158.797 134.775 207.105 1.00 187.59 ? 30   ALA B O     1 
ATOM   2470  C  CB    . ALA B  2 30   ? 158.486 135.719 210.267 1.00 177.51 ? 30   ALA B CB    1 
ATOM   2471  N  N     . LEU B  2 31   ? 159.963 133.528 208.586 1.00 156.23 ? 31   LEU B N     1 
ATOM   2472  C  CA    . LEU B  2 31   ? 160.952 133.141 207.590 1.00 156.08 ? 31   LEU B CA    1 
ATOM   2473  C  C     . LEU B  2 31   ? 160.304 132.404 206.428 1.00 163.12 ? 31   LEU B C     1 
ATOM   2474  O  O     . LEU B  2 31   ? 160.768 132.507 205.287 1.00 171.94 ? 31   LEU B O     1 
ATOM   2475  C  CB    . LEU B  2 31   ? 162.035 132.288 208.244 1.00 151.08 ? 31   LEU B CB    1 
ATOM   2476  C  CG    . LEU B  2 31   ? 163.222 131.915 207.372 1.00 152.27 ? 31   LEU B CG    1 
ATOM   2477  C  CD1   . LEU B  2 31   ? 163.772 133.147 206.693 1.00 148.60 ? 31   LEU B CD1   1 
ATOM   2478  C  CD2   . LEU B  2 31   ? 164.275 131.264 208.234 1.00 157.98 ? 31   LEU B CD2   1 
ATOM   2479  N  N     . ASN B  2 32   ? 159.225 131.668 206.690 1.00 176.93 ? 32   ASN B N     1 
ATOM   2480  C  CA    . ASN B  2 32   ? 158.488 131.049 205.595 1.00 175.55 ? 32   ASN B CA    1 
ATOM   2481  C  C     . ASN B  2 32   ? 157.661 132.066 204.824 1.00 172.62 ? 32   ASN B C     1 
ATOM   2482  O  O     . ASN B  2 32   ? 157.514 131.953 203.604 1.00 171.34 ? 32   ASN B O     1 
ATOM   2483  C  CB    . ASN B  2 32   ? 157.596 129.938 206.126 1.00 181.49 ? 32   ASN B CB    1 
ATOM   2484  C  CG    . ASN B  2 32   ? 158.275 128.600 206.093 1.00 190.38 ? 32   ASN B CG    1 
ATOM   2485  O  OD1   . ASN B  2 32   ? 159.227 128.358 206.831 1.00 186.33 ? 32   ASN B OD1   1 
ATOM   2486  N  ND2   . ASN B  2 32   ? 157.797 127.718 205.224 1.00 204.14 ? 32   ASN B ND2   1 
ATOM   2487  N  N     . VAL B  2 33   ? 157.096 133.052 205.524 1.00 160.92 ? 33   VAL B N     1 
ATOM   2488  C  CA    . VAL B  2 33   ? 156.259 134.039 204.845 1.00 157.43 ? 33   VAL B CA    1 
ATOM   2489  C  C     . VAL B  2 33   ? 157.076 134.840 203.842 1.00 156.39 ? 33   VAL B C     1 
ATOM   2490  O  O     . VAL B  2 33   ? 156.556 135.262 202.801 1.00 165.50 ? 33   VAL B O     1 
ATOM   2491  C  CB    . VAL B  2 33   ? 155.559 134.949 205.876 1.00 158.74 ? 33   VAL B CB    1 
ATOM   2492  C  CG1   . VAL B  2 33   ? 154.954 136.171 205.209 1.00 159.09 ? 33   VAL B CG1   1 
ATOM   2493  C  CG2   . VAL B  2 33   ? 154.473 134.174 206.602 1.00 166.01 ? 33   VAL B CG2   1 
ATOM   2494  N  N     . VAL B  2 34   ? 158.365 135.032 204.116 1.00 173.84 ? 34   VAL B N     1 
ATOM   2495  C  CA    . VAL B  2 34   ? 159.173 135.929 203.273 1.00 176.31 ? 34   VAL B CA    1 
ATOM   2496  C  C     . VAL B  2 34   ? 159.202 135.527 201.803 1.00 184.03 ? 34   VAL B C     1 
ATOM   2497  O  O     . VAL B  2 34   ? 158.891 136.381 200.945 1.00 185.82 ? 34   VAL B O     1 
ATOM   2498  C  CB    . VAL B  2 34   ? 160.587 136.075 203.868 1.00 177.90 ? 34   VAL B CB    1 
ATOM   2499  C  CG1   . VAL B  2 34   ? 161.500 136.771 202.876 1.00 179.64 ? 34   VAL B CG1   1 
ATOM   2500  C  CG2   . VAL B  2 34   ? 160.525 136.840 205.177 1.00 181.43 ? 34   VAL B CG2   1 
ATOM   2501  N  N     . PRO B  2 35   ? 159.568 134.294 201.418 1.00 189.67 ? 35   PRO B N     1 
ATOM   2502  C  CA    . PRO B  2 35   ? 159.754 134.011 199.979 1.00 184.25 ? 35   PRO B CA    1 
ATOM   2503  C  C     . PRO B  2 35   ? 158.479 134.101 199.155 1.00 183.40 ? 35   PRO B C     1 
ATOM   2504  O  O     . PRO B  2 35   ? 158.532 134.516 197.985 1.00 184.11 ? 35   PRO B O     1 
ATOM   2505  C  CB    . PRO B  2 35   ? 160.331 132.590 199.978 1.00 180.15 ? 35   PRO B CB    1 
ATOM   2506  C  CG    . PRO B  2 35   ? 160.913 132.417 201.336 1.00 179.96 ? 35   PRO B CG    1 
ATOM   2507  C  CD    . PRO B  2 35   ? 159.982 133.142 202.240 1.00 184.67 ? 35   PRO B CD    1 
ATOM   2508  N  N     . HIS B  2 36   ? 157.339 133.701 199.721 1.00 188.26 ? 36   HIS B N     1 
ATOM   2509  C  CA    . HIS B  2 36   ? 156.070 133.921 199.038 1.00 185.66 ? 36   HIS B CA    1 
ATOM   2510  C  C     . HIS B  2 36   ? 155.893 135.391 198.702 1.00 182.84 ? 36   HIS B C     1 
ATOM   2511  O  O     . HIS B  2 36   ? 155.447 135.742 197.605 1.00 180.97 ? 36   HIS B O     1 
ATOM   2512  C  CB    . HIS B  2 36   ? 154.909 133.443 199.906 1.00 191.39 ? 36   HIS B CB    1 
ATOM   2513  C  CG    . HIS B  2 36   ? 155.074 132.049 200.415 1.00 195.51 ? 36   HIS B CG    1 
ATOM   2514  N  ND1   . HIS B  2 36   ? 155.253 130.970 199.579 1.00 199.28 ? 36   HIS B ND1   1 
ATOM   2515  C  CD2   . HIS B  2 36   ? 155.083 131.557 201.675 1.00 200.93 ? 36   HIS B CD2   1 
ATOM   2516  C  CE1   . HIS B  2 36   ? 155.372 129.871 200.303 1.00 203.00 ? 36   HIS B CE1   1 
ATOM   2517  N  NE2   . HIS B  2 36   ? 155.269 130.200 201.578 1.00 204.60 ? 36   HIS B NE2   1 
ATOM   2518  N  N     . VAL B  2 37   ? 156.243 136.261 199.648 1.00 182.09 ? 37   VAL B N     1 
ATOM   2519  C  CA    . VAL B  2 37   ? 156.142 137.698 199.431 1.00 184.41 ? 37   VAL B CA    1 
ATOM   2520  C  C     . VAL B  2 37   ? 157.066 138.132 198.300 1.00 184.38 ? 37   VAL B C     1 
ATOM   2521  O  O     . VAL B  2 37   ? 156.674 138.916 197.424 1.00 188.26 ? 37   VAL B O     1 
ATOM   2522  C  CB    . VAL B  2 37   ? 156.444 138.436 200.748 1.00 185.10 ? 37   VAL B CB    1 
ATOM   2523  C  CG1   . VAL B  2 37   ? 157.275 139.680 200.505 1.00 183.68 ? 37   VAL B CG1   1 
ATOM   2524  C  CG2   . VAL B  2 37   ? 155.145 138.779 201.459 1.00 191.82 ? 37   VAL B CG2   1 
ATOM   2525  N  N     . PHE B  2 38   ? 158.297 137.619 198.293 1.00 179.90 ? 38   PHE B N     1 
ATOM   2526  C  CA    . PHE B  2 38   ? 159.244 137.963 197.232 1.00 176.84 ? 38   PHE B CA    1 
ATOM   2527  C  C     . PHE B  2 38   ? 158.673 137.634 195.856 1.00 177.97 ? 38   PHE B C     1 
ATOM   2528  O  O     . PHE B  2 38   ? 158.720 138.455 194.926 1.00 177.93 ? 38   PHE B O     1 
ATOM   2529  C  CB    . PHE B  2 38   ? 160.554 137.216 197.472 1.00 178.81 ? 38   PHE B CB    1 
ATOM   2530  C  CG    . PHE B  2 38   ? 161.582 137.430 196.412 1.00 179.04 ? 38   PHE B CG    1 
ATOM   2531  C  CD1   . PHE B  2 38   ? 162.364 138.567 196.412 1.00 186.97 ? 38   PHE B CD1   1 
ATOM   2532  C  CD2   . PHE B  2 38   ? 161.796 136.477 195.435 1.00 184.83 ? 38   PHE B CD2   1 
ATOM   2533  C  CE1   . PHE B  2 38   ? 163.332 138.766 195.441 1.00 193.82 ? 38   PHE B CE1   1 
ATOM   2534  C  CE2   . PHE B  2 38   ? 162.764 136.667 194.461 1.00 193.25 ? 38   PHE B CE2   1 
ATOM   2535  C  CZ    . PHE B  2 38   ? 163.533 137.814 194.465 1.00 186.07 ? 38   PHE B CZ    1 
ATOM   2536  N  N     . LEU B  2 39   ? 158.106 136.433 195.719 1.00 181.19 ? 39   LEU B N     1 
ATOM   2537  C  CA    . LEU B  2 39   ? 157.580 136.012 194.423 1.00 176.46 ? 39   LEU B CA    1 
ATOM   2538  C  C     . LEU B  2 39   ? 156.327 136.791 194.044 1.00 172.10 ? 39   LEU B C     1 
ATOM   2539  O  O     . LEU B  2 39   ? 156.176 137.205 192.889 1.00 174.52 ? 39   LEU B O     1 
ATOM   2540  C  CB    . LEU B  2 39   ? 157.280 134.520 194.429 1.00 181.90 ? 39   LEU B CB    1 
ATOM   2541  C  CG    . LEU B  2 39   ? 156.795 134.023 193.069 1.00 182.47 ? 39   LEU B CG    1 
ATOM   2542  C  CD1   . LEU B  2 39   ? 157.894 134.183 192.025 1.00 176.88 ? 39   LEU B CD1   1 
ATOM   2543  C  CD2   . LEU B  2 39   ? 156.325 132.580 193.165 1.00 187.79 ? 39   LEU B CD2   1 
ATOM   2544  N  N     . LEU B  2 40   ? 155.405 136.975 194.992 1.00 190.30 ? 40   LEU B N     1 
ATOM   2545  C  CA    . LEU B  2 40   ? 154.215 137.770 194.717 1.00 191.37 ? 40   LEU B CA    1 
ATOM   2546  C  C     . LEU B  2 40   ? 154.555 139.202 194.361 1.00 194.85 ? 40   LEU B C     1 
ATOM   2547  O  O     . LEU B  2 40   ? 153.744 139.885 193.729 1.00 193.85 ? 40   LEU B O     1 
ATOM   2548  C  CB    . LEU B  2 40   ? 153.276 137.777 195.921 1.00 195.86 ? 40   LEU B CB    1 
ATOM   2549  C  CG    . LEU B  2 40   ? 152.443 136.529 196.170 1.00 199.89 ? 40   LEU B CG    1 
ATOM   2550  C  CD1   . LEU B  2 40   ? 151.504 136.780 197.331 1.00 200.19 ? 40   LEU B CD1   1 
ATOM   2551  C  CD2   . LEU B  2 40   ? 151.667 136.173 194.921 1.00 204.66 ? 40   LEU B CD2   1 
ATOM   2552  N  N     . PHE B  2 41   ? 155.720 139.685 194.768 1.00 199.06 ? 41   PHE B N     1 
ATOM   2553  C  CA    . PHE B  2 41   ? 156.078 141.048 194.423 1.00 196.34 ? 41   PHE B CA    1 
ATOM   2554  C  C     . PHE B  2 41   ? 156.763 141.142 193.076 1.00 201.01 ? 41   PHE B C     1 
ATOM   2555  O  O     . PHE B  2 41   ? 156.525 142.107 192.338 1.00 208.33 ? 41   PHE B O     1 
ATOM   2556  C  CB    . PHE B  2 41   ? 156.959 141.642 195.513 1.00 188.04 ? 41   PHE B CB    1 
ATOM   2557  C  CG    . PHE B  2 41   ? 156.216 141.915 196.778 1.00 190.60 ? 41   PHE B CG    1 
ATOM   2558  C  CD1   . PHE B  2 41   ? 154.837 141.762 196.826 1.00 191.53 ? 41   PHE B CD1   1 
ATOM   2559  C  CD2   . PHE B  2 41   ? 156.880 142.326 197.917 1.00 194.67 ? 41   PHE B CD2   1 
ATOM   2560  C  CE1   . PHE B  2 41   ? 154.142 142.007 197.982 1.00 194.35 ? 41   PHE B CE1   1 
ATOM   2561  C  CE2   . PHE B  2 41   ? 156.187 142.580 199.079 1.00 192.00 ? 41   PHE B CE2   1 
ATOM   2562  C  CZ    . PHE B  2 41   ? 154.815 142.416 199.112 1.00 196.05 ? 41   PHE B CZ    1 
ATOM   2563  N  N     . ILE B  2 42   ? 157.580 140.152 192.715 1.00 187.07 ? 42   ILE B N     1 
ATOM   2564  C  CA    . ILE B  2 42   ? 158.145 140.176 191.371 1.00 181.79 ? 42   ILE B CA    1 
ATOM   2565  C  C     . ILE B  2 42   ? 157.108 139.817 190.307 1.00 179.94 ? 42   ILE B C     1 
ATOM   2566  O  O     . ILE B  2 42   ? 157.233 140.251 189.156 1.00 178.54 ? 42   ILE B O     1 
ATOM   2567  C  CB    . ILE B  2 42   ? 159.390 139.277 191.304 1.00 181.92 ? 42   ILE B CB    1 
ATOM   2568  C  CG1   . ILE B  2 42   ? 160.514 139.900 192.128 1.00 178.52 ? 42   ILE B CG1   1 
ATOM   2569  C  CG2   . ILE B  2 42   ? 159.840 139.063 189.870 1.00 186.20 ? 42   ILE B CG2   1 
ATOM   2570  C  CD1   . ILE B  2 42   ? 161.896 139.423 191.749 1.00 179.11 ? 42   ILE B CD1   1 
ATOM   2571  N  N     . THR B  2 43   ? 156.051 139.088 190.661 1.00 215.76 ? 43   THR B N     1 
ATOM   2572  C  CA    . THR B  2 43   ? 155.108 138.676 189.629 1.00 216.73 ? 43   THR B CA    1 
ATOM   2573  C  C     . THR B  2 43   ? 154.255 139.825 189.128 1.00 215.88 ? 43   THR B C     1 
ATOM   2574  O  O     . THR B  2 43   ? 153.722 139.748 188.018 1.00 218.90 ? 43   THR B O     1 
ATOM   2575  C  CB    . THR B  2 43   ? 154.176 137.580 190.130 1.00 225.06 ? 43   THR B CB    1 
ATOM   2576  O  OG1   . THR B  2 43   ? 153.346 137.152 189.042 1.00 225.39 ? 43   THR B OG1   1 
ATOM   2577  C  CG2   . THR B  2 43   ? 153.277 138.105 191.227 1.00 230.59 ? 43   THR B CG2   1 
ATOM   2578  N  N     . PHE B  2 44   ? 154.085 140.873 189.929 1.00 233.21 ? 44   PHE B N     1 
ATOM   2579  C  CA    . PHE B  2 44   ? 153.046 141.846 189.612 1.00 240.36 ? 44   PHE B CA    1 
ATOM   2580  C  C     . PHE B  2 44   ? 153.414 142.792 188.471 1.00 235.75 ? 44   PHE B C     1 
ATOM   2581  O  O     . PHE B  2 44   ? 152.543 143.124 187.655 1.00 234.58 ? 44   PHE B O     1 
ATOM   2582  C  CB    . PHE B  2 44   ? 152.665 142.639 190.861 1.00 243.40 ? 44   PHE B CB    1 
ATOM   2583  C  CG    . PHE B  2 44   ? 151.425 142.131 191.528 1.00 242.46 ? 44   PHE B CG    1 
ATOM   2584  C  CD1   . PHE B  2 44   ? 150.177 142.431 191.013 1.00 247.00 ? 44   PHE B CD1   1 
ATOM   2585  C  CD2   . PHE B  2 44   ? 151.509 141.343 192.654 1.00 242.56 ? 44   PHE B CD2   1 
ATOM   2586  C  CE1   . PHE B  2 44   ? 149.035 141.970 191.619 1.00 251.41 ? 44   PHE B CE1   1 
ATOM   2587  C  CE2   . PHE B  2 44   ? 150.373 140.871 193.263 1.00 251.62 ? 44   PHE B CE2   1 
ATOM   2588  C  CZ    . PHE B  2 44   ? 149.131 141.185 192.747 1.00 261.03 ? 44   PHE B CZ    1 
ATOM   2589  N  N     . PRO B  2 45   ? 154.659 143.266 188.379 1.00 208.44 ? 45   PRO B N     1 
ATOM   2590  C  CA    . PRO B  2 45   ? 155.030 144.040 187.185 1.00 201.68 ? 45   PRO B CA    1 
ATOM   2591  C  C     . PRO B  2 45   ? 154.832 143.262 185.905 1.00 208.10 ? 45   PRO B C     1 
ATOM   2592  O  O     . PRO B  2 45   ? 154.179 143.748 184.974 1.00 214.14 ? 45   PRO B O     1 
ATOM   2593  C  CB    . PRO B  2 45   ? 156.506 144.357 187.430 1.00 201.68 ? 45   PRO B CB    1 
ATOM   2594  C  CG    . PRO B  2 45   ? 156.631 144.377 188.890 1.00 212.11 ? 45   PRO B CG    1 
ATOM   2595  C  CD    . PRO B  2 45   ? 155.729 143.296 189.387 1.00 213.06 ? 45   PRO B CD    1 
ATOM   2596  N  N     . ILE B  2 46   ? 155.388 142.058 185.831 1.00 202.41 ? 46   ILE B N     1 
ATOM   2597  C  CA    . ILE B  2 46   ? 155.282 141.287 184.601 1.00 201.93 ? 46   ILE B CA    1 
ATOM   2598  C  C     . ILE B  2 46   ? 153.833 140.923 184.329 1.00 203.48 ? 46   ILE B C     1 
ATOM   2599  O  O     . ILE B  2 46   ? 153.363 141.015 183.192 1.00 211.21 ? 46   ILE B O     1 
ATOM   2600  C  CB    . ILE B  2 46   ? 156.183 140.045 184.678 1.00 197.29 ? 46   ILE B CB    1 
ATOM   2601  C  CG1   . ILE B  2 46   ? 157.623 140.485 184.923 1.00 191.09 ? 46   ILE B CG1   1 
ATOM   2602  C  CG2   . ILE B  2 46   ? 156.077 139.243 183.408 1.00 192.47 ? 46   ILE B CG2   1 
ATOM   2603  C  CD1   . ILE B  2 46   ? 158.575 139.363 185.140 1.00 193.51 ? 46   ILE B CD1   1 
ATOM   2604  N  N     . LEU B  2 47   ? 153.097 140.525 185.363 1.00 213.11 ? 47   LEU B N     1 
ATOM   2605  C  CA    . LEU B  2 47   ? 151.695 140.188 185.157 1.00 221.42 ? 47   LEU B CA    1 
ATOM   2606  C  C     . LEU B  2 47   ? 150.895 141.401 184.704 1.00 226.16 ? 47   LEU B C     1 
ATOM   2607  O  O     . LEU B  2 47   ? 149.948 141.260 183.923 1.00 237.49 ? 47   LEU B O     1 
ATOM   2608  C  CB    . LEU B  2 47   ? 151.095 139.592 186.434 1.00 221.11 ? 47   LEU B CB    1 
ATOM   2609  N  N     . PHE B  2 48   ? 151.271 142.598 185.149 1.00 220.02 ? 48   PHE B N     1 
ATOM   2610  C  CA    . PHE B  2 48   ? 150.509 143.780 184.768 1.00 226.05 ? 48   PHE B CA    1 
ATOM   2611  C  C     . PHE B  2 48   ? 150.878 144.287 183.383 1.00 233.72 ? 48   PHE B C     1 
ATOM   2612  O  O     . PHE B  2 48   ? 150.035 144.887 182.705 1.00 240.73 ? 48   PHE B O     1 
ATOM   2613  C  CB    . PHE B  2 48   ? 150.705 144.877 185.801 1.00 223.37 ? 48   PHE B CB    1 
ATOM   2614  C  CG    . PHE B  2 48   ? 149.774 144.777 186.943 1.00 222.07 ? 48   PHE B CG    1 
ATOM   2615  C  CD1   . PHE B  2 48   ? 148.466 144.383 186.740 1.00 243.86 ? 48   PHE B CD1   1 
ATOM   2616  C  CD2   . PHE B  2 48   ? 150.196 145.064 188.220 1.00 222.70 ? 48   PHE B CD2   1 
ATOM   2617  C  CE1   . PHE B  2 48   ? 147.589 144.283 187.801 1.00 257.64 ? 48   PHE B CE1   1 
ATOM   2618  C  CE2   . PHE B  2 48   ? 149.331 144.971 189.279 1.00 229.24 ? 48   PHE B CE2   1 
ATOM   2619  C  CZ    . PHE B  2 48   ? 148.024 144.572 189.077 1.00 245.33 ? 48   PHE B CZ    1 
ATOM   2620  N  N     . ILE B  2 49   ? 152.125 144.081 182.961 1.00 212.58 ? 49   ILE B N     1 
ATOM   2621  C  CA    . ILE B  2 49   ? 152.486 144.361 181.577 1.00 211.17 ? 49   ILE B CA    1 
ATOM   2622  C  C     . ILE B  2 49   ? 151.786 143.381 180.646 1.00 226.51 ? 49   ILE B C     1 
ATOM   2623  O  O     . ILE B  2 49   ? 151.233 143.773 179.611 1.00 231.29 ? 49   ILE B O     1 
ATOM   2624  C  CB    . ILE B  2 49   ? 154.009 144.306 181.394 1.00 205.61 ? 49   ILE B CB    1 
ATOM   2625  C  CG1   . ILE B  2 49   ? 154.681 145.399 182.204 1.00 204.44 ? 49   ILE B CG1   1 
ATOM   2626  C  CG2   . ILE B  2 49   ? 154.371 144.457 179.939 1.00 215.55 ? 49   ILE B CG2   1 
ATOM   2627  C  CD1   . ILE B  2 49   ? 156.186 145.390 182.074 1.00 212.27 ? 49   ILE B CD1   1 
ATOM   2628  N  N     . GLY B  2 50   ? 151.785 142.094 181.006 1.00 268.94 ? 50   GLY B N     1 
ATOM   2629  C  CA    . GLY B  2 50   ? 151.134 141.095 180.180 1.00 263.22 ? 50   GLY B CA    1 
ATOM   2630  C  C     . GLY B  2 50   ? 149.627 141.236 180.148 1.00 273.84 ? 50   GLY B C     1 
ATOM   2631  O  O     . GLY B  2 50   ? 148.992 140.879 179.154 1.00 289.30 ? 50   GLY B O     1 
ATOM   2632  N  N     . TRP B  2 51   ? 149.032 141.756 181.224 1.00 284.50 ? 51   TRP B N     1 
ATOM   2633  C  CA    . TRP B  2 51   ? 147.584 141.949 181.244 1.00 292.94 ? 51   TRP B CA    1 
ATOM   2634  C  C     . TRP B  2 51   ? 147.165 143.266 180.599 1.00 290.65 ? 51   TRP B C     1 
ATOM   2635  O  O     . TRP B  2 51   ? 146.040 143.374 180.098 1.00 296.63 ? 51   TRP B O     1 
ATOM   2636  C  CB    . TRP B  2 51   ? 147.055 141.884 182.676 1.00 298.05 ? 51   TRP B CB    1 
ATOM   2637  C  CG    . TRP B  2 51   ? 145.575 142.075 182.749 1.00 307.01 ? 51   TRP B CG    1 
ATOM   2638  C  CD1   . TRP B  2 51   ? 144.618 141.104 182.675 1.00 312.93 ? 51   TRP B CD1   1 
ATOM   2639  C  CD2   . TRP B  2 51   ? 144.875 143.316 182.894 1.00 307.09 ? 51   TRP B CD2   1 
ATOM   2640  N  NE1   . TRP B  2 51   ? 143.367 141.664 182.772 1.00 321.77 ? 51   TRP B NE1   1 
ATOM   2641  C  CE2   . TRP B  2 51   ? 143.498 143.023 182.908 1.00 319.56 ? 51   TRP B CE2   1 
ATOM   2642  C  CE3   . TRP B  2 51   ? 145.281 144.648 183.020 1.00 304.44 ? 51   TRP B CE3   1 
ATOM   2643  C  CZ2   . TRP B  2 51   ? 142.523 144.011 183.041 1.00 320.54 ? 51   TRP B CZ2   1 
ATOM   2644  C  CZ3   . TRP B  2 51   ? 144.311 145.628 183.153 1.00 307.73 ? 51   TRP B CZ3   1 
ATOM   2645  C  CH2   . TRP B  2 51   ? 142.950 145.303 183.160 1.00 309.12 ? 51   TRP B CH2   1 
ATOM   2646  N  N     . GLY B  2 52   ? 148.038 144.268 180.614 1.00 266.61 ? 52   GLY B N     1 
ATOM   2647  C  CA    . GLY B  2 52   ? 147.740 145.547 179.997 1.00 271.04 ? 52   GLY B CA    1 
ATOM   2648  C  C     . GLY B  2 52   ? 147.771 145.521 178.480 1.00 265.32 ? 52   GLY B C     1 
ATOM   2649  O  O     . GLY B  2 52   ? 146.840 145.988 177.822 1.00 264.90 ? 52   GLY B O     1 
ATOM   2650  N  N     . SER B  2 63   ? 149.855 133.799 168.034 1.00 237.74 ? 63   SER B N     1 
ATOM   2651  C  CA    . SER B  2 63   ? 149.061 132.661 168.489 1.00 243.18 ? 63   SER B CA    1 
ATOM   2652  C  C     . SER B  2 63   ? 149.820 131.342 168.341 1.00 239.37 ? 63   SER B C     1 
ATOM   2653  O  O     . SER B  2 63   ? 149.393 130.446 167.614 1.00 239.93 ? 63   SER B O     1 
ATOM   2654  C  CB    . SER B  2 63   ? 147.742 132.594 167.721 1.00 238.80 ? 63   SER B CB    1 
ATOM   2655  O  OG    . SER B  2 63   ? 147.981 132.381 166.345 1.00 242.37 ? 63   SER B OG    1 
ATOM   2656  N  N     . THR B  2 64   ? 150.945 131.225 169.043 1.00 240.98 ? 64   THR B N     1 
ATOM   2657  C  CA    . THR B  2 64   ? 151.758 130.017 169.050 1.00 243.34 ? 64   THR B CA    1 
ATOM   2658  C  C     . THR B  2 64   ? 151.944 129.541 170.487 1.00 244.48 ? 64   THR B C     1 
ATOM   2659  O  O     . THR B  2 64   ? 152.407 130.302 171.343 1.00 239.84 ? 64   THR B O     1 
ATOM   2660  C  CB    . THR B  2 64   ? 153.123 130.261 168.392 1.00 250.05 ? 64   THR B CB    1 
ATOM   2661  O  OG1   . THR B  2 64   ? 153.789 131.347 169.047 1.00 249.58 ? 64   THR B OG1   1 
ATOM   2662  C  CG2   . THR B  2 64   ? 152.962 130.585 166.915 1.00 242.05 ? 64   THR B CG2   1 
ATOM   2663  N  N     . TRP B  2 65   ? 151.580 128.283 170.743 1.00 225.56 ? 65   TRP B N     1 
ATOM   2664  C  CA    . TRP B  2 65   ? 151.688 127.683 172.067 1.00 221.78 ? 65   TRP B CA    1 
ATOM   2665  C  C     . TRP B  2 65   ? 152.930 126.801 172.118 1.00 233.30 ? 65   TRP B C     1 
ATOM   2666  O  O     . TRP B  2 65   ? 153.056 125.851 171.338 1.00 241.31 ? 65   TRP B O     1 
ATOM   2667  C  CB    . TRP B  2 65   ? 150.438 126.871 172.409 1.00 219.24 ? 65   TRP B CB    1 
ATOM   2668  C  CG    . TRP B  2 65   ? 149.187 127.684 172.500 1.00 208.00 ? 65   TRP B CG    1 
ATOM   2669  C  CD1   . TRP B  2 65   ? 148.372 128.054 171.472 1.00 207.49 ? 65   TRP B CD1   1 
ATOM   2670  C  CD2   . TRP B  2 65   ? 148.601 128.225 173.689 1.00 210.72 ? 65   TRP B CD2   1 
ATOM   2671  N  NE1   . TRP B  2 65   ? 147.319 128.797 171.943 1.00 203.02 ? 65   TRP B NE1   1 
ATOM   2672  C  CE2   . TRP B  2 65   ? 147.437 128.916 173.301 1.00 216.88 ? 65   TRP B CE2   1 
ATOM   2673  C  CE3   . TRP B  2 65   ? 148.949 128.194 175.045 1.00 212.54 ? 65   TRP B CE3   1 
ATOM   2674  C  CZ2   . TRP B  2 65   ? 146.615 129.569 174.221 1.00 237.81 ? 65   TRP B CZ2   1 
ATOM   2675  C  CZ3   . TRP B  2 65   ? 148.134 128.845 175.960 1.00 217.51 ? 65   TRP B CZ3   1 
ATOM   2676  C  CH2   . TRP B  2 65   ? 146.977 129.521 175.544 1.00 234.28 ? 65   TRP B CH2   1 
ATOM   2677  N  N     . LEU B  2 66   ? 153.844 127.126 173.024 1.00 229.50 ? 66   LEU B N     1 
ATOM   2678  C  CA    . LEU B  2 66   ? 155.062 126.359 173.256 1.00 232.44 ? 66   LEU B CA    1 
ATOM   2679  C  C     . LEU B  2 66   ? 154.915 125.613 174.575 1.00 241.66 ? 66   LEU B C     1 
ATOM   2680  O  O     . LEU B  2 66   ? 154.667 126.233 175.615 1.00 250.73 ? 66   LEU B O     1 
ATOM   2681  C  CB    . LEU B  2 66   ? 156.286 127.276 173.300 1.00 239.32 ? 66   LEU B CB    1 
ATOM   2682  C  CG    . LEU B  2 66   ? 156.592 128.132 172.070 1.00 251.94 ? 66   LEU B CG    1 
ATOM   2683  C  CD1   . LEU B  2 66   ? 156.858 129.587 172.451 1.00 239.45 ? 66   LEU B CD1   1 
ATOM   2684  C  CD2   . LEU B  2 66   ? 157.780 127.555 171.329 1.00 266.67 ? 66   LEU B CD2   1 
ATOM   2685  N  N     . HIS B  2 67   ? 155.070 124.294 174.537 1.00 217.11 ? 67   HIS B N     1 
ATOM   2686  C  CA    . HIS B  2 67   ? 154.958 123.470 175.731 1.00 214.07 ? 67   HIS B CA    1 
ATOM   2687  C  C     . HIS B  2 67   ? 156.323 122.961 176.160 1.00 214.30 ? 67   HIS B C     1 
ATOM   2688  O  O     . HIS B  2 67   ? 157.204 122.713 175.335 1.00 223.01 ? 67   HIS B O     1 
ATOM   2689  C  CB    . HIS B  2 67   ? 154.014 122.292 175.502 1.00 213.93 ? 67   HIS B CB    1 
ATOM   2690  C  CG    . HIS B  2 67   ? 152.578 122.691 175.430 1.00 218.78 ? 67   HIS B CG    1 
ATOM   2691  N  ND1   . HIS B  2 67   ? 151.831 122.984 176.551 1.00 218.84 ? 67   HIS B ND1   1 
ATOM   2692  C  CD2   . HIS B  2 67   ? 151.751 122.863 174.372 1.00 229.05 ? 67   HIS B CD2   1 
ATOM   2693  C  CE1   . HIS B  2 67   ? 150.604 123.309 176.188 1.00 237.20 ? 67   HIS B CE1   1 
ATOM   2694  N  NE2   . HIS B  2 67   ? 150.530 123.245 174.870 1.00 249.56 ? 67   HIS B NE2   1 
ATOM   2695  N  N     . PHE B  2 68   ? 156.488 122.808 177.469 1.00 195.48 ? 68   PHE B N     1 
ATOM   2696  C  CA    . PHE B  2 68   ? 157.751 122.362 178.020 1.00 201.89 ? 68   PHE B CA    1 
ATOM   2697  C  C     . PHE B  2 68   ? 157.572 121.009 178.702 1.00 211.13 ? 68   PHE B C     1 
ATOM   2698  O  O     . PHE B  2 68   ? 156.480 120.697 179.188 1.00 213.09 ? 68   PHE B O     1 
ATOM   2699  C  CB    . PHE B  2 68   ? 158.298 123.377 179.033 1.00 204.48 ? 68   PHE B CB    1 
ATOM   2700  C  CG    . PHE B  2 68   ? 158.333 124.795 178.525 1.00 205.36 ? 68   PHE B CG    1 
ATOM   2701  C  CD1   . PHE B  2 68   ? 157.228 125.625 178.656 1.00 203.88 ? 68   PHE B CD1   1 
ATOM   2702  C  CD2   . PHE B  2 68   ? 159.476 125.306 177.934 1.00 211.36 ? 68   PHE B CD2   1 
ATOM   2703  C  CE1   . PHE B  2 68   ? 157.262 126.930 178.197 1.00 194.81 ? 68   PHE B CE1   1 
ATOM   2704  C  CE2   . PHE B  2 68   ? 159.517 126.611 177.476 1.00 207.48 ? 68   PHE B CE2   1 
ATOM   2705  C  CZ    . PHE B  2 68   ? 158.408 127.422 177.607 1.00 199.81 ? 68   PHE B CZ    1 
ATOM   2706  N  N     . PRO B  2 69   ? 158.618 120.181 178.743 1.00 222.00 ? 69   PRO B N     1 
ATOM   2707  C  CA    . PRO B  2 69   ? 158.504 118.899 179.448 1.00 215.95 ? 69   PRO B CA    1 
ATOM   2708  C  C     . PRO B  2 69   ? 158.180 119.115 180.920 1.00 211.85 ? 69   PRO B C     1 
ATOM   2709  O  O     . PRO B  2 69   ? 158.713 120.018 181.568 1.00 210.44 ? 69   PRO B O     1 
ATOM   2710  C  CB    . PRO B  2 69   ? 159.885 118.264 179.259 1.00 222.65 ? 69   PRO B CB    1 
ATOM   2711  C  CG    . PRO B  2 69   ? 160.440 118.919 178.038 1.00 226.30 ? 69   PRO B CG    1 
ATOM   2712  C  CD    . PRO B  2 69   ? 159.923 120.330 178.079 1.00 226.47 ? 69   PRO B CD    1 
ATOM   2713  N  N     . GLY B  2 70   ? 157.292 118.275 181.440 1.00 223.09 ? 70   GLY B N     1 
ATOM   2714  C  CA    . GLY B  2 70   ? 156.835 118.398 182.806 1.00 217.64 ? 70   GLY B CA    1 
ATOM   2715  C  C     . GLY B  2 70   ? 155.664 119.326 182.998 1.00 206.36 ? 70   GLY B C     1 
ATOM   2716  O  O     . GLY B  2 70   ? 155.248 119.549 184.141 1.00 205.57 ? 70   GLY B O     1 
ATOM   2717  N  N     . HIS B  2 71   ? 155.116 119.870 181.914 1.00 197.57 ? 71   HIS B N     1 
ATOM   2718  C  CA    . HIS B  2 71   ? 153.986 120.781 182.021 1.00 198.38 ? 71   HIS B CA    1 
ATOM   2719  C  C     . HIS B  2 71   ? 152.828 120.137 182.772 1.00 205.92 ? 71   HIS B C     1 
ATOM   2720  O  O     . HIS B  2 71   ? 152.338 120.680 183.772 1.00 208.28 ? 71   HIS B O     1 
ATOM   2721  C  CB    . HIS B  2 71   ? 153.555 121.211 180.625 1.00 200.99 ? 71   HIS B CB    1 
ATOM   2722  C  CG    . HIS B  2 71   ? 152.446 122.207 180.625 1.00 207.34 ? 71   HIS B CG    1 
ATOM   2723  N  ND1   . HIS B  2 71   ? 152.654 123.551 180.400 1.00 210.07 ? 71   HIS B ND1   1 
ATOM   2724  C  CD2   . HIS B  2 71   ? 151.118 122.059 180.835 1.00 216.07 ? 71   HIS B CD2   1 
ATOM   2725  C  CE1   . HIS B  2 71   ? 151.500 124.187 180.466 1.00 220.04 ? 71   HIS B CE1   1 
ATOM   2726  N  NE2   . HIS B  2 71   ? 150.551 123.305 180.728 1.00 232.56 ? 71   HIS B NE2   1 
ATOM   2727  N  N     . ASN B  2 72   ? 152.379 118.970 182.302 1.00 201.12 ? 72   ASN B N     1 
ATOM   2728  C  CA    . ASN B  2 72   ? 151.272 118.274 182.952 1.00 206.72 ? 72   ASN B CA    1 
ATOM   2729  C  C     . ASN B  2 72   ? 151.642 117.858 184.367 1.00 196.18 ? 72   ASN B C     1 
ATOM   2730  O  O     . ASN B  2 72   ? 150.820 117.952 185.287 1.00 195.73 ? 72   ASN B O     1 
ATOM   2731  C  CB    . ASN B  2 72   ? 150.879 117.055 182.131 1.00 215.67 ? 72   ASN B CB    1 
ATOM   2732  C  CG    . ASN B  2 72   ? 151.103 117.272 180.661 1.00 221.79 ? 72   ASN B CG    1 
ATOM   2733  O  OD1   . ASN B  2 72   ? 151.082 118.409 180.187 1.00 225.85 ? 72   ASN B OD1   1 
ATOM   2734  N  ND2   . ASN B  2 72   ? 151.333 116.189 179.922 1.00 216.60 ? 72   ASN B ND2   1 
ATOM   2735  N  N     . LEU B  2 73   ? 152.872 117.384 184.555 1.00 208.05 ? 73   LEU B N     1 
ATOM   2736  C  CA    . LEU B  2 73   ? 153.341 117.101 185.901 1.00 204.06 ? 73   LEU B CA    1 
ATOM   2737  C  C     . LEU B  2 73   ? 153.326 118.359 186.755 1.00 200.05 ? 73   LEU B C     1 
ATOM   2738  O  O     . LEU B  2 73   ? 152.947 118.312 187.930 1.00 202.82 ? 73   LEU B O     1 
ATOM   2739  C  CB    . LEU B  2 73   ? 154.740 116.499 185.851 1.00 207.87 ? 73   LEU B CB    1 
ATOM   2740  C  CG    . LEU B  2 73   ? 155.295 116.065 187.204 1.00 209.49 ? 73   LEU B CG    1 
ATOM   2741  C  CD1   . LEU B  2 73   ? 154.347 115.079 187.870 1.00 205.74 ? 73   LEU B CD1   1 
ATOM   2742  C  CD2   . LEU B  2 73   ? 156.672 115.455 187.014 1.00 219.06 ? 73   LEU B CD2   1 
ATOM   2743  N  N     . ARG B  2 74   ? 153.712 119.499 186.177 1.00 202.07 ? 74   ARG B N     1 
ATOM   2744  C  CA    . ARG B  2 74   ? 153.704 120.738 186.944 1.00 200.13 ? 74   ARG B CA    1 
ATOM   2745  C  C     . ARG B  2 74   ? 152.300 121.086 187.407 1.00 202.38 ? 74   ARG B C     1 
ATOM   2746  O  O     . ARG B  2 74   ? 152.090 121.450 188.567 1.00 204.87 ? 74   ARG B O     1 
ATOM   2747  C  CB    . ARG B  2 74   ? 154.280 121.888 186.128 1.00 200.79 ? 74   ARG B CB    1 
ATOM   2748  C  CG    . ARG B  2 74   ? 154.230 123.202 186.882 1.00 199.14 ? 74   ARG B CG    1 
ATOM   2749  C  CD    . ARG B  2 74   ? 154.865 124.315 186.095 1.00 203.45 ? 74   ARG B CD    1 
ATOM   2750  N  NE    . ARG B  2 74   ? 156.172 123.926 185.575 1.00 211.00 ? 74   ARG B NE    1 
ATOM   2751  C  CZ    . ARG B  2 74   ? 157.315 124.086 186.230 1.00 215.56 ? 74   ARG B CZ    1 
ATOM   2752  N  NH1   . ARG B  2 74   ? 157.314 124.628 187.441 1.00 217.21 ? 74   ARG B NH1   1 
ATOM   2753  N  NH2   . ARG B  2 74   ? 158.458 123.704 185.676 1.00 218.84 ? 74   ARG B NH2   1 
ATOM   2754  N  N     . TRP B  2 75   ? 151.319 120.981 186.514 1.00 184.55 ? 75   TRP B N     1 
ATOM   2755  C  CA    . TRP B  2 75   ? 149.958 121.338 186.898 1.00 188.25 ? 75   TRP B CA    1 
ATOM   2756  C  C     . TRP B  2 75   ? 149.377 120.351 187.902 1.00 186.20 ? 75   TRP B C     1 
ATOM   2757  O  O     . TRP B  2 75   ? 148.668 120.749 188.834 1.00 188.03 ? 75   TRP B O     1 
ATOM   2758  C  CB    . TRP B  2 75   ? 149.075 121.427 185.665 1.00 198.23 ? 75   TRP B CB    1 
ATOM   2759  C  CG    . TRP B  2 75   ? 149.223 122.712 184.965 1.00 198.90 ? 75   TRP B CG    1 
ATOM   2760  C  CD1   . TRP B  2 75   ? 150.192 123.052 184.076 1.00 194.80 ? 75   TRP B CD1   1 
ATOM   2761  C  CD2   . TRP B  2 75   ? 148.374 123.850 185.096 1.00 198.04 ? 75   TRP B CD2   1 
ATOM   2762  N  NE1   . TRP B  2 75   ? 149.996 124.338 183.633 1.00 192.56 ? 75   TRP B NE1   1 
ATOM   2763  C  CE2   . TRP B  2 75   ? 148.884 124.849 184.245 1.00 196.38 ? 75   TRP B CE2   1 
ATOM   2764  C  CE3   . TRP B  2 75   ? 147.226 124.118 185.846 1.00 204.33 ? 75   TRP B CE3   1 
ATOM   2765  C  CZ2   . TRP B  2 75   ? 148.287 126.098 184.122 1.00 202.34 ? 75   TRP B CZ2   1 
ATOM   2766  C  CZ3   . TRP B  2 75   ? 146.635 125.356 185.726 1.00 218.39 ? 75   TRP B CZ3   1 
ATOM   2767  C  CH2   . TRP B  2 75   ? 147.166 126.335 184.869 1.00 218.62 ? 75   TRP B CH2   1 
ATOM   2768  N  N     . ILE B  2 76   ? 149.655 119.059 187.728 1.00 202.97 ? 76   ILE B N     1 
ATOM   2769  C  CA    . ILE B  2 76   ? 149.207 118.077 188.710 1.00 204.07 ? 76   ILE B CA    1 
ATOM   2770  C  C     . ILE B  2 76   ? 149.783 118.410 190.080 1.00 205.34 ? 76   ILE B C     1 
ATOM   2771  O  O     . ILE B  2 76   ? 149.060 118.476 191.084 1.00 208.65 ? 76   ILE B O     1 
ATOM   2772  C  CB    . ILE B  2 76   ? 149.593 116.658 188.264 1.00 203.34 ? 76   ILE B CB    1 
ATOM   2773  C  CG1   . ILE B  2 76   ? 148.848 116.290 186.985 1.00 208.73 ? 76   ILE B CG1   1 
ATOM   2774  C  CG2   . ILE B  2 76   ? 149.281 115.656 189.362 1.00 202.76 ? 76   ILE B CG2   1 
ATOM   2775  C  CD1   . ILE B  2 76   ? 149.334 115.018 186.356 1.00 213.74 ? 76   ILE B CD1   1 
ATOM   2776  N  N     . LEU B  2 77   ? 151.094 118.637 190.141 1.00 202.20 ? 77   LEU B N     1 
ATOM   2777  C  CA    . LEU B  2 77   ? 151.706 118.983 191.412 1.00 202.10 ? 77   LEU B CA    1 
ATOM   2778  C  C     . LEU B  2 77   ? 151.138 120.278 191.966 1.00 206.92 ? 77   LEU B C     1 
ATOM   2779  O  O     . LEU B  2 77   ? 150.988 120.414 193.181 1.00 217.90 ? 77   LEU B O     1 
ATOM   2780  C  CB    . LEU B  2 77   ? 153.222 119.081 191.253 1.00 204.34 ? 77   LEU B CB    1 
ATOM   2781  C  CG    . LEU B  2 77   ? 153.892 117.761 190.888 1.00 203.36 ? 77   LEU B CG    1 
ATOM   2782  C  CD1   . LEU B  2 77   ? 155.380 117.951 190.663 1.00 209.39 ? 77   LEU B CD1   1 
ATOM   2783  C  CD2   . LEU B  2 77   ? 153.642 116.751 191.976 1.00 203.18 ? 77   LEU B CD2   1 
ATOM   2784  N  N     . THR B  2 78   ? 150.787 121.230 191.102 1.00 211.98 ? 78   THR B N     1 
ATOM   2785  C  CA    . THR B  2 78   ? 150.233 122.483 191.603 1.00 214.35 ? 78   THR B CA    1 
ATOM   2786  C  C     . THR B  2 78   ? 148.857 122.267 192.221 1.00 220.36 ? 78   THR B C     1 
ATOM   2787  O  O     . THR B  2 78   ? 148.517 122.893 193.231 1.00 226.96 ? 78   THR B O     1 
ATOM   2788  C  CB    . THR B  2 78   ? 150.172 123.516 190.486 1.00 212.26 ? 78   THR B CB    1 
ATOM   2789  O  OG1   . THR B  2 78   ? 151.496 123.758 190.002 1.00 211.44 ? 78   THR B OG1   1 
ATOM   2790  C  CG2   . THR B  2 78   ? 149.589 124.816 191.003 1.00 220.87 ? 78   THR B CG2   1 
ATOM   2791  N  N     . PHE B  2 79   ? 148.055 121.375 191.646 1.00 201.74 ? 79   PHE B N     1 
ATOM   2792  C  CA    . PHE B  2 79   ? 146.774 121.073 192.274 1.00 203.47 ? 79   PHE B CA    1 
ATOM   2793  C  C     . PHE B  2 79   ? 146.971 120.345 193.598 1.00 205.63 ? 79   PHE B C     1 
ATOM   2794  O  O     . PHE B  2 79   ? 146.226 120.575 194.564 1.00 218.06 ? 79   PHE B O     1 
ATOM   2795  C  CB    . PHE B  2 79   ? 145.898 120.267 191.328 1.00 202.10 ? 79   PHE B CB    1 
ATOM   2796  C  CG    . PHE B  2 79   ? 145.195 121.112 190.323 1.00 206.23 ? 79   PHE B CG    1 
ATOM   2797  C  CD1   . PHE B  2 79   ? 143.988 121.705 190.632 1.00 213.05 ? 79   PHE B CD1   1 
ATOM   2798  C  CD2   . PHE B  2 79   ? 145.753 121.340 189.079 1.00 212.89 ? 79   PHE B CD2   1 
ATOM   2799  C  CE1   . PHE B  2 79   ? 143.337 122.498 189.709 1.00 231.39 ? 79   PHE B CE1   1 
ATOM   2800  C  CE2   . PHE B  2 79   ? 145.113 122.134 188.151 1.00 228.23 ? 79   PHE B CE2   1 
ATOM   2801  C  CZ    . PHE B  2 79   ? 143.901 122.715 188.466 1.00 240.21 ? 79   PHE B CZ    1 
ATOM   2802  N  N     . ILE B  2 80   ? 147.981 119.480 193.675 1.00 217.58 ? 80   ILE B N     1 
ATOM   2803  C  CA    . ILE B  2 80   ? 148.260 118.826 194.950 1.00 220.74 ? 80   ILE B CA    1 
ATOM   2804  C  C     . ILE B  2 80   ? 148.697 119.856 195.988 1.00 224.25 ? 80   ILE B C     1 
ATOM   2805  O  O     . ILE B  2 80   ? 148.352 119.755 197.174 1.00 230.43 ? 80   ILE B O     1 
ATOM   2806  C  CB    . ILE B  2 80   ? 149.302 117.713 194.766 1.00 221.78 ? 80   ILE B CB    1 
ATOM   2807  C  CG1   . ILE B  2 80   ? 148.905 116.816 193.601 1.00 221.83 ? 80   ILE B CG1   1 
ATOM   2808  C  CG2   . ILE B  2 80   ? 149.379 116.870 196.017 1.00 223.35 ? 80   ILE B CG2   1 
ATOM   2809  C  CD1   . ILE B  2 80   ? 149.981 115.858 193.176 1.00 226.50 ? 80   ILE B CD1   1 
ATOM   2810  N  N     . LEU B  2 81   ? 149.460 120.863 195.559 1.00 240.47 ? 81   LEU B N     1 
ATOM   2811  C  CA    . LEU B  2 81   ? 149.830 121.959 196.450 1.00 238.76 ? 81   LEU B CA    1 
ATOM   2812  C  C     . LEU B  2 81   ? 148.604 122.709 196.934 1.00 246.51 ? 81   LEU B C     1 
ATOM   2813  O  O     . LEU B  2 81   ? 148.511 123.071 198.110 1.00 258.37 ? 81   LEU B O     1 
ATOM   2814  C  CB    . LEU B  2 81   ? 150.758 122.931 195.741 1.00 238.13 ? 81   LEU B CB    1 
ATOM   2815  C  CG    . LEU B  2 81   ? 152.199 122.521 195.533 1.00 245.18 ? 81   LEU B CG    1 
ATOM   2816  C  CD1   . LEU B  2 81   ? 152.913 123.661 194.839 1.00 258.27 ? 81   LEU B CD1   1 
ATOM   2817  C  CD2   . LEU B  2 81   ? 152.812 122.238 196.868 1.00 247.45 ? 81   LEU B CD2   1 
ATOM   2818  N  N     . LEU B  2 82   ? 147.681 123.004 196.023 1.00 239.68 ? 82   LEU B N     1 
ATOM   2819  C  CA    . LEU B  2 82   ? 146.427 123.643 196.400 1.00 241.62 ? 82   LEU B CA    1 
ATOM   2820  C  C     . LEU B  2 82   ? 145.737 122.861 197.514 1.00 245.11 ? 82   LEU B C     1 
ATOM   2821  O  O     . LEU B  2 82   ? 145.314 123.430 198.532 1.00 254.60 ? 82   LEU B O     1 
ATOM   2822  C  CB    . LEU B  2 82   ? 145.532 123.749 195.166 1.00 246.62 ? 82   LEU B CB    1 
ATOM   2823  C  CG    . LEU B  2 82   ? 144.130 124.342 195.286 1.00 260.64 ? 82   LEU B CG    1 
ATOM   2824  C  CD1   . LEU B  2 82   ? 144.211 125.847 195.369 1.00 258.02 ? 82   LEU B CD1   1 
ATOM   2825  C  CD2   . LEU B  2 82   ? 143.262 123.911 194.106 1.00 260.87 ? 82   LEU B CD2   1 
ATOM   2826  N  N     . PHE B  2 83   ? 145.650 121.541 197.346 1.00 232.42 ? 83   PHE B N     1 
ATOM   2827  C  CA    . PHE B  2 83   ? 145.005 120.699 198.353 1.00 236.43 ? 83   PHE B CA    1 
ATOM   2828  C  C     . PHE B  2 83   ? 145.726 120.777 199.699 1.00 241.54 ? 83   PHE B C     1 
ATOM   2829  O  O     . PHE B  2 83   ? 145.101 120.998 200.750 1.00 245.70 ? 83   PHE B O     1 
ATOM   2830  C  CB    . PHE B  2 83   ? 144.951 119.257 197.848 1.00 237.62 ? 83   PHE B CB    1 
ATOM   2831  C  CG    . PHE B  2 83   ? 144.409 118.283 198.849 1.00 249.08 ? 83   PHE B CG    1 
ATOM   2832  C  CD1   . PHE B  2 83   ? 143.046 118.155 199.044 1.00 252.15 ? 83   PHE B CD1   1 
ATOM   2833  C  CD2   . PHE B  2 83   ? 145.263 117.481 199.588 1.00 249.77 ? 83   PHE B CD2   1 
ATOM   2834  C  CE1   . PHE B  2 83   ? 142.545 117.256 199.960 1.00 249.53 ? 83   PHE B CE1   1 
ATOM   2835  C  CE2   . PHE B  2 83   ? 144.768 116.577 200.506 1.00 251.03 ? 83   PHE B CE2   1 
ATOM   2836  C  CZ    . PHE B  2 83   ? 143.407 116.465 200.693 1.00 253.49 ? 83   PHE B CZ    1 
ATOM   2837  N  N     . VAL B  2 84   ? 147.046 120.586 199.692 1.00 235.83 ? 84   VAL B N     1 
ATOM   2838  C  CA    . VAL B  2 84   ? 147.788 120.608 200.949 1.00 235.50 ? 84   VAL B CA    1 
ATOM   2839  C  C     . VAL B  2 84   ? 147.694 121.978 201.610 1.00 238.67 ? 84   VAL B C     1 
ATOM   2840  O  O     . VAL B  2 84   ? 147.683 122.085 202.843 1.00 245.44 ? 84   VAL B O     1 
ATOM   2841  C  CB    . VAL B  2 84   ? 149.250 120.186 200.713 1.00 230.25 ? 84   VAL B CB    1 
ATOM   2842  C  CG1   . VAL B  2 84   ? 150.019 120.192 202.016 1.00 244.30 ? 84   VAL B CG1   1 
ATOM   2843  C  CG2   . VAL B  2 84   ? 149.295 118.812 200.081 1.00 226.78 ? 84   VAL B CG2   1 
ATOM   2844  N  N     . LEU B  2 85   ? 147.588 123.044 200.818 1.00 229.31 ? 85   LEU B N     1 
ATOM   2845  C  CA    . LEU B  2 85   ? 147.454 124.374 201.402 1.00 232.46 ? 85   LEU B CA    1 
ATOM   2846  C  C     . LEU B  2 85   ? 146.094 124.548 202.059 1.00 236.60 ? 85   LEU B C     1 
ATOM   2847  O  O     . LEU B  2 85   ? 145.981 125.199 203.107 1.00 243.22 ? 85   LEU B O     1 
ATOM   2848  C  CB    . LEU B  2 85   ? 147.681 125.438 200.333 1.00 229.31 ? 85   LEU B CB    1 
ATOM   2849  C  CG    . LEU B  2 85   ? 149.144 125.580 199.927 1.00 229.65 ? 85   LEU B CG    1 
ATOM   2850  C  CD1   . LEU B  2 85   ? 149.272 126.553 198.778 1.00 234.99 ? 85   LEU B CD1   1 
ATOM   2851  C  CD2   . LEU B  2 85   ? 149.984 126.022 201.113 1.00 227.34 ? 85   LEU B CD2   1 
ATOM   2852  N  N     . VAL B  2 86   ? 145.049 123.982 201.456 1.00 221.82 ? 86   VAL B N     1 
ATOM   2853  C  CA    . VAL B  2 86   ? 143.753 123.964 202.127 1.00 223.64 ? 86   VAL B CA    1 
ATOM   2854  C  C     . VAL B  2 86   ? 143.867 123.262 203.474 1.00 228.73 ? 86   VAL B C     1 
ATOM   2855  O  O     . VAL B  2 86   ? 143.314 123.720 204.487 1.00 239.99 ? 86   VAL B O     1 
ATOM   2856  C  CB    . VAL B  2 86   ? 142.694 123.303 201.226 1.00 223.30 ? 86   VAL B CB    1 
ATOM   2857  C  CG1   . VAL B  2 86   ? 141.396 123.121 201.992 1.00 237.46 ? 86   VAL B CG1   1 
ATOM   2858  C  CG2   . VAL B  2 86   ? 142.469 124.142 199.979 1.00 228.54 ? 86   VAL B CG2   1 
ATOM   2859  N  N     . CYS B  2 87   ? 144.603 122.151 203.513 1.00 234.44 ? 87   CYS B N     1 
ATOM   2860  C  CA    . CYS B  2 87   ? 144.772 121.442 204.782 1.00 235.49 ? 87   CYS B CA    1 
ATOM   2861  C  C     . CYS B  2 87   ? 145.520 122.292 205.806 1.00 240.45 ? 87   CYS B C     1 
ATOM   2862  O  O     . CYS B  2 87   ? 145.189 122.284 207.000 1.00 248.33 ? 87   CYS B O     1 
ATOM   2863  C  CB    . CYS B  2 87   ? 145.494 120.120 204.550 1.00 236.55 ? 87   CYS B CB    1 
ATOM   2864  S  SG    . CYS B  2 87   ? 144.593 119.031 203.448 1.00 243.60 ? 87   CYS B SG    1 
ATOM   2865  N  N     . GLU B  2 88   ? 146.538 123.028 205.357 1.00 231.88 ? 88   GLU B N     1 
ATOM   2866  C  CA    . GLU B  2 88   ? 147.275 123.898 206.269 1.00 233.00 ? 88   GLU B CA    1 
ATOM   2867  C  C     . GLU B  2 88   ? 146.383 124.998 206.829 1.00 234.24 ? 88   GLU B C     1 
ATOM   2868  O  O     . GLU B  2 88   ? 146.485 125.350 208.010 1.00 242.68 ? 88   GLU B O     1 
ATOM   2869  C  CB    . GLU B  2 88   ? 148.477 124.510 205.559 1.00 234.78 ? 88   GLU B CB    1 
ATOM   2870  C  CG    . GLU B  2 88   ? 149.737 123.684 205.642 1.00 241.52 ? 88   GLU B CG    1 
ATOM   2871  C  CD    . GLU B  2 88   ? 150.939 124.425 205.087 1.00 257.90 ? 88   GLU B CD    1 
ATOM   2872  O  OE1   . GLU B  2 88   ? 150.743 125.321 204.234 1.00 256.49 ? 88   GLU B OE1   1 
ATOM   2873  O  OE2   . GLU B  2 88   ? 152.075 124.120 205.511 1.00 264.94 ? 88   GLU B OE2   1 
ATOM   2874  N  N     . ILE B  2 89   ? 145.516 125.566 205.990 1.00 224.75 ? 89   ILE B N     1 
ATOM   2875  C  CA    . ILE B  2 89   ? 144.570 126.564 206.481 1.00 225.76 ? 89   ILE B CA    1 
ATOM   2876  C  C     . ILE B  2 89   ? 143.649 125.945 207.526 1.00 225.08 ? 89   ILE B C     1 
ATOM   2877  O  O     . ILE B  2 89   ? 143.308 126.580 208.533 1.00 229.33 ? 89   ILE B O     1 
ATOM   2878  C  CB    . ILE B  2 89   ? 143.775 127.176 205.312 1.00 226.78 ? 89   ILE B CB    1 
ATOM   2879  C  CG1   . ILE B  2 89   ? 144.718 127.868 204.329 1.00 219.42 ? 89   ILE B CG1   1 
ATOM   2880  C  CG2   . ILE B  2 89   ? 142.743 128.167 205.826 1.00 228.35 ? 89   ILE B CG2   1 
ATOM   2881  C  CD1   . ILE B  2 89   ? 144.017 128.416 203.107 1.00 221.32 ? 89   ILE B CD1   1 
ATOM   2882  N  N     . ALA B  2 90   ? 143.236 124.693 207.303 1.00 235.48 ? 90   ALA B N     1 
ATOM   2883  C  CA    . ALA B  2 90   ? 142.439 123.997 208.310 1.00 238.00 ? 90   ALA B CA    1 
ATOM   2884  C  C     . ALA B  2 90   ? 143.191 123.893 209.636 1.00 243.56 ? 90   ALA B C     1 
ATOM   2885  O  O     . ALA B  2 90   ? 142.619 124.136 210.709 1.00 248.13 ? 90   ALA B O     1 
ATOM   2886  C  CB    . ALA B  2 90   ? 142.047 122.611 207.804 1.00 241.75 ? 90   ALA B CB    1 
ATOM   2887  N  N     . GLU B  2 91   ? 144.473 123.528 209.579 1.00 242.81 ? 91   GLU B N     1 
ATOM   2888  C  CA    . GLU B  2 91   ? 145.273 123.463 210.801 1.00 240.06 ? 91   GLU B CA    1 
ATOM   2889  C  C     . GLU B  2 91   ? 145.342 124.819 211.490 1.00 237.25 ? 91   GLU B C     1 
ATOM   2890  O  O     . GLU B  2 91   ? 145.230 124.910 212.718 1.00 241.85 ? 91   GLU B O     1 
ATOM   2891  C  CB    . GLU B  2 91   ? 146.683 122.969 210.489 1.00 244.74 ? 91   GLU B CB    1 
ATOM   2892  C  CG    . GLU B  2 91   ? 146.862 121.474 210.611 1.00 256.06 ? 91   GLU B CG    1 
ATOM   2893  C  CD    . GLU B  2 91   ? 148.299 121.054 210.388 1.00 264.34 ? 91   GLU B CD    1 
ATOM   2894  O  OE1   . GLU B  2 91   ? 149.134 121.936 210.098 1.00 264.89 ? 91   GLU B OE1   1 
ATOM   2895  O  OE2   . GLU B  2 91   ? 148.592 119.846 210.500 1.00 263.69 ? 91   GLU B OE2   1 
ATOM   2896  N  N     . GLY B  2 92   ? 145.539 125.881 210.711 1.00 232.77 ? 92   GLY B N     1 
ATOM   2897  C  CA    . GLY B  2 92   ? 145.619 127.210 211.290 1.00 236.72 ? 92   GLY B CA    1 
ATOM   2898  C  C     . GLY B  2 92   ? 144.323 127.648 211.938 1.00 235.24 ? 92   GLY B C     1 
ATOM   2899  O  O     . GLY B  2 92   ? 144.332 128.377 212.933 1.00 240.26 ? 92   GLY B O     1 
ATOM   2900  N  N     . ILE B  2 93   ? 143.193 127.220 211.382 1.00 240.09 ? 93   ILE B N     1 
ATOM   2901  C  CA    . ILE B  2 93   ? 141.916 127.498 212.025 1.00 240.96 ? 93   ILE B CA    1 
ATOM   2902  C  C     . ILE B  2 93   ? 141.796 126.713 213.324 1.00 245.23 ? 93   ILE B C     1 
ATOM   2903  O  O     . ILE B  2 93   ? 141.332 127.240 214.343 1.00 248.18 ? 93   ILE B O     1 
ATOM   2904  C  CB    . ILE B  2 93   ? 140.760 127.184 211.059 1.00 248.78 ? 93   ILE B CB    1 
ATOM   2905  C  CG1   . ILE B  2 93   ? 140.793 128.156 209.882 1.00 245.39 ? 93   ILE B CG1   1 
ATOM   2906  C  CG2   . ILE B  2 93   ? 139.423 127.239 211.787 1.00 256.54 ? 93   ILE B CG2   1 
ATOM   2907  C  CD1   . ILE B  2 93   ? 140.791 129.610 210.297 1.00 242.23 ? 93   ILE B CD1   1 
ATOM   2908  N  N     . LEU B  2 94   ? 142.223 125.449 213.316 1.00 239.80 ? 94   LEU B N     1 
ATOM   2909  C  CA    . LEU B  2 94   ? 142.115 124.631 214.520 1.00 238.38 ? 94   LEU B CA    1 
ATOM   2910  C  C     . LEU B  2 94   ? 142.965 125.195 215.650 1.00 240.36 ? 94   LEU B C     1 
ATOM   2911  O  O     . LEU B  2 94   ? 142.551 125.181 216.816 1.00 241.98 ? 94   LEU B O     1 
ATOM   2912  C  CB    . LEU B  2 94   ? 142.526 123.193 214.217 1.00 239.35 ? 94   LEU B CB    1 
ATOM   2913  C  CG    . LEU B  2 94   ? 141.599 122.422 213.282 1.00 240.13 ? 94   LEU B CG    1 
ATOM   2914  C  CD1   . LEU B  2 94   ? 142.101 121.000 213.094 1.00 247.22 ? 94   LEU B CD1   1 
ATOM   2915  C  CD2   . LEU B  2 94   ? 140.180 122.428 213.825 1.00 240.25 ? 94   LEU B CD2   1 
ATOM   2916  N  N     . SER B  2 95   ? 144.149 125.707 215.325 1.00 250.13 ? 95   SER B N     1 
ATOM   2917  C  CA    . SER B  2 95   ? 145.050 126.187 216.365 1.00 254.97 ? 95   SER B CA    1 
ATOM   2918  C  C     . SER B  2 95   ? 144.533 127.474 216.997 1.00 260.29 ? 95   SER B C     1 
ATOM   2919  O  O     . SER B  2 95   ? 144.407 127.567 218.224 1.00 259.92 ? 95   SER B O     1 
ATOM   2920  C  CB    . SER B  2 95   ? 146.450 126.388 215.784 1.00 260.28 ? 95   SER B CB    1 
ATOM   2921  O  OG    . SER B  2 95   ? 147.350 126.849 216.775 1.00 273.18 ? 95   SER B OG    1 
ATOM   2922  N  N     . ASP B  2 96   ? 144.214 128.474 216.177 1.00 250.45 ? 96   ASP B N     1 
ATOM   2923  C  CA    . ASP B  2 96   ? 143.806 129.786 216.677 1.00 250.24 ? 96   ASP B CA    1 
ATOM   2924  C  C     . ASP B  2 96   ? 142.504 129.718 217.470 1.00 253.96 ? 96   ASP B C     1 
ATOM   2925  O  O     . ASP B  2 96   ? 142.281 130.519 218.380 1.00 256.89 ? 96   ASP B O     1 
ATOM   2926  C  CB    . ASP B  2 96   ? 143.659 130.775 215.518 1.00 242.66 ? 96   ASP B CB    1 
ATOM   2927  N  N     . HIS B  2 103  ? 146.400 134.442 216.956 1.00 224.20 ? 103  HIS B N     1 
ATOM   2928  C  CA    . HIS B  2 103  ? 147.718 134.136 216.404 1.00 227.94 ? 103  HIS B CA    1 
ATOM   2929  C  C     . HIS B  2 103  ? 147.739 134.149 214.867 1.00 234.38 ? 103  HIS B C     1 
ATOM   2930  O  O     . HIS B  2 103  ? 147.736 133.092 214.236 1.00 232.31 ? 103  HIS B O     1 
ATOM   2931  C  CB    . HIS B  2 103  ? 148.195 132.772 216.895 1.00 229.25 ? 103  HIS B CB    1 
ATOM   2932  C  CG    . HIS B  2 103  ? 148.454 132.699 218.364 1.00 234.85 ? 103  HIS B CG    1 
ATOM   2933  N  ND1   . HIS B  2 103  ? 149.600 133.196 218.944 1.00 236.33 ? 103  HIS B ND1   1 
ATOM   2934  C  CD2   . HIS B  2 103  ? 147.720 132.167 219.369 1.00 237.46 ? 103  HIS B CD2   1 
ATOM   2935  C  CE1   . HIS B  2 103  ? 149.558 132.979 220.247 1.00 236.24 ? 103  HIS B CE1   1 
ATOM   2936  N  NE2   . HIS B  2 103  ? 148.428 132.356 220.529 1.00 235.48 ? 103  HIS B NE2   1 
ATOM   2937  N  N     . LEU B  2 104  ? 147.782 135.351 214.279 1.00 232.22 ? 104  LEU B N     1 
ATOM   2938  C  CA    . LEU B  2 104  ? 147.783 135.483 212.821 1.00 226.07 ? 104  LEU B CA    1 
ATOM   2939  C  C     . LEU B  2 104  ? 149.056 134.913 212.217 1.00 222.78 ? 104  LEU B C     1 
ATOM   2940  O  O     . LEU B  2 104  ? 149.008 134.136 211.250 1.00 222.99 ? 104  LEU B O     1 
ATOM   2941  C  CB    . LEU B  2 104  ? 147.628 136.954 212.421 1.00 233.25 ? 104  LEU B CB    1 
ATOM   2942  C  CG    . LEU B  2 104  ? 146.386 137.706 212.905 1.00 241.28 ? 104  LEU B CG    1 
ATOM   2943  C  CD1   . LEU B  2 104  ? 146.477 139.207 212.656 1.00 254.43 ? 104  LEU B CD1   1 
ATOM   2944  C  CD2   . LEU B  2 104  ? 145.158 137.122 212.245 1.00 240.97 ? 104  LEU B CD2   1 
ATOM   2945  N  N     . HIS B  2 105  ? 150.208 135.316 212.764 1.00 226.77 ? 105  HIS B N     1 
ATOM   2946  C  CA    . HIS B  2 105  ? 151.514 134.939 212.247 1.00 228.18 ? 105  HIS B CA    1 
ATOM   2947  C  C     . HIS B  2 105  ? 151.741 133.434 212.233 1.00 225.55 ? 105  HIS B C     1 
ATOM   2948  O  O     . HIS B  2 105  ? 152.728 132.981 211.639 1.00 232.29 ? 105  HIS B O     1 
ATOM   2949  C  CB    . HIS B  2 105  ? 152.598 135.628 213.072 1.00 222.92 ? 105  HIS B CB    1 
ATOM   2950  N  N     . LEU B  2 106  ? 150.875 132.655 212.875 1.00 205.22 ? 106  LEU B N     1 
ATOM   2951  C  CA    . LEU B  2 106  ? 151.044 131.214 212.913 1.00 205.85 ? 106  LEU B CA    1 
ATOM   2952  C  C     . LEU B  2 106  ? 150.379 130.500 211.747 1.00 206.34 ? 106  LEU B C     1 
ATOM   2953  O  O     . LEU B  2 106  ? 150.826 129.412 211.374 1.00 207.59 ? 106  LEU B O     1 
ATOM   2954  C  CB    . LEU B  2 106  ? 150.509 130.664 214.231 1.00 209.74 ? 106  LEU B CB    1 
ATOM   2955  C  CG    . LEU B  2 106  ? 151.257 131.188 215.448 1.00 208.48 ? 106  LEU B CG    1 
ATOM   2956  C  CD1   . LEU B  2 106  ? 150.853 130.380 216.660 1.00 216.65 ? 106  LEU B CD1   1 
ATOM   2957  C  CD2   . LEU B  2 106  ? 152.759 131.116 215.217 1.00 202.68 ? 106  LEU B CD2   1 
ATOM   2958  N  N     . TYR B  2 107  ? 149.345 131.079 211.141 1.00 215.09 ? 107  TYR B N     1 
ATOM   2959  C  CA    . TYR B  2 107  ? 148.736 130.476 209.965 1.00 211.34 ? 107  TYR B CA    1 
ATOM   2960  C  C     . TYR B  2 107  ? 148.894 131.344 208.719 1.00 213.86 ? 107  TYR B C     1 
ATOM   2961  O  O     . TYR B  2 107  ? 148.349 131.002 207.670 1.00 210.71 ? 107  TYR B O     1 
ATOM   2962  C  CB    . TYR B  2 107  ? 147.258 130.163 210.220 1.00 207.10 ? 107  TYR B CB    1 
ATOM   2963  C  CG    . TYR B  2 107  ? 146.365 131.367 210.298 1.00 206.40 ? 107  TYR B CG    1 
ATOM   2964  C  CD1   . TYR B  2 107  ? 146.163 132.028 211.497 1.00 212.98 ? 107  TYR B CD1   1 
ATOM   2965  C  CD2   . TYR B  2 107  ? 145.714 131.836 209.172 1.00 207.92 ? 107  TYR B CD2   1 
ATOM   2966  C  CE1   . TYR B  2 107  ? 145.344 133.129 211.569 1.00 215.10 ? 107  TYR B CE1   1 
ATOM   2967  C  CE2   . TYR B  2 107  ? 144.896 132.934 209.228 1.00 213.18 ? 107  TYR B CE2   1 
ATOM   2968  C  CZ    . TYR B  2 107  ? 144.710 133.581 210.430 1.00 216.51 ? 107  TYR B CZ    1 
ATOM   2969  O  OH    . TYR B  2 107  ? 143.887 134.684 210.488 1.00 221.60 ? 107  TYR B OH    1 
ATOM   2970  N  N     . MET B  2 108  ? 149.631 132.448 208.786 1.00 219.48 ? 108  MET B N     1 
ATOM   2971  C  CA    . MET B  2 108  ? 149.861 133.186 207.544 1.00 211.07 ? 108  MET B CA    1 
ATOM   2972  C  C     . MET B  2 108  ? 150.636 132.422 206.460 1.00 208.28 ? 108  MET B C     1 
ATOM   2973  O  O     . MET B  2 108  ? 150.367 132.649 205.268 1.00 212.15 ? 108  MET B O     1 
ATOM   2974  C  CB    . MET B  2 108  ? 150.571 134.511 207.832 1.00 208.86 ? 108  MET B CB    1 
ATOM   2975  C  CG    . MET B  2 108  ? 149.654 135.526 208.472 1.00 218.21 ? 108  MET B CG    1 
ATOM   2976  S  SD    . MET B  2 108  ? 148.252 135.884 207.403 1.00 214.17 ? 108  MET B SD    1 
ATOM   2977  C  CE    . MET B  2 108  ? 149.052 136.910 206.177 1.00 209.06 ? 108  MET B CE    1 
ATOM   2978  N  N     . PRO B  2 109  ? 151.615 131.554 206.784 1.00 204.91 ? 109  PRO B N     1 
ATOM   2979  C  CA    . PRO B  2 109  ? 152.358 130.886 205.698 1.00 203.21 ? 109  PRO B CA    1 
ATOM   2980  C  C     . PRO B  2 109  ? 151.491 130.180 204.673 1.00 199.28 ? 109  PRO B C     1 
ATOM   2981  O  O     . PRO B  2 109  ? 151.823 130.195 203.481 1.00 201.17 ? 109  PRO B O     1 
ATOM   2982  C  CB    . PRO B  2 109  ? 153.249 129.891 206.450 1.00 202.71 ? 109  PRO B CB    1 
ATOM   2983  C  CG    . PRO B  2 109  ? 153.558 130.560 207.707 1.00 205.68 ? 109  PRO B CG    1 
ATOM   2984  C  CD    . PRO B  2 109  ? 152.309 131.369 208.071 1.00 206.82 ? 109  PRO B CD    1 
ATOM   2985  N  N     . ALA B  2 110  ? 150.394 129.554 205.099 1.00 224.87 ? 110  ALA B N     1 
ATOM   2986  C  CA    . ALA B  2 110  ? 149.515 128.879 204.151 1.00 227.42 ? 110  ALA B CA    1 
ATOM   2987  C  C     . ALA B  2 110  ? 148.834 129.882 203.228 1.00 223.44 ? 110  ALA B C     1 
ATOM   2988  O  O     . ALA B  2 110  ? 148.810 129.705 202.000 1.00 227.50 ? 110  ALA B O     1 
ATOM   2989  C  CB    . ALA B  2 110  ? 148.478 128.048 204.905 1.00 234.72 ? 110  ALA B CB    1 
ATOM   2990  N  N     . GLY B  2 111  ? 148.265 130.941 203.807 1.00 228.03 ? 111  GLY B N     1 
ATOM   2991  C  CA    . GLY B  2 111  ? 147.625 131.971 203.010 1.00 225.57 ? 111  GLY B CA    1 
ATOM   2992  C  C     . GLY B  2 111  ? 148.567 132.646 202.039 1.00 222.92 ? 111  GLY B C     1 
ATOM   2993  O  O     . GLY B  2 111  ? 148.118 133.163 201.013 1.00 223.48 ? 111  GLY B O     1 
ATOM   2994  N  N     . MET B  2 112  ? 149.869 132.652 202.337 1.00 222.60 ? 112  MET B N     1 
ATOM   2995  C  CA    . MET B  2 112  ? 150.818 133.235 201.394 1.00 221.48 ? 112  MET B CA    1 
ATOM   2996  C  C     . MET B  2 112  ? 151.237 132.243 200.316 1.00 218.72 ? 112  MET B C     1 
ATOM   2997  O  O     . MET B  2 112  ? 151.334 132.608 199.139 1.00 221.68 ? 112  MET B O     1 
ATOM   2998  C  CB    . MET B  2 112  ? 152.047 133.758 202.132 1.00 221.55 ? 112  MET B CB    1 
ATOM   2999  C  CG    . MET B  2 112  ? 151.711 134.909 203.036 1.00 222.05 ? 112  MET B CG    1 
ATOM   3000  S  SD    . MET B  2 112  ? 150.644 136.053 202.155 1.00 212.89 ? 112  MET B SD    1 
ATOM   3001  C  CE    . MET B  2 112  ? 151.825 136.751 201.005 1.00 216.78 ? 112  MET B CE    1 
ATOM   3002  N  N     . ALA B  2 113  ? 151.505 130.991 200.692 1.00 213.05 ? 113  ALA B N     1 
ATOM   3003  C  CA    . ALA B  2 113  ? 151.823 129.991 199.682 1.00 210.17 ? 113  ALA B CA    1 
ATOM   3004  C  C     . ALA B  2 113  ? 150.668 129.796 198.716 1.00 204.75 ? 113  ALA B C     1 
ATOM   3005  O  O     . ALA B  2 113  ? 150.889 129.428 197.560 1.00 208.93 ? 113  ALA B O     1 
ATOM   3006  C  CB    . ALA B  2 113  ? 152.187 128.663 200.344 1.00 218.58 ? 113  ALA B CB    1 
ATOM   3007  N  N     . PHE B  2 114  ? 149.437 130.049 199.159 1.00 208.36 ? 114  PHE B N     1 
ATOM   3008  C  CA    . PHE B  2 114  ? 148.288 129.945 198.265 1.00 206.48 ? 114  PHE B CA    1 
ATOM   3009  C  C     . PHE B  2 114  ? 148.417 130.918 197.098 1.00 204.12 ? 114  PHE B C     1 
ATOM   3010  O  O     . PHE B  2 114  ? 148.364 130.527 195.921 1.00 210.20 ? 114  PHE B O     1 
ATOM   3011  C  CB    . PHE B  2 114  ? 147.006 130.197 199.055 1.00 206.78 ? 114  PHE B CB    1 
ATOM   3012  C  CG    . PHE B  2 114  ? 145.757 130.077 198.243 1.00 209.60 ? 114  PHE B CG    1 
ATOM   3013  C  CD1   . PHE B  2 114  ? 145.196 128.840 197.992 1.00 206.49 ? 114  PHE B CD1   1 
ATOM   3014  C  CD2   . PHE B  2 114  ? 145.127 131.207 197.749 1.00 215.34 ? 114  PHE B CD2   1 
ATOM   3015  C  CE1   . PHE B  2 114  ? 144.036 128.731 197.253 1.00 215.54 ? 114  PHE B CE1   1 
ATOM   3016  C  CE2   . PHE B  2 114  ? 143.965 131.105 197.010 1.00 214.31 ? 114  PHE B CE2   1 
ATOM   3017  C  CZ    . PHE B  2 114  ? 143.421 129.866 196.758 1.00 216.90 ? 114  PHE B CZ    1 
ATOM   3018  N  N     . MET B  2 115  ? 148.597 132.201 197.412 1.00 208.65 ? 115  MET B N     1 
ATOM   3019  C  CA    . MET B  2 115  ? 148.789 133.193 196.365 1.00 203.82 ? 115  MET B CA    1 
ATOM   3020  C  C     . MET B  2 115  ? 150.091 132.967 195.612 1.00 200.53 ? 115  MET B C     1 
ATOM   3021  O  O     . MET B  2 115  ? 150.162 133.249 194.415 1.00 200.82 ? 115  MET B O     1 
ATOM   3022  C  CB    . MET B  2 115  ? 148.744 134.594 196.960 1.00 206.77 ? 115  MET B CB    1 
ATOM   3023  C  CG    . MET B  2 115  ? 147.404 134.946 197.574 1.00 210.21 ? 115  MET B CG    1 
ATOM   3024  S  SD    . MET B  2 115  ? 146.031 134.800 196.409 1.00 219.13 ? 115  MET B SD    1 
ATOM   3025  C  CE    . MET B  2 115  ? 146.420 136.086 195.220 1.00 219.46 ? 115  MET B CE    1 
ATOM   3026  N  N     . ALA B  2 116  ? 151.115 132.434 196.275 1.00 190.27 ? 116  ALA B N     1 
ATOM   3027  C  CA    . ALA B  2 116  ? 152.370 132.168 195.579 1.00 190.48 ? 116  ALA B CA    1 
ATOM   3028  C  C     . ALA B  2 116  ? 152.202 131.079 194.527 1.00 193.94 ? 116  ALA B C     1 
ATOM   3029  O  O     . ALA B  2 116  ? 152.725 131.200 193.419 1.00 196.13 ? 116  ALA B O     1 
ATOM   3030  C  CB    . ALA B  2 116  ? 153.456 131.785 196.579 1.00 202.19 ? 116  ALA B CB    1 
ATOM   3031  N  N     . ALA B  2 117  ? 151.465 130.013 194.849 1.00 202.95 ? 117  ALA B N     1 
ATOM   3032  C  CA    . ALA B  2 117  ? 151.220 128.956 193.872 1.00 195.07 ? 117  ALA B CA    1 
ATOM   3033  C  C     . ALA B  2 117  ? 150.307 129.440 192.756 1.00 197.43 ? 117  ALA B C     1 
ATOM   3034  O  O     . ALA B  2 117  ? 150.520 129.104 191.585 1.00 201.24 ? 117  ALA B O     1 
ATOM   3035  C  CB    . ALA B  2 117  ? 150.623 127.728 194.556 1.00 192.81 ? 117  ALA B CB    1 
ATOM   3036  N  N     . ILE B  2 118  ? 149.290 130.235 193.088 1.00 195.96 ? 118  ILE B N     1 
ATOM   3037  C  CA    . ILE B  2 118  ? 148.453 130.790 192.032 1.00 190.09 ? 118  ILE B CA    1 
ATOM   3038  C  C     . ILE B  2 118  ? 149.274 131.699 191.124 1.00 193.56 ? 118  ILE B C     1 
ATOM   3039  O  O     . ILE B  2 118  ? 149.107 131.691 189.898 1.00 200.91 ? 118  ILE B O     1 
ATOM   3040  C  CB    . ILE B  2 118  ? 147.248 131.522 192.633 1.00 189.48 ? 118  ILE B CB    1 
ATOM   3041  C  CG1   . ILE B  2 118  ? 146.350 130.517 193.335 1.00 194.40 ? 118  ILE B CG1   1 
ATOM   3042  C  CG2   . ILE B  2 118  ? 146.485 132.254 191.550 1.00 196.28 ? 118  ILE B CG2   1 
ATOM   3043  C  CD1   . ILE B  2 118  ? 145.041 131.094 193.764 1.00 203.13 ? 118  ILE B CD1   1 
ATOM   3044  N  N     . THR B  2 119  ? 150.195 132.472 191.697 1.00 200.63 ? 119  THR B N     1 
ATOM   3045  C  CA    . THR B  2 119  ? 151.026 133.331 190.867 1.00 201.90 ? 119  THR B CA    1 
ATOM   3046  C  C     . THR B  2 119  ? 152.060 132.525 190.090 1.00 202.19 ? 119  THR B C     1 
ATOM   3047  O  O     . THR B  2 119  ? 152.452 132.925 188.993 1.00 205.01 ? 119  THR B O     1 
ATOM   3048  C  CB    . THR B  2 119  ? 151.691 134.406 191.726 1.00 202.81 ? 119  THR B CB    1 
ATOM   3049  O  OG1   . THR B  2 119  ? 151.162 135.688 191.362 1.00 206.33 ? 119  THR B OG1   1 
ATOM   3050  C  CG2   . THR B  2 119  ? 153.206 134.408 191.547 1.00 205.95 ? 119  THR B CG2   1 
ATOM   3051  N  N     . SER B  2 120  ? 152.499 131.387 190.623 1.00 204.34 ? 120  SER B N     1 
ATOM   3052  C  CA    . SER B  2 120  ? 153.330 130.492 189.833 1.00 201.66 ? 120  SER B CA    1 
ATOM   3053  C  C     . SER B  2 120  ? 152.557 129.957 188.642 1.00 207.09 ? 120  SER B C     1 
ATOM   3054  O  O     . SER B  2 120  ? 153.103 129.830 187.541 1.00 216.74 ? 120  SER B O     1 
ATOM   3055  C  CB    . SER B  2 120  ? 153.837 129.338 190.693 1.00 201.14 ? 120  SER B CB    1 
ATOM   3056  O  OG    . SER B  2 120  ? 154.423 128.340 189.880 1.00 202.65 ? 120  SER B OG    1 
ATOM   3057  N  N     . VAL B  2 121  ? 151.277 129.649 188.838 1.00 199.38 ? 121  VAL B N     1 
ATOM   3058  C  CA    . VAL B  2 121  ? 150.438 129.258 187.712 1.00 197.33 ? 121  VAL B CA    1 
ATOM   3059  C  C     . VAL B  2 121  ? 150.332 130.399 186.708 1.00 197.60 ? 121  VAL B C     1 
ATOM   3060  O  O     . VAL B  2 121  ? 150.404 130.182 185.494 1.00 203.52 ? 121  VAL B O     1 
ATOM   3061  C  CB    . VAL B  2 121  ? 149.056 128.798 188.208 1.00 197.52 ? 121  VAL B CB    1 
ATOM   3062  C  CG1   . VAL B  2 121  ? 147.979 129.088 187.172 1.00 198.47 ? 121  VAL B CG1   1 
ATOM   3063  C  CG2   . VAL B  2 121  ? 149.101 127.321 188.518 1.00 196.55 ? 121  VAL B CG2   1 
ATOM   3064  N  N     . VAL B  2 122  ? 150.172 131.632 187.192 1.00 180.21 ? 122  VAL B N     1 
ATOM   3065  C  CA    . VAL B  2 122  ? 150.073 132.766 186.277 1.00 181.71 ? 122  VAL B CA    1 
ATOM   3066  C  C     . VAL B  2 122  ? 151.373 132.947 185.509 1.00 188.92 ? 122  VAL B C     1 
ATOM   3067  O  O     . VAL B  2 122  ? 151.370 133.232 184.306 1.00 200.61 ? 122  VAL B O     1 
ATOM   3068  C  CB    . VAL B  2 122  ? 149.692 134.045 187.032 1.00 183.91 ? 122  VAL B CB    1 
ATOM   3069  C  CG1   . VAL B  2 122  ? 149.711 135.215 186.085 1.00 186.23 ? 122  VAL B CG1   1 
ATOM   3070  C  CG2   . VAL B  2 122  ? 148.335 133.888 187.627 1.00 183.88 ? 122  VAL B CG2   1 
ATOM   3071  N  N     . TYR B  2 123  ? 152.504 132.788 186.185 1.00 194.42 ? 123  TYR B N     1 
ATOM   3072  C  CA    . TYR B  2 123  ? 153.788 132.839 185.500 1.00 196.43 ? 123  TYR B CA    1 
ATOM   3073  C  C     . TYR B  2 123  ? 153.877 131.764 184.436 1.00 202.43 ? 123  TYR B C     1 
ATOM   3074  O  O     . TYR B  2 123  ? 154.332 132.018 183.318 1.00 207.85 ? 123  TYR B O     1 
ATOM   3075  C  CB    . TYR B  2 123  ? 154.927 132.658 186.488 1.00 195.45 ? 123  TYR B CB    1 
ATOM   3076  C  CG    . TYR B  2 123  ? 155.714 133.897 186.757 1.00 193.54 ? 123  TYR B CG    1 
ATOM   3077  C  CD1   . TYR B  2 123  ? 156.727 134.303 185.908 1.00 186.79 ? 123  TYR B CD1   1 
ATOM   3078  C  CD2   . TYR B  2 123  ? 155.464 134.642 187.885 1.00 206.00 ? 123  TYR B CD2   1 
ATOM   3079  C  CE1   . TYR B  2 123  ? 157.458 135.434 186.182 1.00 196.10 ? 123  TYR B CE1   1 
ATOM   3080  C  CE2   . TYR B  2 123  ? 156.181 135.759 188.166 1.00 209.33 ? 123  TYR B CE2   1 
ATOM   3081  C  CZ    . TYR B  2 123  ? 157.173 136.164 187.319 1.00 204.79 ? 123  TYR B CZ    1 
ATOM   3082  O  OH    . TYR B  2 123  ? 157.873 137.308 187.639 1.00 209.69 ? 123  TYR B OH    1 
ATOM   3083  N  N     . TYR B  2 124  ? 153.476 130.543 184.771 1.00 182.27 ? 124  TYR B N     1 
ATOM   3084  C  CA    . TYR B  2 124  ? 153.635 129.481 183.796 1.00 184.35 ? 124  TYR B CA    1 
ATOM   3085  C  C     . TYR B  2 124  ? 152.689 129.667 182.626 1.00 189.97 ? 124  TYR B C     1 
ATOM   3086  O  O     . TYR B  2 124  ? 153.022 129.293 181.502 1.00 201.22 ? 124  TYR B O     1 
ATOM   3087  C  CB    . TYR B  2 124  ? 153.433 128.119 184.434 1.00 183.78 ? 124  TYR B CB    1 
ATOM   3088  C  CG    . TYR B  2 124  ? 154.287 127.080 183.759 1.00 192.47 ? 124  TYR B CG    1 
ATOM   3089  C  CD1   . TYR B  2 124  ? 155.671 127.122 183.869 1.00 193.41 ? 124  TYR B CD1   1 
ATOM   3090  C  CD2   . TYR B  2 124  ? 153.722 126.073 182.989 1.00 197.38 ? 124  TYR B CD2   1 
ATOM   3091  C  CE1   . TYR B  2 124  ? 156.466 126.181 183.247 1.00 195.79 ? 124  TYR B CE1   1 
ATOM   3092  C  CE2   . TYR B  2 124  ? 154.512 125.127 182.363 1.00 199.70 ? 124  TYR B CE2   1 
ATOM   3093  C  CZ    . TYR B  2 124  ? 155.881 125.187 182.499 1.00 197.95 ? 124  TYR B CZ    1 
ATOM   3094  O  OH    . TYR B  2 124  ? 156.668 124.246 181.883 1.00 208.74 ? 124  TYR B OH    1 
ATOM   3095  N  N     . HIS B  2 125  ? 151.526 130.266 182.848 1.00 194.28 ? 125  HIS B N     1 
ATOM   3096  C  CA    . HIS B  2 125  ? 150.679 130.610 181.714 1.00 194.63 ? 125  HIS B CA    1 
ATOM   3097  C  C     . HIS B  2 125  ? 151.345 131.676 180.852 1.00 200.37 ? 125  HIS B C     1 
ATOM   3098  O  O     . HIS B  2 125  ? 151.335 131.583 179.618 1.00 210.64 ? 125  HIS B O     1 
ATOM   3099  C  CB    . HIS B  2 125  ? 149.308 131.072 182.196 1.00 199.26 ? 125  HIS B CB    1 
ATOM   3100  C  CG    . HIS B  2 125  ? 148.428 131.577 181.101 1.00 208.26 ? 125  HIS B CG    1 
ATOM   3101  N  ND1   . HIS B  2 125  ? 147.989 132.882 181.038 1.00 212.15 ? 125  HIS B ND1   1 
ATOM   3102  C  CD2   . HIS B  2 125  ? 147.912 130.954 180.015 1.00 230.83 ? 125  HIS B CD2   1 
ATOM   3103  C  CE1   . HIS B  2 125  ? 147.236 133.041 179.964 1.00 221.25 ? 125  HIS B CE1   1 
ATOM   3104  N  NE2   . HIS B  2 125  ? 147.175 131.886 179.325 1.00 236.99 ? 125  HIS B NE2   1 
ATOM   3105  N  N     . ASN B  2 126  ? 151.956 132.678 181.485 1.00 200.09 ? 126  ASN B N     1 
ATOM   3106  C  CA    . ASN B  2 126  ? 152.642 133.731 180.743 1.00 198.76 ? 126  ASN B CA    1 
ATOM   3107  C  C     . ASN B  2 126  ? 153.865 133.223 180.006 1.00 206.59 ? 126  ASN B C     1 
ATOM   3108  O  O     . ASN B  2 126  ? 154.294 133.853 179.037 1.00 217.66 ? 126  ASN B O     1 
ATOM   3109  C  CB    . ASN B  2 126  ? 153.052 134.854 181.683 1.00 196.41 ? 126  ASN B CB    1 
ATOM   3110  C  CG    . ASN B  2 126  ? 151.916 135.789 181.974 1.00 197.00 ? 126  ASN B CG    1 
ATOM   3111  O  OD1   . ASN B  2 126  ? 150.818 135.632 181.442 1.00 199.24 ? 126  ASN B OD1   1 
ATOM   3112  N  ND2   . ASN B  2 126  ? 152.167 136.774 182.823 1.00 204.06 ? 126  ASN B ND2   1 
ATOM   3113  N  N     . ILE B  2 127  ? 154.453 132.127 180.465 1.00 204.71 ? 127  ILE B N     1 
ATOM   3114  C  CA    . ILE B  2 127  ? 155.590 131.540 179.770 1.00 208.20 ? 127  ILE B CA    1 
ATOM   3115  C  C     . ILE B  2 127  ? 155.137 130.591 178.669 1.00 211.25 ? 127  ILE B C     1 
ATOM   3116  O  O     . ILE B  2 127  ? 155.751 130.529 177.603 1.00 215.61 ? 127  ILE B O     1 
ATOM   3117  C  CB    . ILE B  2 127  ? 156.519 130.838 180.769 1.00 209.56 ? 127  ILE B CB    1 
ATOM   3118  C  CG1   . ILE B  2 127  ? 157.131 131.849 181.721 1.00 207.53 ? 127  ILE B CG1   1 
ATOM   3119  C  CG2   . ILE B  2 127  ? 157.623 130.085 180.049 1.00 222.73 ? 127  ILE B CG2   1 
ATOM   3120  C  CD1   . ILE B  2 127  ? 157.736 131.180 182.928 1.00 224.12 ? 127  ILE B CD1   1 
ATOM   3121  N  N     . GLU B  2 128  ? 154.066 129.832 178.891 1.00 209.05 ? 128  GLU B N     1 
ATOM   3122  C  CA    . GLU B  2 128  ? 153.532 129.016 177.813 1.00 211.93 ? 128  GLU B CA    1 
ATOM   3123  C  C     . GLU B  2 128  ? 153.092 129.891 176.649 1.00 214.52 ? 128  GLU B C     1 
ATOM   3124  O  O     . GLU B  2 128  ? 153.252 129.511 175.486 1.00 222.41 ? 128  GLU B O     1 
ATOM   3125  C  CB    . GLU B  2 128  ? 152.363 128.163 178.315 1.00 217.17 ? 128  GLU B CB    1 
ATOM   3126  N  N     . THR B  2 129  ? 152.564 131.084 176.937 1.00 208.34 ? 129  THR B N     1 
ATOM   3127  C  CA    . THR B  2 129  ? 152.122 131.933 175.837 1.00 210.08 ? 129  THR B CA    1 
ATOM   3128  C  C     . THR B  2 129  ? 153.304 132.583 175.121 1.00 206.56 ? 129  THR B C     1 
ATOM   3129  O  O     . THR B  2 129  ? 153.264 132.738 173.898 1.00 214.55 ? 129  THR B O     1 
ATOM   3130  C  CB    . THR B  2 129  ? 151.106 132.977 176.335 1.00 214.62 ? 129  THR B CB    1 
ATOM   3131  O  OG1   . THR B  2 129  ? 150.480 133.618 175.217 1.00 224.34 ? 129  THR B OG1   1 
ATOM   3132  C  CG2   . THR B  2 129  ? 151.750 134.031 177.228 1.00 206.88 ? 129  THR B CG2   1 
ATOM   3133  N  N     . SER B  2 130  ? 154.374 132.919 175.839 1.00 230.41 ? 130  SER B N     1 
ATOM   3134  C  CA    . SER B  2 130  ? 155.567 133.487 175.216 1.00 233.05 ? 130  SER B CA    1 
ATOM   3135  C  C     . SER B  2 130  ? 156.778 132.997 175.988 1.00 234.64 ? 130  SER B C     1 
ATOM   3136  O  O     . SER B  2 130  ? 156.853 133.177 177.206 1.00 244.04 ? 130  SER B O     1 
ATOM   3137  C  CB    . SER B  2 130  ? 155.508 135.017 175.196 1.00 234.57 ? 130  SER B CB    1 
ATOM   3138  O  OG    . SER B  2 130  ? 155.221 135.546 176.479 1.00 236.78 ? 130  SER B OG    1 
ATOM   3139  N  N     . ASN B  2 131  ? 157.717 132.368 175.295 1.00 215.33 ? 131  ASN B N     1 
ATOM   3140  C  CA    . ASN B  2 131  ? 158.807 131.694 175.982 1.00 226.07 ? 131  ASN B CA    1 
ATOM   3141  C  C     . ASN B  2 131  ? 159.902 132.674 176.376 1.00 224.95 ? 131  ASN B C     1 
ATOM   3142  O  O     . ASN B  2 131  ? 160.148 133.670 175.696 1.00 230.82 ? 131  ASN B O     1 
ATOM   3143  C  CB    . ASN B  2 131  ? 159.385 130.602 175.093 1.00 235.31 ? 131  ASN B CB    1 
ATOM   3144  C  CG    . ASN B  2 131  ? 159.616 131.084 173.693 1.00 240.88 ? 131  ASN B CG    1 
ATOM   3145  O  OD1   . ASN B  2 131  ? 158.929 131.992 173.223 1.00 235.56 ? 131  ASN B OD1   1 
ATOM   3146  N  ND2   . ASN B  2 131  ? 160.584 130.487 173.009 1.00 249.13 ? 131  ASN B ND2   1 
ATOM   3147  N  N     . PHE B  2 132  ? 160.561 132.377 177.493 1.00 224.07 ? 132  PHE B N     1 
ATOM   3148  C  CA    . PHE B  2 132  ? 161.686 133.160 177.981 1.00 236.50 ? 132  PHE B CA    1 
ATOM   3149  C  C     . PHE B  2 132  ? 162.633 132.239 178.728 1.00 238.75 ? 132  PHE B C     1 
ATOM   3150  O  O     . PHE B  2 132  ? 162.209 131.196 179.241 1.00 234.28 ? 132  PHE B O     1 
ATOM   3151  C  CB    . PHE B  2 132  ? 161.251 134.296 178.922 1.00 239.19 ? 132  PHE B CB    1 
ATOM   3152  C  CG    . PHE B  2 132  ? 160.672 135.493 178.225 1.00 228.02 ? 132  PHE B CG    1 
ATOM   3153  C  CD1   . PHE B  2 132  ? 161.484 136.536 177.810 1.00 223.42 ? 132  PHE B CD1   1 
ATOM   3154  C  CD2   . PHE B  2 132  ? 159.307 135.593 178.023 1.00 234.76 ? 132  PHE B CD2   1 
ATOM   3155  C  CE1   . PHE B  2 132  ? 160.945 137.645 177.188 1.00 224.41 ? 132  PHE B CE1   1 
ATOM   3156  C  CE2   . PHE B  2 132  ? 158.762 136.697 177.400 1.00 233.82 ? 132  PHE B CE2   1 
ATOM   3157  C  CZ    . PHE B  2 132  ? 159.581 137.725 176.986 1.00 230.39 ? 132  PHE B CZ    1 
ATOM   3158  N  N     . PRO B  2 133  ? 163.906 132.577 178.790 1.00 241.59 ? 133  PRO B N     1 
ATOM   3159  C  CA    . PRO B  2 133  ? 164.821 131.834 179.660 1.00 240.39 ? 133  PRO B CA    1 
ATOM   3160  C  C     . PRO B  2 133  ? 164.882 132.431 181.055 1.00 233.62 ? 133  PRO B C     1 
ATOM   3161  O  O     . PRO B  2 133  ? 165.387 131.797 181.982 1.00 244.74 ? 133  PRO B O     1 
ATOM   3162  C  CB    . PRO B  2 133  ? 166.171 131.953 178.936 1.00 256.99 ? 133  PRO B CB    1 
ATOM   3163  C  CG    . PRO B  2 133  ? 165.870 132.644 177.603 1.00 257.35 ? 133  PRO B CG    1 
ATOM   3164  C  CD    . PRO B  2 133  ? 164.633 133.436 177.846 1.00 250.69 ? 133  PRO B CD    1 
ATOM   3165  N  N     . LYS B  2 134  ? 164.392 133.655 181.216 1.00 227.65 ? 134  LYS B N     1 
ATOM   3166  C  CA    . LYS B  2 134  ? 164.603 134.339 182.480 1.00 228.50 ? 134  LYS B CA    1 
ATOM   3167  C  C     . LYS B  2 134  ? 163.462 134.118 183.455 1.00 225.24 ? 134  LYS B C     1 
ATOM   3168  O  O     . LYS B  2 134  ? 163.711 133.920 184.647 1.00 233.37 ? 134  LYS B O     1 
ATOM   3169  C  CB    . LYS B  2 134  ? 164.829 135.833 182.231 1.00 243.35 ? 134  LYS B CB    1 
ATOM   3170  C  CG    . LYS B  2 134  ? 166.252 136.181 181.795 1.00 257.93 ? 134  LYS B CG    1 
ATOM   3171  C  CD    . LYS B  2 134  ? 166.539 135.837 180.322 1.00 250.91 ? 134  LYS B CD    1 
ATOM   3172  C  CE    . LYS B  2 134  ? 167.923 135.213 180.134 1.00 239.59 ? 134  LYS B CE    1 
ATOM   3173  N  NZ    . LYS B  2 134  ? 168.161 134.808 178.722 1.00 228.69 ? 134  LYS B NZ    1 
ATOM   3174  N  N     . LEU B  2 135  ? 162.218 134.139 182.980 1.00 218.11 ? 135  LEU B N     1 
ATOM   3175  C  CA    . LEU B  2 135  ? 161.103 133.927 183.893 1.00 221.37 ? 135  LEU B CA    1 
ATOM   3176  C  C     . LEU B  2 135  ? 161.231 132.589 184.602 1.00 218.71 ? 135  LEU B C     1 
ATOM   3177  O  O     . LEU B  2 135  ? 160.934 132.503 185.799 1.00 214.78 ? 135  LEU B O     1 
ATOM   3178  C  CB    . LEU B  2 135  ? 159.763 134.015 183.144 1.00 228.00 ? 135  LEU B CB    1 
ATOM   3179  C  CG    . LEU B  2 135  ? 159.522 135.243 182.225 1.00 220.53 ? 135  LEU B CG    1 
ATOM   3180  C  CD1   . LEU B  2 135  ? 158.202 135.239 181.422 1.00 205.10 ? 135  LEU B CD1   1 
ATOM   3181  C  CD2   . LEU B  2 135  ? 159.677 136.552 182.982 1.00 214.60 ? 135  LEU B CD2   1 
ATOM   3182  N  N     . LEU B  2 136  ? 161.729 131.558 183.904 1.00 229.64 ? 136  LEU B N     1 
ATOM   3183  C  CA    . LEU B  2 136  ? 161.929 130.246 184.515 1.00 231.76 ? 136  LEU B CA    1 
ATOM   3184  C  C     . LEU B  2 136  ? 162.916 130.315 185.673 1.00 231.64 ? 136  LEU B C     1 
ATOM   3185  O  O     . LEU B  2 136  ? 162.654 129.769 186.747 1.00 233.16 ? 136  LEU B O     1 
ATOM   3186  C  CB    . LEU B  2 136  ? 162.415 129.257 183.461 1.00 234.12 ? 136  LEU B CB    1 
ATOM   3187  C  CG    . LEU B  2 136  ? 161.529 129.175 182.212 1.00 241.31 ? 136  LEU B CG    1 
ATOM   3188  C  CD1   . LEU B  2 136  ? 162.192 128.432 181.061 1.00 254.67 ? 136  LEU B CD1   1 
ATOM   3189  C  CD2   . LEU B  2 136  ? 160.196 128.547 182.569 1.00 235.27 ? 136  LEU B CD2   1 
ATOM   3190  N  N     . ILE B  2 137  ? 164.068 130.965 185.472 1.00 229.71 ? 137  ILE B N     1 
ATOM   3191  C  CA    . ILE B  2 137  ? 164.990 131.171 186.586 1.00 225.74 ? 137  ILE B CA    1 
ATOM   3192  C  C     . ILE B  2 137  ? 164.299 131.926 187.709 1.00 223.12 ? 137  ILE B C     1 
ATOM   3193  O  O     . ILE B  2 137  ? 164.540 131.662 188.898 1.00 228.67 ? 137  ILE B O     1 
ATOM   3194  C  CB    . ILE B  2 137  ? 166.249 131.917 186.110 1.00 227.63 ? 137  ILE B CB    1 
ATOM   3195  C  CG1   . ILE B  2 137  ? 166.818 131.249 184.855 1.00 235.83 ? 137  ILE B CG1   1 
ATOM   3196  C  CG2   . ILE B  2 137  ? 167.298 131.939 187.208 1.00 224.89 ? 137  ILE B CG2   1 
ATOM   3197  C  CD1   . ILE B  2 137  ? 167.930 132.035 184.206 1.00 248.08 ? 137  ILE B CD1   1 
ATOM   3198  N  N     . ALA B  2 138  ? 163.451 132.891 187.358 1.00 216.57 ? 138  ALA B N     1 
ATOM   3199  C  CA    . ALA B  2 138  ? 162.681 133.589 188.377 1.00 221.65 ? 138  ALA B CA    1 
ATOM   3200  C  C     . ALA B  2 138  ? 161.816 132.620 189.178 1.00 220.70 ? 138  ALA B C     1 
ATOM   3201  O  O     . ALA B  2 138  ? 161.633 132.805 190.382 1.00 229.51 ? 138  ALA B O     1 
ATOM   3202  C  CB    . ALA B  2 138  ? 161.844 134.695 187.730 1.00 226.19 ? 138  ALA B CB    1 
ATOM   3203  N  N     . LEU B  2 139  ? 161.320 131.560 188.556 1.00 226.10 ? 139  LEU B N     1 
ATOM   3204  C  CA    . LEU B  2 139  ? 160.605 130.589 189.373 1.00 221.32 ? 139  LEU B CA    1 
ATOM   3205  C  C     . LEU B  2 139  ? 161.582 129.761 190.198 1.00 225.39 ? 139  LEU B C     1 
ATOM   3206  O  O     . LEU B  2 139  ? 161.315 129.462 191.377 1.00 231.04 ? 139  LEU B O     1 
ATOM   3207  C  CB    . LEU B  2 139  ? 159.707 129.704 188.514 1.00 226.14 ? 139  LEU B CB    1 
ATOM   3208  C  CG    . LEU B  2 139  ? 158.337 130.332 188.213 1.00 228.06 ? 139  LEU B CG    1 
ATOM   3209  C  CD1   . LEU B  2 139  ? 157.531 129.396 187.335 1.00 226.02 ? 139  LEU B CD1   1 
ATOM   3210  C  CD2   . LEU B  2 139  ? 157.588 130.667 189.505 1.00 223.24 ? 139  LEU B CD2   1 
ATOM   3211  N  N     . LEU B  2 140  ? 162.727 129.415 189.602 1.00 228.55 ? 140  LEU B N     1 
ATOM   3212  C  CA    . LEU B  2 140  ? 163.626 128.467 190.252 1.00 229.57 ? 140  LEU B CA    1 
ATOM   3213  C  C     . LEU B  2 140  ? 164.160 129.036 191.556 1.00 231.97 ? 140  LEU B C     1 
ATOM   3214  O  O     . LEU B  2 140  ? 164.308 128.308 192.550 1.00 240.03 ? 140  LEU B O     1 
ATOM   3215  C  CB    . LEU B  2 140  ? 164.779 128.078 189.324 1.00 224.46 ? 140  LEU B CB    1 
ATOM   3216  C  CG    . LEU B  2 140  ? 165.878 127.179 189.917 1.00 229.16 ? 140  LEU B CG    1 
ATOM   3217  C  CD1   . LEU B  2 140  ? 165.370 125.810 190.360 1.00 238.66 ? 140  LEU B CD1   1 
ATOM   3218  C  CD2   . LEU B  2 140  ? 167.042 126.995 188.949 1.00 235.56 ? 140  LEU B CD2   1 
ATOM   3219  N  N     . ILE B  2 141  ? 164.429 130.344 191.578 1.00 210.16 ? 141  ILE B N     1 
ATOM   3220  C  CA    . ILE B  2 141  ? 164.915 130.977 192.805 1.00 214.35 ? 141  ILE B CA    1 
ATOM   3221  C  C     . ILE B  2 141  ? 163.916 130.767 193.937 1.00 214.42 ? 141  ILE B C     1 
ATOM   3222  O  O     . ILE B  2 141  ? 164.274 130.348 195.052 1.00 228.05 ? 141  ILE B O     1 
ATOM   3223  C  CB    . ILE B  2 141  ? 165.192 132.475 192.571 1.00 207.55 ? 141  ILE B CB    1 
ATOM   3224  N  N     . TYR B  2 142  ? 162.643 131.052 193.664 1.00 215.24 ? 142  TYR B N     1 
ATOM   3225  C  CA    . TYR B  2 142  ? 161.617 130.912 194.685 1.00 219.50 ? 142  TYR B CA    1 
ATOM   3226  C  C     . TYR B  2 142  ? 161.499 129.473 195.158 1.00 222.36 ? 142  TYR B C     1 
ATOM   3227  O  O     . TYR B  2 142  ? 161.342 129.219 196.359 1.00 230.84 ? 142  TYR B O     1 
ATOM   3228  C  CB    . TYR B  2 142  ? 160.280 131.406 194.148 1.00 222.19 ? 142  TYR B CB    1 
ATOM   3229  C  CG    . TYR B  2 142  ? 159.090 130.941 194.947 1.00 219.16 ? 142  TYR B CG    1 
ATOM   3230  C  CD1   . TYR B  2 142  ? 158.780 131.526 196.167 1.00 220.36 ? 142  TYR B CD1   1 
ATOM   3231  C  CD2   . TYR B  2 142  ? 158.267 129.928 194.473 1.00 213.29 ? 142  TYR B CD2   1 
ATOM   3232  C  CE1   . TYR B  2 142  ? 157.690 131.110 196.891 1.00 225.24 ? 142  TYR B CE1   1 
ATOM   3233  C  CE2   . TYR B  2 142  ? 157.176 129.510 195.190 1.00 215.06 ? 142  TYR B CE2   1 
ATOM   3234  C  CZ    . TYR B  2 142  ? 156.891 130.103 196.398 1.00 224.66 ? 142  TYR B CZ    1 
ATOM   3235  O  OH    . TYR B  2 142  ? 155.803 129.682 197.118 1.00 232.69 ? 142  TYR B OH    1 
ATOM   3236  N  N     . TRP B  2 143  ? 161.555 128.515 194.231 1.00 208.24 ? 143  TRP B N     1 
ATOM   3237  C  CA    . TRP B  2 143  ? 161.450 127.121 194.657 1.00 210.47 ? 143  TRP B CA    1 
ATOM   3238  C  C     . TRP B  2 143  ? 162.574 126.765 195.625 1.00 218.36 ? 143  TRP B C     1 
ATOM   3239  O  O     . TRP B  2 143  ? 162.333 126.149 196.674 1.00 228.85 ? 143  TRP B O     1 
ATOM   3240  C  CB    . TRP B  2 143  ? 161.461 126.175 193.460 1.00 204.87 ? 143  TRP B CB    1 
ATOM   3241  C  CG    . TRP B  2 143  ? 160.249 126.232 192.604 1.00 200.14 ? 143  TRP B CG    1 
ATOM   3242  C  CD1   . TRP B  2 143  ? 160.220 126.432 191.263 1.00 205.72 ? 143  TRP B CD1   1 
ATOM   3243  C  CD2   . TRP B  2 143  ? 158.886 126.084 193.018 1.00 198.26 ? 143  TRP B CD2   1 
ATOM   3244  N  NE1   . TRP B  2 143  ? 158.927 126.421 190.808 1.00 205.53 ? 143  TRP B NE1   1 
ATOM   3245  C  CE2   . TRP B  2 143  ? 158.088 126.208 191.868 1.00 200.30 ? 143  TRP B CE2   1 
ATOM   3246  C  CE3   . TRP B  2 143  ? 158.261 125.857 194.243 1.00 202.24 ? 143  TRP B CE3   1 
ATOM   3247  C  CZ2   . TRP B  2 143  ? 156.699 126.116 191.904 1.00 200.87 ? 143  TRP B CZ2   1 
ATOM   3248  C  CZ3   . TRP B  2 143  ? 156.881 125.766 194.280 1.00 204.57 ? 143  TRP B CZ3   1 
ATOM   3249  C  CH2   . TRP B  2 143  ? 156.116 125.895 193.118 1.00 200.59 ? 143  TRP B CH2   1 
ATOM   3250  N  N     . THR B  2 144  ? 163.810 127.158 195.299 1.00 212.39 ? 144  THR B N     1 
ATOM   3251  C  CA    . THR B  2 144  ? 164.928 126.830 196.185 1.00 215.66 ? 144  THR B CA    1 
ATOM   3252  C  C     . THR B  2 144  ? 164.742 127.446 197.567 1.00 218.75 ? 144  THR B C     1 
ATOM   3253  O  O     . THR B  2 144  ? 164.976 126.786 198.593 1.00 236.24 ? 144  THR B O     1 
ATOM   3254  C  CB    . THR B  2 144  ? 166.255 127.289 195.579 1.00 209.15 ? 144  THR B CB    1 
ATOM   3255  O  OG1   . THR B  2 144  ? 166.138 128.643 195.134 1.00 217.43 ? 144  THR B OG1   1 
ATOM   3256  C  CG2   . THR B  2 144  ? 166.642 126.409 194.416 1.00 209.05 ? 144  THR B CG2   1 
ATOM   3257  N  N     . LEU B  2 145  ? 164.322 128.709 197.619 1.00 206.83 ? 145  LEU B N     1 
ATOM   3258  C  CA    . LEU B  2 145  ? 164.197 129.354 198.923 1.00 209.27 ? 145  LEU B CA    1 
ATOM   3259  C  C     . LEU B  2 145  ? 163.071 128.730 199.749 1.00 213.92 ? 145  LEU B C     1 
ATOM   3260  O  O     . LEU B  2 145  ? 163.211 128.549 200.971 1.00 224.69 ? 145  LEU B O     1 
ATOM   3261  C  CB    . LEU B  2 145  ? 163.986 130.855 198.746 1.00 204.63 ? 145  LEU B CB    1 
ATOM   3262  C  CG    . LEU B  2 145  ? 165.122 131.557 198.000 1.00 201.18 ? 145  LEU B CG    1 
ATOM   3263  C  CD1   . LEU B  2 145  ? 164.902 133.054 197.964 1.00 205.19 ? 145  LEU B CD1   1 
ATOM   3264  C  CD2   . LEU B  2 145  ? 166.457 131.225 198.628 1.00 197.31 ? 145  LEU B CD2   1 
ATOM   3265  N  N     . ALA B  2 146  ? 161.953 128.380 199.105 1.00 209.04 ? 146  ALA B N     1 
ATOM   3266  C  CA    . ALA B  2 146  ? 160.865 127.747 199.845 1.00 215.03 ? 146  ALA B CA    1 
ATOM   3267  C  C     . ALA B  2 146  ? 161.287 126.382 200.368 1.00 230.29 ? 146  ALA B C     1 
ATOM   3268  O  O     . ALA B  2 146  ? 160.915 125.988 201.486 1.00 238.04 ? 146  ALA B O     1 
ATOM   3269  C  CB    . ALA B  2 146  ? 159.626 127.631 198.965 1.00 211.00 ? 146  ALA B CB    1 
ATOM   3270  N  N     . PHE B  2 147  ? 162.076 125.648 199.581 1.00 207.64 ? 147  PHE B N     1 
ATOM   3271  C  CA    . PHE B  2 147  ? 162.595 124.368 200.051 1.00 205.28 ? 147  PHE B CA    1 
ATOM   3272  C  C     . PHE B  2 147  ? 163.468 124.548 201.288 1.00 205.37 ? 147  PHE B C     1 
ATOM   3273  O  O     . PHE B  2 147  ? 163.372 123.775 202.245 1.00 218.27 ? 147  PHE B O     1 
ATOM   3274  C  CB    . PHE B  2 147  ? 163.387 123.690 198.939 1.00 201.06 ? 147  PHE B CB    1 
ATOM   3275  C  CG    . PHE B  2 147  ? 163.963 122.378 199.337 1.00 200.56 ? 147  PHE B CG    1 
ATOM   3276  C  CD1   . PHE B  2 147  ? 163.165 121.252 199.375 1.00 204.90 ? 147  PHE B CD1   1 
ATOM   3277  C  CD2   . PHE B  2 147  ? 165.300 122.264 199.667 1.00 208.83 ? 147  PHE B CD2   1 
ATOM   3278  C  CE1   . PHE B  2 147  ? 163.687 120.032 199.741 1.00 215.11 ? 147  PHE B CE1   1 
ATOM   3279  C  CE2   . PHE B  2 147  ? 165.833 121.046 200.032 1.00 218.75 ? 147  PHE B CE2   1 
ATOM   3280  C  CZ    . PHE B  2 147  ? 165.025 119.926 200.069 1.00 223.92 ? 147  PHE B CZ    1 
ATOM   3281  N  N     . ILE B  2 148  ? 164.321 125.571 201.281 1.00 197.79 ? 148  ILE B N     1 
ATOM   3282  C  CA    . ILE B  2 148  ? 165.174 125.836 202.439 1.00 194.56 ? 148  ILE B CA    1 
ATOM   3283  C  C     . ILE B  2 148  ? 164.334 126.100 203.686 1.00 201.19 ? 148  ILE B C     1 
ATOM   3284  O  O     . ILE B  2 148  ? 164.584 125.535 204.763 1.00 209.95 ? 148  ILE B O     1 
ATOM   3285  C  CB    . ILE B  2 148  ? 166.106 127.015 202.138 1.00 201.61 ? 148  ILE B CB    1 
ATOM   3286  C  CG1   . ILE B  2 148  ? 167.063 126.620 201.018 1.00 202.62 ? 148  ILE B CG1   1 
ATOM   3287  C  CG2   . ILE B  2 148  ? 166.814 127.458 203.412 1.00 206.64 ? 148  ILE B CG2   1 
ATOM   3288  C  CD1   . ILE B  2 148  ? 167.898 127.755 200.486 1.00 209.38 ? 148  ILE B CD1   1 
ATOM   3289  N  N     . THR B  2 149  ? 163.335 126.976 203.565 1.00 179.57 ? 149  THR B N     1 
ATOM   3290  C  CA    . THR B  2 149  ? 162.517 127.300 204.732 1.00 188.75 ? 149  THR B CA    1 
ATOM   3291  C  C     . THR B  2 149  ? 161.785 126.068 205.256 1.00 193.21 ? 149  THR B C     1 
ATOM   3292  O  O     . THR B  2 149  ? 161.718 125.842 206.476 1.00 203.61 ? 149  THR B O     1 
ATOM   3293  C  CB    . THR B  2 149  ? 161.526 128.407 204.386 1.00 188.21 ? 149  THR B CB    1 
ATOM   3294  O  OG1   . THR B  2 149  ? 160.716 127.996 203.279 1.00 194.89 ? 149  THR B OG1   1 
ATOM   3295  C  CG2   . THR B  2 149  ? 162.266 129.679 204.022 1.00 187.00 ? 149  THR B CG2   1 
ATOM   3296  N  N     . LYS B  2 150  ? 161.232 125.254 204.353 1.00 217.38 ? 150  LYS B N     1 
ATOM   3297  C  CA    . LYS B  2 150  ? 160.533 124.053 204.795 1.00 217.98 ? 150  LYS B CA    1 
ATOM   3298  C  C     . LYS B  2 150  ? 161.483 123.079 205.488 1.00 225.12 ? 150  LYS B C     1 
ATOM   3299  O  O     . LYS B  2 150  ? 161.108 122.422 206.470 1.00 232.64 ? 150  LYS B O     1 
ATOM   3300  C  CB    . LYS B  2 150  ? 159.842 123.391 203.605 1.00 211.61 ? 150  LYS B CB    1 
ATOM   3301  C  CG    . LYS B  2 150  ? 158.676 124.188 203.056 1.00 205.21 ? 150  LYS B CG    1 
ATOM   3302  C  CD    . LYS B  2 150  ? 157.608 124.392 204.119 1.00 209.78 ? 150  LYS B CD    1 
ATOM   3303  C  CE    . LYS B  2 150  ? 156.395 125.112 203.550 1.00 219.92 ? 150  LYS B CE    1 
ATOM   3304  N  NZ    . LYS B  2 150  ? 155.327 125.310 204.572 1.00 219.75 ? 150  LYS B NZ    1 
ATOM   3305  N  N     . THR B  2 151  ? 162.723 122.982 205.003 1.00 214.30 ? 151  THR B N     1 
ATOM   3306  C  CA    . THR B  2 151  ? 163.704 122.120 205.657 1.00 212.15 ? 151  THR B CA    1 
ATOM   3307  C  C     . THR B  2 151  ? 163.984 122.585 207.079 1.00 222.11 ? 151  THR B C     1 
ATOM   3308  O  O     . THR B  2 151  ? 164.077 121.766 208.006 1.00 229.48 ? 151  THR B O     1 
ATOM   3309  C  CB    . THR B  2 151  ? 164.996 122.088 204.840 1.00 215.96 ? 151  THR B CB    1 
ATOM   3310  O  OG1   . THR B  2 151  ? 164.748 121.451 203.583 1.00 216.35 ? 151  THR B OG1   1 
ATOM   3311  C  CG2   . THR B  2 151  ? 166.088 121.333 205.580 1.00 218.19 ? 151  THR B CG2   1 
ATOM   3312  N  N     . ILE B  2 152  ? 164.139 123.897 207.269 1.00 195.67 ? 152  ILE B N     1 
ATOM   3313  C  CA    . ILE B  2 152  ? 164.371 124.407 208.620 1.00 194.11 ? 152  ILE B CA    1 
ATOM   3314  C  C     . ILE B  2 152  ? 163.192 124.066 209.525 1.00 201.99 ? 152  ILE B C     1 
ATOM   3315  O  O     . ILE B  2 152  ? 163.371 123.636 210.678 1.00 210.41 ? 152  ILE B O     1 
ATOM   3316  C  CB    . ILE B  2 152  ? 164.659 125.919 208.588 1.00 192.51 ? 152  ILE B CB    1 
ATOM   3317  C  CG1   . ILE B  2 152  ? 166.163 126.177 208.486 1.00 189.29 ? 152  ILE B CG1   1 
ATOM   3318  C  CG2   . ILE B  2 152  ? 164.121 126.596 209.830 1.00 197.84 ? 152  ILE B CG2   1 
ATOM   3319  C  CD1   . ILE B  2 152  ? 166.792 125.714 207.197 1.00 191.15 ? 152  ILE B CD1   1 
ATOM   3320  N  N     . LYS B  2 153  ? 161.968 124.240 209.015 1.00 200.84 ? 153  LYS B N     1 
ATOM   3321  C  CA    . LYS B  2 153  ? 160.787 123.868 209.792 1.00 203.17 ? 153  LYS B CA    1 
ATOM   3322  C  C     . LYS B  2 153  ? 160.840 122.401 210.205 1.00 210.76 ? 153  LYS B C     1 
ATOM   3323  O  O     . LYS B  2 153  ? 160.585 122.057 211.367 1.00 216.79 ? 153  LYS B O     1 
ATOM   3324  C  CB    . LYS B  2 153  ? 159.515 124.144 208.993 1.00 198.16 ? 153  LYS B CB    1 
ATOM   3325  C  CG    . LYS B  2 153  ? 158.979 125.550 209.139 1.00 199.11 ? 153  LYS B CG    1 
ATOM   3326  C  CD    . LYS B  2 153  ? 157.509 125.621 208.751 1.00 202.33 ? 153  LYS B CD    1 
ATOM   3327  C  CE    . LYS B  2 153  ? 156.951 127.032 208.908 1.00 198.47 ? 153  LYS B CE    1 
ATOM   3328  N  NZ    . LYS B  2 153  ? 157.079 127.564 210.293 1.00 196.67 ? 153  LYS B NZ    1 
ATOM   3329  N  N     . PHE B  2 154  ? 161.177 121.526 209.258 1.00 220.20 ? 154  PHE B N     1 
ATOM   3330  C  CA    . PHE B  2 154  ? 161.197 120.092 209.534 1.00 227.16 ? 154  PHE B CA    1 
ATOM   3331  C  C     . PHE B  2 154  ? 162.225 119.744 210.602 1.00 226.26 ? 154  PHE B C     1 
ATOM   3332  O  O     . PHE B  2 154  ? 161.950 118.939 211.501 1.00 228.15 ? 154  PHE B O     1 
ATOM   3333  C  CB    . PHE B  2 154  ? 161.481 119.322 208.246 1.00 230.49 ? 154  PHE B CB    1 
ATOM   3334  C  CG    . PHE B  2 154  ? 161.493 117.829 208.416 1.00 236.23 ? 154  PHE B CG    1 
ATOM   3335  C  CD1   . PHE B  2 154  ? 160.315 117.104 208.354 1.00 237.58 ? 154  PHE B CD1   1 
ATOM   3336  C  CD2   . PHE B  2 154  ? 162.683 117.149 208.617 1.00 239.81 ? 154  PHE B CD2   1 
ATOM   3337  C  CE1   . PHE B  2 154  ? 160.322 115.732 208.501 1.00 243.45 ? 154  PHE B CE1   1 
ATOM   3338  C  CE2   . PHE B  2 154  ? 162.696 115.776 208.767 1.00 246.82 ? 154  PHE B CE2   1 
ATOM   3339  C  CZ    . PHE B  2 154  ? 161.514 115.067 208.708 1.00 248.60 ? 154  PHE B CZ    1 
ATOM   3340  N  N     . VAL B  2 155  ? 163.420 120.333 210.517 1.00 205.93 ? 155  VAL B N     1 
ATOM   3341  C  CA    . VAL B  2 155  ? 164.453 120.053 211.513 1.00 205.01 ? 155  VAL B CA    1 
ATOM   3342  C  C     . VAL B  2 155  ? 163.984 120.478 212.897 1.00 207.13 ? 155  VAL B C     1 
ATOM   3343  O  O     . VAL B  2 155  ? 164.032 119.701 213.864 1.00 212.98 ? 155  VAL B O     1 
ATOM   3344  C  CB    . VAL B  2 155  ? 165.771 120.750 211.133 1.00 204.77 ? 155  VAL B CB    1 
ATOM   3345  C  CG1   . VAL B  2 155  ? 166.770 120.657 212.279 1.00 207.14 ? 155  VAL B CG1   1 
ATOM   3346  C  CG2   . VAL B  2 155  ? 166.341 120.136 209.869 1.00 208.78 ? 155  VAL B CG2   1 
ATOM   3347  N  N     . LYS B  2 156  ? 163.517 121.725 213.012 1.00 218.20 ? 156  LYS B N     1 
ATOM   3348  C  CA    . LYS B  2 156  ? 163.106 122.216 214.322 1.00 220.29 ? 156  LYS B CA    1 
ATOM   3349  C  C     . LYS B  2 156  ? 161.924 121.429 214.869 1.00 220.47 ? 156  LYS B C     1 
ATOM   3350  O  O     . LYS B  2 156  ? 161.760 121.326 216.088 1.00 227.11 ? 156  LYS B O     1 
ATOM   3351  C  CB    . LYS B  2 156  ? 162.783 123.707 214.248 1.00 219.49 ? 156  LYS B CB    1 
ATOM   3352  C  CG    . LYS B  2 156  ? 163.989 124.564 213.886 1.00 223.46 ? 156  LYS B CG    1 
ATOM   3353  C  CD    . LYS B  2 156  ? 165.176 124.286 214.805 1.00 228.65 ? 156  LYS B CD    1 
ATOM   3354  C  CE    . LYS B  2 156  ? 166.394 125.112 214.407 1.00 227.75 ? 156  LYS B CE    1 
ATOM   3355  N  NZ    . LYS B  2 156  ? 167.568 124.858 215.293 1.00 235.77 ? 156  LYS B NZ    1 
ATOM   3356  N  N     . PHE B  2 157  ? 161.101 120.848 213.995 1.00 249.73 ? 157  PHE B N     1 
ATOM   3357  C  CA    . PHE B  2 157  ? 160.031 119.993 214.494 1.00 254.22 ? 157  PHE B CA    1 
ATOM   3358  C  C     . PHE B  2 157  ? 160.580 118.652 214.967 1.00 255.89 ? 157  PHE B C     1 
ATOM   3359  O  O     . PHE B  2 157  ? 160.149 118.128 216.002 1.00 257.33 ? 157  PHE B O     1 
ATOM   3360  C  CB    . PHE B  2 157  ? 158.967 119.794 213.417 1.00 261.14 ? 157  PHE B CB    1 
ATOM   3361  C  CG    . PHE B  2 157  ? 157.662 119.269 213.947 1.00 269.50 ? 157  PHE B CG    1 
ATOM   3362  C  CD1   . PHE B  2 157  ? 157.492 117.914 214.196 1.00 274.79 ? 157  PHE B CD1   1 
ATOM   3363  C  CD2   . PHE B  2 157  ? 156.604 120.127 214.196 1.00 265.85 ? 157  PHE B CD2   1 
ATOM   3364  C  CE1   . PHE B  2 157  ? 156.295 117.427 214.685 1.00 273.81 ? 157  PHE B CE1   1 
ATOM   3365  C  CE2   . PHE B  2 157  ? 155.402 119.646 214.683 1.00 270.89 ? 157  PHE B CE2   1 
ATOM   3366  C  CZ    . PHE B  2 157  ? 155.248 118.293 214.928 1.00 275.86 ? 157  PHE B CZ    1 
ATOM   3367  N  N     . TYR B  2 158  ? 161.530 118.082 214.222 1.00 243.18 ? 158  TYR B N     1 
ATOM   3368  C  CA    . TYR B  2 158  ? 162.096 116.794 214.606 1.00 247.07 ? 158  TYR B CA    1 
ATOM   3369  C  C     . TYR B  2 158  ? 162.764 116.875 215.971 1.00 246.71 ? 158  TYR B C     1 
ATOM   3370  O  O     . TYR B  2 158  ? 162.687 115.929 216.763 1.00 249.12 ? 158  TYR B O     1 
ATOM   3371  C  CB    . TYR B  2 158  ? 163.091 116.315 213.550 1.00 250.06 ? 158  TYR B CB    1 
ATOM   3372  C  CG    . TYR B  2 158  ? 163.645 114.932 213.818 1.00 258.31 ? 158  TYR B CG    1 
ATOM   3373  C  CD1   . TYR B  2 158  ? 164.801 114.756 214.572 1.00 263.74 ? 158  TYR B CD1   1 
ATOM   3374  C  CD2   . TYR B  2 158  ? 163.013 113.799 213.318 1.00 261.22 ? 158  TYR B CD2   1 
ATOM   3375  C  CE1   . TYR B  2 158  ? 165.308 113.495 214.822 1.00 269.82 ? 158  TYR B CE1   1 
ATOM   3376  C  CE2   . TYR B  2 158  ? 163.514 112.534 213.563 1.00 267.73 ? 158  TYR B CE2   1 
ATOM   3377  C  CZ    . TYR B  2 158  ? 164.662 112.389 214.315 1.00 275.05 ? 158  TYR B CZ    1 
ATOM   3378  O  OH    . TYR B  2 158  ? 165.170 111.133 214.564 1.00 288.15 ? 158  TYR B OH    1 
ATOM   3379  N  N     . ASP B  2 159  ? 163.419 118.001 216.267 1.00 253.46 ? 159  ASP B N     1 
ATOM   3380  C  CA    . ASP B  2 159  ? 164.058 118.128 217.576 1.00 253.54 ? 159  ASP B CA    1 
ATOM   3381  C  C     . ASP B  2 159  ? 163.044 118.062 218.711 1.00 250.64 ? 159  ASP B C     1 
ATOM   3382  O  O     . ASP B  2 159  ? 163.397 117.689 219.836 1.00 251.64 ? 159  ASP B O     1 
ATOM   3383  C  CB    . ASP B  2 159  ? 164.864 119.423 217.654 1.00 254.08 ? 159  ASP B CB    1 
ATOM   3384  C  CG    . ASP B  2 159  ? 166.262 119.268 217.094 1.00 252.70 ? 159  ASP B CG    1 
ATOM   3385  O  OD1   . ASP B  2 159  ? 166.523 118.246 216.424 1.00 249.04 ? 159  ASP B OD1   1 
ATOM   3386  O  OD2   . ASP B  2 159  ? 167.103 120.158 217.331 1.00 256.72 ? 159  ASP B OD2   1 
ATOM   3387  N  N     . HIS B  2 160  ? 161.789 118.403 218.442 1.00 246.84 ? 160  HIS B N     1 
ATOM   3388  C  CA    . HIS B  2 160  ? 160.748 118.320 219.458 1.00 251.21 ? 160  HIS B CA    1 
ATOM   3389  C  C     . HIS B  2 160  ? 159.940 117.036 219.303 1.00 251.50 ? 160  HIS B C     1 
ATOM   3390  O  O     . HIS B  2 160  ? 158.965 116.992 218.554 1.00 251.00 ? 160  HIS B O     1 
ATOM   3391  C  CB    . HIS B  2 160  ? 159.823 119.535 219.384 1.00 252.05 ? 160  HIS B CB    1 
ATOM   3392  C  CG    . HIS B  2 160  ? 160.494 120.826 219.740 1.00 251.44 ? 160  HIS B CG    1 
ATOM   3393  N  ND1   . HIS B  2 160  ? 161.426 121.432 218.925 1.00 250.11 ? 160  HIS B ND1   1 
ATOM   3394  C  CD2   . HIS B  2 160  ? 160.365 121.626 220.825 1.00 252.63 ? 160  HIS B CD2   1 
ATOM   3395  C  CE1   . HIS B  2 160  ? 161.841 122.551 219.492 1.00 249.70 ? 160  HIS B CE1   1 
ATOM   3396  N  NE2   . HIS B  2 160  ? 161.213 122.693 220.644 1.00 250.59 ? 160  HIS B NE2   1 
ATOM   3397  N  N     . LEU B  2 167  ? 149.887 116.379 213.655 1.00 262.37 ? 167  LEU B N     1 
ATOM   3398  C  CA    . LEU B  2 167  ? 149.257 116.681 212.374 1.00 256.95 ? 167  LEU B CA    1 
ATOM   3399  C  C     . LEU B  2 167  ? 150.176 117.539 211.512 1.00 249.08 ? 167  LEU B C     1 
ATOM   3400  O  O     . LEU B  2 167  ? 150.248 117.356 210.300 1.00 248.88 ? 167  LEU B O     1 
ATOM   3401  C  CB    . LEU B  2 167  ? 147.919 117.394 212.588 1.00 256.56 ? 167  LEU B CB    1 
ATOM   3402  C  CG    . LEU B  2 167  ? 146.719 116.956 211.741 1.00 252.32 ? 167  LEU B CG    1 
ATOM   3403  C  CD1   . LEU B  2 167  ? 145.508 117.832 212.039 1.00 260.36 ? 167  LEU B CD1   1 
ATOM   3404  C  CD2   . LEU B  2 167  ? 147.038 116.972 210.255 1.00 244.60 ? 167  LEU B CD2   1 
ATOM   3405  N  N     . ARG B  2 168  ? 150.870 118.482 212.153 1.00 238.89 ? 168  ARG B N     1 
ATOM   3406  C  CA    . ARG B  2 168  ? 151.748 119.393 211.424 1.00 242.13 ? 168  ARG B CA    1 
ATOM   3407  C  C     . ARG B  2 168  ? 152.800 118.630 210.630 1.00 244.42 ? 168  ARG B C     1 
ATOM   3408  O  O     . ARG B  2 168  ? 153.158 119.023 209.509 1.00 250.19 ? 168  ARG B O     1 
ATOM   3409  C  CB    . ARG B  2 168  ? 152.425 120.352 212.401 1.00 246.48 ? 168  ARG B CB    1 
ATOM   3410  C  CG    . ARG B  2 168  ? 151.491 120.972 213.421 1.00 250.80 ? 168  ARG B CG    1 
ATOM   3411  C  CD    . ARG B  2 168  ? 150.714 122.108 212.804 1.00 247.70 ? 168  ARG B CD    1 
ATOM   3412  N  NE    . ARG B  2 168  ? 151.605 123.072 212.171 1.00 242.80 ? 168  ARG B NE    1 
ATOM   3413  C  CZ    . ARG B  2 168  ? 151.191 124.140 211.499 1.00 249.34 ? 168  ARG B CZ    1 
ATOM   3414  N  NH1   . ARG B  2 168  ? 149.891 124.378 211.373 1.00 252.27 ? 168  ARG B NH1   1 
ATOM   3415  N  NH2   . ARG B  2 168  ? 152.072 124.966 210.955 1.00 254.41 ? 168  ARG B NH2   1 
ATOM   3416  N  N     . PHE B  2 169  ? 153.299 117.532 211.200 1.00 283.94 ? 169  PHE B N     1 
ATOM   3417  C  CA    . PHE B  2 169  ? 154.420 116.802 210.616 1.00 287.48 ? 169  PHE B CA    1 
ATOM   3418  C  C     . PHE B  2 169  ? 154.094 116.322 209.205 1.00 283.20 ? 169  PHE B C     1 
ATOM   3419  O  O     . PHE B  2 169  ? 154.877 116.528 208.266 1.00 285.52 ? 169  PHE B O     1 
ATOM   3420  C  CB    . PHE B  2 169  ? 154.778 115.631 211.530 1.00 295.81 ? 169  PHE B CB    1 
ATOM   3421  C  CG    . PHE B  2 169  ? 156.037 114.913 211.149 1.00 307.44 ? 169  PHE B CG    1 
ATOM   3422  C  CD1   . PHE B  2 169  ? 157.277 115.432 211.485 1.00 309.37 ? 169  PHE B CD1   1 
ATOM   3423  C  CD2   . PHE B  2 169  ? 155.980 113.702 210.481 1.00 315.28 ? 169  PHE B CD2   1 
ATOM   3424  C  CE1   . PHE B  2 169  ? 158.439 114.763 211.145 1.00 312.36 ? 169  PHE B CE1   1 
ATOM   3425  C  CE2   . PHE B  2 169  ? 157.137 113.030 210.137 1.00 320.63 ? 169  PHE B CE2   1 
ATOM   3426  C  CZ    . PHE B  2 169  ? 158.367 113.561 210.469 1.00 320.32 ? 169  PHE B CZ    1 
ATOM   3427  N  N     . CYS B  2 170  ? 152.954 115.656 209.058 1.00 294.41 ? 170  CYS B N     1 
ATOM   3428  C  CA    . CYS B  2 170  ? 152.540 115.130 207.761 1.00 293.00 ? 170  CYS B CA    1 
ATOM   3429  C  C     . CYS B  2 170  ? 152.400 116.238 206.726 1.00 287.22 ? 170  CYS B C     1 
ATOM   3430  O  O     . CYS B  2 170  ? 153.023 116.196 205.664 1.00 286.08 ? 170  CYS B O     1 
ATOM   3431  C  CB    . CYS B  2 170  ? 151.221 114.366 207.892 1.00 292.61 ? 170  CYS B CB    1 
ATOM   3432  N  N     . LEU B  2 171  ? 151.560 117.221 207.033 1.00 237.69 ? 171  LEU B N     1 
ATOM   3433  C  CA    . LEU B  2 171  ? 151.321 118.340 206.128 1.00 233.67 ? 171  LEU B CA    1 
ATOM   3434  C  C     . LEU B  2 171  ? 152.624 118.990 205.679 1.00 233.08 ? 171  LEU B C     1 
ATOM   3435  O  O     . LEU B  2 171  ? 152.779 119.353 204.512 1.00 235.02 ? 171  LEU B O     1 
ATOM   3436  C  CB    . LEU B  2 171  ? 150.417 119.381 206.792 1.00 233.97 ? 171  LEU B CB    1 
ATOM   3437  C  CG    . LEU B  2 171  ? 148.925 119.044 206.852 1.00 237.64 ? 171  LEU B CG    1 
ATOM   3438  C  CD1   . LEU B  2 171  ? 148.090 120.314 206.919 1.00 232.01 ? 171  LEU B CD1   1 
ATOM   3439  C  CD2   . LEU B  2 171  ? 148.518 118.192 205.660 1.00 236.94 ? 171  LEU B CD2   1 
ATOM   3440  N  N     . THR B  2 172  ? 153.558 119.135 206.612 1.00 243.62 ? 172  THR B N     1 
ATOM   3441  C  CA    . THR B  2 172  ? 154.850 119.746 206.318 1.00 238.67 ? 172  THR B CA    1 
ATOM   3442  C  C     . THR B  2 172  ? 155.726 118.815 205.484 1.00 234.96 ? 172  THR B C     1 
ATOM   3443  O  O     . THR B  2 172  ? 156.393 119.261 204.536 1.00 234.33 ? 172  THR B O     1 
ATOM   3444  C  CB    . THR B  2 172  ? 155.556 120.133 207.620 1.00 248.71 ? 172  THR B CB    1 
ATOM   3445  O  OG1   . THR B  2 172  ? 155.592 119.007 208.510 1.00 259.25 ? 172  THR B OG1   1 
ATOM   3446  C  CG2   . THR B  2 172  ? 154.829 121.292 208.297 1.00 246.64 ? 172  THR B CG2   1 
ATOM   3447  N  N     . GLY B  2 173  ? 155.743 117.519 205.822 1.00 241.41 ? 173  GLY B N     1 
ATOM   3448  C  CA    . GLY B  2 173  ? 156.533 116.577 205.037 1.00 241.27 ? 173  GLY B CA    1 
ATOM   3449  C  C     . GLY B  2 173  ? 156.093 116.514 203.584 1.00 234.86 ? 173  GLY B C     1 
ATOM   3450  O  O     . GLY B  2 173  ? 156.919 116.544 202.661 1.00 235.04 ? 173  GLY B O     1 
ATOM   3451  N  N     . LEU B  2 174  ? 154.781 116.436 203.361 1.00 227.78 ? 174  LEU B N     1 
ATOM   3452  C  CA    . LEU B  2 174  ? 154.276 116.398 201.993 1.00 224.57 ? 174  LEU B CA    1 
ATOM   3453  C  C     . LEU B  2 174  ? 154.571 117.703 201.261 1.00 219.62 ? 174  LEU B C     1 
ATOM   3454  O  O     . LEU B  2 174  ? 154.870 117.695 200.059 1.00 221.50 ? 174  LEU B O     1 
ATOM   3455  C  CB    . LEU B  2 174  ? 152.780 116.095 201.999 1.00 226.66 ? 174  LEU B CB    1 
ATOM   3456  C  CG    . LEU B  2 174  ? 152.417 114.786 202.708 1.00 237.37 ? 174  LEU B CG    1 
ATOM   3457  C  CD1   . LEU B  2 174  ? 150.935 114.464 202.555 1.00 241.92 ? 174  LEU B CD1   1 
ATOM   3458  C  CD2   . LEU B  2 174  ? 153.278 113.628 202.213 1.00 242.61 ? 174  LEU B CD2   1 
ATOM   3459  N  N     . LEU B  2 175  ? 154.499 118.833 201.972 1.00 229.83 ? 175  LEU B N     1 
ATOM   3460  C  CA    . LEU B  2 175  ? 154.895 120.117 201.395 1.00 222.01 ? 175  LEU B CA    1 
ATOM   3461  C  C     . LEU B  2 175  ? 156.317 120.061 200.854 1.00 220.69 ? 175  LEU B C     1 
ATOM   3462  O  O     . LEU B  2 175  ? 156.578 120.443 199.703 1.00 219.93 ? 175  LEU B O     1 
ATOM   3463  C  CB    . LEU B  2 175  ? 154.787 121.220 202.452 1.00 219.08 ? 175  LEU B CB    1 
ATOM   3464  C  CG    . LEU B  2 175  ? 153.610 122.198 202.449 1.00 219.20 ? 175  LEU B CG    1 
ATOM   3465  C  CD1   . LEU B  2 175  ? 153.850 123.294 203.475 1.00 231.65 ? 175  LEU B CD1   1 
ATOM   3466  C  CD2   . LEU B  2 175  ? 153.389 122.794 201.066 1.00 217.42 ? 175  LEU B CD2   1 
ATOM   3467  N  N     . VAL B  2 176  ? 157.255 119.619 201.693 1.00 217.98 ? 176  VAL B N     1 
ATOM   3468  C  CA    . VAL B  2 176  ? 158.653 119.565 201.276 1.00 213.42 ? 176  VAL B CA    1 
ATOM   3469  C  C     . VAL B  2 176  ? 158.811 118.659 200.065 1.00 209.70 ? 176  VAL B C     1 
ATOM   3470  O  O     . VAL B  2 176  ? 159.527 118.994 199.112 1.00 212.49 ? 176  VAL B O     1 
ATOM   3471  C  CB    . VAL B  2 176  ? 159.552 119.110 202.441 1.00 216.59 ? 176  VAL B CB    1 
ATOM   3472  C  CG1   . VAL B  2 176  ? 160.979 118.924 201.960 1.00 217.41 ? 176  VAL B CG1   1 
ATOM   3473  C  CG2   . VAL B  2 176  ? 159.502 120.117 203.580 1.00 226.40 ? 176  VAL B CG2   1 
ATOM   3474  N  N     . ILE B  2 177  ? 158.137 117.504 200.073 1.00 225.43 ? 177  ILE B N     1 
ATOM   3475  C  CA    . ILE B  2 177  ? 158.277 116.569 198.954 1.00 225.75 ? 177  ILE B CA    1 
ATOM   3476  C  C     . ILE B  2 177  ? 157.773 117.198 197.655 1.00 225.12 ? 177  ILE B C     1 
ATOM   3477  O  O     . ILE B  2 177  ? 158.402 117.063 196.593 1.00 227.85 ? 177  ILE B O     1 
ATOM   3478  C  CB    . ILE B  2 177  ? 157.555 115.243 199.264 1.00 229.04 ? 177  ILE B CB    1 
ATOM   3479  C  CG1   . ILE B  2 177  ? 158.192 114.562 200.481 1.00 233.89 ? 177  ILE B CG1   1 
ATOM   3480  C  CG2   . ILE B  2 177  ? 157.590 114.316 198.051 1.00 232.79 ? 177  ILE B CG2   1 
ATOM   3481  C  CD1   . ILE B  2 177  ? 157.564 113.225 200.851 1.00 237.98 ? 177  ILE B CD1   1 
ATOM   3482  N  N     . LEU B  2 178  ? 156.638 117.903 197.719 1.00 225.74 ? 178  LEU B N     1 
ATOM   3483  C  CA    . LEU B  2 178  ? 156.079 118.510 196.511 1.00 218.10 ? 178  LEU B CA    1 
ATOM   3484  C  C     . LEU B  2 178  ? 156.971 119.629 195.986 1.00 216.98 ? 178  LEU B C     1 
ATOM   3485  O  O     . LEU B  2 178  ? 157.207 119.732 194.773 1.00 218.07 ? 178  LEU B O     1 
ATOM   3486  C  CB    . LEU B  2 178  ? 154.671 119.026 196.795 1.00 213.86 ? 178  LEU B CB    1 
ATOM   3487  C  CG    . LEU B  2 178  ? 153.683 117.919 197.169 1.00 212.85 ? 178  LEU B CG    1 
ATOM   3488  C  CD1   . LEU B  2 178  ? 152.378 118.492 197.699 1.00 216.30 ? 178  LEU B CD1   1 
ATOM   3489  C  CD2   . LEU B  2 178  ? 153.434 117.004 195.978 1.00 211.32 ? 178  LEU B CD2   1 
ATOM   3490  N  N     . TYR B  2 179  ? 157.473 120.477 196.885 1.00 207.59 ? 179  TYR B N     1 
ATOM   3491  C  CA    . TYR B  2 179  ? 158.432 121.495 196.474 1.00 204.83 ? 179  TYR B CA    1 
ATOM   3492  C  C     . TYR B  2 179  ? 159.643 120.871 195.792 1.00 209.25 ? 179  TYR B C     1 
ATOM   3493  O  O     . TYR B  2 179  ? 160.121 121.375 194.766 1.00 211.96 ? 179  TYR B O     1 
ATOM   3494  C  CB    . TYR B  2 179  ? 158.867 122.318 197.683 1.00 203.06 ? 179  TYR B CB    1 
ATOM   3495  C  CG    . TYR B  2 179  ? 157.955 123.474 197.991 1.00 206.43 ? 179  TYR B CG    1 
ATOM   3496  C  CD1   . TYR B  2 179  ? 158.095 124.683 197.327 1.00 207.80 ? 179  TYR B CD1   1 
ATOM   3497  C  CD2   . TYR B  2 179  ? 156.954 123.359 198.943 1.00 220.10 ? 179  TYR B CD2   1 
ATOM   3498  C  CE1   . TYR B  2 179  ? 157.266 125.743 197.599 1.00 208.54 ? 179  TYR B CE1   1 
ATOM   3499  C  CE2   . TYR B  2 179  ? 156.120 124.418 199.226 1.00 222.71 ? 179  TYR B CE2   1 
ATOM   3500  C  CZ    . TYR B  2 179  ? 156.283 125.609 198.550 1.00 213.03 ? 179  TYR B CZ    1 
ATOM   3501  O  OH    . TYR B  2 179  ? 155.457 126.674 198.818 1.00 210.00 ? 179  TYR B OH    1 
ATOM   3502  N  N     . GLY B  2 180  ? 160.157 119.773 196.353 1.00 220.20 ? 180  GLY B N     1 
ATOM   3503  C  CA    . GLY B  2 180  ? 161.315 119.126 195.759 1.00 220.33 ? 180  GLY B CA    1 
ATOM   3504  C  C     . GLY B  2 180  ? 161.039 118.602 194.364 1.00 222.34 ? 180  GLY B C     1 
ATOM   3505  O  O     . GLY B  2 180  ? 161.863 118.752 193.457 1.00 226.22 ? 180  GLY B O     1 
ATOM   3506  N  N     . MET B  2 181  ? 159.875 117.979 194.168 1.00 226.15 ? 181  MET B N     1 
ATOM   3507  C  CA    . MET B  2 181  ? 159.549 117.495 192.830 1.00 226.41 ? 181  MET B CA    1 
ATOM   3508  C  C     . MET B  2 181  ? 159.365 118.652 191.851 1.00 226.98 ? 181  MET B C     1 
ATOM   3509  O  O     . MET B  2 181  ? 159.682 118.517 190.658 1.00 230.97 ? 181  MET B O     1 
ATOM   3510  C  CB    . MET B  2 181  ? 158.314 116.594 192.888 1.00 224.89 ? 181  MET B CB    1 
ATOM   3511  C  CG    . MET B  2 181  ? 158.517 115.371 193.803 1.00 224.56 ? 181  MET B CG    1 
ATOM   3512  S  SD    . MET B  2 181  ? 157.281 114.044 193.708 1.00 229.63 ? 181  MET B SD    1 
ATOM   3513  C  CE    . MET B  2 181  ? 157.634 113.329 192.096 1.00 238.38 ? 181  MET B CE    1 
ATOM   3514  N  N     . LEU B  2 182  ? 158.796 119.751 192.129 1.00 225.72 ? 182  LEU B N     1 
ATOM   3515  C  CA    . LEU B  2 182  ? 158.704 120.893 191.221 1.00 224.03 ? 182  LEU B CA    1 
ATOM   3516  C  C     . LEU B  2 182  ? 160.085 121.466 190.909 1.00 226.39 ? 182  LEU B C     1 
ATOM   3517  O  O     . LEU B  2 182  ? 160.354 121.889 189.777 1.00 228.45 ? 182  LEU B O     1 
ATOM   3518  C  CB    . LEU B  2 182  ? 157.784 121.962 191.814 1.00 220.98 ? 182  LEU B CB    1 
ATOM   3519  C  CG    . LEU B  2 182  ? 156.284 121.668 191.728 1.00 217.44 ? 182  LEU B CG    1 
ATOM   3520  C  CD1   . LEU B  2 182  ? 155.502 122.405 192.794 1.00 210.29 ? 182  LEU B CD1   1 
ATOM   3521  C  CD2   . LEU B  2 182  ? 155.771 122.049 190.359 1.00 221.08 ? 182  LEU B CD2   1 
ATOM   3522  N  N     . LEU B  2 183  ? 160.978 121.474 191.903 1.00 213.52 ? 183  LEU B N     1 
ATOM   3523  C  CA    . LEU B  2 183  ? 162.363 121.871 191.664 1.00 214.64 ? 183  LEU B CA    1 
ATOM   3524  C  C     . LEU B  2 183  ? 163.018 120.978 190.623 1.00 216.55 ? 183  LEU B C     1 
ATOM   3525  O  O     . LEU B  2 183  ? 163.711 121.456 189.721 1.00 218.93 ? 183  LEU B O     1 
ATOM   3526  C  CB    . LEU B  2 183  ? 163.150 121.815 192.971 1.00 225.21 ? 183  LEU B CB    1 
ATOM   3527  C  CG    . LEU B  2 183  ? 163.176 123.059 193.851 1.00 228.01 ? 183  LEU B CG    1 
ATOM   3528  C  CD1   . LEU B  2 183  ? 163.465 122.676 195.292 1.00 229.96 ? 183  LEU B CD1   1 
ATOM   3529  C  CD2   . LEU B  2 183  ? 164.234 124.008 193.333 1.00 224.02 ? 183  LEU B CD2   1 
ATOM   3530  N  N     . LEU B  2 184  ? 162.831 119.663 190.756 1.00 245.84 ? 184  LEU B N     1 
ATOM   3531  C  CA    . LEU B  2 184  ? 163.400 118.740 189.779 1.00 244.25 ? 184  LEU B CA    1 
ATOM   3532  C  C     . LEU B  2 184  ? 162.820 118.984 188.396 1.00 248.49 ? 184  LEU B C     1 
ATOM   3533  O  O     . LEU B  2 184  ? 163.522 118.849 187.390 1.00 251.29 ? 184  LEU B O     1 
ATOM   3534  C  CB    . LEU B  2 184  ? 163.155 117.298 190.209 1.00 242.59 ? 184  LEU B CB    1 
ATOM   3535  C  CG    . LEU B  2 184  ? 163.860 116.919 191.504 1.00 246.97 ? 184  LEU B CG    1 
ATOM   3536  C  CD1   . LEU B  2 184  ? 163.578 115.471 191.850 1.00 262.53 ? 184  LEU B CD1   1 
ATOM   3537  C  CD2   . LEU B  2 184  ? 165.353 117.174 191.373 1.00 244.92 ? 184  LEU B CD2   1 
ATOM   3538  N  N     . VAL B  2 185  ? 161.537 119.344 188.330 1.00 241.91 ? 185  VAL B N     1 
ATOM   3539  C  CA    . VAL B  2 185  ? 160.933 119.679 187.043 1.00 237.22 ? 185  VAL B CA    1 
ATOM   3540  C  C     . VAL B  2 185  ? 161.625 120.894 186.435 1.00 241.62 ? 185  VAL B C     1 
ATOM   3541  O  O     . VAL B  2 185  ? 161.946 120.909 185.239 1.00 246.69 ? 185  VAL B O     1 
ATOM   3542  C  CB    . VAL B  2 185  ? 159.421 119.909 187.206 1.00 233.09 ? 185  VAL B CB    1 
ATOM   3543  C  CG1   . VAL B  2 185  ? 158.839 120.467 185.931 1.00 236.99 ? 185  VAL B CG1   1 
ATOM   3544  C  CG2   . VAL B  2 185  ? 158.728 118.608 187.571 1.00 238.00 ? 185  VAL B CG2   1 
ATOM   3545  N  N     . GLU B  2 186  ? 161.872 121.926 187.245 1.00 242.91 ? 186  GLU B N     1 
ATOM   3546  C  CA    . GLU B  2 186  ? 162.570 123.110 186.740 1.00 242.98 ? 186  GLU B CA    1 
ATOM   3547  C  C     . GLU B  2 186  ? 163.981 122.764 186.275 1.00 244.05 ? 186  GLU B C     1 
ATOM   3548  O  O     . GLU B  2 186  ? 164.464 123.291 185.263 1.00 248.03 ? 186  GLU B O     1 
ATOM   3549  C  CB    . GLU B  2 186  ? 162.623 124.197 187.815 1.00 238.82 ? 186  GLU B CB    1 
ATOM   3550  C  CG    . GLU B  2 186  ? 161.269 124.711 188.277 1.00 239.30 ? 186  GLU B CG    1 
ATOM   3551  C  CD    . GLU B  2 186  ? 160.676 125.739 187.336 1.00 232.88 ? 186  GLU B CD    1 
ATOM   3552  O  OE1   . GLU B  2 186  ? 161.320 126.044 186.309 1.00 232.74 ? 186  GLU B OE1   1 
ATOM   3553  O  OE2   . GLU B  2 186  ? 159.569 126.246 187.628 1.00 231.25 ? 186  GLU B OE2   1 
ATOM   3554  N  N     . VAL B  2 187  ? 164.664 121.892 187.012 1.00 243.70 ? 187  VAL B N     1 
ATOM   3555  C  CA    . VAL B  2 187  ? 166.003 121.481 186.602 1.00 247.13 ? 187  VAL B CA    1 
ATOM   3556  C  C     . VAL B  2 187  ? 165.934 120.727 185.281 1.00 248.23 ? 187  VAL B C     1 
ATOM   3557  O  O     . VAL B  2 187  ? 166.792 120.896 184.407 1.00 253.17 ? 187  VAL B O     1 
ATOM   3558  C  CB    . VAL B  2 187  ? 166.681 120.649 187.706 1.00 256.11 ? 187  VAL B CB    1 
ATOM   3559  C  CG1   . VAL B  2 187  ? 168.046 120.166 187.237 1.00 259.23 ? 187  VAL B CG1   1 
ATOM   3560  C  CG2   . VAL B  2 187  ? 166.827 121.475 188.971 1.00 254.95 ? 187  VAL B CG2   1 
ATOM   3561  N  N     . ASN B  2 188  ? 164.908 119.898 185.104 1.00 242.06 ? 188  ASN B N     1 
ATOM   3562  C  CA    . ASN B  2 188  ? 164.719 119.231 183.821 1.00 244.21 ? 188  ASN B CA    1 
ATOM   3563  C  C     . ASN B  2 188  ? 164.528 120.251 182.706 1.00 247.00 ? 188  ASN B C     1 
ATOM   3564  O  O     . ASN B  2 188  ? 165.090 120.103 181.615 1.00 252.04 ? 188  ASN B O     1 
ATOM   3565  C  CB    . ASN B  2 188  ? 163.526 118.280 183.893 1.00 246.70 ? 188  ASN B CB    1 
ATOM   3566  C  CG    . ASN B  2 188  ? 163.319 117.505 182.605 1.00 250.83 ? 188  ASN B CG    1 
ATOM   3567  O  OD1   . ASN B  2 188  ? 164.240 117.364 181.801 1.00 260.82 ? 188  ASN B OD1   1 
ATOM   3568  N  ND2   . ASN B  2 188  ? 162.109 116.993 182.407 1.00 246.12 ? 188  ASN B ND2   1 
ATOM   3569  N  N     . VAL B  2 189  ? 163.753 121.303 182.977 1.00 242.82 ? 189  VAL B N     1 
ATOM   3570  C  CA    . VAL B  2 189  ? 163.461 122.303 181.952 1.00 246.09 ? 189  VAL B CA    1 
ATOM   3571  C  C     . VAL B  2 189  ? 164.729 123.047 181.538 1.00 246.03 ? 189  VAL B C     1 
ATOM   3572  O  O     . VAL B  2 189  ? 164.948 123.312 180.350 1.00 250.87 ? 189  VAL B O     1 
ATOM   3573  C  CB    . VAL B  2 189  ? 162.367 123.272 182.436 1.00 246.84 ? 189  VAL B CB    1 
ATOM   3574  C  CG1   . VAL B  2 189  ? 162.267 124.469 181.507 1.00 239.62 ? 189  VAL B CG1   1 
ATOM   3575  C  CG2   . VAL B  2 189  ? 161.022 122.558 182.517 1.00 244.42 ? 189  VAL B CG2   1 
ATOM   3576  N  N     . ILE B  2 190  ? 165.579 123.407 182.504 1.00 250.74 ? 190  ILE B N     1 
ATOM   3577  C  CA    . ILE B  2 190  ? 166.832 124.053 182.110 1.00 251.18 ? 190  ILE B CA    1 
ATOM   3578  C  C     . ILE B  2 190  ? 167.751 123.055 181.415 1.00 252.62 ? 190  ILE B C     1 
ATOM   3579  O  O     . ILE B  2 190  ? 168.497 123.420 180.496 1.00 259.19 ? 190  ILE B O     1 
ATOM   3580  C  CB    . ILE B  2 190  ? 167.534 124.728 183.304 1.00 255.52 ? 190  ILE B CB    1 
ATOM   3581  C  CG1   . ILE B  2 190  ? 168.978 125.090 182.944 1.00 256.91 ? 190  ILE B CG1   1 
ATOM   3582  C  CG2   . ILE B  2 190  ? 167.526 123.844 184.516 1.00 258.31 ? 190  ILE B CG2   1 
ATOM   3583  C  CD1   . ILE B  2 190  ? 169.775 125.652 184.092 1.00 270.89 ? 190  ILE B CD1   1 
ATOM   3584  N  N     . ARG B  2 191  ? 167.703 121.780 181.817 1.00 254.30 ? 191  ARG B N     1 
ATOM   3585  C  CA    . ARG B  2 191  ? 168.509 120.765 181.152 1.00 254.87 ? 191  ARG B CA    1 
ATOM   3586  C  C     . ARG B  2 191  ? 168.087 120.578 179.704 1.00 257.87 ? 191  ARG B C     1 
ATOM   3587  O  O     . ARG B  2 191  ? 168.907 120.191 178.862 1.00 259.74 ? 191  ARG B O     1 
ATOM   3588  C  CB    . ARG B  2 191  ? 168.401 119.439 181.908 1.00 252.94 ? 191  ARG B CB    1 
ATOM   3589  C  CG    . ARG B  2 191  ? 169.242 118.320 181.318 1.00 256.98 ? 191  ARG B CG    1 
ATOM   3590  C  CD    . ARG B  2 191  ? 169.017 117.004 182.035 1.00 259.80 ? 191  ARG B CD    1 
ATOM   3591  N  NE    . ARG B  2 191  ? 167.667 116.478 181.839 1.00 256.84 ? 191  ARG B NE    1 
ATOM   3592  C  CZ    . ARG B  2 191  ? 167.321 115.645 180.863 1.00 254.04 ? 191  ARG B CZ    1 
ATOM   3593  N  NH1   . ARG B  2 191  ? 168.225 115.242 179.979 1.00 252.74 ? 191  ARG B NH1   1 
ATOM   3594  N  NH2   . ARG B  2 191  ? 166.072 115.212 180.767 1.00 257.65 ? 191  ARG B NH2   1 
ATOM   3595  N  N     . VAL B  2 192  ? 166.825 120.857 179.392 1.00 249.20 ? 192  VAL B N     1 
ATOM   3596  C  CA    . VAL B  2 192  ? 166.307 120.581 178.056 1.00 250.56 ? 192  VAL B CA    1 
ATOM   3597  C  C     . VAL B  2 192  ? 166.828 121.595 177.047 1.00 260.13 ? 192  VAL B C     1 
ATOM   3598  O  O     . VAL B  2 192  ? 167.568 121.244 176.120 1.00 266.15 ? 192  VAL B O     1 
ATOM   3599  C  CB    . VAL B  2 192  ? 164.769 120.541 178.073 1.00 245.65 ? 192  VAL B CB    1 
ATOM   3600  C  CG1   . VAL B  2 192  ? 164.220 120.624 176.662 1.00 251.07 ? 192  VAL B CG1   1 
ATOM   3601  C  CG2   . VAL B  2 192  ? 164.294 119.267 178.734 1.00 244.16 ? 192  VAL B CG2   1 
ATOM   3602  N  N     . ARG B  2 193  ? 166.457 122.866 177.203 1.00 231.14 ? 193  ARG B N     1 
ATOM   3603  C  CA    . ARG B  2 193  ? 166.643 123.824 176.118 1.00 238.20 ? 193  ARG B CA    1 
ATOM   3604  C  C     . ARG B  2 193  ? 167.625 124.947 176.430 1.00 248.53 ? 193  ARG B C     1 
ATOM   3605  O  O     . ARG B  2 193  ? 168.708 124.978 175.839 1.00 258.32 ? 193  ARG B O     1 
ATOM   3606  C  CB    . ARG B  2 193  ? 165.267 124.383 175.759 1.00 238.45 ? 193  ARG B CB    1 
ATOM   3607  C  CG    . ARG B  2 193  ? 164.425 124.596 177.006 1.00 233.33 ? 193  ARG B CG    1 
ATOM   3608  C  CD    . ARG B  2 193  ? 163.370 125.670 176.840 1.00 239.75 ? 193  ARG B CD    1 
ATOM   3609  N  NE    . ARG B  2 193  ? 163.620 126.545 175.701 1.00 243.23 ? 193  ARG B NE    1 
ATOM   3610  C  CZ    . ARG B  2 193  ? 162.734 126.771 174.737 1.00 241.98 ? 193  ARG B CZ    1 
ATOM   3611  N  NH1   . ARG B  2 193  ? 161.540 126.191 174.789 1.00 234.81 ? 193  ARG B NH1   1 
ATOM   3612  N  NH2   . ARG B  2 193  ? 163.029 127.580 173.730 1.00 239.66 ? 193  ARG B NH2   1 
ATOM   3613  N  N     . ARG B  2 194  ? 167.260 125.967 177.199 1.00 256.46 ? 194  ARG B N     1 
ATOM   3614  C  CA    . ARG B  2 194  ? 168.274 127.004 177.436 1.00 263.51 ? 194  ARG B CA    1 
ATOM   3615  C  C     . ARG B  2 194  ? 168.226 127.879 178.698 1.00 258.93 ? 194  ARG B C     1 
ATOM   3616  O  O     . ARG B  2 194  ? 168.181 129.108 178.581 1.00 261.43 ? 194  ARG B O     1 
ATOM   3617  C  CB    . ARG B  2 194  ? 168.404 127.891 176.188 1.00 263.71 ? 194  ARG B CB    1 
ATOM   3618  N  N     . TYR B  2 195  ? 168.238 127.287 179.890 1.00 282.78 ? 195  TYR B N     1 
ATOM   3619  C  CA    . TYR B  2 195  ? 168.237 128.124 181.088 1.00 278.28 ? 195  TYR B CA    1 
ATOM   3620  C  C     . TYR B  2 195  ? 169.541 128.923 181.171 1.00 283.24 ? 195  TYR B C     1 
ATOM   3621  O  O     . TYR B  2 195  ? 169.529 130.137 181.374 1.00 283.19 ? 195  TYR B O     1 
ATOM   3622  C  CB    . TYR B  2 195  ? 168.055 127.269 182.344 1.00 281.37 ? 195  TYR B CB    1 
ATOM   3623  N  N     . ILE B  2 196  ? 170.659 128.224 180.979 1.00 289.09 ? 196  ILE B N     1 
ATOM   3624  C  CA    . ILE B  2 196  ? 172.000 128.808 180.980 1.00 288.71 ? 196  ILE B CA    1 
ATOM   3625  C  C     . ILE B  2 196  ? 172.873 128.012 180.022 1.00 298.99 ? 196  ILE B C     1 
ATOM   3626  O  O     . ILE B  2 196  ? 173.834 128.515 179.442 1.00 296.79 ? 196  ILE B O     1 
ATOM   3627  C  CB    . ILE B  2 196  ? 172.659 128.720 182.368 1.00 284.80 ? 196  ILE B CB    1 
ATOM   3628  C  CG1   . ILE B  2 196  ? 172.040 129.723 183.340 1.00 282.67 ? 196  ILE B CG1   1 
ATOM   3629  C  CG2   . ILE B  2 196  ? 174.157 128.961 182.256 1.00 288.14 ? 196  ILE B CG2   1 
ATOM   3630  C  CD1   . ILE B  2 196  ? 172.634 129.664 184.731 1.00 275.96 ? 196  ILE B CD1   1 
ATOM   3631  N  N     . PHE B  2 197  ? 172.503 126.744 179.894 1.00 295.91 ? 197  PHE B N     1 
ATOM   3632  C  CA    . PHE B  2 197  ? 173.183 125.739 179.081 1.00 297.58 ? 197  PHE B CA    1 
ATOM   3633  C  C     . PHE B  2 197  ? 173.870 126.426 177.893 1.00 300.79 ? 197  PHE B C     1 
ATOM   3634  O  O     . PHE B  2 197  ? 173.659 127.616 177.630 1.00 305.92 ? 197  PHE B O     1 
ATOM   3635  C  CB    . PHE B  2 197  ? 172.193 124.687 178.582 1.00 293.40 ? 197  PHE B CB    1 
ATOM   3636  N  N     . PHE B  2 198  ? 174.703 125.684 177.174 1.00 306.66 ? 198  PHE B N     1 
ATOM   3637  C  CA    . PHE B  2 198  ? 175.481 126.270 176.087 1.00 311.68 ? 198  PHE B CA    1 
ATOM   3638  C  C     . PHE B  2 198  ? 174.661 127.026 175.041 1.00 312.23 ? 198  PHE B C     1 
ATOM   3639  O  O     . PHE B  2 198  ? 173.588 126.600 174.616 1.00 314.89 ? 198  PHE B O     1 
ATOM   3640  C  CB    . PHE B  2 198  ? 176.328 125.194 175.400 1.00 315.48 ? 198  PHE B CB    1 
ATOM   3641  N  N     . LYS B  2 199  ? 175.228 128.165 174.651 1.00 281.43 ? 199  LYS B N     1 
ATOM   3642  C  CA    . LYS B  2 199  ? 174.686 129.143 173.701 1.00 283.73 ? 199  LYS B CA    1 
ATOM   3643  C  C     . LYS B  2 199  ? 173.236 129.040 173.215 1.00 288.65 ? 199  LYS B C     1 
ATOM   3644  O  O     . LYS B  2 199  ? 172.343 129.664 173.786 1.00 294.94 ? 199  LYS B O     1 
ATOM   3645  C  CB    . LYS B  2 199  ? 175.615 129.245 172.484 1.00 283.36 ? 199  LYS B CB    1 
ATOM   3646  N  N     . THR B  2 200  ? 173.000 128.260 172.167 1.00 303.23 ? 200  THR B N     1 
ATOM   3647  C  CA    . THR B  2 200  ? 171.661 128.173 171.586 1.00 303.16 ? 200  THR B CA    1 
ATOM   3648  C  C     . THR B  2 200  ? 170.778 127.027 172.060 1.00 301.05 ? 200  THR B C     1 
ATOM   3649  O  O     . THR B  2 200  ? 171.201 125.872 172.106 1.00 299.14 ? 200  THR B O     1 
ATOM   3650  C  CB    . THR B  2 200  ? 171.735 128.111 170.048 1.00 308.22 ? 200  THR B CB    1 
ATOM   3651  O  OG1   . THR B  2 200  ? 172.406 126.908 169.651 1.00 316.14 ? 200  THR B OG1   1 
ATOM   3652  C  CG2   . THR B  2 200  ? 172.491 129.313 169.504 1.00 306.16 ? 200  THR B CG2   1 
ATOM   3653  N  N     . PRO B  2 201  ? 169.541 127.367 172.411 1.00 296.27 ? 201  PRO B N     1 
ATOM   3654  C  CA    . PRO B  2 201  ? 168.562 126.373 172.856 1.00 296.84 ? 201  PRO B CA    1 
ATOM   3655  C  C     . PRO B  2 201  ? 168.406 125.173 171.935 1.00 303.48 ? 201  PRO B C     1 
ATOM   3656  O  O     . PRO B  2 201  ? 168.184 124.066 172.427 1.00 310.07 ? 201  PRO B O     1 
ATOM   3657  C  CB    . PRO B  2 201  ? 167.256 127.170 172.892 1.00 293.63 ? 201  PRO B CB    1 
ATOM   3658  C  CG    . PRO B  2 201  ? 167.440 128.222 171.853 1.00 298.73 ? 201  PRO B CG    1 
ATOM   3659  C  CD    . PRO B  2 201  ? 168.898 128.588 171.893 1.00 297.07 ? 201  PRO B CD    1 
ATOM   3660  N  N     . ARG B  2 202  ? 168.488 125.380 170.625 1.00 307.24 ? 202  ARG B N     1 
ATOM   3661  C  CA    . ARG B  2 202  ? 168.037 124.361 169.699 1.00 310.52 ? 202  ARG B CA    1 
ATOM   3662  C  C     . ARG B  2 202  ? 166.561 124.162 170.006 1.00 315.61 ? 202  ARG B C     1 
ATOM   3663  O  O     . ARG B  2 202  ? 166.057 123.041 170.063 1.00 327.05 ? 202  ARG B O     1 
ATOM   3664  C  CB    . ARG B  2 202  ? 168.806 123.058 169.907 1.00 312.95 ? 202  ARG B CB    1 
ATOM   3665  N  N     . GLU B  2 203  ? 165.883 125.289 170.208 1.00 310.51 ? 203  GLU B N     1 
ATOM   3666  C  CA    . GLU B  2 203  ? 164.488 125.326 170.629 1.00 304.01 ? 203  GLU B CA    1 
ATOM   3667  C  C     . GLU B  2 203  ? 163.582 124.707 169.578 1.00 301.26 ? 203  GLU B C     1 
ATOM   3668  O  O     . GLU B  2 203  ? 163.897 124.702 168.388 1.00 304.46 ? 203  GLU B O     1 
ATOM   3669  C  CB    . GLU B  2 203  ? 164.054 126.765 170.915 1.00 300.11 ? 203  GLU B CB    1 
ATOM   3670  N  N     . VAL B  2 204  ? 162.461 124.166 170.039 1.00 311.03 ? 204  VAL B N     1 
ATOM   3671  C  CA    . VAL B  2 204  ? 161.636 123.264 169.249 1.00 302.26 ? 204  VAL B CA    1 
ATOM   3672  C  C     . VAL B  2 204  ? 161.059 123.843 167.959 1.00 296.14 ? 204  VAL B C     1 
ATOM   3673  O  O     . VAL B  2 204  ? 161.022 123.143 166.947 1.00 294.16 ? 204  VAL B O     1 
ATOM   3674  C  CB    . VAL B  2 204  ? 160.473 122.698 170.088 1.00 297.97 ? 204  VAL B CB    1 
ATOM   3675  C  CG1   . VAL B  2 204  ? 160.299 121.212 169.819 1.00 297.52 ? 204  VAL B CG1   1 
ATOM   3676  C  CG2   . VAL B  2 204  ? 160.714 122.956 171.569 1.00 293.18 ? 204  VAL B CG2   1 
ATOM   3677  N  N     . LYS B  2 205  ? 160.598 125.090 167.966 1.00 305.02 ? 205  LYS B N     1 
ATOM   3678  C  CA    . LYS B  2 205  ? 159.943 125.579 166.758 1.00 299.03 ? 205  LYS B CA    1 
ATOM   3679  C  C     . LYS B  2 205  ? 158.454 125.264 166.851 1.00 294.39 ? 205  LYS B C     1 
ATOM   3680  O  O     . LYS B  2 205  ? 157.993 124.274 166.266 1.00 294.74 ? 205  LYS B O     1 
ATOM   3681  C  CB    . LYS B  2 205  ? 160.558 124.987 165.491 1.00 302.88 ? 205  LYS B CB    1 
ATOM   3682  C  CG    . LYS B  2 205  ? 160.010 125.608 164.218 1.00 301.89 ? 205  LYS B CG    1 
ATOM   3683  C  CD    . LYS B  2 205  ? 160.574 124.937 162.983 1.00 304.91 ? 205  LYS B CD    1 
ATOM   3684  C  CE    . LYS B  2 205  ? 159.982 125.543 161.722 1.00 304.14 ? 205  LYS B CE    1 
ATOM   3685  N  NZ    . LYS B  2 205  ? 160.495 124.903 160.478 1.00 307.85 ? 205  LYS B NZ    1 
ATOM   3686  N  N     . PRO B  2 206  ? 157.699 126.087 167.581 1.00 300.54 ? 206  PRO B N     1 
ATOM   3687  C  CA    . PRO B  2 206  ? 156.386 125.690 168.148 1.00 292.35 ? 206  PRO B CA    1 
ATOM   3688  C  C     . PRO B  2 206  ? 155.567 124.813 167.220 1.00 298.26 ? 206  PRO B C     1 
ATOM   3689  O  O     . PRO B  2 206  ? 155.534 125.032 165.999 1.00 303.69 ? 206  PRO B O     1 
ATOM   3690  C  CB    . PRO B  2 206  ? 155.688 127.039 168.385 1.00 282.81 ? 206  PRO B CB    1 
ATOM   3691  C  CG    . PRO B  2 206  ? 156.489 128.047 167.600 1.00 293.31 ? 206  PRO B CG    1 
ATOM   3692  C  CD    . PRO B  2 206  ? 157.892 127.542 167.636 1.00 304.39 ? 206  PRO B CD    1 
ATOM   3693  N  N     . PRO B  2 207  ? 154.853 123.836 167.782 1.00 289.52 ? 207  PRO B N     1 
ATOM   3694  C  CA    . PRO B  2 207  ? 154.256 122.759 166.974 1.00 292.42 ? 207  PRO B CA    1 
ATOM   3695  C  C     . PRO B  2 207  ? 153.272 123.282 165.941 1.00 288.62 ? 207  PRO B C     1 
ATOM   3696  O  O     . PRO B  2 207  ? 152.290 123.951 166.269 1.00 284.69 ? 207  PRO B O     1 
ATOM   3697  C  CB    . PRO B  2 207  ? 153.555 121.890 168.025 1.00 293.50 ? 207  PRO B CB    1 
ATOM   3698  C  CG    . PRO B  2 207  ? 153.294 122.824 169.175 1.00 282.79 ? 207  PRO B CG    1 
ATOM   3699  C  CD    . PRO B  2 207  ? 154.469 123.750 169.201 1.00 283.94 ? 207  PRO B CD    1 
ATOM   3700  N  N     . GLU B  2 208  ? 153.538 122.958 164.674 1.00 287.98 ? 208  GLU B N     1 
ATOM   3701  C  CA    . GLU B  2 208  ? 152.661 123.368 163.586 1.00 286.99 ? 208  GLU B CA    1 
ATOM   3702  C  C     . GLU B  2 208  ? 151.457 122.456 163.418 1.00 288.29 ? 208  GLU B C     1 
ATOM   3703  O  O     . GLU B  2 208  ? 150.525 122.822 162.694 1.00 288.58 ? 208  GLU B O     1 
ATOM   3704  C  CB    . GLU B  2 208  ? 153.437 123.418 162.269 1.00 289.94 ? 208  GLU B CB    1 
ATOM   3705  N  N     . ASP B  2 209  ? 151.463 121.282 164.050 1.00 288.22 ? 209  ASP B N     1 
ATOM   3706  C  CA    . ASP B  2 209  ? 150.330 120.373 163.922 1.00 288.85 ? 209  ASP B CA    1 
ATOM   3707  C  C     . ASP B  2 209  ? 149.038 121.050 164.360 1.00 286.71 ? 209  ASP B C     1 
ATOM   3708  O  O     . ASP B  2 209  ? 148.060 121.096 163.603 1.00 286.37 ? 209  ASP B O     1 
ATOM   3709  C  CB    . ASP B  2 209  ? 150.584 119.104 164.734 1.00 288.63 ? 209  ASP B CB    1 
ATOM   3710  N  N     . LEU B  2 210  ? 149.031 121.619 165.562 1.00 288.64 ? 210  LEU B N     1 
ATOM   3711  C  CA    . LEU B  2 210  ? 147.834 122.226 166.132 1.00 289.92 ? 210  LEU B CA    1 
ATOM   3712  C  C     . LEU B  2 210  ? 147.865 123.746 166.108 1.00 285.74 ? 210  LEU B C     1 
ATOM   3713  O  O     . LEU B  2 210  ? 146.904 124.378 166.564 1.00 292.52 ? 210  LEU B O     1 
ATOM   3714  C  CB    . LEU B  2 210  ? 147.632 121.748 167.577 1.00 289.83 ? 210  LEU B CB    1 
ATOM   3715  N  N     . GLN B  2 211  ? 149.016 124.300 165.739 1.00 292.14 ? 211  GLN B N     1 
ATOM   3716  C  CA    . GLN B  2 211  ? 149.210 125.745 165.664 1.00 284.31 ? 211  GLN B CA    1 
ATOM   3717  C  C     . GLN B  2 211  ? 149.185 126.270 164.230 1.00 283.50 ? 211  GLN B C     1 
ATOM   3718  O  O     . GLN B  2 211  ? 149.408 127.457 163.996 1.00 283.49 ? 211  GLN B O     1 
ATOM   3719  C  CB    . GLN B  2 211  ? 150.523 126.142 166.343 1.00 280.63 ? 211  GLN B CB    1 
ATOM   3720  N  N     . ASP B  2 212  ? 148.915 125.387 163.275 1.00 289.24 ? 212  ASP B N     1 
ATOM   3721  C  CA    . ASP B  2 212  ? 148.874 125.780 161.875 1.00 286.05 ? 212  ASP B CA    1 
ATOM   3722  C  C     . ASP B  2 212  ? 147.751 126.780 161.665 1.00 284.23 ? 212  ASP B C     1 
ATOM   3723  O  O     . ASP B  2 212  ? 146.675 126.650 162.251 1.00 290.69 ? 212  ASP B O     1 
ATOM   3724  C  CB    . ASP B  2 212  ? 148.668 124.558 160.979 1.00 286.38 ? 212  ASP B CB    1 
ATOM   3725  N  N     . LEU B  2 213  ? 147.997 127.779 160.825 1.00 255.46 ? 213  LEU B N     1 
ATOM   3726  C  CA    . LEU B  2 213  ? 146.987 128.791 160.569 1.00 263.16 ? 213  LEU B CA    1 
ATOM   3727  C  C     . LEU B  2 213  ? 145.771 128.135 159.937 1.00 276.94 ? 213  LEU B C     1 
ATOM   3728  O  O     . LEU B  2 213  ? 145.898 127.280 159.060 1.00 284.16 ? 213  LEU B O     1 
ATOM   3729  C  CB    . LEU B  2 213  ? 147.539 129.880 159.648 1.00 256.63 ? 213  LEU B CB    1 
ATOM   3730  N  N     . GLY B  2 214  ? 144.591 128.540 160.389 1.00 245.04 ? 214  GLY B N     1 
ATOM   3731  C  CA    . GLY B  2 214  ? 143.350 127.990 159.870 1.00 255.78 ? 214  GLY B CA    1 
ATOM   3732  C  C     . GLY B  2 214  ? 142.606 127.008 160.763 1.00 279.91 ? 214  GLY B C     1 
ATOM   3733  O  O     . GLY B  2 214  ? 141.645 126.379 160.320 1.00 269.52 ? 214  GLY B O     1 
ATOM   3734  N  N     . VAL B  2 215  ? 143.039 126.867 162.014 1.00 237.20 ? 215  VAL B N     1 
ATOM   3735  C  CA    . VAL B  2 215  ? 142.385 125.939 162.940 1.00 223.83 ? 215  VAL B CA    1 
ATOM   3736  C  C     . VAL B  2 215  ? 141.621 126.601 164.097 1.00 218.15 ? 215  VAL B C     1 
ATOM   3737  O  O     . VAL B  2 215  ? 142.148 127.468 164.794 1.00 214.94 ? 215  VAL B O     1 
ATOM   3738  C  CB    . VAL B  2 215  ? 143.395 124.935 163.529 1.00 225.42 ? 215  VAL B CB    1 
ATOM   3739  C  CG1   . VAL B  2 215  ? 142.713 124.031 164.544 1.00 218.32 ? 215  VAL B CG1   1 
ATOM   3740  C  CG2   . VAL B  2 215  ? 144.036 124.115 162.419 1.00 223.97 ? 215  VAL B CG2   1 
ATOM   3741  N  N     . ARG B  2 216  ? 140.372 126.174 164.281 1.00 227.85 ? 216  ARG B N     1 
ATOM   3742  C  CA    . ARG B  2 216  ? 139.486 126.663 165.348 1.00 224.97 ? 216  ARG B CA    1 
ATOM   3743  C  C     . ARG B  2 216  ? 139.426 125.779 166.603 1.00 218.43 ? 216  ARG B C     1 
ATOM   3744  O  O     . ARG B  2 216  ? 139.459 126.272 167.731 1.00 213.53 ? 216  ARG B O     1 
ATOM   3745  C  CB    . ARG B  2 216  ? 138.072 126.884 164.802 1.00 225.62 ? 216  ARG B CB    1 
ATOM   3746  N  N     . PHE B  2 217  ? 139.339 124.471 166.380 1.00 230.33 ? 217  PHE B N     1 
ATOM   3747  C  CA    . PHE B  2 217  ? 139.278 123.459 167.429 1.00 224.21 ? 217  PHE B CA    1 
ATOM   3748  C  C     . PHE B  2 217  ? 140.667 123.249 168.008 1.00 223.90 ? 217  PHE B C     1 
ATOM   3749  O  O     . PHE B  2 217  ? 141.592 122.852 167.292 1.00 225.33 ? 217  PHE B O     1 
ATOM   3750  C  CB    . PHE B  2 217  ? 138.729 122.140 166.882 1.00 214.30 ? 217  PHE B CB    1 
ATOM   3751  C  CG    . PHE B  2 217  ? 138.643 121.033 167.912 1.00 212.70 ? 217  PHE B CG    1 
ATOM   3752  C  CD1   . PHE B  2 217  ? 139.711 120.172 168.126 1.00 211.82 ? 217  PHE B CD1   1 
ATOM   3753  C  CD2   . PHE B  2 217  ? 137.490 120.851 168.654 1.00 211.39 ? 217  PHE B CD2   1 
ATOM   3754  C  CE1   . PHE B  2 217  ? 139.631 119.163 169.067 1.00 213.66 ? 217  PHE B CE1   1 
ATOM   3755  C  CE2   . PHE B  2 217  ? 137.405 119.844 169.595 1.00 208.74 ? 217  PHE B CE2   1 
ATOM   3756  C  CZ    . PHE B  2 217  ? 138.474 118.999 169.800 1.00 209.83 ? 217  PHE B CZ    1 
ATOM   3757  N  N     . LEU B  2 218  ? 140.825 123.524 169.297 1.00 205.74 ? 218  LEU B N     1 
ATOM   3758  C  CA    . LEU B  2 218  ? 142.075 123.237 169.997 1.00 201.64 ? 218  LEU B CA    1 
ATOM   3759  C  C     . LEU B  2 218  ? 141.722 122.525 171.296 1.00 198.63 ? 218  LEU B C     1 
ATOM   3760  O  O     . LEU B  2 218  ? 141.554 123.153 172.340 1.00 199.40 ? 218  LEU B O     1 
ATOM   3761  C  CB    . LEU B  2 218  ? 142.866 124.516 170.240 1.00 202.72 ? 218  LEU B CB    1 
ATOM   3762  C  CG    . LEU B  2 218  ? 142.054 125.728 170.701 1.00 202.16 ? 218  LEU B CG    1 
ATOM   3763  C  CD1   . LEU B  2 218  ? 142.564 126.237 172.041 1.00 203.55 ? 218  LEU B CD1   1 
ATOM   3764  C  CD2   . LEU B  2 218  ? 142.090 126.833 169.657 1.00 212.70 ? 218  LEU B CD2   1 
ATOM   3765  N  N     . GLN B  2 219  ? 141.545 121.221 171.226 1.00 198.27 ? 219  GLN B N     1 
ATOM   3766  C  CA    . GLN B  2 219  ? 141.595 120.486 172.478 1.00 196.68 ? 219  GLN B CA    1 
ATOM   3767  C  C     . GLN B  2 219  ? 143.025 120.076 172.822 1.00 197.00 ? 219  GLN B C     1 
ATOM   3768  O  O     . GLN B  2 219  ? 143.464 120.295 173.957 1.00 201.39 ? 219  GLN B O     1 
ATOM   3769  C  CB    . GLN B  2 219  ? 140.675 119.272 172.451 1.00 200.46 ? 219  GLN B CB    1 
ATOM   3770  C  CG    . GLN B  2 219  ? 140.275 118.836 173.845 1.00 204.35 ? 219  GLN B CG    1 
ATOM   3771  C  CD    . GLN B  2 219  ? 139.401 119.858 174.548 1.00 197.21 ? 219  GLN B CD    1 
ATOM   3772  O  OE1   . GLN B  2 219  ? 138.730 120.668 173.904 1.00 194.57 ? 219  GLN B OE1   1 
ATOM   3773  N  NE2   . GLN B  2 219  ? 139.402 119.825 175.878 1.00 192.58 ? 219  GLN B NE2   1 
ATOM   3774  N  N     . PRO B  2 220  ? 143.790 119.483 171.894 1.00 190.27 ? 220  PRO B N     1 
ATOM   3775  C  CA    . PRO B  2 220  ? 145.165 119.092 172.236 1.00 199.00 ? 220  PRO B CA    1 
ATOM   3776  C  C     . PRO B  2 220  ? 146.118 120.265 172.340 1.00 205.45 ? 220  PRO B C     1 
ATOM   3777  O  O     . PRO B  2 220  ? 147.256 120.078 172.789 1.00 206.15 ? 220  PRO B O     1 
ATOM   3778  C  CB    . PRO B  2 220  ? 145.559 118.168 171.082 1.00 208.19 ? 220  PRO B CB    1 
ATOM   3779  C  CG    . PRO B  2 220  ? 144.780 118.691 169.935 1.00 205.36 ? 220  PRO B CG    1 
ATOM   3780  C  CD    . PRO B  2 220  ? 143.461 119.108 170.503 1.00 193.18 ? 220  PRO B CD    1 
ATOM   3781  N  N     . PHE B  2 221  ? 145.696 121.462 171.943 1.00 226.55 ? 221  PHE B N     1 
ATOM   3782  C  CA    . PHE B  2 221  ? 146.581 122.612 171.833 1.00 223.42 ? 221  PHE B CA    1 
ATOM   3783  C  C     . PHE B  2 221  ? 146.325 123.639 172.929 1.00 219.51 ? 221  PHE B C     1 
ATOM   3784  O  O     . PHE B  2 221  ? 146.388 124.847 172.692 1.00 220.66 ? 221  PHE B O     1 
ATOM   3785  C  CB    . PHE B  2 221  ? 146.445 123.252 170.458 1.00 118.47 ? 221  PHE B CB    1 
ATOM   3786  N  N     . VAL B  2 222  ? 146.023 123.178 174.142 1.00 206.36 ? 222  VAL B N     1 
ATOM   3787  C  CA    . VAL B  2 222  ? 145.837 124.087 175.269 1.00 205.51 ? 222  VAL B CA    1 
ATOM   3788  C  C     . VAL B  2 222  ? 146.579 123.573 176.492 1.00 210.46 ? 222  VAL B C     1 
ATOM   3789  O  O     . VAL B  2 222  ? 147.308 122.577 176.427 1.00 214.75 ? 222  VAL B O     1 
ATOM   3790  C  CB    . VAL B  2 222  ? 144.352 124.306 175.609 1.00 204.04 ? 222  VAL B CB    1 
ATOM   3791  C  CG1   . VAL B  2 222  ? 144.031 125.800 175.632 1.00 201.73 ? 222  VAL B CG1   1 
ATOM   3792  C  CG2   . VAL B  2 222  ? 143.465 123.563 174.642 1.00 205.65 ? 222  VAL B CG2   1 
ATOM   3793  N  N     . ASN B  2 223  ? 146.391 124.258 177.610 1.00 222.92 ? 223  ASN B N     1 
ATOM   3794  C  CA    . ASN B  2 223  ? 147.141 124.008 178.825 1.00 216.62 ? 223  ASN B CA    1 
ATOM   3795  C  C     . ASN B  2 223  ? 146.502 122.882 179.634 1.00 214.11 ? 223  ASN B C     1 
ATOM   3796  O  O     . ASN B  2 223  ? 145.388 122.430 179.361 1.00 218.40 ? 223  ASN B O     1 
ATOM   3797  C  CB    . ASN B  2 223  ? 147.237 125.290 179.650 1.00 215.88 ? 223  ASN B CB    1 
ATOM   3798  C  CG    . ASN B  2 223  ? 145.892 125.938 179.871 1.00 226.27 ? 223  ASN B CG    1 
ATOM   3799  O  OD1   . ASN B  2 223  ? 145.212 125.653 180.855 1.00 230.57 ? 223  ASN B OD1   1 
ATOM   3800  N  ND2   . ASN B  2 223  ? 145.492 126.813 178.948 1.00 228.75 ? 223  ASN B ND2   1 
ATOM   3801  N  N     . LEU B  2 224  ? 147.248 122.428 180.642 1.00 180.12 ? 224  LEU B N     1 
ATOM   3802  C  CA    . LEU B  2 224  ? 146.814 121.313 181.481 1.00 182.37 ? 224  LEU B CA    1 
ATOM   3803  C  C     . LEU B  2 224  ? 145.450 121.589 182.105 1.00 179.17 ? 224  LEU B C     1 
ATOM   3804  O  O     . LEU B  2 224  ? 144.532 120.766 182.018 1.00 183.67 ? 224  LEU B O     1 
ATOM   3805  C  CB    . LEU B  2 224  ? 147.852 121.047 182.578 1.00 186.74 ? 224  LEU B CB    1 
ATOM   3806  N  N     . LEU B  2 225  ? 145.298 122.753 182.748 1.00 185.15 ? 225  LEU B N     1 
ATOM   3807  C  CA    . LEU B  2 225  ? 144.103 122.995 183.544 1.00 182.94 ? 225  LEU B CA    1 
ATOM   3808  C  C     . LEU B  2 225  ? 142.885 123.277 182.687 1.00 188.39 ? 225  LEU B C     1 
ATOM   3809  O  O     . LEU B  2 225  ? 141.758 123.112 183.161 1.00 191.12 ? 225  LEU B O     1 
ATOM   3810  C  CB    . LEU B  2 225  ? 144.332 124.165 184.501 1.00 183.82 ? 225  LEU B CB    1 
ATOM   3811  N  N     . SER B  2 226  ? 143.073 123.706 181.444 1.00 197.30 ? 226  SER B N     1 
ATOM   3812  C  CA    . SER B  2 226  ? 141.916 124.117 180.662 1.00 194.81 ? 226  SER B CA    1 
ATOM   3813  C  C     . SER B  2 226  ? 141.202 122.939 180.017 1.00 195.48 ? 226  SER B C     1 
ATOM   3814  O  O     . SER B  2 226  ? 139.978 122.984 179.855 1.00 199.39 ? 226  SER B O     1 
ATOM   3815  C  CB    . SER B  2 226  ? 142.337 125.115 179.592 1.00 195.59 ? 226  SER B CB    1 
ATOM   3816  O  OG    . SER B  2 226  ? 141.298 125.268 178.641 1.00 196.63 ? 226  SER B OG    1 
ATOM   3817  N  N     . LYS B  2 227  ? 141.940 121.890 179.638 1.00 199.62 ? 227  LYS B N     1 
ATOM   3818  C  CA    . LYS B  2 227  ? 141.339 120.758 178.940 1.00 197.95 ? 227  LYS B CA    1 
ATOM   3819  C  C     . LYS B  2 227  ? 140.146 120.188 179.696 1.00 200.38 ? 227  LYS B C     1 
ATOM   3820  O  O     . LYS B  2 227  ? 139.179 119.723 179.078 1.00 209.05 ? 227  LYS B O     1 
ATOM   3821  C  CB    . LYS B  2 227  ? 142.393 119.677 178.708 1.00 197.32 ? 227  LYS B CB    1 
ATOM   3822  C  CG    . LYS B  2 227  ? 141.889 118.483 177.916 1.00 200.59 ? 227  LYS B CG    1 
ATOM   3823  C  CD    . LYS B  2 227  ? 142.957 117.408 177.759 1.00 204.57 ? 227  LYS B CD    1 
ATOM   3824  C  CE    . LYS B  2 227  ? 143.303 116.761 179.092 1.00 208.14 ? 227  LYS B CE    1 
ATOM   3825  N  NZ    . LYS B  2 227  ? 142.166 115.976 179.659 1.00 217.69 ? 227  LYS B NZ    1 
ATOM   3826  N  N     . GLY B  2 228  ? 140.182 120.228 181.030 1.00 209.02 ? 228  GLY B N     1 
ATOM   3827  C  CA    . GLY B  2 228  ? 139.085 119.673 181.804 1.00 209.79 ? 228  GLY B CA    1 
ATOM   3828  C  C     . GLY B  2 228  ? 137.822 120.509 181.735 1.00 206.59 ? 228  GLY B C     1 
ATOM   3829  O  O     . GLY B  2 228  ? 136.711 119.972 181.728 1.00 212.83 ? 228  GLY B O     1 
ATOM   3830  N  N     . THR B  2 229  ? 137.968 121.832 181.684 1.00 177.61 ? 229  THR B N     1 
ATOM   3831  C  CA    . THR B  2 229  ? 136.827 122.737 181.712 1.00 183.36 ? 229  THR B CA    1 
ATOM   3832  C  C     . THR B  2 229  ? 136.369 123.200 180.337 1.00 191.51 ? 229  THR B C     1 
ATOM   3833  O  O     . THR B  2 229  ? 135.293 123.795 180.237 1.00 192.39 ? 229  THR B O     1 
ATOM   3834  C  CB    . THR B  2 229  ? 137.146 123.979 182.544 1.00 185.73 ? 229  THR B CB    1 
ATOM   3835  O  OG1   . THR B  2 229  ? 136.385 125.087 182.038 1.00 183.60 ? 229  THR B OG1   1 
ATOM   3836  C  CG2   . THR B  2 229  ? 138.625 124.307 182.451 1.00 191.98 ? 229  THR B CG2   1 
ATOM   3837  N  N     . TYR B  2 230  ? 137.155 122.956 179.292 1.00 188.39 ? 230  TYR B N     1 
ATOM   3838  C  CA    . TYR B  2 230  ? 136.885 123.504 177.965 1.00 186.64 ? 230  TYR B CA    1 
ATOM   3839  C  C     . TYR B  2 230  ? 136.732 125.020 178.040 1.00 185.03 ? 230  TYR B C     1 
ATOM   3840  O  O     . TYR B  2 230  ? 135.763 125.607 177.555 1.00 184.76 ? 230  TYR B O     1 
ATOM   3841  C  CB    . TYR B  2 230  ? 135.657 122.843 177.340 1.00 180.56 ? 230  TYR B CB    1 
ATOM   3842  C  CG    . TYR B  2 230  ? 135.619 121.365 177.619 1.00 182.78 ? 230  TYR B CG    1 
ATOM   3843  C  CD1   . TYR B  2 230  ? 136.516 120.504 177.008 1.00 185.57 ? 230  TYR B CD1   1 
ATOM   3844  C  CD2   . TYR B  2 230  ? 134.704 120.834 178.516 1.00 187.74 ? 230  TYR B CD2   1 
ATOM   3845  C  CE1   . TYR B  2 230  ? 136.497 119.153 177.270 1.00 189.45 ? 230  TYR B CE1   1 
ATOM   3846  C  CE2   . TYR B  2 230  ? 134.675 119.485 178.783 1.00 190.34 ? 230  TYR B CE2   1 
ATOM   3847  C  CZ    . TYR B  2 230  ? 135.573 118.649 178.159 1.00 193.89 ? 230  TYR B CZ    1 
ATOM   3848  O  OH    . TYR B  2 230  ? 135.543 117.303 178.429 1.00 208.80 ? 230  TYR B OH    1 
ATOM   3849  N  N     . TRP B  2 231  ? 137.715 125.650 178.686 1.00 183.50 ? 231  TRP B N     1 
ATOM   3850  C  CA    . TRP B  2 231  ? 137.747 127.103 178.794 1.00 185.86 ? 231  TRP B CA    1 
ATOM   3851  C  C     . TRP B  2 231  ? 137.917 127.749 177.423 1.00 185.05 ? 231  TRP B C     1 
ATOM   3852  O  O     . TRP B  2 231  ? 137.314 128.793 177.140 1.00 184.15 ? 231  TRP B O     1 
ATOM   3853  C  CB    . TRP B  2 231  ? 138.874 127.510 179.743 1.00 187.23 ? 231  TRP B CB    1 
ATOM   3854  C  CG    . TRP B  2 231  ? 138.726 128.867 180.332 1.00 188.00 ? 231  TRP B CG    1 
ATOM   3855  C  CD1   . TRP B  2 231  ? 139.643 129.880 180.304 1.00 188.48 ? 231  TRP B CD1   1 
ATOM   3856  C  CD2   . TRP B  2 231  ? 137.596 129.369 181.045 1.00 187.94 ? 231  TRP B CD2   1 
ATOM   3857  N  NE1   . TRP B  2 231  ? 139.149 130.982 180.956 1.00 187.56 ? 231  TRP B NE1   1 
ATOM   3858  C  CE2   . TRP B  2 231  ? 137.892 130.695 181.420 1.00 188.32 ? 231  TRP B CE2   1 
ATOM   3859  C  CE3   . TRP B  2 231  ? 136.356 128.828 181.402 1.00 193.11 ? 231  TRP B CE3   1 
ATOM   3860  C  CZ2   . TRP B  2 231  ? 136.994 131.486 182.131 1.00 193.01 ? 231  TRP B CZ2   1 
ATOM   3861  C  CZ3   . TRP B  2 231  ? 135.467 129.614 182.107 1.00 191.77 ? 231  TRP B CZ3   1 
ATOM   3862  C  CH2   . TRP B  2 231  ? 135.790 130.928 182.465 1.00 187.99 ? 231  TRP B CH2   1 
ATOM   3863  N  N     . TRP B  2 232  ? 138.727 127.129 176.562 1.00 172.12 ? 232  TRP B N     1 
ATOM   3864  C  CA    . TRP B  2 232  ? 138.914 127.602 175.194 1.00 174.09 ? 232  TRP B CA    1 
ATOM   3865  C  C     . TRP B  2 232  ? 137.594 127.830 174.479 1.00 176.17 ? 232  TRP B C     1 
ATOM   3866  O  O     . TRP B  2 232  ? 137.493 128.720 173.626 1.00 188.57 ? 232  TRP B O     1 
ATOM   3867  C  CB    . TRP B  2 232  ? 139.729 126.579 174.407 1.00 177.73 ? 232  TRP B CB    1 
ATOM   3868  C  CG    . TRP B  2 232  ? 138.956 125.309 174.189 1.00 178.02 ? 232  TRP B CG    1 
ATOM   3869  C  CD1   . TRP B  2 232  ? 138.584 124.406 175.140 1.00 178.48 ? 232  TRP B CD1   1 
ATOM   3870  C  CD2   . TRP B  2 232  ? 138.443 124.813 172.948 1.00 179.63 ? 232  TRP B CD2   1 
ATOM   3871  N  NE1   . TRP B  2 232  ? 137.880 123.375 174.570 1.00 180.56 ? 232  TRP B NE1   1 
ATOM   3872  C  CE2   . TRP B  2 232  ? 137.780 123.600 173.223 1.00 189.06 ? 232  TRP B CE2   1 
ATOM   3873  C  CE3   . TRP B  2 232  ? 138.486 125.273 171.630 1.00 179.30 ? 232  TRP B CE3   1 
ATOM   3874  C  CZ2   . TRP B  2 232  ? 137.166 122.845 172.231 1.00 181.91 ? 232  TRP B CZ2   1 
ATOM   3875  C  CZ3   . TRP B  2 232  ? 137.877 124.520 170.647 1.00 186.42 ? 232  TRP B CZ3   1 
ATOM   3876  C  CH2   . TRP B  2 232  ? 137.225 123.320 170.952 1.00 188.57 ? 232  TRP B CH2   1 
ATOM   3877  N  N     . MET B  2 233  ? 136.578 127.023 174.796 1.00 184.99 ? 233  MET B N     1 
ATOM   3878  C  CA    . MET B  2 233  ? 135.302 127.125 174.099 1.00 185.25 ? 233  MET B CA    1 
ATOM   3879  C  C     . MET B  2 233  ? 134.664 128.494 174.275 1.00 188.49 ? 233  MET B C     1 
ATOM   3880  O  O     . MET B  2 233  ? 133.873 128.911 173.420 1.00 200.38 ? 233  MET B O     1 
ATOM   3881  C  CB    . MET B  2 233  ? 134.350 126.030 174.585 1.00 185.81 ? 233  MET B CB    1 
ATOM   3882  C  CG    . MET B  2 233  ? 134.421 124.750 173.771 1.00 194.02 ? 233  MET B CG    1 
ATOM   3883  S  SD    . MET B  2 233  ? 133.719 124.951 172.122 1.00 189.50 ? 233  MET B SD    1 
ATOM   3884  C  CE    . MET B  2 233  ? 131.979 125.140 172.516 1.00 189.93 ? 233  MET B CE    1 
ATOM   3885  N  N     . ASN B  2 234  ? 135.002 129.208 175.357 1.00 190.77 ? 234  ASN B N     1 
ATOM   3886  C  CA    . ASN B  2 234  ? 134.357 130.476 175.684 1.00 194.92 ? 234  ASN B CA    1 
ATOM   3887  C  C     . ASN B  2 234  ? 134.236 131.377 174.461 1.00 204.81 ? 234  ASN B C     1 
ATOM   3888  O  O     . ASN B  2 234  ? 133.128 131.671 173.994 1.00 219.70 ? 234  ASN B O     1 
ATOM   3889  C  CB    . ASN B  2 234  ? 135.139 131.193 176.792 1.00 193.86 ? 234  ASN B CB    1 
ATOM   3890  C  CG    . ASN B  2 234  ? 135.061 130.480 178.132 1.00 196.88 ? 234  ASN B CG    1 
ATOM   3891  O  OD1   . ASN B  2 234  ? 134.272 129.557 178.320 1.00 199.25 ? 234  ASN B OD1   1 
ATOM   3892  N  ND2   . ASN B  2 234  ? 135.883 130.922 179.076 1.00 197.02 ? 234  ASN B ND2   1 
ATOM   3893  N  N     . ALA B  2 235  ? 135.382 131.784 173.911 1.00 207.06 ? 235  ALA B N     1 
ATOM   3894  C  CA    . ALA B  2 235  ? 135.407 132.616 172.716 1.00 213.32 ? 235  ALA B CA    1 
ATOM   3895  C  C     . ALA B  2 235  ? 134.395 132.124 171.697 1.00 212.39 ? 235  ALA B C     1 
ATOM   3896  O  O     . ALA B  2 235  ? 133.464 132.848 171.319 1.00 221.52 ? 235  ALA B O     1 
ATOM   3897  C  CB    . ALA B  2 235  ? 136.816 132.627 172.114 1.00 213.18 ? 235  ALA B CB    1 
ATOM   3898  N  N     . PHE B  2 236  ? 134.524 130.850 171.311 1.00 208.42 ? 236  PHE B N     1 
ATOM   3899  C  CA    . PHE B  2 236  ? 133.663 130.304 170.272 1.00 212.06 ? 236  PHE B CA    1 
ATOM   3900  C  C     . PHE B  2 236  ? 132.198 130.500 170.617 1.00 217.39 ? 236  PHE B C     1 
ATOM   3901  O  O     . PHE B  2 236  ? 131.436 131.062 169.822 1.00 224.77 ? 236  PHE B O     1 
ATOM   3902  C  CB    . PHE B  2 236  ? 133.955 128.824 170.049 1.00 216.75 ? 236  PHE B CB    1 
ATOM   3903  C  CG    . PHE B  2 236  ? 132.940 128.145 169.181 1.00 214.29 ? 236  PHE B CG    1 
ATOM   3904  C  CD1   . PHE B  2 236  ? 132.887 128.409 167.826 1.00 211.56 ? 236  PHE B CD1   1 
ATOM   3905  C  CD2   . PHE B  2 236  ? 132.024 127.261 169.724 1.00 211.25 ? 236  PHE B CD2   1 
ATOM   3906  C  CE1   . PHE B  2 236  ? 131.949 127.799 167.023 1.00 213.57 ? 236  PHE B CE1   1 
ATOM   3907  C  CE2   . PHE B  2 236  ? 131.083 126.644 168.927 1.00 203.36 ? 236  PHE B CE2   1 
ATOM   3908  C  CZ    . PHE B  2 236  ? 131.044 126.915 167.574 1.00 210.87 ? 236  PHE B CZ    1 
ATOM   3909  N  N     . ILE B  2 237  ? 131.782 130.078 171.812 1.00 217.30 ? 237  ILE B N     1 
ATOM   3910  C  CA    . ILE B  2 237  ? 130.358 130.176 172.099 1.00 213.21 ? 237  ILE B CA    1 
ATOM   3911  C  C     . ILE B  2 237  ? 129.941 131.638 172.153 1.00 219.50 ? 237  ILE B C     1 
ATOM   3912  O  O     . ILE B  2 237  ? 128.834 132.000 171.736 1.00 227.74 ? 237  ILE B O     1 
ATOM   3913  C  CB    . ILE B  2 237  ? 129.979 129.424 173.387 1.00 205.82 ? 237  ILE B CB    1 
ATOM   3914  C  CG1   . ILE B  2 237  ? 128.572 129.844 173.805 1.00 213.15 ? 237  ILE B CG1   1 
ATOM   3915  C  CG2   . ILE B  2 237  ? 130.968 129.674 174.500 1.00 207.81 ? 237  ILE B CG2   1 
ATOM   3916  C  CD1   . ILE B  2 237  ? 128.282 129.670 175.258 1.00 215.95 ? 237  ILE B CD1   1 
ATOM   3917  N  N     . LYS B  2 238  ? 130.833 132.509 172.632 1.00 214.79 ? 238  LYS B N     1 
ATOM   3918  C  CA    . LYS B  2 238  ? 130.527 133.935 172.613 1.00 216.77 ? 238  LYS B CA    1 
ATOM   3919  C  C     . LYS B  2 238  ? 130.449 134.453 171.185 1.00 225.25 ? 238  LYS B C     1 
ATOM   3920  O  O     . LYS B  2 238  ? 129.611 135.305 170.868 1.00 233.53 ? 238  LYS B O     1 
ATOM   3921  C  CB    . LYS B  2 238  ? 131.576 134.711 173.401 1.00 212.68 ? 238  LYS B CB    1 
ATOM   3922  C  CG    . LYS B  2 238  ? 131.375 136.213 173.353 1.00 222.27 ? 238  LYS B CG    1 
ATOM   3923  C  CD    . LYS B  2 238  ? 132.636 136.947 173.760 1.00 232.11 ? 238  LYS B CD    1 
ATOM   3924  C  CE    . LYS B  2 238  ? 133.090 136.527 175.144 1.00 246.51 ? 238  LYS B CE    1 
ATOM   3925  N  NZ    . LYS B  2 238  ? 134.337 137.227 175.556 1.00 249.78 ? 238  LYS B NZ    1 
ATOM   3926  N  N     . THR B  2 239  ? 131.314 133.943 170.311 1.00 227.23 ? 239  THR B N     1 
ATOM   3927  C  CA    . THR B  2 239  ? 131.322 134.407 168.930 1.00 225.22 ? 239  THR B CA    1 
ATOM   3928  C  C     . THR B  2 239  ? 130.051 133.986 168.206 1.00 231.19 ? 239  THR B C     1 
ATOM   3929  O  O     . THR B  2 239  ? 129.475 134.773 167.446 1.00 243.35 ? 239  THR B O     1 
ATOM   3930  C  CB    . THR B  2 239  ? 132.559 133.867 168.216 1.00 221.65 ? 239  THR B CB    1 
ATOM   3931  O  OG1   . THR B  2 239  ? 133.726 134.204 168.972 1.00 220.16 ? 239  THR B OG1   1 
ATOM   3932  C  CG2   . THR B  2 239  ? 132.679 134.461 166.822 1.00 224.44 ? 239  THR B CG2   1 
ATOM   3933  N  N     . ALA B  2 240  ? 129.590 132.757 168.458 1.00 240.49 ? 240  ALA B N     1 
ATOM   3934  C  CA    . ALA B  2 240  ? 128.459 132.203 167.721 1.00 246.76 ? 240  ALA B CA    1 
ATOM   3935  C  C     . ALA B  2 240  ? 127.219 133.077 167.847 1.00 252.34 ? 240  ALA B C     1 
ATOM   3936  O  O     . ALA B  2 240  ? 126.439 133.203 166.895 1.00 256.65 ? 240  ALA B O     1 
ATOM   3937  C  CB    . ALA B  2 240  ? 128.161 130.789 168.213 1.00 244.96 ? 240  ALA B CB    1 
ATOM   3938  N  N     . HIS B  2 241  ? 127.009 133.679 169.019 1.00 242.07 ? 241  HIS B N     1 
ATOM   3939  C  CA    . HIS B  2 241  ? 125.837 134.526 169.195 1.00 245.13 ? 241  HIS B CA    1 
ATOM   3940  C  C     . HIS B  2 241  ? 125.954 135.808 168.373 1.00 250.82 ? 241  HIS B C     1 
ATOM   3941  O  O     . HIS B  2 241  ? 124.951 136.307 167.847 1.00 254.45 ? 241  HIS B O     1 
ATOM   3942  C  CB    . HIS B  2 241  ? 125.631 134.844 170.675 1.00 242.87 ? 241  HIS B CB    1 
ATOM   3943  C  CG    . HIS B  2 241  ? 124.218 135.199 171.022 1.00 249.24 ? 241  HIS B CG    1 
ATOM   3944  N  ND1   . HIS B  2 241  ? 123.294 134.263 171.434 1.00 248.26 ? 241  HIS B ND1   1 
ATOM   3945  C  CD2   . HIS B  2 241  ? 123.567 136.385 170.998 1.00 249.78 ? 241  HIS B CD2   1 
ATOM   3946  C  CE1   . HIS B  2 241  ? 122.138 134.859 171.660 1.00 248.99 ? 241  HIS B CE1   1 
ATOM   3947  N  NE2   . HIS B  2 241  ? 122.276 136.147 171.401 1.00 246.49 ? 241  HIS B NE2   1 
ATOM   3948  N  N     . LYS B  2 242  ? 127.170 136.348 168.243 1.00 252.38 ? 242  LYS B N     1 
ATOM   3949  C  CA    . LYS B  2 242  ? 127.355 137.583 167.483 1.00 254.33 ? 242  LYS B CA    1 
ATOM   3950  C  C     . LYS B  2 242  ? 127.138 137.359 165.990 1.00 252.45 ? 242  LYS B C     1 
ATOM   3951  O  O     . LYS B  2 242  ? 126.571 138.218 165.304 1.00 256.69 ? 242  LYS B O     1 
ATOM   3952  C  CB    . LYS B  2 242  ? 128.748 138.157 167.739 1.00 257.11 ? 242  LYS B CB    1 
ATOM   3953  C  CG    . LYS B  2 242  ? 128.945 138.711 169.141 1.00 260.40 ? 242  LYS B CG    1 
ATOM   3954  C  CD    . LYS B  2 242  ? 130.272 139.444 169.263 1.00 266.52 ? 242  LYS B CD    1 
ATOM   3955  C  CE    . LYS B  2 242  ? 130.440 140.065 170.640 1.00 272.69 ? 242  LYS B CE    1 
ATOM   3956  N  NZ    . LYS B  2 242  ? 131.713 140.830 170.735 1.00 277.44 ? 242  LYS B NZ    1 
ATOM   3957  N  N     . LYS B  2 243  ? 127.586 136.219 165.466 1.00 234.66 ? 243  LYS B N     1 
ATOM   3958  C  CA    . LYS B  2 243  ? 127.478 135.913 164.050 1.00 235.37 ? 243  LYS B CA    1 
ATOM   3959  C  C     . LYS B  2 243  ? 127.157 134.433 163.887 1.00 237.25 ? 243  LYS B C     1 
ATOM   3960  O  O     . LYS B  2 243  ? 127.811 133.589 164.522 1.00 242.00 ? 243  LYS B O     1 
ATOM   3961  C  CB    . LYS B  2 243  ? 128.768 136.263 163.307 1.00 239.21 ? 243  LYS B CB    1 
ATOM   3962  C  CG    . LYS B  2 243  ? 128.867 135.627 161.938 1.00 244.99 ? 243  LYS B CG    1 
ATOM   3963  C  CD    . LYS B  2 243  ? 130.289 135.657 161.427 1.00 254.38 ? 243  LYS B CD    1 
ATOM   3964  C  CE    . LYS B  2 243  ? 130.408 134.883 160.133 1.00 265.21 ? 243  LYS B CE    1 
ATOM   3965  N  NZ    . LYS B  2 243  ? 131.803 134.896 159.624 1.00 256.84 ? 243  LYS B NZ    1 
ATOM   3966  N  N     . PRO B  2 244  ? 126.172 134.084 163.050 1.00 246.33 ? 244  PRO B N     1 
ATOM   3967  C  CA    . PRO B  2 244  ? 125.863 132.667 162.816 1.00 244.29 ? 244  PRO B CA    1 
ATOM   3968  C  C     . PRO B  2 244  ? 127.076 131.857 162.393 1.00 243.85 ? 244  PRO B C     1 
ATOM   3969  O  O     . PRO B  2 244  ? 128.051 132.399 161.864 1.00 251.61 ? 244  PRO B O     1 
ATOM   3970  C  CB    . PRO B  2 244  ? 124.809 132.722 161.702 1.00 243.44 ? 244  PRO B CB    1 
ATOM   3971  C  CG    . PRO B  2 244  ? 124.150 134.048 161.884 1.00 251.23 ? 244  PRO B CG    1 
ATOM   3972  C  CD    . PRO B  2 244  ? 125.235 134.982 162.351 1.00 249.79 ? 244  PRO B CD    1 
ATOM   3973  N  N     . ILE B  2 245  ? 127.017 130.553 162.619 1.00 246.66 ? 245  ILE B N     1 
ATOM   3974  C  CA    . ILE B  2 245  ? 128.157 129.665 162.428 1.00 243.41 ? 245  ILE B CA    1 
ATOM   3975  C  C     . ILE B  2 245  ? 128.141 129.111 161.010 1.00 240.92 ? 245  ILE B C     1 
ATOM   3976  O  O     . ILE B  2 245  ? 127.083 128.853 160.426 1.00 243.89 ? 245  ILE B O     1 
ATOM   3977  C  CB    . ILE B  2 245  ? 128.141 128.533 163.475 1.00 239.34 ? 245  ILE B CB    1 
ATOM   3978  C  CG1   . ILE B  2 245  ? 127.925 129.105 164.875 1.00 237.33 ? 245  ILE B CG1   1 
ATOM   3979  C  CG2   . ILE B  2 245  ? 129.438 127.740 163.437 1.00 245.70 ? 245  ILE B CG2   1 
ATOM   3980  C  CD1   . ILE B  2 245  ? 127.685 128.040 165.918 1.00 231.84 ? 245  ILE B CD1   1 
ATOM   3981  N  N     . ASP B  2 246  ? 129.338 128.911 160.459 1.00 257.70 ? 246  ASP B N     1 
ATOM   3982  C  CA    . ASP B  2 246  ? 129.507 128.417 159.101 1.00 253.67 ? 246  ASP B CA    1 
ATOM   3983  C  C     . ASP B  2 246  ? 130.611 127.365 159.080 1.00 251.18 ? 246  ASP B C     1 
ATOM   3984  O  O     . ASP B  2 246  ? 131.383 127.222 160.031 1.00 252.16 ? 246  ASP B O     1 
ATOM   3985  C  CB    . ASP B  2 246  ? 129.834 129.566 158.134 1.00 258.73 ? 246  ASP B CB    1 
ATOM   3986  C  CG    . ASP B  2 246  ? 129.749 129.150 156.677 1.00 260.73 ? 246  ASP B CG    1 
ATOM   3987  O  OD1   . ASP B  2 246  ? 129.331 128.004 156.405 1.00 261.29 ? 246  ASP B OD1   1 
ATOM   3988  O  OD2   . ASP B  2 246  ? 130.109 129.968 155.804 1.00 260.53 ? 246  ASP B OD2   1 
ATOM   3989  N  N     . LEU B  2 247  ? 130.668 126.613 157.973 1.00 250.74 ? 247  LEU B N     1 
ATOM   3990  C  CA    . LEU B  2 247  ? 131.727 125.623 157.800 1.00 250.46 ? 247  LEU B CA    1 
ATOM   3991  C  C     . LEU B  2 247  ? 133.083 126.290 157.612 1.00 254.43 ? 247  LEU B C     1 
ATOM   3992  O  O     . LEU B  2 247  ? 134.099 125.796 158.116 1.00 258.18 ? 247  LEU B O     1 
ATOM   3993  C  CB    . LEU B  2 247  ? 131.415 124.709 156.616 1.00 250.59 ? 247  LEU B CB    1 
ATOM   3994  C  CG    . LEU B  2 247  ? 130.747 123.378 156.969 1.00 250.44 ? 247  LEU B CG    1 
ATOM   3995  C  CD1   . LEU B  2 247  ? 130.466 122.571 155.715 1.00 254.44 ? 247  LEU B CD1   1 
ATOM   3996  C  CD2   . LEU B  2 247  ? 131.624 122.593 157.931 1.00 247.29 ? 247  LEU B CD2   1 
ATOM   3997  N  N     . ARG B  2 248  ? 133.128 127.403 156.875 1.00 249.43 ? 248  ARG B N     1 
ATOM   3998  C  CA    . ARG B  2 248  ? 134.368 128.166 156.805 1.00 253.09 ? 248  ARG B CA    1 
ATOM   3999  C  C     . ARG B  2 248  ? 134.650 128.894 158.112 1.00 246.92 ? 248  ARG B C     1 
ATOM   4000  O  O     . ARG B  2 248  ? 135.809 129.208 158.395 1.00 249.69 ? 248  ARG B O     1 
ATOM   4001  C  CB    . ARG B  2 248  ? 134.319 129.156 155.636 1.00 258.99 ? 248  ARG B CB    1 
ATOM   4002  C  CG    . ARG B  2 248  ? 135.641 129.866 155.367 1.00 264.43 ? 248  ARG B CG    1 
ATOM   4003  C  CD    . ARG B  2 248  ? 135.511 130.887 154.248 1.00 268.79 ? 248  ARG B CD    1 
ATOM   4004  N  NE    . ARG B  2 248  ? 134.451 131.857 154.511 1.00 270.33 ? 248  ARG B NE    1 
ATOM   4005  C  CZ    . ARG B  2 248  ? 134.609 132.968 155.223 1.00 276.01 ? 248  ARG B CZ    1 
ATOM   4006  N  NH1   . ARG B  2 248  ? 133.585 133.791 155.407 1.00 279.00 ? 248  ARG B NH1   1 
ATOM   4007  N  NH2   . ARG B  2 248  ? 135.790 133.258 155.753 1.00 279.67 ? 248  ARG B NH2   1 
ATOM   4008  N  N     . ALA B  2 249  ? 133.622 129.150 158.924 1.00 226.97 ? 249  ALA B N     1 
ATOM   4009  C  CA    . ALA B  2 249  ? 133.856 129.675 160.265 1.00 230.57 ? 249  ALA B CA    1 
ATOM   4010  C  C     . ALA B  2 249  ? 134.612 128.655 161.109 1.00 229.10 ? 249  ALA B C     1 
ATOM   4011  O  O     . ALA B  2 249  ? 135.709 128.931 161.604 1.00 224.96 ? 249  ALA B O     1 
ATOM   4012  C  CB    . ALA B  2 249  ? 132.532 130.060 160.924 1.00 233.53 ? 249  ALA B CB    1 
ATOM   4013  N  N     . ILE B  2 250  ? 134.045 127.457 161.268 1.00 221.51 ? 250  ILE B N     1 
ATOM   4014  C  CA    . ILE B  2 250  ? 134.728 126.396 162.000 1.00 218.83 ? 250  ILE B CA    1 
ATOM   4015  C  C     . ILE B  2 250  ? 135.984 125.977 161.241 1.00 220.31 ? 250  ILE B C     1 
ATOM   4016  O  O     . ILE B  2 250  ? 136.057 126.070 160.008 1.00 218.90 ? 250  ILE B O     1 
ATOM   4017  C  CB    . ILE B  2 250  ? 133.781 125.203 162.233 1.00 213.49 ? 250  ILE B CB    1 
ATOM   4018  C  CG1   . ILE B  2 250  ? 134.268 124.345 163.397 1.00 202.82 ? 250  ILE B CG1   1 
ATOM   4019  C  CG2   . ILE B  2 250  ? 133.642 124.359 160.976 1.00 219.53 ? 250  ILE B CG2   1 
ATOM   4020  C  CD1   . ILE B  2 250  ? 133.330 123.217 163.725 1.00 200.03 ? 250  ILE B CD1   1 
ATOM   4021  N  N     . GLY B  2 251  ? 136.995 125.526 161.982 1.00 206.36 ? 251  GLY B N     1 
ATOM   4022  C  CA    . GLY B  2 251  ? 138.318 125.315 161.429 1.00 206.84 ? 251  GLY B CA    1 
ATOM   4023  C  C     . GLY B  2 251  ? 138.461 124.031 160.636 1.00 199.70 ? 251  GLY B C     1 
ATOM   4024  O  O     . GLY B  2 251  ? 137.501 123.492 160.078 1.00 194.28 ? 251  GLY B O     1 
ATOM   4025  N  N     . LYS B  2 252  ? 139.701 123.556 160.563 1.00 212.25 ? 252  LYS B N     1 
ATOM   4026  C  CA    . LYS B  2 252  ? 140.020 122.258 159.997 1.00 211.34 ? 252  LYS B CA    1 
ATOM   4027  C  C     . LYS B  2 252  ? 140.281 121.262 161.124 1.00 215.40 ? 252  LYS B C     1 
ATOM   4028  O  O     . LYS B  2 252  ? 140.131 121.565 162.309 1.00 221.57 ? 252  LYS B O     1 
ATOM   4029  C  CB    . LYS B  2 252  ? 141.227 122.356 159.064 1.00 211.12 ? 252  LYS B CB    1 
ATOM   4030  C  CG    . LYS B  2 252  ? 140.891 122.811 157.660 1.00 211.93 ? 252  LYS B CG    1 
ATOM   4031  C  CD    . LYS B  2 252  ? 142.137 122.827 156.800 1.00 218.02 ? 252  LYS B CD    1 
ATOM   4032  C  CE    . LYS B  2 252  ? 141.837 123.317 155.399 1.00 220.68 ? 252  LYS B CE    1 
ATOM   4033  N  NZ    . LYS B  2 252  ? 143.085 123.489 154.609 1.00 226.76 ? 252  LYS B NZ    1 
ATOM   4034  N  N     . LEU B  2 253  ? 140.684 120.054 160.749 1.00 206.12 ? 253  LEU B N     1 
ATOM   4035  C  CA    . LEU B  2 253  ? 140.903 119.097 161.821 1.00 204.66 ? 253  LEU B CA    1 
ATOM   4036  C  C     . LEU B  2 253  ? 142.391 118.935 162.113 1.00 207.94 ? 253  LEU B C     1 
ATOM   4037  O  O     . LEU B  2 253  ? 143.223 119.025 161.206 1.00 209.11 ? 253  LEU B O     1 
ATOM   4038  C  CB    . LEU B  2 253  ? 140.287 117.742 161.459 1.00 207.99 ? 253  LEU B CB    1 
ATOM   4039  C  CG    . LEU B  2 253  ? 139.327 117.156 162.497 1.00 204.84 ? 253  LEU B CG    1 
ATOM   4040  C  CD1   . LEU B  2 253  ? 138.467 118.255 163.085 1.00 200.26 ? 253  LEU B CD1   1 
ATOM   4041  C  CD2   . LEU B  2 253  ? 138.465 116.063 161.886 1.00 211.80 ? 253  LEU B CD2   1 
ATOM   4042  N  N     . PRO B  2 254  ? 142.735 118.703 163.383 1.00 197.60 ? 254  PRO B N     1 
ATOM   4043  C  CA    . PRO B  2 254  ? 144.146 118.621 163.777 1.00 202.16 ? 254  PRO B CA    1 
ATOM   4044  C  C     . PRO B  2 254  ? 144.913 117.537 163.033 1.00 206.21 ? 254  PRO B C     1 
ATOM   4045  O  O     . PRO B  2 254  ? 144.368 116.715 162.292 1.00 213.28 ? 254  PRO B O     1 
ATOM   4046  C  CB    . PRO B  2 254  ? 144.084 118.319 165.280 1.00 203.99 ? 254  PRO B CB    1 
ATOM   4047  C  CG    . PRO B  2 254  ? 142.796 118.923 165.720 1.00 199.52 ? 254  PRO B CG    1 
ATOM   4048  C  CD    . PRO B  2 254  ? 141.846 118.744 164.556 1.00 199.24 ? 254  PRO B CD    1 
ATOM   4049  N  N     . ILE B  2 255  ? 146.235 117.577 163.242 1.00 203.64 ? 255  ILE B N     1 
ATOM   4050  C  CA    . ILE B  2 255  ? 147.144 116.583 162.680 1.00 207.27 ? 255  ILE B CA    1 
ATOM   4051  C  C     . ILE B  2 255  ? 146.705 115.186 163.085 1.00 208.18 ? 255  ILE B C     1 
ATOM   4052  O  O     . ILE B  2 255  ? 146.686 114.264 162.260 1.00 214.73 ? 255  ILE B O     1 
ATOM   4053  C  CB    . ILE B  2 255  ? 148.598 116.872 163.119 1.00 211.47 ? 255  ILE B CB    1 
ATOM   4054  N  N     . ALA B  2 256  ? 146.363 114.999 164.366 1.00 200.34 ? 256  ALA B N     1 
ATOM   4055  C  CA    . ALA B  2 256  ? 146.001 113.694 164.903 1.00 203.49 ? 256  ALA B CA    1 
ATOM   4056  C  C     . ALA B  2 256  ? 144.505 113.420 164.863 1.00 203.50 ? 256  ALA B C     1 
ATOM   4057  O  O     . ALA B  2 256  ? 144.030 112.542 165.595 1.00 209.17 ? 256  ALA B O     1 
ATOM   4058  C  CB    . ALA B  2 256  ? 146.517 113.553 166.336 1.00 206.68 ? 256  ALA B CB    1 
ATOM   4059  N  N     . MET B  2 257  ? 143.753 114.157 164.048 1.00 211.01 ? 257  MET B N     1 
ATOM   4060  C  CA    . MET B  2 257  ? 142.313 113.980 163.955 1.00 213.48 ? 257  MET B CA    1 
ATOM   4061  C  C     . MET B  2 257  ? 141.827 113.645 162.555 1.00 212.31 ? 257  MET B C     1 
ATOM   4062  O  O     . MET B  2 257  ? 140.634 113.370 162.388 1.00 210.41 ? 257  MET B O     1 
ATOM   4063  C  CB    . MET B  2 257  ? 141.593 115.248 164.436 1.00 215.84 ? 257  MET B CB    1 
ATOM   4064  C  CG    . MET B  2 257  ? 141.619 115.460 165.937 1.00 214.87 ? 257  MET B CG    1 
ATOM   4065  S  SD    . MET B  2 257  ? 140.561 114.298 166.813 1.00 232.20 ? 257  MET B SD    1 
ATOM   4066  C  CE    . MET B  2 257  ? 139.081 114.359 165.807 1.00 214.48 ? 257  MET B CE    1 
ATOM   4067  N  N     . ARG B  2 258  ? 142.704 113.653 161.557 1.00 214.57 ? 258  ARG B N     1 
ATOM   4068  C  CA    . ARG B  2 258  ? 142.275 113.453 160.181 1.00 218.61 ? 258  ARG B CA    1 
ATOM   4069  C  C     . ARG B  2 258  ? 141.921 111.995 159.930 1.00 226.95 ? 258  ARG B C     1 
ATOM   4070  O  O     . ARG B  2 258  ? 142.586 111.082 160.427 1.00 238.18 ? 258  ARG B O     1 
ATOM   4071  C  CB    . ARG B  2 258  ? 143.376 113.903 159.225 1.00 217.05 ? 258  ARG B CB    1 
ATOM   4072  C  CG    . ARG B  2 258  ? 143.822 115.322 159.482 1.00 204.90 ? 258  ARG B CG    1 
ATOM   4073  C  CD    . ARG B  2 258  ? 144.879 115.755 158.501 1.00 205.37 ? 258  ARG B CD    1 
ATOM   4074  N  NE    . ARG B  2 258  ? 145.144 117.184 158.616 1.00 206.66 ? 258  ARG B NE    1 
ATOM   4075  C  CZ    . ARG B  2 258  ? 144.397 118.125 158.048 1.00 208.32 ? 258  ARG B CZ    1 
ATOM   4076  N  NH1   . ARG B  2 258  ? 144.709 119.404 158.202 1.00 204.25 ? 258  ARG B NH1   1 
ATOM   4077  N  NH2   . ARG B  2 258  ? 143.335 117.786 157.326 1.00 206.83 ? 258  ARG B NH2   1 
ATOM   4078  N  N     . ALA B  2 259  ? 140.860 111.781 159.149 1.00 237.36 ? 259  ALA B N     1 
ATOM   4079  C  CA    . ALA B  2 259  ? 140.420 110.424 158.848 1.00 240.17 ? 259  ALA B CA    1 
ATOM   4080  C  C     . ALA B  2 259  ? 141.478 109.637 158.089 1.00 247.22 ? 259  ALA B C     1 
ATOM   4081  O  O     . ALA B  2 259  ? 141.476 108.402 158.147 1.00 254.63 ? 259  ALA B O     1 
ATOM   4082  C  CB    . ALA B  2 259  ? 139.114 110.455 158.053 1.00 239.22 ? 259  ALA B CB    1 
ATOM   4083  N  N     . LEU B  2 260  ? 142.386 110.318 157.389 1.00 248.88 ? 260  LEU B N     1 
ATOM   4084  C  CA    . LEU B  2 260  ? 143.437 109.612 156.663 1.00 254.63 ? 260  LEU B CA    1 
ATOM   4085  C  C     . LEU B  2 260  ? 144.335 108.839 157.618 1.00 260.86 ? 260  LEU B C     1 
ATOM   4086  O  O     . LEU B  2 260  ? 144.635 107.661 157.391 1.00 265.35 ? 260  LEU B O     1 
ATOM   4087  C  CB    . LEU B  2 260  ? 144.252 110.600 155.832 1.00 249.18 ? 260  LEU B CB    1 
ATOM   4088  C  CG    . LEU B  2 260  ? 144.215 110.371 154.320 1.00 250.15 ? 260  LEU B CG    1 
ATOM   4089  C  CD1   . LEU B  2 260  ? 145.182 111.309 153.613 1.00 251.69 ? 260  LEU B CD1   1 
ATOM   4090  C  CD2   . LEU B  2 260  ? 144.522 108.918 153.985 1.00 248.29 ? 260  LEU B CD2   1 
ATOM   4091  N  N     . THR B  2 261  ? 144.762 109.482 158.707 1.00 244.52 ? 261  THR B N     1 
ATOM   4092  C  CA    . THR B  2 261  ? 145.640 108.814 159.661 1.00 246.50 ? 261  THR B CA    1 
ATOM   4093  C  C     . THR B  2 261  ? 144.916 107.699 160.407 1.00 255.99 ? 261  THR B C     1 
ATOM   4094  O  O     . THR B  2 261  ? 145.521 106.664 160.718 1.00 264.10 ? 261  THR B O     1 
ATOM   4095  C  CB    . THR B  2 261  ? 146.212 109.826 160.654 1.00 237.38 ? 261  THR B CB    1 
ATOM   4096  O  OG1   . THR B  2 261  ? 146.646 110.998 159.949 1.00 229.74 ? 261  THR B OG1   1 
ATOM   4097  C  CG2   . THR B  2 261  ? 147.394 109.223 161.403 1.00 247.39 ? 261  THR B CG2   1 
ATOM   4098  N  N     . ASN B  2 262  ? 143.628 107.885 160.704 1.00 245.10 ? 262  ASN B N     1 
ATOM   4099  C  CA    . ASN B  2 262  ? 142.867 106.830 161.365 1.00 249.17 ? 262  ASN B CA    1 
ATOM   4100  C  C     . ASN B  2 262  ? 142.708 105.621 160.454 1.00 257.31 ? 262  ASN B C     1 
ATOM   4101  O  O     . ASN B  2 262  ? 142.894 104.479 160.886 1.00 264.59 ? 262  ASN B O     1 
ATOM   4102  C  CB    . ASN B  2 262  ? 141.503 107.363 161.803 1.00 242.46 ? 262  ASN B CB    1 
ATOM   4103  C  CG    . ASN B  2 262  ? 141.581 108.167 163.086 1.00 234.74 ? 262  ASN B CG    1 
ATOM   4104  O  OD1   . ASN B  2 262  ? 142.350 107.842 163.991 1.00 232.57 ? 262  ASN B OD1   1 
ATOM   4105  N  ND2   . ASN B  2 262  ? 140.777 109.224 163.171 1.00 236.29 ? 262  ASN B ND2   1 
ATOM   4106  N  N     . TYR B  2 263  ? 142.357 105.857 159.191 1.00 250.36 ? 263  TYR B N     1 
ATOM   4107  C  CA    . TYR B  2 263  ? 142.294 104.774 158.215 1.00 256.08 ? 263  TYR B CA    1 
ATOM   4108  C  C     . TYR B  2 263  ? 143.644 104.081 158.073 1.00 267.04 ? 263  TYR B C     1 
ATOM   4109  O  O     . TYR B  2 263  ? 143.710 102.851 157.966 1.00 275.28 ? 263  TYR B O     1 
ATOM   4110  C  CB    . TYR B  2 263  ? 141.815 105.333 156.877 1.00 251.86 ? 263  TYR B CB    1 
ATOM   4111  C  CG    . TYR B  2 263  ? 142.031 104.447 155.675 1.00 256.55 ? 263  TYR B CG    1 
ATOM   4112  C  CD1   . TYR B  2 263  ? 141.212 103.352 155.434 1.00 254.88 ? 263  TYR B CD1   1 
ATOM   4113  C  CD2   . TYR B  2 263  ? 143.034 104.732 154.762 1.00 260.33 ? 263  TYR B CD2   1 
ATOM   4114  C  CE1   . TYR B  2 263  ? 141.407 102.550 154.324 1.00 258.08 ? 263  TYR B CE1   1 
ATOM   4115  C  CE2   . TYR B  2 263  ? 143.236 103.940 153.654 1.00 263.21 ? 263  TYR B CE2   1 
ATOM   4116  C  CZ    . TYR B  2 263  ? 142.422 102.852 153.436 1.00 262.21 ? 263  TYR B CZ    1 
ATOM   4117  O  OH    . TYR B  2 263  ? 142.630 102.068 152.326 1.00 263.82 ? 263  TYR B OH    1 
ATOM   4118  N  N     . GLN B  2 264  ? 144.732 104.857 158.090 1.00 267.28 ? 264  GLN B N     1 
ATOM   4119  C  CA    . GLN B  2 264  ? 146.080 104.301 158.009 1.00 272.89 ? 264  GLN B CA    1 
ATOM   4120  C  C     . GLN B  2 264  ? 146.360 103.355 159.173 1.00 282.61 ? 264  GLN B C     1 
ATOM   4121  O  O     . GLN B  2 264  ? 146.759 102.199 158.979 1.00 289.50 ? 264  GLN B O     1 
ATOM   4122  C  CB    . GLN B  2 264  ? 147.093 105.447 157.999 1.00 268.89 ? 264  GLN B CB    1 
ATOM   4123  C  CG    . GLN B  2 264  ? 148.524 105.031 157.750 1.00 275.95 ? 264  GLN B CG    1 
ATOM   4124  C  CD    . GLN B  2 264  ? 148.741 104.568 156.328 1.00 276.93 ? 264  GLN B CD    1 
ATOM   4125  O  OE1   . GLN B  2 264  ? 148.832 103.370 156.061 1.00 275.76 ? 264  GLN B OE1   1 
ATOM   4126  N  NE2   . GLN B  2 264  ? 148.821 105.518 155.400 1.00 279.58 ? 264  GLN B NE2   1 
ATOM   4127  N  N     . ARG B  2 265  ? 146.197 103.862 160.395 1.00 259.92 ? 265  ARG B N     1 
ATOM   4128  C  CA    . ARG B  2 265  ? 146.390 103.059 161.598 1.00 266.10 ? 265  ARG B CA    1 
ATOM   4129  C  C     . ARG B  2 265  ? 145.526 101.803 161.565 1.00 274.08 ? 265  ARG B C     1 
ATOM   4130  O  O     . ARG B  2 265  ? 145.987 100.703 161.893 1.00 283.12 ? 265  ARG B O     1 
ATOM   4131  C  CB    . ARG B  2 265  ? 146.062 103.916 162.821 1.00 257.88 ? 265  ARG B CB    1 
ATOM   4132  C  CG    . ARG B  2 265  ? 146.281 103.257 164.167 1.00 256.08 ? 265  ARG B CG    1 
ATOM   4133  C  CD    . ARG B  2 265  ? 145.899 104.213 165.295 1.00 257.36 ? 265  ARG B CD    1 
ATOM   4134  N  NE    . ARG B  2 265  ? 146.662 105.459 165.250 1.00 264.03 ? 265  ARG B NE    1 
ATOM   4135  C  CZ    . ARG B  2 265  ? 147.852 105.628 165.818 1.00 265.59 ? 265  ARG B CZ    1 
ATOM   4136  N  NH1   . ARG B  2 265  ? 148.476 106.796 165.728 1.00 264.77 ? 265  ARG B NH1   1 
ATOM   4137  N  NH2   . ARG B  2 265  ? 148.422 104.626 166.475 1.00 263.39 ? 265  ARG B NH2   1 
ATOM   4138  N  N     . LEU B  2 266  ? 144.263 101.954 161.159 1.00 269.58 ? 266  LEU B N     1 
ATOM   4139  C  CA    . LEU B  2 266  ? 143.334 100.830 161.163 1.00 274.38 ? 266  LEU B CA    1 
ATOM   4140  C  C     . LEU B  2 266  ? 143.747 99.764  160.159 1.00 282.53 ? 266  LEU B C     1 
ATOM   4141  O  O     . LEU B  2 266  ? 143.692 98.570  160.459 1.00 294.39 ? 266  LEU B O     1 
ATOM   4142  C  CB    . LEU B  2 266  ? 141.919 101.326 160.859 1.00 271.07 ? 266  LEU B CB    1 
ATOM   4143  C  CG    . LEU B  2 266  ? 140.816 100.271 160.768 1.00 274.13 ? 266  LEU B CG    1 
ATOM   4144  C  CD1   . LEU B  2 266  ? 140.595 99.616  162.118 1.00 281.57 ? 266  LEU B CD1   1 
ATOM   4145  C  CD2   . LEU B  2 266  ? 139.526 100.886 160.248 1.00 262.65 ? 266  LEU B CD2   1 
ATOM   4146  N  N     . CYS B  2 267  ? 144.162 100.171 158.961 1.00 285.55 ? 267  CYS B N     1 
ATOM   4147  C  CA    . CYS B  2 267  ? 144.580 99.182  157.976 1.00 295.36 ? 267  CYS B CA    1 
ATOM   4148  C  C     . CYS B  2 267  ? 145.882 98.514  158.390 1.00 302.48 ? 267  CYS B C     1 
ATOM   4149  O  O     . CYS B  2 267  ? 146.066 97.315  158.159 1.00 312.75 ? 267  CYS B O     1 
ATOM   4150  C  CB    . CYS B  2 267  ? 144.702 99.823  156.597 1.00 286.55 ? 267  CYS B CB    1 
ATOM   4151  S  SG    . CYS B  2 267  ? 143.183 99.706  155.617 1.00 286.02 ? 267  CYS B SG    1 
ATOM   4152  N  N     . VAL B  2 268  ? 146.795 99.261  159.015 1.00 301.15 ? 268  VAL B N     1 
ATOM   4153  C  CA    . VAL B  2 268  ? 148.025 98.643  159.507 1.00 303.19 ? 268  VAL B CA    1 
ATOM   4154  C  C     . VAL B  2 268  ? 147.702 97.585  160.555 1.00 312.45 ? 268  VAL B C     1 
ATOM   4155  O  O     . VAL B  2 268  ? 148.241 96.470  160.525 1.00 321.57 ? 268  VAL B O     1 
ATOM   4156  C  CB    . VAL B  2 268  ? 148.984 99.716  160.057 1.00 294.49 ? 268  VAL B CB    1 
ATOM   4157  C  CG1   . VAL B  2 268  ? 150.112 99.063  160.836 1.00 297.31 ? 268  VAL B CG1   1 
ATOM   4158  C  CG2   . VAL B  2 268  ? 149.543 100.555 158.919 1.00 290.16 ? 268  VAL B CG2   1 
ATOM   4159  N  N     . ALA B  2 269  ? 146.805 97.911  161.489 1.00 318.53 ? 269  ALA B N     1 
ATOM   4160  C  CA    . ALA B  2 269  ? 146.433 96.941  162.513 1.00 323.43 ? 269  ALA B CA    1 
ATOM   4161  C  C     . ALA B  2 269  ? 145.689 95.757  161.909 1.00 333.94 ? 269  ALA B C     1 
ATOM   4162  O  O     . ALA B  2 269  ? 145.879 94.616  162.339 1.00 344.72 ? 269  ALA B O     1 
ATOM   4163  C  CB    . ALA B  2 269  ? 145.589 97.614  163.595 1.00 317.14 ? 269  ALA B CB    1 
ATOM   4164  N  N     . PHE B  2 270  ? 144.842 96.008  160.909 1.00 322.74 ? 270  PHE B N     1 
ATOM   4165  C  CA    . PHE B  2 270  ? 144.129 94.924  160.243 1.00 328.02 ? 270  PHE B CA    1 
ATOM   4166  C  C     . PHE B  2 270  ? 145.099 93.982  159.542 1.00 336.53 ? 270  PHE B C     1 
ATOM   4167  O  O     . PHE B  2 270  ? 144.935 92.757  159.588 1.00 343.36 ? 270  PHE B O     1 
ATOM   4168  C  CB    . PHE B  2 270  ? 143.116 95.518  159.260 1.00 323.75 ? 270  PHE B CB    1 
ATOM   4169  C  CG    . PHE B  2 270  ? 142.349 94.496  158.468 1.00 327.05 ? 270  PHE B CG    1 
ATOM   4170  C  CD1   . PHE B  2 270  ? 141.235 93.870  159.005 1.00 329.87 ? 270  PHE B CD1   1 
ATOM   4171  C  CD2   . PHE B  2 270  ? 142.728 94.181  157.173 1.00 326.61 ? 270  PHE B CD2   1 
ATOM   4172  C  CE1   . PHE B  2 270  ? 140.523 92.936  158.268 1.00 332.43 ? 270  PHE B CE1   1 
ATOM   4173  C  CE2   . PHE B  2 270  ? 142.023 93.249  156.432 1.00 331.17 ? 270  PHE B CE2   1 
ATOM   4174  C  CZ    . PHE B  2 270  ? 140.919 92.626  156.979 1.00 331.95 ? 270  PHE B CZ    1 
ATOM   4175  N  N     . ASP B  2 271  ? 146.136 94.536  158.909 1.00 343.46 ? 271  ASP B N     1 
ATOM   4176  C  CA    . ASP B  2 271  ? 147.153 93.708  158.272 1.00 350.89 ? 271  ASP B CA    1 
ATOM   4177  C  C     . ASP B  2 271  ? 147.911 92.884  159.306 1.00 358.84 ? 271  ASP B C     1 
ATOM   4178  O  O     . ASP B  2 271  ? 148.129 91.679  159.121 1.00 366.05 ? 271  ASP B O     1 
ATOM   4179  C  CB    . ASP B  2 271  ? 148.114 94.589  157.475 1.00 348.58 ? 271  ASP B CB    1 
ATOM   4180  C  CG    . ASP B  2 271  ? 149.221 93.795  156.805 1.00 358.34 ? 271  ASP B CG    1 
ATOM   4181  O  OD1   . ASP B  2 271  ? 149.047 92.576  156.597 1.00 363.28 ? 271  ASP B OD1   1 
ATOM   4182  O  OD2   . ASP B  2 271  ? 150.271 94.395  156.490 1.00 359.74 ? 271  ASP B OD2   1 
ATOM   4183  N  N     . ALA B  2 272  ? 148.326 93.522  160.403 1.00 344.81 ? 272  ALA B N     1 
ATOM   4184  C  CA    . ALA B  2 272  ? 149.037 92.794  161.449 1.00 351.36 ? 272  ALA B CA    1 
ATOM   4185  C  C     . ALA B  2 272  ? 148.170 91.687  162.041 1.00 357.54 ? 272  ALA B C     1 
ATOM   4186  O  O     . ALA B  2 272  ? 148.676 90.622  162.412 1.00 363.59 ? 272  ALA B O     1 
ATOM   4187  C  CB    . ALA B  2 272  ? 149.499 93.759  162.540 1.00 346.43 ? 272  ALA B CB    1 
ATOM   4188  N  N     . GLN B  2 273  ? 146.859 91.924  162.140 1.00 358.32 ? 273  GLN B N     1 
ATOM   4189  C  CA    . GLN B  2 273  ? 145.946 90.905  162.646 1.00 362.83 ? 273  GLN B CA    1 
ATOM   4190  C  C     . GLN B  2 273  ? 145.787 89.763  161.649 1.00 368.90 ? 273  GLN B C     1 
ATOM   4191  O  O     . GLN B  2 273  ? 145.666 88.596  162.043 1.00 373.60 ? 273  GLN B O     1 
ATOM   4192  C  CB    . GLN B  2 273  ? 144.588 91.535  162.958 1.00 356.95 ? 273  GLN B CB    1 
ATOM   4193  C  CG    . GLN B  2 273  ? 143.585 90.604  163.622 1.00 355.63 ? 273  GLN B CG    1 
ATOM   4194  C  CD    . GLN B  2 273  ? 143.967 90.251  165.048 1.00 364.79 ? 273  GLN B CD    1 
ATOM   4195  O  OE1   . GLN B  2 273  ? 144.180 91.130  165.884 1.00 369.69 ? 273  GLN B OE1   1 
ATOM   4196  N  NE2   . GLN B  2 273  ? 144.058 88.957  165.331 1.00 365.31 ? 273  GLN B NE2   1 
ATOM   4197  N  N     . ALA B  2 274  ? 145.769 90.083  160.352 1.00 367.69 ? 274  ALA B N     1 
ATOM   4198  C  CA    . ALA B  2 274  ? 145.597 89.045  159.341 1.00 371.72 ? 274  ALA B CA    1 
ATOM   4199  C  C     . ALA B  2 274  ? 146.833 88.163  159.230 1.00 374.69 ? 274  ALA B C     1 
ATOM   4200  O  O     . ALA B  2 274  ? 146.718 86.947  159.034 1.00 376.96 ? 274  ALA B O     1 
ATOM   4201  C  CB    . ALA B  2 274  ? 145.266 89.681  157.991 1.00 366.06 ? 274  ALA B CB    1 
ATOM   4202  N  N     . ARG B  2 275  ? 148.025 88.757  159.350 1.00 374.31 ? 275  ARG B N     1 
ATOM   4203  C  CA    . ARG B  2 275  ? 149.248 87.963  159.270 1.00 375.72 ? 275  ARG B CA    1 
ATOM   4204  C  C     . ARG B  2 275  ? 149.355 86.981  160.429 1.00 376.99 ? 275  ARG B C     1 
ATOM   4205  O  O     . ARG B  2 275  ? 149.918 85.890  160.270 1.00 377.73 ? 275  ARG B O     1 
ATOM   4206  C  CB    . ARG B  2 275  ? 150.472 88.879  159.227 1.00 375.47 ? 275  ARG B CB    1 
ATOM   4207  C  CG    . ARG B  2 275  ? 151.808 88.145  159.212 1.00 377.19 ? 275  ARG B CG    1 
ATOM   4208  C  CD    . ARG B  2 275  ? 152.962 89.102  158.971 1.00 377.56 ? 275  ARG B CD    1 
ATOM   4209  N  NE    . ARG B  2 275  ? 152.785 90.355  159.697 1.00 377.31 ? 275  ARG B NE    1 
ATOM   4210  C  CZ    . ARG B  2 275  ? 153.094 90.528  160.977 1.00 379.25 ? 275  ARG B CZ    1 
ATOM   4211  N  NH1   . ARG B  2 275  ? 152.898 91.705  161.552 1.00 377.94 ? 275  ARG B NH1   1 
ATOM   4212  N  NH2   . ARG B  2 275  ? 153.597 89.524  161.683 1.00 381.22 ? 275  ARG B NH2   1 
ATOM   4213  N  N     . LYS B  2 276  ? 148.817 87.338  161.590 1.00 356.60 ? 276  LYS B N     1 
ATOM   4214  C  CA    . LYS B  2 276  ? 148.822 86.448  162.747 1.00 356.39 ? 276  LYS B CA    1 
ATOM   4215  C  C     . LYS B  2 276  ? 147.870 85.273  162.536 1.00 358.27 ? 276  LYS B C     1 
ATOM   4216  O  O     . LYS B  2 276  ? 148.288 84.184  162.140 1.00 360.55 ? 276  LYS B O     1 
ATOM   4217  C  CB    . LYS B  2 276  ? 148.440 87.214  164.016 1.00 354.51 ? 276  LYS B CB    1 
ATOM   4218  N  N     . GLY B  2 283  ? 138.021 87.493  159.056 1.00 311.91 ? 283  GLY B N     1 
ATOM   4219  C  CA    . GLY B  2 283  ? 136.970 87.021  159.940 1.00 311.29 ? 283  GLY B CA    1 
ATOM   4220  C  C     . GLY B  2 283  ? 136.323 88.128  160.751 1.00 310.88 ? 283  GLY B C     1 
ATOM   4221  O  O     . GLY B  2 283  ? 136.883 89.214  160.883 1.00 310.78 ? 283  GLY B O     1 
ATOM   4222  N  N     . ALA B  2 284  ? 135.140 87.844  161.306 1.00 327.95 ? 284  ALA B N     1 
ATOM   4223  C  CA    . ALA B  2 284  ? 134.399 88.860  162.050 1.00 324.59 ? 284  ALA B CA    1 
ATOM   4224  C  C     . ALA B  2 284  ? 135.096 89.228  163.354 1.00 321.58 ? 284  ALA B C     1 
ATOM   4225  O  O     . ALA B  2 284  ? 135.099 90.397  163.757 1.00 319.44 ? 284  ALA B O     1 
ATOM   4226  C  CB    . ALA B  2 284  ? 132.974 88.376  162.322 1.00 321.02 ? 284  ALA B CB    1 
ATOM   4227  N  N     . ARG B  2 285  ? 135.684 88.244  164.039 1.00 392.04 ? 285  ARG B N     1 
ATOM   4228  C  CA    . ARG B  2 285  ? 136.343 88.522  165.310 1.00 391.85 ? 285  ARG B CA    1 
ATOM   4229  C  C     . ARG B  2 285  ? 137.631 89.314  165.114 1.00 392.65 ? 285  ARG B C     1 
ATOM   4230  O  O     . ARG B  2 285  ? 138.017 90.110  165.983 1.00 391.69 ? 285  ARG B O     1 
ATOM   4231  C  CB    . ARG B  2 285  ? 136.626 87.210  166.046 1.00 220.12 ? 285  ARG B CB    1 
ATOM   4232  C  CG    . ARG B  2 285  ? 135.447 86.231  166.096 1.00 220.12 ? 285  ARG B CG    1 
ATOM   4233  C  CD    . ARG B  2 285  ? 135.816 84.903  166.784 1.00 220.12 ? 285  ARG B CD    1 
ATOM   4234  N  NE    . ARG B  2 285  ? 136.741 84.086  165.991 1.00 220.12 ? 285  ARG B NE    1 
ATOM   4235  C  CZ    . ARG B  2 285  ? 138.061 84.058  166.170 1.00 220.12 ? 285  ARG B CZ    1 
ATOM   4236  N  NH1   . ARG B  2 285  ? 138.621 84.801  167.116 1.00 220.12 ? 285  ARG B NH1   1 
ATOM   4237  N  NH2   . ARG B  2 285  ? 138.825 83.288  165.402 1.00 220.12 ? 285  ARG B NH2   1 
ATOM   4238  N  N     . ALA B  2 286  ? 138.312 89.101  163.985 1.00 357.89 ? 286  ALA B N     1 
ATOM   4239  C  CA    . ALA B  2 286  ? 139.599 89.746  163.754 1.00 358.16 ? 286  ALA B CA    1 
ATOM   4240  C  C     . ALA B  2 286  ? 139.456 91.262  163.681 1.00 354.38 ? 286  ALA B C     1 
ATOM   4241  O  O     . ALA B  2 286  ? 140.256 92.000  164.269 1.00 352.63 ? 286  ALA B O     1 
ATOM   4242  C  CB    . ALA B  2 286  ? 140.230 89.201  162.472 1.00 363.41 ? 286  ALA B CB    1 
ATOM   4243  N  N     . ILE B  2 287  ? 138.443 91.748  162.957 1.00 402.84 ? 287  ILE B N     1 
ATOM   4244  C  CA    . ILE B  2 287  ? 138.286 93.192  162.823 1.00 399.32 ? 287  ILE B CA    1 
ATOM   4245  C  C     . ILE B  2 287  ? 137.900 93.812  164.163 1.00 395.37 ? 287  ILE B C     1 
ATOM   4246  O  O     . ILE B  2 287  ? 138.284 94.948  164.463 1.00 393.05 ? 287  ILE B O     1 
ATOM   4247  C  CB    . ILE B  2 287  ? 137.271 93.524  161.710 1.00 234.13 ? 287  ILE B CB    1 
ATOM   4248  C  CG1   . ILE B  2 287  ? 135.839 93.227  162.150 1.00 234.13 ? 287  ILE B CG1   1 
ATOM   4249  C  CG2   . ILE B  2 287  ? 137.615 92.760  160.427 1.00 234.13 ? 287  ILE B CG2   1 
ATOM   4250  C  CD1   . ILE B  2 287  ? 135.059 94.471  162.526 1.00 234.13 ? 287  ILE B CD1   1 
ATOM   4251  N  N     . TRP B  2 288  ? 137.156 93.079  164.995 1.00 330.65 ? 288  TRP B N     1 
ATOM   4252  C  CA    . TRP B  2 288  ? 136.836 93.583  166.326 1.00 327.20 ? 288  TRP B CA    1 
ATOM   4253  C  C     . TRP B  2 288  ? 138.099 93.728  167.164 1.00 324.88 ? 288  TRP B C     1 
ATOM   4254  O  O     . TRP B  2 288  ? 138.316 94.758  167.825 1.00 324.00 ? 288  TRP B O     1 
ATOM   4255  C  CB    . TRP B  2 288  ? 135.840 92.645  167.007 1.00 326.09 ? 288  TRP B CB    1 
ATOM   4256  C  CG    . TRP B  2 288  ? 135.039 93.300  168.093 1.00 320.37 ? 288  TRP B CG    1 
ATOM   4257  C  CD1   . TRP B  2 288  ? 135.519 93.895  169.221 1.00 319.47 ? 288  TRP B CD1   1 
ATOM   4258  C  CD2   . TRP B  2 288  ? 133.612 93.417  168.155 1.00 316.71 ? 288  TRP B CD2   1 
ATOM   4259  N  NE1   . TRP B  2 288  ? 134.480 94.382  169.979 1.00 318.02 ? 288  TRP B NE1   1 
ATOM   4260  C  CE2   . TRP B  2 288  ? 133.298 94.098  169.347 1.00 317.14 ? 288  TRP B CE2   1 
ATOM   4261  C  CE3   . TRP B  2 288  ? 132.569 93.008  167.321 1.00 313.36 ? 288  TRP B CE3   1 
ATOM   4262  C  CZ2   . TRP B  2 288  ? 131.986 94.385  169.722 1.00 315.48 ? 288  TRP B CZ2   1 
ATOM   4263  C  CZ3   . TRP B  2 288  ? 131.266 93.294  167.694 1.00 310.07 ? 288  TRP B CZ3   1 
ATOM   4264  C  CH2   . TRP B  2 288  ? 130.987 93.975  168.882 1.00 309.71 ? 288  TRP B CH2   1 
ATOM   4265  N  N     . ARG B  2 289  ? 138.944 92.692  167.153 1.00 351.63 ? 289  ARG B N     1 
ATOM   4266  C  CA    . ARG B  2 289  ? 140.235 92.788  167.827 1.00 349.77 ? 289  ARG B CA    1 
ATOM   4267  C  C     . ARG B  2 289  ? 141.032 93.980  167.311 1.00 347.30 ? 289  ARG B C     1 
ATOM   4268  O  O     . ARG B  2 289  ? 141.649 94.712  168.093 1.00 345.96 ? 289  ARG B O     1 
ATOM   4269  C  CB    . ARG B  2 289  ? 141.021 91.490  167.643 1.00 353.83 ? 289  ARG B CB    1 
ATOM   4270  N  N     . ALA B  2 290  ? 141.013 94.202  165.995 1.00 362.81 ? 290  ALA B N     1 
ATOM   4271  C  CA    . ALA B  2 290  ? 141.770 95.313  165.425 1.00 364.41 ? 290  ALA B CA    1 
ATOM   4272  C  C     . ALA B  2 290  ? 141.239 96.656  165.910 1.00 358.24 ? 290  ALA B C     1 
ATOM   4273  O  O     . ALA B  2 290  ? 142.021 97.566  166.208 1.00 352.96 ? 290  ALA B O     1 
ATOM   4274  C  CB    . ALA B  2 290  ? 141.747 95.241  163.898 1.00 375.19 ? 290  ALA B CB    1 
ATOM   4275  N  N     . LEU B  2 291  ? 139.914 96.805  165.985 1.00 423.37 ? 291  LEU B N     1 
ATOM   4276  C  CA    . LEU B  2 291  ? 139.340 98.049  166.494 1.00 416.37 ? 291  LEU B CA    1 
ATOM   4277  C  C     . LEU B  2 291  ? 139.798 98.313  167.924 1.00 414.28 ? 291  LEU B C     1 
ATOM   4278  O  O     . LEU B  2 291  ? 140.299 99.407  168.241 1.00 411.34 ? 291  LEU B O     1 
ATOM   4279  C  CB    . LEU B  2 291  ? 137.814 97.998  166.426 1.00 230.93 ? 291  LEU B CB    1 
ATOM   4280  C  CG    . LEU B  2 291  ? 137.187 97.833  165.041 1.00 230.93 ? 291  LEU B CG    1 
ATOM   4281  C  CD1   . LEU B  2 291  ? 135.690 97.629  165.166 1.00 230.93 ? 291  LEU B CD1   1 
ATOM   4282  C  CD2   . LEU B  2 291  ? 137.498 99.031  164.160 1.00 230.93 ? 291  LEU B CD2   1 
ATOM   4283  N  N     . CYS B  2 292  ? 139.631 97.318  168.801 1.00 414.43 ? 292  CYS B N     1 
ATOM   4284  C  CA    . CYS B  2 292  ? 140.054 97.497  170.189 1.00 410.96 ? 292  CYS B CA    1 
ATOM   4285  C  C     . CYS B  2 292  ? 141.536 97.850  170.264 1.00 407.94 ? 292  CYS B C     1 
ATOM   4286  O  O     . CYS B  2 292  ? 141.940 98.712  171.061 1.00 404.46 ? 292  CYS B O     1 
ATOM   4287  C  CB    . CYS B  2 292  ? 139.743 96.246  171.015 1.00 220.07 ? 292  CYS B CB    1 
ATOM   4288  S  SG    . CYS B  2 292  ? 138.316 96.395  172.157 1.00 220.07 ? 292  CYS B SG    1 
ATOM   4289  N  N     . HIS B  2 293  ? 142.358 97.218  169.418 1.00 343.97 ? 293  HIS B N     1 
ATOM   4290  C  CA    . HIS B  2 293  ? 143.784 97.530  169.396 1.00 342.51 ? 293  HIS B CA    1 
ATOM   4291  C  C     . HIS B  2 293  ? 144.030 98.980  168.990 1.00 339.57 ? 293  HIS B C     1 
ATOM   4292  O  O     . HIS B  2 293  ? 144.842 99.677  169.607 1.00 343.00 ? 293  HIS B O     1 
ATOM   4293  C  CB    . HIS B  2 293  ? 144.522 96.583  168.447 1.00 346.13 ? 293  HIS B CB    1 
ATOM   4294  C  CG    . HIS B  2 293  ? 145.977 96.906  168.282 1.00 347.83 ? 293  HIS B CG    1 
ATOM   4295  N  ND1   . HIS B  2 293  ? 146.419 97.998  167.569 1.00 349.79 ? 293  HIS B ND1   1 
ATOM   4296  C  CD2   . HIS B  2 293  ? 147.087 96.278  168.736 1.00 349.90 ? 293  HIS B CD2   1 
ATOM   4297  C  CE1   . HIS B  2 293  ? 147.739 98.036  167.596 1.00 352.68 ? 293  HIS B CE1   1 
ATOM   4298  N  NE2   . HIS B  2 293  ? 148.170 97.002  168.295 1.00 352.96 ? 293  HIS B NE2   1 
ATOM   4299  N  N     . ALA B  2 294  ? 143.386 99.402  167.907 1.00 340.38 ? 294  ALA B N     1 
ATOM   4300  C  CA    . ALA B  2 294  ? 143.632 100.730 167.363 1.00 340.89 ? 294  ALA B CA    1 
ATOM   4301  C  C     . ALA B  2 294  ? 143.302 101.901 168.269 1.00 333.25 ? 294  ALA B C     1 
ATOM   4302  O  O     . ALA B  2 294  ? 144.103 102.829 168.379 1.00 330.96 ? 294  ALA B O     1 
ATOM   4303  C  CB    . ALA B  2 294  ? 142.911 100.884 166.032 1.00 348.15 ? 294  ALA B CB    1 
ATOM   4304  N  N     . PHE B  2 295  ? 142.141 101.882 168.913 1.00 334.78 ? 295  PHE B N     1 
ATOM   4305  C  CA    . PHE B  2 295  ? 141.817 102.990 169.796 1.00 328.08 ? 295  PHE B CA    1 
ATOM   4306  C  C     . PHE B  2 295  ? 142.798 102.981 170.964 1.00 329.15 ? 295  PHE B C     1 
ATOM   4307  O  O     . PHE B  2 295  ? 143.352 104.014 171.333 1.00 320.61 ? 295  PHE B O     1 
ATOM   4308  C  CB    . PHE B  2 295  ? 140.361 102.902 170.228 1.00 319.70 ? 295  PHE B CB    1 
ATOM   4309  C  CG    . PHE B  2 295  ? 139.412 102.801 169.070 1.00 318.14 ? 295  PHE B CG    1 
ATOM   4310  C  CD1   . PHE B  2 295  ? 139.345 103.816 168.130 1.00 313.63 ? 295  PHE B CD1   1 
ATOM   4311  C  CD2   . PHE B  2 295  ? 138.610 101.685 168.901 1.00 321.75 ? 295  PHE B CD2   1 
ATOM   4312  C  CE1   . PHE B  2 295  ? 138.484 103.729 167.052 1.00 308.27 ? 295  PHE B CE1   1 
ATOM   4313  C  CE2   . PHE B  2 295  ? 137.745 101.591 167.827 1.00 319.35 ? 295  PHE B CE2   1 
ATOM   4314  C  CZ    . PHE B  2 295  ? 137.682 102.614 166.901 1.00 313.50 ? 295  PHE B CZ    1 
ATOM   4315  N  N     . GLY B  2 296  ? 143.018 101.797 171.522 1.00 339.77 ? 296  GLY B N     1 
ATOM   4316  C  CA    . GLY B  2 296  ? 144.045 101.631 172.526 1.00 339.77 ? 296  GLY B CA    1 
ATOM   4317  C  C     . GLY B  2 296  ? 144.080 102.434 173.802 1.00 339.77 ? 296  GLY B C     1 
ATOM   4318  O  O     . GLY B  2 296  ? 143.148 102.459 174.610 1.00 339.77 ? 296  GLY B O     1 
ATOM   4319  N  N     . ARG B  2 297  ? 145.204 103.127 173.942 1.00 364.20 ? 297  ARG B N     1 
ATOM   4320  C  CA    . ARG B  2 297  ? 145.528 103.908 175.115 1.00 351.94 ? 297  ARG B CA    1 
ATOM   4321  C  C     . ARG B  2 297  ? 144.489 104.965 175.412 1.00 344.87 ? 297  ARG B C     1 
ATOM   4322  O  O     . ARG B  2 297  ? 144.177 105.182 176.571 1.00 342.78 ? 297  ARG B O     1 
ATOM   4323  C  CB    . ARG B  2 297  ? 146.885 104.587 174.926 1.00 350.52 ? 297  ARG B CB    1 
ATOM   4324  C  CG    . ARG B  2 297  ? 148.005 103.647 174.518 1.00 351.40 ? 297  ARG B CG    1 
ATOM   4325  C  CD    . ARG B  2 297  ? 149.126 104.400 173.822 1.00 355.62 ? 297  ARG B CD    1 
ATOM   4326  N  NE    . ARG B  2 297  ? 149.555 105.576 174.577 1.00 361.05 ? 297  ARG B NE    1 
ATOM   4327  C  CZ    . ARG B  2 297  ? 150.553 106.373 174.213 1.00 358.99 ? 297  ARG B CZ    1 
ATOM   4328  N  NH1   . ARG B  2 297  ? 151.234 106.122 173.104 1.00 355.67 ? 297  ARG B NH1   1 
ATOM   4329  N  NH2   . ARG B  2 297  ? 150.875 107.421 174.961 1.00 357.54 ? 297  ARG B NH2   1 
ATOM   4330  N  N     . ARG B  2 298  ? 143.940 105.624 174.398 1.00 425.48 ? 298  ARG B N     1 
ATOM   4331  C  CA    . ARG B  2 298  ? 142.933 106.641 174.676 1.00 420.89 ? 298  ARG B CA    1 
ATOM   4332  C  C     . ARG B  2 298  ? 141.735 105.996 175.369 1.00 417.84 ? 298  ARG B C     1 
ATOM   4333  O  O     . ARG B  2 298  ? 141.258 106.479 176.405 1.00 413.11 ? 298  ARG B O     1 
ATOM   4334  C  CB    . ARG B  2 298  ? 142.483 107.313 173.380 1.00 226.28 ? 298  ARG B CB    1 
ATOM   4335  C  CG    . ARG B  2 298  ? 143.545 108.179 172.724 1.00 226.28 ? 298  ARG B CG    1 
ATOM   4336  C  CD    . ARG B  2 298  ? 143.816 109.427 173.547 1.00 226.28 ? 298  ARG B CD    1 
ATOM   4337  N  NE    . ARG B  2 298  ? 144.822 110.283 172.927 1.00 226.28 ? 298  ARG B NE    1 
ATOM   4338  C  CZ    . ARG B  2 298  ? 145.211 111.455 173.418 1.00 226.28 ? 298  ARG B CZ    1 
ATOM   4339  N  NH1   . ARG B  2 298  ? 144.677 111.916 174.540 1.00 226.28 ? 298  ARG B NH1   1 
ATOM   4340  N  NH2   . ARG B  2 298  ? 146.133 112.168 172.788 1.00 226.28 ? 298  ARG B NH2   1 
ATOM   4341  N  N     . LEU B  2 299  ? 141.299 104.857 174.844 1.00 410.04 ? 299  LEU B N     1 
ATOM   4342  C  CA    . LEU B  2 299  ? 140.168 104.157 175.423 1.00 408.29 ? 299  LEU B CA    1 
ATOM   4343  C  C     . LEU B  2 299  ? 140.492 103.705 176.838 1.00 404.31 ? 299  LEU B C     1 
ATOM   4344  O  O     . LEU B  2 299  ? 139.667 103.827 177.740 1.00 401.00 ? 299  LEU B O     1 
ATOM   4345  C  CB    . LEU B  2 299  ? 139.778 102.960 174.561 1.00 227.56 ? 299  LEU B CB    1 
ATOM   4346  C  CG    . LEU B  2 299  ? 138.587 102.170 175.094 1.00 227.56 ? 299  LEU B CG    1 
ATOM   4347  C  CD1   . LEU B  2 299  ? 137.513 103.115 175.605 1.00 227.56 ? 299  LEU B CD1   1 
ATOM   4348  C  CD2   . LEU B  2 299  ? 138.033 101.240 174.025 1.00 227.56 ? 299  LEU B CD2   1 
ATOM   4349  N  N     . ILE B  2 300  ? 141.708 103.210 177.041 1.00 428.95 ? 300  ILE B N     1 
ATOM   4350  C  CA    . ILE B  2 300  ? 142.111 102.744 178.363 1.00 427.21 ? 300  ILE B CA    1 
ATOM   4351  C  C     . ILE B  2 300  ? 142.105 103.885 179.371 1.00 425.18 ? 300  ILE B C     1 
ATOM   4352  O  O     . ILE B  2 300  ? 141.670 103.729 180.511 1.00 425.09 ? 300  ILE B O     1 
ATOM   4353  C  CB    . ILE B  2 300  ? 143.506 102.103 178.329 1.00 241.99 ? 300  ILE B CB    1 
ATOM   4354  C  CG1   . ILE B  2 300  ? 143.505 100.890 177.399 1.00 241.99 ? 300  ILE B CG1   1 
ATOM   4355  C  CG2   . ILE B  2 300  ? 143.938 101.706 179.731 1.00 241.99 ? 300  ILE B CG2   1 
ATOM   4356  C  CD1   . ILE B  2 300  ? 144.836 100.173 177.326 1.00 241.99 ? 300  ILE B CD1   1 
ATOM   4357  N  N     . LEU B  2 301  ? 142.583 105.042 178.927 1.00 369.53 ? 301  LEU B N     1 
ATOM   4358  C  CA    . LEU B  2 301  ? 142.653 106.244 179.737 1.00 370.86 ? 301  LEU B CA    1 
ATOM   4359  C  C     . LEU B  2 301  ? 141.262 106.692 180.129 1.00 367.21 ? 301  LEU B C     1 
ATOM   4360  O  O     . LEU B  2 301  ? 141.037 107.116 181.262 1.00 365.52 ? 301  LEU B O     1 
ATOM   4361  C  CB    . LEU B  2 301  ? 143.360 107.358 178.967 1.00 373.98 ? 301  LEU B CB    1 
ATOM   4362  C  CG    . LEU B  2 301  ? 143.485 108.713 179.668 1.00 371.68 ? 301  LEU B CG    1 
ATOM   4363  C  CD1   . LEU B  2 301  ? 144.462 109.612 178.926 1.00 377.92 ? 301  LEU B CD1   1 
ATOM   4364  C  CD2   . LEU B  2 301  ? 142.132 109.392 179.812 1.00 365.67 ? 301  LEU B CD2   1 
ATOM   4365  N  N     . SER B  2 302  ? 140.326 106.592 179.192 1.00 417.40 ? 302  SER B N     1 
ATOM   4366  C  CA    . SER B  2 302  ? 138.966 107.001 179.481 1.00 412.70 ? 302  SER B CA    1 
ATOM   4367  C  C     . SER B  2 302  ? 138.456 106.132 180.615 1.00 411.75 ? 302  SER B C     1 
ATOM   4368  O  O     . SER B  2 302  ? 137.782 106.612 181.524 1.00 407.82 ? 302  SER B O     1 
ATOM   4369  C  CB    . SER B  2 302  ? 138.080 106.824 178.253 1.00 238.11 ? 302  SER B CB    1 
ATOM   4370  O  OG    . SER B  2 302  ? 137.753 105.461 178.062 1.00 238.11 ? 302  SER B OG    1 
ATOM   4371  N  N     . SER B  2 303  ? 138.797 104.851 180.571 1.00 369.38 ? 303  SER B N     1 
ATOM   4372  C  CA    . SER B  2 303  ? 138.355 103.929 181.615 1.00 368.44 ? 303  SER B CA    1 
ATOM   4373  C  C     . SER B  2 303  ? 138.999 104.258 182.958 1.00 366.52 ? 303  SER B C     1 
ATOM   4374  O  O     . SER B  2 303  ? 138.339 104.204 184.004 1.00 363.16 ? 303  SER B O     1 
ATOM   4375  C  CB    . SER B  2 303  ? 138.666 102.488 181.207 1.00 372.66 ? 303  SER B CB    1 
ATOM   4376  N  N     . THR B  2 304  ? 140.288 104.608 182.948 1.00 350.80 ? 304  THR B N     1 
ATOM   4377  C  CA    . THR B  2 304  ? 140.973 104.949 184.192 1.00 349.54 ? 304  THR B CA    1 
ATOM   4378  C  C     . THR B  2 304  ? 140.393 106.214 184.817 1.00 349.62 ? 304  THR B C     1 
ATOM   4379  O  O     . THR B  2 304  ? 140.191 106.279 186.042 1.00 349.12 ? 304  THR B O     1 
ATOM   4380  C  CB    . THR B  2 304  ? 142.471 105.120 183.938 1.00 346.45 ? 304  THR B CB    1 
ATOM   4381  N  N     . PHE B  2 305  ? 140.139 107.234 183.994 1.00 339.72 ? 305  PHE B N     1 
ATOM   4382  C  CA    . PHE B  2 305  ? 139.479 108.437 184.489 1.00 338.28 ? 305  PHE B CA    1 
ATOM   4383  C  C     . PHE B  2 305  ? 138.141 108.099 185.130 1.00 337.56 ? 305  PHE B C     1 
ATOM   4384  O  O     . PHE B  2 305  ? 137.816 108.602 186.214 1.00 333.93 ? 305  PHE B O     1 
ATOM   4385  C  CB    . PHE B  2 305  ? 139.284 109.437 183.349 1.00 339.87 ? 305  PHE B CB    1 
ATOM   4386  C  CG    . PHE B  2 305  ? 140.421 110.405 183.184 1.00 341.99 ? 305  PHE B CG    1 
ATOM   4387  C  CD1   . PHE B  2 305  ? 141.702 109.955 182.919 1.00 344.78 ? 305  PHE B CD1   1 
ATOM   4388  C  CD2   . PHE B  2 305  ? 140.202 111.769 183.276 1.00 338.50 ? 305  PHE B CD2   1 
ATOM   4389  C  CE1   . PHE B  2 305  ? 142.748 110.846 182.763 1.00 346.50 ? 305  PHE B CE1   1 
ATOM   4390  C  CE2   . PHE B  2 305  ? 141.241 112.666 183.120 1.00 343.28 ? 305  PHE B CE2   1 
ATOM   4391  C  CZ    . PHE B  2 305  ? 142.515 112.204 182.863 1.00 349.46 ? 305  PHE B CZ    1 
ATOM   4392  N  N     . ARG B  2 306  ? 137.361 107.233 184.481 1.00 434.41 ? 306  ARG B N     1 
ATOM   4393  C  CA    . ARG B  2 306  ? 136.056 106.878 185.024 1.00 432.66 ? 306  ARG B CA    1 
ATOM   4394  C  C     . ARG B  2 306  ? 136.188 106.129 186.347 1.00 432.49 ? 306  ARG B C     1 
ATOM   4395  O  O     . ARG B  2 306  ? 135.384 106.335 187.262 1.00 436.58 ? 306  ARG B O     1 
ATOM   4396  C  CB    . ARG B  2 306  ? 135.275 106.056 184.002 1.00 258.33 ? 306  ARG B CB    1 
ATOM   4397  C  CG    . ARG B  2 306  ? 133.908 105.593 184.472 1.00 258.33 ? 306  ARG B CG    1 
ATOM   4398  C  CD    . ARG B  2 306  ? 132.984 106.738 184.837 1.00 258.33 ? 306  ARG B CD    1 
ATOM   4399  N  NE    . ARG B  2 306  ? 131.680 106.249 185.281 1.00 258.33 ? 306  ARG B NE    1 
ATOM   4400  C  CZ    . ARG B  2 306  ? 131.388 105.935 186.541 1.00 258.33 ? 306  ARG B CZ    1 
ATOM   4401  N  NH1   . ARG B  2 306  ? 132.308 106.065 187.488 1.00 258.33 ? 306  ARG B NH1   1 
ATOM   4402  N  NH2   . ARG B  2 306  ? 130.177 105.494 186.855 1.00 258.33 ? 306  ARG B NH2   1 
ATOM   4403  N  N     . ILE B  2 307  ? 137.210 105.283 186.484 1.00 427.30 ? 307  ILE B N     1 
ATOM   4404  C  CA    . ILE B  2 307  ? 137.371 104.532 187.729 1.00 429.61 ? 307  ILE B CA    1 
ATOM   4405  C  C     . ILE B  2 307  ? 137.771 105.459 188.875 1.00 432.63 ? 307  ILE B C     1 
ATOM   4406  O  O     . ILE B  2 307  ? 137.277 105.324 190.006 1.00 433.69 ? 307  ILE B O     1 
ATOM   4407  C  CB    . ILE B  2 307  ? 138.382 103.387 187.536 1.00 257.91 ? 307  ILE B CB    1 
ATOM   4408  C  CG1   . ILE B  2 307  ? 137.791 102.319 186.616 1.00 257.91 ? 307  ILE B CG1   1 
ATOM   4409  C  CG2   . ILE B  2 307  ? 138.776 102.783 188.875 1.00 257.91 ? 307  ILE B CG2   1 
ATOM   4410  C  CD1   . ILE B  2 307  ? 138.668 101.102 186.441 1.00 257.91 ? 307  ILE B CD1   1 
ATOM   4411  N  N     . LEU B  2 308  ? 138.672 106.409 188.609 1.00 418.87 ? 308  LEU B N     1 
ATOM   4412  C  CA    . LEU B  2 308  ? 139.022 107.380 189.645 1.00 419.63 ? 308  LEU B CA    1 
ATOM   4413  C  C     . LEU B  2 308  ? 137.813 108.225 190.035 1.00 417.95 ? 308  LEU B C     1 
ATOM   4414  O  O     . LEU B  2 308  ? 137.569 108.480 191.228 1.00 418.79 ? 308  LEU B O     1 
ATOM   4415  C  CB    . LEU B  2 308  ? 140.173 108.269 189.168 1.00 240.72 ? 308  LEU B CB    1 
ATOM   4416  C  CG    . LEU B  2 308  ? 141.473 107.572 188.758 1.00 240.72 ? 308  LEU B CG    1 
ATOM   4417  C  CD1   . LEU B  2 308  ? 142.570 108.596 188.486 1.00 240.72 ? 308  LEU B CD1   1 
ATOM   4418  C  CD2   . LEU B  2 308  ? 141.920 106.567 189.811 1.00 240.72 ? 308  LEU B CD2   1 
ATOM   4419  N  N     . ALA B  2 309  ? 137.035 108.661 189.041 1.00 386.87 ? 309  ALA B N     1 
ATOM   4420  C  CA    . ALA B  2 309  ? 135.809 109.391 189.341 1.00 383.48 ? 309  ALA B CA    1 
ATOM   4421  C  C     . ALA B  2 309  ? 134.868 108.548 190.189 1.00 386.25 ? 309  ALA B C     1 
ATOM   4422  O  O     . ALA B  2 309  ? 134.203 109.068 191.090 1.00 384.36 ? 309  ALA B O     1 
ATOM   4423  C  CB    . ALA B  2 309  ? 135.126 109.837 188.049 1.00 380.19 ? 309  ALA B CB    1 
ATOM   4424  N  N     . ASP B  2 310  ? 134.816 107.238 189.935 1.00 395.98 ? 310  ASP B N     1 
ATOM   4425  C  CA    . ASP B  2 310  ? 133.938 106.370 190.713 1.00 399.52 ? 310  ASP B CA    1 
ATOM   4426  C  C     . ASP B  2 310  ? 134.387 106.280 192.168 1.00 404.00 ? 310  ASP B C     1 
ATOM   4427  O  O     . ASP B  2 310  ? 133.556 106.356 193.087 1.00 405.49 ? 310  ASP B O     1 
ATOM   4428  C  CB    . ASP B  2 310  ? 133.886 104.975 190.091 1.00 401.59 ? 310  ASP B CB    1 
ATOM   4429  N  N     . LEU B  2 311  ? 135.692 106.097 192.401 1.00 478.34 ? 311  LEU B N     1 
ATOM   4430  C  CA    . LEU B  2 311  ? 136.163 106.026 193.784 1.00 476.99 ? 311  LEU B CA    1 
ATOM   4431  C  C     . LEU B  2 311  ? 135.867 107.325 194.534 1.00 478.93 ? 311  LEU B C     1 
ATOM   4432  O  O     . LEU B  2 311  ? 135.450 107.301 195.699 1.00 482.77 ? 311  LEU B O     1 
ATOM   4433  C  CB    . LEU B  2 311  ? 137.655 105.687 193.846 1.00 282.66 ? 311  LEU B CB    1 
ATOM   4434  C  CG    . LEU B  2 311  ? 138.762 106.636 193.377 1.00 282.66 ? 311  LEU B CG    1 
ATOM   4435  C  CD1   . LEU B  2 311  ? 139.207 107.632 194.451 1.00 282.66 ? 311  LEU B CD1   1 
ATOM   4436  C  CD2   . LEU B  2 311  ? 139.943 105.820 192.886 1.00 282.66 ? 311  LEU B CD2   1 
ATOM   4437  N  N     . LEU B  2 312  ? 136.042 108.476 193.880 1.00 496.50 ? 312  LEU B N     1 
ATOM   4438  C  CA    . LEU B  2 312  ? 135.694 109.722 194.568 1.00 493.78 ? 312  LEU B CA    1 
ATOM   4439  C  C     . LEU B  2 312  ? 134.182 109.837 194.794 1.00 496.45 ? 312  LEU B C     1 
ATOM   4440  O  O     . LEU B  2 312  ? 133.731 110.344 195.841 1.00 498.70 ? 312  LEU B O     1 
ATOM   4441  C  CB    . LEU B  2 312  ? 136.210 110.923 193.780 1.00 247.97 ? 312  LEU B CB    1 
ATOM   4442  C  CG    . LEU B  2 312  ? 137.705 111.037 193.511 1.00 247.97 ? 312  LEU B CG    1 
ATOM   4443  C  CD1   . LEU B  2 312  ? 137.937 112.029 192.387 1.00 247.97 ? 312  LEU B CD1   1 
ATOM   4444  C  CD2   . LEU B  2 312  ? 138.464 111.459 194.762 1.00 247.97 ? 312  LEU B CD2   1 
ATOM   4445  N  N     . GLY B  2 313  ? 133.386 109.391 193.813 1.00 434.69 ? 313  GLY B N     1 
ATOM   4446  C  CA    . GLY B  2 313  ? 131.941 109.398 193.974 1.00 435.34 ? 313  GLY B CA    1 
ATOM   4447  C  C     . GLY B  2 313  ? 131.481 108.590 195.170 1.00 440.17 ? 313  GLY B C     1 
ATOM   4448  O  O     . GLY B  2 313  ? 130.527 108.962 195.853 1.00 442.36 ? 313  GLY B O     1 
ATOM   4449  N  N     . PHE B  2 314  ? 132.150 107.467 195.433 1.00 544.34 ? 314  PHE B N     1 
ATOM   4450  C  CA    . PHE B  2 314  ? 131.899 106.753 196.683 1.00 548.43 ? 314  PHE B CA    1 
ATOM   4451  C  C     . PHE B  2 314  ? 132.424 107.524 197.883 1.00 555.57 ? 314  PHE B C     1 
ATOM   4452  O  O     . PHE B  2 314  ? 131.863 107.417 198.978 1.00 559.07 ? 314  PHE B O     1 
ATOM   4453  C  CB    . PHE B  2 314  ? 132.542 105.375 196.649 1.00 296.82 ? 314  PHE B CB    1 
ATOM   4454  C  CG    . PHE B  2 314  ? 132.180 104.585 195.446 1.00 296.82 ? 314  PHE B CG    1 
ATOM   4455  C  CD1   . PHE B  2 314  ? 130.927 104.724 194.852 1.00 296.82 ? 314  PHE B CD1   1 
ATOM   4456  C  CD2   . PHE B  2 314  ? 133.092 103.720 194.883 1.00 296.82 ? 314  PHE B CD2   1 
ATOM   4457  C  CE1   . PHE B  2 314  ? 130.591 103.992 193.717 1.00 296.82 ? 314  PHE B CE1   1 
ATOM   4458  C  CE2   . PHE B  2 314  ? 132.768 102.986 193.754 1.00 296.82 ? 314  PHE B CE2   1 
ATOM   4459  C  CZ    . PHE B  2 314  ? 131.511 103.125 193.169 1.00 296.82 ? 314  PHE B CZ    1 
ATOM   4460  N  N     . ALA B  2 315  ? 133.519 108.268 197.708 1.00 441.56 ? 315  ALA B N     1 
ATOM   4461  C  CA    . ALA B  2 315  ? 134.112 108.967 198.844 1.00 443.37 ? 315  ALA B CA    1 
ATOM   4462  C  C     . ALA B  2 315  ? 133.154 109.998 199.435 1.00 446.07 ? 315  ALA B C     1 
ATOM   4463  O  O     . ALA B  2 315  ? 133.132 110.203 200.655 1.00 451.71 ? 315  ALA B O     1 
ATOM   4464  C  CB    . ALA B  2 315  ? 135.424 109.625 198.422 1.00 442.78 ? 315  ALA B CB    1 
ATOM   4465  N  N     . GLY B  2 316  ? 132.366 110.660 198.589 1.00 405.56 ? 316  GLY B N     1 
ATOM   4466  C  CA    . GLY B  2 316  ? 131.420 111.657 199.067 1.00 407.70 ? 316  GLY B CA    1 
ATOM   4467  C  C     . GLY B  2 316  ? 130.510 111.259 200.227 1.00 413.15 ? 316  GLY B C     1 
ATOM   4468  O  O     . GLY B  2 316  ? 130.453 111.940 201.269 1.00 414.65 ? 316  GLY B O     1 
ATOM   4469  N  N     . PRO B  2 317  ? 129.761 110.157 200.068 1.00 398.23 ? 317  PRO B N     1 
ATOM   4470  C  CA    . PRO B  2 317  ? 128.897 109.698 201.176 1.00 402.78 ? 317  PRO B CA    1 
ATOM   4471  C  C     . PRO B  2 317  ? 129.623 109.499 202.506 1.00 403.29 ? 317  PRO B C     1 
ATOM   4472  O  O     . PRO B  2 317  ? 129.021 109.673 203.576 1.00 406.05 ? 317  PRO B O     1 
ATOM   4473  C  CB    . PRO B  2 317  ? 128.325 108.377 200.643 1.00 415.87 ? 317  PRO B CB    1 
ATOM   4474  C  CG    . PRO B  2 317  ? 128.291 108.559 199.155 1.00 420.59 ? 317  PRO B CG    1 
ATOM   4475  C  CD    . PRO B  2 317  ? 129.478 109.433 198.813 1.00 403.43 ? 317  PRO B CD    1 
ATOM   4476  N  N     . LEU B  2 318  ? 130.901 109.116 202.471 1.00 469.90 ? 318  LEU B N     1 
ATOM   4477  C  CA    . LEU B  2 318  ? 131.681 109.005 203.702 1.00 470.23 ? 318  LEU B CA    1 
ATOM   4478  C  C     . LEU B  2 318  ? 131.804 110.357 204.401 1.00 470.01 ? 318  LEU B C     1 
ATOM   4479  O  O     . LEU B  2 318  ? 131.696 110.450 205.634 1.00 471.84 ? 318  LEU B O     1 
ATOM   4480  C  CB    . LEU B  2 318  ? 133.062 108.433 203.385 1.00 246.23 ? 318  LEU B CB    1 
ATOM   4481  C  CG    . LEU B  2 318  ? 134.079 108.307 204.518 1.00 246.23 ? 318  LEU B CG    1 
ATOM   4482  C  CD1   . LEU B  2 318  ? 133.543 107.409 205.614 1.00 246.23 ? 318  LEU B CD1   1 
ATOM   4483  C  CD2   . LEU B  2 318  ? 135.399 107.775 203.986 1.00 246.23 ? 318  LEU B CD2   1 
ATOM   4484  N  N     . CYS B  2 319  ? 132.048 111.418 203.626 1.00 421.63 ? 319  CYS B N     1 
ATOM   4485  C  CA    . CYS B  2 319  ? 132.049 112.758 204.195 1.00 425.37 ? 319  CYS B CA    1 
ATOM   4486  C  C     . CYS B  2 319  ? 130.692 113.093 204.795 1.00 426.03 ? 319  CYS B C     1 
ATOM   4487  O  O     . CYS B  2 319  ? 130.611 113.749 205.842 1.00 426.42 ? 319  CYS B O     1 
ATOM   4488  C  CB    . CYS B  2 319  ? 132.439 113.782 203.129 1.00 425.37 ? 319  CYS B CB    1 
ATOM   4489  N  N     . ILE B  2 320  ? 129.608 112.651 204.150 1.00 486.92 ? 320  ILE B N     1 
ATOM   4490  C  CA    . ILE B  2 320  ? 128.285 112.848 204.749 1.00 490.22 ? 320  ILE B CA    1 
ATOM   4491  C  C     . ILE B  2 320  ? 128.209 112.177 206.118 1.00 492.91 ? 320  ILE B C     1 
ATOM   4492  O  O     . ILE B  2 320  ? 127.705 112.757 207.091 1.00 494.86 ? 320  ILE B O     1 
ATOM   4493  C  CB    . ILE B  2 320  ? 127.182 112.338 203.807 1.00 265.61 ? 320  ILE B CB    1 
ATOM   4494  C  CG1   . ILE B  2 320  ? 126.920 113.364 202.704 1.00 265.61 ? 320  ILE B CG1   1 
ATOM   4495  C  CG2   . ILE B  2 320  ? 125.906 112.036 204.589 1.00 265.61 ? 320  ILE B CG2   1 
ATOM   4496  C  CD1   . ILE B  2 320  ? 125.719 113.046 201.854 1.00 265.61 ? 320  ILE B CD1   1 
ATOM   4497  N  N     . PHE B  2 321  ? 128.683 110.929 206.203 1.00 415.26 ? 321  PHE B N     1 
ATOM   4498  C  CA    . PHE B  2 321  ? 128.690 110.211 207.478 1.00 421.82 ? 321  PHE B CA    1 
ATOM   4499  C  C     . PHE B  2 321  ? 129.419 111.011 208.549 1.00 419.29 ? 321  PHE B C     1 
ATOM   4500  O  O     . PHE B  2 321  ? 128.919 111.186 209.669 1.00 423.25 ? 321  PHE B O     1 
ATOM   4501  C  CB    . PHE B  2 321  ? 129.336 108.832 207.299 1.00 423.93 ? 321  PHE B CB    1 
ATOM   4502  C  CG    . PHE B  2 321  ? 129.678 108.138 208.596 1.00 429.75 ? 321  PHE B CG    1 
ATOM   4503  C  CD1   . PHE B  2 321  ? 128.731 107.379 209.264 1.00 442.88 ? 321  PHE B CD1   1 
ATOM   4504  C  CD2   . PHE B  2 321  ? 130.953 108.232 209.137 1.00 429.50 ? 321  PHE B CD2   1 
ATOM   4505  C  CE1   . PHE B  2 321  ? 129.043 106.739 210.452 1.00 448.85 ? 321  PHE B CE1   1 
ATOM   4506  C  CE2   . PHE B  2 321  ? 131.270 107.594 210.325 1.00 433.83 ? 321  PHE B CE2   1 
ATOM   4507  C  CZ    . PHE B  2 321  ? 130.314 106.845 210.982 1.00 441.68 ? 321  PHE B CZ    1 
ATOM   4508  N  N     . GLY B  2 322  ? 130.611 111.507 208.213 1.00 467.30 ? 322  GLY B N     1 
ATOM   4509  C  CA    . GLY B  2 322  ? 131.380 112.272 209.185 1.00 465.17 ? 322  GLY B CA    1 
ATOM   4510  C  C     . GLY B  2 322  ? 130.668 113.535 209.638 1.00 465.96 ? 322  GLY B C     1 
ATOM   4511  O  O     . GLY B  2 322  ? 130.676 113.876 210.827 1.00 469.40 ? 322  GLY B O     1 
ATOM   4512  N  N     . ILE B  2 323  ? 130.055 114.253 208.694 1.00 550.20 ? 323  ILE B N     1 
ATOM   4513  C  CA    . ILE B  2 323  ? 129.350 115.485 209.042 1.00 547.67 ? 323  ILE B CA    1 
ATOM   4514  C  C     . ILE B  2 323  ? 128.207 115.191 210.001 1.00 551.33 ? 323  ILE B C     1 
ATOM   4515  O  O     . ILE B  2 323  ? 128.013 115.891 211.002 1.00 547.07 ? 323  ILE B O     1 
ATOM   4516  C  CB    . ILE B  2 323  ? 128.849 116.198 207.776 1.00 334.58 ? 323  ILE B CB    1 
ATOM   4517  C  CG1   . ILE B  2 323  ? 130.034 116.663 206.938 1.00 334.58 ? 323  ILE B CG1   1 
ATOM   4518  C  CG2   . ILE B  2 323  ? 127.947 117.369 208.147 1.00 334.58 ? 323  ILE B CG2   1 
ATOM   4519  C  CD1   . ILE B  2 323  ? 129.649 117.402 205.689 1.00 334.58 ? 323  ILE B CD1   1 
ATOM   4520  N  N     . VAL B  2 324  ? 127.428 114.150 209.705 1.00 623.66 ? 324  VAL B N     1 
ATOM   4521  C  CA    . VAL B  2 324  ? 126.308 113.812 210.577 1.00 627.48 ? 324  VAL B CA    1 
ATOM   4522  C  C     . VAL B  2 324  ? 126.813 113.413 211.957 1.00 627.42 ? 324  VAL B C     1 
ATOM   4523  O  O     . VAL B  2 324  ? 126.212 113.765 212.981 1.00 629.73 ? 324  VAL B O     1 
ATOM   4524  C  CB    . VAL B  2 324  ? 125.447 112.704 209.945 1.00 301.77 ? 324  VAL B CB    1 
ATOM   4525  C  CG1   . VAL B  2 324  ? 124.267 112.382 210.845 1.00 301.77 ? 324  VAL B CG1   1 
ATOM   4526  C  CG2   . VAL B  2 324  ? 124.959 113.138 208.574 1.00 301.77 ? 324  VAL B CG2   1 
ATOM   4527  N  N     . ASP B  2 325  ? 127.933 112.689 212.008 1.00 606.48 ? 325  ASP B N     1 
ATOM   4528  C  CA    . ASP B  2 325  ? 128.459 112.272 213.303 1.00 605.27 ? 325  ASP B CA    1 
ATOM   4529  C  C     . ASP B  2 325  ? 128.899 113.469 214.136 1.00 605.07 ? 325  ASP B C     1 
ATOM   4530  O  O     . ASP B  2 325  ? 128.606 113.535 215.335 1.00 607.59 ? 325  ASP B O     1 
ATOM   4531  C  CB    . ASP B  2 325  ? 129.607 111.285 213.119 1.00 391.65 ? 325  ASP B CB    1 
ATOM   4532  C  CG    . ASP B  2 325  ? 129.164 109.844 213.278 1.00 391.65 ? 325  ASP B CG    1 
ATOM   4533  O  OD1   . ASP B  2 325  ? 127.950 109.615 213.475 1.00 391.65 ? 325  ASP B OD1   1 
ATOM   4534  O  OD2   . ASP B  2 325  ? 130.025 108.945 213.217 1.00 391.65 ? 325  ASP B OD2   1 
ATOM   4535  N  N     . HIS B  2 326  ? 129.595 114.431 213.527 1.00 642.61 ? 326  HIS B N     1 
ATOM   4536  C  CA    . HIS B  2 326  ? 129.977 115.597 214.318 1.00 639.80 ? 326  HIS B CA    1 
ATOM   4537  C  C     . HIS B  2 326  ? 128.766 116.448 214.680 1.00 639.50 ? 326  HIS B C     1 
ATOM   4538  O  O     . HIS B  2 326  ? 128.764 117.093 215.731 1.00 638.84 ? 326  HIS B O     1 
ATOM   4539  C  CB    . HIS B  2 326  ? 131.028 116.447 213.599 1.00 306.29 ? 326  HIS B CB    1 
ATOM   4540  C  CG    . HIS B  2 326  ? 131.563 117.571 214.439 1.00 306.29 ? 326  HIS B CG    1 
ATOM   4541  N  ND1   . HIS B  2 326  ? 130.885 118.759 214.610 1.00 306.29 ? 326  HIS B ND1   1 
ATOM   4542  C  CD2   . HIS B  2 326  ? 132.700 117.682 215.169 1.00 306.29 ? 326  HIS B CD2   1 
ATOM   4543  C  CE1   . HIS B  2 326  ? 131.582 119.556 215.400 1.00 306.29 ? 326  HIS B CE1   1 
ATOM   4544  N  NE2   . HIS B  2 326  ? 132.689 118.926 215.754 1.00 306.29 ? 326  HIS B NE2   1 
ATOM   4545  N  N     . LEU B  2 327  ? 127.723 116.442 213.845 1.00 562.28 ? 327  LEU B N     1 
ATOM   4546  C  CA    . LEU B  2 327  ? 126.488 117.128 214.216 1.00 564.77 ? 327  LEU B CA    1 
ATOM   4547  C  C     . LEU B  2 327  ? 125.851 116.475 215.437 1.00 567.35 ? 327  LEU B C     1 
ATOM   4548  O  O     . LEU B  2 327  ? 125.266 117.161 216.284 1.00 567.81 ? 327  LEU B O     1 
ATOM   4549  C  CB    . LEU B  2 327  ? 125.510 117.145 213.041 1.00 563.16 ? 327  LEU B CB    1 
ATOM   4550  N  N     . GLY B  2 328  ? 125.952 115.149 215.540 1.00 565.69 ? 328  GLY B N     1 
ATOM   4551  C  CA    . GLY B  2 328  ? 125.438 114.464 216.714 1.00 569.74 ? 328  GLY B CA    1 
ATOM   4552  C  C     . GLY B  2 328  ? 126.224 114.758 217.976 1.00 567.28 ? 328  GLY B C     1 
ATOM   4553  O  O     . GLY B  2 328  ? 125.661 114.753 219.075 1.00 568.82 ? 328  GLY B O     1 
ATOM   4554  N  N     . LYS B  2 329  ? 127.521 115.016 217.845 1.00 555.79 ? 329  LYS B N     1 
ATOM   4555  C  CA    . LYS B  2 329  ? 128.360 115.305 219.001 1.00 561.37 ? 329  LYS B CA    1 
ATOM   4556  C  C     . LYS B  2 329  ? 128.163 116.741 219.473 1.00 562.76 ? 329  LYS B C     1 
ATOM   4557  O  O     . LYS B  2 329  ? 127.109 117.090 220.005 1.00 567.11 ? 329  LYS B O     1 
ATOM   4558  C  CB    . LYS B  2 329  ? 129.833 115.055 218.670 1.00 564.57 ? 329  LYS B CB    1 
ATOM   4559  N  N     . ASN B  2 354  ? 136.271 119.616 213.588 1.00 236.76 ? 354  ASN B N     1 
ATOM   4560  C  CA    . ASN B  2 354  ? 136.614 118.681 212.524 1.00 238.14 ? 354  ASN B CA    1 
ATOM   4561  C  C     . ASN B  2 354  ? 135.416 118.475 211.606 1.00 239.56 ? 354  ASN B C     1 
ATOM   4562  O  O     . ASN B  2 354  ? 135.206 117.385 211.080 1.00 244.12 ? 354  ASN B O     1 
ATOM   4563  C  CB    . ASN B  2 354  ? 137.074 117.346 213.113 1.00 239.91 ? 354  ASN B CB    1 
ATOM   4564  C  CG    . ASN B  2 354  ? 138.221 116.732 212.339 1.00 244.28 ? 354  ASN B CG    1 
ATOM   4565  O  OD1   . ASN B  2 354  ? 138.689 117.291 211.351 1.00 242.90 ? 354  ASN B OD1   1 
ATOM   4566  N  ND2   . ASN B  2 354  ? 138.694 115.580 212.799 1.00 246.35 ? 354  ASN B ND2   1 
ATOM   4567  N  N     . ALA B  2 355  ? 134.639 119.541 211.421 1.00 241.27 ? 355  ALA B N     1 
ATOM   4568  C  CA    . ALA B  2 355  ? 133.392 119.486 210.667 1.00 245.99 ? 355  ALA B CA    1 
ATOM   4569  C  C     . ALA B  2 355  ? 133.403 120.373 209.432 1.00 245.22 ? 355  ALA B C     1 
ATOM   4570  O  O     . ALA B  2 355  ? 132.978 119.932 208.357 1.00 246.81 ? 355  ALA B O     1 
ATOM   4571  C  CB    . ALA B  2 355  ? 132.214 119.873 211.573 1.00 255.44 ? 355  ALA B CB    1 
ATOM   4572  N  N     . TYR B  2 356  ? 133.847 121.629 209.555 1.00 258.25 ? 356  TYR B N     1 
ATOM   4573  C  CA    . TYR B  2 356  ? 133.958 122.482 208.377 1.00 254.10 ? 356  TYR B CA    1 
ATOM   4574  C  C     . TYR B  2 356  ? 134.946 121.897 207.382 1.00 251.74 ? 356  TYR B C     1 
ATOM   4575  O  O     . TYR B  2 356  ? 134.765 122.017 206.162 1.00 247.38 ? 356  TYR B O     1 
ATOM   4576  C  CB    . TYR B  2 356  ? 134.391 123.892 208.774 1.00 257.07 ? 356  TYR B CB    1 
ATOM   4577  C  CG    . TYR B  2 356  ? 133.649 124.481 209.946 1.00 264.17 ? 356  TYR B CG    1 
ATOM   4578  C  CD1   . TYR B  2 356  ? 134.100 124.280 211.244 1.00 266.85 ? 356  TYR B CD1   1 
ATOM   4579  C  CD2   . TYR B  2 356  ? 132.513 125.256 209.756 1.00 269.89 ? 356  TYR B CD2   1 
ATOM   4580  C  CE1   . TYR B  2 356  ? 133.434 124.822 212.323 1.00 270.70 ? 356  TYR B CE1   1 
ATOM   4581  C  CE2   . TYR B  2 356  ? 131.839 125.805 210.831 1.00 273.04 ? 356  TYR B CE2   1 
ATOM   4582  C  CZ    . TYR B  2 356  ? 132.305 125.585 212.113 1.00 273.91 ? 356  TYR B CZ    1 
ATOM   4583  O  OH    . TYR B  2 356  ? 131.642 126.129 213.189 1.00 273.42 ? 356  TYR B OH    1 
ATOM   4584  N  N     . VAL B  2 357  ? 136.009 121.275 207.891 1.00 258.50 ? 357  VAL B N     1 
ATOM   4585  C  CA    . VAL B  2 357  ? 136.936 120.574 207.015 1.00 257.38 ? 357  VAL B CA    1 
ATOM   4586  C  C     . VAL B  2 357  ? 136.190 119.516 206.204 1.00 261.75 ? 357  VAL B C     1 
ATOM   4587  O  O     . VAL B  2 357  ? 136.444 119.340 205.009 1.00 264.54 ? 357  VAL B O     1 
ATOM   4588  C  CB    . VAL B  2 357  ? 138.105 119.987 207.842 1.00 255.41 ? 357  VAL B CB    1 
ATOM   4589  C  CG1   . VAL B  2 357  ? 137.610 119.009 208.917 1.00 255.92 ? 357  VAL B CG1   1 
ATOM   4590  C  CG2   . VAL B  2 357  ? 139.177 119.366 206.944 1.00 255.03 ? 357  VAL B CG2   1 
ATOM   4591  N  N     . LEU B  2 358  ? 135.215 118.839 206.815 1.00 275.19 ? 358  LEU B N     1 
ATOM   4592  C  CA    . LEU B  2 358  ? 134.434 117.851 206.074 1.00 276.49 ? 358  LEU B CA    1 
ATOM   4593  C  C     . LEU B  2 358  ? 133.665 118.511 204.935 1.00 277.83 ? 358  LEU B C     1 
ATOM   4594  O  O     . LEU B  2 358  ? 133.631 117.986 203.820 1.00 279.48 ? 358  LEU B O     1 
ATOM   4595  C  CB    . LEU B  2 358  ? 133.483 117.100 207.013 1.00 280.03 ? 358  LEU B CB    1 
ATOM   4596  C  CG    . LEU B  2 358  ? 134.020 115.883 207.765 1.00 283.22 ? 358  LEU B CG    1 
ATOM   4597  C  CD1   . LEU B  2 358  ? 135.509 115.995 208.096 1.00 277.62 ? 358  LEU B CD1   1 
ATOM   4598  C  CD2   . LEU B  2 358  ? 133.209 115.735 209.030 1.00 291.16 ? 358  LEU B CD2   1 
ATOM   4599  N  N     . ALA B  2 359  ? 133.103 119.698 205.175 1.00 260.00 ? 359  ALA B N     1 
ATOM   4600  C  CA    . ALA B  2 359  ? 132.360 120.389 204.123 1.00 259.20 ? 359  ALA B CA    1 
ATOM   4601  C  C     . ALA B  2 359  ? 133.278 120.808 202.979 1.00 259.25 ? 359  ALA B C     1 
ATOM   4602  O  O     . ALA B  2 359  ? 132.950 120.611 201.802 1.00 262.95 ? 359  ALA B O     1 
ATOM   4603  C  CB    . ALA B  2 359  ? 131.634 121.600 204.704 1.00 265.80 ? 359  ALA B CB    1 
ATOM   4604  N  N     . VAL B  2 360  ? 134.432 121.395 203.305 1.00 255.03 ? 360  VAL B N     1 
ATOM   4605  C  CA    . VAL B  2 360  ? 135.351 121.858 202.266 1.00 253.74 ? 360  VAL B CA    1 
ATOM   4606  C  C     . VAL B  2 360  ? 135.876 120.681 201.452 1.00 256.63 ? 360  VAL B C     1 
ATOM   4607  O  O     . VAL B  2 360  ? 135.923 120.723 200.214 1.00 259.30 ? 360  VAL B O     1 
ATOM   4608  C  CB    . VAL B  2 360  ? 136.499 122.669 202.893 1.00 252.36 ? 360  VAL B CB    1 
ATOM   4609  C  CG1   . VAL B  2 360  ? 137.503 123.087 201.828 1.00 252.99 ? 360  VAL B CG1   1 
ATOM   4610  C  CG2   . VAL B  2 360  ? 135.950 123.882 203.625 1.00 256.39 ? 360  VAL B CG2   1 
ATOM   4611  N  N     . LEU B  2 361  ? 136.283 119.611 202.144 1.00 250.62 ? 361  LEU B N     1 
ATOM   4612  C  CA    . LEU B  2 361  ? 136.797 118.421 201.474 1.00 250.69 ? 361  LEU B CA    1 
ATOM   4613  C  C     . LEU B  2 361  ? 135.723 117.765 200.614 1.00 248.94 ? 361  LEU B C     1 
ATOM   4614  O  O     . LEU B  2 361  ? 136.009 117.296 199.506 1.00 251.35 ? 361  LEU B O     1 
ATOM   4615  C  CB    . LEU B  2 361  ? 137.342 117.440 202.516 1.00 247.66 ? 361  LEU B CB    1 
ATOM   4616  C  CG    . LEU B  2 361  ? 138.798 117.567 202.988 1.00 250.31 ? 361  LEU B CG    1 
ATOM   4617  C  CD1   . LEU B  2 361  ? 139.220 119.013 203.256 1.00 248.73 ? 361  LEU B CD1   1 
ATOM   4618  C  CD2   . LEU B  2 361  ? 138.997 116.712 204.228 1.00 260.72 ? 361  LEU B CD2   1 
ATOM   4619  N  N     . LEU B  2 362  ? 134.475 117.739 201.096 1.00 260.67 ? 362  LEU B N     1 
ATOM   4620  C  CA    . LEU B  2 362  ? 133.375 117.182 200.316 1.00 264.54 ? 362  LEU B CA    1 
ATOM   4621  C  C     . LEU B  2 362  ? 133.137 117.986 199.047 1.00 263.17 ? 362  LEU B C     1 
ATOM   4622  O  O     . LEU B  2 362  ? 132.942 117.416 197.965 1.00 263.43 ? 362  LEU B O     1 
ATOM   4623  C  CB    . LEU B  2 362  ? 132.114 117.138 201.184 1.00 265.75 ? 362  LEU B CB    1 
ATOM   4624  C  CG    . LEU B  2 362  ? 130.740 116.713 200.655 1.00 273.46 ? 362  LEU B CG    1 
ATOM   4625  C  CD1   . LEU B  2 362  ? 129.932 116.152 201.810 1.00 285.34 ? 362  LEU B CD1   1 
ATOM   4626  C  CD2   . LEU B  2 362  ? 129.978 117.867 200.005 1.00 276.31 ? 362  LEU B CD2   1 
ATOM   4627  N  N     . PHE B  2 363  ? 133.132 119.316 199.165 1.00 263.27 ? 363  PHE B N     1 
ATOM   4628  C  CA    . PHE B  2 363  ? 132.977 120.173 197.994 1.00 262.38 ? 363  PHE B CA    1 
ATOM   4629  C  C     . PHE B  2 363  ? 134.072 119.905 196.969 1.00 261.59 ? 363  PHE B C     1 
ATOM   4630  O  O     . PHE B  2 363  ? 133.797 119.730 195.771 1.00 268.25 ? 363  PHE B O     1 
ATOM   4631  C  CB    . PHE B  2 363  ? 132.988 121.636 198.433 1.00 268.98 ? 363  PHE B CB    1 
ATOM   4632  C  CG    . PHE B  2 363  ? 133.089 122.613 197.301 1.00 271.86 ? 363  PHE B CG    1 
ATOM   4633  C  CD1   . PHE B  2 363  ? 132.026 122.802 196.439 1.00 275.82 ? 363  PHE B CD1   1 
ATOM   4634  C  CD2   . PHE B  2 363  ? 134.245 123.355 197.108 1.00 273.09 ? 363  PHE B CD2   1 
ATOM   4635  C  CE1   . PHE B  2 363  ? 132.108 123.708 195.401 1.00 278.65 ? 363  PHE B CE1   1 
ATOM   4636  C  CE2   . PHE B  2 363  ? 134.338 124.264 196.068 1.00 275.37 ? 363  PHE B CE2   1 
ATOM   4637  C  CZ    . PHE B  2 363  ? 133.267 124.439 195.213 1.00 281.13 ? 363  PHE B CZ    1 
ATOM   4638  N  N     . LEU B  2 364  ? 135.331 119.876 197.428 1.00 256.88 ? 364  LEU B N     1 
ATOM   4639  C  CA    . LEU B  2 364  ? 136.444 119.575 196.531 1.00 255.77 ? 364  LEU B CA    1 
ATOM   4640  C  C     . LEU B  2 364  ? 136.253 118.223 195.859 1.00 253.44 ? 364  LEU B C     1 
ATOM   4641  O  O     . LEU B  2 364  ? 136.455 118.089 194.645 1.00 252.50 ? 364  LEU B O     1 
ATOM   4642  C  CB    . LEU B  2 364  ? 137.769 119.611 197.302 1.00 253.87 ? 364  LEU B CB    1 
ATOM   4643  C  CG    . LEU B  2 364  ? 139.117 119.591 196.564 1.00 259.72 ? 364  LEU B CG    1 
ATOM   4644  C  CD1   . LEU B  2 364  ? 140.212 120.155 197.461 1.00 268.84 ? 364  LEU B CD1   1 
ATOM   4645  C  CD2   . LEU B  2 364  ? 139.516 118.197 196.077 1.00 258.21 ? 364  LEU B CD2   1 
ATOM   4646  N  N     . ALA B  2 365  ? 135.866 117.207 196.635 1.00 259.73 ? 365  ALA B N     1 
ATOM   4647  C  CA    . ALA B  2 365  ? 135.708 115.870 196.078 1.00 258.75 ? 365  ALA B CA    1 
ATOM   4648  C  C     . ALA B  2 365  ? 134.642 115.851 194.996 1.00 262.52 ? 365  ALA B C     1 
ATOM   4649  O  O     . ALA B  2 365  ? 134.855 115.289 193.917 1.00 264.23 ? 365  ALA B O     1 
ATOM   4650  C  CB    . ALA B  2 365  ? 135.365 114.876 197.187 1.00 262.25 ? 365  ALA B CB    1 
ATOM   4651  N  N     . LEU B  2 366  ? 133.490 116.469 195.265 1.00 270.18 ? 366  LEU B N     1 
ATOM   4652  C  CA    . LEU B  2 366  ? 132.414 116.484 194.281 1.00 270.17 ? 366  LEU B CA    1 
ATOM   4653  C  C     . LEU B  2 366  ? 132.862 117.171 192.997 1.00 267.81 ? 366  LEU B C     1 
ATOM   4654  O  O     . LEU B  2 366  ? 132.660 116.641 191.892 1.00 268.79 ? 366  LEU B O     1 
ATOM   4655  C  CB    . LEU B  2 366  ? 131.178 117.167 194.870 1.00 272.07 ? 366  LEU B CB    1 
ATOM   4656  C  CG    . LEU B  2 366  ? 130.204 116.309 195.691 1.00 279.03 ? 366  LEU B CG    1 
ATOM   4657  C  CD1   . LEU B  2 366  ? 130.916 115.386 196.674 1.00 282.34 ? 366  LEU B CD1   1 
ATOM   4658  C  CD2   . LEU B  2 366  ? 129.234 117.207 196.430 1.00 291.50 ? 366  LEU B CD2   1 
ATOM   4659  N  N     . LEU B  2 367  ? 133.498 118.342 193.125 1.00 253.09 ? 367  LEU B N     1 
ATOM   4660  C  CA    . LEU B  2 367  ? 134.022 119.037 191.949 1.00 246.25 ? 367  LEU B CA    1 
ATOM   4661  C  C     . LEU B  2 367  ? 134.968 118.138 191.158 1.00 249.78 ? 367  LEU B C     1 
ATOM   4662  O  O     . LEU B  2 367  ? 134.891 118.063 189.923 1.00 253.57 ? 367  LEU B O     1 
ATOM   4663  C  CB    . LEU B  2 367  ? 134.724 120.328 192.379 1.00 240.72 ? 367  LEU B CB    1 
ATOM   4664  C  CG    . LEU B  2 367  ? 135.311 121.322 191.364 1.00 249.00 ? 367  LEU B CG    1 
ATOM   4665  C  CD1   . LEU B  2 367  ? 135.372 122.705 191.993 1.00 252.20 ? 367  LEU B CD1   1 
ATOM   4666  C  CD2   . LEU B  2 367  ? 136.702 120.913 190.888 1.00 255.20 ? 367  LEU B CD2   1 
ATOM   4667  N  N     . LEU B  2 368  ? 135.871 117.447 191.859 1.00 240.30 ? 368  LEU B N     1 
ATOM   4668  C  CA    . LEU B  2 368  ? 136.851 116.600 191.187 1.00 240.95 ? 368  LEU B CA    1 
ATOM   4669  C  C     . LEU B  2 368  ? 136.175 115.466 190.420 1.00 238.67 ? 368  LEU B C     1 
ATOM   4670  O  O     . LEU B  2 368  ? 136.538 115.176 189.269 1.00 237.67 ? 368  LEU B O     1 
ATOM   4671  C  CB    . LEU B  2 368  ? 137.842 116.052 192.215 1.00 241.85 ? 368  LEU B CB    1 
ATOM   4672  C  CG    . LEU B  2 368  ? 139.164 115.476 191.715 1.00 241.79 ? 368  LEU B CG    1 
ATOM   4673  C  CD1   . LEU B  2 368  ? 139.896 116.500 190.870 1.00 237.13 ? 368  LEU B CD1   1 
ATOM   4674  C  CD2   . LEU B  2 368  ? 140.020 115.051 192.895 1.00 249.67 ? 368  LEU B CD2   1 
ATOM   4675  N  N     . GLN B  2 369  ? 135.193 114.811 191.044 1.00 275.96 ? 369  GLN B N     1 
ATOM   4676  C  CA    . GLN B  2 369  ? 134.464 113.754 190.351 1.00 279.51 ? 369  GLN B CA    1 
ATOM   4677  C  C     . GLN B  2 369  ? 133.816 114.279 189.090 1.00 274.62 ? 369  GLN B C     1 
ATOM   4678  O  O     . GLN B  2 369  ? 133.830 113.616 188.048 1.00 275.30 ? 369  GLN B O     1 
ATOM   4679  C  CB    . GLN B  2 369  ? 133.383 113.170 191.236 1.00 286.15 ? 369  GLN B CB    1 
ATOM   4680  C  CG    . GLN B  2 369  ? 133.794 112.893 192.627 1.00 292.78 ? 369  GLN B CG    1 
ATOM   4681  C  CD    . GLN B  2 369  ? 132.605 112.660 193.516 1.00 296.62 ? 369  GLN B CD    1 
ATOM   4682  O  OE1   . GLN B  2 369  ? 131.508 112.419 193.027 1.00 293.23 ? 369  GLN B OE1   1 
ATOM   4683  N  NE2   . GLN B  2 369  ? 132.804 112.737 194.824 1.00 301.18 ? 369  GLN B NE2   1 
ATOM   4684  N  N     . ARG B  2 370  ? 133.195 115.452 189.179 1.00 246.78 ? 370  ARG B N     1 
ATOM   4685  C  CA    . ARG B  2 370  ? 132.527 115.981 187.999 1.00 245.17 ? 370  ARG B CA    1 
ATOM   4686  C  C     . ARG B  2 370  ? 133.527 116.229 186.884 1.00 243.81 ? 370  ARG B C     1 
ATOM   4687  O  O     . ARG B  2 370  ? 133.296 115.842 185.726 1.00 245.41 ? 370  ARG B O     1 
ATOM   4688  C  CB    . ARG B  2 370  ? 131.783 117.264 188.341 1.00 248.30 ? 370  ARG B CB    1 
ATOM   4689  C  CG    . ARG B  2 370  ? 130.875 117.138 189.532 1.00 258.35 ? 370  ARG B CG    1 
ATOM   4690  C  CD    . ARG B  2 370  ? 129.966 115.937 189.436 1.00 266.40 ? 370  ARG B CD    1 
ATOM   4691  N  NE    . ARG B  2 370  ? 129.298 115.712 190.708 1.00 276.18 ? 370  ARG B NE    1 
ATOM   4692  C  CZ    . ARG B  2 370  ? 129.572 114.711 191.535 1.00 277.17 ? 370  ARG B CZ    1 
ATOM   4693  N  NH1   . ARG B  2 370  ? 128.921 114.583 192.674 1.00 280.72 ? 370  ARG B NH1   1 
ATOM   4694  N  NH2   . ARG B  2 370  ? 130.484 113.812 191.196 1.00 274.70 ? 370  ARG B NH2   1 
ATOM   4695  N  N     . THR B  2 371  ? 134.657 116.855 187.220 1.00 245.26 ? 371  THR B N     1 
ATOM   4696  C  CA    . THR B  2 371  ? 135.671 117.135 186.209 1.00 242.44 ? 371  THR B CA    1 
ATOM   4697  C  C     . THR B  2 371  ? 136.109 115.854 185.510 1.00 243.99 ? 371  THR B C     1 
ATOM   4698  O  O     . THR B  2 371  ? 136.091 115.768 184.274 1.00 248.04 ? 371  THR B O     1 
ATOM   4699  C  CB    . THR B  2 371  ? 136.871 117.844 186.839 1.00 240.62 ? 371  THR B CB    1 
ATOM   4700  O  OG1   . THR B  2 371  ? 136.473 119.141 187.301 1.00 242.56 ? 371  THR B OG1   1 
ATOM   4701  C  CG2   . THR B  2 371  ? 137.994 118.000 185.818 1.00 238.04 ? 371  THR B CG2   1 
ATOM   4702  N  N     . PHE B  2 372  ? 136.462 114.827 186.290 1.00 250.41 ? 372  PHE B N     1 
ATOM   4703  C  CA    . PHE B  2 372  ? 137.007 113.619 185.676 1.00 250.95 ? 372  PHE B CA    1 
ATOM   4704  C  C     . PHE B  2 372  ? 135.943 112.826 184.920 1.00 250.83 ? 372  PHE B C     1 
ATOM   4705  O  O     . PHE B  2 372  ? 136.247 112.225 183.880 1.00 250.68 ? 372  PHE B O     1 
ATOM   4706  C  CB    . PHE B  2 372  ? 137.698 112.758 186.732 1.00 254.23 ? 372  PHE B CB    1 
ATOM   4707  C  CG    . PHE B  2 372  ? 139.107 113.198 187.039 1.00 252.31 ? 372  PHE B CG    1 
ATOM   4708  C  CD1   . PHE B  2 372  ? 139.346 114.412 187.661 1.00 259.10 ? 372  PHE B CD1   1 
ATOM   4709  C  CD2   . PHE B  2 372  ? 140.190 112.404 186.693 1.00 250.22 ? 372  PHE B CD2   1 
ATOM   4710  C  CE1   . PHE B  2 372  ? 140.637 114.825 187.936 1.00 261.30 ? 372  PHE B CE1   1 
ATOM   4711  C  CE2   . PHE B  2 372  ? 141.483 112.813 186.970 1.00 259.16 ? 372  PHE B CE2   1 
ATOM   4712  C  CZ    . PHE B  2 372  ? 141.706 114.024 187.592 1.00 262.44 ? 372  PHE B CZ    1 
ATOM   4713  N  N     . LEU B  2 373  ? 134.693 112.831 185.394 1.00 239.66 ? 373  LEU B N     1 
ATOM   4714  C  CA    . LEU B  2 373  ? 133.617 112.185 184.648 1.00 239.57 ? 373  LEU B CA    1 
ATOM   4715  C  C     . LEU B  2 373  ? 133.440 112.821 183.276 1.00 240.47 ? 373  LEU B C     1 
ATOM   4716  O  O     . LEU B  2 373  ? 133.324 112.121 182.257 1.00 244.55 ? 373  LEU B O     1 
ATOM   4717  C  CB    . LEU B  2 373  ? 132.315 112.273 185.439 1.00 245.69 ? 373  LEU B CB    1 
ATOM   4718  C  CG    . LEU B  2 373  ? 131.763 110.967 185.995 1.00 252.61 ? 373  LEU B CG    1 
ATOM   4719  C  CD1   . LEU B  2 373  ? 130.470 111.247 186.736 1.00 255.60 ? 373  LEU B CD1   1 
ATOM   4720  C  CD2   . LEU B  2 373  ? 131.541 109.980 184.868 1.00 255.75 ? 373  LEU B CD2   1 
ATOM   4721  N  N     . GLN B  2 374  ? 133.402 114.154 183.231 1.00 224.28 ? 374  GLN B N     1 
ATOM   4722  C  CA    . GLN B  2 374  ? 133.205 114.816 181.947 1.00 221.38 ? 374  GLN B CA    1 
ATOM   4723  C  C     . GLN B  2 374  ? 134.395 114.599 181.021 1.00 227.69 ? 374  GLN B C     1 
ATOM   4724  O  O     . GLN B  2 374  ? 134.217 114.430 179.806 1.00 229.08 ? 374  GLN B O     1 
ATOM   4725  C  CB    . GLN B  2 374  ? 132.930 116.301 182.160 1.00 220.37 ? 374  GLN B CB    1 
ATOM   4726  C  CG    . GLN B  2 374  ? 131.447 116.629 182.193 1.00 221.89 ? 374  GLN B CG    1 
ATOM   4727  C  CD    . GLN B  2 374  ? 130.654 115.629 183.011 1.00 222.01 ? 374  GLN B CD    1 
ATOM   4728  O  OE1   . GLN B  2 374  ? 129.821 114.899 182.478 1.00 227.77 ? 374  GLN B OE1   1 
ATOM   4729  N  NE2   . GLN B  2 374  ? 130.910 115.592 184.313 1.00 222.80 ? 374  GLN B NE2   1 
ATOM   4730  N  N     . ALA B  2 375  ? 135.614 114.581 181.567 1.00 220.88 ? 375  ALA B N     1 
ATOM   4731  C  CA    . ALA B  2 375  ? 136.777 114.292 180.728 1.00 220.21 ? 375  ALA B CA    1 
ATOM   4732  C  C     . ALA B  2 375  ? 136.705 112.882 180.147 1.00 220.64 ? 375  ALA B C     1 
ATOM   4733  O  O     . ALA B  2 375  ? 137.039 112.666 178.971 1.00 223.78 ? 375  ALA B O     1 
ATOM   4734  C  CB    . ALA B  2 375  ? 138.066 114.485 181.526 1.00 217.29 ? 375  ALA B CB    1 
ATOM   4735  N  N     . SER B  2 376  ? 136.263 111.909 180.955 1.00 231.67 ? 376  SER B N     1 
ATOM   4736  C  CA    . SER B  2 376  ? 136.105 110.541 180.466 1.00 237.16 ? 376  SER B CA    1 
ATOM   4737  C  C     . SER B  2 376  ? 135.094 110.476 179.329 1.00 235.85 ? 376  SER B C     1 
ATOM   4738  O  O     . SER B  2 376  ? 135.337 109.831 178.297 1.00 240.41 ? 376  SER B O     1 
ATOM   4739  C  CB    . SER B  2 376  ? 135.675 109.624 181.609 1.00 246.36 ? 376  SER B CB    1 
ATOM   4740  O  OG    . SER B  2 376  ? 134.975 108.495 181.112 1.00 254.64 ? 376  SER B OG    1 
ATOM   4741  N  N     . TYR B  2 377  ? 133.939 111.120 179.516 1.00 210.57 ? 377  TYR B N     1 
ATOM   4742  C  CA    . TYR B  2 377  ? 132.941 111.170 178.451 1.00 210.81 ? 377  TYR B CA    1 
ATOM   4743  C  C     . TYR B  2 377  ? 133.522 111.773 177.175 1.00 209.34 ? 377  TYR B C     1 
ATOM   4744  O  O     . TYR B  2 377  ? 133.305 111.247 176.073 1.00 215.76 ? 377  TYR B O     1 
ATOM   4745  C  CB    . TYR B  2 377  ? 131.719 111.966 178.911 1.00 213.65 ? 377  TYR B CB    1 
ATOM   4746  C  CG    . TYR B  2 377  ? 130.702 111.150 179.673 1.00 218.08 ? 377  TYR B CG    1 
ATOM   4747  C  CD1   . TYR B  2 377  ? 129.900 110.225 179.021 1.00 223.30 ? 377  TYR B CD1   1 
ATOM   4748  C  CD2   . TYR B  2 377  ? 130.534 111.314 181.040 1.00 219.21 ? 377  TYR B CD2   1 
ATOM   4749  C  CE1   . TYR B  2 377  ? 128.965 109.478 179.709 1.00 230.47 ? 377  TYR B CE1   1 
ATOM   4750  C  CE2   . TYR B  2 377  ? 129.600 110.571 181.738 1.00 221.62 ? 377  TYR B CE2   1 
ATOM   4751  C  CZ    . TYR B  2 377  ? 128.818 109.654 181.068 1.00 228.64 ? 377  TYR B CZ    1 
ATOM   4752  O  OH    . TYR B  2 377  ? 127.886 108.908 181.752 1.00 245.35 ? 377  TYR B OH    1 
ATOM   4753  N  N     . TYR B  2 378  ? 134.274 112.867 177.307 1.00 215.53 ? 378  TYR B N     1 
ATOM   4754  C  CA    . TYR B  2 378  ? 134.848 113.521 176.134 1.00 217.21 ? 378  TYR B CA    1 
ATOM   4755  C  C     . TYR B  2 378  ? 135.796 112.597 175.381 1.00 221.59 ? 378  TYR B C     1 
ATOM   4756  O  O     . TYR B  2 378  ? 135.761 112.521 174.146 1.00 225.94 ? 378  TYR B O     1 
ATOM   4757  C  CB    . TYR B  2 378  ? 135.583 114.795 176.542 1.00 217.75 ? 378  TYR B CB    1 
ATOM   4758  C  CG    . TYR B  2 378  ? 136.491 115.279 175.445 1.00 216.66 ? 378  TYR B CG    1 
ATOM   4759  C  CD1   . TYR B  2 378  ? 135.977 115.977 174.365 1.00 218.64 ? 378  TYR B CD1   1 
ATOM   4760  C  CD2   . TYR B  2 378  ? 137.855 115.011 175.469 1.00 222.60 ? 378  TYR B CD2   1 
ATOM   4761  C  CE1   . TYR B  2 378  ? 136.790 116.406 173.346 1.00 220.35 ? 378  TYR B CE1   1 
ATOM   4762  C  CE2   . TYR B  2 378  ? 138.679 115.436 174.452 1.00 225.91 ? 378  TYR B CE2   1 
ATOM   4763  C  CZ    . TYR B  2 378  ? 138.139 116.137 173.394 1.00 226.54 ? 378  TYR B CZ    1 
ATOM   4764  O  OH    . TYR B  2 378  ? 138.943 116.568 172.368 1.00 233.24 ? 378  TYR B OH    1 
ATOM   4765  N  N     . VAL B  2 379  ? 136.686 111.913 176.104 1.00 236.37 ? 379  VAL B N     1 
ATOM   4766  C  CA    . VAL B  2 379  ? 137.661 111.073 175.412 1.00 233.74 ? 379  VAL B CA    1 
ATOM   4767  C  C     . VAL B  2 379  ? 136.982 109.861 174.779 1.00 241.39 ? 379  VAL B C     1 
ATOM   4768  O  O     . VAL B  2 379  ? 137.378 109.412 173.691 1.00 250.82 ? 379  VAL B O     1 
ATOM   4769  C  CB    . VAL B  2 379  ? 138.796 110.668 176.369 1.00 232.08 ? 379  VAL B CB    1 
ATOM   4770  C  CG1   . VAL B  2 379  ? 139.754 109.707 175.685 1.00 238.15 ? 379  VAL B CG1   1 
ATOM   4771  C  CG2   . VAL B  2 379  ? 139.545 111.906 176.843 1.00 233.79 ? 379  VAL B CG2   1 
ATOM   4772  N  N     . ALA B  2 380  ? 135.945 109.321 175.428 1.00 233.24 ? 380  ALA B N     1 
ATOM   4773  C  CA    . ALA B  2 380  ? 135.163 108.265 174.790 1.00 234.21 ? 380  ALA B CA    1 
ATOM   4774  C  C     . ALA B  2 380  ? 134.551 108.751 173.482 1.00 236.25 ? 380  ALA B C     1 
ATOM   4775  O  O     . ALA B  2 380  ? 134.575 108.036 172.470 1.00 245.21 ? 380  ALA B O     1 
ATOM   4776  C  CB    . ALA B  2 380  ? 134.076 107.769 175.741 1.00 240.84 ? 380  ALA B CB    1 
ATOM   4777  N  N     . ILE B  2 381  ? 134.005 109.972 173.480 1.00 230.20 ? 381  ILE B N     1 
ATOM   4778  C  CA    . ILE B  2 381  ? 133.416 110.520 172.258 1.00 229.87 ? 381  ILE B CA    1 
ATOM   4779  C  C     . ILE B  2 381  ? 134.480 110.691 171.179 1.00 236.47 ? 381  ILE B C     1 
ATOM   4780  O  O     . ILE B  2 381  ? 134.227 110.454 169.990 1.00 246.81 ? 381  ILE B O     1 
ATOM   4781  C  CB    . ILE B  2 381  ? 132.701 111.851 172.550 1.00 223.56 ? 381  ILE B CB    1 
ATOM   4782  C  CG1   . ILE B  2 381  ? 131.578 111.659 173.574 1.00 225.68 ? 381  ILE B CG1   1 
ATOM   4783  C  CG2   . ILE B  2 381  ? 132.153 112.439 171.267 1.00 225.17 ? 381  ILE B CG2   1 
ATOM   4784  C  CD1   . ILE B  2 381  ? 130.355 110.953 173.036 1.00 230.51 ? 381  ILE B CD1   1 
ATOM   4785  N  N     . GLU B  2 382  ? 135.677 111.132 171.574 1.00 235.06 ? 382  GLU B N     1 
ATOM   4786  C  CA    . GLU B  2 382  ? 136.774 111.268 170.620 1.00 236.85 ? 382  GLU B CA    1 
ATOM   4787  C  C     . GLU B  2 382  ? 137.087 109.938 169.951 1.00 246.23 ? 382  GLU B C     1 
ATOM   4788  O  O     . GLU B  2 382  ? 137.182 109.846 168.715 1.00 259.79 ? 382  GLU B O     1 
ATOM   4789  C  CB    . GLU B  2 382  ? 138.015 111.801 171.328 1.00 234.34 ? 382  GLU B CB    1 
ATOM   4790  C  CG    . GLU B  2 382  ? 137.996 113.283 171.580 1.00 233.06 ? 382  GLU B CG    1 
ATOM   4791  C  CD    . GLU B  2 382  ? 138.401 114.083 170.359 1.00 239.10 ? 382  GLU B CD    1 
ATOM   4792  O  OE1   . GLU B  2 382  ? 137.879 113.815 169.255 1.00 241.39 ? 382  GLU B OE1   1 
ATOM   4793  O  OE2   . GLU B  2 382  ? 139.256 114.981 170.503 1.00 240.67 ? 382  GLU B OE2   1 
ATOM   4794  N  N     . THR B  2 383  ? 137.279 108.902 170.768 1.00 263.36 ? 383  THR B N     1 
ATOM   4795  C  CA    . THR B  2 383  ? 137.546 107.577 170.227 1.00 261.80 ? 383  THR B CA    1 
ATOM   4796  C  C     . THR B  2 383  ? 136.425 107.133 169.292 1.00 264.12 ? 383  THR B C     1 
ATOM   4797  O  O     . THR B  2 383  ? 136.685 106.566 168.224 1.00 275.11 ? 383  THR B O     1 
ATOM   4798  C  CB    . THR B  2 383  ? 137.738 106.585 171.372 1.00 259.40 ? 383  THR B CB    1 
ATOM   4799  O  OG1   . THR B  2 383  ? 138.888 106.963 172.139 1.00 263.97 ? 383  THR B OG1   1 
ATOM   4800  C  CG2   . THR B  2 383  ? 137.933 105.184 170.834 1.00 264.28 ? 383  THR B CG2   1 
ATOM   4801  N  N     . GLY B  2 384  ? 135.171 107.423 169.656 1.00 255.63 ? 384  GLY B N     1 
ATOM   4802  C  CA    . GLY B  2 384  ? 134.055 107.010 168.817 1.00 268.45 ? 384  GLY B CA    1 
ATOM   4803  C  C     . GLY B  2 384  ? 134.030 107.699 167.463 1.00 273.32 ? 384  GLY B C     1 
ATOM   4804  O  O     . GLY B  2 384  ? 133.778 107.060 166.434 1.00 283.08 ? 384  GLY B O     1 
ATOM   4805  N  N     . ILE B  2 385  ? 134.271 109.011 167.442 1.00 239.33 ? 385  ILE B N     1 
ATOM   4806  C  CA    . ILE B  2 385  ? 134.257 109.732 166.171 1.00 238.12 ? 385  ILE B CA    1 
ATOM   4807  C  C     . ILE B  2 385  ? 135.402 109.268 165.282 1.00 246.22 ? 385  ILE B C     1 
ATOM   4808  O  O     . ILE B  2 385  ? 135.243 109.130 164.060 1.00 250.66 ? 385  ILE B O     1 
ATOM   4809  C  CB    . ILE B  2 385  ? 134.296 111.252 166.400 1.00 232.48 ? 385  ILE B CB    1 
ATOM   4810  C  CG1   . ILE B  2 385  ? 133.010 111.714 167.085 1.00 229.97 ? 385  ILE B CG1   1 
ATOM   4811  C  CG2   . ILE B  2 385  ? 134.496 111.992 165.079 1.00 242.00 ? 385  ILE B CG2   1 
ATOM   4812  C  CD1   . ILE B  2 385  ? 132.955 113.198 167.369 1.00 233.13 ? 385  ILE B CD1   1 
ATOM   4813  N  N     . ASN B  2 386  ? 136.569 109.004 165.877 1.00 240.61 ? 386  ASN B N     1 
ATOM   4814  C  CA    . ASN B  2 386  ? 137.667 108.472 165.074 1.00 240.28 ? 386  ASN B CA    1 
ATOM   4815  C  C     . ASN B  2 386  ? 137.329 107.089 164.522 1.00 245.97 ? 386  ASN B C     1 
ATOM   4816  O  O     . ASN B  2 386  ? 137.644 106.787 163.362 1.00 251.85 ? 386  ASN B O     1 
ATOM   4817  C  CB    . ASN B  2 386  ? 138.955 108.439 165.896 1.00 243.47 ? 386  ASN B CB    1 
ATOM   4818  C  CG    . ASN B  2 386  ? 139.621 109.798 165.984 1.00 245.56 ? 386  ASN B CG    1 
ATOM   4819  O  OD1   . ASN B  2 386  ? 139.546 110.597 165.050 1.00 247.11 ? 386  ASN B OD1   1 
ATOM   4820  N  ND2   . ASN B  2 386  ? 140.280 110.068 167.108 1.00 241.04 ? 386  ASN B ND2   1 
ATOM   4821  N  N     . LEU B  2 387  ? 136.682 106.239 165.330 1.00 248.32 ? 387  LEU B N     1 
ATOM   4822  C  CA    . LEU B  2 387  ? 136.204 104.949 164.832 1.00 255.62 ? 387  LEU B CA    1 
ATOM   4823  C  C     . LEU B  2 387  ? 135.300 105.132 163.628 1.00 258.80 ? 387  LEU B C     1 
ATOM   4824  O  O     . LEU B  2 387  ? 135.450 104.450 162.606 1.00 265.68 ? 387  LEU B O     1 
ATOM   4825  C  CB    . LEU B  2 387  ? 135.443 104.191 165.924 1.00 259.34 ? 387  LEU B CB    1 
ATOM   4826  C  CG    . LEU B  2 387  ? 134.494 103.102 165.399 1.00 265.96 ? 387  LEU B CG    1 
ATOM   4827  C  CD1   . LEU B  2 387  ? 135.050 101.690 165.583 1.00 269.39 ? 387  LEU B CD1   1 
ATOM   4828  C  CD2   . LEU B  2 387  ? 133.105 103.232 166.019 1.00 265.12 ? 387  LEU B CD2   1 
ATOM   4829  N  N     . ARG B  2 388  ? 134.323 106.032 163.752 1.00 240.23 ? 388  ARG B N     1 
ATOM   4830  C  CA    . ARG B  2 388  ? 133.377 106.249 162.665 1.00 238.03 ? 388  ARG B CA    1 
ATOM   4831  C  C     . ARG B  2 388  ? 134.098 106.661 161.393 1.00 244.49 ? 388  ARG B C     1 
ATOM   4832  O  O     . ARG B  2 388  ? 133.864 106.089 160.322 1.00 251.94 ? 388  ARG B O     1 
ATOM   4833  C  CB    . ARG B  2 388  ? 132.353 107.309 163.050 1.00 237.71 ? 388  ARG B CB    1 
ATOM   4834  C  CG    . ARG B  2 388  ? 131.605 107.834 161.850 1.00 235.62 ? 388  ARG B CG    1 
ATOM   4835  C  CD    . ARG B  2 388  ? 130.518 108.783 162.260 1.00 238.26 ? 388  ARG B CD    1 
ATOM   4836  N  NE    . ARG B  2 388  ? 130.917 110.177 162.138 1.00 234.28 ? 388  ARG B NE    1 
ATOM   4837  C  CZ    . ARG B  2 388  ? 130.141 111.197 162.483 1.00 231.89 ? 388  ARG B CZ    1 
ATOM   4838  N  NH1   . ARG B  2 388  ? 128.928 110.970 162.975 1.00 236.58 ? 388  ARG B NH1   1 
ATOM   4839  N  NH2   . ARG B  2 388  ? 130.576 112.442 162.337 1.00 225.29 ? 388  ARG B NH2   1 
ATOM   4840  N  N     . GLY B  2 389  ? 134.975 107.662 161.495 1.00 232.01 ? 389  GLY B N     1 
ATOM   4841  C  CA    . GLY B  2 389  ? 135.721 108.098 160.324 1.00 234.68 ? 389  GLY B CA    1 
ATOM   4842  C  C     . GLY B  2 389  ? 136.505 106.969 159.681 1.00 244.91 ? 389  GLY B C     1 
ATOM   4843  O  O     . GLY B  2 389  ? 136.454 106.772 158.460 1.00 252.28 ? 389  GLY B O     1 
ATOM   4844  N  N     . ALA B  2 390  ? 137.219 106.189 160.504 1.00 237.41 ? 390  ALA B N     1 
ATOM   4845  C  CA    . ALA B  2 390  ? 138.090 105.150 159.966 1.00 246.95 ? 390  ALA B CA    1 
ATOM   4846  C  C     . ALA B  2 390  ? 137.291 104.056 159.272 1.00 252.05 ? 390  ALA B C     1 
ATOM   4847  O  O     . ALA B  2 390  ? 137.636 103.639 158.160 1.00 259.30 ? 390  ALA B O     1 
ATOM   4848  C  CB    . ALA B  2 390  ? 138.954 104.566 161.080 1.00 251.73 ? 390  ALA B CB    1 
ATOM   4849  N  N     . ILE B  2 391  ? 136.218 103.574 159.904 1.00 234.60 ? 391  ILE B N     1 
ATOM   4850  C  CA    . ILE B  2 391  ? 135.465 102.497 159.265 1.00 236.96 ? 391  ILE B CA    1 
ATOM   4851  C  C     . ILE B  2 391  ? 134.704 103.020 158.048 1.00 242.51 ? 391  ILE B C     1 
ATOM   4852  O  O     . ILE B  2 391  ? 134.525 102.291 157.062 1.00 250.78 ? 391  ILE B O     1 
ATOM   4853  C  CB    . ILE B  2 391  ? 134.537 101.781 160.269 1.00 235.00 ? 391  ILE B CB    1 
ATOM   4854  C  CG1   . ILE B  2 391  ? 133.372 102.677 160.704 1.00 236.20 ? 391  ILE B CG1   1 
ATOM   4855  C  CG2   . ILE B  2 391  ? 135.331 101.279 161.470 1.00 236.60 ? 391  ILE B CG2   1 
ATOM   4856  C  CD1   . ILE B  2 391  ? 132.034 102.290 160.088 1.00 233.74 ? 391  ILE B CD1   1 
ATOM   4857  N  N     . GLN B  2 392  ? 134.279 104.290 158.064 1.00 242.05 ? 392  GLN B N     1 
ATOM   4858  C  CA    . GLN B  2 392  ? 133.644 104.865 156.882 1.00 239.93 ? 392  GLN B CA    1 
ATOM   4859  C  C     . GLN B  2 392  ? 134.596 104.854 155.697 1.00 249.04 ? 392  GLN B C     1 
ATOM   4860  O  O     . GLN B  2 392  ? 134.245 104.378 154.609 1.00 258.60 ? 392  GLN B O     1 
ATOM   4861  C  CB    . GLN B  2 392  ? 133.170 106.290 157.172 1.00 234.16 ? 392  GLN B CB    1 
ATOM   4862  C  CG    . GLN B  2 392  ? 131.790 106.373 157.797 1.00 235.45 ? 392  GLN B CG    1 
ATOM   4863  C  CD    . GLN B  2 392  ? 131.455 107.772 158.285 1.00 234.42 ? 392  GLN B CD    1 
ATOM   4864  O  OE1   . GLN B  2 392  ? 132.265 108.693 158.174 1.00 231.23 ? 392  GLN B OE1   1 
ATOM   4865  N  NE2   . GLN B  2 392  ? 130.255 107.937 158.834 1.00 237.02 ? 392  GLN B NE2   1 
ATOM   4866  N  N     . THR B  2 393  ? 135.815 105.363 155.886 1.00 237.75 ? 393  THR B N     1 
ATOM   4867  C  CA    . THR B  2 393  ? 136.737 105.381 154.755 1.00 241.53 ? 393  THR B CA    1 
ATOM   4868  C  C     . THR B  2 393  ? 137.189 103.976 154.371 1.00 249.39 ? 393  THR B C     1 
ATOM   4869  O  O     . THR B  2 393  ? 137.447 103.717 153.190 1.00 254.32 ? 393  THR B O     1 
ATOM   4870  C  CB    . THR B  2 393  ? 137.945 106.275 155.038 1.00 243.44 ? 393  THR B CB    1 
ATOM   4871  O  OG1   . THR B  2 393  ? 138.971 106.010 154.072 1.00 244.95 ? 393  THR B OG1   1 
ATOM   4872  C  CG2   . THR B  2 393  ? 138.490 106.025 156.410 1.00 247.90 ? 393  THR B CG2   1 
ATOM   4873  N  N     . LYS B  2 394  ? 137.252 103.047 155.328 1.00 246.73 ? 394  LYS B N     1 
ATOM   4874  C  CA    . LYS B  2 394  ? 137.623 101.677 154.981 1.00 250.91 ? 394  LYS B CA    1 
ATOM   4875  C  C     . LYS B  2 394  ? 136.568 101.039 154.086 1.00 252.18 ? 394  LYS B C     1 
ATOM   4876  O  O     . LYS B  2 394  ? 136.895 100.442 153.051 1.00 255.87 ? 394  LYS B O     1 
ATOM   4877  C  CB    . LYS B  2 394  ? 137.833 100.848 156.247 1.00 253.91 ? 394  LYS B CB    1 
ATOM   4878  C  CG    . LYS B  2 394  ? 138.511 99.513  155.999 1.00 268.87 ? 394  LYS B CG    1 
ATOM   4879  C  CD    . LYS B  2 394  ? 138.876 98.831  157.308 1.00 287.19 ? 394  LYS B CD    1 
ATOM   4880  C  CE    . LYS B  2 394  ? 139.715 97.583  157.078 1.00 309.48 ? 394  LYS B CE    1 
ATOM   4881  N  NZ    . LYS B  2 394  ? 140.146 96.964  158.364 1.00 317.73 ? 394  LYS B NZ    1 
ATOM   4882  N  N     . ILE B  2 395  ? 135.288 101.177 154.451 1.00 251.55 ? 395  ILE B N     1 
ATOM   4883  C  CA    . ILE B  2 395  ? 134.247 100.582 153.623 1.00 247.78 ? 395  ILE B CA    1 
ATOM   4884  C  C     . ILE B  2 395  ? 134.120 101.320 152.300 1.00 250.60 ? 395  ILE B C     1 
ATOM   4885  O  O     . ILE B  2 395  ? 133.781 100.709 151.281 1.00 256.16 ? 395  ILE B O     1 
ATOM   4886  C  CB    . ILE B  2 395  ? 132.895 100.521 154.358 1.00 247.60 ? 395  ILE B CB    1 
ATOM   4887  C  CG1   . ILE B  2 395  ? 132.243 101.899 154.467 1.00 245.50 ? 395  ILE B CG1   1 
ATOM   4888  C  CG2   . ILE B  2 395  ? 133.071 99.912  155.728 1.00 255.87 ? 395  ILE B CG2   1 
ATOM   4889  C  CD1   . ILE B  2 395  ? 130.903 101.874 155.166 1.00 249.90 ? 395  ILE B CD1   1 
ATOM   4890  N  N     . TYR B  2 396  ? 134.420 102.621 152.265 1.00 254.51 ? 396  TYR B N     1 
ATOM   4891  C  CA    . TYR B  2 396  ? 134.365 103.310 150.980 1.00 250.82 ? 396  TYR B CA    1 
ATOM   4892  C  C     . TYR B  2 396  ? 135.496 102.870 150.062 1.00 253.45 ? 396  TYR B C     1 
ATOM   4893  O  O     . TYR B  2 396  ? 135.303 102.772 148.844 1.00 257.13 ? 396  TYR B O     1 
ATOM   4894  C  CB    . TYR B  2 396  ? 134.410 104.820 151.161 1.00 249.64 ? 396  TYR B CB    1 
ATOM   4895  C  CG    . TYR B  2 396  ? 134.413 105.519 149.828 1.00 247.15 ? 396  TYR B CG    1 
ATOM   4896  C  CD1   . TYR B  2 396  ? 133.249 105.621 149.080 1.00 245.54 ? 396  TYR B CD1   1 
ATOM   4897  C  CD2   . TYR B  2 396  ? 135.583 106.034 149.295 1.00 243.66 ? 396  TYR B CD2   1 
ATOM   4898  C  CE1   . TYR B  2 396  ? 133.244 106.243 147.853 1.00 242.88 ? 396  TYR B CE1   1 
ATOM   4899  C  CE2   . TYR B  2 396  ? 135.590 106.656 148.064 1.00 241.21 ? 396  TYR B CE2   1 
ATOM   4900  C  CZ    . TYR B  2 396  ? 134.418 106.757 147.349 1.00 241.65 ? 396  TYR B CZ    1 
ATOM   4901  O  OH    . TYR B  2 396  ? 134.425 107.376 146.126 1.00 241.20 ? 396  TYR B OH    1 
ATOM   4902  N  N     . ASN B  2 397  ? 136.681 102.606 150.619 1.00 246.41 ? 397  ASN B N     1 
ATOM   4903  C  CA    . ASN B  2 397  ? 137.756 102.056 149.802 1.00 249.49 ? 397  ASN B CA    1 
ATOM   4904  C  C     . ASN B  2 397  ? 137.406 100.659 149.309 1.00 254.43 ? 397  ASN B C     1 
ATOM   4905  O  O     . ASN B  2 397  ? 137.728 100.298 148.170 1.00 255.21 ? 397  ASN B O     1 
ATOM   4906  C  CB    . ASN B  2 397  ? 139.060 102.026 150.591 1.00 253.91 ? 397  ASN B CB    1 
ATOM   4907  C  CG    . ASN B  2 397  ? 140.136 101.226 149.889 1.00 251.63 ? 397  ASN B CG    1 
ATOM   4908  O  OD1   . ASN B  2 397  ? 140.307 100.034 150.144 1.00 255.01 ? 397  ASN B OD1   1 
ATOM   4909  N  ND2   . ASN B  2 397  ? 140.853 101.873 148.978 1.00 251.45 ? 397  ASN B ND2   1 
ATOM   4910  N  N     . LYS B  2 398  ? 136.746 99.861  150.151 1.00 260.75 ? 398  LYS B N     1 
ATOM   4911  C  CA    . LYS B  2 398  ? 136.403 98.505  149.745 1.00 260.46 ? 398  LYS B CA    1 
ATOM   4912  C  C     . LYS B  2 398  ? 135.261 98.466  148.734 1.00 263.10 ? 398  LYS B C     1 
ATOM   4913  O  O     . LYS B  2 398  ? 135.166 97.507  147.960 1.00 267.41 ? 398  LYS B O     1 
ATOM   4914  C  CB    . LYS B  2 398  ? 136.049 97.665  150.971 1.00 264.39 ? 398  LYS B CB    1 
ATOM   4915  C  CG    . LYS B  2 398  ? 135.995 96.179  150.687 1.00 274.93 ? 398  LYS B CG    1 
ATOM   4916  C  CD    . LYS B  2 398  ? 135.090 95.485  151.670 1.00 281.22 ? 398  LYS B CD    1 
ATOM   4917  C  CE    . LYS B  2 398  ? 133.737 96.177  151.763 1.00 290.23 ? 398  LYS B CE    1 
ATOM   4918  N  NZ    . LYS B  2 398  ? 133.060 96.306  150.439 1.00 292.11 ? 398  LYS B NZ    1 
ATOM   4919  N  N     . ILE B  2 399  ? 134.389 99.478  148.721 1.00 264.71 ? 399  ILE B N     1 
ATOM   4920  C  CA    . ILE B  2 399  ? 133.339 99.521  147.701 1.00 262.61 ? 399  ILE B CA    1 
ATOM   4921  C  C     . ILE B  2 399  ? 133.951 99.559  146.308 1.00 265.96 ? 399  ILE B C     1 
ATOM   4922  O  O     . ILE B  2 399  ? 133.362 99.046  145.349 1.00 268.08 ? 399  ILE B O     1 
ATOM   4923  C  CB    . ILE B  2 399  ? 132.390 100.715 147.945 1.00 260.35 ? 399  ILE B CB    1 
ATOM   4924  C  CG1   . ILE B  2 399  ? 131.523 100.458 149.178 1.00 258.50 ? 399  ILE B CG1   1 
ATOM   4925  C  CG2   . ILE B  2 399  ? 131.476 100.963 146.748 1.00 263.86 ? 399  ILE B CG2   1 
ATOM   4926  C  CD1   . ILE B  2 399  ? 130.520 101.541 149.453 1.00 266.64 ? 399  ILE B CD1   1 
ATOM   4927  N  N     . MET B  2 400  ? 135.155 100.115 146.183 1.00 263.82 ? 400  MET B N     1 
ATOM   4928  C  CA    . MET B  2 400  ? 135.824 100.180 144.887 1.00 263.41 ? 400  MET B CA    1 
ATOM   4929  C  C     . MET B  2 400  ? 136.105 98.785  144.346 1.00 266.58 ? 400  MET B C     1 
ATOM   4930  O  O     . MET B  2 400  ? 135.647 98.422  143.258 1.00 269.07 ? 400  MET B O     1 
ATOM   4931  C  CB    . MET B  2 400  ? 137.115 100.990 145.008 1.00 264.71 ? 400  MET B CB    1 
ATOM   4932  C  CG    . MET B  2 400  ? 136.901 102.406 145.509 1.00 264.93 ? 400  MET B CG    1 
ATOM   4933  S  SD    . MET B  2 400  ? 135.442 103.185 144.781 1.00 276.57 ? 400  MET B SD    1 
ATOM   4934  C  CE    . MET B  2 400  ? 135.870 103.217 143.039 1.00 271.83 ? 400  MET B CE    1 
ATOM   4935  N  N     . HIS B  2 401  ? 136.855 97.983  145.100 1.00 258.49 ? 401  HIS B N     1 
ATOM   4936  C  CA    . HIS B  2 401  ? 137.221 96.647  144.650 1.00 260.83 ? 401  HIS B CA    1 
ATOM   4937  C  C     . HIS B  2 401  ? 136.033 95.694  144.587 1.00 264.61 ? 401  HIS B C     1 
ATOM   4938  O  O     . HIS B  2 401  ? 136.191 94.573  144.092 1.00 265.43 ? 401  HIS B O     1 
ATOM   4939  C  CB    . HIS B  2 401  ? 138.304 96.069  145.563 1.00 262.52 ? 401  HIS B CB    1 
ATOM   4940  C  CG    . HIS B  2 401  ? 139.559 96.883  145.598 1.00 262.27 ? 401  HIS B CG    1 
ATOM   4941  N  ND1   . HIS B  2 401  ? 139.563 98.241  145.843 1.00 263.37 ? 401  HIS B ND1   1 
ATOM   4942  C  CD2   . HIS B  2 401  ? 140.855 96.531  145.422 1.00 262.61 ? 401  HIS B CD2   1 
ATOM   4943  C  CE1   . HIS B  2 401  ? 140.806 98.690  145.813 1.00 261.83 ? 401  HIS B CE1   1 
ATOM   4944  N  NE2   . HIS B  2 401  ? 141.610 97.672  145.559 1.00 261.85 ? 401  HIS B NE2   1 
ATOM   4945  N  N     . LEU B  2 402  ? 134.863 96.104  145.073 1.00 275.14 ? 402  LEU B N     1 
ATOM   4946  C  CA    . LEU B  2 402  ? 133.683 95.253  144.995 1.00 281.98 ? 402  LEU B CA    1 
ATOM   4947  C  C     . LEU B  2 402  ? 133.294 95.023  143.541 1.00 290.10 ? 402  LEU B C     1 
ATOM   4948  O  O     . LEU B  2 402  ? 133.303 95.948  142.726 1.00 288.22 ? 402  LEU B O     1 
ATOM   4949  C  CB    . LEU B  2 402  ? 132.519 95.883  145.763 1.00 282.06 ? 402  LEU B CB    1 
ATOM   4950  C  CG    . LEU B  2 402  ? 131.143 95.223  145.627 1.00 282.23 ? 402  LEU B CG    1 
ATOM   4951  C  CD1   . LEU B  2 402  ? 130.491 95.038  146.990 1.00 285.66 ? 402  LEU B CD1   1 
ATOM   4952  C  CD2   . LEU B  2 402  ? 130.235 96.036  144.713 1.00 284.21 ? 402  LEU B CD2   1 
ATOM   4953  N  N     . SER B  2 403  ? 132.955 93.780  143.219 1.00 272.16 ? 403  SER B N     1 
ATOM   4954  C  CA    . SER B  2 403  ? 132.554 93.420  141.869 1.00 274.46 ? 403  SER B CA    1 
ATOM   4955  C  C     . SER B  2 403  ? 131.049 93.576  141.698 1.00 281.90 ? 403  SER B C     1 
ATOM   4956  O  O     . SER B  2 403  ? 130.273 93.405  142.643 1.00 285.74 ? 403  SER B O     1 
ATOM   4957  C  CB    . SER B  2 403  ? 132.975 91.985  141.544 1.00 277.15 ? 403  SER B CB    1 
ATOM   4958  O  OG    . SER B  2 403  ? 134.386 91.858  141.540 1.00 268.41 ? 403  SER B OG    1 
ATOM   4959  N  N     . THR B  2 404  ? 130.642 93.913  140.472 1.00 281.38 ? 404  THR B N     1 
ATOM   4960  C  CA    . THR B  2 404  ? 129.229 94.131  140.185 1.00 284.56 ? 404  THR B CA    1 
ATOM   4961  C  C     . THR B  2 404  ? 128.422 92.840  140.244 1.00 293.49 ? 404  THR B C     1 
ATOM   4962  O  O     . THR B  2 404  ? 127.189 92.895  140.315 1.00 296.73 ? 404  THR B O     1 
ATOM   4963  C  CB    . THR B  2 404  ? 129.063 94.792  138.812 1.00 282.21 ? 404  THR B CB    1 
ATOM   4964  O  OG1   . THR B  2 404  ? 130.125 95.731  138.604 1.00 281.02 ? 404  THR B OG1   1 
ATOM   4965  C  CG2   . THR B  2 404  ? 127.734 95.531  138.725 1.00 282.03 ? 404  THR B CG2   1 
ATOM   4966  N  N     . SER B  2 405  ? 129.085 91.680  140.219 1.00 296.19 ? 405  SER B N     1 
ATOM   4967  C  CA    . SER B  2 405  ? 128.365 90.426  140.415 1.00 296.19 ? 405  SER B CA    1 
ATOM   4968  C  C     . SER B  2 405  ? 127.822 90.313  141.829 1.00 296.19 ? 405  SER B C     1 
ATOM   4969  O  O     . SER B  2 405  ? 126.810 89.641  142.049 1.00 296.19 ? 405  SER B O     1 
ATOM   4970  C  CB    . SER B  2 405  ? 129.268 89.235  140.101 1.00 296.19 ? 405  SER B CB    1 
ATOM   4971  O  OG    . SER B  2 405  ? 129.538 89.156  138.714 1.00 296.19 ? 405  SER B OG    1 
ATOM   4972  N  N     . ASN B  2 406  ? 128.478 90.947  142.801 1.00 305.11 ? 406  ASN B N     1 
ATOM   4973  C  CA    . ASN B  2 406  ? 127.862 91.081  144.114 1.00 305.11 ? 406  ASN B CA    1 
ATOM   4974  C  C     . ASN B  2 406  ? 126.746 92.116  144.085 1.00 305.11 ? 406  ASN B C     1 
ATOM   4975  O  O     . ASN B  2 406  ? 125.687 91.915  144.693 1.00 305.11 ? 406  ASN B O     1 
ATOM   4976  C  CB    . ASN B  2 406  ? 128.916 91.456  145.153 1.00 305.11 ? 406  ASN B CB    1 
ATOM   4977  C  CG    . ASN B  2 406  ? 129.968 90.384  145.326 1.00 305.11 ? 406  ASN B CG    1 
ATOM   4978  O  OD1   . ASN B  2 406  ? 131.153 90.613  145.089 1.00 305.11 ? 406  ASN B OD1   1 
ATOM   4979  N  ND2   . ASN B  2 406  ? 129.535 89.196  145.738 1.00 305.11 ? 406  ASN B ND2   1 
ATOM   4980  N  N     . LEU B  2 407  ? 126.963 93.223  143.369 1.00 303.69 ? 407  LEU B N     1 
ATOM   4981  C  CA    . LEU B  2 407  ? 125.952 94.271  143.281 1.00 303.69 ? 407  LEU B CA    1 
ATOM   4982  C  C     . LEU B  2 407  ? 124.640 93.746  142.709 1.00 303.69 ? 407  LEU B C     1 
ATOM   4983  O  O     . LEU B  2 407  ? 123.564 94.224  143.083 1.00 303.69 ? 407  LEU B O     1 
ATOM   4984  C  CB    . LEU B  2 407  ? 126.483 95.424  142.427 1.00 303.69 ? 407  LEU B CB    1 
ATOM   4985  C  CG    . LEU B  2 407  ? 125.743 96.762  142.506 1.00 303.69 ? 407  LEU B CG    1 
ATOM   4986  C  CD1   . LEU B  2 407  ? 126.073 97.486  143.805 1.00 303.69 ? 407  LEU B CD1   1 
ATOM   4987  C  CD2   . LEU B  2 407  ? 126.056 97.639  141.297 1.00 303.69 ? 407  LEU B CD2   1 
ATOM   4988  N  N     . SER B  2 408  ? 124.710 92.767  141.802 1.00 310.24 ? 408  SER B N     1 
ATOM   4989  C  CA    . SER B  2 408  ? 123.497 92.138  141.289 1.00 310.24 ? 408  SER B CA    1 
ATOM   4990  C  C     . SER B  2 408  ? 122.751 91.381  142.382 1.00 310.24 ? 408  SER B C     1 
ATOM   4991  O  O     . SER B  2 408  ? 121.516 91.321  142.362 1.00 310.24 ? 408  SER B O     1 
ATOM   4992  C  CB    . SER B  2 408  ? 123.841 91.201  140.130 1.00 310.24 ? 408  SER B CB    1 
ATOM   4993  O  OG    . SER B  2 408  ? 124.606 90.097  140.576 1.00 310.24 ? 408  SER B OG    1 
ATOM   4994  N  N     . MET B  2 409  ? 123.474 90.801  143.337 1.00 303.03 ? 409  MET B N     1 
ATOM   4995  C  CA    . MET B  2 409  ? 122.851 90.042  144.412 1.00 303.03 ? 409  MET B CA    1 
ATOM   4996  C  C     . MET B  2 409  ? 122.294 90.976  145.485 1.00 303.03 ? 409  MET B C     1 
ATOM   4997  O  O     . MET B  2 409  ? 122.623 92.162  145.546 1.00 303.03 ? 409  MET B O     1 
ATOM   4998  C  CB    . MET B  2 409  ? 123.847 89.060  145.035 1.00 303.03 ? 409  MET B CB    1 
ATOM   4999  C  CG    . MET B  2 409  ? 124.662 88.267  144.024 1.00 303.03 ? 409  MET B CG    1 
ATOM   5000  S  SD    . MET B  2 409  ? 123.671 87.576  142.685 1.00 303.03 ? 409  MET B SD    1 
ATOM   5001  C  CE    . MET B  2 409  ? 122.539 86.534  143.604 1.00 303.03 ? 409  MET B CE    1 
ATOM   5002  N  N     . GLY B  2 410  ? 121.432 90.416  146.337 1.00 299.77 ? 410  GLY B N     1 
ATOM   5003  C  CA    . GLY B  2 410  ? 120.796 91.216  147.372 1.00 299.77 ? 410  GLY B CA    1 
ATOM   5004  C  C     . GLY B  2 410  ? 121.760 91.689  148.443 1.00 299.77 ? 410  GLY B C     1 
ATOM   5005  O  O     . GLY B  2 410  ? 121.508 92.697  149.111 1.00 299.77 ? 410  GLY B O     1 
ATOM   5006  N  N     . GLU B  2 411  ? 122.877 90.981  148.618 1.00 303.13 ? 411  GLU B N     1 
ATOM   5007  C  CA    . GLU B  2 411  ? 123.826 91.346  149.665 1.00 303.13 ? 411  GLU B CA    1 
ATOM   5008  C  C     . GLU B  2 411  ? 124.463 92.708  149.403 1.00 303.13 ? 411  GLU B C     1 
ATOM   5009  O  O     . GLU B  2 411  ? 124.676 93.485  150.342 1.00 303.13 ? 411  GLU B O     1 
ATOM   5010  C  CB    . GLU B  2 411  ? 124.897 90.267  149.799 1.00 303.13 ? 411  GLU B CB    1 
ATOM   5011  N  N     . MET B  2 412  ? 124.780 93.029  148.148 1.00 299.47 ? 412  MET B N     1 
ATOM   5012  C  CA    . MET B  2 412  ? 125.352 94.335  147.838 1.00 299.47 ? 412  MET B CA    1 
ATOM   5013  C  C     . MET B  2 412  ? 124.314 95.306  147.275 1.00 299.47 ? 412  MET B C     1 
ATOM   5014  O  O     . MET B  2 412  ? 124.639 96.139  146.420 1.00 299.47 ? 412  MET B O     1 
ATOM   5015  C  CB    . MET B  2 412  ? 126.540 94.193  146.883 1.00 299.47 ? 412  MET B CB    1 
ATOM   5016  N  N     . THR B  2 413  ? 123.069 95.213  147.741 1.00 292.65 ? 413  THR B N     1 
ATOM   5017  C  CA    . THR B  2 413  ? 122.046 96.181  147.364 1.00 292.65 ? 413  THR B CA    1 
ATOM   5018  C  C     . THR B  2 413  ? 122.480 97.586  147.777 1.00 292.65 ? 413  THR B C     1 
ATOM   5019  O  O     . THR B  2 413  ? 123.031 97.788  148.862 1.00 292.65 ? 413  THR B O     1 
ATOM   5020  C  CB    . THR B  2 413  ? 120.712 95.811  148.022 1.00 292.65 ? 413  THR B CB    1 
ATOM   5021  O  OG1   . THR B  2 413  ? 120.281 94.533  147.538 1.00 292.65 ? 413  THR B OG1   1 
ATOM   5022  C  CG2   . THR B  2 413  ? 119.638 96.844  147.713 1.00 292.65 ? 413  THR B CG2   1 
ATOM   5023  N  N     . ALA B  2 414  ? 122.249 98.558  146.889 1.00 291.93 ? 414  ALA B N     1 
ATOM   5024  C  CA    . ALA B  2 414  ? 122.650 99.934  147.170 1.00 291.93 ? 414  ALA B CA    1 
ATOM   5025  C  C     . ALA B  2 414  ? 121.989 100.448 148.444 1.00 291.93 ? 414  ALA B C     1 
ATOM   5026  O  O     . ALA B  2 414  ? 122.653 101.028 149.316 1.00 291.93 ? 414  ALA B O     1 
ATOM   5027  C  CB    . ALA B  2 414  ? 122.307 100.836 145.982 1.00 291.93 ? 414  ALA B CB    1 
ATOM   5028  N  N     . GLY B  2 415  ? 120.675 100.249 148.562 1.00 294.69 ? 415  GLY B N     1 
ATOM   5029  C  CA    . GLY B  2 415  ? 119.994 100.605 149.795 1.00 294.69 ? 415  GLY B CA    1 
ATOM   5030  C  C     . GLY B  2 415  ? 120.581 99.897  150.998 1.00 294.69 ? 415  GLY B C     1 
ATOM   5031  O  O     . GLY B  2 415  ? 120.707 100.486 152.076 1.00 294.69 ? 415  GLY B O     1 
ATOM   5032  N  N     . GLN B  2 416  ? 120.971 98.631  150.825 1.00 288.77 ? 416  GLN B N     1 
ATOM   5033  C  CA    . GLN B  2 416  ? 121.606 97.890  151.909 1.00 288.77 ? 416  GLN B CA    1 
ATOM   5034  C  C     . GLN B  2 416  ? 122.930 98.529  152.313 1.00 288.77 ? 416  GLN B C     1 
ATOM   5035  O  O     . GLN B  2 416  ? 123.245 98.623  153.502 1.00 288.77 ? 416  GLN B O     1 
ATOM   5036  C  CB    . GLN B  2 416  ? 121.817 96.436  151.498 1.00 288.77 ? 416  GLN B CB    1 
ATOM   5037  C  CG    . GLN B  2 416  ? 122.269 95.536  152.628 1.00 288.77 ? 416  GLN B CG    1 
ATOM   5038  C  CD    . GLN B  2 416  ? 121.252 95.466  153.747 1.00 288.77 ? 416  GLN B CD    1 
ATOM   5039  O  OE1   . GLN B  2 416  ? 120.082 95.153  153.520 1.00 288.77 ? 416  GLN B OE1   1 
ATOM   5040  N  NE2   . GLN B  2 416  ? 121.689 95.770  154.965 1.00 288.77 ? 416  GLN B NE2   1 
ATOM   5041  N  N     . ILE B  2 417  ? 123.707 99.000  151.335 1.00 282.27 ? 417  ILE B N     1 
ATOM   5042  C  CA    . ILE B  2 417  ? 125.017 99.570  151.640 1.00 282.27 ? 417  ILE B CA    1 
ATOM   5043  C  C     . ILE B  2 417  ? 124.874 100.924 152.329 1.00 282.27 ? 417  ILE B C     1 
ATOM   5044  O  O     . ILE B  2 417  ? 125.632 101.250 153.254 1.00 282.27 ? 417  ILE B O     1 
ATOM   5045  C  CB    . ILE B  2 417  ? 125.866 99.663  150.358 1.00 282.27 ? 417  ILE B CB    1 
ATOM   5046  C  CG1   . ILE B  2 417  ? 126.246 98.259  149.882 1.00 282.27 ? 417  ILE B CG1   1 
ATOM   5047  C  CG2   . ILE B  2 417  ? 127.111 100.498 150.593 1.00 282.27 ? 417  ILE B CG2   1 
ATOM   5048  C  CD1   . ILE B  2 417  ? 127.147 98.244  148.672 1.00 282.27 ? 417  ILE B CD1   1 
ATOM   5049  N  N     . CYS B  2 418  ? 123.900 101.734 151.906 1.00 295.99 ? 418  CYS B N     1 
ATOM   5050  C  CA    . CYS B  2 418  ? 123.705 103.021 152.572 1.00 295.99 ? 418  CYS B CA    1 
ATOM   5051  C  C     . CYS B  2 418  ? 123.130 102.845 153.972 1.00 295.99 ? 418  CYS B C     1 
ATOM   5052  O  O     . CYS B  2 418  ? 123.506 103.579 154.900 1.00 295.99 ? 418  CYS B O     1 
ATOM   5053  C  CB    . CYS B  2 418  ? 122.812 103.926 151.728 1.00 295.99 ? 418  CYS B CB    1 
ATOM   5054  S  SG    . CYS B  2 418  ? 123.709 104.775 150.421 1.00 295.99 ? 418  CYS B SG    1 
ATOM   5055  N  N     . ASN B  2 419  ? 122.207 101.892 154.144 1.00 298.87 ? 419  ASN B N     1 
ATOM   5056  C  CA    . ASN B  2 419  ? 121.783 101.508 155.485 1.00 294.82 ? 419  ASN B CA    1 
ATOM   5057  C  C     . ASN B  2 419  ? 122.982 101.102 156.328 1.00 290.03 ? 419  ASN B C     1 
ATOM   5058  O  O     . ASN B  2 419  ? 123.112 101.520 157.483 1.00 284.47 ? 419  ASN B O     1 
ATOM   5059  C  CB    . ASN B  2 419  ? 120.767 100.367 155.415 1.00 295.89 ? 419  ASN B CB    1 
ATOM   5060  C  CG    . ASN B  2 419  ? 119.381 100.834 155.006 1.00 300.76 ? 419  ASN B CG    1 
ATOM   5061  O  OD1   . ASN B  2 419  ? 119.186 101.986 154.623 1.00 303.11 ? 419  ASN B OD1   1 
ATOM   5062  N  ND2   . ASN B  2 419  ? 118.407 99.929  155.081 1.00 305.42 ? 419  ASN B ND2   1 
ATOM   5063  N  N     . LEU B  2 420  ? 123.877 100.290 155.756 1.00 290.89 ? 420  LEU B N     1 
ATOM   5064  C  CA    . LEU B  2 420  ? 125.117 99.927  156.433 1.00 289.90 ? 420  LEU B CA    1 
ATOM   5065  C  C     . LEU B  2 420  ? 125.842 101.168 156.937 1.00 284.88 ? 420  LEU B C     1 
ATOM   5066  O  O     . LEU B  2 420  ? 126.048 101.332 158.142 1.00 282.33 ? 420  LEU B O     1 
ATOM   5067  C  CB    . LEU B  2 420  ? 126.012 99.120  155.487 1.00 293.05 ? 420  LEU B CB    1 
ATOM   5068  C  CG    . LEU B  2 420  ? 127.424 98.787  155.968 1.00 296.09 ? 420  LEU B CG    1 
ATOM   5069  C  CD1   . LEU B  2 420  ? 127.527 97.323  156.372 1.00 300.42 ? 420  LEU B CD1   1 
ATOM   5070  C  CD2   . LEU B  2 420  ? 128.449 99.132  154.902 1.00 298.27 ? 420  LEU B CD2   1 
ATOM   5071  N  N     . VAL B  2 421  ? 126.194 102.076 156.022 1.00 299.43 ? 421  VAL B N     1 
ATOM   5072  C  CA    . VAL B  2 421  ? 126.958 103.269 156.401 1.00 294.33 ? 421  VAL B CA    1 
ATOM   5073  C  C     . VAL B  2 421  ? 126.269 104.011 157.543 1.00 292.44 ? 421  VAL B C     1 
ATOM   5074  O  O     . VAL B  2 421  ? 126.846 104.204 158.623 1.00 290.73 ? 421  VAL B O     1 
ATOM   5075  C  CB    . VAL B  2 421  ? 127.166 104.192 155.190 1.00 294.04 ? 421  VAL B CB    1 
ATOM   5076  C  CG1   . VAL B  2 421  ? 127.977 105.411 155.601 1.00 290.87 ? 421  VAL B CG1   1 
ATOM   5077  C  CG2   . VAL B  2 421  ? 127.853 103.445 154.064 1.00 297.13 ? 421  VAL B CG2   1 
ATOM   5078  N  N     . ALA B  2 422  ? 125.007 104.401 157.332 1.00 306.79 ? 422  ALA B N     1 
ATOM   5079  C  CA    . ALA B  2 422  ? 124.320 105.265 158.293 1.00 304.20 ? 422  ALA B CA    1 
ATOM   5080  C  C     . ALA B  2 422  ? 124.116 104.571 159.641 1.00 302.20 ? 422  ALA B C     1 
ATOM   5081  O  O     . ALA B  2 422  ? 124.608 105.038 160.683 1.00 300.01 ? 422  ALA B O     1 
ATOM   5082  C  CB    . ALA B  2 422  ? 122.982 105.725 157.712 1.00 303.21 ? 422  ALA B CB    1 
ATOM   5083  N  N     . ILE B  2 423  ? 123.381 103.453 159.644 1.00 316.13 ? 423  ILE B N     1 
ATOM   5084  C  CA    . ILE B  2 423  ? 123.038 102.827 160.914 1.00 315.40 ? 423  ILE B CA    1 
ATOM   5085  C  C     . ILE B  2 423  ? 124.263 102.248 161.612 1.00 314.88 ? 423  ILE B C     1 
ATOM   5086  O  O     . ILE B  2 423  ? 124.256 102.138 162.838 1.00 313.32 ? 423  ILE B O     1 
ATOM   5087  C  CB    . ILE B  2 423  ? 121.955 101.742 160.738 1.00 318.76 ? 423  ILE B CB    1 
ATOM   5088  C  CG1   . ILE B  2 423  ? 122.575 100.400 160.341 1.00 325.52 ? 423  ILE B CG1   1 
ATOM   5089  C  CG2   . ILE B  2 423  ? 120.906 102.191 159.726 1.00 319.68 ? 423  ILE B CG2   1 
ATOM   5090  C  CD1   . ILE B  2 423  ? 122.118 99.234  161.195 1.00 328.08 ? 423  ILE B CD1   1 
ATOM   5091  N  N     . ASP B  2 424  ? 125.342 101.921 160.891 1.00 415.47 ? 424  ASP B N     1 
ATOM   5092  C  CA    . ASP B  2 424  ? 126.509 101.372 161.567 1.00 416.59 ? 424  ASP B CA    1 
ATOM   5093  C  C     . ASP B  2 424  ? 127.380 102.468 162.156 1.00 412.63 ? 424  ASP B C     1 
ATOM   5094  O  O     . ASP B  2 424  ? 127.919 102.297 163.254 1.00 411.96 ? 424  ASP B O     1 
ATOM   5095  C  CB    . ASP B  2 424  ? 127.309 100.500 160.606 1.00 228.83 ? 424  ASP B CB    1 
ATOM   5096  C  CG    . ASP B  2 424  ? 126.546 99.260  160.188 1.00 228.83 ? 424  ASP B CG    1 
ATOM   5097  O  OD1   . ASP B  2 424  ? 125.725 98.772  160.994 1.00 228.83 ? 424  ASP B OD1   1 
ATOM   5098  O  OD2   . ASP B  2 424  ? 126.753 98.780  159.055 1.00 228.83 ? 424  ASP B OD2   1 
ATOM   5099  N  N     . THR B  2 425  ? 127.532 103.592 161.446 1.00 324.44 ? 425  THR B N     1 
ATOM   5100  C  CA    . THR B  2 425  ? 128.005 104.809 162.088 1.00 316.86 ? 425  THR B CA    1 
ATOM   5101  C  C     . THR B  2 425  ? 127.310 104.984 163.432 1.00 314.21 ? 425  THR B C     1 
ATOM   5102  O  O     . THR B  2 425  ? 127.958 105.035 164.488 1.00 316.05 ? 425  THR B O     1 
ATOM   5103  C  CB    . THR B  2 425  ? 127.744 106.008 161.162 1.00 316.07 ? 425  THR B CB    1 
ATOM   5104  O  OG1   . THR B  2 425  ? 128.875 106.214 160.304 1.00 324.20 ? 425  THR B OG1   1 
ATOM   5105  C  CG2   . THR B  2 425  ? 127.450 107.286 161.951 1.00 309.87 ? 425  THR B CG2   1 
ATOM   5106  N  N     . ASN B  2 426  ? 125.974 104.996 163.403 1.00 315.76 ? 426  ASN B N     1 
ATOM   5107  C  CA    . ASN B  2 426  ? 125.210 105.254 164.619 1.00 314.92 ? 426  ASN B CA    1 
ATOM   5108  C  C     . ASN B  2 426  ? 125.500 104.213 165.695 1.00 312.29 ? 426  ASN B C     1 
ATOM   5109  O  O     . ASN B  2 426  ? 125.893 104.555 166.818 1.00 309.22 ? 426  ASN B O     1 
ATOM   5110  C  CB    . ASN B  2 426  ? 123.717 105.306 164.295 1.00 319.70 ? 426  ASN B CB    1 
ATOM   5111  C  CG    . ASN B  2 426  ? 123.343 106.529 163.484 1.00 320.67 ? 426  ASN B CG    1 
ATOM   5112  O  OD1   . ASN B  2 426  ? 124.213 107.241 162.980 1.00 318.93 ? 426  ASN B OD1   1 
ATOM   5113  N  ND2   . ASN B  2 426  ? 122.045 106.781 163.352 1.00 319.36 ? 426  ASN B ND2   1 
ATOM   5114  N  N     . GLN B  2 427  ? 125.327 102.930 165.366 1.00 312.02 ? 427  GLN B N     1 
ATOM   5115  C  CA    . GLN B  2 427  ? 125.396 101.883 166.380 1.00 314.02 ? 427  GLN B CA    1 
ATOM   5116  C  C     . GLN B  2 427  ? 126.800 101.751 166.957 1.00 312.25 ? 427  GLN B C     1 
ATOM   5117  O  O     . GLN B  2 427  ? 126.968 101.635 168.178 1.00 311.74 ? 427  GLN B O     1 
ATOM   5118  C  CB    . GLN B  2 427  ? 124.926 100.546 165.802 1.00 320.46 ? 427  GLN B CB    1 
ATOM   5119  C  CG    . GLN B  2 427  ? 123.492 100.532 165.273 1.00 324.16 ? 427  GLN B CG    1 
ATOM   5120  C  CD    . GLN B  2 427  ? 122.476 101.102 166.246 1.00 329.00 ? 427  GLN B CD    1 
ATOM   5121  O  OE1   . GLN B  2 427  ? 122.640 101.017 167.463 1.00 328.86 ? 427  GLN B OE1   1 
ATOM   5122  N  NE2   . GLN B  2 427  ? 121.412 101.689 165.708 1.00 331.45 ? 427  GLN B NE2   1 
ATOM   5123  N  N     . LEU B  2 428  ? 127.825 101.749 166.101 1.00 311.88 ? 428  LEU B N     1 
ATOM   5124  C  CA    . LEU B  2 428  ? 129.185 101.625 166.606 1.00 309.04 ? 428  LEU B CA    1 
ATOM   5125  C  C     . LEU B  2 428  ? 129.575 102.835 167.444 1.00 304.11 ? 428  LEU B C     1 
ATOM   5126  O  O     . LEU B  2 428  ? 130.233 102.686 168.481 1.00 300.56 ? 428  LEU B O     1 
ATOM   5127  C  CB    . LEU B  2 428  ? 130.158 101.416 165.448 1.00 310.27 ? 428  LEU B CB    1 
ATOM   5128  C  CG    . LEU B  2 428  ? 130.276 99.962  164.989 1.00 309.90 ? 428  LEU B CG    1 
ATOM   5129  C  CD1   . LEU B  2 428  ? 131.212 99.830  163.799 1.00 320.26 ? 428  LEU B CD1   1 
ATOM   5130  C  CD2   . LEU B  2 428  ? 130.743 99.085  166.140 1.00 308.35 ? 428  LEU B CD2   1 
ATOM   5131  N  N     . MET B  2 429  ? 129.143 104.038 167.045 1.00 305.02 ? 429  MET B N     1 
ATOM   5132  C  CA    . MET B  2 429  ? 129.445 105.216 167.852 1.00 302.18 ? 429  MET B CA    1 
ATOM   5133  C  C     . MET B  2 429  ? 128.771 105.144 169.220 1.00 304.41 ? 429  MET B C     1 
ATOM   5134  O  O     . MET B  2 429  ? 129.392 105.459 170.244 1.00 301.26 ? 429  MET B O     1 
ATOM   5135  C  CB    . MET B  2 429  ? 129.016 106.476 167.106 1.00 299.63 ? 429  MET B CB    1 
ATOM   5136  C  CG    . MET B  2 429  ? 130.158 107.417 166.787 1.00 298.24 ? 429  MET B CG    1 
ATOM   5137  S  SD    . MET B  2 429  ? 129.659 108.725 165.658 1.00 308.84 ? 429  MET B SD    1 
ATOM   5138  C  CE    . MET B  2 429  ? 128.106 109.233 166.386 1.00 299.18 ? 429  MET B CE    1 
ATOM   5139  N  N     . TRP B  2 430  ? 127.506 104.722 169.266 1.00 315.90 ? 430  TRP B N     1 
ATOM   5140  C  CA    . TRP B  2 430  ? 126.814 104.675 170.550 1.00 309.99 ? 430  TRP B CA    1 
ATOM   5141  C  C     . TRP B  2 430  ? 127.398 103.594 171.456 1.00 308.43 ? 430  TRP B C     1 
ATOM   5142  O  O     . TRP B  2 430  ? 127.560 103.810 172.665 1.00 305.51 ? 430  TRP B O     1 
ATOM   5143  C  CB    . TRP B  2 430  ? 125.312 104.475 170.337 1.00 306.35 ? 430  TRP B CB    1 
ATOM   5144  C  CG    . TRP B  2 430  ? 124.655 105.639 169.627 1.00 301.09 ? 430  TRP B CG    1 
ATOM   5145  C  CD1   . TRP B  2 430  ? 123.886 105.585 168.498 1.00 302.64 ? 430  TRP B CD1   1 
ATOM   5146  C  CD2   . TRP B  2 430  ? 124.727 107.023 169.993 1.00 304.69 ? 430  TRP B CD2   1 
ATOM   5147  N  NE1   . TRP B  2 430  ? 123.478 106.846 168.141 1.00 302.06 ? 430  TRP B NE1   1 
ATOM   5148  C  CE2   . TRP B  2 430  ? 123.977 107.747 169.043 1.00 303.89 ? 430  TRP B CE2   1 
ATOM   5149  C  CE3   . TRP B  2 430  ? 125.344 107.720 171.035 1.00 309.68 ? 430  TRP B CE3   1 
ATOM   5150  C  CZ2   . TRP B  2 430  ? 123.833 109.130 169.105 1.00 305.67 ? 430  TRP B CZ2   1 
ATOM   5151  C  CZ3   . TRP B  2 430  ? 125.204 109.092 171.092 1.00 307.90 ? 430  TRP B CZ3   1 
ATOM   5152  C  CH2   . TRP B  2 430  ? 124.453 109.785 170.134 1.00 306.60 ? 430  TRP B CH2   1 
ATOM   5153  N  N     . PHE B  2 431  ? 127.743 102.431 170.898 1.00 419.24 ? 431  PHE B N     1 
ATOM   5154  C  CA    . PHE B  2 431  ? 128.378 101.405 171.719 1.00 418.22 ? 431  PHE B CA    1 
ATOM   5155  C  C     . PHE B  2 431  ? 129.738 101.866 172.214 1.00 414.43 ? 431  PHE B C     1 
ATOM   5156  O  O     . PHE B  2 431  ? 130.140 101.537 173.335 1.00 412.46 ? 431  PHE B O     1 
ATOM   5157  C  CB    . PHE B  2 431  ? 128.530 100.097 170.948 1.00 223.43 ? 431  PHE B CB    1 
ATOM   5158  C  CG    . PHE B  2 431  ? 129.478 99.125  171.602 1.00 223.43 ? 431  PHE B CG    1 
ATOM   5159  C  CD1   . PHE B  2 431  ? 129.064 98.349  172.673 1.00 223.43 ? 431  PHE B CD1   1 
ATOM   5160  C  CD2   . PHE B  2 431  ? 130.788 98.998  171.156 1.00 223.43 ? 431  PHE B CD2   1 
ATOM   5161  C  CE1   . PHE B  2 431  ? 129.934 97.459  173.280 1.00 223.43 ? 431  PHE B CE1   1 
ATOM   5162  C  CE2   . PHE B  2 431  ? 131.661 98.111  171.759 1.00 223.43 ? 431  PHE B CE2   1 
ATOM   5163  C  CZ    . PHE B  2 431  ? 131.233 97.340  172.821 1.00 223.43 ? 431  PHE B CZ    1 
ATOM   5164  N  N     . PHE B  2 432  ? 130.469 102.618 171.394 1.00 323.51 ? 432  PHE B N     1 
ATOM   5165  C  CA    . PHE B  2 432  ? 131.767 103.082 171.839 1.00 321.30 ? 432  PHE B CA    1 
ATOM   5166  C  C     . PHE B  2 432  ? 131.689 104.278 172.768 1.00 315.47 ? 432  PHE B C     1 
ATOM   5167  O  O     . PHE B  2 432  ? 132.708 104.655 173.354 1.00 314.22 ? 432  PHE B O     1 
ATOM   5168  C  CB    . PHE B  2 432  ? 132.633 103.396 170.641 1.00 318.81 ? 432  PHE B CB    1 
ATOM   5169  C  CG    . PHE B  2 432  ? 133.832 102.550 170.590 1.00 312.71 ? 432  PHE B CG    1 
ATOM   5170  C  CD1   . PHE B  2 432  ? 133.754 101.258 170.117 1.00 313.32 ? 432  PHE B CD1   1 
ATOM   5171  C  CD2   . PHE B  2 432  ? 135.027 103.010 171.104 1.00 308.71 ? 432  PHE B CD2   1 
ATOM   5172  C  CE1   . PHE B  2 432  ? 134.868 100.452 170.108 1.00 317.98 ? 432  PHE B CE1   1 
ATOM   5173  C  CE2   . PHE B  2 432  ? 136.145 102.216 171.102 1.00 313.36 ? 432  PHE B CE2   1 
ATOM   5174  C  CZ    . PHE B  2 432  ? 136.069 100.932 170.607 1.00 318.35 ? 432  PHE B CZ    1 
ATOM   5175  N  N     . PHE B  2 433  ? 130.520 104.893 172.898 1.00 427.41 ? 433  PHE B N     1 
ATOM   5176  C  CA    . PHE B  2 433  ? 130.333 105.837 173.992 1.00 421.12 ? 433  PHE B CA    1 
ATOM   5177  C  C     . PHE B  2 433  ? 129.909 105.132 175.276 1.00 425.37 ? 433  PHE B C     1 
ATOM   5178  O  O     . PHE B  2 433  ? 130.262 105.585 176.370 1.00 425.91 ? 433  PHE B O     1 
ATOM   5179  C  CB    . PHE B  2 433  ? 129.296 106.891 173.626 1.00 245.55 ? 433  PHE B CB    1 
ATOM   5180  C  CG    . PHE B  2 433  ? 129.570 107.598 172.329 1.00 245.55 ? 433  PHE B CG    1 
ATOM   5181  C  CD1   . PHE B  2 433  ? 130.853 107.684 171.810 1.00 245.55 ? 433  PHE B CD1   1 
ATOM   5182  C  CD2   . PHE B  2 433  ? 128.529 108.188 171.629 1.00 245.55 ? 433  PHE B CD2   1 
ATOM   5183  C  CE1   . PHE B  2 433  ? 131.086 108.339 170.613 1.00 245.55 ? 433  PHE B CE1   1 
ATOM   5184  C  CE2   . PHE B  2 433  ? 128.757 108.843 170.437 1.00 245.55 ? 433  PHE B CE2   1 
ATOM   5185  C  CZ    . PHE B  2 433  ? 130.035 108.922 169.929 1.00 245.55 ? 433  PHE B CZ    1 
ATOM   5186  N  N     . LEU B  2 434  ? 129.149 104.039 175.166 1.00 344.04 ? 434  LEU B N     1 
ATOM   5187  C  CA    . LEU B  2 434  ? 128.659 103.330 176.345 1.00 344.60 ? 434  LEU B CA    1 
ATOM   5188  C  C     . LEU B  2 434  ? 129.617 102.264 176.873 1.00 345.33 ? 434  LEU B C     1 
ATOM   5189  O  O     . LEU B  2 434  ? 129.391 101.747 177.973 1.00 343.49 ? 434  LEU B O     1 
ATOM   5190  C  CB    . LEU B  2 434  ? 127.301 102.677 176.049 1.00 339.52 ? 434  LEU B CB    1 
ATOM   5191  C  CG    . LEU B  2 434  ? 126.100 103.621 175.970 1.00 337.25 ? 434  LEU B CG    1 
ATOM   5192  C  CD1   . LEU B  2 434  ? 124.814 102.836 175.766 1.00 340.78 ? 434  LEU B CD1   1 
ATOM   5193  C  CD2   . LEU B  2 434  ? 126.018 104.478 177.222 1.00 334.07 ? 434  LEU B CD2   1 
ATOM   5194  N  N     . CYS B  2 435  ? 130.666 101.912 176.126 1.00 326.75 ? 435  CYS B N     1 
ATOM   5195  C  CA    . CYS B  2 435  ? 131.594 100.869 176.558 1.00 327.42 ? 435  CYS B CA    1 
ATOM   5196  C  C     . CYS B  2 435  ? 132.496 101.326 177.704 1.00 324.07 ? 435  CYS B C     1 
ATOM   5197  O  O     . CYS B  2 435  ? 132.708 100.557 178.653 1.00 329.18 ? 435  CYS B O     1 
ATOM   5198  C  CB    . CYS B  2 435  ? 132.442 100.382 175.380 1.00 330.15 ? 435  CYS B CB    1 
ATOM   5199  S  SG    . CYS B  2 435  ? 133.552 99.015  175.787 1.00 334.03 ? 435  CYS B SG    1 
ATOM   5200  N  N     . PRO B  2 436  ? 133.062 102.539 177.665 1.00 310.75 ? 436  PRO B N     1 
ATOM   5201  C  CA    . PRO B  2 436  ? 133.790 103.017 178.851 1.00 309.65 ? 436  PRO B CA    1 
ATOM   5202  C  C     . PRO B  2 436  ? 132.916 103.119 180.090 1.00 309.94 ? 436  PRO B C     1 
ATOM   5203  O  O     . PRO B  2 436  ? 133.427 102.984 181.209 1.00 314.07 ? 436  PRO B O     1 
ATOM   5204  C  CB    . PRO B  2 436  ? 134.309 104.395 178.415 1.00 311.59 ? 436  PRO B CB    1 
ATOM   5205  C  CG    . PRO B  2 436  ? 134.385 104.311 176.938 1.00 314.42 ? 436  PRO B CG    1 
ATOM   5206  C  CD    . PRO B  2 436  ? 133.226 103.464 176.528 1.00 311.93 ? 436  PRO B CD    1 
ATOM   5207  N  N     . ASN B  2 437  ? 131.611 103.356 179.921 1.00 296.97 ? 437  ASN B N     1 
ATOM   5208  C  CA    . ASN B  2 437  ? 130.712 103.441 181.068 1.00 299.71 ? 437  ASN B CA    1 
ATOM   5209  C  C     . ASN B  2 437  ? 130.567 102.088 181.757 1.00 303.95 ? 437  ASN B C     1 
ATOM   5210  O  O     . ASN B  2 437  ? 130.503 102.020 182.989 1.00 305.91 ? 437  ASN B O     1 
ATOM   5211  C  CB    . ASN B  2 437  ? 129.347 103.973 180.626 1.00 299.92 ? 437  ASN B CB    1 
ATOM   5212  C  CG    . ASN B  2 437  ? 128.421 104.261 181.796 1.00 307.04 ? 437  ASN B CG    1 
ATOM   5213  O  OD1   . ASN B  2 437  ? 128.868 104.448 182.927 1.00 312.43 ? 437  ASN B OD1   1 
ATOM   5214  N  ND2   . ASN B  2 437  ? 127.119 104.300 181.526 1.00 311.46 ? 437  ASN B ND2   1 
ATOM   5215  N  N     . LEU B  2 438  ? 130.526 101.002 180.981 1.00 304.95 ? 438  LEU B N     1 
ATOM   5216  C  CA    . LEU B  2 438  ? 130.413 99.672  181.564 1.00 302.55 ? 438  LEU B CA    1 
ATOM   5217  C  C     . LEU B  2 438  ? 131.757 99.084  181.974 1.00 306.95 ? 438  LEU B C     1 
ATOM   5218  O  O     . LEU B  2 438  ? 131.787 98.180  182.812 1.00 308.36 ? 438  LEU B O     1 
ATOM   5219  C  CB    . LEU B  2 438  ? 129.709 98.716  180.586 1.00 302.32 ? 438  LEU B CB    1 
ATOM   5220  C  CG    . LEU B  2 438  ? 130.339 98.334  179.242 1.00 304.68 ? 438  LEU B CG    1 
ATOM   5221  C  CD1   . LEU B  2 438  ? 131.325 97.172  179.358 1.00 305.73 ? 438  LEU B CD1   1 
ATOM   5222  C  CD2   . LEU B  2 438  ? 129.246 97.996  178.247 1.00 305.45 ? 438  LEU B CD2   1 
ATOM   5223  N  N     . TRP B  2 439  ? 132.872 99.578  181.421 1.00 301.72 ? 439  TRP B N     1 
ATOM   5224  C  CA    . TRP B  2 439  ? 134.166 99.120  181.921 1.00 304.21 ? 439  TRP B CA    1 
ATOM   5225  C  C     . TRP B  2 439  ? 134.481 99.660  183.318 1.00 302.33 ? 439  TRP B C     1 
ATOM   5226  O  O     . TRP B  2 439  ? 135.611 99.464  183.794 1.00 307.09 ? 439  TRP B O     1 
ATOM   5227  C  CB    . TRP B  2 439  ? 135.288 99.480  180.947 1.00 308.25 ? 439  TRP B CB    1 
ATOM   5228  C  CG    . TRP B  2 439  ? 135.694 98.331  180.072 1.00 313.89 ? 439  TRP B CG    1 
ATOM   5229  C  CD1   . TRP B  2 439  ? 135.417 98.173  178.744 1.00 315.60 ? 439  TRP B CD1   1 
ATOM   5230  C  CD2   . TRP B  2 439  ? 136.437 97.171  180.468 1.00 312.46 ? 439  TRP B CD2   1 
ATOM   5231  N  NE1   . TRP B  2 439  ? 135.949 96.989  178.288 1.00 317.40 ? 439  TRP B NE1   1 
ATOM   5232  C  CE2   . TRP B  2 439  ? 136.579 96.355  179.327 1.00 315.35 ? 439  TRP B CE2   1 
ATOM   5233  C  CE3   . TRP B  2 439  ? 136.999 96.743  181.679 1.00 310.22 ? 439  TRP B CE3   1 
ATOM   5234  C  CZ2   . TRP B  2 439  ? 137.259 95.136  179.360 1.00 313.92 ? 439  TRP B CZ2   1 
ATOM   5235  C  CZ3   . TRP B  2 439  ? 137.675 95.532  181.708 1.00 313.19 ? 439  TRP B CZ3   1 
ATOM   5236  C  CH2   . TRP B  2 439  ? 137.799 94.744  180.556 1.00 314.86 ? 439  TRP B CH2   1 
ATOM   5237  N  N     . ALA B  2 440  ? 133.529 100.332 183.968 1.00 302.35 ? 440  ALA B N     1 
ATOM   5238  C  CA    . ALA B  2 440  ? 133.668 100.781 185.343 1.00 304.04 ? 440  ALA B CA    1 
ATOM   5239  C  C     . ALA B  2 440  ? 132.566 100.287 186.269 1.00 304.71 ? 440  ALA B C     1 
ATOM   5240  O  O     . ALA B  2 440  ? 132.638 100.547 187.477 1.00 308.81 ? 440  ALA B O     1 
ATOM   5241  C  CB    . ALA B  2 440  ? 133.705 102.313 185.411 1.00 303.90 ? 440  ALA B CB    1 
ATOM   5242  N  N     . MET B  2 441  ? 131.546 99.611  185.748 1.00 294.59 ? 441  MET B N     1 
ATOM   5243  C  CA    . MET B  2 441  ? 130.539 99.001  186.614 1.00 299.44 ? 441  MET B CA    1 
ATOM   5244  C  C     . MET B  2 441  ? 131.130 97.962  187.568 1.00 305.09 ? 441  MET B C     1 
ATOM   5245  O  O     . MET B  2 441  ? 130.796 98.007  188.769 1.00 308.35 ? 441  MET B O     1 
ATOM   5246  C  CB    . MET B  2 441  ? 129.417 98.418  185.744 1.00 296.95 ? 441  MET B CB    1 
ATOM   5247  C  CG    . MET B  2 441  ? 128.388 97.565  186.477 1.00 303.51 ? 441  MET B CG    1 
ATOM   5248  S  SD    . MET B  2 441  ? 127.256 96.713  185.351 1.00 321.46 ? 441  MET B SD    1 
ATOM   5249  C  CE    . MET B  2 441  ? 128.382 95.653  184.440 1.00 319.83 ? 441  MET B CE    1 
ATOM   5250  N  N     . PRO B  2 442  ? 131.995 97.025  187.138 1.00 305.44 ? 442  PRO B N     1 
ATOM   5251  C  CA    . PRO B  2 442  ? 132.504 96.033  188.110 1.00 308.33 ? 442  PRO B CA    1 
ATOM   5252  C  C     . PRO B  2 442  ? 133.296 96.646  189.259 1.00 313.82 ? 442  PRO B C     1 
ATOM   5253  O  O     . PRO B  2 442  ? 133.037 96.326  190.430 1.00 319.16 ? 442  PRO B O     1 
ATOM   5254  C  CB    . PRO B  2 442  ? 133.372 95.108  187.241 1.00 307.14 ? 442  PRO B CB    1 
ATOM   5255  C  CG    . PRO B  2 442  ? 132.834 95.261  185.862 1.00 301.96 ? 442  PRO B CG    1 
ATOM   5256  C  CD    . PRO B  2 442  ? 132.458 96.713  185.771 1.00 302.76 ? 442  PRO B CD    1 
ATOM   5257  N  N     . VAL B  2 443  ? 134.273 97.504  188.958 1.00 292.06 ? 443  VAL B N     1 
ATOM   5258  C  CA    . VAL B  2 443  ? 135.056 98.144  190.012 1.00 295.40 ? 443  VAL B CA    1 
ATOM   5259  C  C     . VAL B  2 443  ? 134.145 98.950  190.929 1.00 299.97 ? 443  VAL B C     1 
ATOM   5260  O  O     . VAL B  2 443  ? 134.315 98.950  192.157 1.00 306.64 ? 443  VAL B O     1 
ATOM   5261  C  CB    . VAL B  2 443  ? 136.168 99.012  189.390 1.00 291.12 ? 443  VAL B CB    1 
ATOM   5262  C  CG1   . VAL B  2 443  ? 135.683 99.644  188.094 1.00 286.70 ? 443  VAL B CG1   1 
ATOM   5263  C  CG2   . VAL B  2 443  ? 136.636 100.081 190.364 1.00 299.71 ? 443  VAL B CG2   1 
ATOM   5264  N  N     . GLN B  2 444  ? 133.143 99.618  190.353 1.00 301.35 ? 444  GLN B N     1 
ATOM   5265  C  CA    . GLN B  2 444  ? 132.212 100.411 191.150 1.00 301.37 ? 444  GLN B CA    1 
ATOM   5266  C  C     . GLN B  2 444  ? 131.472 99.544  192.161 1.00 309.99 ? 444  GLN B C     1 
ATOM   5267  O  O     . GLN B  2 444  ? 131.427 99.869  193.354 1.00 318.18 ? 444  GLN B O     1 
ATOM   5268  C  CB    . GLN B  2 444  ? 131.225 101.144 190.236 1.00 295.19 ? 444  GLN B CB    1 
ATOM   5269  C  CG    . GLN B  2 444  ? 129.827 101.395 190.829 1.00 290.26 ? 444  GLN B CG    1 
ATOM   5270  C  CD    . GLN B  2 444  ? 129.192 102.681 190.309 1.00 284.19 ? 444  GLN B CD    1 
ATOM   5271  O  OE1   . GLN B  2 444  ? 129.643 103.244 189.312 1.00 280.44 ? 444  GLN B OE1   1 
ATOM   5272  N  NE2   . GLN B  2 444  ? 128.151 103.156 190.990 1.00 286.62 ? 444  GLN B NE2   1 
ATOM   5273  N  N     . ILE B  2 445  ? 130.895 98.428  191.708 1.00 304.23 ? 445  ILE B N     1 
ATOM   5274  C  CA    . ILE B  2 445  ? 130.115 97.605  192.631 1.00 309.86 ? 445  ILE B CA    1 
ATOM   5275  C  C     . ILE B  2 445  ? 131.019 96.964  193.682 1.00 313.97 ? 445  ILE B C     1 
ATOM   5276  O  O     . ILE B  2 445  ? 130.647 96.849  194.862 1.00 321.00 ? 445  ILE B O     1 
ATOM   5277  C  CB    . ILE B  2 445  ? 129.283 96.571  191.848 1.00 310.48 ? 445  ILE B CB    1 
ATOM   5278  C  CG1   . ILE B  2 445  ? 130.171 95.627  191.041 1.00 310.38 ? 445  ILE B CG1   1 
ATOM   5279  C  CG2   . ILE B  2 445  ? 128.347 97.278  190.885 1.00 314.06 ? 445  ILE B CG2   1 
ATOM   5280  C  CD1   . ILE B  2 445  ? 130.418 94.290  191.694 1.00 308.49 ? 445  ILE B CD1   1 
ATOM   5281  N  N     . ILE B  2 446  ? 132.233 96.563  193.286 1.00 311.96 ? 446  ILE B N     1 
ATOM   5282  C  CA    . ILE B  2 446  ? 133.159 95.964  194.245 1.00 313.22 ? 446  ILE B CA    1 
ATOM   5283  C  C     . ILE B  2 446  ? 133.501 96.963  195.351 1.00 319.58 ? 446  ILE B C     1 
ATOM   5284  O  O     . ILE B  2 446  ? 133.441 96.640  196.547 1.00 325.47 ? 446  ILE B O     1 
ATOM   5285  C  CB    . ILE B  2 446  ? 134.421 95.448  193.528 1.00 309.54 ? 446  ILE B CB    1 
ATOM   5286  C  CG1   . ILE B  2 446  ? 134.078 94.258  192.626 1.00 305.85 ? 446  ILE B CG1   1 
ATOM   5287  C  CG2   . ILE B  2 446  ? 135.493 95.057  194.536 1.00 312.07 ? 446  ILE B CG2   1 
ATOM   5288  C  CD1   . ILE B  2 446  ? 135.272 93.678  191.883 1.00 303.96 ? 446  ILE B CD1   1 
ATOM   5289  N  N     . VAL B  2 447  ? 133.854 98.198  194.969 1.00 310.87 ? 447  VAL B N     1 
ATOM   5290  C  CA    . VAL B  2 447  ? 134.174 99.200  195.983 1.00 313.63 ? 447  VAL B CA    1 
ATOM   5291  C  C     . VAL B  2 447  ? 132.943 99.523  196.819 1.00 325.14 ? 447  VAL B C     1 
ATOM   5292  O  O     . VAL B  2 447  ? 133.053 99.797  198.021 1.00 335.28 ? 447  VAL B O     1 
ATOM   5293  C  CB    . VAL B  2 447  ? 134.774 100.467 195.340 1.00 306.34 ? 447  VAL B CB    1 
ATOM   5294  C  CG1   . VAL B  2 447  ? 135.171 101.459 196.416 1.00 314.59 ? 447  VAL B CG1   1 
ATOM   5295  C  CG2   . VAL B  2 447  ? 135.987 100.116 194.493 1.00 304.71 ? 447  VAL B CG2   1 
ATOM   5296  N  N     . GLY B  2 448  ? 131.755 99.481  196.212 1.00 312.22 ? 448  GLY B N     1 
ATOM   5297  C  CA    . GLY B  2 448  ? 130.543 99.707  196.983 1.00 319.08 ? 448  GLY B CA    1 
ATOM   5298  C  C     . GLY B  2 448  ? 130.387 98.711  198.115 1.00 332.07 ? 448  GLY B C     1 
ATOM   5299  O  O     . GLY B  2 448  ? 130.104 99.083  199.261 1.00 340.26 ? 448  GLY B O     1 
ATOM   5300  N  N     . VAL B  2 449  ? 130.586 97.423  197.818 1.00 312.56 ? 449  VAL B N     1 
ATOM   5301  C  CA    . VAL B  2 449  ? 130.390 96.446  198.891 1.00 320.55 ? 449  VAL B CA    1 
ATOM   5302  C  C     . VAL B  2 449  ? 131.529 96.513  199.909 1.00 329.42 ? 449  VAL B C     1 
ATOM   5303  O  O     . VAL B  2 449  ? 131.293 96.376  201.123 1.00 337.24 ? 449  VAL B O     1 
ATOM   5304  C  CB    . VAL B  2 449  ? 130.191 95.016  198.342 1.00 318.28 ? 449  VAL B CB    1 
ATOM   5305  C  CG1   . VAL B  2 449  ? 131.466 94.451  197.735 1.00 316.19 ? 449  VAL B CG1   1 
ATOM   5306  C  CG2   . VAL B  2 449  ? 129.670 94.103  199.453 1.00 310.38 ? 449  VAL B CG2   1 
ATOM   5307  N  N     . ILE B  2 450  ? 132.767 96.760  199.458 1.00 314.70 ? 450  ILE B N     1 
ATOM   5308  C  CA    . ILE B  2 450  ? 133.866 96.850  200.414 1.00 320.56 ? 450  ILE B CA    1 
ATOM   5309  C  C     . ILE B  2 450  ? 133.729 98.089  201.293 1.00 326.69 ? 450  ILE B C     1 
ATOM   5310  O  O     . ILE B  2 450  ? 134.305 98.140  202.386 1.00 334.90 ? 450  ILE B O     1 
ATOM   5311  C  CB    . ILE B  2 450  ? 135.237 96.823  199.711 1.00 320.72 ? 450  ILE B CB    1 
ATOM   5312  C  CG1   . ILE B  2 450  ? 136.332 96.366  200.683 1.00 334.05 ? 450  ILE B CG1   1 
ATOM   5313  C  CG2   . ILE B  2 450  ? 135.596 98.188  199.159 1.00 313.44 ? 450  ILE B CG2   1 
ATOM   5314  C  CD1   . ILE B  2 450  ? 137.718 96.343  200.077 1.00 343.64 ? 450  ILE B CD1   1 
ATOM   5315  N  N     . LEU B  2 451  ? 132.965 99.089  200.850 1.00 323.99 ? 451  LEU B N     1 
ATOM   5316  C  CA    . LEU B  2 451  ? 132.702 100.240 201.706 1.00 327.46 ? 451  LEU B CA    1 
ATOM   5317  C  C     . LEU B  2 451  ? 131.542 99.973  202.658 1.00 334.48 ? 451  LEU B C     1 
ATOM   5318  O  O     . LEU B  2 451  ? 131.582 100.394 203.820 1.00 337.85 ? 451  LEU B O     1 
ATOM   5319  C  CB    . LEU B  2 451  ? 132.417 101.472 200.847 1.00 322.99 ? 451  LEU B CB    1 
ATOM   5320  C  CG    . LEU B  2 451  ? 133.003 102.810 201.298 1.00 322.15 ? 451  LEU B CG    1 
ATOM   5321  C  CD1   . LEU B  2 451  ? 132.715 103.868 200.251 1.00 320.60 ? 451  LEU B CD1   1 
ATOM   5322  C  CD2   . LEU B  2 451  ? 132.452 103.234 202.648 1.00 318.79 ? 451  LEU B CD2   1 
ATOM   5323  N  N     . LEU B  2 452  ? 130.507 99.268  202.189 1.00 311.66 ? 452  LEU B N     1 
ATOM   5324  C  CA    . LEU B  2 452  ? 129.335 99.045  203.029 1.00 318.92 ? 452  LEU B CA    1 
ATOM   5325  C  C     . LEU B  2 452  ? 129.560 97.991  204.108 1.00 326.79 ? 452  LEU B C     1 
ATOM   5326  O  O     . LEU B  2 452  ? 128.788 97.952  205.074 1.00 335.60 ? 452  LEU B O     1 
ATOM   5327  C  CB    . LEU B  2 452  ? 128.114 98.673  202.172 1.00 315.83 ? 452  LEU B CB    1 
ATOM   5328  C  CG    . LEU B  2 452  ? 127.987 97.351  201.402 1.00 311.55 ? 452  LEU B CG    1 
ATOM   5329  C  CD1   . LEU B  2 452  ? 127.424 96.223  202.265 1.00 316.65 ? 452  LEU B CD1   1 
ATOM   5330  C  CD2   . LEU B  2 452  ? 127.126 97.543  200.158 1.00 307.95 ? 452  LEU B CD2   1 
ATOM   5331  N  N     . TYR B  2 453  ? 130.576 97.132  203.972 1.00 307.68 ? 453  TYR B N     1 
ATOM   5332  C  CA    . TYR B  2 453  ? 130.921 96.255  205.093 1.00 318.71 ? 453  TYR B CA    1 
ATOM   5333  C  C     . TYR B  2 453  ? 131.240 97.072  206.342 1.00 321.91 ? 453  TYR B C     1 
ATOM   5334  O  O     . TYR B  2 453  ? 130.637 96.874  207.405 1.00 325.74 ? 453  TYR B O     1 
ATOM   5335  C  CB    . TYR B  2 453  ? 132.101 95.344  204.736 1.00 320.66 ? 453  TYR B CB    1 
ATOM   5336  C  CG    . TYR B  2 453  ? 132.604 94.479  205.889 1.00 330.76 ? 453  TYR B CG    1 
ATOM   5337  C  CD1   . TYR B  2 453  ? 132.002 93.261  206.191 1.00 335.09 ? 453  TYR B CD1   1 
ATOM   5338  C  CD2   . TYR B  2 453  ? 133.689 94.876  206.663 1.00 333.29 ? 453  TYR B CD2   1 
ATOM   5339  C  CE1   . TYR B  2 453  ? 132.462 92.472  207.237 1.00 338.29 ? 453  TYR B CE1   1 
ATOM   5340  C  CE2   . TYR B  2 453  ? 134.155 94.095  207.708 1.00 336.59 ? 453  TYR B CE2   1 
ATOM   5341  C  CZ    . TYR B  2 453  ? 133.537 92.893  207.990 1.00 339.28 ? 453  TYR B CZ    1 
ATOM   5342  O  OH    . TYR B  2 453  ? 133.997 92.113  209.027 1.00 342.83 ? 453  TYR B OH    1 
ATOM   5343  N  N     . TYR B  2 454  ? 132.178 98.018  206.222 1.00 311.50 ? 454  TYR B N     1 
ATOM   5344  C  CA    . TYR B  2 454  ? 132.622 98.819  207.359 1.00 314.72 ? 454  TYR B CA    1 
ATOM   5345  C  C     . TYR B  2 454  ? 131.524 99.698  207.940 1.00 313.75 ? 454  TYR B C     1 
ATOM   5346  O  O     . TYR B  2 454  ? 131.731 100.290 209.003 1.00 315.48 ? 454  TYR B O     1 
ATOM   5347  C  CB    . TYR B  2 454  ? 133.802 99.700  206.950 1.00 317.01 ? 454  TYR B CB    1 
ATOM   5348  C  CG    . TYR B  2 454  ? 135.009 98.925  206.483 1.00 324.23 ? 454  TYR B CG    1 
ATOM   5349  C  CD1   . TYR B  2 454  ? 135.337 97.703  207.053 1.00 330.44 ? 454  TYR B CD1   1 
ATOM   5350  C  CD2   . TYR B  2 454  ? 135.819 99.413  205.467 1.00 321.86 ? 454  TYR B CD2   1 
ATOM   5351  C  CE1   . TYR B  2 454  ? 136.439 96.988  206.626 1.00 334.35 ? 454  TYR B CE1   1 
ATOM   5352  C  CE2   . TYR B  2 454  ? 136.924 98.708  205.033 1.00 327.10 ? 454  TYR B CE2   1 
ATOM   5353  C  CZ    . TYR B  2 454  ? 137.230 97.496  205.614 1.00 333.23 ? 454  TYR B CZ    1 
ATOM   5354  O  OH    . TYR B  2 454  ? 138.332 96.795  205.180 1.00 338.68 ? 454  TYR B OH    1 
ATOM   5355  N  N     . ILE B  2 455  ? 130.374 99.805  207.281 1.00 317.05 ? 455  ILE B N     1 
ATOM   5356  C  CA    . ILE B  2 455  ? 129.279 100.635 207.752 1.00 312.92 ? 455  ILE B CA    1 
ATOM   5357  C  C     . ILE B  2 455  ? 128.143 99.797  208.325 1.00 317.61 ? 455  ILE B C     1 
ATOM   5358  O  O     . ILE B  2 455  ? 127.509 100.195 209.304 1.00 318.20 ? 455  ILE B O     1 
ATOM   5359  C  CB    . ILE B  2 455  ? 128.773 101.553 206.618 1.00 308.17 ? 455  ILE B CB    1 
ATOM   5360  C  CG1   . ILE B  2 455  ? 129.934 102.372 206.057 1.00 306.74 ? 455  ILE B CG1   1 
ATOM   5361  C  CG2   . ILE B  2 455  ? 127.680 102.473 207.122 1.00 302.27 ? 455  ILE B CG2   1 
ATOM   5362  C  CD1   . ILE B  2 455  ? 129.521 103.369 205.009 1.00 302.41 ? 455  ILE B CD1   1 
ATOM   5363  N  N     . LEU B  2 456  ? 127.877 98.629  207.738 1.00 313.72 ? 456  LEU B N     1 
ATOM   5364  C  CA    . LEU B  2 456  ? 126.814 97.772  208.243 1.00 318.20 ? 456  LEU B CA    1 
ATOM   5365  C  C     . LEU B  2 456  ? 127.297 96.906  209.401 1.00 321.91 ? 456  LEU B C     1 
ATOM   5366  O  O     . LEU B  2 456  ? 126.659 96.862  210.458 1.00 326.51 ? 456  LEU B O     1 
ATOM   5367  C  CB    . LEU B  2 456  ? 126.261 96.900  207.113 1.00 322.00 ? 456  LEU B CB    1 
ATOM   5368  N  N     . GLY B  2 457  ? 128.418 96.212  209.225 1.00 320.71 ? 457  GLY B N     1 
ATOM   5369  C  CA    . GLY B  2 457  ? 128.906 95.305  210.251 1.00 325.80 ? 457  GLY B CA    1 
ATOM   5370  C  C     . GLY B  2 457  ? 128.418 93.892  210.004 1.00 331.91 ? 457  GLY B C     1 
ATOM   5371  O  O     . GLY B  2 457  ? 128.557 93.369  208.898 1.00 330.52 ? 457  GLY B O     1 
ATOM   5372  N  N     . VAL B  2 458  ? 127.841 93.274  211.038 1.00 350.31 ? 458  VAL B N     1 
ATOM   5373  C  CA    . VAL B  2 458  ? 127.268 91.941  210.888 1.00 353.32 ? 458  VAL B CA    1 
ATOM   5374  C  C     . VAL B  2 458  ? 125.988 91.956  210.067 1.00 354.53 ? 458  VAL B C     1 
ATOM   5375  O  O     . VAL B  2 458  ? 125.523 90.894  209.636 1.00 356.34 ? 458  VAL B O     1 
ATOM   5376  C  CB    . VAL B  2 458  ? 127.010 91.305  212.271 1.00 356.12 ? 458  VAL B CB    1 
ATOM   5377  C  CG1   . VAL B  2 458  ? 125.694 91.798  212.858 1.00 357.63 ? 458  VAL B CG1   1 
ATOM   5378  C  CG2   . VAL B  2 458  ? 127.039 89.781  212.181 1.00 359.54 ? 458  VAL B CG2   1 
ATOM   5379  N  N     . SER B  2 459  ? 125.415 93.134  209.831 1.00 344.12 ? 459  SER B N     1 
ATOM   5380  C  CA    . SER B  2 459  ? 124.208 93.277  209.030 1.00 344.17 ? 459  SER B CA    1 
ATOM   5381  C  C     . SER B  2 459  ? 124.500 93.380  207.539 1.00 343.42 ? 459  SER B C     1 
ATOM   5382  O  O     . SER B  2 459  ? 123.616 93.773  206.770 1.00 344.38 ? 459  SER B O     1 
ATOM   5383  C  CB    . SER B  2 459  ? 123.417 94.505  209.493 1.00 342.87 ? 459  SER B CB    1 
ATOM   5384  O  OG    . SER B  2 459  ? 122.222 94.650  208.746 1.00 346.08 ? 459  SER B OG    1 
ATOM   5385  N  N     . ALA B  2 460  ? 125.718 93.039  207.113 1.00 342.30 ? 460  ALA B N     1 
ATOM   5386  C  CA    . ALA B  2 460  ? 126.025 93.057  205.689 1.00 341.34 ? 460  ALA B CA    1 
ATOM   5387  C  C     . ALA B  2 460  ? 125.341 91.915  204.952 1.00 343.16 ? 460  ALA B C     1 
ATOM   5388  O  O     . ALA B  2 460  ? 124.994 92.077  203.774 1.00 342.34 ? 460  ALA B O     1 
ATOM   5389  C  CB    . ALA B  2 460  ? 127.533 92.987  205.463 1.00 336.25 ? 460  ALA B CB    1 
ATOM   5390  N  N     . LEU B  2 461  ? 125.135 90.771  205.631 1.00 349.71 ? 461  LEU B N     1 
ATOM   5391  C  CA    . LEU B  2 461  ? 124.614 89.563  204.989 1.00 351.15 ? 461  LEU B CA    1 
ATOM   5392  C  C     . LEU B  2 461  ? 123.385 89.846  204.139 1.00 351.78 ? 461  LEU B C     1 
ATOM   5393  O  O     . LEU B  2 461  ? 123.265 89.319  203.031 1.00 353.33 ? 461  LEU B O     1 
ATOM   5394  C  CB    . LEU B  2 461  ? 124.288 88.504  206.040 1.00 352.62 ? 461  LEU B CB    1 
ATOM   5395  C  CG    . LEU B  2 461  ? 125.296 87.363  206.258 1.00 353.66 ? 461  LEU B CG    1 
ATOM   5396  C  CD1   . LEU B  2 461  ? 124.840 86.503  207.415 1.00 354.96 ? 461  LEU B CD1   1 
ATOM   5397  C  CD2   . LEU B  2 461  ? 125.440 86.534  204.994 1.00 351.91 ? 461  LEU B CD2   1 
ATOM   5398  N  N     . ILE B  2 462  ? 122.468 90.681  204.631 1.00 355.90 ? 462  ILE B N     1 
ATOM   5399  C  CA    . ILE B  2 462  ? 121.210 90.901  203.921 1.00 357.26 ? 462  ILE B CA    1 
ATOM   5400  C  C     . ILE B  2 462  ? 121.462 91.614  202.597 1.00 353.88 ? 462  ILE B C     1 
ATOM   5401  O  O     . ILE B  2 462  ? 121.003 91.167  201.538 1.00 359.61 ? 462  ILE B O     1 
ATOM   5402  C  CB    . ILE B  2 462  ? 120.222 91.676  204.810 1.00 359.84 ? 462  ILE B CB    1 
ATOM   5403  N  N     . GLY B  2 463  ? 122.184 92.737  202.635 1.00 366.55 ? 463  GLY B N     1 
ATOM   5404  C  CA    . GLY B  2 463  ? 122.488 93.450  201.403 1.00 362.78 ? 463  GLY B CA    1 
ATOM   5405  C  C     . GLY B  2 463  ? 123.327 92.629  200.442 1.00 357.55 ? 463  GLY B C     1 
ATOM   5406  O  O     . GLY B  2 463  ? 123.144 92.701  199.222 1.00 352.57 ? 463  GLY B O     1 
ATOM   5407  N  N     . ALA B  2 464  ? 124.259 91.833  200.980 1.00 365.22 ? 464  ALA B N     1 
ATOM   5408  C  CA    . ALA B  2 464  ? 125.082 90.975  200.134 1.00 361.26 ? 464  ALA B CA    1 
ATOM   5409  C  C     . ALA B  2 464  ? 124.239 89.914  199.441 1.00 358.19 ? 464  ALA B C     1 
ATOM   5410  O  O     . ALA B  2 464  ? 124.405 89.667  198.239 1.00 351.93 ? 464  ALA B O     1 
ATOM   5411  C  CB    . ALA B  2 464  ? 126.190 90.329  200.964 1.00 365.24 ? 464  ALA B CB    1 
ATOM   5412  N  N     . ALA B  2 465  ? 123.326 89.279  200.184 1.00 364.68 ? 465  ALA B N     1 
ATOM   5413  C  CA    . ALA B  2 465  ? 122.428 88.301  199.582 1.00 363.46 ? 465  ALA B CA    1 
ATOM   5414  C  C     . ALA B  2 465  ? 121.543 88.947  198.528 1.00 359.53 ? 465  ALA B C     1 
ATOM   5415  O  O     . ALA B  2 465  ? 121.254 88.338  197.495 1.00 354.25 ? 465  ALA B O     1 
ATOM   5416  C  CB    . ALA B  2 465  ? 121.578 87.634  200.662 1.00 368.61 ? 465  ALA B CB    1 
ATOM   5417  N  N     . VAL B  2 466  ? 121.121 90.192  198.759 1.00 363.88 ? 466  VAL B N     1 
ATOM   5418  C  CA    . VAL B  2 466  ? 120.287 90.885  197.780 1.00 358.38 ? 466  VAL B CA    1 
ATOM   5419  C  C     . VAL B  2 466  ? 121.061 91.141  196.491 1.00 351.65 ? 466  VAL B C     1 
ATOM   5420  O  O     . VAL B  2 466  ? 120.585 90.840  195.388 1.00 347.19 ? 466  VAL B O     1 
ATOM   5421  C  CB    . VAL B  2 466  ? 119.737 92.190  198.379 1.00 360.50 ? 466  VAL B CB    1 
ATOM   5422  C  CG1   . VAL B  2 466  ? 119.500 93.211  197.282 1.00 353.30 ? 466  VAL B CG1   1 
ATOM   5423  C  CG2   . VAL B  2 466  ? 118.454 91.909  199.143 1.00 365.19 ? 466  VAL B CG2   1 
ATOM   5424  N  N     . ILE B  2 467  ? 122.270 91.705  196.604 1.00 348.05 ? 467  ILE B N     1 
ATOM   5425  C  CA    . ILE B  2 467  ? 123.036 92.049  195.406 1.00 343.32 ? 467  ILE B CA    1 
ATOM   5426  C  C     . ILE B  2 467  ? 123.713 90.844  194.771 1.00 342.54 ? 467  ILE B C     1 
ATOM   5427  O  O     . ILE B  2 467  ? 124.294 90.976  193.686 1.00 337.23 ? 467  ILE B O     1 
ATOM   5428  C  CB    . ILE B  2 467  ? 124.076 93.146  195.706 1.00 338.58 ? 467  ILE B CB    1 
ATOM   5429  C  CG1   . ILE B  2 467  ? 125.048 92.697  196.801 1.00 345.11 ? 467  ILE B CG1   1 
ATOM   5430  C  CG2   . ILE B  2 467  ? 123.379 94.448  196.088 1.00 337.36 ? 467  ILE B CG2   1 
ATOM   5431  C  CD1   . ILE B  2 467  ? 125.869 93.828  197.394 1.00 343.29 ? 467  ILE B CD1   1 
ATOM   5432  N  N     . ILE B  2 468  ? 123.667 89.677  195.414 1.00 354.34 ? 468  ILE B N     1 
ATOM   5433  C  CA    . ILE B  2 468  ? 124.057 88.440  194.745 1.00 354.39 ? 468  ILE B CA    1 
ATOM   5434  C  C     . ILE B  2 468  ? 122.854 87.762  194.081 1.00 351.68 ? 468  ILE B C     1 
ATOM   5435  O  O     . ILE B  2 468  ? 122.992 87.190  192.994 1.00 349.94 ? 468  ILE B O     1 
ATOM   5436  C  CB    . ILE B  2 468  ? 124.762 87.490  195.734 1.00 357.53 ? 468  ILE B CB    1 
ATOM   5437  C  CG1   . ILE B  2 468  ? 126.146 88.031  196.107 1.00 359.42 ? 468  ILE B CG1   1 
ATOM   5438  C  CG2   . ILE B  2 468  ? 124.891 86.085  195.158 1.00 357.93 ? 468  ILE B CG2   1 
ATOM   5439  C  CD1   . ILE B  2 468  ? 126.959 87.094  196.984 1.00 361.26 ? 468  ILE B CD1   1 
ATOM   5440  N  N     . LEU B  2 469  ? 121.672 87.833  194.702 1.00 351.07 ? 469  LEU B N     1 
ATOM   5441  C  CA    . LEU B  2 469  ? 120.442 87.338  194.094 1.00 349.38 ? 469  LEU B CA    1 
ATOM   5442  C  C     . LEU B  2 469  ? 120.028 88.174  192.890 1.00 344.41 ? 469  LEU B C     1 
ATOM   5443  O  O     . LEU B  2 469  ? 119.296 87.680  192.027 1.00 341.63 ? 469  LEU B O     1 
ATOM   5444  C  CB    . LEU B  2 469  ? 119.327 87.323  195.148 1.00 352.58 ? 469  LEU B CB    1 
ATOM   5445  C  CG    . LEU B  2 469  ? 117.957 86.700  194.870 1.00 351.41 ? 469  LEU B CG    1 
ATOM   5446  C  CD1   . LEU B  2 469  ? 117.404 86.078  196.143 1.00 351.96 ? 469  LEU B CD1   1 
ATOM   5447  C  CD2   . LEU B  2 469  ? 116.984 87.736  194.333 1.00 349.24 ? 469  LEU B CD2   1 
ATOM   5448  N  N     . LEU B  2 470  ? 120.480 89.427  192.823 1.00 358.55 ? 470  LEU B N     1 
ATOM   5449  C  CA    . LEU B  2 470  ? 120.169 90.270  191.672 1.00 354.70 ? 470  LEU B CA    1 
ATOM   5450  C  C     . LEU B  2 470  ? 120.811 89.739  190.392 1.00 350.58 ? 470  LEU B C     1 
ATOM   5451  O  O     . LEU B  2 470  ? 120.161 89.692  189.342 1.00 349.75 ? 470  LEU B O     1 
ATOM   5452  C  CB    . LEU B  2 470  ? 120.626 91.703  191.944 1.00 350.94 ? 470  LEU B CB    1 
ATOM   5453  C  CG    . LEU B  2 470  ? 119.579 92.818  191.934 1.00 355.03 ? 470  LEU B CG    1 
ATOM   5454  C  CD1   . LEU B  2 470  ? 120.156 94.087  192.537 1.00 351.04 ? 470  LEU B CD1   1 
ATOM   5455  C  CD2   . LEU B  2 470  ? 119.082 93.079  190.522 1.00 358.10 ? 470  LEU B CD2   1 
ATOM   5456  N  N     . ALA B  2 471  ? 122.074 89.311  190.466 1.00 359.94 ? 471  ALA B N     1 
ATOM   5457  C  CA    . ALA B  2 471  ? 122.869 89.094  189.257 1.00 355.61 ? 471  ALA B CA    1 
ATOM   5458  C  C     . ALA B  2 471  ? 122.339 87.994  188.335 1.00 358.92 ? 471  ALA B C     1 
ATOM   5459  O  O     . ALA B  2 471  ? 122.169 88.265  187.132 1.00 357.80 ? 471  ALA B O     1 
ATOM   5460  C  CB    . ALA B  2 471  ? 124.326 88.825  189.653 1.00 347.41 ? 471  ALA B CB    1 
ATOM   5461  N  N     . PRO B  2 472  ? 122.078 86.761  188.793 1.00 355.83 ? 472  PRO B N     1 
ATOM   5462  C  CA    . PRO B  2 472  ? 121.754 85.700  187.818 1.00 353.77 ? 472  PRO B CA    1 
ATOM   5463  C  C     . PRO B  2 472  ? 120.406 85.879  187.143 1.00 353.18 ? 472  PRO B C     1 
ATOM   5464  O  O     . PRO B  2 472  ? 120.270 85.593  185.943 1.00 353.30 ? 472  PRO B O     1 
ATOM   5465  C  CB    . PRO B  2 472  ? 121.805 84.423  188.669 1.00 355.19 ? 472  PRO B CB    1 
ATOM   5466  C  CG    . PRO B  2 472  ? 121.435 84.884  190.032 1.00 356.30 ? 472  PRO B CG    1 
ATOM   5467  C  CD    . PRO B  2 472  ? 122.045 86.251  190.177 1.00 355.12 ? 472  PRO B CD    1 
ATOM   5468  N  N     . VAL B  2 473  ? 119.393 86.332  187.887 1.00 353.79 ? 473  VAL B N     1 
ATOM   5469  C  CA    . VAL B  2 473  ? 118.096 86.605  187.277 1.00 352.00 ? 473  VAL B CA    1 
ATOM   5470  C  C     . VAL B  2 473  ? 118.227 87.716  186.241 1.00 350.01 ? 473  VAL B C     1 
ATOM   5471  O  O     . VAL B  2 473  ? 117.582 87.680  185.186 1.00 355.90 ? 473  VAL B O     1 
ATOM   5472  C  CB    . VAL B  2 473  ? 117.057 86.948  188.359 1.00 351.16 ? 473  VAL B CB    1 
ATOM   5473  C  CG1   . VAL B  2 473  ? 115.644 86.766  187.819 1.00 350.38 ? 473  VAL B CG1   1 
ATOM   5474  C  CG2   . VAL B  2 473  ? 117.276 86.091  189.595 1.00 356.67 ? 473  VAL B CG2   1 
ATOM   5475  N  N     . GLN B  2 474  ? 119.085 88.708  186.515 1.00 358.56 ? 474  GLN B N     1 
ATOM   5476  C  CA    . GLN B  2 474  ? 119.351 89.761  185.537 1.00 354.37 ? 474  GLN B CA    1 
ATOM   5477  C  C     . GLN B  2 474  ? 120.029 89.201  184.292 1.00 358.20 ? 474  GLN B C     1 
ATOM   5478  O  O     . GLN B  2 474  ? 119.725 89.629  183.174 1.00 365.62 ? 474  GLN B O     1 
ATOM   5479  C  CB    . GLN B  2 474  ? 120.214 90.861  186.159 1.00 347.14 ? 474  GLN B CB    1 
ATOM   5480  C  CG    . GLN B  2 474  ? 119.493 91.756  187.154 1.00 344.28 ? 474  GLN B CG    1 
ATOM   5481  C  CD    . GLN B  2 474  ? 118.298 92.468  186.552 1.00 351.14 ? 474  GLN B CD    1 
ATOM   5482  O  OE1   . GLN B  2 474  ? 118.267 92.756  185.354 1.00 357.53 ? 474  GLN B OE1   1 
ATOM   5483  N  NE2   . GLN B  2 474  ? 117.304 92.757  187.384 1.00 349.88 ? 474  GLN B NE2   1 
ATOM   5484  N  N     . TYR B  2 475  ? 120.952 88.252  184.468 1.00 344.40 ? 475  TYR B N     1 
ATOM   5485  C  CA    . TYR B  2 475  ? 121.592 87.622  183.315 1.00 344.72 ? 475  TYR B CA    1 
ATOM   5486  C  C     . TYR B  2 475  ? 120.566 86.903  182.444 1.00 350.89 ? 475  TYR B C     1 
ATOM   5487  O  O     . TYR B  2 475  ? 120.568 87.039  181.210 1.00 354.85 ? 475  TYR B O     1 
ATOM   5488  C  CB    . TYR B  2 475  ? 122.676 86.651  183.786 1.00 341.10 ? 475  TYR B CB    1 
ATOM   5489  N  N     . PHE B  2 476  ? 119.667 86.143  183.074 1.00 339.83 ? 476  PHE B N     1 
ATOM   5490  C  CA    . PHE B  2 476  ? 118.647 85.426  182.307 1.00 346.13 ? 476  PHE B CA    1 
ATOM   5491  C  C     . PHE B  2 476  ? 117.698 86.395  181.600 1.00 349.56 ? 476  PHE B C     1 
ATOM   5492  O  O     . PHE B  2 476  ? 117.316 86.173  180.440 1.00 354.69 ? 476  PHE B O     1 
ATOM   5493  C  CB    . PHE B  2 476  ? 117.878 84.472  183.222 1.00 346.29 ? 476  PHE B CB    1 
ATOM   5494  C  CG    . PHE B  2 476  ? 117.267 83.301  182.501 1.00 350.72 ? 476  PHE B CG    1 
ATOM   5495  C  CD1   . PHE B  2 476  ? 116.018 83.406  181.909 1.00 353.24 ? 476  PHE B CD1   1 
ATOM   5496  C  CD2   . PHE B  2 476  ? 117.945 82.094  182.415 1.00 353.29 ? 476  PHE B CD2   1 
ATOM   5497  C  CE1   . PHE B  2 476  ? 115.456 82.330  181.244 1.00 357.26 ? 476  PHE B CE1   1 
ATOM   5498  C  CE2   . PHE B  2 476  ? 117.389 81.015  181.751 1.00 358.24 ? 476  PHE B CE2   1 
ATOM   5499  C  CZ    . PHE B  2 476  ? 116.144 81.133  181.165 1.00 359.54 ? 476  PHE B CZ    1 
ATOM   5500  N  N     . VAL B  2 477  ? 117.318 87.483  182.280 1.00 334.11 ? 477  VAL B N     1 
ATOM   5501  C  CA    . VAL B  2 477  ? 116.454 88.492  181.669 1.00 333.61 ? 477  VAL B CA    1 
ATOM   5502  C  C     . VAL B  2 477  ? 117.137 89.122  180.460 1.00 337.21 ? 477  VAL B C     1 
ATOM   5503  O  O     . VAL B  2 477  ? 116.514 89.325  179.406 1.00 347.01 ? 477  VAL B O     1 
ATOM   5504  C  CB    . VAL B  2 477  ? 116.059 89.555  182.713 1.00 328.11 ? 477  VAL B CB    1 
ATOM   5505  C  CG1   . VAL B  2 477  ? 115.467 90.781  182.039 1.00 334.48 ? 477  VAL B CG1   1 
ATOM   5506  C  CG2   . VAL B  2 477  ? 115.077 88.975  183.718 1.00 328.23 ? 477  VAL B CG2   1 
ATOM   5507  N  N     . ALA B  2 478  ? 118.431 89.431  180.587 1.00 334.86 ? 478  ALA B N     1 
ATOM   5508  C  CA    . ALA B  2 478  ? 119.157 90.031  179.473 1.00 339.87 ? 478  ALA B CA    1 
ATOM   5509  C  C     . ALA B  2 478  ? 119.237 89.079  178.286 1.00 343.96 ? 478  ALA B C     1 
ATOM   5510  O  O     . ALA B  2 478  ? 119.160 89.513  177.129 1.00 351.58 ? 478  ALA B O     1 
ATOM   5511  C  CB    . ALA B  2 478  ? 120.557 90.447  179.924 1.00 330.61 ? 478  ALA B CB    1 
ATOM   5512  N  N     . THR B  2 479  ? 119.398 87.779  178.548 1.00 332.43 ? 479  THR B N     1 
ATOM   5513  C  CA    . THR B  2 479  ? 119.387 86.799  177.462 1.00 334.67 ? 479  THR B CA    1 
ATOM   5514  C  C     . THR B  2 479  ? 118.045 86.800  176.731 1.00 340.79 ? 479  THR B C     1 
ATOM   5515  O  O     . THR B  2 479  ? 117.988 86.887  175.490 1.00 349.59 ? 479  THR B O     1 
ATOM   5516  C  CB    . THR B  2 479  ? 119.692 85.407  178.022 1.00 329.57 ? 479  THR B CB    1 
ATOM   5517  O  OG1   . THR B  2 479  ? 121.007 85.392  178.597 1.00 322.31 ? 479  THR B OG1   1 
ATOM   5518  C  CG2   . THR B  2 479  ? 119.607 84.354  176.925 1.00 334.06 ? 479  THR B CG2   1 
ATOM   5519  N  N     . LYS B  2 480  ? 116.954 86.687  177.497 1.00 323.85 ? 480  LYS B N     1 
ATOM   5520  C  CA    . LYS B  2 480  ? 115.621 86.699  176.898 1.00 327.94 ? 480  LYS B CA    1 
ATOM   5521  C  C     . LYS B  2 480  ? 115.364 87.991  176.132 1.00 331.78 ? 480  LYS B C     1 
ATOM   5522  O  O     . LYS B  2 480  ? 114.552 88.012  175.198 1.00 336.75 ? 480  LYS B O     1 
ATOM   5523  C  CB    . LYS B  2 480  ? 114.556 86.497  177.975 1.00 325.44 ? 480  LYS B CB    1 
ATOM   5524  C  CG    . LYS B  2 480  ? 114.719 85.216  178.783 1.00 322.88 ? 480  LYS B CG    1 
ATOM   5525  C  CD    . LYS B  2 480  ? 114.597 83.977  177.910 1.00 324.97 ? 480  LYS B CD    1 
ATOM   5526  C  CE    . LYS B  2 480  ? 113.193 83.823  177.349 1.00 328.46 ? 480  LYS B CE    1 
ATOM   5527  N  NZ    . LYS B  2 480  ? 113.049 82.566  176.565 1.00 329.02 ? 480  LYS B NZ    1 
ATOM   5528  N  N     . LEU B  2 481  ? 116.040 89.077  176.513 1.00 325.93 ? 481  LEU B N     1 
ATOM   5529  C  CA    . LEU B  2 481  ? 115.897 90.346  175.801 1.00 329.42 ? 481  LEU B CA    1 
ATOM   5530  C  C     . LEU B  2 481  ? 116.655 90.331  174.470 1.00 334.01 ? 481  LEU B C     1 
ATOM   5531  O  O     . LEU B  2 481  ? 116.099 90.682  173.413 1.00 341.75 ? 481  LEU B O     1 
ATOM   5532  C  CB    . LEU B  2 481  ? 116.379 91.475  176.718 1.00 325.01 ? 481  LEU B CB    1 
ATOM   5533  C  CG    . LEU B  2 481  ? 116.348 92.967  176.384 1.00 322.28 ? 481  LEU B CG    1 
ATOM   5534  C  CD1   . LEU B  2 481  ? 116.431 93.786  177.667 1.00 317.50 ? 481  LEU B CD1   1 
ATOM   5535  C  CD2   . LEU B  2 481  ? 117.499 93.329  175.473 1.00 333.42 ? 481  LEU B CD2   1 
ATOM   5536  N  N     . SER B  2 482  ? 117.930 89.927  174.507 1.00 332.75 ? 482  SER B N     1 
ATOM   5537  C  CA    . SER B  2 482  ? 118.750 89.921  173.298 1.00 336.06 ? 482  SER B CA    1 
ATOM   5538  C  C     . SER B  2 482  ? 118.121 89.060  172.211 1.00 341.17 ? 482  SER B C     1 
ATOM   5539  O  O     . SER B  2 482  ? 118.189 89.398  171.012 1.00 345.52 ? 482  SER B O     1 
ATOM   5540  C  CB    . SER B  2 482  ? 120.158 89.420  173.620 1.00 329.33 ? 482  SER B CB    1 
ATOM   5541  O  OG    . SER B  2 482  ? 120.729 90.144  174.697 1.00 322.95 ? 482  SER B OG    1 
ATOM   5542  N  N     . GLN B  2 483  ? 117.513 87.935  172.608 1.00 327.50 ? 483  GLN B N     1 
ATOM   5543  C  CA    . GLN B  2 483  ? 116.943 87.043  171.601 1.00 333.47 ? 483  GLN B CA    1 
ATOM   5544  C  C     . GLN B  2 483  ? 115.847 87.733  170.794 1.00 339.95 ? 483  GLN B C     1 
ATOM   5545  O  O     . GLN B  2 483  ? 115.784 87.581  169.569 1.00 344.13 ? 483  GLN B O     1 
ATOM   5546  C  CB    . GLN B  2 483  ? 116.423 85.761  172.247 1.00 331.15 ? 483  GLN B CB    1 
ATOM   5547  C  CG    . GLN B  2 483  ? 117.520 84.842  172.788 1.00 329.68 ? 483  GLN B CG    1 
ATOM   5548  C  CD    . GLN B  2 483  ? 118.426 84.246  171.708 1.00 333.92 ? 483  GLN B CD    1 
ATOM   5549  O  OE1   . GLN B  2 483  ? 118.426 84.676  170.553 1.00 336.61 ? 483  GLN B OE1   1 
ATOM   5550  N  NE2   . GLN B  2 483  ? 119.204 83.240  172.092 1.00 334.24 ? 483  GLN B NE2   1 
ATOM   5551  N  N     . ALA B  2 484  ? 114.981 88.504  171.455 1.00 322.79 ? 484  ALA B N     1 
ATOM   5552  C  CA    . ALA B  2 484  ? 113.978 89.264  170.717 1.00 329.48 ? 484  ALA B CA    1 
ATOM   5553  C  C     . ALA B  2 484  ? 114.621 90.354  169.865 1.00 333.19 ? 484  ALA B C     1 
ATOM   5554  O  O     . ALA B  2 484  ? 114.190 90.605  168.727 1.00 341.54 ? 484  ALA B O     1 
ATOM   5555  C  CB    . ALA B  2 484  ? 112.956 89.867  171.680 1.00 331.77 ? 484  ALA B CB    1 
ATOM   5556  N  N     . GLN B  2 485  ? 115.646 91.023  170.401 1.00 321.82 ? 485  GLN B N     1 
ATOM   5557  C  CA    . GLN B  2 485  ? 116.177 92.191  169.700 1.00 323.35 ? 485  GLN B CA    1 
ATOM   5558  C  C     . GLN B  2 485  ? 116.805 91.821  168.358 1.00 330.04 ? 485  GLN B C     1 
ATOM   5559  O  O     . GLN B  2 485  ? 116.691 92.578  167.377 1.00 336.78 ? 485  GLN B O     1 
ATOM   5560  C  CB    . GLN B  2 485  ? 117.188 92.912  170.578 1.00 317.62 ? 485  GLN B CB    1 
ATOM   5561  C  CG    . GLN B  2 485  ? 117.586 94.245  170.020 1.00 314.04 ? 485  GLN B CG    1 
ATOM   5562  C  CD    . GLN B  2 485  ? 118.167 95.142  171.073 1.00 308.35 ? 485  GLN B CD    1 
ATOM   5563  O  OE1   . GLN B  2 485  ? 118.310 94.753  172.233 1.00 308.28 ? 485  GLN B OE1   1 
ATOM   5564  N  NE2   . GLN B  2 485  ? 118.519 96.353  170.678 1.00 306.76 ? 485  GLN B NE2   1 
ATOM   5565  N  N     . ARG B  2 486  ? 117.494 90.680  168.290 1.00 314.41 ? 486  ARG B N     1 
ATOM   5566  C  CA    . ARG B  2 486  ? 118.157 90.338  167.029 1.00 321.20 ? 486  ARG B CA    1 
ATOM   5567  C  C     . ARG B  2 486  ? 117.141 90.099  165.907 1.00 331.89 ? 486  ARG B C     1 
ATOM   5568  O  O     . ARG B  2 486  ? 117.303 90.595  164.778 1.00 337.74 ? 486  ARG B O     1 
ATOM   5569  C  CB    . ARG B  2 486  ? 119.067 89.125  167.214 1.00 318.32 ? 486  ARG B CB    1 
ATOM   5570  C  CG    . ARG B  2 486  ? 119.890 88.786  165.968 1.00 315.07 ? 486  ARG B CG    1 
ATOM   5571  C  CD    . ARG B  2 486  ? 121.039 87.820  166.260 1.00 313.61 ? 486  ARG B CD    1 
ATOM   5572  N  NE    . ARG B  2 486  ? 122.096 88.433  167.063 1.00 310.67 ? 486  ARG B NE    1 
ATOM   5573  C  CZ    . ARG B  2 486  ? 122.293 88.191  168.355 1.00 309.55 ? 486  ARG B CZ    1 
ATOM   5574  N  NH1   . ARG B  2 486  ? 123.279 88.798  169.004 1.00 307.30 ? 486  ARG B NH1   1 
ATOM   5575  N  NH2   . ARG B  2 486  ? 121.510 87.339  169.001 1.00 309.30 ? 486  ARG B NH2   1 
ATOM   5576  N  N     . SER B  2 487  ? 116.080 89.341  166.198 1.00 327.46 ? 487  SER B N     1 
ATOM   5577  C  CA    . SER B  2 487  ? 115.030 89.134  165.206 1.00 334.18 ? 487  SER B CA    1 
ATOM   5578  C  C     . SER B  2 487  ? 114.354 90.453  164.839 1.00 340.36 ? 487  SER B C     1 
ATOM   5579  O  O     . SER B  2 487  ? 113.959 90.658  163.679 1.00 346.31 ? 487  SER B O     1 
ATOM   5580  C  CB    . SER B  2 487  ? 114.005 88.124  165.725 1.00 333.16 ? 487  SER B CB    1 
ATOM   5581  O  OG    . SER B  2 487  ? 114.640 86.927  166.147 1.00 331.65 ? 487  SER B OG    1 
ATOM   5582  N  N     . THR B  2 488  ? 114.200 91.355  165.821 1.00 327.91 ? 488  THR B N     1 
ATOM   5583  C  CA    . THR B  2 488  ? 113.722 92.705  165.523 1.00 334.26 ? 488  THR B CA    1 
ATOM   5584  C  C     . THR B  2 488  ? 114.550 93.345  164.414 1.00 338.71 ? 488  THR B C     1 
ATOM   5585  O  O     . THR B  2 488  ? 114.007 93.910  163.452 1.00 344.24 ? 488  THR B O     1 
ATOM   5586  C  CB    . THR B  2 488  ? 113.785 93.584  166.774 1.00 331.74 ? 488  THR B CB    1 
ATOM   5587  O  OG1   . THR B  2 488  ? 113.335 92.847  167.916 1.00 329.52 ? 488  THR B OG1   1 
ATOM   5588  C  CG2   . THR B  2 488  ? 112.928 94.829  166.591 1.00 342.88 ? 488  THR B CG2   1 
ATOM   5589  N  N     . LEU B  2 489  ? 115.877 93.286  164.555 1.00 325.61 ? 489  LEU B N     1 
ATOM   5590  C  CA    . LEU B  2 489  ? 116.740 93.916  163.559 1.00 331.23 ? 489  LEU B CA    1 
ATOM   5591  C  C     . LEU B  2 489  ? 116.574 93.270  162.188 1.00 336.14 ? 489  LEU B C     1 
ATOM   5592  O  O     . LEU B  2 489  ? 116.517 93.972  161.170 1.00 341.47 ? 489  LEU B O     1 
ATOM   5593  C  CB    . LEU B  2 489  ? 118.198 93.869  164.008 1.00 327.29 ? 489  LEU B CB    1 
ATOM   5594  C  CG    . LEU B  2 489  ? 118.709 95.193  164.583 1.00 329.98 ? 489  LEU B CG    1 
ATOM   5595  C  CD1   . LEU B  2 489  ? 117.908 95.595  165.813 1.00 332.74 ? 489  LEU B CD1   1 
ATOM   5596  C  CD2   . LEU B  2 489  ? 120.189 95.103  164.901 1.00 329.40 ? 489  LEU B CD2   1 
ATOM   5597  N  N     . GLU B  2 490  ? 116.486 91.939  162.139 1.00 321.83 ? 490  GLU B N     1 
ATOM   5598  C  CA    . GLU B  2 490  ? 116.296 91.282  160.841 1.00 325.43 ? 490  GLU B CA    1 
ATOM   5599  C  C     . GLU B  2 490  ? 115.016 91.761  160.158 1.00 333.26 ? 490  GLU B C     1 
ATOM   5600  O  O     . GLU B  2 490  ? 115.013 92.088  158.958 1.00 337.64 ? 490  GLU B O     1 
ATOM   5601  C  CB    . GLU B  2 490  ? 116.273 89.763  161.007 1.00 319.51 ? 490  GLU B CB    1 
ATOM   5602  C  CG    . GLU B  2 490  ? 117.646 89.153  161.214 1.00 314.77 ? 490  GLU B CG    1 
ATOM   5603  C  CD    . GLU B  2 490  ? 117.638 87.643  161.101 1.00 310.55 ? 490  GLU B CD    1 
ATOM   5604  O  OE1   . GLU B  2 490  ? 116.551 87.067  160.894 1.00 310.28 ? 490  GLU B OE1   1 
ATOM   5605  O  OE2   . GLU B  2 490  ? 118.723 87.033  161.219 1.00 309.03 ? 490  GLU B OE2   1 
ATOM   5606  N  N     . HIS B  2 491  ? 113.921 91.828  160.916 1.00 336.67 ? 491  HIS B N     1 
ATOM   5607  C  CA    . HIS B  2 491  ? 112.644 92.217  160.323 1.00 342.80 ? 491  HIS B CA    1 
ATOM   5608  C  C     . HIS B  2 491  ? 112.660 93.668  159.853 1.00 348.54 ? 491  HIS B C     1 
ATOM   5609  O  O     . HIS B  2 491  ? 112.142 93.981  158.771 1.00 355.72 ? 491  HIS B O     1 
ATOM   5610  C  CB    . HIS B  2 491  ? 111.513 91.977  161.318 1.00 342.92 ? 491  HIS B CB    1 
ATOM   5611  C  CG    . HIS B  2 491  ? 111.129 90.537  161.449 1.00 343.30 ? 491  HIS B CG    1 
ATOM   5612  N  ND1   . HIS B  2 491  ? 109.819 90.125  161.563 1.00 347.07 ? 491  HIS B ND1   1 
ATOM   5613  C  CD2   . HIS B  2 491  ? 111.880 89.411  161.476 1.00 341.75 ? 491  HIS B CD2   1 
ATOM   5614  C  CE1   . HIS B  2 491  ? 109.780 88.807  161.659 1.00 344.73 ? 491  HIS B CE1   1 
ATOM   5615  N  NE2   . HIS B  2 491  ? 111.018 88.350  161.609 1.00 342.16 ? 491  HIS B NE2   1 
ATOM   5616  N  N     . SER B  2 492  ? 113.244 94.571  160.648 1.00 333.50 ? 492  SER B N     1 
ATOM   5617  C  CA    . SER B  2 492  ? 113.337 95.963  160.214 1.00 335.89 ? 492  SER B CA    1 
ATOM   5618  C  C     . SER B  2 492  ? 114.200 96.091  158.962 1.00 338.95 ? 492  SER B C     1 
ATOM   5619  O  O     . SER B  2 492  ? 113.911 96.911  158.074 1.00 343.77 ? 492  SER B O     1 
ATOM   5620  C  CB    . SER B  2 492  ? 113.892 96.829  161.345 1.00 332.46 ? 492  SER B CB    1 
ATOM   5621  O  OG    . SER B  2 492  ? 113.883 98.202  160.995 1.00 333.16 ? 492  SER B OG    1 
ATOM   5622  N  N     . ASN B  2 493  ? 115.256 95.277  158.866 1.00 330.90 ? 493  ASN B N     1 
ATOM   5623  C  CA    . ASN B  2 493  ? 116.126 95.338  157.698 1.00 333.07 ? 493  ASN B CA    1 
ATOM   5624  C  C     . ASN B  2 493  ? 115.386 94.899  156.440 1.00 341.21 ? 493  ASN B C     1 
ATOM   5625  O  O     . ASN B  2 493  ? 115.609 95.454  155.357 1.00 344.36 ? 493  ASN B O     1 
ATOM   5626  C  CB    . ASN B  2 493  ? 117.369 94.479  157.921 1.00 328.87 ? 493  ASN B CB    1 
ATOM   5627  C  CG    . ASN B  2 493  ? 118.487 94.808  156.952 1.00 323.61 ? 493  ASN B CG    1 
ATOM   5628  O  OD1   . ASN B  2 493  ? 118.513 95.889  156.359 1.00 323.15 ? 493  ASN B OD1   1 
ATOM   5629  N  ND2   . ASN B  2 493  ? 119.422 93.879  156.789 1.00 319.87 ? 493  ASN B ND2   1 
ATOM   5630  N  N     . GLU B  2 494  ? 114.500 93.906  156.555 1.00 324.10 ? 494  GLU B N     1 
ATOM   5631  C  CA    . GLU B  2 494  ? 113.724 93.560  155.363 1.00 325.90 ? 494  GLU B CA    1 
ATOM   5632  C  C     . GLU B  2 494  ? 112.649 94.607  155.060 1.00 330.79 ? 494  GLU B C     1 
ATOM   5633  O  O     . GLU B  2 494  ? 112.370 94.887  153.884 1.00 332.72 ? 494  GLU B O     1 
ATOM   5634  C  CB    . GLU B  2 494  ? 113.095 92.173  155.503 1.00 329.29 ? 494  GLU B CB    1 
ATOM   5635  C  CG    . GLU B  2 494  ? 112.275 91.741  154.282 1.00 339.23 ? 494  GLU B CG    1 
ATOM   5636  C  CD    . GLU B  2 494  ? 113.095 91.638  152.997 1.00 341.72 ? 494  GLU B CD    1 
ATOM   5637  O  OE1   . GLU B  2 494  ? 114.338 91.516  153.078 1.00 338.19 ? 494  GLU B OE1   1 
ATOM   5638  O  OE2   . GLU B  2 494  ? 112.495 91.676  151.901 1.00 344.51 ? 494  GLU B OE2   1 
ATOM   5639  N  N     . ARG B  2 495  ? 112.051 95.202  156.099 1.00 342.60 ? 495  ARG B N     1 
ATOM   5640  C  CA    . ARG B  2 495  ? 111.057 96.251  155.875 1.00 339.79 ? 495  ARG B CA    1 
ATOM   5641  C  C     . ARG B  2 495  ? 111.657 97.429  155.117 1.00 339.32 ? 495  ARG B C     1 
ATOM   5642  O  O     . ARG B  2 495  ? 110.993 98.033  154.263 1.00 342.86 ? 495  ARG B O     1 
ATOM   5643  C  CB    . ARG B  2 495  ? 110.463 96.722  157.203 1.00 337.80 ? 495  ARG B CB    1 
ATOM   5644  C  CG    . ARG B  2 495  ? 109.571 97.953  157.057 1.00 338.34 ? 495  ARG B CG    1 
ATOM   5645  C  CD    . ARG B  2 495  ? 108.872 98.348  158.352 1.00 339.24 ? 495  ARG B CD    1 
ATOM   5646  N  NE    . ARG B  2 495  ? 109.795 98.804  159.390 1.00 329.33 ? 495  ARG B NE    1 
ATOM   5647  C  CZ    . ARG B  2 495  ? 110.245 100.051 159.504 1.00 322.07 ? 495  ARG B CZ    1 
ATOM   5648  N  NH1   . ARG B  2 495  ? 109.873 100.981 158.634 1.00 320.62 ? 495  ARG B NH1   1 
ATOM   5649  N  NH2   . ARG B  2 495  ? 111.076 100.369 160.489 1.00 316.04 ? 495  ARG B NH2   1 
ATOM   5650  N  N     . LEU B  2 496  ? 112.911 97.777  155.417 1.00 334.75 ? 496  LEU B N     1 
ATOM   5651  C  CA    . LEU B  2 496  ? 113.517 98.924  154.745 1.00 332.60 ? 496  LEU B CA    1 
ATOM   5652  C  C     . LEU B  2 496  ? 113.708 98.667  153.254 1.00 335.40 ? 496  LEU B C     1 
ATOM   5653  O  O     . LEU B  2 496  ? 113.486 99.566  152.432 1.00 335.06 ? 496  LEU B O     1 
ATOM   5654  C  CB    . LEU B  2 496  ? 114.842 99.289  155.406 1.00 328.19 ? 496  LEU B CB    1 
ATOM   5655  C  CG    . LEU B  2 496  ? 114.664 99.930  156.783 1.00 320.46 ? 496  LEU B CG    1 
ATOM   5656  C  CD1   . LEU B  2 496  ? 115.956 100.571 157.253 1.00 316.92 ? 496  LEU B CD1   1 
ATOM   5657  C  CD2   . LEU B  2 496  ? 113.527 100.946 156.761 1.00 315.49 ? 496  LEU B CD2   1 
ATOM   5658  N  N     . LYS B  2 497  ? 114.102 97.449  152.875 1.00 360.18 ? 497  LYS B N     1 
ATOM   5659  C  CA    . LYS B  2 497  ? 114.240 97.152  151.453 1.00 361.85 ? 497  LYS B CA    1 
ATOM   5660  C  C     . LYS B  2 497  ? 112.883 97.093  150.762 1.00 364.12 ? 497  LYS B C     1 
ATOM   5661  O  O     . LYS B  2 497  ? 112.756 97.497  149.599 1.00 364.31 ? 497  LYS B O     1 
ATOM   5662  C  CB    . LYS B  2 497  ? 114.996 95.840  151.255 1.00 240.62 ? 497  LYS B CB    1 
ATOM   5663  C  CG    . LYS B  2 497  ? 116.485 95.938  151.549 1.00 240.62 ? 497  LYS B CG    1 
ATOM   5664  C  CD    . LYS B  2 497  ? 117.221 94.689  151.084 1.00 240.62 ? 497  LYS B CD    1 
ATOM   5665  C  CE    . LYS B  2 497  ? 116.714 93.452  151.814 1.00 240.62 ? 497  LYS B CE    1 
ATOM   5666  N  NZ    . LYS B  2 497  ? 117.376 92.199  151.355 1.00 240.62 ? 497  LYS B NZ    1 
ATOM   5667  N  N     . GLN B  2 498  ? 111.853 96.608  151.465 1.00 331.07 ? 498  GLN B N     1 
ATOM   5668  C  CA    . GLN B  2 498  ? 110.511 96.638  150.890 1.00 335.25 ? 498  GLN B CA    1 
ATOM   5669  C  C     . GLN B  2 498  ? 110.048 98.071  150.646 1.00 333.40 ? 498  GLN B C     1 
ATOM   5670  O  O     . GLN B  2 498  ? 109.442 98.370  149.611 1.00 336.17 ? 498  GLN B O     1 
ATOM   5671  C  CB    . GLN B  2 498  ? 109.535 95.889  151.793 1.00 341.18 ? 498  GLN B CB    1 
ATOM   5672  C  CG    . GLN B  2 498  ? 109.746 94.387  151.786 1.00 349.54 ? 498  GLN B CG    1 
ATOM   5673  C  CD    . GLN B  2 498  ? 108.585 93.637  152.395 1.00 358.79 ? 498  GLN B CD    1 
ATOM   5674  O  OE1   . GLN B  2 498  ? 107.590 94.236  152.794 1.00 363.32 ? 498  GLN B OE1   1 
ATOM   5675  N  NE2   . GLN B  2 498  ? 108.707 92.315  152.469 1.00 362.06 ? 498  GLN B NE2   1 
ATOM   5676  N  N     . THR B  2 499  ? 110.360 98.984  151.571 1.00 344.71 ? 499  THR B N     1 
ATOM   5677  C  CA    . THR B  2 499  ? 110.025 100.393 151.368 1.00 341.30 ? 499  THR B CA    1 
ATOM   5678  C  C     . THR B  2 499  ? 110.819 101.002 150.212 1.00 339.85 ? 499  THR B C     1 
ATOM   5679  O  O     . THR B  2 499  ? 110.275 101.787 149.426 1.00 338.31 ? 499  THR B O     1 
ATOM   5680  C  CB    . THR B  2 499  ? 110.266 101.177 152.661 1.00 341.59 ? 499  THR B CB    1 
ATOM   5681  O  OG1   . THR B  2 499  ? 109.247 100.851 153.613 1.00 347.17 ? 499  THR B OG1   1 
ATOM   5682  C  CG2   . THR B  2 499  ? 110.256 102.678 152.406 1.00 336.39 ? 499  THR B CG2   1 
ATOM   5683  N  N     . ASN B  2 500  ? 112.107 100.659 150.101 1.00 335.58 ? 500  ASN B N     1 
ATOM   5684  C  CA    . ASN B  2 500  ? 112.920 101.156 148.991 1.00 335.12 ? 500  ASN B CA    1 
ATOM   5685  C  C     . ASN B  2 500  ? 112.325 100.752 147.651 1.00 334.16 ? 500  ASN B C     1 
ATOM   5686  O  O     . ASN B  2 500  ? 112.178 101.583 146.746 1.00 329.45 ? 500  ASN B O     1 
ATOM   5687  C  CB    . ASN B  2 500  ? 114.353 100.635 149.098 1.00 335.50 ? 500  ASN B CB    1 
ATOM   5688  C  CG    . ASN B  2 500  ? 115.207 101.472 150.014 1.00 335.95 ? 500  ASN B CG    1 
ATOM   5689  O  OD1   . ASN B  2 500  ? 114.700 102.126 150.919 1.00 335.47 ? 500  ASN B OD1   1 
ATOM   5690  N  ND2   . ASN B  2 500  ? 116.515 101.461 149.780 1.00 338.38 ? 500  ASN B ND2   1 
ATOM   5691  N  N     . GLU B  2 501  ? 111.991 99.471  147.499 1.00 342.97 ? 501  GLU B N     1 
ATOM   5692  C  CA    . GLU B  2 501  ? 111.394 99.005  146.256 1.00 343.01 ? 501  GLU B CA    1 
ATOM   5693  C  C     . GLU B  2 501  ? 109.930 99.403  146.113 1.00 340.01 ? 501  GLU B C     1 
ATOM   5694  O  O     . GLU B  2 501  ? 109.359 99.216  145.033 1.00 336.09 ? 501  GLU B O     1 
ATOM   5695  C  CB    . GLU B  2 501  ? 111.543 97.487  146.140 1.00 347.11 ? 501  GLU B CB    1 
ATOM   5696  C  CG    . GLU B  2 501  ? 112.986 97.044  145.944 1.00 349.94 ? 501  GLU B CG    1 
ATOM   5697  C  CD    . GLU B  2 501  ? 113.166 95.543  146.045 1.00 356.41 ? 501  GLU B CD    1 
ATOM   5698  O  OE1   . GLU B  2 501  ? 112.155 94.827  146.204 1.00 358.66 ? 501  GLU B OE1   1 
ATOM   5699  O  OE2   . GLU B  2 501  ? 114.325 95.080  145.970 1.00 359.02 ? 501  GLU B OE2   1 
ATOM   5700  N  N     . MET B  2 502  ? 109.309 99.936  147.167 1.00 340.15 ? 502  MET B N     1 
ATOM   5701  C  CA    . MET B  2 502  ? 107.968 100.491 147.048 1.00 341.70 ? 502  MET B CA    1 
ATOM   5702  C  C     . MET B  2 502  ? 107.958 101.951 146.612 1.00 336.32 ? 502  MET B C     1 
ATOM   5703  O  O     . MET B  2 502  ? 107.041 102.365 145.895 1.00 337.87 ? 502  MET B O     1 
ATOM   5704  C  CB    . MET B  2 502  ? 107.218 100.365 148.378 1.00 348.51 ? 502  MET B CB    1 
ATOM   5705  C  CG    . MET B  2 502  ? 106.125 99.309  148.383 1.00 357.65 ? 502  MET B CG    1 
ATOM   5706  S  SD    . MET B  2 502  ? 104.825 99.683  149.575 1.00 381.87 ? 502  MET B SD    1 
ATOM   5707  C  CE    . MET B  2 502  ? 104.105 101.147 148.837 1.00 391.55 ? 502  MET B CE    1 
ATOM   5708  N  N     . LEU B  2 503  ? 108.952 102.743 147.022 1.00 335.58 ? 503  LEU B N     1 
ATOM   5709  C  CA    . LEU B  2 503  ? 108.926 104.178 146.751 1.00 332.71 ? 503  LEU B CA    1 
ATOM   5710  C  C     . LEU B  2 503  ? 109.486 104.547 145.382 1.00 330.70 ? 503  LEU B C     1 
ATOM   5711  O  O     . LEU B  2 503  ? 108.988 105.483 144.748 1.00 328.23 ? 503  LEU B O     1 
ATOM   5712  C  CB    . LEU B  2 503  ? 109.691 104.938 147.838 1.00 331.28 ? 503  LEU B CB    1 
ATOM   5713  C  CG    . LEU B  2 503  ? 108.918 105.146 149.139 1.00 332.83 ? 503  LEU B CG    1 
ATOM   5714  C  CD1   . LEU B  2 503  ? 109.651 106.117 150.049 1.00 332.70 ? 503  LEU B CD1   1 
ATOM   5715  C  CD2   . LEU B  2 503  ? 107.507 105.634 148.851 1.00 333.40 ? 503  LEU B CD2   1 
ATOM   5716  N  N     . ARG B  2 504  ? 110.514 103.842 144.908 1.00 324.33 ? 504  ARG B N     1 
ATOM   5717  C  CA    . ARG B  2 504  ? 111.057 104.146 143.588 1.00 321.14 ? 504  ARG B CA    1 
ATOM   5718  C  C     . ARG B  2 504  ? 110.152 103.688 142.454 1.00 324.98 ? 504  ARG B C     1 
ATOM   5719  O  O     . ARG B  2 504  ? 110.508 103.881 141.286 1.00 322.71 ? 504  ARG B O     1 
ATOM   5720  C  CB    . ARG B  2 504  ? 112.444 103.521 143.433 1.00 315.42 ? 504  ARG B CB    1 
ATOM   5721  C  CG    . ARG B  2 504  ? 113.487 104.121 144.359 1.00 310.16 ? 504  ARG B CG    1 
ATOM   5722  C  CD    . ARG B  2 504  ? 114.870 103.575 144.068 1.00 305.33 ? 504  ARG B CD    1 
ATOM   5723  N  NE    . ARG B  2 504  ? 115.882 104.168 144.939 1.00 301.93 ? 504  ARG B NE    1 
ATOM   5724  C  CZ    . ARG B  2 504  ? 117.174 103.862 144.895 1.00 301.03 ? 504  ARG B CZ    1 
ATOM   5725  N  NH1   . ARG B  2 504  ? 118.026 104.449 145.724 1.00 300.20 ? 504  ARG B NH1   1 
ATOM   5726  N  NH2   . ARG B  2 504  ? 117.615 102.967 144.022 1.00 299.94 ? 504  ARG B NH2   1 
ATOM   5727  N  N     . GLY B  2 505  ? 109.001 103.097 142.762 1.00 322.84 ? 505  GLY B N     1 
ATOM   5728  C  CA    . GLY B  2 505  ? 108.057 102.693 141.743 1.00 330.27 ? 505  GLY B CA    1 
ATOM   5729  C  C     . GLY B  2 505  ? 106.629 103.073 142.073 1.00 339.30 ? 505  GLY B C     1 
ATOM   5730  O  O     . GLY B  2 505  ? 105.690 102.390 141.652 1.00 349.18 ? 505  GLY B O     1 
ATOM   5731  N  N     . MET B  2 506  ? 106.445 104.161 142.827 1.00 346.89 ? 506  MET B N     1 
ATOM   5732  C  CA    . MET B  2 506  ? 105.092 104.580 143.181 1.00 351.03 ? 506  MET B CA    1 
ATOM   5733  C  C     . MET B  2 506  ? 104.290 104.983 141.952 1.00 358.48 ? 506  MET B C     1 
ATOM   5734  O  O     . MET B  2 506  ? 103.057 104.897 141.964 1.00 365.68 ? 506  MET B O     1 
ATOM   5735  C  CB    . MET B  2 506  ? 105.132 105.729 144.190 1.00 343.49 ? 506  MET B CB    1 
ATOM   5736  C  CG    . MET B  2 506  ? 105.364 105.287 145.633 1.00 340.59 ? 506  MET B CG    1 
ATOM   5737  S  SD    . MET B  2 506  ? 104.088 104.180 146.281 1.00 344.74 ? 506  MET B SD    1 
ATOM   5738  C  CE    . MET B  2 506  ? 102.646 105.241 146.242 1.00 348.21 ? 506  MET B CE    1 
ATOM   5739  N  N     . LYS B  2 507  ? 104.962 105.410 140.883 1.00 354.49 ? 507  LYS B N     1 
ATOM   5740  C  CA    . LYS B  2 507  ? 104.256 105.732 139.648 1.00 356.37 ? 507  LYS B CA    1 
ATOM   5741  C  C     . LYS B  2 507  ? 103.565 104.496 139.084 1.00 370.14 ? 507  LYS B C     1 
ATOM   5742  O  O     . LYS B  2 507  ? 102.340 104.470 138.918 1.00 376.88 ? 507  LYS B O     1 
ATOM   5743  C  CB    . LYS B  2 507  ? 105.226 106.330 138.629 1.00 347.11 ? 507  LYS B CB    1 
ATOM   5744  C  CG    . LYS B  2 507  ? 104.566 106.737 137.323 1.00 340.29 ? 507  LYS B CG    1 
ATOM   5745  C  CD    . LYS B  2 507  ? 105.491 107.602 136.488 1.00 330.05 ? 507  LYS B CD    1 
ATOM   5746  C  CE    . LYS B  2 507  ? 104.834 107.997 135.177 1.00 323.92 ? 507  LYS B CE    1 
ATOM   5747  N  NZ    . LYS B  2 507  ? 105.697 108.907 134.373 1.00 321.95 ? 507  LYS B NZ    1 
ATOM   5748  N  N     . LEU B  2 508  ? 104.342 103.450 138.795 1.00 344.42 ? 508  LEU B N     1 
ATOM   5749  C  CA    . LEU B  2 508  ? 103.763 102.209 138.289 1.00 353.60 ? 508  LEU B CA    1 
ATOM   5750  C  C     . LEU B  2 508  ? 102.834 101.565 139.311 1.00 358.92 ? 508  LEU B C     1 
ATOM   5751  O  O     . LEU B  2 508  ? 101.880 100.875 138.932 1.00 369.36 ? 508  LEU B O     1 
ATOM   5752  C  CB    . LEU B  2 508  ? 104.878 101.240 137.886 1.00 354.72 ? 508  LEU B CB    1 
ATOM   5753  C  CG    . LEU B  2 508  ? 104.464 99.886  137.304 1.00 368.58 ? 508  LEU B CG    1 
ATOM   5754  C  CD1   . LEU B  2 508  ? 105.247 99.575  136.037 1.00 377.52 ? 508  LEU B CD1   1 
ATOM   5755  C  CD2   . LEU B  2 508  ? 104.648 98.778  138.331 1.00 372.32 ? 508  LEU B CD2   1 
ATOM   5756  N  N     . LEU B  2 509  ? 103.090 101.778 140.604 1.00 351.10 ? 509  LEU B N     1 
ATOM   5757  C  CA    . LEU B  2 509  ? 102.217 101.212 141.626 1.00 355.63 ? 509  LEU B CA    1 
ATOM   5758  C  C     . LEU B  2 509  ? 100.830 101.841 141.573 1.00 363.38 ? 509  LEU B C     1 
ATOM   5759  O  O     . LEU B  2 509  ? 99.818  101.134 141.497 1.00 375.17 ? 509  LEU B O     1 
ATOM   5760  C  CB    . LEU B  2 509  ? 102.837 101.396 143.009 1.00 353.08 ? 509  LEU B CB    1 
ATOM   5761  C  CG    . LEU B  2 509  ? 102.074 100.656 144.104 1.00 367.03 ? 509  LEU B CG    1 
ATOM   5762  C  CD1   . LEU B  2 509  ? 102.258 99.160  143.933 1.00 380.70 ? 509  LEU B CD1   1 
ATOM   5763  C  CD2   . LEU B  2 509  ? 102.519 101.106 145.479 1.00 357.16 ? 509  LEU B CD2   1 
ATOM   5764  N  N     . LYS B  2 510  ? 100.763 103.172 141.609 1.00 358.95 ? 510  LYS B N     1 
ATOM   5765  C  CA    . LYS B  2 510  ? 99.487  103.869 141.537 1.00 363.73 ? 510  LYS B CA    1 
ATOM   5766  C  C     . LYS B  2 510  ? 98.860  103.816 140.155 1.00 372.93 ? 510  LYS B C     1 
ATOM   5767  O  O     . LYS B  2 510  ? 97.675  104.138 140.025 1.00 379.47 ? 510  LYS B O     1 
ATOM   5768  C  CB    . LYS B  2 510  ? 99.658  105.329 141.956 1.00 354.61 ? 510  LYS B CB    1 
ATOM   5769  C  CG    . LYS B  2 510  ? 100.194 105.514 143.361 1.00 350.37 ? 510  LYS B CG    1 
ATOM   5770  C  CD    . LYS B  2 510  ? 100.258 106.986 143.726 1.00 337.52 ? 510  LYS B CD    1 
ATOM   5771  C  CE    . LYS B  2 510  ? 98.869  107.563 143.949 1.00 337.14 ? 510  LYS B CE    1 
ATOM   5772  N  NZ    . LYS B  2 510  ? 98.284  107.131 145.249 1.00 343.46 ? 510  LYS B NZ    1 
ATOM   5773  N  N     . LEU B  2 511  ? 99.618  103.433 139.128 1.00 364.08 ? 511  LEU B N     1 
ATOM   5774  C  CA    . LEU B  2 511  ? 99.071  103.433 137.776 1.00 374.27 ? 511  LEU B CA    1 
ATOM   5775  C  C     . LEU B  2 511  ? 97.898  102.466 137.650 1.00 387.94 ? 511  LEU B C     1 
ATOM   5776  O  O     . LEU B  2 511  ? 96.787  102.865 137.285 1.00 396.08 ? 511  LEU B O     1 
ATOM   5777  C  CB    . LEU B  2 511  ? 100.172 103.107 136.766 1.00 372.53 ? 511  LEU B CB    1 
ATOM   5778  C  CG    . LEU B  2 511  ? 100.334 104.129 135.633 1.00 381.28 ? 511  LEU B CG    1 
ATOM   5779  C  CD1   . LEU B  2 511  ? 99.851  105.506 136.059 1.00 385.98 ? 511  LEU B CD1   1 
ATOM   5780  C  CD2   . LEU B  2 511  ? 101.780 104.207 135.173 1.00 376.19 ? 511  LEU B CD2   1 
ATOM   5781  N  N     . TYR B  2 512  ? 98.121  101.182 137.940 1.00 362.13 ? 512  TYR B N     1 
ATOM   5782  C  CA    . TYR B  2 512  ? 97.020  100.229 137.977 1.00 372.67 ? 512  TYR B CA    1 
ATOM   5783  C  C     . TYR B  2 512  ? 96.723  99.738  139.388 1.00 373.83 ? 512  TYR B C     1 
ATOM   5784  O  O     . TYR B  2 512  ? 96.114  98.677  139.558 1.00 379.11 ? 512  TYR B O     1 
ATOM   5785  C  CB    . TYR B  2 512  ? 97.263  99.043  137.038 1.00 375.08 ? 512  TYR B CB    1 
ATOM   5786  C  CG    . TYR B  2 512  ? 98.703  98.696  136.738 1.00 367.80 ? 512  TYR B CG    1 
ATOM   5787  C  CD1   . TYR B  2 512  ? 99.499  98.064  137.681 1.00 366.61 ? 512  TYR B CD1   1 
ATOM   5788  C  CD2   . TYR B  2 512  ? 99.248  98.954  135.486 1.00 370.84 ? 512  TYR B CD2   1 
ATOM   5789  C  CE1   . TYR B  2 512  ? 100.811 97.727  137.395 1.00 363.26 ? 512  TYR B CE1   1 
ATOM   5790  C  CE2   . TYR B  2 512  ? 100.554 98.620  135.191 1.00 366.19 ? 512  TYR B CE2   1 
ATOM   5791  C  CZ    . TYR B  2 512  ? 101.332 98.009  136.148 1.00 362.36 ? 512  TYR B CZ    1 
ATOM   5792  O  OH    . TYR B  2 512  ? 102.633 97.675  135.853 1.00 357.81 ? 512  TYR B OH    1 
ATOM   5793  N  N     . ALA B  2 513  ? 97.149  100.494 140.401 1.00 375.75 ? 513  ALA B N     1 
ATOM   5794  C  CA    . ALA B  2 513  ? 96.666  100.355 141.775 1.00 373.16 ? 513  ALA B CA    1 
ATOM   5795  C  C     . ALA B  2 513  ? 96.898  98.941  142.319 1.00 375.27 ? 513  ALA B C     1 
ATOM   5796  O  O     . ALA B  2 513  ? 95.967  98.188  142.612 1.00 377.91 ? 513  ALA B O     1 
ATOM   5797  C  CB    . ALA B  2 513  ? 95.187  100.747 141.864 1.00 382.55 ? 513  ALA B CB    1 
ATOM   5798  N  N     . TRP B  2 514  ? 98.178  98.595  142.440 1.00 379.66 ? 514  TRP B N     1 
ATOM   5799  C  CA    . TRP B  2 514  ? 98.593  97.431  143.210 1.00 380.01 ? 514  TRP B CA    1 
ATOM   5800  C  C     . TRP B  2 514  ? 98.885  97.776  144.663 1.00 377.15 ? 514  TRP B C     1 
ATOM   5801  O  O     . TRP B  2 514  ? 99.581  97.015  145.346 1.00 378.31 ? 514  TRP B O     1 
ATOM   5802  C  CB    . TRP B  2 514  ? 99.824  96.778  142.578 1.00 381.25 ? 514  TRP B CB    1 
ATOM   5803  C  CG    . TRP B  2 514  ? 99.515  95.915  141.410 1.00 382.73 ? 514  TRP B CG    1 
ATOM   5804  C  CD1   . TRP B  2 514  ? 98.287  95.471  141.021 1.00 383.47 ? 514  TRP B CD1   1 
ATOM   5805  C  CD2   . TRP B  2 514  ? 100.453 95.387  140.470 1.00 383.38 ? 514  TRP B CD2   1 
ATOM   5806  N  NE1   . TRP B  2 514  ? 98.403  94.695  139.893 1.00 384.62 ? 514  TRP B NE1   1 
ATOM   5807  C  CE2   . TRP B  2 514  ? 99.723  94.630  139.533 1.00 383.90 ? 514  TRP B CE2   1 
ATOM   5808  C  CE3   . TRP B  2 514  ? 101.840 95.481  140.327 1.00 383.95 ? 514  TRP B CE3   1 
ATOM   5809  C  CZ2   . TRP B  2 514  ? 100.334 93.970  138.469 1.00 385.28 ? 514  TRP B CZ2   1 
ATOM   5810  C  CZ3   . TRP B  2 514  ? 102.445 94.826  139.271 1.00 384.45 ? 514  TRP B CZ3   1 
ATOM   5811  C  CH2   . TRP B  2 514  ? 101.693 94.080  138.355 1.00 384.82 ? 514  TRP B CH2   1 
ATOM   5812  N  N     . GLU B  2 515  ? 98.361  98.907  145.143 1.00 378.90 ? 515  GLU B N     1 
ATOM   5813  C  CA    . GLU B  2 515  ? 98.760  99.434  146.445 1.00 376.81 ? 515  GLU B CA    1 
ATOM   5814  C  C     . GLU B  2 515  ? 98.422  98.464  147.568 1.00 381.31 ? 515  GLU B C     1 
ATOM   5815  O  O     . GLU B  2 515  ? 99.264  98.187  148.429 1.00 380.93 ? 515  GLU B O     1 
ATOM   5816  C  CB    . GLU B  2 515  ? 98.091  100.785 146.686 1.00 371.61 ? 515  GLU B CB    1 
ATOM   5817  C  CG    . GLU B  2 515  ? 98.404  101.825 145.629 1.00 365.84 ? 515  GLU B CG    1 
ATOM   5818  C  CD    . GLU B  2 515  ? 97.502  103.038 145.723 1.00 360.98 ? 515  GLU B CD    1 
ATOM   5819  O  OE1   . GLU B  2 515  ? 96.493  102.976 146.457 1.00 363.85 ? 515  GLU B OE1   1 
ATOM   5820  O  OE2   . GLU B  2 515  ? 97.805  104.055 145.064 1.00 355.66 ? 515  GLU B OE2   1 
ATOM   5821  N  N     . SER B  2 516  ? 97.195  97.928  147.568 1.00 377.63 ? 516  SER B N     1 
ATOM   5822  C  CA    . SER B  2 516  ? 96.726  97.111  148.684 1.00 377.23 ? 516  SER B CA    1 
ATOM   5823  C  C     . SER B  2 516  ? 97.678  95.960  148.986 1.00 377.10 ? 516  SER B C     1 
ATOM   5824  O  O     . SER B  2 516  ? 97.933  95.646  150.153 1.00 377.42 ? 516  SER B O     1 
ATOM   5825  C  CB    . SER B  2 516  ? 95.324  96.577  148.388 1.00 380.27 ? 516  SER B CB    1 
ATOM   5826  O  OG    . SER B  2 516  ? 95.344  95.670  147.299 1.00 382.16 ? 516  SER B OG    1 
ATOM   5827  N  N     . ILE B  2 517  ? 98.240  95.339  147.946 1.00 384.42 ? 517  ILE B N     1 
ATOM   5828  C  CA    . ILE B  2 517  ? 99.117  94.188  148.143 1.00 384.19 ? 517  ILE B CA    1 
ATOM   5829  C  C     . ILE B  2 517  ? 100.383 94.598  148.888 1.00 383.17 ? 517  ILE B C     1 
ATOM   5830  O  O     . ILE B  2 517  ? 100.735 94.011  149.923 1.00 383.07 ? 517  ILE B O     1 
ATOM   5831  C  CB    . ILE B  2 517  ? 99.445  93.537  146.788 1.00 383.07 ? 517  ILE B CB    1 
ATOM   5832  C  CG1   . ILE B  2 517  ? 98.161  93.303  145.993 1.00 383.44 ? 517  ILE B CG1   1 
ATOM   5833  C  CG2   . ILE B  2 517  ? 100.199 92.234  146.992 1.00 380.11 ? 517  ILE B CG2   1 
ATOM   5834  C  CD1   . ILE B  2 517  ? 98.398  92.917  144.554 1.00 379.74 ? 517  ILE B CD1   1 
ATOM   5835  N  N     . PHE B  2 518  ? 101.091 95.605  148.372 1.00 384.25 ? 518  PHE B N     1 
ATOM   5836  C  CA    . PHE B  2 518  ? 102.336 96.040  148.998 1.00 382.54 ? 518  PHE B CA    1 
ATOM   5837  C  C     . PHE B  2 518  ? 102.085 96.612  150.388 1.00 380.34 ? 518  PHE B C     1 
ATOM   5838  O  O     . PHE B  2 518  ? 102.890 96.418  151.306 1.00 379.45 ? 518  PHE B O     1 
ATOM   5839  C  CB    . PHE B  2 518  ? 103.037 97.067  148.111 1.00 381.13 ? 518  PHE B CB    1 
ATOM   5840  C  CG    . PHE B  2 518  ? 103.618 96.489  146.851 1.00 384.35 ? 518  PHE B CG    1 
ATOM   5841  C  CD1   . PHE B  2 518  ? 102.804 96.162  145.781 1.00 384.20 ? 518  PHE B CD1   1 
ATOM   5842  C  CD2   . PHE B  2 518  ? 104.982 96.284  146.734 1.00 387.03 ? 518  PHE B CD2   1 
ATOM   5843  C  CE1   . PHE B  2 518  ? 103.336 95.633  144.621 1.00 388.49 ? 518  PHE B CE1   1 
ATOM   5844  C  CE2   . PHE B  2 518  ? 105.521 95.756  145.576 1.00 389.67 ? 518  PHE B CE2   1 
ATOM   5845  C  CZ    . PHE B  2 518  ? 104.697 95.431  144.518 1.00 390.61 ? 518  PHE B CZ    1 
ATOM   5846  N  N     . CYS B  2 519  ? 100.960 97.308  150.565 1.00 389.38 ? 519  CYS B N     1 
ATOM   5847  C  CA    . CYS B  2 519  ? 100.646 97.887  151.865 1.00 387.69 ? 519  CYS B CA    1 
ATOM   5848  C  C     . CYS B  2 519  ? 100.331 96.808  152.890 1.00 386.37 ? 519  CYS B C     1 
ATOM   5849  O  O     . CYS B  2 519  ? 100.756 96.907  154.046 1.00 384.26 ? 519  CYS B O     1 
ATOM   5850  C  CB    . CYS B  2 519  ? 99.482  98.867  151.731 1.00 387.81 ? 519  CYS B CB    1 
ATOM   5851  S  SG    . CYS B  2 519  ? 99.823  100.237 150.609 1.00 378.95 ? 519  CYS B SG    1 
ATOM   5852  N  N     . SER B  2 520  ? 99.609  95.760  152.489 1.00 389.88 ? 520  SER B N     1 
ATOM   5853  C  CA    . SER B  2 520  ? 99.360  94.649  153.399 1.00 389.05 ? 520  SER B CA    1 
ATOM   5854  C  C     . SER B  2 520  ? 100.640 93.887  153.712 1.00 384.60 ? 520  SER B C     1 
ATOM   5855  O  O     . SER B  2 520  ? 100.809 93.405  154.836 1.00 379.98 ? 520  SER B O     1 
ATOM   5856  C  CB    . SER B  2 520  ? 98.308  93.709  152.812 1.00 392.83 ? 520  SER B CB    1 
ATOM   5857  O  OG    . SER B  2 520  ? 97.055  94.358  152.686 1.00 397.52 ? 520  SER B OG    1 
ATOM   5858  N  N     . ARG B  2 521  ? 101.556 93.778  152.746 1.00 385.95 ? 521  ARG B N     1 
ATOM   5859  C  CA    . ARG B  2 521  ? 102.833 93.124  153.026 1.00 383.47 ? 521  ARG B CA    1 
ATOM   5860  C  C     . ARG B  2 521  ? 103.652 93.925  154.032 1.00 379.59 ? 521  ARG B C     1 
ATOM   5861  O  O     . ARG B  2 521  ? 104.217 93.360  154.982 1.00 375.43 ? 521  ARG B O     1 
ATOM   5862  C  CB    . ARG B  2 521  ? 103.620 92.920  151.732 1.00 383.79 ? 521  ARG B CB    1 
ATOM   5863  C  CG    . ARG B  2 521  ? 103.089 91.805  150.850 1.00 380.00 ? 521  ARG B CG    1 
ATOM   5864  C  CD    . ARG B  2 521  ? 104.097 91.436  149.773 1.00 377.01 ? 521  ARG B CD    1 
ATOM   5865  N  NE    . ARG B  2 521  ? 105.413 91.151  150.339 1.00 373.48 ? 521  ARG B NE    1 
ATOM   5866  C  CZ    . ARG B  2 521  ? 106.453 90.716  149.635 1.00 369.52 ? 521  ARG B CZ    1 
ATOM   5867  N  NH1   . ARG B  2 521  ? 107.612 90.485  150.235 1.00 369.65 ? 521  ARG B NH1   1 
ATOM   5868  N  NH2   . ARG B  2 521  ? 106.333 90.508  148.331 1.00 368.38 ? 521  ARG B NH2   1 
ATOM   5869  N  N     . VAL B  2 522  ? 103.733 95.244  153.841 1.00 388.18 ? 522  VAL B N     1 
ATOM   5870  C  CA    . VAL B  2 522  ? 104.452 96.071  154.802 1.00 384.11 ? 522  VAL B CA    1 
ATOM   5871  C  C     . VAL B  2 522  ? 103.739 96.060  156.150 1.00 378.59 ? 522  VAL B C     1 
ATOM   5872  O  O     . VAL B  2 522  ? 104.386 96.120  157.199 1.00 374.67 ? 522  VAL B O     1 
ATOM   5873  C  CB    . VAL B  2 522  ? 104.639 97.501  154.265 1.00 384.12 ? 522  VAL B CB    1 
ATOM   5874  C  CG1   . VAL B  2 522  ? 105.442 98.332  155.252 1.00 378.69 ? 522  VAL B CG1   1 
ATOM   5875  C  CG2   . VAL B  2 522  ? 105.347 97.471  152.924 1.00 382.36 ? 522  VAL B CG2   1 
ATOM   5876  N  N     . GLU B  2 523  ? 102.408 95.943  156.153 1.00 392.90 ? 523  GLU B N     1 
ATOM   5877  C  CA    . GLU B  2 523  ? 101.678 95.853  157.413 1.00 384.46 ? 523  GLU B CA    1 
ATOM   5878  C  C     . GLU B  2 523  ? 101.998 94.554  158.143 1.00 379.30 ? 523  GLU B C     1 
ATOM   5879  O  O     . GLU B  2 523  ? 102.158 94.552  159.367 1.00 374.42 ? 523  GLU B O     1 
ATOM   5880  C  CB    . GLU B  2 523  ? 100.173 95.970  157.157 1.00 383.01 ? 523  GLU B CB    1 
ATOM   5881  C  CG    . GLU B  2 523  ? 99.337  96.201  158.409 1.00 372.89 ? 523  GLU B CG    1 
ATOM   5882  C  CD    . GLU B  2 523  ? 99.417  97.631  158.915 1.00 363.88 ? 523  GLU B CD    1 
ATOM   5883  O  OE1   . GLU B  2 523  ? 99.864  98.511  158.149 1.00 360.70 ? 523  GLU B OE1   1 
ATOM   5884  O  OE2   . GLU B  2 523  ? 99.029  97.876  160.078 1.00 357.24 ? 523  GLU B OE2   1 
ATOM   5885  N  N     . VAL B  2 524  ? 102.104 93.444  157.408 1.00 385.39 ? 524  VAL B N     1 
ATOM   5886  C  CA    . VAL B  2 524  ? 102.465 92.167  158.022 1.00 381.27 ? 524  VAL B CA    1 
ATOM   5887  C  C     . VAL B  2 524  ? 103.881 92.222  158.587 1.00 376.17 ? 524  VAL B C     1 
ATOM   5888  O  O     . VAL B  2 524  ? 104.143 91.755  159.709 1.00 370.80 ? 524  VAL B O     1 
ATOM   5889  C  CB    . VAL B  2 524  ? 102.302 91.025  157.001 1.00 384.72 ? 524  VAL B CB    1 
ATOM   5890  C  CG1   . VAL B  2 524  ? 103.015 89.772  157.481 1.00 383.08 ? 524  VAL B CG1   1 
ATOM   5891  C  CG2   . VAL B  2 524  ? 100.829 90.740  156.752 1.00 388.17 ? 524  VAL B CG2   1 
ATOM   5892  N  N     . THR B  2 525  ? 104.819 92.784  157.820 1.00 378.20 ? 525  THR B N     1 
ATOM   5893  C  CA    . THR B  2 525  ? 106.178 92.945  158.329 1.00 374.23 ? 525  THR B CA    1 
ATOM   5894  C  C     . THR B  2 525  ? 106.198 93.836  159.566 1.00 369.86 ? 525  THR B C     1 
ATOM   5895  O  O     . THR B  2 525  ? 106.939 93.574  160.524 1.00 364.29 ? 525  THR B O     1 
ATOM   5896  C  CB    . THR B  2 525  ? 107.085 93.519  157.238 1.00 368.95 ? 525  THR B CB    1 
ATOM   5897  O  OG1   . THR B  2 525  ? 107.072 92.649  156.100 1.00 374.75 ? 525  THR B OG1   1 
ATOM   5898  C  CG2   . THR B  2 525  ? 108.512 93.655  157.751 1.00 359.03 ? 525  THR B CG2   1 
ATOM   5899  N  N     . ARG B  2 526  ? 105.372 94.886  159.572 1.00 380.97 ? 526  ARG B N     1 
ATOM   5900  C  CA    . ARG B  2 526  ? 105.288 95.764  160.729 1.00 373.93 ? 526  ARG B CA    1 
ATOM   5901  C  C     . ARG B  2 526  ? 104.706 95.038  161.933 1.00 372.73 ? 526  ARG B C     1 
ATOM   5902  O  O     . ARG B  2 526  ? 105.114 95.286  163.069 1.00 368.76 ? 526  ARG B O     1 
ATOM   5903  C  CB    . ARG B  2 526  ? 104.448 96.993  160.394 1.00 371.03 ? 526  ARG B CB    1 
ATOM   5904  C  CG    . ARG B  2 526  ? 104.755 98.173  161.279 1.00 360.18 ? 526  ARG B CG    1 
ATOM   5905  C  CD    . ARG B  2 526  ? 106.178 98.641  161.038 1.00 354.05 ? 526  ARG B CD    1 
ATOM   5906  N  NE    . ARG B  2 526  ? 106.496 99.838  161.804 1.00 345.59 ? 526  ARG B NE    1 
ATOM   5907  C  CZ    . ARG B  2 526  ? 107.334 99.864  162.834 1.00 335.02 ? 526  ARG B CZ    1 
ATOM   5908  N  NH1   . ARG B  2 526  ? 107.946 98.754  163.216 1.00 335.66 ? 526  ARG B NH1   1 
ATOM   5909  N  NH2   . ARG B  2 526  ? 107.564 101.001 163.475 1.00 331.44 ? 526  ARG B NH2   1 
ATOM   5910  N  N     . ARG B  2 527  ? 103.751 94.135  161.703 1.00 366.25 ? 527  ARG B N     1 
ATOM   5911  C  CA    . ARG B  2 527  ? 103.177 93.362  162.802 1.00 362.65 ? 527  ARG B CA    1 
ATOM   5912  C  C     . ARG B  2 527  ? 104.206 92.416  163.408 1.00 355.26 ? 527  ARG B C     1 
ATOM   5913  O  O     . ARG B  2 527  ? 104.269 92.258  164.633 1.00 353.47 ? 527  ARG B O     1 
ATOM   5914  C  CB    . ARG B  2 527  ? 101.952 92.586  162.320 1.00 368.32 ? 527  ARG B CB    1 
ATOM   5915  C  CG    . ARG B  2 527  ? 100.780 93.456  161.899 1.00 372.81 ? 527  ARG B CG    1 
ATOM   5916  C  CD    . ARG B  2 527  ? 99.668  92.612  161.311 1.00 375.88 ? 527  ARG B CD    1 
ATOM   5917  N  NE    . ARG B  2 527  ? 99.163  91.661  162.294 1.00 377.42 ? 527  ARG B NE    1 
ATOM   5918  C  CZ    . ARG B  2 527  ? 98.252  91.960  163.212 1.00 376.86 ? 527  ARG B CZ    1 
ATOM   5919  N  NH1   . ARG B  2 527  ? 97.847  91.039  164.074 1.00 377.24 ? 527  ARG B NH1   1 
ATOM   5920  N  NH2   . ARG B  2 527  ? 97.745  93.184  163.267 1.00 376.77 ? 527  ARG B NH2   1 
ATOM   5921  N  N     . LYS B  2 528  ? 105.016 91.770  162.569 1.00 368.97 ? 528  LYS B N     1 
ATOM   5922  C  CA    . LYS B  2 528  ? 106.073 90.906  163.096 1.00 360.51 ? 528  LYS B CA    1 
ATOM   5923  C  C     . LYS B  2 528  ? 107.103 91.712  163.889 1.00 355.59 ? 528  LYS B C     1 
ATOM   5924  O  O     . LYS B  2 528  ? 107.508 91.326  165.002 1.00 352.43 ? 528  LYS B O     1 
ATOM   5925  C  CB    . LYS B  2 528  ? 106.737 90.147  161.949 1.00 356.20 ? 528  LYS B CB    1 
ATOM   5926  C  CG    . LYS B  2 528  ? 105.821 89.209  161.180 1.00 355.98 ? 528  LYS B CG    1 
ATOM   5927  C  CD    . LYS B  2 528  ? 106.590 88.475  160.089 1.00 345.75 ? 528  LYS B CD    1 
ATOM   5928  C  CE    . LYS B  2 528  ? 105.729 87.440  159.381 1.00 343.28 ? 528  LYS B CE    1 
ATOM   5929  N  NZ    . LYS B  2 528  ? 106.514 86.680  158.370 1.00 337.89 ? 528  LYS B NZ    1 
ATOM   5930  N  N     . GLU B  2 529  ? 107.540 92.842  163.325 1.00 376.94 ? 529  GLU B N     1 
ATOM   5931  C  CA    . GLU B  2 529  ? 108.443 93.742  164.035 1.00 371.00 ? 529  GLU B CA    1 
ATOM   5932  C  C     . GLU B  2 529  ? 107.839 94.192  165.365 1.00 359.92 ? 529  GLU B C     1 
ATOM   5933  O  O     . GLU B  2 529  ? 108.542 94.296  166.377 1.00 354.52 ? 529  GLU B O     1 
ATOM   5934  C  CB    . GLU B  2 529  ? 108.766 94.940  163.138 1.00 373.10 ? 529  GLU B CB    1 
ATOM   5935  C  CG    . GLU B  2 529  ? 109.995 95.742  163.532 1.00 370.77 ? 529  GLU B CG    1 
ATOM   5936  C  CD    . GLU B  2 529  ? 109.743 96.665  164.704 1.00 376.88 ? 529  GLU B CD    1 
ATOM   5937  O  OE1   . GLU B  2 529  ? 108.579 97.078  164.904 1.00 380.66 ? 529  GLU B OE1   1 
ATOM   5938  O  OE2   . GLU B  2 529  ? 110.709 96.972  165.428 1.00 375.40 ? 529  GLU B OE2   1 
ATOM   5939  N  N     . MET B  2 530  ? 106.530 94.451  165.381 1.00 367.05 ? 530  MET B N     1 
ATOM   5940  C  CA    . MET B  2 530  ? 105.836 94.874  166.594 1.00 360.27 ? 530  MET B CA    1 
ATOM   5941  C  C     . MET B  2 530  ? 105.769 93.755  167.622 1.00 355.53 ? 530  MET B C     1 
ATOM   5942  O  O     . MET B  2 530  ? 105.809 94.019  168.825 1.00 349.83 ? 530  MET B O     1 
ATOM   5943  C  CB    . MET B  2 530  ? 104.427 95.351  166.243 1.00 361.60 ? 530  MET B CB    1 
ATOM   5944  C  CG    . MET B  2 530  ? 103.703 96.078  167.360 1.00 360.01 ? 530  MET B CG    1 
ATOM   5945  S  SD    . MET B  2 530  ? 104.541 97.600  167.840 1.00 356.62 ? 530  MET B SD    1 
ATOM   5946  C  CE    . MET B  2 530  ? 104.711 98.414  166.253 1.00 339.19 ? 530  MET B CE    1 
ATOM   5947  N  N     . THR B  2 531  ? 105.635 92.508  167.171 1.00 356.02 ? 531  THR B N     1 
ATOM   5948  C  CA    . THR B  2 531  ? 105.730 91.379  168.094 1.00 351.01 ? 531  THR B CA    1 
ATOM   5949  C  C     . THR B  2 531  ? 107.086 91.370  168.787 1.00 343.52 ? 531  THR B C     1 
ATOM   5950  O  O     . THR B  2 531  ? 107.180 91.262  170.021 1.00 339.31 ? 531  THR B O     1 
ATOM   5951  C  CB    . THR B  2 531  ? 105.503 90.065  167.345 1.00 356.58 ? 531  THR B CB    1 
ATOM   5952  O  OG1   . THR B  2 531  ? 104.200 90.066  166.754 1.00 362.30 ? 531  THR B OG1   1 
ATOM   5953  C  CG2   . THR B  2 531  ? 105.635 88.873  168.284 1.00 353.60 ? 531  THR B CG2   1 
ATOM   5954  N  N     . SER B  2 532  ? 108.154 91.502  167.998 1.00 362.35 ? 532  SER B N     1 
ATOM   5955  C  CA    . SER B  2 532  ? 109.486 91.598  168.589 1.00 354.94 ? 532  SER B CA    1 
ATOM   5956  C  C     . SER B  2 532  ? 109.569 92.759  169.582 1.00 345.16 ? 532  SER B C     1 
ATOM   5957  O  O     . SER B  2 532  ? 110.076 92.599  170.703 1.00 337.23 ? 532  SER B O     1 
ATOM   5958  C  CB    . SER B  2 532  ? 110.532 91.740  167.486 1.00 350.99 ? 532  SER B CB    1 
ATOM   5959  O  OG    . SER B  2 532  ? 110.624 90.547  166.725 1.00 353.33 ? 532  SER B OG    1 
ATOM   5960  N  N     . LEU B  2 533  ? 109.040 93.923  169.200 1.00 350.28 ? 533  LEU B N     1 
ATOM   5961  C  CA    . LEU B  2 533  ? 109.133 95.101  170.059 1.00 344.14 ? 533  LEU B CA    1 
ATOM   5962  C  C     . LEU B  2 533  ? 108.351 94.926  171.357 1.00 338.49 ? 533  LEU B C     1 
ATOM   5963  O  O     . LEU B  2 533  ? 108.801 95.368  172.416 1.00 332.59 ? 533  LEU B O     1 
ATOM   5964  C  CB    . LEU B  2 533  ? 108.641 96.341  169.317 1.00 349.98 ? 533  LEU B CB    1 
ATOM   5965  C  CG    . LEU B  2 533  ? 109.677 97.084  168.481 1.00 346.53 ? 533  LEU B CG    1 
ATOM   5966  C  CD1   . LEU B  2 533  ? 109.063 98.355  167.924 1.00 341.91 ? 533  LEU B CD1   1 
ATOM   5967  C  CD2   . LEU B  2 533  ? 110.923 97.394  169.300 1.00 333.60 ? 533  LEU B CD2   1 
ATOM   5968  N  N     . ARG B  2 534  ? 107.172 94.303  171.293 1.00 349.57 ? 534  ARG B N     1 
ATOM   5969  C  CA    . ARG B  2 534  ? 106.368 94.140  172.500 1.00 344.20 ? 534  ARG B CA    1 
ATOM   5970  C  C     . ARG B  2 534  ? 107.005 93.129  173.447 1.00 334.58 ? 534  ARG B C     1 
ATOM   5971  O  O     . ARG B  2 534  ? 106.956 93.304  174.673 1.00 334.16 ? 534  ARG B O     1 
ATOM   5972  C  CB    . ARG B  2 534  ? 104.930 93.747  172.146 1.00 349.44 ? 534  ARG B CB    1 
ATOM   5973  C  CG    . ARG B  2 534  ? 104.761 92.375  171.514 1.00 350.71 ? 534  ARG B CG    1 
ATOM   5974  C  CD    . ARG B  2 534  ? 103.342 92.157  171.009 1.00 349.15 ? 534  ARG B CD    1 
ATOM   5975  N  NE    . ARG B  2 534  ? 102.379 92.021  172.097 1.00 343.70 ? 534  ARG B NE    1 
ATOM   5976  C  CZ    . ARG B  2 534  ? 101.975 90.857  172.593 1.00 339.15 ? 534  ARG B CZ    1 
ATOM   5977  N  NH1   . ARG B  2 534  ? 101.094 90.828  173.583 1.00 334.16 ? 534  ARG B NH1   1 
ATOM   5978  N  NH2   . ARG B  2 534  ? 102.449 89.721  172.099 1.00 339.90 ? 534  ARG B NH2   1 
ATOM   5979  N  N     . ALA B  2 535  ? 107.632 92.080  172.902 1.00 353.84 ? 535  ALA B N     1 
ATOM   5980  C  CA    . ALA B  2 535  ? 108.415 91.192  173.758 1.00 342.11 ? 535  ALA B CA    1 
ATOM   5981  C  C     . ALA B  2 535  ? 109.526 91.964  174.465 1.00 335.15 ? 535  ALA B C     1 
ATOM   5982  O  O     . ALA B  2 535  ? 109.689 91.867  175.692 1.00 325.30 ? 535  ALA B O     1 
ATOM   5983  C  CB    . ALA B  2 535  ? 108.988 90.037  172.937 1.00 343.39 ? 535  ALA B CB    1 
ATOM   5984  N  N     . PHE B  2 536  ? 110.281 92.763  173.700 1.00 337.56 ? 536  PHE B N     1 
ATOM   5985  C  CA    . PHE B  2 536  ? 111.352 93.571  174.281 1.00 331.45 ? 536  PHE B CA    1 
ATOM   5986  C  C     . PHE B  2 536  ? 110.825 94.502  175.370 1.00 324.76 ? 536  PHE B C     1 
ATOM   5987  O  O     . PHE B  2 536  ? 111.451 94.658  176.426 1.00 325.87 ? 536  PHE B O     1 
ATOM   5988  C  CB    . PHE B  2 536  ? 112.048 94.372  173.180 1.00 338.20 ? 536  PHE B CB    1 
ATOM   5989  C  CG    . PHE B  2 536  ? 113.094 95.332  173.685 1.00 340.06 ? 536  PHE B CG    1 
ATOM   5990  C  CD1   . PHE B  2 536  ? 114.402 94.918  173.865 1.00 331.55 ? 536  PHE B CD1   1 
ATOM   5991  C  CD2   . PHE B  2 536  ? 112.773 96.654  173.957 1.00 346.69 ? 536  PHE B CD2   1 
ATOM   5992  C  CE1   . PHE B  2 536  ? 115.365 95.797  174.321 1.00 329.90 ? 536  PHE B CE1   1 
ATOM   5993  C  CE2   . PHE B  2 536  ? 113.733 97.537  174.415 1.00 344.29 ? 536  PHE B CE2   1 
ATOM   5994  C  CZ    . PHE B  2 536  ? 115.032 97.106  174.596 1.00 335.17 ? 536  PHE B CZ    1 
ATOM   5995  N  N     . ALA B  2 537  ? 109.666 95.123  175.133 1.00 347.59 ? 537  ALA B N     1 
ATOM   5996  C  CA    . ALA B  2 537  ? 109.137 96.105  176.073 1.00 336.70 ? 537  ALA B CA    1 
ATOM   5997  C  C     . ALA B  2 537  ? 108.660 95.447  177.362 1.00 332.93 ? 537  ALA B C     1 
ATOM   5998  O  O     . ALA B  2 537  ? 108.902 95.972  178.459 1.00 324.21 ? 537  ALA B O     1 
ATOM   5999  C  CB    . ALA B  2 537  ? 108.002 96.894  175.421 1.00 339.50 ? 537  ALA B CB    1 
ATOM   6000  N  N     . VAL B  2 538  ? 107.980 94.302  177.259 1.00 337.28 ? 538  VAL B N     1 
ATOM   6001  C  CA    . VAL B  2 538  ? 107.566 93.587  178.465 1.00 334.92 ? 538  VAL B CA    1 
ATOM   6002  C  C     . VAL B  2 538  ? 108.785 93.157  179.272 1.00 329.78 ? 538  VAL B C     1 
ATOM   6003  O  O     . VAL B  2 538  ? 108.798 93.251  180.510 1.00 323.82 ? 538  VAL B O     1 
ATOM   6004  C  CB    . VAL B  2 538  ? 106.672 92.388  178.098 1.00 340.39 ? 538  VAL B CB    1 
ATOM   6005  C  CG1   . VAL B  2 538  ? 106.491 91.471  179.297 1.00 334.54 ? 538  VAL B CG1   1 
ATOM   6006  C  CG2   . VAL B  2 538  ? 105.323 92.874  177.593 1.00 344.32 ? 538  VAL B CG2   1 
ATOM   6007  N  N     . TYR B  2 539  ? 109.840 92.703  178.589 1.00 335.48 ? 539  TYR B N     1 
ATOM   6008  C  CA    . TYR B  2 539  ? 111.031 92.287  179.324 1.00 332.11 ? 539  TYR B CA    1 
ATOM   6009  C  C     . TYR B  2 539  ? 111.712 93.469  180.009 1.00 326.41 ? 539  TYR B C     1 
ATOM   6010  O  O     . TYR B  2 539  ? 112.172 93.346  181.151 1.00 331.77 ? 539  TYR B O     1 
ATOM   6011  C  CB    . TYR B  2 539  ? 111.991 91.554  178.393 1.00 330.32 ? 539  TYR B CB    1 
ATOM   6012  C  CG    . TYR B  2 539  ? 111.577 90.120  178.180 1.00 331.02 ? 539  TYR B CG    1 
ATOM   6013  C  CD1   . TYR B  2 539  ? 111.042 89.375  179.224 1.00 330.87 ? 539  TYR B CD1   1 
ATOM   6014  C  CD2   . TYR B  2 539  ? 111.695 89.518  176.938 1.00 331.98 ? 539  TYR B CD2   1 
ATOM   6015  C  CE1   . TYR B  2 539  ? 110.651 88.067  179.040 1.00 330.60 ? 539  TYR B CE1   1 
ATOM   6016  C  CE2   . TYR B  2 539  ? 111.307 88.209  176.743 1.00 331.24 ? 539  TYR B CE2   1 
ATOM   6017  C  CZ    . TYR B  2 539  ? 110.785 87.488  177.798 1.00 331.43 ? 539  TYR B CZ    1 
ATOM   6018  O  OH    . TYR B  2 539  ? 110.396 86.181  177.605 1.00 331.24 ? 539  TYR B OH    1 
ATOM   6019  N  N     . THR B  2 540  ? 111.767 94.628  179.345 1.00 346.43 ? 540  THR B N     1 
ATOM   6020  C  CA    . THR B  2 540  ? 112.355 95.802  179.991 1.00 339.23 ? 540  THR B CA    1 
ATOM   6021  C  C     . THR B  2 540  ? 111.518 96.275  181.176 1.00 336.93 ? 540  THR B C     1 
ATOM   6022  O  O     . THR B  2 540  ? 112.073 96.747  182.180 1.00 328.68 ? 540  THR B O     1 
ATOM   6023  C  CB    . THR B  2 540  ? 112.532 96.938  178.981 1.00 341.79 ? 540  THR B CB    1 
ATOM   6024  O  OG1   . THR B  2 540  ? 111.286 97.199  178.325 1.00 347.08 ? 540  THR B OG1   1 
ATOM   6025  C  CG2   . THR B  2 540  ? 113.588 96.577  177.941 1.00 340.70 ? 540  THR B CG2   1 
ATOM   6026  N  N     . SER B  2 541  ? 110.190 96.154  181.084 1.00 347.76 ? 541  SER B N     1 
ATOM   6027  C  CA    . SER B  2 541  ? 109.335 96.512  182.213 1.00 342.29 ? 541  SER B CA    1 
ATOM   6028  C  C     . SER B  2 541  ? 109.596 95.606  183.411 1.00 339.30 ? 541  SER B C     1 
ATOM   6029  O  O     . SER B  2 541  ? 109.696 96.080  184.550 1.00 332.73 ? 541  SER B O     1 
ATOM   6030  C  CB    . SER B  2 541  ? 107.864 96.446  181.797 1.00 344.66 ? 541  SER B CB    1 
ATOM   6031  O  OG    . SER B  2 541  ? 107.003 96.768  182.878 1.00 342.53 ? 541  SER B OG    1 
ATOM   6032  N  N     . ILE B  2 542  ? 109.708 94.295  183.171 1.00 348.61 ? 542  ILE B N     1 
ATOM   6033  C  CA    . ILE B  2 542  ? 110.058 93.376  184.254 1.00 345.82 ? 542  ILE B CA    1 
ATOM   6034  C  C     . ILE B  2 542  ? 111.428 93.724  184.828 1.00 341.74 ? 542  ILE B C     1 
ATOM   6035  O  O     . ILE B  2 542  ? 111.648 93.652  186.047 1.00 334.89 ? 542  ILE B O     1 
ATOM   6036  C  CB    . ILE B  2 542  ? 110.002 91.919  183.756 1.00 346.51 ? 542  ILE B CB    1 
ATOM   6037  C  CG1   . ILE B  2 542  ? 108.587 91.563  183.300 1.00 349.98 ? 542  ILE B CG1   1 
ATOM   6038  C  CG2   . ILE B  2 542  ? 110.461 90.960  184.841 1.00 341.80 ? 542  ILE B CG2   1 
ATOM   6039  C  CD1   . ILE B  2 542  ? 108.456 90.158  182.751 1.00 352.75 ? 542  ILE B CD1   1 
ATOM   6040  N  N     . SER B  2 543  ? 112.366 94.121  183.962 1.00 352.29 ? 543  SER B N     1 
ATOM   6041  C  CA    . SER B  2 543  ? 113.699 94.504  184.421 1.00 348.94 ? 543  SER B CA    1 
ATOM   6042  C  C     . SER B  2 543  ? 113.635 95.686  185.381 1.00 347.22 ? 543  SER B C     1 
ATOM   6043  O  O     . SER B  2 543  ? 114.267 95.669  186.447 1.00 340.11 ? 543  SER B O     1 
ATOM   6044  C  CB    . SER B  2 543  ? 114.590 94.836  183.222 1.00 350.83 ? 543  SER B CB    1 
ATOM   6045  O  OG    . SER B  2 543  ? 115.804 95.440  183.638 1.00 344.14 ? 543  SER B OG    1 
ATOM   6046  N  N     . ILE B  2 544  ? 112.884 96.731  185.015 1.00 347.86 ? 544  ILE B N     1 
ATOM   6047  C  CA    . ILE B  2 544  ? 112.790 97.906  185.883 1.00 344.49 ? 544  ILE B CA    1 
ATOM   6048  C  C     . ILE B  2 544  ? 112.064 97.557  187.180 1.00 347.10 ? 544  ILE B C     1 
ATOM   6049  O  O     . ILE B  2 544  ? 112.428 98.043  188.262 1.00 343.28 ? 544  ILE B O     1 
ATOM   6050  C  CB    . ILE B  2 544  ? 112.109 99.081  185.157 1.00 339.05 ? 544  ILE B CB    1 
ATOM   6051  C  CG1   . ILE B  2 544  ? 112.784 99.322  183.809 1.00 334.04 ? 544  ILE B CG1   1 
ATOM   6052  C  CG2   . ILE B  2 544  ? 112.215 100.349 186.000 1.00 334.68 ? 544  ILE B CG2   1 
ATOM   6053  C  CD1   . ILE B  2 544  ? 114.311 99.426  183.903 1.00 322.86 ? 544  ILE B CD1   1 
ATOM   6054  N  N     . PHE B  2 545  ? 111.028 96.716  187.092 1.00 348.08 ? 545  PHE B N     1 
ATOM   6055  C  CA    . PHE B  2 545  ? 110.343 96.245  188.293 1.00 348.86 ? 545  PHE B CA    1 
ATOM   6056  C  C     . PHE B  2 545  ? 111.322 95.600  189.263 1.00 348.07 ? 545  PHE B C     1 
ATOM   6057  O  O     . PHE B  2 545  ? 111.302 95.885  190.464 1.00 350.69 ? 545  PHE B O     1 
ATOM   6058  C  CB    . PHE B  2 545  ? 109.243 95.250  187.921 1.00 353.75 ? 545  PHE B CB    1 
ATOM   6059  C  CG    . PHE B  2 545  ? 108.755 94.417  189.083 1.00 356.68 ? 545  PHE B CG    1 
ATOM   6060  C  CD1   . PHE B  2 545  ? 108.289 95.026  190.235 1.00 364.01 ? 545  PHE B CD1   1 
ATOM   6061  C  CD2   . PHE B  2 545  ? 108.756 93.026  189.019 1.00 352.98 ? 545  PHE B CD2   1 
ATOM   6062  C  CE1   . PHE B  2 545  ? 107.842 94.275  191.305 1.00 368.61 ? 545  PHE B CE1   1 
ATOM   6063  C  CE2   . PHE B  2 545  ? 108.307 92.263  190.091 1.00 355.64 ? 545  PHE B CE2   1 
ATOM   6064  C  CZ    . PHE B  2 545  ? 107.851 92.889  191.234 1.00 362.44 ? 545  PHE B CZ    1 
ATOM   6065  N  N     . MET B  2 546  ? 112.169 94.702  188.762 1.00 355.29 ? 546  MET B N     1 
ATOM   6066  C  CA    . MET B  2 546  ? 113.131 94.036  189.632 1.00 353.99 ? 546  MET B CA    1 
ATOM   6067  C  C     . MET B  2 546  ? 114.130 95.038  190.197 1.00 352.50 ? 546  MET B C     1 
ATOM   6068  O  O     . MET B  2 546  ? 114.369 95.083  191.414 1.00 356.05 ? 546  MET B O     1 
ATOM   6069  C  CB    . MET B  2 546  ? 113.845 92.926  188.864 1.00 352.18 ? 546  MET B CB    1 
ATOM   6070  C  CG    . MET B  2 546  ? 112.955 91.749  188.504 1.00 352.82 ? 546  MET B CG    1 
ATOM   6071  S  SD    . MET B  2 546  ? 113.898 90.457  187.678 1.00 353.27 ? 546  MET B SD    1 
ATOM   6072  C  CE    . MET B  2 546  ? 115.213 90.208  188.868 1.00 359.96 ? 546  MET B CE    1 
ATOM   6073  N  N     . ASN B  2 547  ? 114.695 95.875  189.322 1.00 359.90 ? 547  ASN B N     1 
ATOM   6074  C  CA    . ASN B  2 547  ? 115.701 96.863  189.691 1.00 355.24 ? 547  ASN B CA    1 
ATOM   6075  C  C     . ASN B  2 547  ? 115.187 97.910  190.661 1.00 355.57 ? 547  ASN B C     1 
ATOM   6076  O  O     . ASN B  2 547  ? 115.995 98.680  191.191 1.00 353.10 ? 547  ASN B O     1 
ATOM   6077  C  CB    . ASN B  2 547  ? 116.236 97.561  188.440 1.00 348.59 ? 547  ASN B CB    1 
ATOM   6078  C  CG    . ASN B  2 547  ? 117.057 96.637  187.570 1.00 345.55 ? 547  ASN B CG    1 
ATOM   6079  O  OD1   . ASN B  2 547  ? 117.156 95.440  187.842 1.00 345.59 ? 547  ASN B OD1   1 
ATOM   6080  N  ND2   . ASN B  2 547  ? 117.651 97.186  186.516 1.00 347.07 ? 547  ASN B ND2   1 
ATOM   6081  N  N     . THR B  2 548  ? 113.874 97.999  190.869 1.00 354.45 ? 548  THR B N     1 
ATOM   6082  C  CA    . THR B  2 548  ? 113.370 98.797  191.983 1.00 355.44 ? 548  THR B CA    1 
ATOM   6083  C  C     . THR B  2 548  ? 112.955 97.957  193.186 1.00 364.48 ? 548  THR B C     1 
ATOM   6084  O  O     . THR B  2 548  ? 113.213 98.353  194.327 1.00 369.22 ? 548  THR B O     1 
ATOM   6085  C  CB    . THR B  2 548  ? 112.182 99.669  191.555 1.00 355.16 ? 548  THR B CB    1 
ATOM   6086  O  OG1   . THR B  2 548  ? 112.561 100.483 190.441 1.00 345.17 ? 548  THR B OG1   1 
ATOM   6087  C  CG2   . THR B  2 548  ? 111.760 100.587 192.699 1.00 357.38 ? 548  THR B CG2   1 
ATOM   6088  N  N     . ALA B  2 549  ? 112.326 96.799  192.965 1.00 362.50 ? 549  ALA B N     1 
ATOM   6089  C  CA    . ALA B  2 549  ? 111.741 96.044  194.068 1.00 371.02 ? 549  ALA B CA    1 
ATOM   6090  C  C     . ALA B  2 549  ? 112.807 95.403  194.945 1.00 374.75 ? 549  ALA B C     1 
ATOM   6091  O  O     . ALA B  2 549  ? 112.706 95.439  196.175 1.00 380.14 ? 549  ALA B O     1 
ATOM   6092  C  CB    . ALA B  2 549  ? 110.783 94.985  193.523 1.00 374.94 ? 549  ALA B CB    1 
ATOM   6093  N  N     . ILE B  2 550  ? 113.828 94.804  194.331 1.00 367.48 ? 550  ILE B N     1 
ATOM   6094  C  CA    . ILE B  2 550  ? 114.922 94.210  195.108 1.00 369.58 ? 550  ILE B CA    1 
ATOM   6095  C  C     . ILE B  2 550  ? 115.639 95.263  195.942 1.00 376.93 ? 550  ILE B C     1 
ATOM   6096  O  O     . ILE B  2 550  ? 115.926 94.998  197.122 1.00 381.67 ? 550  ILE B O     1 
ATOM   6097  C  CB    . ILE B  2 550  ? 115.882 93.451  194.179 1.00 365.59 ? 550  ILE B CB    1 
ATOM   6098  C  CG1   . ILE B  2 550  ? 115.097 92.519  193.243 1.00 361.76 ? 550  ILE B CG1   1 
ATOM   6099  C  CG2   . ILE B  2 550  ? 116.915 92.672  194.973 1.00 367.02 ? 550  ILE B CG2   1 
ATOM   6100  C  CD1   . ILE B  2 550  ? 115.962 91.824  192.220 1.00 357.38 ? 550  ILE B CD1   1 
ATOM   6101  N  N     . PRO B  2 551  ? 115.965 96.447  195.412 1.00 364.48 ? 551  PRO B N     1 
ATOM   6102  C  CA    . PRO B  2 551  ? 116.612 97.476  196.245 1.00 369.70 ? 551  PRO B CA    1 
ATOM   6103  C  C     . PRO B  2 551  ? 115.850 97.878  197.503 1.00 376.12 ? 551  PRO B C     1 
ATOM   6104  O  O     . PRO B  2 551  ? 116.441 97.943  198.596 1.00 381.69 ? 551  PRO B O     1 
ATOM   6105  C  CB    . PRO B  2 551  ? 116.733 98.636  195.251 1.00 363.53 ? 551  PRO B CB    1 
ATOM   6106  C  CG    . PRO B  2 551  ? 117.004 97.974  193.983 1.00 361.93 ? 551  PRO B CG    1 
ATOM   6107  C  CD    . PRO B  2 551  ? 116.083 96.792  193.984 1.00 358.28 ? 551  PRO B CD    1 
ATOM   6108  N  N     . ILE B  2 552  ? 114.557 98.179  197.378 1.00 356.95 ? 552  ILE B N     1 
ATOM   6109  C  CA    . ILE B  2 552  ? 113.787 98.667  198.520 1.00 363.94 ? 552  ILE B CA    1 
ATOM   6110  C  C     . ILE B  2 552  ? 113.683 97.588  199.593 1.00 368.59 ? 552  ILE B C     1 
ATOM   6111  O  O     . ILE B  2 552  ? 113.843 97.861  200.796 1.00 377.75 ? 552  ILE B O     1 
ATOM   6112  C  CB    . ILE B  2 552  ? 112.402 99.148  198.045 1.00 366.97 ? 552  ILE B CB    1 
ATOM   6113  C  CG1   . ILE B  2 552  ? 112.558 100.269 197.015 1.00 362.97 ? 552  ILE B CG1   1 
ATOM   6114  C  CG2   . ILE B  2 552  ? 111.559 99.609  199.217 1.00 388.21 ? 552  ILE B CG2   1 
ATOM   6115  C  CD1   . ILE B  2 552  ? 111.250 100.842 196.513 1.00 369.79 ? 552  ILE B CD1   1 
ATOM   6116  N  N     . ALA B  2 553  ? 113.419 96.347  199.173 1.00 369.80 ? 553  ALA B N     1 
ATOM   6117  C  CA    . ALA B  2 553  ? 113.414 95.232  200.111 1.00 372.84 ? 553  ALA B CA    1 
ATOM   6118  C  C     . ALA B  2 553  ? 114.752 95.114  200.824 1.00 373.52 ? 553  ALA B C     1 
ATOM   6119  O  O     . ALA B  2 553  ? 114.795 94.890  202.039 1.00 379.52 ? 553  ALA B O     1 
ATOM   6120  C  CB    . ALA B  2 553  ? 113.074 93.931  199.380 1.00 369.45 ? 553  ALA B CB    1 
ATOM   6121  N  N     . ALA B  2 554  ? 115.857 95.278  200.086 1.00 365.67 ? 554  ALA B N     1 
ATOM   6122  C  CA    . ALA B  2 554  ? 117.182 95.209  200.701 1.00 366.02 ? 554  ALA B CA    1 
ATOM   6123  C  C     . ALA B  2 554  ? 117.335 96.230  201.819 1.00 372.65 ? 554  ALA B C     1 
ATOM   6124  O  O     . ALA B  2 554  ? 117.758 95.895  202.935 1.00 379.96 ? 554  ALA B O     1 
ATOM   6125  C  CB    . ALA B  2 554  ? 118.260 95.431  199.646 1.00 357.47 ? 554  ALA B CB    1 
ATOM   6126  N  N     . VAL B  2 555  ? 117.024 97.491  201.519 1.00 362.44 ? 555  VAL B N     1 
ATOM   6127  C  CA    . VAL B  2 555  ? 117.181 98.554  202.514 1.00 366.34 ? 555  VAL B CA    1 
ATOM   6128  C  C     . VAL B  2 555  ? 116.355 98.239  203.758 1.00 374.76 ? 555  VAL B C     1 
ATOM   6129  O  O     . VAL B  2 555  ? 116.862 98.267  204.896 1.00 375.39 ? 555  VAL B O     1 
ATOM   6130  C  CB    . VAL B  2 555  ? 116.793 99.913  201.906 1.00 365.73 ? 555  VAL B CB    1 
ATOM   6131  C  CG1   . VAL B  2 555  ? 116.894 101.023 202.939 1.00 375.73 ? 555  VAL B CG1   1 
ATOM   6132  C  CG2   . VAL B  2 555  ? 117.673 100.222 200.715 1.00 354.34 ? 555  VAL B CG2   1 
ATOM   6133  N  N     . LEU B  2 556  ? 115.070 97.925  203.549 1.00 366.13 ? 556  LEU B N     1 
ATOM   6134  C  CA    . LEU B  2 556  ? 114.166 97.607  204.653 1.00 374.67 ? 556  LEU B CA    1 
ATOM   6135  C  C     . LEU B  2 556  ? 114.721 96.485  205.523 1.00 373.00 ? 556  LEU B C     1 
ATOM   6136  O  O     . LEU B  2 556  ? 114.797 96.610  206.756 1.00 375.03 ? 556  LEU B O     1 
ATOM   6137  C  CB    . LEU B  2 556  ? 112.787 97.230  204.093 1.00 379.12 ? 556  LEU B CB    1 
ATOM   6138  C  CG    . LEU B  2 556  ? 111.800 96.421  204.947 1.00 388.67 ? 556  LEU B CG    1 
ATOM   6139  C  CD1   . LEU B  2 556  ? 111.320 97.230  206.133 1.00 402.88 ? 556  LEU B CD1   1 
ATOM   6140  C  CD2   . LEU B  2 556  ? 110.610 95.904  204.124 1.00 392.75 ? 556  LEU B CD2   1 
ATOM   6141  N  N     . ILE B  2 557  ? 115.120 95.378  204.890 1.00 366.05 ? 557  ILE B N     1 
ATOM   6142  C  CA    . ILE B  2 557  ? 115.579 94.213  205.641 1.00 368.60 ? 557  ILE B CA    1 
ATOM   6143  C  C     . ILE B  2 557  ? 116.824 94.556  206.447 1.00 365.69 ? 557  ILE B C     1 
ATOM   6144  O  O     . ILE B  2 557  ? 116.914 94.237  207.638 1.00 366.69 ? 557  ILE B O     1 
ATOM   6145  C  CB    . ILE B  2 557  ? 115.822 93.018  204.699 1.00 371.47 ? 557  ILE B CB    1 
ATOM   6146  C  CG1   . ILE B  2 557  ? 114.521 92.601  204.003 1.00 374.24 ? 557  ILE B CG1   1 
ATOM   6147  C  CG2   . ILE B  2 557  ? 116.417 91.834  205.460 1.00 376.51 ? 557  ILE B CG2   1 
ATOM   6148  C  CD1   . ILE B  2 557  ? 113.361 92.353  204.942 1.00 379.93 ? 557  ILE B CD1   1 
ATOM   6149  N  N     . THR B  2 558  ? 117.799 95.222  205.819 1.00 366.71 ? 558  THR B N     1 
ATOM   6150  C  CA    . THR B  2 558  ? 119.044 95.528  206.523 1.00 363.89 ? 558  THR B CA    1 
ATOM   6151  C  C     . THR B  2 558  ? 118.786 96.384  207.760 1.00 366.06 ? 558  THR B C     1 
ATOM   6152  O  O     . THR B  2 558  ? 119.274 96.077  208.860 1.00 366.95 ? 558  THR B O     1 
ATOM   6153  C  CB    . THR B  2 558  ? 120.030 96.224  205.577 1.00 357.02 ? 558  THR B CB    1 
ATOM   6154  O  OG1   . THR B  2 558  ? 119.395 97.352  204.960 1.00 358.05 ? 558  THR B OG1   1 
ATOM   6155  C  CG2   . THR B  2 558  ? 120.502 95.260  204.496 1.00 354.41 ? 558  THR B CG2   1 
ATOM   6156  N  N     . PHE B  2 559  ? 118.000 97.455  207.608 1.00 358.91 ? 559  PHE B N     1 
ATOM   6157  C  CA    . PHE B  2 559  ? 117.771 98.335  208.749 1.00 359.90 ? 559  PHE B CA    1 
ATOM   6158  C  C     . PHE B  2 559  ? 117.021 97.617  209.867 1.00 364.45 ? 559  PHE B C     1 
ATOM   6159  O  O     . PHE B  2 559  ? 117.449 97.648  211.035 1.00 363.08 ? 559  PHE B O     1 
ATOM   6160  C  CB    . PHE B  2 559  ? 117.034 99.589  208.297 1.00 356.98 ? 559  PHE B CB    1 
ATOM   6161  C  CG    . PHE B  2 559  ? 117.939 100.620 207.712 1.00 350.40 ? 559  PHE B CG    1 
ATOM   6162  C  CD1   . PHE B  2 559  ? 118.709 101.415 208.538 1.00 345.77 ? 559  PHE B CD1   1 
ATOM   6163  C  CD2   . PHE B  2 559  ? 118.057 100.771 206.340 1.00 351.51 ? 559  PHE B CD2   1 
ATOM   6164  C  CE1   . PHE B  2 559  ? 119.560 102.351 208.017 1.00 335.30 ? 559  PHE B CE1   1 
ATOM   6165  C  CE2   . PHE B  2 559  ? 118.911 101.713 205.811 1.00 339.93 ? 559  PHE B CE2   1 
ATOM   6166  C  CZ    . PHE B  2 559  ? 119.661 102.505 206.652 1.00 331.18 ? 559  PHE B CZ    1 
ATOM   6167  N  N     . VAL B  2 560  ? 115.915 96.944  209.524 1.00 351.41 ? 560  VAL B N     1 
ATOM   6168  C  CA    . VAL B  2 560  ? 115.144 96.223  210.534 1.00 355.69 ? 560  VAL B CA    1 
ATOM   6169  C  C     . VAL B  2 560  ? 116.023 95.213  211.257 1.00 357.21 ? 560  VAL B C     1 
ATOM   6170  O  O     . VAL B  2 560  ? 115.939 95.060  212.483 1.00 358.43 ? 560  VAL B O     1 
ATOM   6171  C  CB    . VAL B  2 560  ? 113.918 95.551  209.893 1.00 363.41 ? 560  VAL B CB    1 
ATOM   6172  C  CG1   . VAL B  2 560  ? 113.232 94.625  210.887 1.00 370.24 ? 560  VAL B CG1   1 
ATOM   6173  C  CG2   . VAL B  2 560  ? 112.942 96.604  209.392 1.00 367.80 ? 560  VAL B CG2   1 
ATOM   6174  N  N     . GLY B  2 561  ? 116.891 94.522  210.517 1.00 360.99 ? 561  GLY B N     1 
ATOM   6175  C  CA    . GLY B  2 561  ? 117.781 93.563  211.144 1.00 362.84 ? 561  GLY B CA    1 
ATOM   6176  C  C     . GLY B  2 561  ? 118.739 94.206  212.126 1.00 360.40 ? 561  GLY B C     1 
ATOM   6177  O  O     . GLY B  2 561  ? 119.006 93.657  213.198 1.00 360.89 ? 561  GLY B O     1 
ATOM   6178  N  N     . HIS B  2 562  ? 119.276 95.378  211.776 1.00 368.70 ? 562  HIS B N     1 
ATOM   6179  C  CA    . HIS B  2 562  ? 120.241 95.995  212.681 1.00 364.78 ? 562  HIS B CA    1 
ATOM   6180  C  C     . HIS B  2 562  ? 119.582 96.475  213.974 1.00 364.66 ? 562  HIS B C     1 
ATOM   6181  O  O     . HIS B  2 562  ? 120.132 96.269  215.058 1.00 363.42 ? 562  HIS B O     1 
ATOM   6182  C  CB    . HIS B  2 562  ? 120.973 97.158  212.017 1.00 361.69 ? 562  HIS B CB    1 
ATOM   6183  C  CG    . HIS B  2 562  ? 121.948 97.838  212.932 1.00 356.08 ? 562  HIS B CG    1 
ATOM   6184  N  ND1   . HIS B  2 562  ? 123.249 97.408  213.089 1.00 354.01 ? 562  HIS B ND1   1 
ATOM   6185  C  CD2   . HIS B  2 562  ? 121.799 98.896  213.763 1.00 351.13 ? 562  HIS B CD2   1 
ATOM   6186  C  CE1   . HIS B  2 562  ? 123.865 98.185  213.961 1.00 351.15 ? 562  HIS B CE1   1 
ATOM   6187  N  NE2   . HIS B  2 562  ? 123.009 99.096  214.385 1.00 349.68 ? 562  HIS B NE2   1 
ATOM   6188  N  N     . VAL B  2 563  ? 118.409 97.115  213.891 1.00 362.09 ? 563  VAL B N     1 
ATOM   6189  C  CA    . VAL B  2 563  ? 117.875 97.801  215.074 1.00 358.70 ? 563  VAL B CA    1 
ATOM   6190  C  C     . VAL B  2 563  ? 117.480 96.803  216.164 1.00 361.18 ? 563  VAL B C     1 
ATOM   6191  O  O     . VAL B  2 563  ? 117.921 96.915  217.310 1.00 359.87 ? 563  VAL B O     1 
ATOM   6192  C  CB    . VAL B  2 563  ? 116.689 98.717  214.705 1.00 354.98 ? 563  VAL B CB    1 
ATOM   6193  C  CG1   . VAL B  2 563  ? 117.184 100.117 214.334 1.00 349.77 ? 563  VAL B CG1   1 
ATOM   6194  C  CG2   . VAL B  2 563  ? 115.851 98.110  213.609 1.00 348.77 ? 563  VAL B CG2   1 
ATOM   6195  N  N     . SER B  2 564  ? 116.641 95.819  215.832 1.00 350.91 ? 564  SER B N     1 
ATOM   6196  C  CA    . SER B  2 564  ? 116.017 94.948  216.831 1.00 355.22 ? 564  SER B CA    1 
ATOM   6197  C  C     . SER B  2 564  ? 116.301 93.464  216.645 1.00 356.60 ? 564  SER B C     1 
ATOM   6198  O  O     . SER B  2 564  ? 116.176 92.705  217.616 1.00 358.63 ? 564  SER B O     1 
ATOM   6199  C  CB    . SER B  2 564  ? 114.492 95.160  216.854 1.00 359.39 ? 564  SER B CB    1 
ATOM   6200  O  OG    . SER B  2 564  ? 113.906 94.837  215.611 1.00 362.23 ? 564  SER B OG    1 
ATOM   6201  N  N     . PHE B  2 565  ? 116.681 93.022  215.447 1.00 357.26 ? 565  PHE B N     1 
ATOM   6202  C  CA    . PHE B  2 565  ? 116.817 91.588  215.215 1.00 359.59 ? 565  PHE B CA    1 
ATOM   6203  C  C     . PHE B  2 565  ? 118.019 91.020  215.967 1.00 356.17 ? 565  PHE B C     1 
ATOM   6204  O  O     . PHE B  2 565  ? 117.870 90.127  216.810 1.00 359.15 ? 565  PHE B O     1 
ATOM   6205  C  CB    . PHE B  2 565  ? 116.881 91.308  213.710 1.00 365.16 ? 565  PHE B CB    1 
ATOM   6206  C  CG    . PHE B  2 565  ? 117.812 90.182  213.316 1.00 372.60 ? 565  PHE B CG    1 
ATOM   6207  C  CD1   . PHE B  2 565  ? 117.431 88.855  213.442 1.00 379.34 ? 565  PHE B CD1   1 
ATOM   6208  C  CD2   . PHE B  2 565  ? 119.047 90.466  212.747 1.00 372.30 ? 565  PHE B CD2   1 
ATOM   6209  C  CE1   . PHE B  2 565  ? 118.281 87.832  213.045 1.00 385.37 ? 565  PHE B CE1   1 
ATOM   6210  C  CE2   . PHE B  2 565  ? 119.900 89.451  212.349 1.00 379.97 ? 565  PHE B CE2   1 
ATOM   6211  C  CZ    . PHE B  2 565  ? 119.516 88.133  212.498 1.00 385.79 ? 565  PHE B CZ    1 
ATOM   6212  N  N     . PHE B  2 566  ? 119.223 91.517  215.676 1.00 371.01 ? 566  PHE B N     1 
ATOM   6213  C  CA    . PHE B  2 566  ? 120.348 90.940  216.405 1.00 362.50 ? 566  PHE B CA    1 
ATOM   6214  C  C     . PHE B  2 566  ? 121.303 91.964  217.006 1.00 355.64 ? 566  PHE B C     1 
ATOM   6215  O  O     . PHE B  2 566  ? 121.801 91.754  218.116 1.00 352.74 ? 566  PHE B O     1 
ATOM   6216  C  CB    . PHE B  2 566  ? 121.126 90.001  215.476 1.00 362.90 ? 566  PHE B CB    1 
ATOM   6217  C  CG    . PHE B  2 566  ? 122.127 89.136  216.181 1.00 362.04 ? 566  PHE B CG    1 
ATOM   6218  C  CD1   . PHE B  2 566  ? 121.731 87.970  216.823 1.00 365.50 ? 566  PHE B CD1   1 
ATOM   6219  C  CD2   . PHE B  2 566  ? 123.467 89.473  216.186 1.00 359.48 ? 566  PHE B CD2   1 
ATOM   6220  C  CE1   . PHE B  2 566  ? 122.659 87.169  217.464 1.00 364.74 ? 566  PHE B CE1   1 
ATOM   6221  C  CE2   . PHE B  2 566  ? 124.399 88.678  216.824 1.00 360.30 ? 566  PHE B CE2   1 
ATOM   6222  C  CZ    . PHE B  2 566  ? 123.995 87.523  217.465 1.00 363.55 ? 566  PHE B CZ    1 
ATOM   6223  N  N     . LYS B  2 567  ? 121.561 93.078  216.306 1.00 381.02 ? 567  LYS B N     1 
ATOM   6224  C  CA    . LYS B  2 567  ? 122.832 93.779  216.484 1.00 368.72 ? 567  LYS B CA    1 
ATOM   6225  C  C     . LYS B  2 567  ? 122.951 94.431  217.859 1.00 363.84 ? 567  LYS B C     1 
ATOM   6226  O  O     . LYS B  2 567  ? 124.046 94.472  218.429 1.00 359.37 ? 567  LYS B O     1 
ATOM   6227  C  CB    . LYS B  2 567  ? 123.018 94.811  215.376 1.00 363.08 ? 567  LYS B CB    1 
ATOM   6228  C  CG    . LYS B  2 567  ? 124.341 94.673  214.619 1.00 354.37 ? 567  LYS B CG    1 
ATOM   6229  C  CD    . LYS B  2 567  ? 125.555 94.920  215.516 1.00 343.05 ? 567  LYS B CD    1 
ATOM   6230  C  CE    . LYS B  2 567  ? 126.859 94.834  214.729 1.00 336.58 ? 567  LYS B CE    1 
ATOM   6231  N  NZ    . LYS B  2 567  ? 128.052 95.111  215.580 1.00 331.10 ? 567  LYS B NZ    1 
ATOM   6232  N  N     . GLU B  2 568  ? 121.853 94.965  218.397 1.00 370.26 ? 568  GLU B N     1 
ATOM   6233  C  CA    . GLU B  2 568  ? 121.810 95.637  219.697 1.00 364.79 ? 568  GLU B CA    1 
ATOM   6234  C  C     . GLU B  2 568  ? 122.686 96.886  219.762 1.00 360.51 ? 568  GLU B C     1 
ATOM   6235  O  O     . GLU B  2 568  ? 122.863 97.455  220.846 1.00 356.32 ? 568  GLU B O     1 
ATOM   6236  C  CB    . GLU B  2 568  ? 122.188 94.685  220.842 1.00 363.08 ? 568  GLU B CB    1 
ATOM   6237  C  CG    . GLU B  2 568  ? 121.130 93.644  221.175 1.00 363.94 ? 568  GLU B CG    1 
ATOM   6238  C  CD    . GLU B  2 568  ? 119.955 94.222  221.942 1.00 363.54 ? 568  GLU B CD    1 
ATOM   6239  O  OE1   . GLU B  2 568  ? 120.013 95.409  222.327 1.00 362.28 ? 568  GLU B OE1   1 
ATOM   6240  O  OE2   . GLU B  2 568  ? 118.972 93.485  222.165 1.00 364.33 ? 568  GLU B OE2   1 
ATOM   6241  N  N     . SER B  2 569  ? 123.240 97.330  218.639 1.00 364.62 ? 569  SER B N     1 
ATOM   6242  C  CA    . SER B  2 569  ? 123.976 98.587  218.554 1.00 356.96 ? 569  SER B CA    1 
ATOM   6243  C  C     . SER B  2 569  ? 123.091 99.575  217.806 1.00 352.47 ? 569  SER B C     1 
ATOM   6244  O  O     . SER B  2 569  ? 122.812 99.384  216.619 1.00 354.41 ? 569  SER B O     1 
ATOM   6245  C  CB    . SER B  2 569  ? 125.321 98.396  217.852 1.00 358.96 ? 569  SER B CB    1 
ATOM   6246  O  OG    . SER B  2 569  ? 126.063 99.605  217.823 1.00 365.76 ? 569  SER B OG    1 
ATOM   6247  N  N     . ASP B  2 570  ? 122.636 100.616 218.501 1.00 343.61 ? 570  ASP B N     1 
ATOM   6248  C  CA    . ASP B  2 570  ? 121.711 101.568 217.899 1.00 341.09 ? 570  ASP B CA    1 
ATOM   6249  C  C     . ASP B  2 570  ? 122.351 102.246 216.697 1.00 335.99 ? 570  ASP B C     1 
ATOM   6250  O  O     . ASP B  2 570  ? 123.391 102.900 216.823 1.00 336.49 ? 570  ASP B O     1 
ATOM   6251  C  CB    . ASP B  2 570  ? 121.283 102.613 218.929 1.00 340.46 ? 570  ASP B CB    1 
ATOM   6252  C  CG    . ASP B  2 570  ? 120.435 102.024 220.032 1.00 342.18 ? 570  ASP B CG    1 
ATOM   6253  O  OD1   . ASP B  2 570  ? 120.124 100.818 219.963 1.00 343.18 ? 570  ASP B OD1   1 
ATOM   6254  O  OD2   . ASP B  2 570  ? 120.078 102.770 220.969 1.00 341.42 ? 570  ASP B OD2   1 
ATOM   6255  N  N     . LEU B  2 571  ? 121.728 102.092 215.530 1.00 343.28 ? 571  LEU B N     1 
ATOM   6256  C  CA    . LEU B  2 571  ? 122.242 102.717 214.315 1.00 339.79 ? 571  LEU B CA    1 
ATOM   6257  C  C     . LEU B  2 571  ? 122.092 104.225 214.445 1.00 334.04 ? 571  LEU B C     1 
ATOM   6258  O  O     . LEU B  2 571  ? 120.984 104.765 214.391 1.00 337.35 ? 571  LEU B O     1 
ATOM   6259  C  CB    . LEU B  2 571  ? 121.535 102.188 213.069 1.00 346.40 ? 571  LEU B CB    1 
ATOM   6260  C  CG    . LEU B  2 571  ? 120.025 101.962 212.940 1.00 349.57 ? 571  LEU B CG    1 
ATOM   6261  C  CD1   . LEU B  2 571  ? 119.271 103.199 212.475 1.00 355.73 ? 571  LEU B CD1   1 
ATOM   6262  C  CD2   . LEU B  2 571  ? 119.790 100.829 211.962 1.00 359.92 ? 571  LEU B CD2   1 
ATOM   6263  N  N     . SER B  2 572  ? 123.210 104.906 214.659 1.00 348.53 ? 572  SER B N     1 
ATOM   6264  C  CA    . SER B  2 572  ? 123.197 106.353 214.608 1.00 342.08 ? 572  SER B CA    1 
ATOM   6265  C  C     . SER B  2 572  ? 122.758 106.798 213.213 1.00 340.33 ? 572  SER B C     1 
ATOM   6266  O  O     . SER B  2 572  ? 123.070 106.138 212.218 1.00 343.59 ? 572  SER B O     1 
ATOM   6267  C  CB    . SER B  2 572  ? 124.576 106.916 214.940 1.00 336.78 ? 572  SER B CB    1 
ATOM   6268  O  OG    . SER B  2 572  ? 125.592 106.218 214.245 1.00 333.91 ? 572  SER B OG    1 
ATOM   6269  N  N     . PRO B  2 573  ? 122.023 107.904 213.118 1.00 345.27 ? 573  PRO B N     1 
ATOM   6270  C  CA    . PRO B  2 573  ? 121.492 108.335 211.812 1.00 345.14 ? 573  PRO B CA    1 
ATOM   6271  C  C     . PRO B  2 573  ? 122.553 108.471 210.726 1.00 338.47 ? 573  PRO B C     1 
ATOM   6272  O  O     . PRO B  2 573  ? 122.236 108.321 209.534 1.00 340.80 ? 573  PRO B O     1 
ATOM   6273  C  CB    . PRO B  2 573  ? 120.837 109.685 212.140 1.00 345.81 ? 573  PRO B CB    1 
ATOM   6274  C  CG    . PRO B  2 573  ? 120.498 109.587 213.607 1.00 348.60 ? 573  PRO B CG    1 
ATOM   6275  C  CD    . PRO B  2 573  ? 121.598 108.784 214.217 1.00 348.65 ? 573  PRO B CD    1 
ATOM   6276  N  N     . SER B  2 574  ? 123.805 108.739 211.109 1.00 374.35 ? 574  SER B N     1 
ATOM   6277  C  CA    . SER B  2 574  ? 124.891 108.828 210.137 1.00 367.37 ? 574  SER B CA    1 
ATOM   6278  C  C     . SER B  2 574  ? 125.016 107.538 209.338 1.00 374.67 ? 574  SER B C     1 
ATOM   6279  O  O     . SER B  2 574  ? 125.125 107.563 208.104 1.00 377.62 ? 574  SER B O     1 
ATOM   6280  C  CB    . SER B  2 574  ? 126.213 109.132 210.847 1.00 352.40 ? 574  SER B CB    1 
ATOM   6281  O  OG    . SER B  2 574  ? 126.031 109.959 211.982 1.00 350.71 ? 574  SER B OG    1 
ATOM   6282  N  N     . VAL B  2 575  ? 125.018 106.399 210.032 1.00 329.59 ? 575  VAL B N     1 
ATOM   6283  C  CA    . VAL B  2 575  ? 125.105 105.106 209.362 1.00 331.90 ? 575  VAL B CA    1 
ATOM   6284  C  C     . VAL B  2 575  ? 123.944 104.933 208.396 1.00 336.87 ? 575  VAL B C     1 
ATOM   6285  O  O     . VAL B  2 575  ? 124.126 104.504 207.249 1.00 339.00 ? 575  VAL B O     1 
ATOM   6286  C  CB    . VAL B  2 575  ? 125.149 103.974 210.406 1.00 335.42 ? 575  VAL B CB    1 
ATOM   6287  C  CG1   . VAL B  2 575  ? 125.213 102.616 209.725 1.00 348.34 ? 575  VAL B CG1   1 
ATOM   6288  C  CG2   . VAL B  2 575  ? 126.330 104.163 211.350 1.00 330.06 ? 575  VAL B CG2   1 
ATOM   6289  N  N     . ALA B  2 576  ? 122.735 105.292 208.839 1.00 331.98 ? 576  ALA B N     1 
ATOM   6290  C  CA    . ALA B  2 576  ? 121.540 105.138 208.014 1.00 338.32 ? 576  ALA B CA    1 
ATOM   6291  C  C     . ALA B  2 576  ? 121.656 105.919 206.711 1.00 336.56 ? 576  ALA B C     1 
ATOM   6292  O  O     . ALA B  2 576  ? 121.458 105.371 205.615 1.00 340.43 ? 576  ALA B O     1 
ATOM   6293  C  CB    . ALA B  2 576  ? 120.312 105.598 208.799 1.00 344.93 ? 576  ALA B CB    1 
ATOM   6294  N  N     . PHE B  2 577  ? 121.981 107.206 206.814 1.00 308.04 ? 577  PHE B N     1 
ATOM   6295  C  CA    . PHE B  2 577  ? 121.997 108.043 205.621 1.00 310.09 ? 577  PHE B CA    1 
ATOM   6296  C  C     . PHE B  2 577  ? 123.170 107.695 204.710 1.00 310.14 ? 577  PHE B C     1 
ATOM   6297  O  O     . PHE B  2 577  ? 123.032 107.721 203.479 1.00 318.66 ? 577  PHE B O     1 
ATOM   6298  C  CB    . PHE B  2 577  ? 122.014 109.514 206.024 1.00 307.69 ? 577  PHE B CB    1 
ATOM   6299  C  CG    . PHE B  2 577  ? 120.690 110.008 206.533 1.00 309.37 ? 577  PHE B CG    1 
ATOM   6300  C  CD1   . PHE B  2 577  ? 119.688 110.364 205.647 1.00 312.19 ? 577  PHE B CD1   1 
ATOM   6301  C  CD2   . PHE B  2 577  ? 120.439 110.105 207.891 1.00 310.90 ? 577  PHE B CD2   1 
ATOM   6302  C  CE1   . PHE B  2 577  ? 118.470 110.814 206.106 1.00 318.82 ? 577  PHE B CE1   1 
ATOM   6303  C  CE2   . PHE B  2 577  ? 119.222 110.554 208.354 1.00 315.94 ? 577  PHE B CE2   1 
ATOM   6304  C  CZ    . PHE B  2 577  ? 118.238 110.908 207.459 1.00 323.82 ? 577  PHE B CZ    1 
ATOM   6305  N  N     . ALA B  2 578  ? 124.325 107.343 205.285 1.00 336.85 ? 578  ALA B N     1 
ATOM   6306  C  CA    . ALA B  2 578  ? 125.450 106.920 204.457 1.00 336.55 ? 578  ALA B CA    1 
ATOM   6307  C  C     . ALA B  2 578  ? 125.125 105.636 203.705 1.00 338.66 ? 578  ALA B C     1 
ATOM   6308  O  O     . ALA B  2 578  ? 125.501 105.475 202.534 1.00 336.84 ? 578  ALA B O     1 
ATOM   6309  C  CB    . ALA B  2 578  ? 126.699 106.741 205.321 1.00 334.98 ? 578  ALA B CB    1 
ATOM   6310  N  N     . SER B  2 579  ? 124.414 104.711 204.359 1.00 335.96 ? 579  SER B N     1 
ATOM   6311  C  CA    . SER B  2 579  ? 123.984 103.496 203.683 1.00 338.83 ? 579  SER B CA    1 
ATOM   6312  C  C     . SER B  2 579  ? 123.033 103.815 202.538 1.00 336.91 ? 579  SER B C     1 
ATOM   6313  O  O     . SER B  2 579  ? 123.167 103.260 201.441 1.00 338.35 ? 579  SER B O     1 
ATOM   6314  C  CB    . SER B  2 579  ? 123.322 102.549 204.680 1.00 348.35 ? 579  SER B CB    1 
ATOM   6315  O  OG    . SER B  2 579  ? 122.204 103.174 205.285 1.00 349.52 ? 579  SER B OG    1 
ATOM   6316  N  N     . LEU B  2 580  ? 122.065 104.708 202.775 1.00 339.27 ? 580  LEU B N     1 
ATOM   6317  C  CA    . LEU B  2 580  ? 121.150 105.093 201.701 1.00 339.38 ? 580  LEU B CA    1 
ATOM   6318  C  C     . LEU B  2 580  ? 121.905 105.698 200.522 1.00 333.94 ? 580  LEU B C     1 
ATOM   6319  O  O     . LEU B  2 580  ? 121.596 105.410 199.358 1.00 333.17 ? 580  LEU B O     1 
ATOM   6320  C  CB    . LEU B  2 580  ? 120.098 106.074 202.222 1.00 341.62 ? 580  LEU B CB    1 
ATOM   6321  C  CG    . LEU B  2 580  ? 119.085 106.580 201.189 1.00 347.43 ? 580  LEU B CG    1 
ATOM   6322  C  CD1   . LEU B  2 580  ? 118.313 105.424 200.566 1.00 354.45 ? 580  LEU B CD1   1 
ATOM   6323  C  CD2   . LEU B  2 580  ? 118.133 107.590 201.813 1.00 351.90 ? 580  LEU B CD2   1 
ATOM   6324  N  N     . SER B  2 581  ? 122.914 106.523 200.806 1.00 340.44 ? 581  SER B N     1 
ATOM   6325  C  CA    . SER B  2 581  ? 123.688 107.157 199.743 1.00 335.94 ? 581  SER B CA    1 
ATOM   6326  C  C     . SER B  2 581  ? 124.453 106.126 198.917 1.00 330.05 ? 581  SER B C     1 
ATOM   6327  O  O     . SER B  2 581  ? 124.336 106.090 197.681 1.00 329.51 ? 581  SER B O     1 
ATOM   6328  C  CB    . SER B  2 581  ? 124.646 108.189 200.343 1.00 330.63 ? 581  SER B CB    1 
ATOM   6329  O  OG    . SER B  2 581  ? 123.943 109.149 201.110 1.00 333.19 ? 581  SER B OG    1 
ATOM   6330  N  N     . LEU B  2 582  ? 125.261 105.292 199.584 1.00 331.03 ? 582  LEU B N     1 
ATOM   6331  C  CA    . LEU B  2 582  ? 126.007 104.250 198.879 1.00 329.56 ? 582  LEU B CA    1 
ATOM   6332  C  C     . LEU B  2 582  ? 125.071 103.350 198.087 1.00 328.06 ? 582  LEU B C     1 
ATOM   6333  O  O     . LEU B  2 582  ? 125.387 102.921 196.969 1.00 319.82 ? 582  LEU B O     1 
ATOM   6334  C  CB    . LEU B  2 582  ? 126.820 103.414 199.871 1.00 332.19 ? 582  LEU B CB    1 
ATOM   6335  C  CG    . LEU B  2 582  ? 128.122 103.995 200.424 1.00 333.13 ? 582  LEU B CG    1 
ATOM   6336  C  CD1   . LEU B  2 582  ? 128.738 103.053 201.451 1.00 348.28 ? 582  LEU B CD1   1 
ATOM   6337  C  CD2   . LEU B  2 582  ? 129.104 104.276 199.299 1.00 323.59 ? 582  LEU B CD2   1 
ATOM   6338  N  N     . PHE B  2 583  ? 123.903 103.066 198.655 1.00 325.67 ? 583  PHE B N     1 
ATOM   6339  C  CA    . PHE B  2 583  ? 122.934 102.198 198.010 1.00 324.84 ? 583  PHE B CA    1 
ATOM   6340  C  C     . PHE B  2 583  ? 122.391 102.817 196.728 1.00 316.01 ? 583  PHE B C     1 
ATOM   6341  O  O     . PHE B  2 583  ? 122.254 102.133 195.707 1.00 317.79 ? 583  PHE B O     1 
ATOM   6342  C  CB    . PHE B  2 583  ? 121.833 101.911 199.021 1.00 336.48 ? 583  PHE B CB    1 
ATOM   6343  C  CG    . PHE B  2 583  ? 120.621 101.323 198.436 1.00 345.58 ? 583  PHE B CG    1 
ATOM   6344  C  CD1   . PHE B  2 583  ? 120.537 99.962  198.237 1.00 353.48 ? 583  PHE B CD1   1 
ATOM   6345  C  CD2   . PHE B  2 583  ? 119.553 102.129 198.092 1.00 350.75 ? 583  PHE B CD2   1 
ATOM   6346  C  CE1   . PHE B  2 583  ? 119.414 99.417  197.699 1.00 368.49 ? 583  PHE B CE1   1 
ATOM   6347  C  CE2   . PHE B  2 583  ? 118.431 101.590 197.553 1.00 361.83 ? 583  PHE B CE2   1 
ATOM   6348  C  CZ    . PHE B  2 583  ? 118.361 100.236 197.364 1.00 370.63 ? 583  PHE B CZ    1 
ATOM   6349  N  N     . HIS B  2 584  ? 122.069 104.113 196.762 1.00 329.78 ? 584  HIS B N     1 
ATOM   6350  C  CA    . HIS B  2 584  ? 121.625 104.803 195.553 1.00 324.53 ? 584  HIS B CA    1 
ATOM   6351  C  C     . HIS B  2 584  ? 122.711 104.791 194.478 1.00 321.80 ? 584  HIS B C     1 
ATOM   6352  O  O     . HIS B  2 584  ? 122.428 104.579 193.281 1.00 319.33 ? 584  HIS B O     1 
ATOM   6353  C  CB    . HIS B  2 584  ? 121.234 106.236 195.905 1.00 322.56 ? 584  HIS B CB    1 
ATOM   6354  C  CG    . HIS B  2 584  ? 120.432 106.920 194.847 1.00 320.46 ? 584  HIS B CG    1 
ATOM   6355  N  ND1   . HIS B  2 584  ? 119.057 106.993 194.890 1.00 317.78 ? 584  HIS B ND1   1 
ATOM   6356  C  CD2   . HIS B  2 584  ? 120.810 107.550 193.712 1.00 318.47 ? 584  HIS B CD2   1 
ATOM   6357  C  CE1   . HIS B  2 584  ? 118.622 107.646 193.828 1.00 312.42 ? 584  HIS B CE1   1 
ATOM   6358  N  NE2   . HIS B  2 584  ? 119.664 107.991 193.096 1.00 312.13 ? 584  HIS B NE2   1 
ATOM   6359  N  N     . ILE B  2 585  ? 123.960 105.037 194.889 1.00 312.24 ? 585  ILE B N     1 
ATOM   6360  C  CA    . ILE B  2 585  ? 125.076 104.982 193.946 1.00 311.17 ? 585  ILE B CA    1 
ATOM   6361  C  C     . ILE B  2 585  ? 125.163 103.602 193.307 1.00 309.38 ? 585  ILE B C     1 
ATOM   6362  O  O     . ILE B  2 585  ? 125.458 103.473 192.115 1.00 307.48 ? 585  ILE B O     1 
ATOM   6363  C  CB    . ILE B  2 585  ? 126.396 105.364 194.642 1.00 310.40 ? 585  ILE B CB    1 
ATOM   6364  C  CG1   . ILE B  2 585  ? 126.265 106.710 195.347 1.00 310.54 ? 585  ILE B CG1   1 
ATOM   6365  C  CG2   . ILE B  2 585  ? 127.520 105.441 193.632 1.00 303.67 ? 585  ILE B CG2   1 
ATOM   6366  C  CD1   . ILE B  2 585  ? 125.910 107.845 194.424 1.00 307.97 ? 585  ILE B CD1   1 
ATOM   6367  N  N     . LEU B  2 586  ? 124.914 102.549 194.091 1.00 319.91 ? 586  LEU B N     1 
ATOM   6368  C  CA    . LEU B  2 586  ? 124.920 101.199 193.530 1.00 316.64 ? 586  LEU B CA    1 
ATOM   6369  C  C     . LEU B  2 586  ? 123.737 100.980 192.589 1.00 313.70 ? 586  LEU B C     1 
ATOM   6370  O  O     . LEU B  2 586  ? 123.853 100.254 191.594 1.00 310.87 ? 586  LEU B O     1 
ATOM   6371  C  CB    . LEU B  2 586  ? 124.900 100.165 194.652 1.00 323.15 ? 586  LEU B CB    1 
ATOM   6372  C  CG    . LEU B  2 586  ? 124.850 98.706  194.200 1.00 324.76 ? 586  LEU B CG    1 
ATOM   6373  C  CD1   . LEU B  2 586  ? 126.029 98.405  193.298 1.00 332.42 ? 586  LEU B CD1   1 
ATOM   6374  C  CD2   . LEU B  2 586  ? 124.833 97.765  195.394 1.00 318.24 ? 586  LEU B CD2   1 
ATOM   6375  N  N     . VAL B  2 587  ? 122.592 101.586 192.897 1.00 328.00 ? 587  VAL B N     1 
ATOM   6376  C  CA    . VAL B  2 587  ? 121.377 101.331 192.129 1.00 325.00 ? 587  VAL B CA    1 
ATOM   6377  C  C     . VAL B  2 587  ? 121.491 101.907 190.725 1.00 321.22 ? 587  VAL B C     1 
ATOM   6378  O  O     . VAL B  2 587  ? 121.064 101.275 189.749 1.00 320.78 ? 587  VAL B O     1 
ATOM   6379  C  CB    . VAL B  2 587  ? 120.152 101.890 192.877 1.00 327.61 ? 587  VAL B CB    1 
ATOM   6380  C  CG1   . VAL B  2 587  ? 118.963 102.034 191.939 1.00 325.92 ? 587  VAL B CG1   1 
ATOM   6381  C  CG2   . VAL B  2 587  ? 119.797 100.983 194.042 1.00 336.55 ? 587  VAL B CG2   1 
ATOM   6382  N  N     . THR B  2 588  ? 122.082 103.098 190.592 1.00 320.38 ? 588  THR B N     1 
ATOM   6383  C  CA    . THR B  2 588  ? 122.091 103.748 189.276 1.00 316.46 ? 588  THR B CA    1 
ATOM   6384  C  C     . THR B  2 588  ? 122.672 102.881 188.156 1.00 313.88 ? 588  THR B C     1 
ATOM   6385  O  O     . THR B  2 588  ? 122.052 102.827 187.078 1.00 314.09 ? 588  THR B O     1 
ATOM   6386  C  CB    . THR B  2 588  ? 122.808 105.099 189.353 1.00 314.68 ? 588  THR B CB    1 
ATOM   6387  O  OG1   . THR B  2 588  ? 122.106 105.959 190.255 1.00 322.35 ? 588  THR B OG1   1 
ATOM   6388  C  CG2   . THR B  2 588  ? 122.850 105.759 187.971 1.00 312.95 ? 588  THR B CG2   1 
ATOM   6389  N  N     . PRO B  2 589  ? 123.815 102.188 188.312 1.00 322.95 ? 589  PRO B N     1 
ATOM   6390  C  CA    . PRO B  2 589  ? 124.315 101.383 187.178 1.00 319.38 ? 589  PRO B CA    1 
ATOM   6391  C  C     . PRO B  2 589  ? 123.378 100.273 186.720 1.00 323.04 ? 589  PRO B C     1 
ATOM   6392  O  O     . PRO B  2 589  ? 123.344 99.968  185.522 1.00 321.49 ? 589  PRO B O     1 
ATOM   6393  C  CB    . PRO B  2 589  ? 125.643 100.825 187.708 1.00 313.92 ? 589  PRO B CB    1 
ATOM   6394  C  CG    . PRO B  2 589  ? 126.103 101.844 188.681 1.00 317.68 ? 589  PRO B CG    1 
ATOM   6395  C  CD    . PRO B  2 589  ? 124.829 102.271 189.381 1.00 323.28 ? 589  PRO B CD    1 
ATOM   6396  N  N     . LEU B  2 590  ? 122.622 99.654  187.633 1.00 325.74 ? 590  LEU B N     1 
ATOM   6397  C  CA    . LEU B  2 590  ? 121.781 98.517  187.255 1.00 327.60 ? 590  LEU B CA    1 
ATOM   6398  C  C     . LEU B  2 590  ? 120.693 98.924  186.270 1.00 324.94 ? 590  LEU B C     1 
ATOM   6399  O  O     . LEU B  2 590  ? 120.433 98.210  185.292 1.00 325.51 ? 590  LEU B O     1 
ATOM   6400  C  CB    . LEU B  2 590  ? 121.164 97.889  188.503 1.00 335.25 ? 590  LEU B CB    1 
ATOM   6401  C  CG    . LEU B  2 590  ? 122.162 97.392  189.548 1.00 340.31 ? 590  LEU B CG    1 
ATOM   6402  C  CD1   . LEU B  2 590  ? 121.444 97.052  190.838 1.00 357.60 ? 590  LEU B CD1   1 
ATOM   6403  C  CD2   . LEU B  2 590  ? 122.927 96.186  189.022 1.00 336.25 ? 590  LEU B CD2   1 
ATOM   6404  N  N     . PHE B  2 591  ? 120.038 100.062 186.513 1.00 311.37 ? 591  PHE B N     1 
ATOM   6405  C  CA    . PHE B  2 591  ? 119.066 100.583 185.557 1.00 314.07 ? 591  PHE B CA    1 
ATOM   6406  C  C     . PHE B  2 591  ? 119.717 100.843 184.203 1.00 308.30 ? 591  PHE B C     1 
ATOM   6407  O  O     . PHE B  2 591  ? 119.097 100.631 183.153 1.00 311.00 ? 591  PHE B O     1 
ATOM   6408  C  CB    . PHE B  2 591  ? 118.440 101.865 186.109 1.00 319.93 ? 591  PHE B CB    1 
ATOM   6409  C  CG    . PHE B  2 591  ? 117.279 102.387 185.304 1.00 316.71 ? 591  PHE B CG    1 
ATOM   6410  C  CD1   . PHE B  2 591  ? 117.491 103.130 184.153 1.00 315.61 ? 591  PHE B CD1   1 
ATOM   6411  C  CD2   . PHE B  2 591  ? 115.975 102.162 185.719 1.00 315.03 ? 591  PHE B CD2   1 
ATOM   6412  C  CE1   . PHE B  2 591  ? 116.428 103.615 183.420 1.00 315.91 ? 591  PHE B CE1   1 
ATOM   6413  C  CE2   . PHE B  2 591  ? 114.905 102.653 184.992 1.00 311.38 ? 591  PHE B CE2   1 
ATOM   6414  C  CZ    . PHE B  2 591  ? 115.133 103.378 183.839 1.00 311.64 ? 591  PHE B CZ    1 
ATOM   6415  N  N     . LEU B  2 592  ? 120.969 101.299 184.212 1.00 323.29 ? 592  LEU B N     1 
ATOM   6416  C  CA    . LEU B  2 592  ? 121.645 101.666 182.972 1.00 321.10 ? 592  LEU B CA    1 
ATOM   6417  C  C     . LEU B  2 592  ? 121.969 100.451 182.115 1.00 319.15 ? 592  LEU B C     1 
ATOM   6418  O  O     . LEU B  2 592  ? 121.867 100.514 180.884 1.00 320.26 ? 592  LEU B O     1 
ATOM   6419  C  CB    . LEU B  2 592  ? 122.926 102.425 183.286 1.00 316.94 ? 592  LEU B CB    1 
ATOM   6420  C  CG    . LEU B  2 592  ? 122.721 103.860 183.728 1.00 316.80 ? 592  LEU B CG    1 
ATOM   6421  C  CD1   . LEU B  2 592  ? 124.085 104.493 183.866 1.00 305.58 ? 592  LEU B CD1   1 
ATOM   6422  C  CD2   . LEU B  2 592  ? 121.872 104.567 182.688 1.00 315.98 ? 592  LEU B CD2   1 
ATOM   6423  N  N     . LEU B  2 593  ? 122.391 99.348  182.742 1.00 324.58 ? 593  LEU B N     1 
ATOM   6424  C  CA    . LEU B  2 593  ? 122.892 98.208  181.978 1.00 320.21 ? 593  LEU B CA    1 
ATOM   6425  C  C     . LEU B  2 593  ? 121.808 97.610  181.094 1.00 321.43 ? 593  LEU B C     1 
ATOM   6426  O  O     . LEU B  2 593  ? 122.113 97.039  180.039 1.00 322.17 ? 593  LEU B O     1 
ATOM   6427  C  CB    . LEU B  2 593  ? 123.474 97.143  182.915 1.00 318.05 ? 593  LEU B CB    1 
ATOM   6428  C  CG    . LEU B  2 593  ? 122.585 96.149  183.678 1.00 322.40 ? 593  LEU B CG    1 
ATOM   6429  C  CD1   . LEU B  2 593  ? 122.288 94.879  182.872 1.00 325.20 ? 593  LEU B CD1   1 
ATOM   6430  C  CD2   . LEU B  2 593  ? 123.222 95.791  185.015 1.00 322.28 ? 593  LEU B CD2   1 
ATOM   6431  N  N     . SER B  2 594  ? 120.543 97.727  181.504 1.00 294.63 ? 594  SER B N     1 
ATOM   6432  C  CA    . SER B  2 594  ? 119.451 97.211  180.684 1.00 295.67 ? 594  SER B CA    1 
ATOM   6433  C  C     . SER B  2 594  ? 119.358 97.957  179.356 1.00 288.57 ? 594  SER B C     1 
ATOM   6434  O  O     . SER B  2 594  ? 119.168 97.341  178.301 1.00 293.07 ? 594  SER B O     1 
ATOM   6435  C  CB    . SER B  2 594  ? 118.135 97.302  181.454 1.00 300.90 ? 594  SER B CB    1 
ATOM   6436  O  OG    . SER B  2 594  ? 117.829 98.642  181.793 1.00 300.33 ? 594  SER B OG    1 
ATOM   6437  N  N     . SER B  2 595  ? 119.490 99.286  179.388 1.00 286.74 ? 595  SER B N     1 
ATOM   6438  C  CA    . SER B  2 595  ? 119.562 100.057 178.150 1.00 288.05 ? 595  SER B CA    1 
ATOM   6439  C  C     . SER B  2 595  ? 120.841 99.753  177.377 1.00 284.71 ? 595  SER B C     1 
ATOM   6440  O  O     . SER B  2 595  ? 120.856 99.830  176.142 1.00 287.56 ? 595  SER B O     1 
ATOM   6441  C  CB    . SER B  2 595  ? 119.471 101.552 178.455 1.00 287.76 ? 595  SER B CB    1 
ATOM   6442  O  OG    . SER B  2 595  ? 118.288 101.870 179.162 1.00 290.74 ? 595  SER B OG    1 
ATOM   6443  N  N     . VAL B  2 596  ? 121.924 99.417  178.084 1.00 299.34 ? 596  VAL B N     1 
ATOM   6444  C  CA    . VAL B  2 596  ? 123.206 99.167  177.427 1.00 300.40 ? 596  VAL B CA    1 
ATOM   6445  C  C     . VAL B  2 596  ? 123.120 97.955  176.505 1.00 297.82 ? 596  VAL B C     1 
ATOM   6446  O  O     . VAL B  2 596  ? 123.713 97.945  175.420 1.00 298.50 ? 596  VAL B O     1 
ATOM   6447  C  CB    . VAL B  2 596  ? 124.321 99.008  178.480 1.00 297.80 ? 596  VAL B CB    1 
ATOM   6448  C  CG1   . VAL B  2 596  ? 125.573 98.396  177.873 1.00 293.37 ? 596  VAL B CG1   1 
ATOM   6449  C  CG2   . VAL B  2 596  ? 124.649 100.357 179.106 1.00 295.01 ? 596  VAL B CG2   1 
ATOM   6450  N  N     . VAL B  2 597  ? 122.366 96.927  176.908 1.00 297.32 ? 597  VAL B N     1 
ATOM   6451  C  CA    . VAL B  2 597  ? 122.234 95.718  176.091 1.00 294.38 ? 597  VAL B CA    1 
ATOM   6452  C  C     . VAL B  2 597  ? 121.658 96.053  174.717 1.00 293.17 ? 597  VAL B C     1 
ATOM   6453  O  O     . VAL B  2 597  ? 122.034 95.446  173.699 1.00 292.95 ? 597  VAL B O     1 
ATOM   6454  C  CB    . VAL B  2 597  ? 121.374 94.673  176.831 1.00 295.55 ? 597  VAL B CB    1 
ATOM   6455  C  CG1   . VAL B  2 597  ? 121.093 93.475  175.942 1.00 300.17 ? 597  VAL B CG1   1 
ATOM   6456  C  CG2   . VAL B  2 597  ? 122.066 94.231  178.109 1.00 292.12 ? 597  VAL B CG2   1 
ATOM   6457  N  N     . ARG B  2 598  ? 120.744 97.028  174.669 1.00 291.33 ? 598  ARG B N     1 
ATOM   6458  C  CA    . ARG B  2 598  ? 120.143 97.442  173.406 1.00 292.41 ? 598  ARG B CA    1 
ATOM   6459  C  C     . ARG B  2 598  ? 121.201 97.922  172.417 1.00 284.63 ? 598  ARG B C     1 
ATOM   6460  O  O     . ARG B  2 598  ? 121.132 97.607  171.223 1.00 285.00 ? 598  ARG B O     1 
ATOM   6461  C  CB    . ARG B  2 598  ? 119.101 98.533  173.664 1.00 298.86 ? 598  ARG B CB    1 
ATOM   6462  C  CG    . ARG B  2 598  ? 118.315 98.968  172.438 1.00 313.12 ? 598  ARG B CG    1 
ATOM   6463  C  CD    . ARG B  2 598  ? 117.254 99.991  172.806 1.00 332.18 ? 598  ARG B CD    1 
ATOM   6464  N  NE    . ARG B  2 598  ? 117.845 101.181 173.411 1.00 345.29 ? 598  ARG B NE    1 
ATOM   6465  C  CZ    . ARG B  2 598  ? 118.359 102.191 172.717 1.00 356.17 ? 598  ARG B CZ    1 
ATOM   6466  N  NH1   . ARG B  2 598  ? 118.880 103.235 173.347 1.00 366.17 ? 598  ARG B NH1   1 
ATOM   6467  N  NH2   . ARG B  2 598  ? 118.355 102.157 171.391 1.00 355.02 ? 598  ARG B NH2   1 
ATOM   6468  N  N     . SER B  2 599  ? 122.186 98.687  172.890 1.00 296.52 ? 599  SER B N     1 
ATOM   6469  C  CA    . SER B  2 599  ? 123.273 99.106  172.013 1.00 298.59 ? 599  SER B CA    1 
ATOM   6470  C  C     . SER B  2 599  ? 124.306 98.007  171.812 1.00 296.16 ? 599  SER B C     1 
ATOM   6471  O  O     . SER B  2 599  ? 124.961 97.967  170.770 1.00 295.63 ? 599  SER B O     1 
ATOM   6472  C  CB    . SER B  2 599  ? 123.948 100.364 172.564 1.00 296.65 ? 599  SER B CB    1 
ATOM   6473  O  OG    . SER B  2 599  ? 123.141 101.508 172.348 1.00 290.19 ? 599  SER B OG    1 
ATOM   6474  N  N     . THR B  2 600  ? 124.443 97.098  172.779 1.00 283.34 ? 600  THR B N     1 
ATOM   6475  C  CA    . THR B  2 600  ? 125.491 96.081  172.718 1.00 280.33 ? 600  THR B CA    1 
ATOM   6476  C  C     . THR B  2 600  ? 125.205 95.041  171.641 1.00 280.17 ? 600  THR B C     1 
ATOM   6477  O  O     . THR B  2 600  ? 126.063 94.752  170.792 1.00 281.42 ? 600  THR B O     1 
ATOM   6478  C  CB    . THR B  2 600  ? 125.634 95.409  174.083 1.00 280.15 ? 600  THR B CB    1 
ATOM   6479  O  OG1   . THR B  2 600  ? 126.025 96.383  175.058 1.00 279.65 ? 600  THR B OG1   1 
ATOM   6480  C  CG2   . THR B  2 600  ? 126.671 94.296  174.031 1.00 274.61 ? 600  THR B CG2   1 
ATOM   6481  N  N     . VAL B  2 601  ? 124.009 94.448  171.675 1.00 290.12 ? 601  VAL B N     1 
ATOM   6482  C  CA    . VAL B  2 601  ? 123.648 93.485  170.638 1.00 289.81 ? 601  VAL B CA    1 
ATOM   6483  C  C     . VAL B  2 601  ? 123.599 94.163  169.275 1.00 291.40 ? 601  VAL B C     1 
ATOM   6484  O  O     . VAL B  2 601  ? 123.877 93.539  168.245 1.00 295.84 ? 601  VAL B O     1 
ATOM   6485  C  CB    . VAL B  2 601  ? 122.310 92.808  170.986 1.00 290.89 ? 601  VAL B CB    1 
ATOM   6486  C  CG1   . VAL B  2 601  ? 121.215 93.837  171.103 1.00 292.28 ? 601  VAL B CG1   1 
ATOM   6487  C  CG2   . VAL B  2 601  ? 121.955 91.759  169.950 1.00 291.22 ? 601  VAL B CG2   1 
ATOM   6488  N  N     . LYS B  2 602  ? 123.269 95.455  169.248 1.00 295.79 ? 602  LYS B N     1 
ATOM   6489  C  CA    . LYS B  2 602  ? 123.248 96.173  167.982 1.00 293.94 ? 602  LYS B CA    1 
ATOM   6490  C  C     . LYS B  2 602  ? 124.653 96.372  167.436 1.00 296.04 ? 602  LYS B C     1 
ATOM   6491  O  O     . LYS B  2 602  ? 124.873 96.255  166.229 1.00 299.62 ? 602  LYS B O     1 
ATOM   6492  C  CB    . LYS B  2 602  ? 122.533 97.508  168.149 1.00 288.73 ? 602  LYS B CB    1 
ATOM   6493  C  CG    . LYS B  2 602  ? 121.065 97.426  167.802 1.00 288.58 ? 602  LYS B CG    1 
ATOM   6494  C  CD    . LYS B  2 602  ? 120.417 98.787  167.815 1.00 286.30 ? 602  LYS B CD    1 
ATOM   6495  C  CE    . LYS B  2 602  ? 119.276 98.844  166.826 1.00 283.51 ? 602  LYS B CE    1 
ATOM   6496  N  NZ    . LYS B  2 602  ? 118.631 100.182 166.849 1.00 277.81 ? 602  LYS B NZ    1 
ATOM   6497  N  N     . ALA B  2 603  ? 125.617 96.664  168.309 1.00 291.95 ? 603  ALA B N     1 
ATOM   6498  C  CA    . ALA B  2 603  ? 127.006 96.742  167.871 1.00 290.68 ? 603  ALA B CA    1 
ATOM   6499  C  C     . ALA B  2 603  ? 127.494 95.392  167.364 1.00 296.76 ? 603  ALA B C     1 
ATOM   6500  O  O     . ALA B  2 603  ? 128.186 95.314  166.339 1.00 301.21 ? 603  ALA B O     1 
ATOM   6501  C  CB    . ALA B  2 603  ? 127.892 97.234  169.012 1.00 284.48 ? 603  ALA B CB    1 
ATOM   6502  N  N     . LEU B  2 604  ? 127.140 94.317  168.072 1.00 293.76 ? 604  LEU B N     1 
ATOM   6503  C  CA    . LEU B  2 604  ? 127.502 92.976  167.616 1.00 293.95 ? 604  LEU B CA    1 
ATOM   6504  C  C     . LEU B  2 604  ? 126.940 92.694  166.225 1.00 297.03 ? 604  LEU B C     1 
ATOM   6505  O  O     . LEU B  2 604  ? 127.657 92.220  165.332 1.00 302.27 ? 604  LEU B O     1 
ATOM   6506  C  CB    . LEU B  2 604  ? 127.009 91.934  168.621 1.00 291.00 ? 604  LEU B CB    1 
ATOM   6507  C  CG    . LEU B  2 604  ? 127.112 90.473  168.177 1.00 294.66 ? 604  LEU B CG    1 
ATOM   6508  C  CD1   . LEU B  2 604  ? 128.561 90.081  167.913 1.00 296.30 ? 604  LEU B CD1   1 
ATOM   6509  C  CD2   . LEU B  2 604  ? 126.482 89.555  169.212 1.00 296.48 ? 604  LEU B CD2   1 
ATOM   6510  N  N     . VAL B  2 605  ? 125.652 92.984  166.022 1.00 294.88 ? 605  VAL B N     1 
ATOM   6511  C  CA    . VAL B  2 605  ? 125.014 92.742  164.730 1.00 295.51 ? 605  VAL B CA    1 
ATOM   6512  C  C     . VAL B  2 605  ? 125.644 93.607  163.645 1.00 298.72 ? 605  VAL B C     1 
ATOM   6513  O  O     . VAL B  2 605  ? 125.864 93.149  162.516 1.00 304.01 ? 605  VAL B O     1 
ATOM   6514  C  CB    . VAL B  2 605  ? 123.494 92.976  164.834 1.00 289.69 ? 605  VAL B CB    1 
ATOM   6515  C  CG1   . VAL B  2 605  ? 122.855 92.987  163.454 1.00 290.85 ? 605  VAL B CG1   1 
ATOM   6516  C  CG2   . VAL B  2 605  ? 122.852 91.910  165.706 1.00 290.23 ? 605  VAL B CG2   1 
ATOM   6517  N  N     . SER B  2 606  ? 125.943 94.870  163.967 1.00 285.81 ? 606  SER B N     1 
ATOM   6518  C  CA    . SER B  2 606  ? 126.530 95.771  162.981 1.00 287.53 ? 606  SER B CA    1 
ATOM   6519  C  C     . SER B  2 606  ? 127.903 95.293  162.545 1.00 292.68 ? 606  SER B C     1 
ATOM   6520  O  O     . SER B  2 606  ? 128.252 95.378  161.366 1.00 297.47 ? 606  SER B O     1 
ATOM   6521  C  CB    . SER B  2 606  ? 126.623 97.187  163.545 1.00 284.61 ? 606  SER B CB    1 
ATOM   6522  O  OG    . SER B  2 606  ? 125.363 97.835  163.525 1.00 284.60 ? 606  SER B OG    1 
ATOM   6523  N  N     . VAL B  2 607  ? 128.699 94.777  163.479 1.00 283.66 ? 607  VAL B N     1 
ATOM   6524  C  CA    . VAL B  2 607  ? 130.023 94.305  163.097 1.00 286.37 ? 607  VAL B CA    1 
ATOM   6525  C  C     . VAL B  2 607  ? 129.926 92.999  162.317 1.00 292.59 ? 607  VAL B C     1 
ATOM   6526  O  O     . VAL B  2 607  ? 130.687 92.778  161.369 1.00 296.98 ? 607  VAL B O     1 
ATOM   6527  C  CB    . VAL B  2 607  ? 130.925 94.167  164.332 1.00 285.66 ? 607  VAL B CB    1 
ATOM   6528  C  CG1   . VAL B  2 607  ? 132.086 93.244  164.025 1.00 289.02 ? 607  VAL B CG1   1 
ATOM   6529  C  CG2   . VAL B  2 607  ? 131.437 95.531  164.747 1.00 284.65 ? 607  VAL B CG2   1 
ATOM   6530  N  N     . GLN B  2 608  ? 129.005 92.107  162.703 1.00 279.98 ? 608  GLN B N     1 
ATOM   6531  C  CA    . GLN B  2 608  ? 128.788 90.911  161.893 1.00 282.48 ? 608  GLN B CA    1 
ATOM   6532  C  C     . GLN B  2 608  ? 128.427 91.287  160.460 1.00 284.80 ? 608  GLN B C     1 
ATOM   6533  O  O     . GLN B  2 608  ? 128.978 90.728  159.498 1.00 288.58 ? 608  GLN B O     1 
ATOM   6534  C  CB    . GLN B  2 608  ? 127.696 90.041  162.514 1.00 280.03 ? 608  GLN B CB    1 
ATOM   6535  C  CG    . GLN B  2 608  ? 128.137 89.224  163.722 1.00 283.84 ? 608  GLN B CG    1 
ATOM   6536  C  CD    . GLN B  2 608  ? 127.047 88.282  164.208 1.00 289.33 ? 608  GLN B CD    1 
ATOM   6537  O  OE1   . GLN B  2 608  ? 125.932 88.286  163.686 1.00 289.03 ? 608  GLN B OE1   1 
ATOM   6538  N  NE2   . GLN B  2 608  ? 127.366 87.468  165.210 1.00 293.13 ? 608  GLN B NE2   1 
ATOM   6539  N  N     . LYS B  2 609  ? 127.517 92.252  160.301 1.00 281.74 ? 609  LYS B N     1 
ATOM   6540  C  CA    . LYS B  2 609  ? 127.144 92.723  158.971 1.00 282.74 ? 609  LYS B CA    1 
ATOM   6541  C  C     . LYS B  2 609  ? 128.336 93.333  158.246 1.00 287.81 ? 609  LYS B C     1 
ATOM   6542  O  O     . LYS B  2 609  ? 128.542 93.081  157.052 1.00 290.79 ? 609  LYS B O     1 
ATOM   6543  C  CB    . LYS B  2 609  ? 126.010 93.742  159.083 1.00 277.01 ? 609  LYS B CB    1 
ATOM   6544  C  CG    . LYS B  2 609  ? 125.604 94.384  157.769 1.00 275.88 ? 609  LYS B CG    1 
ATOM   6545  C  CD    . LYS B  2 609  ? 124.645 95.537  158.009 1.00 274.25 ? 609  LYS B CD    1 
ATOM   6546  C  CE    . LYS B  2 609  ? 123.428 95.086  158.800 1.00 269.04 ? 609  LYS B CE    1 
ATOM   6547  N  NZ    . LYS B  2 609  ? 122.487 96.211  159.050 1.00 265.13 ? 609  LYS B NZ    1 
ATOM   6548  N  N     . LEU B  2 610  ? 129.139 94.129  158.953 1.00 283.60 ? 610  LEU B N     1 
ATOM   6549  C  CA    . LEU B  2 610  ? 130.288 94.776  158.332 1.00 286.52 ? 610  LEU B CA    1 
ATOM   6550  C  C     . LEU B  2 610  ? 131.324 93.754  157.876 1.00 289.38 ? 610  LEU B C     1 
ATOM   6551  O  O     . LEU B  2 610  ? 131.973 93.936  156.838 1.00 292.09 ? 610  LEU B O     1 
ATOM   6552  C  CB    . LEU B  2 610  ? 130.910 95.770  159.315 1.00 285.01 ? 610  LEU B CB    1 
ATOM   6553  C  CG    . LEU B  2 610  ? 132.025 96.659  158.774 1.00 284.32 ? 610  LEU B CG    1 
ATOM   6554  C  CD1   . LEU B  2 610  ? 131.627 97.176  157.416 1.00 284.54 ? 610  LEU B CD1   1 
ATOM   6555  C  CD2   . LEU B  2 610  ? 132.282 97.810  159.725 1.00 282.72 ? 610  LEU B CD2   1 
ATOM   6556  N  N     . SER B  2 611  ? 131.489 92.669  158.637 1.00 291.42 ? 611  SER B N     1 
ATOM   6557  C  CA    . SER B  2 611  ? 132.464 91.650  158.266 1.00 294.40 ? 611  SER B CA    1 
ATOM   6558  C  C     . SER B  2 611  ? 131.959 90.807  157.106 1.00 295.36 ? 611  SER B C     1 
ATOM   6559  O  O     . SER B  2 611  ? 132.739 90.417  156.233 1.00 298.17 ? 611  SER B O     1 
ATOM   6560  C  CB    . SER B  2 611  ? 132.789 90.777  159.471 1.00 296.33 ? 611  SER B CB    1 
ATOM   6561  O  OG    . SER B  2 611  ? 133.397 91.552  160.491 1.00 296.71 ? 611  SER B OG    1 
ATOM   6562  N  N     . GLU B  2 612  ? 130.656 90.512  157.077 1.00 292.04 ? 612  GLU B N     1 
ATOM   6563  C  CA    . GLU B  2 612  ? 130.112 89.839  155.902 1.00 293.52 ? 612  GLU B CA    1 
ATOM   6564  C  C     . GLU B  2 612  ? 130.187 90.728  154.667 1.00 293.79 ? 612  GLU B C     1 
ATOM   6565  O  O     . GLU B  2 612  ? 130.310 90.220  153.548 1.00 294.99 ? 612  GLU B O     1 
ATOM   6566  C  CB    . GLU B  2 612  ? 128.673 89.396  156.165 1.00 291.87 ? 612  GLU B CB    1 
ATOM   6567  C  CG    . GLU B  2 612  ? 128.565 88.177  157.069 1.00 292.82 ? 612  GLU B CG    1 
ATOM   6568  C  CD    . GLU B  2 612  ? 127.131 87.728  157.275 1.00 295.05 ? 612  GLU B CD    1 
ATOM   6569  O  OE1   . GLU B  2 612  ? 126.214 88.410  156.768 1.00 294.56 ? 612  GLU B OE1   1 
ATOM   6570  O  OE2   . GLU B  2 612  ? 126.921 86.693  157.945 1.00 298.18 ? 612  GLU B OE2   1 
ATOM   6571  N  N     . PHE B  2 613  ? 130.128 92.051  154.849 1.00 288.59 ? 613  PHE B N     1 
ATOM   6572  C  CA    . PHE B  2 613  ? 130.264 92.959  153.713 1.00 286.75 ? 613  PHE B CA    1 
ATOM   6573  C  C     . PHE B  2 613  ? 131.708 93.026  153.231 1.00 286.55 ? 613  PHE B C     1 
ATOM   6574  O  O     . PHE B  2 613  ? 131.961 93.097  152.023 1.00 289.35 ? 613  PHE B O     1 
ATOM   6575  C  CB    . PHE B  2 613  ? 129.756 94.351  154.087 1.00 286.86 ? 613  PHE B CB    1 
ATOM   6576  C  CG    . PHE B  2 613  ? 129.807 95.340  152.959 1.00 286.94 ? 613  PHE B CG    1 
ATOM   6577  C  CD1   . PHE B  2 613  ? 129.158 95.077  151.763 1.00 286.10 ? 613  PHE B CD1   1 
ATOM   6578  C  CD2   . PHE B  2 613  ? 130.486 96.536  153.100 1.00 284.78 ? 613  PHE B CD2   1 
ATOM   6579  C  CE1   . PHE B  2 613  ? 129.198 95.988  150.725 1.00 281.01 ? 613  PHE B CE1   1 
ATOM   6580  C  CE2   . PHE B  2 613  ? 130.525 97.452  152.065 1.00 277.71 ? 613  PHE B CE2   1 
ATOM   6581  C  CZ    . PHE B  2 613  ? 129.883 97.176  150.877 1.00 276.16 ? 613  PHE B CZ    1 
ATOM   6582  N  N     . LEU B  2 614  ? 132.669 93.010  154.158 1.00 295.14 ? 614  LEU B N     1 
ATOM   6583  C  CA    . LEU B  2 614  ? 134.069 93.000  153.756 1.00 295.23 ? 614  LEU B CA    1 
ATOM   6584  C  C     . LEU B  2 614  ? 134.463 91.700  153.066 1.00 298.35 ? 614  LEU B C     1 
ATOM   6585  O  O     . LEU B  2 614  ? 135.431 91.685  152.298 1.00 297.48 ? 614  LEU B O     1 
ATOM   6586  C  CB    . LEU B  2 614  ? 134.967 93.248  154.967 1.00 294.47 ? 614  LEU B CB    1 
ATOM   6587  C  CG    . LEU B  2 614  ? 136.433 93.555  154.659 1.00 292.03 ? 614  LEU B CG    1 
ATOM   6588  C  CD1   . LEU B  2 614  ? 136.817 94.926  155.192 1.00 285.56 ? 614  LEU B CD1   1 
ATOM   6589  C  CD2   . LEU B  2 614  ? 137.337 92.472  155.230 1.00 301.15 ? 614  LEU B CD2   1 
ATOM   6590  N  N     . SER B  2 615  ? 133.726 90.617  153.308 1.00 308.03 ? 615  SER B N     1 
ATOM   6591  C  CA    . SER B  2 615  ? 134.025 89.316  152.732 1.00 309.08 ? 615  SER B CA    1 
ATOM   6592  C  C     . SER B  2 615  ? 133.397 89.113  151.359 1.00 310.69 ? 615  SER B C     1 
ATOM   6593  O  O     . SER B  2 615  ? 133.253 87.965  150.919 1.00 310.63 ? 615  SER B O     1 
ATOM   6594  C  CB    . SER B  2 615  ? 133.570 88.206  153.681 1.00 309.06 ? 615  SER B CB    1 
ATOM   6595  O  OG    . SER B  2 615  ? 133.800 86.930  153.111 1.00 311.86 ? 615  SER B OG    1 
ATOM   6596  N  N     . SER B  2 616  ? 133.016 90.188  150.677 1.00 318.50 ? 616  SER B N     1 
ATOM   6597  C  CA    . SER B  2 616  ? 132.481 90.051  149.334 1.00 320.95 ? 616  SER B CA    1 
ATOM   6598  C  C     . SER B  2 616  ? 133.613 89.805  148.334 1.00 320.99 ? 616  SER B C     1 
ATOM   6599  O  O     . SER B  2 616  ? 134.800 89.893  148.661 1.00 317.09 ? 616  SER B O     1 
ATOM   6600  C  CB    . SER B  2 616  ? 131.679 91.292  148.945 1.00 317.68 ? 616  SER B CB    1 
ATOM   6601  O  OG    . SER B  2 616  ? 132.494 92.450  148.967 1.00 314.02 ? 616  SER B OG    1 
ATOM   6602  N  N     . ALA B  2 617  ? 133.227 89.494  147.099 1.00 308.18 ? 617  ALA B N     1 
ATOM   6603  C  CA    . ALA B  2 617  ? 134.194 89.118  146.078 1.00 308.18 ? 617  ALA B CA    1 
ATOM   6604  C  C     . ALA B  2 617  ? 135.006 90.324  145.621 1.00 308.18 ? 617  ALA B C     1 
ATOM   6605  O  O     . ALA B  2 617  ? 134.461 91.398  145.350 1.00 308.18 ? 617  ALA B O     1 
ATOM   6606  C  CB    . ALA B  2 617  ? 133.493 88.478  144.881 1.00 308.18 ? 617  ALA B CB    1 
ATOM   6607  N  N     . GLU B  2 618  ? 136.317 90.131  145.530 1.00 310.77 ? 618  GLU B N     1 
ATOM   6608  C  CA    . GLU B  2 618  ? 137.244 91.164  145.102 1.00 310.77 ? 618  GLU B CA    1 
ATOM   6609  C  C     . GLU B  2 618  ? 137.117 91.393  143.594 1.00 310.77 ? 618  GLU B C     1 
ATOM   6610  O  O     . GLU B  2 618  ? 136.344 90.733  142.897 1.00 310.77 ? 618  GLU B O     1 
ATOM   6611  C  CB    . GLU B  2 618  ? 138.667 90.756  145.481 1.00 310.77 ? 618  GLU B CB    1 
ATOM   6612  C  CG    . GLU B  2 618  ? 139.698 91.871  145.527 1.00 310.77 ? 618  GLU B CG    1 
ATOM   6613  C  CD    . GLU B  2 618  ? 141.110 91.343  145.706 1.00 310.77 ? 618  GLU B CD    1 
ATOM   6614  O  OE1   . GLU B  2 618  ? 141.269 90.147  146.035 1.00 310.77 ? 618  GLU B OE1   1 
ATOM   6615  O  OE2   . GLU B  2 618  ? 142.064 92.124  145.516 1.00 310.77 ? 618  GLU B OE2   1 
ATOM   6616  N  N     . ILE B  2 619  ? 137.884 92.357  143.088 1.00 312.17 ? 619  ILE B N     1 
ATOM   6617  C  CA    . ILE B  2 619  ? 138.128 92.502  141.659 1.00 312.17 ? 619  ILE B CA    1 
ATOM   6618  C  C     . ILE B  2 619  ? 139.504 91.922  141.365 1.00 312.17 ? 619  ILE B C     1 
ATOM   6619  O  O     . ILE B  2 619  ? 140.440 92.079  142.161 1.00 312.17 ? 619  ILE B O     1 
ATOM   6620  C  CB    . ILE B  2 619  ? 138.022 93.973  141.204 1.00 312.17 ? 619  ILE B CB    1 
ATOM   6621  C  CG1   . ILE B  2 619  ? 138.017 94.051  139.680 1.00 312.17 ? 619  ILE B CG1   1 
ATOM   6622  C  CG2   . ILE B  2 619  ? 139.150 94.818  141.789 1.00 312.17 ? 619  ILE B CG2   1 
ATOM   6623  C  CD1   . ILE B  2 619  ? 136.897 93.260  139.048 1.00 312.17 ? 619  ILE B CD1   1 
ATOM   6624  N  N     . ARG B  2 620  ? 139.626 91.226  140.241 1.00 324.22 ? 620  ARG B N     1 
ATOM   6625  C  CA    . ARG B  2 620  ? 140.835 90.471  139.933 1.00 324.22 ? 620  ARG B CA    1 
ATOM   6626  C  C     . ARG B  2 620  ? 141.827 91.364  139.196 1.00 324.22 ? 620  ARG B C     1 
ATOM   6627  O  O     . ARG B  2 620  ? 141.501 91.931  138.148 1.00 324.22 ? 620  ARG B O     1 
ATOM   6628  C  CB    . ARG B  2 620  ? 140.498 89.232  139.106 1.00 324.22 ? 620  ARG B CB    1 
ATOM   6629  C  CG    . ARG B  2 620  ? 141.664 88.278  138.904 1.00 324.22 ? 620  ARG B CG    1 
ATOM   6630  C  CD    . ARG B  2 620  ? 141.169 86.881  138.570 1.00 324.22 ? 620  ARG B CD    1 
ATOM   6631  N  NE    . ARG B  2 620  ? 140.212 86.889  137.468 1.00 324.22 ? 620  ARG B NE    1 
ATOM   6632  C  CZ    . ARG B  2 620  ? 139.535 85.821  137.057 1.00 324.22 ? 620  ARG B CZ    1 
ATOM   6633  N  NH1   . ARG B  2 620  ? 138.683 85.921  136.045 1.00 324.22 ? 620  ARG B NH1   1 
ATOM   6634  N  NH2   . ARG B  2 620  ? 139.709 84.653  137.659 1.00 324.22 ? 620  ARG B NH2   1 
ATOM   6635  N  N     . GLU B  2 621  ? 143.031 91.485  139.746 1.00 313.40 ? 621  GLU B N     1 
ATOM   6636  C  CA    . GLU B  2 621  ? 144.078 92.268  139.105 1.00 313.40 ? 621  GLU B CA    1 
ATOM   6637  C  C     . GLU B  2 621  ? 144.619 91.532  137.887 1.00 313.40 ? 621  GLU B C     1 
ATOM   6638  O  O     . GLU B  2 621  ? 144.794 90.310  137.903 1.00 313.40 ? 621  GLU B O     1 
ATOM   6639  C  CB    . GLU B  2 621  ? 145.208 92.559  140.096 1.00 313.40 ? 621  GLU B CB    1 
ATOM   6640  C  CG    . GLU B  2 621  ? 146.436 93.230  139.486 1.00 313.40 ? 621  GLU B CG    1 
ATOM   6641  C  CD    . GLU B  2 621  ? 146.146 94.617  138.945 1.00 313.40 ? 621  GLU B CD    1 
ATOM   6642  O  OE1   . GLU B  2 621  ? 145.229 95.287  139.467 1.00 313.40 ? 621  GLU B OE1   1 
ATOM   6643  O  OE2   . GLU B  2 621  ? 146.839 95.039  137.994 1.00 313.40 ? 621  GLU B OE2   1 
ATOM   6644  N  N     . GLU B  2 622  ? 144.880 92.285  136.823 1.00 322.03 ? 622  GLU B N     1 
ATOM   6645  C  CA    . GLU B  2 622  ? 145.394 91.726  135.579 1.00 322.03 ? 622  GLU B CA    1 
ATOM   6646  C  C     . GLU B  2 622  ? 146.795 91.152  135.761 1.00 322.03 ? 622  GLU B C     1 
ATOM   6647  O  O     . GLU B  2 622  ? 147.323 90.481  134.873 1.00 322.03 ? 622  GLU B O     1 
ATOM   6648  C  CB    . GLU B  2 622  ? 145.400 92.794  134.486 1.00 322.03 ? 622  GLU B CB    1 
ATOM   6649  C  CG    . GLU B  2 622  ? 144.051 93.456  134.275 1.00 322.03 ? 622  GLU B CG    1 
ATOM   6650  C  CD    . GLU B  2 622  ? 144.161 94.793  133.573 1.00 322.03 ? 622  GLU B CD    1 
ATOM   6651  O  OE1   . GLU B  2 622  ? 145.276 95.355  133.533 1.00 322.03 ? 622  GLU B OE1   1 
ATOM   6652  O  OE2   . GLU B  2 622  ? 143.133 95.282  133.061 1.00 322.03 ? 622  GLU B OE2   1 
ATOM   6653  N  N     . CYS B  2 678  ? 144.919 99.724  119.097 1.00 357.81 ? 678  CYS B N     1 
ATOM   6654  C  CA    . CYS B  2 678  ? 143.744 98.910  118.804 1.00 357.81 ? 678  CYS B CA    1 
ATOM   6655  C  C     . CYS B  2 678  ? 143.385 98.018  119.994 1.00 357.81 ? 678  CYS B C     1 
ATOM   6656  O  O     . CYS B  2 678  ? 144.268 97.536  120.704 1.00 357.81 ? 678  CYS B O     1 
ATOM   6657  C  CB    . CYS B  2 678  ? 143.981 98.062  117.550 1.00 357.81 ? 678  CYS B CB    1 
ATOM   6658  S  SG    . CYS B  2 678  ? 145.254 96.794  117.699 1.00 357.81 ? 678  CYS B SG    1 
ATOM   6659  N  N     . VAL B  2 679  ? 142.089 97.807  120.211 1.00 359.83 ? 679  VAL B N     1 
ATOM   6660  C  CA    . VAL B  2 679  ? 141.608 96.956  121.295 1.00 359.83 ? 679  VAL B CA    1 
ATOM   6661  C  C     . VAL B  2 679  ? 141.568 95.517  120.793 1.00 359.83 ? 679  VAL B C     1 
ATOM   6662  O  O     . VAL B  2 679  ? 140.877 95.211  119.816 1.00 359.83 ? 679  VAL B O     1 
ATOM   6663  C  CB    . VAL B  2 679  ? 140.225 97.407  121.787 1.00 359.83 ? 679  VAL B CB    1 
ATOM   6664  C  CG1   . VAL B  2 679  ? 139.740 96.499  122.906 1.00 359.83 ? 679  VAL B CG1   1 
ATOM   6665  C  CG2   . VAL B  2 679  ? 140.268 98.856  122.247 1.00 359.83 ? 679  VAL B CG2   1 
ATOM   6666  N  N     . GLN B  2 680  ? 142.302 94.632  121.463 1.00 349.99 ? 680  GLN B N     1 
ATOM   6667  C  CA    . GLN B  2 680  ? 142.500 93.264  120.999 1.00 349.99 ? 680  GLN B CA    1 
ATOM   6668  C  C     . GLN B  2 680  ? 141.916 92.277  122.000 1.00 349.99 ? 680  GLN B C     1 
ATOM   6669  O  O     . GLN B  2 680  ? 142.093 92.429  123.213 1.00 349.99 ? 680  GLN B O     1 
ATOM   6670  C  CB    . GLN B  2 680  ? 143.996 92.980  120.786 1.00 349.99 ? 680  GLN B CB    1 
ATOM   6671  C  CG    . GLN B  2 680  ? 144.327 91.561  120.347 1.00 349.99 ? 680  GLN B CG    1 
ATOM   6672  C  CD    . GLN B  2 680  ? 145.822 91.322  120.243 1.00 349.99 ? 680  GLN B CD    1 
ATOM   6673  O  OE1   . GLN B  2 680  ? 146.606 92.265  120.120 1.00 349.99 ? 680  GLN B OE1   1 
ATOM   6674  N  NE2   . GLN B  2 680  ? 146.226 90.057  120.301 1.00 349.99 ? 680  GLN B NE2   1 
ATOM   6675  N  N     . ILE B  2 681  ? 141.223 91.260  121.485 1.00 346.42 ? 681  ILE B N     1 
ATOM   6676  C  CA    . ILE B  2 681  ? 140.664 90.191  122.308 1.00 346.42 ? 681  ILE B CA    1 
ATOM   6677  C  C     . ILE B  2 681  ? 140.862 88.874  121.576 1.00 346.42 ? 681  ILE B C     1 
ATOM   6678  O  O     . ILE B  2 681  ? 140.400 88.716  120.439 1.00 346.42 ? 681  ILE B O     1 
ATOM   6679  C  CB    . ILE B  2 681  ? 139.172 90.401  122.608 1.00 346.42 ? 681  ILE B CB    1 
ATOM   6680  C  CG1   . ILE B  2 681  ? 138.970 91.536  123.606 1.00 346.42 ? 681  ILE B CG1   1 
ATOM   6681  C  CG2   . ILE B  2 681  ? 138.544 89.112  123.120 1.00 346.42 ? 681  ILE B CG2   1 
ATOM   6682  C  CD1   . ILE B  2 681  ? 137.530 91.743  123.952 1.00 346.42 ? 681  ILE B CD1   1 
ATOM   6683  N  N     . ILE B  2 682  ? 141.531 87.927  122.230 1.00 354.64 ? 682  ILE B N     1 
ATOM   6684  C  CA    . ILE B  2 682  ? 141.745 86.589  121.695 1.00 354.64 ? 682  ILE B CA    1 
ATOM   6685  C  C     . ILE B  2 682  ? 141.339 85.583  122.766 1.00 354.64 ? 682  ILE B C     1 
ATOM   6686  O  O     . ILE B  2 682  ? 141.929 85.553  123.855 1.00 354.64 ? 682  ILE B O     1 
ATOM   6687  C  CB    . ILE B  2 682  ? 143.205 86.374  121.253 1.00 354.64 ? 682  ILE B CB    1 
ATOM   6688  C  CG1   . ILE B  2 682  ? 143.572 84.888  121.269 1.00 354.64 ? 682  ILE B CG1   1 
ATOM   6689  C  CG2   . ILE B  2 682  ? 144.156 87.201  122.106 1.00 354.64 ? 682  ILE B CG2   1 
ATOM   6690  C  CD1   . ILE B  2 682  ? 145.027 84.621  120.946 1.00 354.64 ? 682  ILE B CD1   1 
ATOM   6691  N  N     . GLY B  2 683  ? 140.309 84.787  122.470 1.00 348.45 ? 683  GLY B N     1 
ATOM   6692  C  CA    . GLY B  2 683  ? 139.856 83.721  123.344 1.00 348.45 ? 683  GLY B CA    1 
ATOM   6693  C  C     . GLY B  2 683  ? 138.988 84.149  124.509 1.00 348.45 ? 683  GLY B C     1 
ATOM   6694  O  O     . GLY B  2 683  ? 139.292 83.825  125.655 1.00 348.45 ? 683  GLY B O     1 
ATOM   6695  N  N     . GLY B  2 684  ? 137.892 84.851  124.233 1.00 358.88 ? 684  GLY B N     1 
ATOM   6696  C  CA    . GLY B  2 684  ? 137.062 85.386  125.305 1.00 358.88 ? 684  GLY B CA    1 
ATOM   6697  C  C     . GLY B  2 684  ? 136.309 84.288  126.046 1.00 358.88 ? 684  GLY B C     1 
ATOM   6698  O  O     . GLY B  2 684  ? 135.713 83.396  125.427 1.00 358.88 ? 684  GLY B O     1 
ATOM   6699  N  N     . PHE B  2 685  ? 136.331 84.353  127.381 1.00 356.59 ? 685  PHE B N     1 
ATOM   6700  C  CA    . PHE B  2 685  ? 135.692 83.323  128.199 1.00 356.59 ? 685  PHE B CA    1 
ATOM   6701  C  C     . PHE B  2 685  ? 135.515 83.854  129.616 1.00 356.59 ? 685  PHE B C     1 
ATOM   6702  O  O     . PHE B  2 685  ? 136.507 84.013  130.332 1.00 356.59 ? 685  PHE B O     1 
ATOM   6703  C  CB    . PHE B  2 685  ? 136.537 82.053  128.182 1.00 356.59 ? 685  PHE B CB    1 
ATOM   6704  C  CG    . PHE B  2 685  ? 135.876 80.871  128.816 1.00 356.59 ? 685  PHE B CG    1 
ATOM   6705  C  CD1   . PHE B  2 685  ? 135.073 80.028  128.065 1.00 356.59 ? 685  PHE B CD1   1 
ATOM   6706  C  CD2   . PHE B  2 685  ? 136.075 80.583  130.155 1.00 356.59 ? 685  PHE B CD2   1 
ATOM   6707  C  CE1   . PHE B  2 685  ? 134.468 78.929  128.641 1.00 356.59 ? 685  PHE B CE1   1 
ATOM   6708  C  CE2   . PHE B  2 685  ? 135.473 79.486  130.740 1.00 356.59 ? 685  PHE B CE2   1 
ATOM   6709  C  CZ    . PHE B  2 685  ? 134.670 78.656  129.983 1.00 356.59 ? 685  PHE B CZ    1 
ATOM   6710  N  N     . PHE B  2 686  ? 134.270 84.097  130.034 1.00 347.48 ? 686  PHE B N     1 
ATOM   6711  C  CA    . PHE B  2 686  ? 134.010 84.490  131.415 1.00 347.48 ? 686  PHE B CA    1 
ATOM   6712  C  C     . PHE B  2 686  ? 132.539 84.297  131.755 1.00 347.48 ? 686  PHE B C     1 
ATOM   6713  O  O     . PHE B  2 686  ? 131.672 84.279  130.877 1.00 347.48 ? 686  PHE B O     1 
ATOM   6714  C  CB    . PHE B  2 686  ? 134.421 85.941  131.689 1.00 347.48 ? 686  PHE B CB    1 
ATOM   6715  C  CG    . PHE B  2 686  ? 134.501 86.275  133.153 1.00 347.48 ? 686  PHE B CG    1 
ATOM   6716  C  CD1   . PHE B  2 686  ? 135.306 85.533  133.997 1.00 347.48 ? 686  PHE B CD1   1 
ATOM   6717  C  CD2   . PHE B  2 686  ? 133.768 87.320  133.689 1.00 347.48 ? 686  PHE B CD2   1 
ATOM   6718  C  CE1   . PHE B  2 686  ? 135.384 85.822  135.345 1.00 347.48 ? 686  PHE B CE1   1 
ATOM   6719  C  CE2   . PHE B  2 686  ? 133.848 87.616  135.039 1.00 347.48 ? 686  PHE B CE2   1 
ATOM   6720  C  CZ    . PHE B  2 686  ? 134.657 86.868  135.865 1.00 347.48 ? 686  PHE B CZ    1 
ATOM   6721  N  N     . THR B  2 687  ? 132.275 84.163  133.056 1.00 355.46 ? 687  THR B N     1 
ATOM   6722  C  CA    . THR B  2 687  ? 130.928 84.021  133.595 1.00 355.46 ? 687  THR B CA    1 
ATOM   6723  C  C     . THR B  2 687  ? 130.794 84.899  134.832 1.00 355.46 ? 687  THR B C     1 
ATOM   6724  O  O     . THR B  2 687  ? 131.778 85.433  135.350 1.00 355.46 ? 687  THR B O     1 
ATOM   6725  C  CB    . THR B  2 687  ? 130.607 82.562  133.946 1.00 355.46 ? 687  THR B CB    1 
ATOM   6726  O  OG1   . THR B  2 687  ? 129.275 82.475  134.471 1.00 355.46 ? 687  THR B OG1   1 
ATOM   6727  C  CG2   . THR B  2 687  ? 131.593 82.027  134.973 1.00 355.46 ? 687  THR B CG2   1 
ATOM   6728  N  N     . TRP B  2 688  ? 129.563 85.043  135.308 1.00 342.82 ? 688  TRP B N     1 
ATOM   6729  C  CA    . TRP B  2 688  ? 129.240 85.951  136.414 1.00 342.82 ? 688  TRP B CA    1 
ATOM   6730  C  C     . TRP B  2 688  ? 129.204 85.245  137.768 1.00 342.82 ? 688  TRP B C     1 
ATOM   6731  O  O     . TRP B  2 688  ? 128.231 85.377  138.510 1.00 342.82 ? 688  TRP B O     1 
ATOM   6732  C  CB    . TRP B  2 688  ? 127.912 86.643  136.138 1.00 342.82 ? 688  TRP B CB    1 
ATOM   6733  C  CG    . TRP B  2 688  ? 127.882 87.457  134.882 1.00 342.82 ? 688  TRP B CG    1 
ATOM   6734  C  CD1   . TRP B  2 688  ? 127.625 87.008  133.618 1.00 342.82 ? 688  TRP B CD1   1 
ATOM   6735  C  CD2   . TRP B  2 688  ? 128.095 88.868  134.770 1.00 342.82 ? 688  TRP B CD2   1 
ATOM   6736  N  NE1   . TRP B  2 688  ? 127.672 88.053  132.727 1.00 342.82 ? 688  TRP B NE1   1 
ATOM   6737  C  CE2   . TRP B  2 688  ? 127.960 89.206  133.410 1.00 342.82 ? 688  TRP B CE2   1 
ATOM   6738  C  CE3   . TRP B  2 688  ? 128.399 89.879  135.689 1.00 342.82 ? 688  TRP B CE3   1 
ATOM   6739  C  CZ2   . TRP B  2 688  ? 128.112 90.510  132.946 1.00 342.82 ? 688  TRP B CZ2   1 
ATOM   6740  C  CZ3   . TRP B  2 688  ? 128.540 91.174  135.228 1.00 342.82 ? 688  TRP B CZ3   1 
ATOM   6741  C  CH2   . TRP B  2 688  ? 128.399 91.477  133.869 1.00 342.82 ? 688  TRP B CH2   1 
ATOM   6742  N  N     . THR B  2 689  ? 130.264 84.506  138.122 1.00 352.61 ? 689  THR B N     1 
ATOM   6743  C  CA    . THR B  2 689  ? 130.411 83.874  139.434 1.00 352.61 ? 689  THR B CA    1 
ATOM   6744  C  C     . THR B  2 689  ? 131.824 83.314  139.577 1.00 352.61 ? 689  THR B C     1 
ATOM   6745  O  O     . THR B  2 689  ? 132.551 83.208  138.583 1.00 352.61 ? 689  THR B O     1 
ATOM   6746  C  CB    . THR B  2 689  ? 129.393 82.745  139.649 1.00 352.61 ? 689  THR B CB    1 
ATOM   6747  O  OG1   . THR B  2 689  ? 128.743 82.415  138.414 1.00 352.61 ? 689  THR B OG1   1 
ATOM   6748  C  CG2   . THR B  2 689  ? 128.350 83.141  140.694 1.00 352.61 ? 689  THR B CG2   1 
ATOM   6749  N  N     . PRO B  2 690  ? 132.257 82.961  140.791 1.00 364.32 ? 690  PRO B N     1 
ATOM   6750  C  CA    . PRO B  2 690  ? 133.503 82.188  140.919 1.00 364.32 ? 690  PRO B CA    1 
ATOM   6751  C  C     . PRO B  2 690  ? 133.454 80.848  140.206 1.00 364.32 ? 690  PRO B C     1 
ATOM   6752  O  O     . PRO B  2 690  ? 134.513 80.321  139.838 1.00 364.32 ? 690  PRO B O     1 
ATOM   6753  C  CB    . PRO B  2 690  ? 133.653 82.014  142.436 1.00 364.32 ? 690  PRO B CB    1 
ATOM   6754  C  CG    . PRO B  2 690  ? 132.937 83.189  143.013 1.00 364.32 ? 690  PRO B CG    1 
ATOM   6755  C  CD    . PRO B  2 690  ? 131.773 83.447  142.097 1.00 364.32 ? 690  PRO B CD    1 
ATOM   6756  N  N     . ASP B  2 691  ? 132.267 80.282  139.996 1.00 357.50 ? 691  ASP B N     1 
ATOM   6757  C  CA    . ASP B  2 691  ? 132.121 79.023  139.274 1.00 357.50 ? 691  ASP B CA    1 
ATOM   6758  C  C     . ASP B  2 691  ? 130.692 78.918  138.762 1.00 357.50 ? 691  ASP B C     1 
ATOM   6759  O  O     . ASP B  2 691  ? 129.745 79.165  139.515 1.00 357.50 ? 691  ASP B O     1 
ATOM   6760  C  CB    . ASP B  2 691  ? 132.459 77.827  140.172 1.00 357.50 ? 691  ASP B CB    1 
ATOM   6761  N  N     . GLY B  2 692  ? 130.542 78.555  137.495 1.00 365.99 ? 692  GLY B N     1 
ATOM   6762  C  CA    . GLY B  2 692  ? 129.223 78.410  136.911 1.00 365.99 ? 692  GLY B CA    1 
ATOM   6763  C  C     . GLY B  2 692  ? 129.316 78.321  135.408 1.00 365.99 ? 692  GLY B C     1 
ATOM   6764  O  O     . GLY B  2 692  ? 130.374 78.524  134.806 1.00 365.99 ? 692  GLY B O     1 
ATOM   6765  N  N     . ILE B  2 693  ? 128.176 78.005  134.803 1.00 370.19 ? 693  ILE B N     1 
ATOM   6766  C  CA    . ILE B  2 693  ? 128.112 77.914  133.338 1.00 370.19 ? 693  ILE B CA    1 
ATOM   6767  C  C     . ILE B  2 693  ? 128.282 79.308  132.744 1.00 370.19 ? 693  ILE B C     1 
ATOM   6768  O  O     . ILE B  2 693  ? 127.724 80.280  133.283 1.00 370.19 ? 693  ILE B O     1 
ATOM   6769  C  CB    . ILE B  2 693  ? 126.791 77.281  132.897 1.00 370.19 ? 693  ILE B CB    1 
ATOM   6770  C  CG1   . ILE B  2 693  ? 125.611 77.944  133.612 1.00 370.19 ? 693  ILE B CG1   1 
ATOM   6771  C  CG2   . ILE B  2 693  ? 126.808 75.781  133.158 1.00 370.19 ? 693  ILE B CG2   1 
ATOM   6772  C  CD1   . ILE B  2 693  ? 124.265 77.392  133.205 1.00 370.19 ? 693  ILE B CD1   1 
ATOM   6773  N  N     . PRO B  2 694  ? 129.037 79.462  131.660 1.00 370.40 ? 694  PRO B N     1 
ATOM   6774  C  CA    . PRO B  2 694  ? 129.380 80.798  131.175 1.00 370.40 ? 694  PRO B CA    1 
ATOM   6775  C  C     . PRO B  2 694  ? 128.424 81.331  130.118 1.00 370.40 ? 694  PRO B C     1 
ATOM   6776  O  O     . PRO B  2 694  ? 127.626 80.605  129.521 1.00 370.40 ? 694  PRO B O     1 
ATOM   6777  C  CB    . PRO B  2 694  ? 130.785 80.602  130.576 1.00 370.40 ? 694  PRO B CB    1 
ATOM   6778  C  CG    . PRO B  2 694  ? 131.055 79.097  130.608 1.00 370.40 ? 694  PRO B CG    1 
ATOM   6779  C  CD    . PRO B  2 694  ? 129.759 78.419  130.919 1.00 370.40 ? 694  PRO B CD    1 
ATOM   6780  N  N     . THR B  2 695  ? 128.524 82.644  129.906 1.00 365.40 ? 695  THR B N     1 
ATOM   6781  C  CA    . THR B  2 695  ? 127.871 83.321  128.798 1.00 365.40 ? 695  THR B CA    1 
ATOM   6782  C  C     . THR B  2 695  ? 128.851 83.931  127.805 1.00 365.40 ? 695  THR B C     1 
ATOM   6783  O  O     . THR B  2 695  ? 128.449 84.237  126.678 1.00 365.40 ? 695  THR B O     1 
ATOM   6784  C  CB    . THR B  2 695  ? 126.938 84.426  129.318 1.00 365.40 ? 695  THR B CB    1 
ATOM   6785  O  OG1   . THR B  2 695  ? 126.524 85.255  128.227 1.00 365.40 ? 695  THR B OG1   1 
ATOM   6786  C  CG2   . THR B  2 695  ? 127.646 85.275  130.367 1.00 365.40 ? 695  THR B CG2   1 
ATOM   6787  N  N     . LEU B  2 696  ? 130.113 84.108  128.187 1.00 366.65 ? 696  LEU B N     1 
ATOM   6788  C  CA    . LEU B  2 696  ? 131.164 84.573  127.292 1.00 366.65 ? 696  LEU B CA    1 
ATOM   6789  C  C     . LEU B  2 696  ? 131.953 83.355  126.820 1.00 366.65 ? 696  LEU B C     1 
ATOM   6790  O  O     . LEU B  2 696  ? 132.559 82.653  127.637 1.00 366.65 ? 696  LEU B O     1 
ATOM   6791  C  CB    . LEU B  2 696  ? 132.074 85.569  128.014 1.00 366.65 ? 696  LEU B CB    1 
ATOM   6792  C  CG    . LEU B  2 696  ? 132.768 86.708  127.266 1.00 366.65 ? 696  LEU B CG    1 
ATOM   6793  C  CD1   . LEU B  2 696  ? 133.703 87.437  128.218 1.00 366.65 ? 696  LEU B CD1   1 
ATOM   6794  C  CD2   . LEU B  2 696  ? 133.527 86.208  126.055 1.00 366.65 ? 696  LEU B CD2   1 
ATOM   6795  N  N     . SER B  2 697  ? 131.945 83.101  125.511 1.00 375.06 ? 697  SER B N     1 
ATOM   6796  C  CA    . SER B  2 697  ? 132.554 81.890  124.966 1.00 375.06 ? 697  SER B CA    1 
ATOM   6797  C  C     . SER B  2 697  ? 133.224 82.202  123.636 1.00 375.06 ? 697  SER B C     1 
ATOM   6798  O  O     . SER B  2 697  ? 132.544 82.519  122.655 1.00 375.06 ? 697  SER B O     1 
ATOM   6799  C  CB    . SER B  2 697  ? 131.516 80.780  124.792 1.00 375.06 ? 697  SER B CB    1 
ATOM   6800  O  OG    . SER B  2 697  ? 132.094 79.639  124.180 1.00 375.06 ? 697  SER B OG    1 
ATOM   6801  N  N     . ASN B  2 698  ? 134.555 82.104  123.610 1.00 371.99 ? 698  ASN B N     1 
ATOM   6802  C  CA    . ASN B  2 698  ? 135.341 82.109  122.376 1.00 371.99 ? 698  ASN B CA    1 
ATOM   6803  C  C     . ASN B  2 698  ? 135.082 83.366  121.546 1.00 371.99 ? 698  ASN B C     1 
ATOM   6804  O  O     . ASN B  2 698  ? 134.594 83.312  120.416 1.00 371.99 ? 698  ASN B O     1 
ATOM   6805  C  CB    . ASN B  2 698  ? 135.062 80.842  121.560 1.00 371.99 ? 698  ASN B CB    1 
ATOM   6806  C  CG    . ASN B  2 698  ? 135.053 79.590  122.414 1.00 371.99 ? 698  ASN B CG    1 
ATOM   6807  O  OD1   . ASN B  2 698  ? 135.628 79.564  123.503 1.00 371.99 ? 698  ASN B OD1   1 
ATOM   6808  N  ND2   . ASN B  2 698  ? 134.399 78.545  121.925 1.00 371.99 ? 698  ASN B ND2   1 
ATOM   6809  N  N     . ILE B  2 699  ? 135.427 84.511  122.127 1.00 360.63 ? 699  ILE B N     1 
ATOM   6810  C  CA    . ILE B  2 699  ? 135.269 85.804  121.472 1.00 360.63 ? 699  ILE B CA    1 
ATOM   6811  C  C     . ILE B  2 699  ? 136.632 86.285  120.990 1.00 360.63 ? 699  ILE B C     1 
ATOM   6812  O  O     . ILE B  2 699  ? 137.598 86.329  121.765 1.00 360.63 ? 699  ILE B O     1 
ATOM   6813  C  CB    . ILE B  2 699  ? 134.615 86.832  122.412 1.00 360.63 ? 699  ILE B CB    1 
ATOM   6814  C  CG1   . ILE B  2 699  ? 133.099 86.614  122.451 1.00 360.63 ? 699  ILE B CG1   1 
ATOM   6815  C  CG2   . ILE B  2 699  ? 134.954 88.251  121.981 1.00 360.63 ? 699  ILE B CG2   1 
ATOM   6816  C  CD1   . ILE B  2 699  ? 132.325 87.763  123.062 1.00 360.63 ? 699  ILE B CD1   1 
ATOM   6817  N  N     . THR B  2 700  ? 136.712 86.633  119.709 1.00 350.25 ? 700  THR B N     1 
ATOM   6818  C  CA    . THR B  2 700  ? 137.923 87.161  119.098 1.00 350.25 ? 700  THR B CA    1 
ATOM   6819  C  C     . THR B  2 700  ? 137.553 88.422  118.336 1.00 350.25 ? 700  THR B C     1 
ATOM   6820  O  O     . THR B  2 700  ? 136.660 88.387  117.483 1.00 350.25 ? 700  THR B O     1 
ATOM   6821  C  CB    . THR B  2 700  ? 138.561 86.137  118.151 1.00 350.25 ? 700  THR B CB    1 
ATOM   6822  O  OG1   . THR B  2 700  ? 138.693 84.879  118.825 1.00 350.25 ? 700  THR B OG1   1 
ATOM   6823  C  CG2   . THR B  2 700  ? 139.932 86.611  117.698 1.00 350.25 ? 700  THR B CG2   1 
ATOM   6824  N  N     . ILE B  2 701  ? 138.223 89.532  118.640 1.00 358.93 ? 701  ILE B N     1 
ATOM   6825  C  CA    . ILE B  2 701  ? 137.823 90.813  118.065 1.00 358.93 ? 701  ILE B CA    1 
ATOM   6826  C  C     . ILE B  2 701  ? 139.017 91.760  118.060 1.00 358.93 ? 701  ILE B C     1 
ATOM   6827  O  O     . ILE B  2 701  ? 139.761 91.855  119.041 1.00 358.93 ? 701  ILE B O     1 
ATOM   6828  C  CB    . ILE B  2 701  ? 136.616 91.411  118.828 1.00 358.93 ? 701  ILE B CB    1 
ATOM   6829  C  CG1   . ILE B  2 701  ? 136.598 92.936  118.728 1.00 358.93 ? 701  ILE B CG1   1 
ATOM   6830  C  CG2   . ILE B  2 701  ? 136.616 90.975  120.281 1.00 358.93 ? 701  ILE B CG2   1 
ATOM   6831  C  CD1   . ILE B  2 701  ? 135.551 93.573  119.609 1.00 358.93 ? 701  ILE B CD1   1 
ATOM   6832  N  N     . ARG B  2 702  ? 139.185 92.466  116.942 1.00 353.83 ? 702  ARG B N     1 
ATOM   6833  C  CA    . ARG B  2 702  ? 140.196 93.504  116.789 1.00 353.83 ? 702  ARG B CA    1 
ATOM   6834  C  C     . ARG B  2 702  ? 139.507 94.829  116.490 1.00 353.83 ? 702  ARG B C     1 
ATOM   6835  O  O     . ARG B  2 702  ? 138.612 94.890  115.640 1.00 353.83 ? 702  ARG B O     1 
ATOM   6836  C  CB    . ARG B  2 702  ? 141.185 93.150  115.674 1.00 353.83 ? 702  ARG B CB    1 
ATOM   6837  C  CG    . ARG B  2 702  ? 141.986 91.885  115.940 1.00 353.83 ? 702  ARG B CG    1 
ATOM   6838  C  CD    . ARG B  2 702  ? 142.817 91.477  114.735 1.00 353.83 ? 702  ARG B CD    1 
ATOM   6839  N  NE    . ARG B  2 702  ? 143.444 90.172  114.931 1.00 353.83 ? 702  ARG B NE    1 
ATOM   6840  C  CZ    . ARG B  2 702  ? 144.088 89.500  113.983 1.00 353.83 ? 702  ARG B CZ    1 
ATOM   6841  N  NH1   . ARG B  2 702  ? 144.626 88.319  114.253 1.00 353.83 ? 702  ARG B NH1   1 
ATOM   6842  N  NH2   . ARG B  2 702  ? 144.191 90.007  112.762 1.00 353.83 ? 702  ARG B NH2   1 
ATOM   6843  N  N     . ILE B  2 703  ? 139.922 95.881  117.191 1.00 352.23 ? 703  ILE B N     1 
ATOM   6844  C  CA    . ILE B  2 703  ? 139.320 97.206  117.063 1.00 352.23 ? 703  ILE B CA    1 
ATOM   6845  C  C     . ILE B  2 703  ? 140.412 98.230  116.773 1.00 352.23 ? 703  ILE B C     1 
ATOM   6846  O  O     . ILE B  2 703  ? 140.972 98.812  117.715 1.00 352.23 ? 703  ILE B O     1 
ATOM   6847  C  CB    . ILE B  2 703  ? 138.552 97.599  118.334 1.00 352.23 ? 703  ILE B CB    1 
ATOM   6848  C  CG1   . ILE B  2 703  ? 137.752 96.419  118.881 1.00 352.23 ? 703  ILE B CG1   1 
ATOM   6849  C  CG2   . ILE B  2 703  ? 137.632 98.774  118.055 1.00 352.23 ? 703  ILE B CG2   1 
ATOM   6850  C  CD1   . ILE B  2 703  ? 137.059 96.726  120.188 1.00 352.23 ? 703  ILE B CD1   1 
ATOM   6851  N  N     . PRO B  2 704  ? 140.747 98.484  115.510 1.00 338.34 ? 704  PRO B N     1 
ATOM   6852  C  CA    . PRO B  2 704  ? 141.746 99.516  115.210 1.00 338.34 ? 704  PRO B CA    1 
ATOM   6853  C  C     . PRO B  2 704  ? 141.252 100.906 115.584 1.00 338.34 ? 704  PRO B C     1 
ATOM   6854  O  O     . PRO B  2 704  ? 140.050 101.177 115.621 1.00 338.34 ? 704  PRO B O     1 
ATOM   6855  C  CB    . PRO B  2 704  ? 141.952 99.384  113.696 1.00 338.34 ? 704  PRO B CB    1 
ATOM   6856  C  CG    . PRO B  2 704  ? 140.712 98.713  113.196 1.00 338.34 ? 704  PRO B CG    1 
ATOM   6857  C  CD    . PRO B  2 704  ? 140.274 97.794  114.298 1.00 338.34 ? 704  PRO B CD    1 
ATOM   6858  N  N     . ARG B  2 705  ? 142.204 101.792 115.858 1.00 337.93 ? 705  ARG B N     1 
ATOM   6859  C  CA    . ARG B  2 705  ? 141.882 103.141 116.295 1.00 337.93 ? 705  ARG B CA    1 
ATOM   6860  C  C     . ARG B  2 705  ? 141.204 103.931 115.173 1.00 337.93 ? 705  ARG B C     1 
ATOM   6861  O  O     . ARG B  2 705  ? 141.223 103.547 113.999 1.00 337.93 ? 705  ARG B O     1 
ATOM   6862  C  CB    . ARG B  2 705  ? 143.144 103.862 116.765 1.00 337.93 ? 705  ARG B CB    1 
ATOM   6863  C  CG    . ARG B  2 705  ? 144.128 104.165 115.646 1.00 337.93 ? 705  ARG B CG    1 
ATOM   6864  C  CD    . ARG B  2 705  ? 145.372 104.866 116.167 1.00 337.93 ? 705  ARG B CD    1 
ATOM   6865  N  NE    . ARG B  2 705  ? 146.141 105.482 115.089 1.00 337.93 ? 705  ARG B NE    1 
ATOM   6866  C  CZ    . ARG B  2 705  ? 147.119 104.878 114.422 1.00 337.93 ? 705  ARG B CZ    1 
ATOM   6867  N  NH1   . ARG B  2 705  ? 147.759 105.523 113.454 1.00 337.93 ? 705  ARG B NH1   1 
ATOM   6868  N  NH2   . ARG B  2 705  ? 147.459 103.632 114.722 1.00 337.93 ? 705  ARG B NH2   1 
ATOM   6869  N  N     . GLY B  2 706  ? 140.602 105.054 115.556 1.00 330.35 ? 706  GLY B N     1 
ATOM   6870  C  CA    . GLY B  2 706  ? 139.945 105.933 114.598 1.00 330.35 ? 706  GLY B CA    1 
ATOM   6871  C  C     . GLY B  2 706  ? 138.911 105.239 113.738 1.00 330.35 ? 706  GLY B C     1 
ATOM   6872  O  O     . GLY B  2 706  ? 138.812 105.521 112.538 1.00 330.35 ? 706  GLY B O     1 
ATOM   6873  N  N     . GLN B  2 707  ? 138.136 104.334 114.328 1.00 333.21 ? 707  GLN B N     1 
ATOM   6874  C  CA    . GLN B  2 707  ? 137.240 103.471 113.575 1.00 333.21 ? 707  GLN B CA    1 
ATOM   6875  C  C     . GLN B  2 707  ? 135.952 103.259 114.358 1.00 333.21 ? 707  GLN B C     1 
ATOM   6876  O  O     . GLN B  2 707  ? 135.981 103.119 115.583 1.00 333.21 ? 707  GLN B O     1 
ATOM   6877  C  CB    . GLN B  2 707  ? 137.922 102.127 113.277 1.00 333.21 ? 707  GLN B CB    1 
ATOM   6878  C  CG    . GLN B  2 707  ? 136.986 100.970 112.991 1.00 333.21 ? 707  GLN B CG    1 
ATOM   6879  C  CD    . GLN B  2 707  ? 137.262 99.770  113.878 1.00 333.21 ? 707  GLN B CD    1 
ATOM   6880  O  OE1   . GLN B  2 707  ? 137.654 99.916  115.036 1.00 333.21 ? 707  GLN B OE1   1 
ATOM   6881  N  NE2   . GLN B  2 707  ? 137.063 98.576  113.336 1.00 333.21 ? 707  GLN B NE2   1 
ATOM   6882  N  N     . LEU B  2 708  ? 134.825 103.245 113.650 1.00 333.21 ? 708  LEU B N     1 
ATOM   6883  C  CA    . LEU B  2 708  ? 133.530 103.011 114.269 1.00 333.21 ? 708  LEU B CA    1 
ATOM   6884  C  C     . LEU B  2 708  ? 133.174 101.531 114.212 1.00 333.21 ? 708  LEU B C     1 
ATOM   6885  O  O     . LEU B  2 708  ? 133.401 100.858 113.199 1.00 333.21 ? 708  LEU B O     1 
ATOM   6886  C  CB    . LEU B  2 708  ? 132.448 103.837 113.573 1.00 333.21 ? 708  LEU B CB    1 
ATOM   6887  C  CG    . LEU B  2 708  ? 131.581 104.719 114.472 1.00 333.21 ? 708  LEU B CG    1 
ATOM   6888  C  CD1   . LEU B  2 708  ? 130.480 105.390 113.665 1.00 333.21 ? 708  LEU B CD1   1 
ATOM   6889  C  CD2   . LEU B  2 708  ? 130.997 103.907 115.610 1.00 333.21 ? 708  LEU B CD2   1 
ATOM   6890  N  N     . THR B  2 709  ? 132.602 101.025 115.305 1.00 345.82 ? 709  THR B N     1 
ATOM   6891  C  CA    . THR B  2 709  ? 132.245 99.613  115.413 1.00 345.82 ? 709  THR B CA    1 
ATOM   6892  C  C     . THR B  2 709  ? 130.841 99.499  115.987 1.00 345.82 ? 709  THR B C     1 
ATOM   6893  O  O     . THR B  2 709  ? 130.601 99.881  117.138 1.00 345.82 ? 709  THR B O     1 
ATOM   6894  C  CB    . THR B  2 709  ? 133.237 98.852  116.290 1.00 345.82 ? 709  THR B CB    1 
ATOM   6895  O  OG1   . THR B  2 709  ? 134.519 98.827  115.655 1.00 345.82 ? 709  THR B OG1   1 
ATOM   6896  C  CG2   . THR B  2 709  ? 132.756 97.429  116.514 1.00 345.82 ? 709  THR B CG2   1 
ATOM   6897  N  N     . MET B  2 710  ? 129.920 98.961  115.193 1.00 352.84 ? 710  MET B N     1 
ATOM   6898  C  CA    . MET B  2 710  ? 128.549 98.732  115.627 1.00 352.84 ? 710  MET B CA    1 
ATOM   6899  C  C     . MET B  2 710  ? 128.425 97.282  116.075 1.00 352.84 ? 710  MET B C     1 
ATOM   6900  O  O     . MET B  2 710  ? 128.580 96.353  115.272 1.00 352.84 ? 710  MET B O     1 
ATOM   6901  C  CB    . MET B  2 710  ? 127.553 99.061  114.518 1.00 352.84 ? 710  MET B CB    1 
ATOM   6902  C  CG    . MET B  2 710  ? 127.542 100.530 114.105 1.00 352.84 ? 710  MET B CG    1 
ATOM   6903  S  SD    . MET B  2 710  ? 127.538 101.688 115.488 1.00 352.84 ? 710  MET B SD    1 
ATOM   6904  C  CE    . MET B  2 710  ? 127.534 103.260 114.622 1.00 352.84 ? 710  MET B CE    1 
ATOM   6905  N  N     . ILE B  2 711  ? 128.200 97.090  117.363 1.00 341.19 ? 711  ILE B N     1 
ATOM   6906  C  CA    . ILE B  2 711  ? 127.781 95.793  117.866 1.00 341.19 ? 711  ILE B CA    1 
ATOM   6907  C  C     . ILE B  2 711  ? 126.271 95.686  117.716 1.00 341.19 ? 711  ILE B C     1 
ATOM   6908  O  O     . ILE B  2 711  ? 125.531 96.636  117.996 1.00 341.19 ? 711  ILE B O     1 
ATOM   6909  C  CB    . ILE B  2 711  ? 128.225 95.614  119.326 1.00 341.19 ? 711  ILE B CB    1 
ATOM   6910  C  CG1   . ILE B  2 711  ? 129.695 96.000  119.473 1.00 341.19 ? 711  ILE B CG1   1 
ATOM   6911  C  CG2   . ILE B  2 711  ? 128.003 94.181  119.775 1.00 341.19 ? 711  ILE B CG2   1 
ATOM   6912  C  CD1   . ILE B  2 711  ? 130.249 95.776  120.854 1.00 341.19 ? 711  ILE B CD1   1 
ATOM   6913  N  N     . VAL B  2 712  ? 125.800 94.530  117.249 1.00 349.24 ? 712  VAL B N     1 
ATOM   6914  C  CA    . VAL B  2 712  ? 124.383 94.302  117.015 1.00 349.24 ? 712  VAL B CA    1 
ATOM   6915  C  C     . VAL B  2 712  ? 124.061 92.857  117.375 1.00 349.24 ? 712  VAL B C     1 
ATOM   6916  O  O     . VAL B  2 712  ? 124.944 91.999  117.456 1.00 349.24 ? 712  VAL B O     1 
ATOM   6917  C  CB    . VAL B  2 712  ? 123.975 94.609  115.553 1.00 349.24 ? 712  VAL B CB    1 
ATOM   6918  C  CG1   . VAL B  2 712  ? 124.310 93.435  114.640 1.00 349.24 ? 712  VAL B CG1   1 
ATOM   6919  C  CG2   . VAL B  2 712  ? 122.501 94.977  115.467 1.00 349.24 ? 712  VAL B CG2   1 
ATOM   6920  N  N     . GLY B  2 713  ? 122.786 92.604  117.601 1.00 352.56 ? 713  GLY B N     1 
ATOM   6921  C  CA    . GLY B  2 713  ? 122.330 91.286  118.000 1.00 352.56 ? 713  GLY B CA    1 
ATOM   6922  C  C     . GLY B  2 713  ? 121.041 91.384  118.782 1.00 352.56 ? 713  GLY B C     1 
ATOM   6923  O  O     . GLY B  2 713  ? 120.582 92.465  119.148 1.00 352.56 ? 713  GLY B O     1 
ATOM   6924  N  N     . GLN B  2 714  ? 120.459 90.217  119.043 1.00 355.54 ? 714  GLN B N     1 
ATOM   6925  C  CA    . GLN B  2 714  ? 119.176 90.131  119.722 1.00 355.54 ? 714  GLN B CA    1 
ATOM   6926  C  C     . GLN B  2 714  ? 119.310 90.563  121.183 1.00 355.54 ? 714  GLN B C     1 
ATOM   6927  O  O     . GLN B  2 714  ? 120.397 90.879  121.675 1.00 355.54 ? 714  GLN B O     1 
ATOM   6928  C  CB    . GLN B  2 714  ? 118.624 88.711  119.623 1.00 355.54 ? 714  GLN B CB    1 
ATOM   6929  C  CG    . GLN B  2 714  ? 118.805 88.059  118.255 1.00 355.54 ? 714  GLN B CG    1 
ATOM   6930  C  CD    . GLN B  2 714  ? 117.873 88.626  117.200 1.00 355.54 ? 714  GLN B CD    1 
ATOM   6931  O  OE1   . GLN B  2 714  ? 116.873 88.003  116.844 1.00 355.54 ? 714  GLN B OE1   1 
ATOM   6932  N  NE2   . GLN B  2 714  ? 118.203 89.805  116.684 1.00 355.54 ? 714  GLN B NE2   1 
ATOM   6933  N  N     . VAL B  2 715  ? 118.178 90.577  121.886 1.00 336.98 ? 715  VAL B N     1 
ATOM   6934  C  CA    . VAL B  2 715  ? 118.185 90.900  123.307 1.00 336.98 ? 715  VAL B CA    1 
ATOM   6935  C  C     . VAL B  2 715  ? 118.815 89.750  124.079 1.00 336.98 ? 715  VAL B C     1 
ATOM   6936  O  O     . VAL B  2 715  ? 118.421 88.586  123.924 1.00 336.98 ? 715  VAL B O     1 
ATOM   6937  C  CB    . VAL B  2 715  ? 116.761 91.188  123.803 1.00 336.98 ? 715  VAL B CB    1 
ATOM   6938  C  CG1   . VAL B  2 715  ? 116.781 91.564  125.277 1.00 336.98 ? 715  VAL B CG1   1 
ATOM   6939  C  CG2   . VAL B  2 715  ? 116.124 92.294  122.974 1.00 336.98 ? 715  VAL B CG2   1 
ATOM   6940  N  N     . GLY B  2 716  ? 119.800 90.072  124.912 1.00 330.30 ? 716  GLY B N     1 
ATOM   6941  C  CA    . GLY B  2 716  ? 120.485 89.062  125.692 1.00 330.30 ? 716  GLY B CA    1 
ATOM   6942  C  C     . GLY B  2 716  ? 121.541 88.322  124.899 1.00 330.30 ? 716  GLY B C     1 
ATOM   6943  O  O     . GLY B  2 716  ? 121.518 87.091  124.820 1.00 330.30 ? 716  GLY B O     1 
ATOM   6944  N  N     . CYS B  2 717  ? 122.474 89.066  124.305 1.00 353.61 ? 717  CYS B N     1 
ATOM   6945  C  CA    . CYS B  2 717  ? 123.550 88.478  123.516 1.00 353.61 ? 717  CYS B CA    1 
ATOM   6946  C  C     . CYS B  2 717  ? 124.909 88.997  123.965 1.00 353.61 ? 717  CYS B C     1 
ATOM   6947  O  O     . CYS B  2 717  ? 125.854 89.054  123.172 1.00 353.61 ? 717  CYS B O     1 
ATOM   6948  C  CB    . CYS B  2 717  ? 123.341 88.739  122.025 1.00 353.61 ? 717  CYS B CB    1 
ATOM   6949  S  SG    . CYS B  2 717  ? 121.907 87.896  121.316 1.00 353.61 ? 717  CYS B SG    1 
ATOM   6950  N  N     . GLY B  2 718  ? 125.022 89.377  125.235 1.00 335.55 ? 718  GLY B N     1 
ATOM   6951  C  CA    . GLY B  2 718  ? 126.303 89.794  125.780 1.00 335.55 ? 718  GLY B CA    1 
ATOM   6952  C  C     . GLY B  2 718  ? 126.901 91.009  125.108 1.00 335.55 ? 718  GLY B C     1 
ATOM   6953  O  O     . GLY B  2 718  ? 128.121 91.070  124.916 1.00 335.55 ? 718  GLY B O     1 
ATOM   6954  N  N     . LYS B  2 719  ? 126.066 91.976  124.732 1.00 320.36 ? 719  LYS B N     1 
ATOM   6955  C  CA    . LYS B  2 719  ? 126.584 93.209  124.148 1.00 320.36 ? 719  LYS B CA    1 
ATOM   6956  C  C     . LYS B  2 719  ? 127.115 94.134  125.236 1.00 320.36 ? 719  LYS B C     1 
ATOM   6957  O  O     . LYS B  2 719  ? 128.286 94.529  125.220 1.00 320.36 ? 719  LYS B O     1 
ATOM   6958  C  CB    . LYS B  2 719  ? 125.497 93.891  123.314 1.00 320.36 ? 719  LYS B CB    1 
ATOM   6959  C  CG    . LYS B  2 719  ? 125.081 93.085  122.088 1.00 320.36 ? 719  LYS B CG    1 
ATOM   6960  C  CD    . LYS B  2 719  ? 124.114 93.852  121.201 1.00 320.36 ? 719  LYS B CD    1 
ATOM   6961  C  CE    . LYS B  2 719  ? 122.802 94.126  121.917 1.00 320.36 ? 719  LYS B CE    1 
ATOM   6962  N  NZ    . LYS B  2 719  ? 121.889 94.965  121.092 1.00 320.36 ? 719  LYS B NZ    1 
ATOM   6963  N  N     . SER B  2 720  ? 126.265 94.480  126.203 1.00 306.57 ? 720  SER B N     1 
ATOM   6964  C  CA    . SER B  2 720  ? 126.750 95.214  127.364 1.00 306.57 ? 720  SER B CA    1 
ATOM   6965  C  C     . SER B  2 720  ? 127.787 94.406  128.130 1.00 306.57 ? 720  SER B C     1 
ATOM   6966  O  O     . SER B  2 720  ? 128.712 94.977  128.718 1.00 306.57 ? 720  SER B O     1 
ATOM   6967  C  CB    . SER B  2 720  ? 125.579 95.585  128.272 1.00 306.57 ? 720  SER B CB    1 
ATOM   6968  O  OG    . SER B  2 720  ? 124.584 96.284  127.548 1.00 306.57 ? 720  SER B OG    1 
ATOM   6969  N  N     . SER B  2 721  ? 127.669 93.078  128.114 1.00 316.39 ? 721  SER B N     1 
ATOM   6970  C  CA    . SER B  2 721  ? 128.639 92.245  128.815 1.00 316.39 ? 721  SER B CA    1 
ATOM   6971  C  C     . SER B  2 721  ? 129.986 92.257  128.107 1.00 316.39 ? 721  SER B C     1 
ATOM   6972  O  O     . SER B  2 721  ? 131.035 92.301  128.760 1.00 316.39 ? 721  SER B O     1 
ATOM   6973  C  CB    . SER B  2 721  ? 128.105 90.822  128.939 1.00 316.39 ? 721  SER B CB    1 
ATOM   6974  O  OG    . SER B  2 721  ? 126.803 90.826  129.496 1.00 316.39 ? 721  SER B OG    1 
ATOM   6975  N  N     . LEU B  2 722  ? 129.982 92.201  126.776 1.00 316.71 ? 722  LEU B N     1 
ATOM   6976  C  CA    . LEU B  2 722  ? 131.218 92.406  126.032 1.00 316.71 ? 722  LEU B CA    1 
ATOM   6977  C  C     . LEU B  2 722  ? 131.795 93.786  126.316 1.00 316.71 ? 722  LEU B C     1 
ATOM   6978  O  O     . LEU B  2 722  ? 133.013 93.944  126.462 1.00 316.71 ? 722  LEU B O     1 
ATOM   6979  C  CB    . LEU B  2 722  ? 130.953 92.212  124.539 1.00 316.71 ? 722  LEU B CB    1 
ATOM   6980  C  CG    . LEU B  2 722  ? 132.013 92.548  123.493 1.00 316.71 ? 722  LEU B CG    1 
ATOM   6981  C  CD1   . LEU B  2 722  ? 133.324 91.842  123.781 1.00 316.71 ? 722  LEU B CD1   1 
ATOM   6982  C  CD2   . LEU B  2 722  ? 131.488 92.160  122.123 1.00 316.71 ? 722  LEU B CD2   1 
ATOM   6983  N  N     . LEU B  2 723  ? 130.927 94.794  126.436 1.00 316.51 ? 723  LEU B N     1 
ATOM   6984  C  CA    . LEU B  2 723  ? 131.387 96.143  126.747 1.00 316.51 ? 723  LEU B CA    1 
ATOM   6985  C  C     . LEU B  2 723  ? 132.065 96.204  128.110 1.00 316.51 ? 723  LEU B C     1 
ATOM   6986  O  O     . LEU B  2 723  ? 133.069 96.901  128.284 1.00 316.51 ? 723  LEU B O     1 
ATOM   6987  C  CB    . LEU B  2 723  ? 130.213 97.117  126.695 1.00 316.51 ? 723  LEU B CB    1 
ATOM   6988  C  CG    . LEU B  2 723  ? 130.460 98.413  125.929 1.00 316.51 ? 723  LEU B CG    1 
ATOM   6989  C  CD1   . LEU B  2 723  ? 130.587 98.113  124.444 1.00 316.51 ? 723  LEU B CD1   1 
ATOM   6990  C  CD2   . LEU B  2 723  ? 129.341 99.404  126.198 1.00 316.51 ? 723  LEU B CD2   1 
ATOM   6991  N  N     . LEU B  2 724  ? 131.523 95.485  129.093 1.00 317.97 ? 724  LEU B N     1 
ATOM   6992  C  CA    . LEU B  2 724  ? 132.082 95.545  130.441 1.00 317.97 ? 724  LEU B CA    1 
ATOM   6993  C  C     . LEU B  2 724  ? 133.339 94.690  130.574 1.00 317.97 ? 724  LEU B C     1 
ATOM   6994  O  O     . LEU B  2 724  ? 134.260 95.053  131.314 1.00 317.97 ? 724  LEU B O     1 
ATOM   6995  C  CB    . LEU B  2 724  ? 131.035 95.119  131.467 1.00 317.97 ? 724  LEU B CB    1 
ATOM   6996  C  CG    . LEU B  2 724  ? 129.818 96.039  131.577 1.00 317.97 ? 724  LEU B CG    1 
ATOM   6997  C  CD1   . LEU B  2 724  ? 129.049 95.776  132.865 1.00 317.97 ? 724  LEU B CD1   1 
ATOM   6998  C  CD2   . LEU B  2 724  ? 130.242 97.495  131.487 1.00 317.97 ? 724  LEU B CD2   1 
ATOM   6999  N  N     . ALA B  2 725  ? 133.393 93.550  129.880 1.00 317.82 ? 725  ALA B N     1 
ATOM   7000  C  CA    . ALA B  2 725  ? 134.606 92.737  129.896 1.00 317.82 ? 725  ALA B CA    1 
ATOM   7001  C  C     . ALA B  2 725  ? 135.754 93.465  129.208 1.00 317.82 ? 725  ALA B C     1 
ATOM   7002  O  O     . ALA B  2 725  ? 136.879 93.496  129.720 1.00 317.82 ? 725  ALA B O     1 
ATOM   7003  C  CB    . ALA B  2 725  ? 134.347 91.384  129.235 1.00 317.82 ? 725  ALA B CB    1 
ATOM   7004  N  N     . THR B  2 726  ? 135.484 94.056  128.038 1.00 325.62 ? 726  THR B N     1 
ATOM   7005  C  CA    . THR B  2 726  ? 136.467 94.933  127.407 1.00 325.62 ? 726  THR B CA    1 
ATOM   7006  C  C     . THR B  2 726  ? 136.910 96.041  128.350 1.00 325.62 ? 726  THR B C     1 
ATOM   7007  O  O     . THR B  2 726  ? 138.034 96.543  128.240 1.00 325.62 ? 726  THR B O     1 
ATOM   7008  C  CB    . THR B  2 726  ? 135.889 95.546  126.131 1.00 325.62 ? 726  THR B CB    1 
ATOM   7009  O  OG1   . THR B  2 726  ? 134.596 96.101  126.407 1.00 325.62 ? 726  THR B OG1   1 
ATOM   7010  C  CG2   . THR B  2 726  ? 135.758 94.501  125.047 1.00 325.62 ? 726  THR B CG2   1 
ATOM   7011  N  N     . LEU B  2 727  ? 136.040 96.438  129.276 1.00 318.62 ? 727  LEU B N     1 
ATOM   7012  C  CA    . LEU B  2 727  ? 136.318 97.508  130.220 1.00 318.62 ? 727  LEU B CA    1 
ATOM   7013  C  C     . LEU B  2 727  ? 137.227 97.071  131.359 1.00 318.62 ? 727  LEU B C     1 
ATOM   7014  O  O     . LEU B  2 727  ? 137.551 97.893  132.221 1.00 318.62 ? 727  LEU B O     1 
ATOM   7015  C  CB    . LEU B  2 727  ? 135.000 98.042  130.784 1.00 318.62 ? 727  LEU B CB    1 
ATOM   7016  C  CG    . LEU B  2 727  ? 134.877 99.532  131.093 1.00 318.62 ? 727  LEU B CG    1 
ATOM   7017  C  CD1   . LEU B  2 727  ? 135.247 100.365 129.875 1.00 318.62 ? 727  LEU B CD1   1 
ATOM   7018  C  CD2   . LEU B  2 727  ? 133.457 99.837  131.538 1.00 318.62 ? 727  LEU B CD2   1 
ATOM   7019  N  N     . GLY B  2 728  ? 137.645 95.806  131.386 1.00 314.59 ? 728  GLY B N     1 
ATOM   7020  C  CA    . GLY B  2 728  ? 138.415 95.282  132.491 1.00 314.59 ? 728  GLY B CA    1 
ATOM   7021  C  C     . GLY B  2 728  ? 137.655 95.132  133.788 1.00 314.59 ? 728  GLY B C     1 
ATOM   7022  O  O     . GLY B  2 728  ? 138.197 94.555  134.739 1.00 314.59 ? 728  GLY B O     1 
ATOM   7023  N  N     . GLU B  2 729  ? 136.418 95.629  133.863 1.00 311.61 ? 729  GLU B N     1 
ATOM   7024  C  CA    . GLU B  2 729  ? 135.605 95.457  135.059 1.00 311.61 ? 729  GLU B CA    1 
ATOM   7025  C  C     . GLU B  2 729  ? 135.298 93.993  135.331 1.00 311.61 ? 729  GLU B C     1 
ATOM   7026  O  O     . GLU B  2 729  ? 134.946 93.636  136.461 1.00 311.61 ? 729  GLU B O     1 
ATOM   7027  C  CB    . GLU B  2 729  ? 134.306 96.255  134.917 1.00 311.61 ? 729  GLU B CB    1 
ATOM   7028  C  CG    . GLU B  2 729  ? 133.497 96.352  136.191 1.00 311.61 ? 729  GLU B CG    1 
ATOM   7029  C  CD    . GLU B  2 729  ? 134.308 96.913  137.335 1.00 311.61 ? 729  GLU B CD    1 
ATOM   7030  O  OE1   . GLU B  2 729  ? 134.607 98.125  137.310 1.00 311.61 ? 729  GLU B OE1   1 
ATOM   7031  O  OE2   . GLU B  2 729  ? 134.666 96.136  138.246 1.00 311.61 ? 729  GLU B OE2   1 
ATOM   7032  N  N     . MET B  2 730  ? 135.435 93.137  134.322 1.00 325.32 ? 730  MET B N     1 
ATOM   7033  C  CA    . MET B  2 730  ? 135.177 91.703  134.438 1.00 325.32 ? 730  MET B CA    1 
ATOM   7034  C  C     . MET B  2 730  ? 136.337 90.975  133.765 1.00 325.32 ? 730  MET B C     1 
ATOM   7035  O  O     . MET B  2 730  ? 136.317 90.753  132.551 1.00 325.32 ? 730  MET B O     1 
ATOM   7036  C  CB    . MET B  2 730  ? 133.845 91.341  133.804 1.00 325.32 ? 730  MET B CB    1 
ATOM   7037  C  CG    . MET B  2 730  ? 132.811 90.819  134.776 1.00 325.32 ? 730  MET B CG    1 
ATOM   7038  S  SD    . MET B  2 730  ? 131.449 90.000  133.926 1.00 325.32 ? 730  MET B SD    1 
ATOM   7039  C  CE    . MET B  2 730  ? 132.033 89.980  132.231 1.00 325.32 ? 730  MET B CE    1 
ATOM   7040  N  N     . GLN B  2 731  ? 137.346 90.609  134.553 1.00 338.02 ? 731  GLN B N     1 
ATOM   7041  C  CA    . GLN B  2 731  ? 138.494 89.886  134.016 1.00 338.02 ? 731  GLN B CA    1 
ATOM   7042  C  C     . GLN B  2 731  ? 138.081 88.464  133.663 1.00 338.02 ? 731  GLN B C     1 
ATOM   7043  O  O     . GLN B  2 731  ? 137.578 87.724  134.514 1.00 338.02 ? 731  GLN B O     1 
ATOM   7044  C  CB    . GLN B  2 731  ? 139.645 89.882  135.021 1.00 338.02 ? 731  GLN B CB    1 
ATOM   7045  C  CG    . GLN B  2 731  ? 140.843 89.030  134.601 1.00 338.02 ? 731  GLN B CG    1 
ATOM   7046  C  CD    . GLN B  2 731  ? 141.586 89.592  133.397 1.00 338.02 ? 731  GLN B CD    1 
ATOM   7047  O  OE1   . GLN B  2 731  ? 141.677 90.806  133.219 1.00 338.02 ? 731  GLN B OE1   1 
ATOM   7048  N  NE2   . GLN B  2 731  ? 142.122 88.704  132.564 1.00 338.02 ? 731  GLN B NE2   1 
ATOM   7049  N  N     . LYS B  2 732  ? 138.294 88.085  132.406 1.00 351.49 ? 732  LYS B N     1 
ATOM   7050  C  CA    . LYS B  2 732  ? 137.846 86.790  131.916 1.00 351.49 ? 732  LYS B CA    1 
ATOM   7051  C  C     . LYS B  2 732  ? 138.617 85.655  132.580 1.00 351.49 ? 732  LYS B C     1 
ATOM   7052  O  O     . LYS B  2 732  ? 139.751 85.824  133.037 1.00 351.49 ? 732  LYS B O     1 
ATOM   7053  C  CB    . LYS B  2 732  ? 138.008 86.722  130.400 1.00 351.49 ? 732  LYS B CB    1 
ATOM   7054  C  CG    . LYS B  2 732  ? 137.212 87.775  129.656 1.00 351.49 ? 732  LYS B CG    1 
ATOM   7055  C  CD    . LYS B  2 732  ? 137.715 87.935  128.236 1.00 351.49 ? 732  LYS B CD    1 
ATOM   7056  C  CE    . LYS B  2 732  ? 137.075 89.134  127.563 1.00 351.49 ? 732  LYS B CE    1 
ATOM   7057  N  NZ    . LYS B  2 732  ? 137.718 89.433  126.257 1.00 351.49 ? 732  LYS B NZ    1 
ATOM   7058  N  N     . VAL B  2 733  ? 137.976 84.484  132.641 1.00 350.39 ? 733  VAL B N     1 
ATOM   7059  C  CA    . VAL B  2 733  ? 138.620 83.307  133.220 1.00 350.39 ? 733  VAL B CA    1 
ATOM   7060  C  C     . VAL B  2 733  ? 139.861 82.939  132.417 1.00 350.39 ? 733  VAL B C     1 
ATOM   7061  O  O     . VAL B  2 733  ? 140.982 82.922  132.937 1.00 350.39 ? 733  VAL B O     1 
ATOM   7062  C  CB    . VAL B  2 733  ? 137.631 82.129  133.293 1.00 350.39 ? 733  VAL B CB    1 
ATOM   7063  C  CG1   . VAL B  2 733  ? 138.368 80.839  133.614 1.00 350.39 ? 733  VAL B CG1   1 
ATOM   7064  C  CG2   . VAL B  2 733  ? 136.564 82.393  134.334 1.00 350.39 ? 733  VAL B CG2   1 
ATOM   7065  N  N     . SER B  2 734  ? 139.675 82.645  131.132 1.00 348.17 ? 734  SER B N     1 
ATOM   7066  C  CA    . SER B  2 734  ? 140.760 82.232  130.249 1.00 348.17 ? 734  SER B CA    1 
ATOM   7067  C  C     . SER B  2 734  ? 140.643 83.009  128.946 1.00 348.17 ? 734  SER B C     1 
ATOM   7068  O  O     . SER B  2 734  ? 139.721 82.770  128.161 1.00 348.17 ? 734  SER B O     1 
ATOM   7069  C  CB    . SER B  2 734  ? 140.714 80.726  129.993 1.00 348.17 ? 734  SER B CB    1 
ATOM   7070  O  OG    . SER B  2 734  ? 139.404 80.313  129.641 1.00 348.17 ? 734  SER B OG    1 
ATOM   7071  N  N     . GLY B  2 735  ? 141.566 83.930  128.719 1.00 341.39 ? 735  GLY B N     1 
ATOM   7072  C  CA    . GLY B  2 735  ? 141.564 84.718  127.506 1.00 341.39 ? 735  GLY B CA    1 
ATOM   7073  C  C     . GLY B  2 735  ? 142.435 85.943  127.637 1.00 341.39 ? 735  GLY B C     1 
ATOM   7074  O  O     . GLY B  2 735  ? 142.711 86.436  128.732 1.00 341.39 ? 735  GLY B O     1 
ATOM   7075  N  N     . ALA B  2 736  ? 142.871 86.446  126.486 1.00 349.40 ? 736  ALA B N     1 
ATOM   7076  C  CA    . ALA B  2 736  ? 143.771 87.588  126.424 1.00 349.40 ? 736  ALA B CA    1 
ATOM   7077  C  C     . ALA B  2 736  ? 143.037 88.812  125.894 1.00 349.40 ? 736  ALA B C     1 
ATOM   7078  O  O     . ALA B  2 736  ? 142.280 88.724  124.921 1.00 349.40 ? 736  ALA B O     1 
ATOM   7079  C  CB    . ALA B  2 736  ? 144.987 87.285  125.543 1.00 349.40 ? 736  ALA B CB    1 
ATOM   7080  N  N     . VAL B  2 737  ? 143.269 89.953  126.538 1.00 339.46 ? 737  VAL B N     1 
ATOM   7081  C  CA    . VAL B  2 737  ? 142.609 91.204  126.179 1.00 339.46 ? 737  VAL B CA    1 
ATOM   7082  C  C     . VAL B  2 737  ? 143.574 92.352  126.445 1.00 339.46 ? 737  VAL B C     1 
ATOM   7083  O  O     . VAL B  2 737  ? 144.128 92.468  127.543 1.00 339.46 ? 737  VAL B O     1 
ATOM   7084  C  CB    . VAL B  2 737  ? 141.286 91.384  126.953 1.00 339.46 ? 737  VAL B CB    1 
ATOM   7085  C  CG1   . VAL B  2 737  ? 141.474 91.048  128.429 1.00 339.46 ? 737  VAL B CG1   1 
ATOM   7086  C  CG2   . VAL B  2 737  ? 140.752 92.794  126.776 1.00 339.46 ? 737  VAL B CG2   1 
ATOM   7087  N  N     . PHE B  2 738  ? 143.781 93.198  125.435 1.00 345.80 ? 738  PHE B N     1 
ATOM   7088  C  CA    . PHE B  2 738  ? 144.744 94.288  125.515 1.00 345.80 ? 738  PHE B CA    1 
ATOM   7089  C  C     . PHE B  2 738  ? 144.145 95.561  124.933 1.00 345.80 ? 738  PHE B C     1 
ATOM   7090  O  O     . PHE B  2 738  ? 143.276 95.516  124.059 1.00 345.80 ? 738  PHE B O     1 
ATOM   7091  C  CB    . PHE B  2 738  ? 146.046 93.974  124.759 1.00 345.80 ? 738  PHE B CB    1 
ATOM   7092  C  CG    . PHE B  2 738  ? 146.525 92.558  124.916 1.00 345.80 ? 738  PHE B CG    1 
ATOM   7093  C  CD1   . PHE B  2 738  ? 146.067 91.559  124.069 1.00 345.80 ? 738  PHE B CD1   1 
ATOM   7094  C  CD2   . PHE B  2 738  ? 147.449 92.228  125.892 1.00 345.80 ? 738  PHE B CD2   1 
ATOM   7095  C  CE1   . PHE B  2 738  ? 146.510 90.259  124.203 1.00 345.80 ? 738  PHE B CE1   1 
ATOM   7096  C  CE2   . PHE B  2 738  ? 147.897 90.929  126.033 1.00 345.80 ? 738  PHE B CE2   1 
ATOM   7097  C  CZ    . PHE B  2 738  ? 147.427 89.944  125.186 1.00 345.80 ? 738  PHE B CZ    1 
ATOM   7098  N  N     . TRP B  2 739  ? 144.637 96.698  125.417 1.00 338.04 ? 739  TRP B N     1 
ATOM   7099  C  CA    . TRP B  2 739  ? 144.330 97.991  124.813 1.00 338.04 ? 739  TRP B CA    1 
ATOM   7100  C  C     . TRP B  2 739  ? 145.430 98.999  125.124 1.00 338.04 ? 739  TRP B C     1 
ATOM   7101  O  O     . TRP B  2 739  ? 146.542 98.894  124.605 1.00 338.04 ? 739  TRP B O     1 
ATOM   7102  C  CB    . TRP B  2 739  ? 142.971 98.520  125.288 1.00 338.04 ? 739  TRP B CB    1 
ATOM   7103  C  CG    . TRP B  2 739  ? 142.814 98.623  126.778 1.00 338.04 ? 739  TRP B CG    1 
ATOM   7104  C  CD1   . TRP B  2 739  ? 143.255 99.634  127.587 1.00 338.04 ? 739  TRP B CD1   1 
ATOM   7105  C  CD2   . TRP B  2 739  ? 142.145 97.691  127.630 1.00 338.04 ? 739  TRP B CD2   1 
ATOM   7106  N  NE1   . TRP B  2 739  ? 142.910 99.379  128.894 1.00 338.04 ? 739  TRP B NE1   1 
ATOM   7107  C  CE2   . TRP B  2 739  ? 142.227 98.191  128.946 1.00 338.04 ? 739  TRP B CE2   1 
ATOM   7108  C  CE3   . TRP B  2 739  ? 141.489 96.478  127.410 1.00 338.04 ? 739  TRP B CE3   1 
ATOM   7109  C  CZ2   . TRP B  2 739  ? 141.677 97.520  130.033 1.00 338.04 ? 739  TRP B CZ2   1 
ATOM   7110  C  CZ3   . TRP B  2 739  ? 140.948 95.813  128.489 1.00 338.04 ? 739  TRP B CZ3   1 
ATOM   7111  C  CH2   . TRP B  2 739  ? 141.043 96.336  129.784 1.00 338.04 ? 739  TRP B CH2   1 
ATOM   7112  N  N     . GLY B  2 768  ? 144.037 101.959 130.228 1.00 264.63 ? 768  GLY B N     1 
ATOM   7113  C  CA    . GLY B  2 768  ? 143.872 103.385 129.997 1.00 264.63 ? 768  GLY B CA    1 
ATOM   7114  C  C     . GLY B  2 768  ? 142.530 103.919 130.457 1.00 264.63 ? 768  GLY B C     1 
ATOM   7115  O  O     . GLY B  2 768  ? 141.564 103.162 130.552 1.00 264.63 ? 768  GLY B O     1 
ATOM   7116  N  N     . PRO B  2 769  ? 142.458 105.229 130.738 1.00 271.45 ? 769  PRO B N     1 
ATOM   7117  C  CA    . PRO B  2 769  ? 141.210 105.827 131.235 1.00 271.45 ? 769  PRO B CA    1 
ATOM   7118  C  C     . PRO B  2 769  ? 140.212 106.012 130.103 1.00 271.45 ? 769  PRO B C     1 
ATOM   7119  O  O     . PRO B  2 769  ? 140.395 106.850 129.216 1.00 271.45 ? 769  PRO B O     1 
ATOM   7120  C  CB    . PRO B  2 769  ? 141.676 107.167 131.820 1.00 271.45 ? 769  PRO B CB    1 
ATOM   7121  C  CG    . PRO B  2 769  ? 143.012 107.457 131.183 1.00 271.45 ? 769  PRO B CG    1 
ATOM   7122  C  CD    . PRO B  2 769  ? 143.463 106.250 130.402 1.00 271.45 ? 769  PRO B CD    1 
ATOM   7123  N  N     . VAL B  2 770  ? 139.141 105.226 130.138 1.00 292.81 ? 770  VAL B N     1 
ATOM   7124  C  CA    . VAL B  2 770  ? 138.207 105.098 129.031 1.00 292.81 ? 770  VAL B CA    1 
ATOM   7125  C  C     . VAL B  2 770  ? 136.883 105.726 129.437 1.00 292.81 ? 770  VAL B C     1 
ATOM   7126  O  O     . VAL B  2 770  ? 136.289 105.344 130.453 1.00 292.81 ? 770  VAL B O     1 
ATOM   7127  C  CB    . VAL B  2 770  ? 138.024 103.628 128.627 1.00 292.81 ? 770  VAL B CB    1 
ATOM   7128  C  CG1   . VAL B  2 770  ? 138.043 102.737 129.861 1.00 292.81 ? 770  VAL B CG1   1 
ATOM   7129  C  CG2   . VAL B  2 770  ? 136.735 103.451 127.867 1.00 292.81 ? 770  VAL B CG2   1 
ATOM   7130  N  N     . ALA B  2 771  ? 136.430 106.697 128.650 1.00 309.52 ? 771  ALA B N     1 
ATOM   7131  C  CA    . ALA B  2 771  ? 135.100 107.253 128.844 1.00 309.52 ? 771  ALA B CA    1 
ATOM   7132  C  C     . ALA B  2 771  ? 134.046 106.243 128.412 1.00 309.52 ? 771  ALA B C     1 
ATOM   7133  O  O     . ALA B  2 771  ? 134.264 105.425 127.515 1.00 309.52 ? 771  ALA B O     1 
ATOM   7134  C  CB    . ALA B  2 771  ? 134.935 108.553 128.059 1.00 309.52 ? 771  ALA B CB    1 
ATOM   7135  N  N     . TYR B  2 772  ? 132.883 106.318 129.054 1.00 290.31 ? 772  TYR B N     1 
ATOM   7136  C  CA    . TYR B  2 772  ? 131.878 105.278 128.901 1.00 290.31 ? 772  TYR B CA    1 
ATOM   7137  C  C     . TYR B  2 772  ? 130.533 105.741 129.444 1.00 290.31 ? 772  TYR B C     1 
ATOM   7138  O  O     . TYR B  2 772  ? 130.446 106.213 130.582 1.00 290.31 ? 772  TYR B O     1 
ATOM   7139  C  CB    . TYR B  2 772  ? 132.359 104.006 129.604 1.00 290.31 ? 772  TYR B CB    1 
ATOM   7140  C  CG    . TYR B  2 772  ? 131.282 103.004 129.916 1.00 290.31 ? 772  TYR B CG    1 
ATOM   7141  C  CD1   . TYR B  2 772  ? 130.660 102.290 128.905 1.00 290.31 ? 772  TYR B CD1   1 
ATOM   7142  C  CD2   . TYR B  2 772  ? 130.904 102.755 131.226 1.00 290.31 ? 772  TYR B CD2   1 
ATOM   7143  C  CE1   . TYR B  2 772  ? 129.678 101.368 129.188 1.00 290.31 ? 772  TYR B CE1   1 
ATOM   7144  C  CE2   . TYR B  2 772  ? 129.924 101.836 131.521 1.00 290.31 ? 772  TYR B CE2   1 
ATOM   7145  C  CZ    . TYR B  2 772  ? 129.314 101.144 130.498 1.00 290.31 ? 772  TYR B CZ    1 
ATOM   7146  O  OH    . TYR B  2 772  ? 128.332 100.224 130.786 1.00 290.31 ? 772  TYR B OH    1 
ATOM   7147  N  N     . ALA B  2 773  ? 129.484 105.622 128.635 1.00 294.39 ? 773  ALA B N     1 
ATOM   7148  C  CA    . ALA B  2 773  ? 128.121 105.961 129.035 1.00 294.39 ? 773  ALA B CA    1 
ATOM   7149  C  C     . ALA B  2 773  ? 127.325 104.664 129.093 1.00 294.39 ? 773  ALA B C     1 
ATOM   7150  O  O     . ALA B  2 773  ? 127.077 104.036 128.057 1.00 294.39 ? 773  ALA B O     1 
ATOM   7151  C  CB    . ALA B  2 773  ? 127.487 106.952 128.063 1.00 294.39 ? 773  ALA B CB    1 
ATOM   7152  N  N     . SER B  2 774  ? 126.919 104.270 130.296 1.00 280.14 ? 774  SER B N     1 
ATOM   7153  C  CA    . SER B  2 774  ? 126.337 102.955 130.509 1.00 280.14 ? 774  SER B CA    1 
ATOM   7154  C  C     . SER B  2 774  ? 124.905 102.896 129.979 1.00 280.14 ? 774  SER B C     1 
ATOM   7155  O  O     . SER B  2 774  ? 124.307 103.904 129.590 1.00 280.14 ? 774  SER B O     1 
ATOM   7156  C  CB    . SER B  2 774  ? 126.369 102.594 131.991 1.00 280.14 ? 774  SER B CB    1 
ATOM   7157  O  OG    . SER B  2 774  ? 125.974 101.249 132.188 1.00 280.14 ? 774  SER B OG    1 
ATOM   7158  N  N     . GLN B  2 775  ? 124.354 101.679 129.978 1.00 292.76 ? 775  GLN B N     1 
ATOM   7159  C  CA    . GLN B  2 775  ? 123.014 101.459 129.440 1.00 292.76 ? 775  GLN B CA    1 
ATOM   7160  C  C     . GLN B  2 775  ? 121.939 102.044 130.346 1.00 292.76 ? 775  GLN B C     1 
ATOM   7161  O  O     . GLN B  2 775  ? 120.847 102.383 129.873 1.00 292.76 ? 775  GLN B O     1 
ATOM   7162  C  CB    . GLN B  2 775  ? 122.781 99.963  129.230 1.00 292.76 ? 775  GLN B CB    1 
ATOM   7163  C  CG    . GLN B  2 775  ? 121.657 99.629  128.263 1.00 292.76 ? 775  GLN B CG    1 
ATOM   7164  C  CD    . GLN B  2 775  ? 121.707 98.188  127.791 1.00 292.76 ? 775  GLN B CD    1 
ATOM   7165  O  OE1   . GLN B  2 775  ? 122.009 97.277  128.566 1.00 292.76 ? 775  GLN B OE1   1 
ATOM   7166  N  NE2   . GLN B  2 775  ? 121.425 97.976  126.510 1.00 292.76 ? 775  GLN B NE2   1 
ATOM   7167  N  N     . LYS B  2 776  ? 122.222 102.165 131.639 1.00 288.96 ? 776  LYS B N     1 
ATOM   7168  C  CA    . LYS B  2 776  ? 121.305 102.763 132.608 1.00 288.96 ? 776  LYS B CA    1 
ATOM   7169  C  C     . LYS B  2 776  ? 122.001 103.963 133.234 1.00 288.96 ? 776  LYS B C     1 
ATOM   7170  O  O     . LYS B  2 776  ? 122.808 103.801 134.167 1.00 288.96 ? 776  LYS B O     1 
ATOM   7171  C  CB    . LYS B  2 776  ? 120.905 101.745 133.674 1.00 288.96 ? 776  LYS B CB    1 
ATOM   7172  C  CG    . LYS B  2 776  ? 119.997 102.281 134.765 1.00 288.96 ? 776  LYS B CG    1 
ATOM   7173  C  CD    . LYS B  2 776  ? 119.799 101.228 135.848 1.00 288.96 ? 776  LYS B CD    1 
ATOM   7174  C  CE    . LYS B  2 776  ? 119.062 101.791 137.052 1.00 288.96 ? 776  LYS B CE    1 
ATOM   7175  N  NZ    . LYS B  2 776  ? 118.947 100.782 138.144 1.00 288.96 ? 776  LYS B NZ    1 
ATOM   7176  N  N     . PRO B  2 777  ? 121.734 105.179 132.761 1.00 287.51 ? 777  PRO B N     1 
ATOM   7177  C  CA    . PRO B  2 777  ? 122.555 106.328 133.156 1.00 287.51 ? 777  PRO B CA    1 
ATOM   7178  C  C     . PRO B  2 777  ? 122.352 106.702 134.617 1.00 287.51 ? 777  PRO B C     1 
ATOM   7179  O  O     . PRO B  2 777  ? 121.410 106.272 135.285 1.00 287.51 ? 777  PRO B O     1 
ATOM   7180  C  CB    . PRO B  2 777  ? 122.072 107.442 132.227 1.00 287.51 ? 777  PRO B CB    1 
ATOM   7181  C  CG    . PRO B  2 777  ? 120.659 107.071 131.924 1.00 287.51 ? 777  PRO B CG    1 
ATOM   7182  C  CD    . PRO B  2 777  ? 120.631 105.569 131.866 1.00 287.51 ? 777  PRO B CD    1 
ATOM   7183  N  N     . TRP B  2 778  ? 123.270 107.532 135.106 1.00 286.20 ? 778  TRP B N     1 
ATOM   7184  C  CA    . TRP B  2 778  ? 123.232 108.006 136.479 1.00 286.20 ? 778  TRP B CA    1 
ATOM   7185  C  C     . TRP B  2 778  ? 123.788 109.418 136.524 1.00 286.20 ? 778  TRP B C     1 
ATOM   7186  O  O     . TRP B  2 778  ? 124.628 109.798 135.705 1.00 286.20 ? 778  TRP B O     1 
ATOM   7187  C  CB    . TRP B  2 778  ? 124.037 107.105 137.420 1.00 286.20 ? 778  TRP B CB    1 
ATOM   7188  C  CG    . TRP B  2 778  ? 125.507 107.336 137.319 1.00 286.20 ? 778  TRP B CG    1 
ATOM   7189  C  CD1   . TRP B  2 778  ? 126.296 107.105 136.234 1.00 286.20 ? 778  TRP B CD1   1 
ATOM   7190  C  CD2   . TRP B  2 778  ? 126.369 107.846 138.342 1.00 286.20 ? 778  TRP B CD2   1 
ATOM   7191  N  NE1   . TRP B  2 778  ? 127.599 107.440 136.515 1.00 286.20 ? 778  TRP B NE1   1 
ATOM   7192  C  CE2   . TRP B  2 778  ? 127.670 107.897 137.802 1.00 286.20 ? 778  TRP B CE2   1 
ATOM   7193  C  CE3   . TRP B  2 778  ? 126.167 108.265 139.658 1.00 286.20 ? 778  TRP B CE3   1 
ATOM   7194  C  CZ2   . TRP B  2 778  ? 128.764 108.348 138.535 1.00 286.20 ? 778  TRP B CZ2   1 
ATOM   7195  C  CZ3   . TRP B  2 778  ? 127.254 108.716 140.383 1.00 286.20 ? 778  TRP B CZ3   1 
ATOM   7196  C  CH2   . TRP B  2 778  ? 128.537 108.751 139.821 1.00 286.20 ? 778  TRP B CH2   1 
ATOM   7197  N  N     . LEU B  2 779  ? 123.315 110.184 137.497 1.00 301.85 ? 779  LEU B N     1 
ATOM   7198  C  CA    . LEU B  2 779  ? 123.714 111.569 137.673 1.00 301.85 ? 779  LEU B CA    1 
ATOM   7199  C  C     . LEU B  2 779  ? 124.262 111.769 139.080 1.00 301.85 ? 779  LEU B C     1 
ATOM   7200  O  O     . LEU B  2 779  ? 123.936 111.026 140.009 1.00 301.85 ? 779  LEU B O     1 
ATOM   7201  C  CB    . LEU B  2 779  ? 122.534 112.512 137.424 1.00 301.85 ? 779  LEU B CB    1 
ATOM   7202  C  CG    . LEU B  2 779  ? 121.643 112.154 136.233 1.00 301.85 ? 779  LEU B CG    1 
ATOM   7203  C  CD1   . LEU B  2 779  ? 120.457 113.093 136.164 1.00 301.85 ? 779  LEU B CD1   1 
ATOM   7204  C  CD2   . LEU B  2 779  ? 122.424 112.184 134.927 1.00 301.85 ? 779  LEU B CD2   1 
ATOM   7205  N  N     . LEU B  2 780  ? 125.103 112.786 139.226 1.00 292.65 ? 780  LEU B N     1 
ATOM   7206  C  CA    . LEU B  2 780  ? 125.722 113.106 140.502 1.00 292.65 ? 780  LEU B CA    1 
ATOM   7207  C  C     . LEU B  2 780  ? 124.940 114.205 141.208 1.00 292.65 ? 780  LEU B C     1 
ATOM   7208  O  O     . LEU B  2 780  ? 124.250 115.008 140.574 1.00 292.65 ? 780  LEU B O     1 
ATOM   7209  C  CB    . LEU B  2 780  ? 127.177 113.548 140.315 1.00 292.65 ? 780  LEU B CB    1 
ATOM   7210  C  CG    . LEU B  2 780  ? 128.235 112.493 139.978 1.00 292.65 ? 780  LEU B CG    1 
ATOM   7211  C  CD1   . LEU B  2 780  ? 128.114 112.001 138.542 1.00 292.65 ? 780  LEU B CD1   1 
ATOM   7212  C  CD2   . LEU B  2 780  ? 129.632 113.042 140.237 1.00 292.65 ? 780  LEU B CD2   1 
ATOM   7213  N  N     . ASN B  2 781  ? 125.055 114.236 142.535 1.00 306.07 ? 781  ASN B N     1 
ATOM   7214  C  CA    . ASN B  2 781  ? 124.417 115.275 143.342 1.00 306.07 ? 781  ASN B CA    1 
ATOM   7215  C  C     . ASN B  2 781  ? 125.219 116.556 143.146 1.00 306.07 ? 781  ASN B C     1 
ATOM   7216  O  O     . ASN B  2 781  ? 126.056 116.945 143.967 1.00 306.07 ? 781  ASN B O     1 
ATOM   7217  C  CB    . ASN B  2 781  ? 124.351 114.868 144.807 1.00 306.07 ? 781  ASN B CB    1 
ATOM   7218  C  CG    . ASN B  2 781  ? 123.220 115.548 145.546 1.00 306.07 ? 781  ASN B CG    1 
ATOM   7219  O  OD1   . ASN B  2 781  ? 122.203 115.904 144.950 1.00 306.07 ? 781  ASN B OD1   1 
ATOM   7220  N  ND2   . ASN B  2 781  ? 123.391 115.735 146.849 1.00 306.07 ? 781  ASN B ND2   1 
ATOM   7221  N  N     . ALA B  2 782  ? 124.957 117.218 142.027 1.00 311.57 ? 782  ALA B N     1 
ATOM   7222  C  CA    . ALA B  2 782  ? 125.728 118.377 141.604 1.00 311.57 ? 782  ALA B CA    1 
ATOM   7223  C  C     . ALA B  2 782  ? 124.908 119.143 140.573 1.00 311.57 ? 782  ALA B C     1 
ATOM   7224  O  O     . ALA B  2 782  ? 123.709 118.903 140.403 1.00 311.57 ? 782  ALA B O     1 
ATOM   7225  C  CB    . ALA B  2 782  ? 127.089 117.950 141.045 1.00 311.57 ? 782  ALA B CB    1 
ATOM   7226  N  N     . THR B  2 783  ? 125.558 120.073 139.890 1.00 315.89 ? 783  THR B N     1 
ATOM   7227  C  CA    . THR B  2 783  ? 124.924 120.837 138.833 1.00 315.89 ? 783  THR B CA    1 
ATOM   7228  C  C     . THR B  2 783  ? 125.118 120.145 137.484 1.00 315.89 ? 783  THR B C     1 
ATOM   7229  O  O     . THR B  2 783  ? 125.879 119.184 137.351 1.00 315.89 ? 783  THR B O     1 
ATOM   7230  C  CB    . THR B  2 783  ? 125.486 122.253 138.799 1.00 315.89 ? 783  THR B CB    1 
ATOM   7231  O  OG1   . THR B  2 783  ? 126.887 122.202 138.504 1.00 315.89 ? 783  THR B OG1   1 
ATOM   7232  C  CG2   . THR B  2 783  ? 125.287 122.926 140.148 1.00 315.89 ? 783  THR B CG2   1 
ATOM   7233  N  N     . VAL B  2 784  ? 124.412 120.651 136.472 1.00 304.12 ? 784  VAL B N     1 
ATOM   7234  C  CA    . VAL B  2 784  ? 124.510 120.079 135.132 1.00 304.12 ? 784  VAL B CA    1 
ATOM   7235  C  C     . VAL B  2 784  ? 125.912 120.279 134.570 1.00 304.12 ? 784  VAL B C     1 
ATOM   7236  O  O     . VAL B  2 784  ? 126.533 119.342 134.048 1.00 304.12 ? 784  VAL B O     1 
ATOM   7237  C  CB    . VAL B  2 784  ? 123.442 120.691 134.210 1.00 304.12 ? 784  VAL B CB    1 
ATOM   7238  C  CG1   . VAL B  2 784  ? 123.559 120.121 132.808 1.00 304.12 ? 784  VAL B CG1   1 
ATOM   7239  C  CG2   . VAL B  2 784  ? 122.051 120.455 134.779 1.00 304.12 ? 784  VAL B CG2   1 
ATOM   7240  N  N     . GLU B  2 785  ? 126.425 121.510 134.657 1.00 315.59 ? 785  GLU B N     1 
ATOM   7241  C  CA    . GLU B  2 785  ? 127.789 121.789 134.225 1.00 315.59 ? 785  GLU B CA    1 
ATOM   7242  C  C     . GLU B  2 785  ? 128.780 120.856 134.901 1.00 315.59 ? 785  GLU B C     1 
ATOM   7243  O  O     . GLU B  2 785  ? 129.753 120.417 134.282 1.00 315.59 ? 785  GLU B O     1 
ATOM   7244  C  CB    . GLU B  2 785  ? 128.156 123.242 134.533 1.00 315.59 ? 785  GLU B CB    1 
ATOM   7245  C  CG    . GLU B  2 785  ? 127.269 124.285 133.878 1.00 315.59 ? 785  GLU B CG    1 
ATOM   7246  C  CD    . GLU B  2 785  ? 127.479 125.677 134.460 1.00 315.59 ? 785  GLU B CD    1 
ATOM   7247  O  OE1   . GLU B  2 785  ? 128.211 125.799 135.468 1.00 315.59 ? 785  GLU B OE1   1 
ATOM   7248  O  OE2   . GLU B  2 785  ? 126.913 126.648 133.914 1.00 315.59 ? 785  GLU B OE2   1 
ATOM   7249  N  N     . GLU B  2 786  ? 128.542 120.539 136.175 1.00 322.30 ? 786  GLU B N     1 
ATOM   7250  C  CA    . GLU B  2 786  ? 129.447 119.657 136.903 1.00 322.30 ? 786  GLU B CA    1 
ATOM   7251  C  C     . GLU B  2 786  ? 129.319 118.216 136.421 1.00 322.30 ? 786  GLU B C     1 
ATOM   7252  O  O     . GLU B  2 786  ? 130.324 117.507 136.292 1.00 322.30 ? 786  GLU B O     1 
ATOM   7253  C  CB    . GLU B  2 786  ? 129.170 119.756 138.401 1.00 322.30 ? 786  GLU B CB    1 
ATOM   7254  C  CG    . GLU B  2 786  ? 130.198 119.071 139.277 1.00 322.30 ? 786  GLU B CG    1 
ATOM   7255  C  CD    . GLU B  2 786  ? 130.075 119.478 140.732 1.00 322.30 ? 786  GLU B CD    1 
ATOM   7256  O  OE1   . GLU B  2 786  ? 129.630 120.615 140.993 1.00 322.30 ? 786  GLU B OE1   1 
ATOM   7257  O  OE2   . GLU B  2 786  ? 130.412 118.656 141.613 1.00 322.30 ? 786  GLU B OE2   1 
ATOM   7258  N  N     . ASN B  2 787  ? 128.091 117.766 136.149 1.00 309.27 ? 787  ASN B N     1 
ATOM   7259  C  CA    . ASN B  2 787  ? 127.896 116.427 135.612 1.00 309.27 ? 787  ASN B CA    1 
ATOM   7260  C  C     . ASN B  2 787  ? 128.502 116.273 134.227 1.00 309.27 ? 787  ASN B C     1 
ATOM   7261  O  O     . ASN B  2 787  ? 128.832 115.152 133.830 1.00 309.27 ? 787  ASN B O     1 
ATOM   7262  C  CB    . ASN B  2 787  ? 126.407 116.083 135.566 1.00 309.27 ? 787  ASN B CB    1 
ATOM   7263  C  CG    . ASN B  2 787  ? 125.888 115.577 136.893 1.00 309.27 ? 787  ASN B CG    1 
ATOM   7264  O  OD1   . ASN B  2 787  ? 125.755 114.371 137.101 1.00 309.27 ? 787  ASN B OD1   1 
ATOM   7265  N  ND2   . ASN B  2 787  ? 125.599 116.497 137.805 1.00 309.27 ? 787  ASN B ND2   1 
ATOM   7266  N  N     . ILE B  2 788  ? 128.655 117.364 133.483 1.00 310.33 ? 788  ILE B N     1 
ATOM   7267  C  CA    . ILE B  2 788  ? 129.261 117.255 132.163 1.00 310.33 ? 788  ILE B CA    1 
ATOM   7268  C  C     . ILE B  2 788  ? 130.772 117.497 132.199 1.00 310.33 ? 788  ILE B C     1 
ATOM   7269  O  O     . ILE B  2 788  ? 131.496 116.982 131.342 1.00 310.33 ? 788  ILE B O     1 
ATOM   7270  C  CB    . ILE B  2 788  ? 128.556 118.202 131.181 1.00 310.33 ? 788  ILE B CB    1 
ATOM   7271  C  CG1   . ILE B  2 788  ? 127.048 117.972 131.250 1.00 310.33 ? 788  ILE B CG1   1 
ATOM   7272  C  CG2   . ILE B  2 788  ? 129.023 117.953 129.759 1.00 310.33 ? 788  ILE B CG2   1 
ATOM   7273  C  CD1   . ILE B  2 788  ? 126.256 118.817 130.297 1.00 310.33 ? 788  ILE B CD1   1 
ATOM   7274  N  N     . THR B  2 789  ? 131.273 118.245 133.183 1.00 306.32 ? 789  THR B N     1 
ATOM   7275  C  CA    . THR B  2 789  ? 132.718 118.423 133.296 1.00 306.32 ? 789  THR B CA    1 
ATOM   7276  C  C     . THR B  2 789  ? 133.381 117.181 133.875 1.00 306.32 ? 789  THR B C     1 
ATOM   7277  O  O     . THR B  2 789  ? 134.336 116.653 133.295 1.00 306.32 ? 789  THR B O     1 
ATOM   7278  C  CB    . THR B  2 789  ? 133.047 119.642 134.156 1.00 306.32 ? 789  THR B CB    1 
ATOM   7279  O  OG1   . THR B  2 789  ? 132.319 119.574 135.391 1.00 306.32 ? 789  THR B OG1   1 
ATOM   7280  C  CG2   . THR B  2 789  ? 132.707 120.926 133.421 1.00 306.32 ? 789  THR B CG2   1 
ATOM   7281  N  N     . PHE B  2 790  ? 132.893 116.709 135.024 1.00 297.07 ? 790  PHE B N     1 
ATOM   7282  C  CA    . PHE B  2 790  ? 133.404 115.503 135.671 1.00 297.07 ? 790  PHE B CA    1 
ATOM   7283  C  C     . PHE B  2 790  ? 134.881 115.662 136.045 1.00 297.07 ? 790  PHE B C     1 
ATOM   7284  O  O     . PHE B  2 790  ? 135.758 114.945 135.559 1.00 297.07 ? 790  PHE B O     1 
ATOM   7285  C  CB    . PHE B  2 790  ? 133.183 114.277 134.778 1.00 297.07 ? 790  PHE B CB    1 
ATOM   7286  C  CG    . PHE B  2 790  ? 133.004 113.002 135.537 1.00 297.07 ? 790  PHE B CG    1 
ATOM   7287  C  CD1   . PHE B  2 790  ? 131.748 112.611 135.960 1.00 297.07 ? 790  PHE B CD1   1 
ATOM   7288  C  CD2   . PHE B  2 790  ? 134.089 112.195 135.830 1.00 297.07 ? 790  PHE B CD2   1 
ATOM   7289  C  CE1   . PHE B  2 790  ? 131.573 111.439 136.659 1.00 297.07 ? 790  PHE B CE1   1 
ATOM   7290  C  CE2   . PHE B  2 790  ? 133.923 111.022 136.531 1.00 297.07 ? 790  PHE B CE2   1 
ATOM   7291  C  CZ    . PHE B  2 790  ? 132.662 110.643 136.948 1.00 297.07 ? 790  PHE B CZ    1 
ATOM   7292  N  N     . GLU B  2 791  ? 135.140 116.645 136.911 1.00 303.82 ? 791  GLU B N     1 
ATOM   7293  C  CA    . GLU B  2 791  ? 136.444 116.972 137.490 1.00 303.82 ? 791  GLU B CA    1 
ATOM   7294  C  C     . GLU B  2 791  ? 137.408 117.578 136.471 1.00 303.82 ? 791  GLU B C     1 
ATOM   7295  O  O     . GLU B  2 791  ? 138.513 117.985 136.850 1.00 303.82 ? 791  GLU B O     1 
ATOM   7296  C  CB    . GLU B  2 791  ? 137.106 115.750 138.152 1.00 303.82 ? 791  GLU B CB    1 
ATOM   7297  C  CG    . GLU B  2 791  ? 138.185 116.057 139.194 1.00 303.82 ? 791  GLU B CG    1 
ATOM   7298  C  CD    . GLU B  2 791  ? 137.716 115.837 140.626 1.00 303.82 ? 791  GLU B CD    1 
ATOM   7299  O  OE1   . GLU B  2 791  ? 136.496 115.934 140.881 1.00 303.82 ? 791  GLU B OE1   1 
ATOM   7300  O  OE2   . GLU B  2 791  ? 138.569 115.559 141.499 1.00 303.82 ? 791  GLU B OE2   1 
ATOM   7301  N  N     . SER B  2 792  ? 137.027 117.676 135.204 1.00 304.66 ? 792  SER B N     1 
ATOM   7302  C  CA    . SER B  2 792  ? 137.922 118.297 134.241 1.00 304.66 ? 792  SER B CA    1 
ATOM   7303  C  C     . SER B  2 792  ? 137.721 119.811 134.220 1.00 304.66 ? 792  SER B C     1 
ATOM   7304  O  O     . SER B  2 792  ? 136.607 120.300 134.439 1.00 304.66 ? 792  SER B O     1 
ATOM   7305  C  CB    . SER B  2 792  ? 137.678 117.726 132.846 1.00 304.66 ? 792  SER B CB    1 
ATOM   7306  O  OG    . SER B  2 792  ? 138.477 118.376 131.873 1.00 304.66 ? 792  SER B OG    1 
ATOM   7307  N  N     . PRO B  2 793  ? 138.785 120.577 133.973 1.00 292.47 ? 793  PRO B N     1 
ATOM   7308  C  CA    . PRO B  2 793  ? 138.640 122.035 133.903 1.00 292.47 ? 793  PRO B CA    1 
ATOM   7309  C  C     . PRO B  2 793  ? 137.709 122.460 132.776 1.00 292.47 ? 793  PRO B C     1 
ATOM   7310  O  O     . PRO B  2 793  ? 137.526 121.748 131.786 1.00 292.47 ? 793  PRO B O     1 
ATOM   7311  C  CB    . PRO B  2 793  ? 140.074 122.524 133.656 1.00 292.47 ? 793  PRO B CB    1 
ATOM   7312  C  CG    . PRO B  2 793  ? 140.809 121.326 133.133 1.00 292.47 ? 793  PRO B CG    1 
ATOM   7313  C  CD    . PRO B  2 793  ? 140.188 120.157 133.829 1.00 292.47 ? 793  PRO B CD    1 
ATOM   7314  N  N     . PHE B  2 794  ? 137.117 123.640 132.941 1.00 315.88 ? 794  PHE B N     1 
ATOM   7315  C  CA    . PHE B  2 794  ? 136.173 124.155 131.960 1.00 315.88 ? 794  PHE B CA    1 
ATOM   7316  C  C     . PHE B  2 794  ? 136.894 124.621 130.702 1.00 315.88 ? 794  PHE B C     1 
ATOM   7317  O  O     . PHE B  2 794  ? 138.100 124.882 130.697 1.00 315.88 ? 794  PHE B O     1 
ATOM   7318  C  CB    . PHE B  2 794  ? 135.362 125.313 132.544 1.00 315.88 ? 794  PHE B CB    1 
ATOM   7319  C  CG    . PHE B  2 794  ? 133.931 124.967 132.824 1.00 315.88 ? 794  PHE B CG    1 
ATOM   7320  C  CD1   . PHE B  2 794  ? 132.982 125.015 131.815 1.00 315.88 ? 794  PHE B CD1   1 
ATOM   7321  C  CD2   . PHE B  2 794  ? 133.534 124.599 134.099 1.00 315.88 ? 794  PHE B CD2   1 
ATOM   7322  C  CE1   . PHE B  2 794  ? 131.662 124.697 132.072 1.00 315.88 ? 794  PHE B CE1   1 
ATOM   7323  C  CE2   . PHE B  2 794  ? 132.214 124.282 134.363 1.00 315.88 ? 794  PHE B CE2   1 
ATOM   7324  C  CZ    . PHE B  2 794  ? 131.277 124.330 133.347 1.00 315.88 ? 794  PHE B CZ    1 
ATOM   7325  N  N     . ASN B  2 795  ? 136.127 124.730 129.619 1.00 316.25 ? 795  ASN B N     1 
ATOM   7326  C  CA    . ASN B  2 795  ? 136.645 125.241 128.360 1.00 316.25 ? 795  ASN B CA    1 
ATOM   7327  C  C     . ASN B  2 795  ? 135.546 126.031 127.668 1.00 316.25 ? 795  ASN B C     1 
ATOM   7328  O  O     . ASN B  2 795  ? 134.394 125.587 127.615 1.00 316.25 ? 795  ASN B O     1 
ATOM   7329  C  CB    . ASN B  2 795  ? 137.146 124.110 127.458 1.00 316.25 ? 795  ASN B CB    1 
ATOM   7330  C  CG    . ASN B  2 795  ? 138.553 123.663 127.812 1.00 316.25 ? 795  ASN B CG    1 
ATOM   7331  O  OD1   . ASN B  2 795  ? 138.762 122.956 128.798 1.00 316.25 ? 795  ASN B OD1   1 
ATOM   7332  N  ND2   . ASN B  2 795  ? 139.525 124.066 127.002 1.00 316.25 ? 795  ASN B ND2   1 
ATOM   7333  N  N     . LYS B  2 796  ? 135.914 127.203 127.152 1.00 320.83 ? 796  LYS B N     1 
ATOM   7334  C  CA    . LYS B  2 796  ? 134.947 128.097 126.526 1.00 320.83 ? 796  LYS B CA    1 
ATOM   7335  C  C     . LYS B  2 796  ? 134.238 127.412 125.363 1.00 320.83 ? 796  LYS B C     1 
ATOM   7336  O  O     . LYS B  2 796  ? 133.015 127.226 125.385 1.00 320.83 ? 796  LYS B O     1 
ATOM   7337  C  CB    . LYS B  2 796  ? 135.656 129.372 126.063 1.00 320.83 ? 796  LYS B CB    1 
ATOM   7338  C  CG    . LYS B  2 796  ? 134.772 130.406 125.386 1.00 320.83 ? 796  LYS B CG    1 
ATOM   7339  C  CD    . LYS B  2 796  ? 135.606 131.603 124.953 1.00 320.83 ? 796  LYS B CD    1 
ATOM   7340  C  CE    . LYS B  2 796  ? 134.801 132.587 124.123 1.00 320.83 ? 796  LYS B CE    1 
ATOM   7341  N  NZ    . LYS B  2 796  ? 135.655 133.701 123.626 1.00 320.83 ? 796  LYS B NZ    1 
ATOM   7342  N  N     . GLN B  2 797  ? 134.995 127.014 124.339 1.00 322.42 ? 797  GLN B N     1 
ATOM   7343  C  CA    . GLN B  2 797  ? 134.378 126.451 123.143 1.00 322.42 ? 797  GLN B CA    1 
ATOM   7344  C  C     . GLN B  2 797  ? 134.039 124.976 123.298 1.00 322.42 ? 797  GLN B C     1 
ATOM   7345  O  O     . GLN B  2 797  ? 133.052 124.512 122.718 1.00 322.42 ? 797  GLN B O     1 
ATOM   7346  C  CB    . GLN B  2 797  ? 135.290 126.652 121.931 1.00 322.42 ? 797  GLN B CB    1 
ATOM   7347  C  CG    . GLN B  2 797  ? 135.304 128.076 121.405 1.00 322.42 ? 797  GLN B CG    1 
ATOM   7348  C  CD    . GLN B  2 797  ? 133.916 128.574 121.044 1.00 322.42 ? 797  GLN B CD    1 
ATOM   7349  O  OE1   . GLN B  2 797  ? 133.544 129.699 121.375 1.00 322.42 ? 797  GLN B OE1   1 
ATOM   7350  N  NE2   . GLN B  2 797  ? 133.145 127.737 120.358 1.00 322.42 ? 797  GLN B NE2   1 
ATOM   7351  N  N     . ARG B  2 798  ? 134.835 124.229 124.064 1.00 320.67 ? 798  ARG B N     1 
ATOM   7352  C  CA    . ARG B  2 798  ? 134.613 122.792 124.190 1.00 320.67 ? 798  ARG B CA    1 
ATOM   7353  C  C     . ARG B  2 798  ? 133.250 122.491 124.804 1.00 320.67 ? 798  ARG B C     1 
ATOM   7354  O  O     . ARG B  2 798  ? 132.470 121.698 124.261 1.00 320.67 ? 798  ARG B O     1 
ATOM   7355  C  CB    . ARG B  2 798  ? 135.731 122.174 125.026 1.00 320.67 ? 798  ARG B CB    1 
ATOM   7356  C  CG    . ARG B  2 798  ? 135.545 120.713 125.353 1.00 320.67 ? 798  ARG B CG    1 
ATOM   7357  C  CD    . ARG B  2 798  ? 136.077 119.829 124.249 1.00 320.67 ? 798  ARG B CD    1 
ATOM   7358  N  NE    . ARG B  2 798  ? 136.176 118.439 124.679 1.00 320.67 ? 798  ARG B NE    1 
ATOM   7359  C  CZ    . ARG B  2 798  ? 136.692 117.464 123.940 1.00 320.67 ? 798  ARG B CZ    1 
ATOM   7360  N  NH1   . ARG B  2 798  ? 137.162 117.726 122.728 1.00 320.67 ? 798  ARG B NH1   1 
ATOM   7361  N  NH2   . ARG B  2 798  ? 136.744 116.226 124.415 1.00 320.67 ? 798  ARG B NH2   1 
ATOM   7362  N  N     . TYR B  2 799  ? 132.956 123.108 125.950 1.00 321.80 ? 799  TYR B N     1 
ATOM   7363  C  CA    . TYR B  2 799  ? 131.687 122.859 126.623 1.00 321.80 ? 799  TYR B CA    1 
ATOM   7364  C  C     . TYR B  2 799  ? 130.510 123.280 125.753 1.00 321.80 ? 799  TYR B C     1 
ATOM   7365  O  O     . TYR B  2 799  ? 129.513 122.554 125.654 1.00 321.80 ? 799  TYR B O     1 
ATOM   7366  C  CB    . TYR B  2 799  ? 131.655 123.591 127.964 1.00 321.80 ? 799  TYR B CB    1 
ATOM   7367  C  CG    . TYR B  2 799  ? 130.301 123.590 128.635 1.00 321.80 ? 799  TYR B CG    1 
ATOM   7368  C  CD1   . TYR B  2 799  ? 129.879 122.507 129.392 1.00 321.80 ? 799  TYR B CD1   1 
ATOM   7369  C  CD2   . TYR B  2 799  ? 129.445 124.678 128.514 1.00 321.80 ? 799  TYR B CD2   1 
ATOM   7370  C  CE1   . TYR B  2 799  ? 128.640 122.506 130.008 1.00 321.80 ? 799  TYR B CE1   1 
ATOM   7371  C  CE2   . TYR B  2 799  ? 128.206 124.685 129.125 1.00 321.80 ? 799  TYR B CE2   1 
ATOM   7372  C  CZ    . TYR B  2 799  ? 127.810 123.597 129.871 1.00 321.80 ? 799  TYR B CZ    1 
ATOM   7373  O  OH    . TYR B  2 799  ? 126.577 123.600 130.483 1.00 321.80 ? 799  TYR B OH    1 
ATOM   7374  N  N     . LYS B  2 800  ? 130.606 124.448 125.115 1.00 325.02 ? 800  LYS B N     1 
ATOM   7375  C  CA    . LYS B  2 800  ? 129.512 124.905 124.266 1.00 325.02 ? 800  LYS B CA    1 
ATOM   7376  C  C     . LYS B  2 800  ? 129.299 123.963 123.089 1.00 325.02 ? 800  LYS B C     1 
ATOM   7377  O  O     . LYS B  2 800  ? 128.159 123.703 122.696 1.00 325.02 ? 800  LYS B O     1 
ATOM   7378  C  CB    . LYS B  2 800  ? 129.774 126.329 123.777 1.00 325.02 ? 800  LYS B CB    1 
ATOM   7379  C  CG    . LYS B  2 800  ? 129.466 127.407 124.812 1.00 325.02 ? 800  LYS B CG    1 
ATOM   7380  C  CD    . LYS B  2 800  ? 129.553 128.805 124.210 1.00 325.02 ? 800  LYS B CD    1 
ATOM   7381  C  CE    . LYS B  2 800  ? 128.514 129.011 123.114 1.00 325.02 ? 800  LYS B CE    1 
ATOM   7382  N  NZ    . LYS B  2 800  ? 127.121 128.928 123.636 1.00 325.02 ? 800  LYS B NZ    1 
ATOM   7383  N  N     . MET B  2 801  ? 130.380 123.427 122.522 1.00 336.35 ? 801  MET B N     1 
ATOM   7384  C  CA    . MET B  2 801  ? 130.231 122.486 121.418 1.00 336.35 ? 801  MET B CA    1 
ATOM   7385  C  C     . MET B  2 801  ? 129.561 121.203 121.882 1.00 336.35 ? 801  MET B C     1 
ATOM   7386  O  O     . MET B  2 801  ? 128.655 120.685 121.213 1.00 336.35 ? 801  MET B O     1 
ATOM   7387  C  CB    . MET B  2 801  ? 131.591 122.187 120.788 1.00 336.35 ? 801  MET B CB    1 
ATOM   7388  C  CG    . MET B  2 801  ? 132.067 123.271 119.843 1.00 336.35 ? 801  MET B CG    1 
ATOM   7389  S  SD    . MET B  2 801  ? 130.774 123.749 118.677 1.00 336.35 ? 801  MET B SD    1 
ATOM   7390  C  CE    . MET B  2 801  ? 130.466 122.194 117.838 1.00 336.35 ? 801  MET B CE    1 
ATOM   7391  N  N     . VAL B  2 802  ? 129.991 120.671 123.027 1.00 321.47 ? 802  VAL B N     1 
ATOM   7392  C  CA    . VAL B  2 802  ? 129.395 119.433 123.521 1.00 321.47 ? 802  VAL B CA    1 
ATOM   7393  C  C     . VAL B  2 802  ? 127.920 119.646 123.838 1.00 321.47 ? 802  VAL B C     1 
ATOM   7394  O  O     . VAL B  2 802  ? 127.089 118.755 123.619 1.00 321.47 ? 802  VAL B O     1 
ATOM   7395  C  CB    . VAL B  2 802  ? 130.172 118.906 124.738 1.00 321.47 ? 802  VAL B CB    1 
ATOM   7396  C  CG1   . VAL B  2 802  ? 129.535 117.629 125.261 1.00 321.47 ? 802  VAL B CG1   1 
ATOM   7397  C  CG2   . VAL B  2 802  ? 131.620 118.652 124.364 1.00 321.47 ? 802  VAL B CG2   1 
ATOM   7398  N  N     . ILE B  2 803  ? 127.564 120.832 124.331 1.00 322.41 ? 803  ILE B N     1 
ATOM   7399  C  CA    . ILE B  2 803  ? 126.162 121.115 124.623 1.00 322.41 ? 803  ILE B CA    1 
ATOM   7400  C  C     . ILE B  2 803  ? 125.362 121.239 123.332 1.00 322.41 ? 803  ILE B C     1 
ATOM   7401  O  O     . ILE B  2 803  ? 124.287 120.645 123.188 1.00 322.41 ? 803  ILE B O     1 
ATOM   7402  C  CB    . ILE B  2 803  ? 126.032 122.383 125.486 1.00 322.41 ? 803  ILE B CB    1 
ATOM   7403  C  CG1   . ILE B  2 803  ? 126.593 122.138 126.885 1.00 322.41 ? 803  ILE B CG1   1 
ATOM   7404  C  CG2   . ILE B  2 803  ? 124.575 122.811 125.572 1.00 322.41 ? 803  ILE B CG2   1 
ATOM   7405  C  CD1   . ILE B  2 803  ? 125.706 121.276 127.747 1.00 322.41 ? 803  ILE B CD1   1 
ATOM   7406  N  N     . GLU B  2 804  ? 125.875 122.011 122.371 1.00 336.32 ? 804  GLU B N     1 
ATOM   7407  C  CA    . GLU B  2 804  ? 125.149 122.272 121.136 1.00 336.32 ? 804  GLU B CA    1 
ATOM   7408  C  C     . GLU B  2 804  ? 125.153 121.087 120.183 1.00 336.32 ? 804  GLU B C     1 
ATOM   7409  O  O     . GLU B  2 804  ? 124.468 121.138 119.156 1.00 336.32 ? 804  GLU B O     1 
ATOM   7410  C  CB    . GLU B  2 804  ? 125.731 123.506 120.444 1.00 336.32 ? 804  GLU B CB    1 
ATOM   7411  C  CG    . GLU B  2 804  ? 125.523 124.799 121.227 1.00 336.32 ? 804  GLU B CG    1 
ATOM   7412  C  CD    . GLU B  2 804  ? 126.182 126.000 120.574 1.00 336.32 ? 804  GLU B CD    1 
ATOM   7413  O  OE1   . GLU B  2 804  ? 126.881 125.814 119.556 1.00 336.32 ? 804  GLU B OE1   1 
ATOM   7414  O  OE2   . GLU B  2 804  ? 126.001 127.130 121.078 1.00 336.32 ? 804  GLU B OE2   1 
ATOM   7415  N  N     . ALA B  2 805  ? 125.908 120.032 120.486 1.00 337.52 ? 805  ALA B N     1 
ATOM   7416  C  CA    . ALA B  2 805  ? 125.816 118.800 119.719 1.00 337.52 ? 805  ALA B CA    1 
ATOM   7417  C  C     . ALA B  2 805  ? 124.885 117.773 120.346 1.00 337.52 ? 805  ALA B C     1 
ATOM   7418  O  O     . ALA B  2 805  ? 124.423 116.867 119.644 1.00 337.52 ? 805  ALA B O     1 
ATOM   7419  C  CB    . ALA B  2 805  ? 127.205 118.176 119.542 1.00 337.52 ? 805  ALA B CB    1 
ATOM   7420  N  N     . CYS B  2 806  ? 124.592 117.893 121.640 1.00 336.36 ? 806  CYS B N     1 
ATOM   7421  C  CA    . CYS B  2 806  ? 123.798 116.904 122.356 1.00 336.36 ? 806  CYS B CA    1 
ATOM   7422  C  C     . CYS B  2 806  ? 122.304 117.187 122.333 1.00 336.36 ? 806  CYS B C     1 
ATOM   7423  O  O     . CYS B  2 806  ? 121.553 116.473 123.003 1.00 336.36 ? 806  CYS B O     1 
ATOM   7424  C  CB    . CYS B  2 806  ? 124.268 116.802 123.809 1.00 336.36 ? 806  CYS B CB    1 
ATOM   7425  S  SG    . CYS B  2 806  ? 125.771 115.835 124.025 1.00 336.36 ? 806  CYS B SG    1 
ATOM   7426  N  N     . SER B  2 807  ? 121.855 118.202 121.593 1.00 331.09 ? 807  SER B N     1 
ATOM   7427  C  CA    . SER B  2 807  ? 120.438 118.573 121.544 1.00 331.09 ? 807  SER B CA    1 
ATOM   7428  C  C     . SER B  2 807  ? 119.899 118.835 122.951 1.00 331.09 ? 807  SER B C     1 
ATOM   7429  O  O     . SER B  2 807  ? 118.830 118.355 123.335 1.00 331.09 ? 807  SER B O     1 
ATOM   7430  C  CB    . SER B  2 807  ? 119.614 117.499 120.830 1.00 331.09 ? 807  SER B CB    1 
ATOM   7431  O  OG    . SER B  2 807  ? 120.300 116.993 119.696 1.00 331.09 ? 807  SER B OG    1 
ATOM   7432  N  N     . LEU B  2 808  ? 120.659 119.608 123.727 1.00 338.35 ? 808  LEU B N     1 
ATOM   7433  C  CA    . LEU B  2 808  ? 120.379 119.790 125.144 1.00 338.35 ? 808  LEU B CA    1 
ATOM   7434  C  C     . LEU B  2 808  ? 120.250 121.242 125.580 1.00 338.35 ? 808  LEU B C     1 
ATOM   7435  O  O     . LEU B  2 808  ? 119.734 121.485 126.677 1.00 338.35 ? 808  LEU B O     1 
ATOM   7436  C  CB    . LEU B  2 808  ? 121.473 119.116 125.987 1.00 338.35 ? 808  LEU B CB    1 
ATOM   7437  C  CG    . LEU B  2 808  ? 121.132 118.708 127.418 1.00 338.35 ? 808  LEU B CG    1 
ATOM   7438  C  CD1   . LEU B  2 808  ? 119.984 117.715 127.426 1.00 338.35 ? 808  LEU B CD1   1 
ATOM   7439  C  CD2   . LEU B  2 808  ? 122.356 118.117 128.089 1.00 338.35 ? 808  LEU B CD2   1 
ATOM   7440  N  N     . GLN B  2 809  ? 120.682 122.212 124.769 1.00 348.67 ? 809  GLN B N     1 
ATOM   7441  C  CA    . GLN B  2 809  ? 120.627 123.605 125.215 1.00 348.67 ? 809  GLN B CA    1 
ATOM   7442  C  C     . GLN B  2 809  ? 119.202 124.118 125.382 1.00 348.67 ? 809  GLN B C     1 
ATOM   7443  O  O     . GLN B  2 809  ? 118.930 124.787 126.395 1.00 348.67 ? 809  GLN B O     1 
ATOM   7444  C  CB    . GLN B  2 809  ? 121.435 124.492 124.262 1.00 348.67 ? 809  GLN B CB    1 
ATOM   7445  C  CG    . GLN B  2 809  ? 121.540 125.934 124.729 1.00 348.67 ? 809  GLN B CG    1 
ATOM   7446  C  CD    . GLN B  2 809  ? 122.388 126.786 123.808 1.00 348.67 ? 809  GLN B CD    1 
ATOM   7447  O  OE1   . GLN B  2 809  ? 122.039 127.005 122.648 1.00 348.67 ? 809  GLN B OE1   1 
ATOM   7448  N  NE2   . GLN B  2 809  ? 123.515 127.265 124.320 1.00 348.67 ? 809  GLN B NE2   1 
ATOM   7449  N  N     . PRO B  2 810  ? 118.263 123.881 124.455 1.00 348.74 ? 810  PRO B N     1 
ATOM   7450  C  CA    . PRO B  2 810  ? 116.895 124.389 124.684 1.00 348.74 ? 810  PRO B CA    1 
ATOM   7451  C  C     . PRO B  2 810  ? 116.277 123.885 125.975 1.00 348.74 ? 810  PRO B C     1 
ATOM   7452  O  O     . PRO B  2 810  ? 115.732 124.677 126.757 1.00 348.74 ? 810  PRO B O     1 
ATOM   7453  C  CB    . PRO B  2 810  ? 116.131 123.891 123.449 1.00 348.74 ? 810  PRO B CB    1 
ATOM   7454  C  CG    . PRO B  2 810  ? 117.167 123.728 122.409 1.00 348.74 ? 810  PRO B CG    1 
ATOM   7455  C  CD    . PRO B  2 810  ? 118.383 123.243 123.131 1.00 348.74 ? 810  PRO B CD    1 
ATOM   7456  N  N     . ASP B  2 811  ? 116.356 122.577 126.227 1.00 346.26 ? 811  ASP B N     1 
ATOM   7457  C  CA    . ASP B  2 811  ? 115.779 122.020 127.444 1.00 346.26 ? 811  ASP B CA    1 
ATOM   7458  C  C     . ASP B  2 811  ? 116.486 122.551 128.686 1.00 346.26 ? 811  ASP B C     1 
ATOM   7459  O  O     . ASP B  2 811  ? 115.843 122.812 129.711 1.00 346.26 ? 811  ASP B O     1 
ATOM   7460  C  CB    . ASP B  2 811  ? 115.839 120.494 127.400 1.00 346.26 ? 811  ASP B CB    1 
ATOM   7461  C  CG    . ASP B  2 811  ? 115.295 119.855 128.660 1.00 346.26 ? 811  ASP B CG    1 
ATOM   7462  O  OD1   . ASP B  2 811  ? 114.060 119.863 128.847 1.00 346.26 ? 811  ASP B OD1   1 
ATOM   7463  O  OD2   . ASP B  2 811  ? 116.107 119.347 129.463 1.00 346.26 ? 811  ASP B OD2   1 
ATOM   7464  N  N     . ILE B  2 812  ? 117.809 122.713 128.617 1.00 346.00 ? 812  ILE B N     1 
ATOM   7465  C  CA    . ILE B  2 812  ? 118.548 123.273 129.744 1.00 346.00 ? 812  ILE B CA    1 
ATOM   7466  C  C     . ILE B  2 812  ? 118.067 124.688 130.046 1.00 346.00 ? 812  ILE B C     1 
ATOM   7467  O  O     . ILE B  2 812  ? 117.870 125.057 131.211 1.00 346.00 ? 812  ILE B O     1 
ATOM   7468  C  CB    . ILE B  2 812  ? 120.062 123.225 129.463 1.00 346.00 ? 812  ILE B CB    1 
ATOM   7469  C  CG1   . ILE B  2 812  ? 120.594 121.811 129.702 1.00 346.00 ? 812  ILE B CG1   1 
ATOM   7470  C  CG2   . ILE B  2 812  ? 120.810 124.226 130.323 1.00 346.00 ? 812  ILE B CG2   1 
ATOM   7471  C  CD1   . ILE B  2 812  ? 120.327 121.294 131.099 1.00 346.00 ? 812  ILE B CD1   1 
ATOM   7472  N  N     . ASP B  2 813  ? 117.848 125.493 129.006 1.00 349.03 ? 813  ASP B N     1 
ATOM   7473  C  CA    . ASP B  2 813  ? 117.379 126.858 129.211 1.00 349.03 ? 813  ASP B CA    1 
ATOM   7474  C  C     . ASP B  2 813  ? 115.916 126.916 129.637 1.00 349.03 ? 813  ASP B C     1 
ATOM   7475  O  O     . ASP B  2 813  ? 115.486 127.932 130.192 1.00 349.03 ? 813  ASP B O     1 
ATOM   7476  C  CB    . ASP B  2 813  ? 117.591 127.682 127.939 1.00 349.03 ? 813  ASP B CB    1 
ATOM   7477  C  CG    . ASP B  2 813  ? 119.014 127.591 127.419 1.00 349.03 ? 813  ASP B CG    1 
ATOM   7478  O  OD1   . ASP B  2 813  ? 119.938 127.399 128.239 1.00 349.03 ? 813  ASP B OD1   1 
ATOM   7479  O  OD2   . ASP B  2 813  ? 119.209 127.704 126.191 1.00 349.03 ? 813  ASP B OD2   1 
ATOM   7480  N  N     . ILE B  2 814  ? 115.143 125.854 129.389 1.00 341.20 ? 814  ILE B N     1 
ATOM   7481  C  CA    . ILE B  2 814  ? 113.753 125.825 129.842 1.00 341.20 ? 814  ILE B CA    1 
ATOM   7482  C  C     . ILE B  2 814  ? 113.672 125.602 131.351 1.00 341.20 ? 814  ILE B C     1 
ATOM   7483  O  O     . ILE B  2 814  ? 112.707 126.032 131.998 1.00 341.20 ? 814  ILE B O     1 
ATOM   7484  C  CB    . ILE B  2 814  ? 112.973 124.753 129.052 1.00 341.20 ? 814  ILE B CB    1 
ATOM   7485  C  CG1   . ILE B  2 814  ? 112.714 125.232 127.622 1.00 341.20 ? 814  ILE B CG1   1 
ATOM   7486  C  CG2   . ILE B  2 814  ? 111.656 124.390 129.734 1.00 341.20 ? 814  ILE B CG2   1 
ATOM   7487  C  CD1   . ILE B  2 814  ? 111.877 124.278 126.795 1.00 341.20 ? 814  ILE B CD1   1 
ATOM   7488  N  N     . LEU B  2 815  ? 114.690 124.964 131.938 1.00 337.13 ? 815  LEU B N     1 
ATOM   7489  C  CA    . LEU B  2 815  ? 114.700 124.645 133.360 1.00 337.13 ? 815  LEU B CA    1 
ATOM   7490  C  C     . LEU B  2 815  ? 114.521 125.903 134.215 1.00 337.13 ? 815  LEU B C     1 
ATOM   7491  O  O     . LEU B  2 815  ? 114.734 127.022 133.741 1.00 337.13 ? 815  LEU B O     1 
ATOM   7492  C  CB    . LEU B  2 815  ? 116.009 123.943 133.722 1.00 337.13 ? 815  LEU B CB    1 
ATOM   7493  C  CG    . LEU B  2 815  ? 115.937 122.424 133.864 1.00 337.13 ? 815  LEU B CG    1 
ATOM   7494  C  CD1   . LEU B  2 815  ? 115.257 121.795 132.662 1.00 337.13 ? 815  LEU B CD1   1 
ATOM   7495  C  CD2   . LEU B  2 815  ? 117.329 121.852 134.048 1.00 337.13 ? 815  LEU B CD2   1 
ATOM   7496  N  N     . PRO B  2 816  ? 114.115 125.741 135.482 1.00 322.87 ? 816  PRO B N     1 
ATOM   7497  C  CA    . PRO B  2 816  ? 113.912 126.929 136.335 1.00 322.87 ? 816  PRO B CA    1 
ATOM   7498  C  C     . PRO B  2 816  ? 115.158 127.786 136.479 1.00 322.87 ? 816  PRO B C     1 
ATOM   7499  O  O     . PRO B  2 816  ? 115.088 129.015 136.348 1.00 322.87 ? 816  PRO B O     1 
ATOM   7500  C  CB    . PRO B  2 816  ? 113.467 126.323 137.676 1.00 322.87 ? 816  PRO B CB    1 
ATOM   7501  C  CG    . PRO B  2 816  ? 113.931 124.900 137.631 1.00 322.87 ? 816  PRO B CG    1 
ATOM   7502  C  CD    . PRO B  2 816  ? 113.792 124.495 136.201 1.00 322.87 ? 816  PRO B CD    1 
ATOM   7503  N  N     . HIS B  2 817  ? 116.301 127.168 136.755 1.00 315.77 ? 817  HIS B N     1 
ATOM   7504  C  CA    . HIS B  2 817  ? 117.589 127.844 136.713 1.00 315.77 ? 817  HIS B CA    1 
ATOM   7505  C  C     . HIS B  2 817  ? 118.211 127.572 135.353 1.00 315.77 ? 817  HIS B C     1 
ATOM   7506  O  O     . HIS B  2 817  ? 118.383 126.409 134.971 1.00 315.77 ? 817  HIS B O     1 
ATOM   7507  C  CB    . HIS B  2 817  ? 118.501 127.360 137.840 1.00 315.77 ? 817  HIS B CB    1 
ATOM   7508  C  CG    . HIS B  2 817  ? 117.925 127.562 139.205 1.00 315.77 ? 817  HIS B CG    1 
ATOM   7509  N  ND1   . HIS B  2 817  ? 118.420 128.494 140.092 1.00 315.77 ? 817  HIS B ND1   1 
ATOM   7510  C  CD2   . HIS B  2 817  ? 116.883 126.962 139.831 1.00 315.77 ? 817  HIS B CD2   1 
ATOM   7511  C  CE1   . HIS B  2 817  ? 117.714 128.454 141.208 1.00 315.77 ? 817  HIS B CE1   1 
ATOM   7512  N  NE2   . HIS B  2 817  ? 116.776 127.534 141.076 1.00 315.77 ? 817  HIS B NE2   1 
ATOM   7513  N  N     . GLY B  2 818  ? 118.530 128.646 134.623 1.00 327.17 ? 818  GLY B N     1 
ATOM   7514  C  CA    . GLY B  2 818  ? 119.042 128.502 133.267 1.00 327.17 ? 818  GLY B CA    1 
ATOM   7515  C  C     . GLY B  2 818  ? 120.202 127.534 133.160 1.00 327.17 ? 818  GLY B C     1 
ATOM   7516  O  O     . GLY B  2 818  ? 120.357 126.853 132.141 1.00 327.17 ? 818  GLY B O     1 
ATOM   7517  N  N     . ASP B  2 819  ? 121.026 127.457 134.197 1.00 313.96 ? 819  ASP B N     1 
ATOM   7518  C  CA    . ASP B  2 819  ? 122.059 126.436 134.294 1.00 313.96 ? 819  ASP B CA    1 
ATOM   7519  C  C     . ASP B  2 819  ? 122.391 126.258 135.768 1.00 313.96 ? 819  ASP B C     1 
ATOM   7520  O  O     . ASP B  2 819  ? 121.841 126.944 136.636 1.00 313.96 ? 819  ASP B O     1 
ATOM   7521  C  CB    . ASP B  2 819  ? 123.295 126.804 133.475 1.00 313.96 ? 819  ASP B CB    1 
ATOM   7522  C  CG    . ASP B  2 819  ? 124.142 125.596 133.134 1.00 313.96 ? 819  ASP B CG    1 
ATOM   7523  O  OD1   . ASP B  2 819  ? 124.070 124.595 133.878 1.00 313.96 ? 819  ASP B OD1   1 
ATOM   7524  O  OD2   . ASP B  2 819  ? 124.873 125.646 132.123 1.00 313.96 ? 819  ASP B OD2   1 
ATOM   7525  N  N     . GLN B  2 820  ? 123.296 125.323 136.042 1.00 308.16 ? 820  GLN B N     1 
ATOM   7526  C  CA    . GLN B  2 820  ? 123.695 124.980 137.404 1.00 308.16 ? 820  GLN B CA    1 
ATOM   7527  C  C     . GLN B  2 820  ? 122.500 124.573 138.258 1.00 308.16 ? 820  GLN B C     1 
ATOM   7528  O  O     . GLN B  2 820  ? 122.545 124.671 139.488 1.00 308.16 ? 820  GLN B O     1 
ATOM   7529  C  CB    . GLN B  2 820  ? 124.463 126.130 138.061 1.00 308.16 ? 820  GLN B CB    1 
ATOM   7530  C  CG    . GLN B  2 820  ? 125.651 126.601 137.242 1.00 308.16 ? 820  GLN B CG    1 
ATOM   7531  C  CD    . GLN B  2 820  ? 126.834 127.006 138.101 1.00 308.16 ? 820  GLN B CD    1 
ATOM   7532  O  OE1   . GLN B  2 820  ? 126.693 127.223 139.303 1.00 308.16 ? 820  GLN B OE1   1 
ATOM   7533  N  NE2   . GLN B  2 820  ? 128.010 127.102 137.486 1.00 308.16 ? 820  GLN B NE2   1 
ATOM   7534  N  N     . THR B  2 821  ? 121.422 124.128 137.611 1.00 321.45 ? 821  THR B N     1 
ATOM   7535  C  CA    . THR B  2 821  ? 120.274 123.608 138.337 1.00 321.45 ? 821  THR B CA    1 
ATOM   7536  C  C     . THR B  2 821  ? 120.685 122.371 139.123 1.00 321.45 ? 821  THR B C     1 
ATOM   7537  O  O     . THR B  2 821  ? 121.285 121.442 138.575 1.00 321.45 ? 821  THR B O     1 
ATOM   7538  C  CB    . THR B  2 821  ? 119.140 123.268 137.370 1.00 321.45 ? 821  THR B CB    1 
ATOM   7539  O  OG1   . THR B  2 821  ? 118.804 124.426 136.595 1.00 321.45 ? 821  THR B OG1   1 
ATOM   7540  C  CG2   . THR B  2 821  ? 117.910 122.806 138.138 1.00 321.45 ? 821  THR B CG2   1 
ATOM   7541  N  N     . GLN B  2 822  ? 120.368 122.367 140.413 1.00 304.32 ? 822  GLN B N     1 
ATOM   7542  C  CA    . GLN B  2 822  ? 120.771 121.270 141.288 1.00 304.32 ? 822  GLN B CA    1 
ATOM   7543  C  C     . GLN B  2 822  ? 119.962 120.034 140.919 1.00 304.32 ? 822  GLN B C     1 
ATOM   7544  O  O     . GLN B  2 822  ? 118.793 119.902 141.295 1.00 304.32 ? 822  GLN B O     1 
ATOM   7545  C  CB    . GLN B  2 822  ? 120.574 121.655 142.750 1.00 304.32 ? 822  GLN B CB    1 
ATOM   7546  C  CG    . GLN B  2 822  ? 121.276 120.737 143.744 1.00 304.32 ? 822  GLN B CG    1 
ATOM   7547  C  CD    . GLN B  2 822  ? 122.791 120.898 143.739 1.00 304.32 ? 822  GLN B CD    1 
ATOM   7548  O  OE1   . GLN B  2 822  ? 123.348 121.676 142.961 1.00 304.32 ? 822  GLN B OE1   1 
ATOM   7549  N  NE2   . GLN B  2 822  ? 123.464 120.161 144.616 1.00 304.32 ? 822  GLN B NE2   1 
ATOM   7550  N  N     . ILE B  2 823  ? 120.584 119.130 140.164 1.00 307.45 ? 823  ILE B N     1 
ATOM   7551  C  CA    . ILE B  2 823  ? 119.913 117.903 139.758 1.00 307.45 ? 823  ILE B CA    1 
ATOM   7552  C  C     . ILE B  2 823  ? 119.574 117.090 140.997 1.00 307.45 ? 823  ILE B C     1 
ATOM   7553  O  O     . ILE B  2 823  ? 120.458 116.743 141.790 1.00 307.45 ? 823  ILE B O     1 
ATOM   7554  C  CB    . ILE B  2 823  ? 120.785 117.107 138.785 1.00 307.45 ? 823  ILE B CB    1 
ATOM   7555  C  CG1   . ILE B  2 823  ? 120.808 117.787 137.417 1.00 307.45 ? 823  ILE B CG1   1 
ATOM   7556  C  CG2   . ILE B  2 823  ? 120.282 115.683 138.670 1.00 307.45 ? 823  ILE B CG2   1 
ATOM   7557  C  CD1   . ILE B  2 823  ? 121.544 116.998 136.364 1.00 307.45 ? 823  ILE B CD1   1 
ATOM   7558  N  N     . GLY B  2 824  ? 118.291 116.789 141.171 1.00 325.07 ? 824  GLY B N     1 
ATOM   7559  C  CA    . GLY B  2 824  ? 117.843 116.003 142.303 1.00 325.07 ? 824  GLY B CA    1 
ATOM   7560  C  C     . GLY B  2 824  ? 118.452 114.617 142.341 1.00 325.07 ? 824  GLY B C     1 
ATOM   7561  O  O     . GLY B  2 824  ? 119.182 114.223 141.426 1.00 325.07 ? 824  GLY B O     1 
ATOM   7562  N  N     . GLU B  2 825  ? 118.153 113.866 143.396 1.00 322.93 ? 825  GLU B N     1 
ATOM   7563  C  CA    . GLU B  2 825  ? 118.735 112.542 143.578 1.00 322.93 ? 825  GLU B CA    1 
ATOM   7564  C  C     . GLU B  2 825  ? 118.273 111.609 142.462 1.00 322.93 ? 825  GLU B C     1 
ATOM   7565  O  O     . GLU B  2 825  ? 117.071 111.375 142.299 1.00 322.93 ? 825  GLU B O     1 
ATOM   7566  C  CB    . GLU B  2 825  ? 118.350 111.987 144.948 1.00 322.93 ? 825  GLU B CB    1 
ATOM   7567  C  CG    . GLU B  2 825  ? 119.030 112.684 146.132 1.00 322.93 ? 825  GLU B CG    1 
ATOM   7568  C  CD    . GLU B  2 825  ? 118.557 114.117 146.356 1.00 322.93 ? 825  GLU B CD    1 
ATOM   7569  O  OE1   . GLU B  2 825  ? 117.574 114.541 145.710 1.00 322.93 ? 825  GLU B OE1   1 
ATOM   7570  O  OE2   . GLU B  2 825  ? 119.174 114.823 147.180 1.00 322.93 ? 825  GLU B OE2   1 
ATOM   7571  N  N     . ARG B  2 826  ? 119.239 111.108 141.680 1.00 335.28 ? 826  ARG B N     1 
ATOM   7572  C  CA    . ARG B  2 826  ? 119.043 110.204 140.546 1.00 335.28 ? 826  ARG B CA    1 
ATOM   7573  C  C     . ARG B  2 826  ? 118.435 110.920 139.343 1.00 335.28 ? 826  ARG B C     1 
ATOM   7574  O  O     . ARG B  2 826  ? 118.312 110.332 138.264 1.00 335.28 ? 826  ARG B O     1 
ATOM   7575  C  CB    . ARG B  2 826  ? 118.180 108.996 140.938 1.00 335.28 ? 826  ARG B CB    1 
ATOM   7576  C  CG    . ARG B  2 826  ? 118.821 108.077 141.972 1.00 335.28 ? 826  ARG B CG    1 
ATOM   7577  C  CD    . ARG B  2 826  ? 117.990 106.820 142.208 1.00 335.28 ? 826  ARG B CD    1 
ATOM   7578  N  NE    . ARG B  2 826  ? 116.682 107.118 142.785 1.00 335.28 ? 826  ARG B NE    1 
ATOM   7579  C  CZ    . ARG B  2 826  ? 115.540 107.094 142.105 1.00 335.28 ? 826  ARG B CZ    1 
ATOM   7580  N  NH1   . ARG B  2 826  ? 114.400 107.382 142.718 1.00 335.28 ? 826  ARG B NH1   1 
ATOM   7581  N  NH2   . ARG B  2 826  ? 115.535 106.779 140.818 1.00 335.28 ? 826  ARG B NH2   1 
ATOM   7582  N  N     . GLY B  2 827  ? 118.069 112.190 139.512 1.00 340.64 ? 827  GLY B N     1 
ATOM   7583  C  CA    . GLY B  2 827  ? 117.516 112.970 138.421 1.00 340.64 ? 827  GLY B CA    1 
ATOM   7584  C  C     . GLY B  2 827  ? 116.007 112.878 138.301 1.00 340.64 ? 827  GLY B C     1 
ATOM   7585  O  O     . GLY B  2 827  ? 115.480 112.667 137.202 1.00 340.64 ? 827  GLY B O     1 
ATOM   7586  N  N     . ILE B  2 828  ? 115.299 113.040 139.421 1.00 334.12 ? 828  ILE B N     1 
ATOM   7587  C  CA    . ILE B  2 828  ? 113.844 112.920 139.404 1.00 334.12 ? 828  ILE B CA    1 
ATOM   7588  C  C     . ILE B  2 828  ? 113.214 114.109 138.691 1.00 334.12 ? 828  ILE B C     1 
ATOM   7589  O  O     . ILE B  2 828  ? 112.261 113.952 137.915 1.00 334.12 ? 828  ILE B O     1 
ATOM   7590  C  CB    . ILE B  2 828  ? 113.303 112.763 140.837 1.00 334.12 ? 828  ILE B CB    1 
ATOM   7591  C  CG1   . ILE B  2 828  ? 113.880 111.508 141.490 1.00 334.12 ? 828  ILE B CG1   1 
ATOM   7592  C  CG2   . ILE B  2 828  ? 111.787 112.691 140.837 1.00 334.12 ? 828  ILE B CG2   1 
ATOM   7593  C  CD1   . ILE B  2 828  ? 113.415 111.301 142.907 1.00 334.12 ? 828  ILE B CD1   1 
ATOM   7594  N  N     . ASN B  2 829  ? 113.738 115.315 138.920 1.00 321.24 ? 829  ASN B N     1 
ATOM   7595  C  CA    . ASN B  2 829  ? 113.233 116.509 138.257 1.00 321.24 ? 829  ASN B CA    1 
ATOM   7596  C  C     . ASN B  2 829  ? 113.723 116.637 136.814 1.00 321.24 ? 829  ASN B C     1 
ATOM   7597  O  O     . ASN B  2 829  ? 113.635 117.724 136.229 1.00 321.24 ? 829  ASN B O     1 
ATOM   7598  C  CB    . ASN B  2 829  ? 113.596 117.761 139.064 1.00 321.24 ? 829  ASN B CB    1 
ATOM   7599  C  CG    . ASN B  2 829  ? 115.060 117.803 139.460 1.00 321.24 ? 829  ASN B CG    1 
ATOM   7600  O  OD1   . ASN B  2 829  ? 115.677 116.771 139.715 1.00 321.24 ? 829  ASN B OD1   1 
ATOM   7601  N  ND2   . ASN B  2 829  ? 115.620 119.007 139.521 1.00 321.24 ? 829  ASN B ND2   1 
ATOM   7602  N  N     . LEU B  2 830  ? 114.242 115.551 136.241 1.00 337.58 ? 830  LEU B N     1 
ATOM   7603  C  CA    . LEU B  2 830  ? 114.598 115.472 134.833 1.00 337.58 ? 830  LEU B CA    1 
ATOM   7604  C  C     . LEU B  2 830  ? 113.726 114.420 134.156 1.00 337.58 ? 830  LEU B C     1 
ATOM   7605  O  O     . LEU B  2 830  ? 113.113 113.572 134.814 1.00 337.58 ? 830  LEU B O     1 
ATOM   7606  C  CB    . LEU B  2 830  ? 116.086 115.135 134.642 1.00 337.58 ? 830  LEU B CB    1 
ATOM   7607  C  CG    . LEU B  2 830  ? 117.125 116.206 134.998 1.00 337.58 ? 830  LEU B CG    1 
ATOM   7608  C  CD1   . LEU B  2 830  ? 117.313 116.338 136.504 1.00 337.58 ? 830  LEU B CD1   1 
ATOM   7609  C  CD2   . LEU B  2 830  ? 118.450 115.910 134.320 1.00 337.58 ? 830  LEU B CD2   1 
ATOM   7610  N  N     . SER B  2 831  ? 113.666 114.485 132.827 1.00 333.20 ? 831  SER B N     1 
ATOM   7611  C  CA    . SER B  2 831  ? 112.824 113.587 132.050 1.00 333.20 ? 831  SER B CA    1 
ATOM   7612  C  C     . SER B  2 831  ? 113.617 112.341 131.659 1.00 333.20 ? 831  SER B C     1 
ATOM   7613  O  O     . SER B  2 831  ? 114.760 112.144 132.080 1.00 333.20 ? 831  SER B O     1 
ATOM   7614  C  CB    . SER B  2 831  ? 112.261 114.316 130.831 1.00 333.20 ? 831  SER B CB    1 
ATOM   7615  O  OG    . SER B  2 831  ? 113.071 114.116 129.687 1.00 333.20 ? 831  SER B OG    1 
ATOM   7616  N  N     . GLY B  2 832  ? 113.011 111.475 130.847 1.00 324.74 ? 832  GLY B N     1 
ATOM   7617  C  CA    . GLY B  2 832  ? 113.695 110.255 130.446 1.00 324.74 ? 832  GLY B CA    1 
ATOM   7618  C  C     . GLY B  2 832  ? 114.850 110.517 129.496 1.00 324.74 ? 832  GLY B C     1 
ATOM   7619  O  O     . GLY B  2 832  ? 115.973 110.054 129.721 1.00 324.74 ? 832  GLY B O     1 
ATOM   7620  N  N     . GLY B  2 833  ? 114.588 111.260 128.420 1.00 326.10 ? 833  GLY B N     1 
ATOM   7621  C  CA    . GLY B  2 833  ? 115.632 111.521 127.444 1.00 326.10 ? 833  GLY B CA    1 
ATOM   7622  C  C     . GLY B  2 833  ? 116.684 112.497 127.929 1.00 326.10 ? 833  GLY B C     1 
ATOM   7623  O  O     . GLY B  2 833  ? 117.830 112.461 127.464 1.00 326.10 ? 833  GLY B O     1 
ATOM   7624  N  N     . GLN B  2 834  ? 116.321 113.372 128.870 1.00 327.96 ? 834  GLN B N     1 
ATOM   7625  C  CA    . GLN B  2 834  ? 117.268 114.371 129.353 1.00 327.96 ? 834  GLN B CA    1 
ATOM   7626  C  C     . GLN B  2 834  ? 118.449 113.721 130.061 1.00 327.96 ? 834  GLN B C     1 
ATOM   7627  O  O     . GLN B  2 834  ? 119.604 114.096 129.830 1.00 327.96 ? 834  GLN B O     1 
ATOM   7628  C  CB    . GLN B  2 834  ? 116.561 115.354 130.284 1.00 327.96 ? 834  GLN B CB    1 
ATOM   7629  C  CG    . GLN B  2 834  ? 115.457 116.143 129.615 1.00 327.96 ? 834  GLN B CG    1 
ATOM   7630  C  CD    . GLN B  2 834  ? 114.638 116.940 130.607 1.00 327.96 ? 834  GLN B CD    1 
ATOM   7631  O  OE1   . GLN B  2 834  ? 115.085 117.208 131.723 1.00 327.96 ? 834  GLN B OE1   1 
ATOM   7632  N  NE2   . GLN B  2 834  ? 113.430 117.321 130.210 1.00 327.96 ? 834  GLN B NE2   1 
ATOM   7633  N  N     . ARG B  2 835  ? 118.182 112.743 130.929 1.00 332.92 ? 835  ARG B N     1 
ATOM   7634  C  CA    . ARG B  2 835  ? 119.266 112.086 131.649 1.00 332.92 ? 835  ARG B CA    1 
ATOM   7635  C  C     . ARG B  2 835  ? 120.179 111.322 130.699 1.00 332.92 ? 835  ARG B C     1 
ATOM   7636  O  O     . ARG B  2 835  ? 121.404 111.315 130.878 1.00 332.92 ? 835  ARG B O     1 
ATOM   7637  C  CB    . ARG B  2 835  ? 118.698 111.161 132.725 1.00 332.92 ? 835  ARG B CB    1 
ATOM   7638  C  CG    . ARG B  2 835  ? 117.958 111.894 133.834 1.00 332.92 ? 835  ARG B CG    1 
ATOM   7639  C  CD    . ARG B  2 835  ? 117.672 110.991 135.025 1.00 332.92 ? 835  ARG B CD    1 
ATOM   7640  N  NE    . ARG B  2 835  ? 116.620 110.018 134.746 1.00 332.92 ? 835  ARG B NE    1 
ATOM   7641  C  CZ    . ARG B  2 835  ? 115.319 110.285 134.824 1.00 332.92 ? 835  ARG B CZ    1 
ATOM   7642  N  NH1   . ARG B  2 835  ? 114.429 109.340 134.558 1.00 332.92 ? 835  ARG B NH1   1 
ATOM   7643  N  NH2   . ARG B  2 835  ? 114.909 111.499 135.162 1.00 332.92 ? 835  ARG B NH2   1 
ATOM   7644  N  N     . GLN B  2 836  ? 119.607 110.683 129.676 1.00 321.30 ? 836  GLN B N     1 
ATOM   7645  C  CA    . GLN B  2 836  ? 120.430 109.978 128.700 1.00 321.30 ? 836  GLN B CA    1 
ATOM   7646  C  C     . GLN B  2 836  ? 121.312 110.949 127.930 1.00 321.30 ? 836  GLN B C     1 
ATOM   7647  O  O     . GLN B  2 836  ? 122.507 110.695 127.730 1.00 321.30 ? 836  GLN B O     1 
ATOM   7648  C  CB    . GLN B  2 836  ? 119.551 109.180 127.740 1.00 321.30 ? 836  GLN B CB    1 
ATOM   7649  C  CG    . GLN B  2 836  ? 118.775 108.072 128.406 1.00 321.30 ? 836  GLN B CG    1 
ATOM   7650  C  CD    . GLN B  2 836  ? 118.550 106.895 127.486 1.00 321.30 ? 836  GLN B CD    1 
ATOM   7651  O  OE1   . GLN B  2 836  ? 119.024 106.880 126.350 1.00 321.30 ? 836  GLN B OE1   1 
ATOM   7652  N  NE2   . GLN B  2 836  ? 117.824 105.895 127.975 1.00 321.30 ? 836  GLN B NE2   1 
ATOM   7653  N  N     . ARG B  2 837  ? 120.736 112.066 127.481 1.00 325.50 ? 837  ARG B N     1 
ATOM   7654  C  CA    . ARG B  2 837  ? 121.533 113.065 126.778 1.00 325.50 ? 837  ARG B CA    1 
ATOM   7655  C  C     . ARG B  2 837  ? 122.630 113.621 127.676 1.00 325.50 ? 837  ARG B C     1 
ATOM   7656  O  O     . ARG B  2 837  ? 123.742 113.892 127.209 1.00 325.50 ? 837  ARG B O     1 
ATOM   7657  C  CB    . ARG B  2 837  ? 120.637 114.186 126.253 1.00 325.50 ? 837  ARG B CB    1 
ATOM   7658  C  CG    . ARG B  2 837  ? 119.801 113.786 125.049 1.00 325.50 ? 837  ARG B CG    1 
ATOM   7659  C  CD    . ARG B  2 837  ? 119.190 114.994 124.366 1.00 325.50 ? 837  ARG B CD    1 
ATOM   7660  N  NE    . ARG B  2 837  ? 118.207 115.664 125.206 1.00 325.50 ? 837  ARG B NE    1 
ATOM   7661  C  CZ    . ARG B  2 837  ? 116.918 115.346 125.234 1.00 325.50 ? 837  ARG B CZ    1 
ATOM   7662  N  NH1   . ARG B  2 837  ? 116.462 114.366 124.467 1.00 325.50 ? 837  ARG B NH1   1 
ATOM   7663  N  NH2   . ARG B  2 837  ? 116.086 116.006 126.029 1.00 325.50 ? 837  ARG B NH2   1 
ATOM   7664  N  N     . ILE B  2 838  ? 122.354 113.766 128.973 1.00 315.80 ? 838  ILE B N     1 
ATOM   7665  C  CA    . ILE B  2 838  ? 123.362 114.301 129.885 1.00 315.80 ? 838  ILE B CA    1 
ATOM   7666  C  C     . ILE B  2 838  ? 124.492 113.298 130.090 1.00 315.80 ? 838  ILE B C     1 
ATOM   7667  O  O     . ILE B  2 838  ? 125.672 113.671 130.124 1.00 315.80 ? 838  ILE B O     1 
ATOM   7668  C  CB    . ILE B  2 838  ? 122.708 114.715 131.216 1.00 315.80 ? 838  ILE B CB    1 
ATOM   7669  C  CG1   . ILE B  2 838  ? 121.962 116.039 131.037 1.00 315.80 ? 838  ILE B CG1   1 
ATOM   7670  C  CG2   . ILE B  2 838  ? 123.751 114.825 132.322 1.00 315.80 ? 838  ILE B CG2   1 
ATOM   7671  C  CD1   . ILE B  2 838  ? 121.369 116.589 132.307 1.00 315.80 ? 838  ILE B CD1   1 
ATOM   7672  N  N     . SER B  2 839  ? 124.158 112.013 130.223 1.00 318.09 ? 839  SER B N     1 
ATOM   7673  C  CA    . SER B  2 839  ? 125.205 111.001 130.345 1.00 318.09 ? 839  SER B CA    1 
ATOM   7674  C  C     . SER B  2 839  ? 126.060 110.937 129.084 1.00 318.09 ? 839  SER B C     1 
ATOM   7675  O  O     . SER B  2 839  ? 127.293 110.822 129.159 1.00 318.09 ? 839  SER B O     1 
ATOM   7676  C  CB    . SER B  2 839  ? 124.588 109.636 130.649 1.00 318.09 ? 839  SER B CB    1 
ATOM   7677  O  OG    . SER B  2 839  ? 123.893 109.129 129.523 1.00 318.09 ? 839  SER B OG    1 
ATOM   7678  N  N     . VAL B  2 840  ? 125.421 111.010 127.913 1.00 310.57 ? 840  VAL B N     1 
ATOM   7679  C  CA    . VAL B  2 840  ? 126.175 110.982 126.661 1.00 310.57 ? 840  VAL B CA    1 
ATOM   7680  C  C     . VAL B  2 840  ? 127.051 112.221 126.539 1.00 310.57 ? 840  VAL B C     1 
ATOM   7681  O  O     . VAL B  2 840  ? 128.181 112.150 126.046 1.00 310.57 ? 840  VAL B O     1 
ATOM   7682  C  CB    . VAL B  2 840  ? 125.219 110.839 125.462 1.00 310.57 ? 840  VAL B CB    1 
ATOM   7683  C  CG1   . VAL B  2 840  ? 125.989 110.923 124.153 1.00 310.57 ? 840  VAL B CG1   1 
ATOM   7684  C  CG2   . VAL B  2 840  ? 124.470 109.529 125.551 1.00 310.57 ? 840  VAL B CG2   1 
ATOM   7685  N  N     . ALA B  2 841  ? 126.552 113.371 126.999 1.00 314.54 ? 841  ALA B N     1 
ATOM   7686  C  CA    . ALA B  2 841  ? 127.363 114.584 127.006 1.00 314.54 ? 841  ALA B CA    1 
ATOM   7687  C  C     . ALA B  2 841  ? 128.579 114.429 127.909 1.00 314.54 ? 841  ALA B C     1 
ATOM   7688  O  O     . ALA B  2 841  ? 129.678 114.870 127.560 1.00 314.54 ? 841  ALA B O     1 
ATOM   7689  C  CB    . ALA B  2 841  ? 126.520 115.776 127.452 1.00 314.54 ? 841  ALA B CB    1 
ATOM   7690  N  N     . ARG B  2 842  ? 128.395 113.822 129.082 1.00 314.26 ? 842  ARG B N     1 
ATOM   7691  C  CA    . ARG B  2 842  ? 129.532 113.579 129.964 1.00 314.26 ? 842  ARG B CA    1 
ATOM   7692  C  C     . ARG B  2 842  ? 130.572 112.704 129.278 1.00 314.26 ? 842  ARG B C     1 
ATOM   7693  O  O     . ARG B  2 842  ? 131.763 113.038 129.248 1.00 314.26 ? 842  ARG B O     1 
ATOM   7694  C  CB    . ARG B  2 842  ? 129.071 112.928 131.266 1.00 314.26 ? 842  ARG B CB    1 
ATOM   7695  C  CG    . ARG B  2 842  ? 130.222 112.623 132.212 1.00 314.26 ? 842  ARG B CG    1 
ATOM   7696  C  CD    . ARG B  2 842  ? 129.873 111.540 133.217 1.00 314.26 ? 842  ARG B CD    1 
ATOM   7697  N  NE    . ARG B  2 842  ? 128.789 111.933 134.112 1.00 314.26 ? 842  ARG B NE    1 
ATOM   7698  C  CZ    . ARG B  2 842  ? 127.526 111.551 133.963 1.00 314.26 ? 842  ARG B CZ    1 
ATOM   7699  N  NH1   . ARG B  2 842  ? 127.185 110.764 132.952 1.00 314.26 ? 842  ARG B NH1   1 
ATOM   7700  N  NH2   . ARG B  2 842  ? 126.604 111.955 134.826 1.00 314.26 ? 842  ARG B NH2   1 
ATOM   7701  N  N     . ALA B  2 843  ? 130.135 111.577 128.712 1.00 312.11 ? 843  ALA B N     1 
ATOM   7702  C  CA    . ALA B  2 843  ? 131.078 110.659 128.078 1.00 312.11 ? 843  ALA B CA    1 
ATOM   7703  C  C     . ALA B  2 843  ? 131.683 111.233 126.803 1.00 312.11 ? 843  ALA B C     1 
ATOM   7704  O  O     . ALA B  2 843  ? 132.749 110.775 126.376 1.00 312.11 ? 843  ALA B O     1 
ATOM   7705  C  CB    . ALA B  2 843  ? 130.395 109.328 127.769 1.00 312.11 ? 843  ALA B CB    1 
ATOM   7706  N  N     . LEU B  2 844  ? 131.031 112.215 126.191 1.00 317.89 ? 844  LEU B N     1 
ATOM   7707  C  CA    . LEU B  2 844  ? 131.510 112.813 124.954 1.00 317.89 ? 844  LEU B CA    1 
ATOM   7708  C  C     . LEU B  2 844  ? 132.401 114.023 125.188 1.00 317.89 ? 844  LEU B C     1 
ATOM   7709  O  O     . LEU B  2 844  ? 133.216 114.356 124.321 1.00 317.89 ? 844  LEU B O     1 
ATOM   7710  C  CB    . LEU B  2 844  ? 130.305 113.202 124.094 1.00 317.89 ? 844  LEU B CB    1 
ATOM   7711  C  CG    . LEU B  2 844  ? 130.533 113.777 122.706 1.00 317.89 ? 844  LEU B CG    1 
ATOM   7712  C  CD1   . LEU B  2 844  ? 131.529 112.928 121.970 1.00 317.89 ? 844  LEU B CD1   1 
ATOM   7713  C  CD2   . LEU B  2 844  ? 129.212 113.813 121.969 1.00 317.89 ? 844  LEU B CD2   1 
ATOM   7714  N  N     . TYR B  2 845  ? 132.273 114.674 126.343 1.00 313.43 ? 845  TYR B N     1 
ATOM   7715  C  CA    . TYR B  2 845  ? 133.063 115.860 126.646 1.00 313.43 ? 845  TYR B CA    1 
ATOM   7716  C  C     . TYR B  2 845  ? 134.460 115.510 127.132 1.00 313.43 ? 845  TYR B C     1 
ATOM   7717  O  O     . TYR B  2 845  ? 135.394 116.292 126.931 1.00 313.43 ? 845  TYR B O     1 
ATOM   7718  C  CB    . TYR B  2 845  ? 132.326 116.700 127.693 1.00 313.43 ? 845  TYR B CB    1 
ATOM   7719  C  CG    . TYR B  2 845  ? 133.131 117.818 128.322 1.00 313.43 ? 845  TYR B CG    1 
ATOM   7720  C  CD1   . TYR B  2 845  ? 133.880 117.599 129.472 1.00 313.43 ? 845  TYR B CD1   1 
ATOM   7721  C  CD2   . TYR B  2 845  ? 133.114 119.100 127.789 1.00 313.43 ? 845  TYR B CD2   1 
ATOM   7722  C  CE1   . TYR B  2 845  ? 134.604 118.616 130.059 1.00 313.43 ? 845  TYR B CE1   1 
ATOM   7723  C  CE2   . TYR B  2 845  ? 133.835 120.127 128.371 1.00 313.43 ? 845  TYR B CE2   1 
ATOM   7724  C  CZ    . TYR B  2 845  ? 134.579 119.877 129.505 1.00 313.43 ? 845  TYR B CZ    1 
ATOM   7725  O  OH    . TYR B  2 845  ? 135.301 120.892 130.090 1.00 313.43 ? 845  TYR B OH    1 
ATOM   7726  N  N     . GLN B  2 846  ? 134.622 114.355 127.763 1.00 313.59 ? 846  GLN B N     1 
ATOM   7727  C  CA    . GLN B  2 846  ? 135.901 114.009 128.361 1.00 313.59 ? 846  GLN B CA    1 
ATOM   7728  C  C     . GLN B  2 846  ? 136.941 113.676 127.298 1.00 313.59 ? 846  GLN B C     1 
ATOM   7729  O  O     . GLN B  2 846  ? 136.623 113.198 126.207 1.00 313.59 ? 846  GLN B O     1 
ATOM   7730  C  CB    . GLN B  2 846  ? 135.736 112.833 129.320 1.00 313.59 ? 846  GLN B CB    1 
ATOM   7731  C  CG    . GLN B  2 846  ? 135.356 113.251 130.728 1.00 313.59 ? 846  GLN B CG    1 
ATOM   7732  C  CD    . GLN B  2 846  ? 136.497 113.945 131.449 1.00 313.59 ? 846  GLN B CD    1 
ATOM   7733  O  OE1   . GLN B  2 846  ? 137.651 113.863 131.026 1.00 313.59 ? 846  GLN B OE1   1 
ATOM   7734  N  NE2   . GLN B  2 846  ? 136.183 114.630 132.543 1.00 313.59 ? 846  GLN B NE2   1 
ATOM   7735  N  N     . GLN B  2 847  ? 138.201 113.940 127.635 1.00 301.51 ? 847  GLN B N     1 
ATOM   7736  C  CA    . GLN B  2 847  ? 139.326 113.642 126.761 1.00 301.51 ? 847  GLN B CA    1 
ATOM   7737  C  C     . GLN B  2 847  ? 139.800 112.218 127.018 1.00 301.51 ? 847  GLN B C     1 
ATOM   7738  O  O     . GLN B  2 847  ? 140.230 111.897 128.131 1.00 301.51 ? 847  GLN B O     1 
ATOM   7739  C  CB    . GLN B  2 847  ? 140.464 114.634 126.998 1.00 301.51 ? 847  GLN B CB    1 
ATOM   7740  C  CG    . GLN B  2 847  ? 140.089 116.083 126.755 1.00 301.51 ? 847  GLN B CG    1 
ATOM   7741  C  CD    . GLN B  2 847  ? 140.001 116.420 125.280 1.00 301.51 ? 847  GLN B CD    1 
ATOM   7742  O  OE1   . GLN B  2 847  ? 139.163 115.885 124.556 1.00 301.51 ? 847  GLN B OE1   1 
ATOM   7743  N  NE2   . GLN B  2 847  ? 140.881 117.305 124.824 1.00 301.51 ? 847  GLN B NE2   1 
ATOM   7744  N  N     . THR B  2 848  ? 139.730 111.372 125.992 1.00 309.32 ? 848  THR B N     1 
ATOM   7745  C  CA    . THR B  2 848  ? 140.172 109.986 126.100 1.00 309.32 ? 848  THR B CA    1 
ATOM   7746  C  C     . THR B  2 848  ? 140.295 109.404 124.698 1.00 309.32 ? 848  THR B C     1 
ATOM   7747  O  O     . THR B  2 848  ? 139.904 110.027 123.707 1.00 309.32 ? 848  THR B O     1 
ATOM   7748  C  CB    . THR B  2 848  ? 139.209 109.143 126.939 1.00 309.32 ? 848  THR B CB    1 
ATOM   7749  O  OG1   . THR B  2 848  ? 139.843 107.909 127.298 1.00 309.32 ? 848  THR B OG1   1 
ATOM   7750  C  CG2   . THR B  2 848  ? 137.954 108.840 126.139 1.00 309.32 ? 848  THR B CG2   1 
ATOM   7751  N  N     . ASN B  2 849  ? 140.844 108.189 124.633 1.00 302.29 ? 849  ASN B N     1 
ATOM   7752  C  CA    . ASN B  2 849  ? 140.977 107.494 123.356 1.00 302.29 ? 849  ASN B CA    1 
ATOM   7753  C  C     . ASN B  2 849  ? 139.690 106.769 122.980 1.00 302.29 ? 849  ASN B C     1 
ATOM   7754  O  O     . ASN B  2 849  ? 139.074 107.066 121.951 1.00 302.29 ? 849  ASN B O     1 
ATOM   7755  C  CB    . ASN B  2 849  ? 142.141 106.502 123.413 1.00 302.29 ? 849  ASN B CB    1 
ATOM   7756  C  CG    . ASN B  2 849  ? 143.453 107.161 123.771 1.00 302.29 ? 849  ASN B CG    1 
ATOM   7757  O  OD1   . ASN B  2 849  ? 143.572 108.386 123.747 1.00 302.29 ? 849  ASN B OD1   1 
ATOM   7758  N  ND2   . ASN B  2 849  ? 144.452 106.350 124.097 1.00 302.29 ? 849  ASN B ND2   1 
ATOM   7759  N  N     . VAL B  2 850  ? 139.271 105.817 123.810 1.00 307.53 ? 850  VAL B N     1 
ATOM   7760  C  CA    . VAL B  2 850  ? 138.172 104.911 123.489 1.00 307.53 ? 850  VAL B CA    1 
ATOM   7761  C  C     . VAL B  2 850  ? 136.924 105.369 124.224 1.00 307.53 ? 850  VAL B C     1 
ATOM   7762  O  O     . VAL B  2 850  ? 136.972 105.662 125.426 1.00 307.53 ? 850  VAL B O     1 
ATOM   7763  C  CB    . VAL B  2 850  ? 138.522 103.462 123.868 1.00 307.53 ? 850  VAL B CB    1 
ATOM   7764  C  CG1   . VAL B  2 850  ? 137.791 102.484 122.957 1.00 307.53 ? 850  VAL B CG1   1 
ATOM   7765  C  CG2   . VAL B  2 850  ? 140.023 103.248 123.818 1.00 307.53 ? 850  VAL B CG2   1 
ATOM   7766  N  N     . VAL B  2 851  ? 135.802 105.423 123.511 1.00 321.25 ? 851  VAL B N     1 
ATOM   7767  C  CA    . VAL B  2 851  ? 134.513 105.761 124.101 1.00 321.25 ? 851  VAL B CA    1 
ATOM   7768  C  C     . VAL B  2 851  ? 133.534 104.630 123.812 1.00 321.25 ? 851  VAL B C     1 
ATOM   7769  O  O     . VAL B  2 851  ? 133.340 104.248 122.651 1.00 321.25 ? 851  VAL B O     1 
ATOM   7770  C  CB    . VAL B  2 851  ? 133.982 107.113 123.583 1.00 321.25 ? 851  VAL B CB    1 
ATOM   7771  C  CG1   . VAL B  2 851  ? 134.902 108.236 124.024 1.00 321.25 ? 851  VAL B CG1   1 
ATOM   7772  C  CG2   . VAL B  2 851  ? 133.851 107.119 122.070 1.00 321.25 ? 851  VAL B CG2   1 
ATOM   7773  N  N     . PHE B  2 852  ? 132.934 104.088 124.868 1.00 310.86 ? 852  PHE B N     1 
ATOM   7774  C  CA    . PHE B  2 852  ? 131.888 103.081 124.751 1.00 310.86 ? 852  PHE B CA    1 
ATOM   7775  C  C     . PHE B  2 852  ? 130.535 103.734 124.993 1.00 310.86 ? 852  PHE B C     1 
ATOM   7776  O  O     . PHE B  2 852  ? 130.344 104.420 126.002 1.00 310.86 ? 852  PHE B O     1 
ATOM   7777  C  CB    . PHE B  2 852  ? 132.093 101.945 125.751 1.00 310.86 ? 852  PHE B CB    1 
ATOM   7778  C  CG    . PHE B  2 852  ? 133.338 101.148 125.523 1.00 310.86 ? 852  PHE B CG    1 
ATOM   7779  C  CD1   . PHE B  2 852  ? 133.372 100.147 124.570 1.00 310.86 ? 852  PHE B CD1   1 
ATOM   7780  C  CD2   . PHE B  2 852  ? 134.471 101.382 126.279 1.00 310.86 ? 852  PHE B CD2   1 
ATOM   7781  C  CE1   . PHE B  2 852  ? 134.516 99.403  124.365 1.00 310.86 ? 852  PHE B CE1   1 
ATOM   7782  C  CE2   . PHE B  2 852  ? 135.619 100.642 126.080 1.00 310.86 ? 852  PHE B CE2   1 
ATOM   7783  C  CZ    . PHE B  2 852  ? 135.642 99.652  125.121 1.00 310.86 ? 852  PHE B CZ    1 
ATOM   7784  N  N     . LEU B  2 853  ? 129.598 103.514 124.073 1.00 322.73 ? 853  LEU B N     1 
ATOM   7785  C  CA    . LEU B  2 853  ? 128.246 104.052 124.191 1.00 322.73 ? 853  LEU B CA    1 
ATOM   7786  C  C     . LEU B  2 853  ? 127.257 102.893 124.182 1.00 322.73 ? 853  LEU B C     1 
ATOM   7787  O  O     . LEU B  2 853  ? 127.067 102.230 123.153 1.00 322.73 ? 853  LEU B O     1 
ATOM   7788  C  CB    . LEU B  2 853  ? 127.949 105.054 123.078 1.00 322.73 ? 853  LEU B CB    1 
ATOM   7789  C  CG    . LEU B  2 853  ? 128.453 106.483 123.308 1.00 322.73 ? 853  LEU B CG    1 
ATOM   7790  C  CD1   . LEU B  2 853  ? 129.970 106.578 123.210 1.00 322.73 ? 853  LEU B CD1   1 
ATOM   7791  C  CD2   . LEU B  2 853  ? 127.795 107.449 122.338 1.00 322.73 ? 853  LEU B CD2   1 
ATOM   7792  N  N     . ASP B  2 854  ? 126.600 102.681 125.325 1.00 325.67 ? 854  ASP B N     1 
ATOM   7793  C  CA    . ASP B  2 854  ? 125.744 101.519 125.581 1.00 325.67 ? 854  ASP B CA    1 
ATOM   7794  C  C     . ASP B  2 854  ? 124.290 101.913 125.323 1.00 325.67 ? 854  ASP B C     1 
ATOM   7795  O  O     . ASP B  2 854  ? 123.550 102.277 126.237 1.00 325.67 ? 854  ASP B O     1 
ATOM   7796  C  CB    . ASP B  2 854  ? 125.965 101.021 127.010 1.00 325.67 ? 854  ASP B CB    1 
ATOM   7797  C  CG    . ASP B  2 854  ? 125.737 99.526  127.164 1.00 325.67 ? 854  ASP B CG    1 
ATOM   7798  O  OD1   . ASP B  2 854  ? 125.171 98.899  126.245 1.00 325.67 ? 854  ASP B OD1   1 
ATOM   7799  O  OD2   . ASP B  2 854  ? 126.131 98.977  128.217 1.00 325.67 ? 854  ASP B OD2   1 
ATOM   7800  N  N     . ASP B  2 855  ? 123.881 101.820 124.055 1.00 331.43 ? 855  ASP B N     1 
ATOM   7801  C  CA    . ASP B  2 855  ? 122.556 102.214 123.580 1.00 331.43 ? 855  ASP B CA    1 
ATOM   7802  C  C     . ASP B  2 855  ? 122.221 103.635 124.020 1.00 331.43 ? 855  ASP B C     1 
ATOM   7803  O  O     . ASP B  2 855  ? 121.364 103.832 124.892 1.00 331.43 ? 855  ASP B O     1 
ATOM   7804  C  CB    . ASP B  2 855  ? 121.480 101.241 124.073 1.00 331.43 ? 855  ASP B CB    1 
ATOM   7805  C  CG    . ASP B  2 855  ? 120.159 101.391 123.319 1.00 331.43 ? 855  ASP B CG    1 
ATOM   7806  O  OD1   . ASP B  2 855  ? 120.116 102.130 122.313 1.00 331.43 ? 855  ASP B OD1   1 
ATOM   7807  O  OD2   . ASP B  2 855  ? 119.160 100.766 123.739 1.00 331.43 ? 855  ASP B OD2   1 
ATOM   7808  N  N     . PRO B  2 856  ? 122.870 104.647 123.451 1.00 326.12 ? 856  PRO B N     1 
ATOM   7809  C  CA    . PRO B  2 856  ? 122.553 106.026 123.833 1.00 326.12 ? 856  PRO B CA    1 
ATOM   7810  C  C     . PRO B  2 856  ? 121.353 106.584 123.082 1.00 326.12 ? 856  PRO B C     1 
ATOM   7811  O  O     . PRO B  2 856  ? 121.131 107.798 123.076 1.00 326.12 ? 856  PRO B O     1 
ATOM   7812  C  CB    . PRO B  2 856  ? 123.837 106.779 123.476 1.00 326.12 ? 856  PRO B CB    1 
ATOM   7813  C  CG    . PRO B  2 856  ? 124.373 106.030 122.306 1.00 326.12 ? 856  PRO B CG    1 
ATOM   7814  C  CD    . PRO B  2 856  ? 124.010 104.582 122.518 1.00 326.12 ? 856  PRO B CD    1 
ATOM   7815  N  N     . PHE B  2 857  ? 120.571 105.711 122.443 1.00 341.52 ? 857  PHE B N     1 
ATOM   7816  C  CA    . PHE B  2 857  ? 119.450 106.138 121.612 1.00 341.52 ? 857  PHE B CA    1 
ATOM   7817  C  C     . PHE B  2 857  ? 118.118 105.545 122.050 1.00 341.52 ? 857  PHE B C     1 
ATOM   7818  O  O     . PHE B  2 857  ? 117.147 105.608 121.286 1.00 341.52 ? 857  PHE B O     1 
ATOM   7819  C  CB    . PHE B  2 857  ? 119.708 105.780 120.147 1.00 341.52 ? 857  PHE B CB    1 
ATOM   7820  C  CG    . PHE B  2 857  ? 121.032 106.253 119.636 1.00 341.52 ? 857  PHE B CG    1 
ATOM   7821  C  CD1   . PHE B  2 857  ? 121.267 107.600 119.425 1.00 341.52 ? 857  PHE B CD1   1 
ATOM   7822  C  CD2   . PHE B  2 857  ? 122.045 105.350 119.369 1.00 341.52 ? 857  PHE B CD2   1 
ATOM   7823  C  CE1   . PHE B  2 857  ? 122.488 108.040 118.955 1.00 341.52 ? 857  PHE B CE1   1 
ATOM   7824  C  CE2   . PHE B  2 857  ? 123.266 105.784 118.898 1.00 341.52 ? 857  PHE B CE2   1 
ATOM   7825  C  CZ    . PHE B  2 857  ? 123.490 107.129 118.692 1.00 341.52 ? 857  PHE B CZ    1 
ATOM   7826  N  N     . SER B  2 858  ? 118.041 104.973 123.250 1.00 339.08 ? 858  SER B N     1 
ATOM   7827  C  CA    . SER B  2 858  ? 116.793 104.362 123.694 1.00 339.08 ? 858  SER B CA    1 
ATOM   7828  C  C     . SER B  2 858  ? 115.726 105.419 123.955 1.00 339.08 ? 858  SER B C     1 
ATOM   7829  O  O     . SER B  2 858  ? 114.615 105.340 123.417 1.00 339.08 ? 858  SER B O     1 
ATOM   7830  C  CB    . SER B  2 858  ? 117.036 103.518 124.944 1.00 339.08 ? 858  SER B CB    1 
ATOM   7831  O  OG    . SER B  2 858  ? 117.516 104.313 126.013 1.00 339.08 ? 858  SER B OG    1 
ATOM   7832  N  N     . ALA B  2 859  ? 116.051 106.427 124.769 1.00 343.15 ? 859  ALA B N     1 
ATOM   7833  C  CA    . ALA B  2 859  ? 115.091 107.444 125.184 1.00 343.15 ? 859  ALA B CA    1 
ATOM   7834  C  C     . ALA B  2 859  ? 115.127 108.687 124.305 1.00 343.15 ? 859  ALA B C     1 
ATOM   7835  O  O     . ALA B  2 859  ? 114.868 109.796 124.795 1.00 343.15 ? 859  ALA B O     1 
ATOM   7836  C  CB    . ALA B  2 859  ? 115.327 107.823 126.648 1.00 343.15 ? 859  ALA B CB    1 
ATOM   7837  N  N     . LEU B  2 860  ? 115.453 108.540 123.024 1.00 348.37 ? 860  LEU B N     1 
ATOM   7838  C  CA    . LEU B  2 860  ? 115.408 109.640 122.076 1.00 348.37 ? 860  LEU B CA    1 
ATOM   7839  C  C     . LEU B  2 860  ? 114.500 109.279 120.909 1.00 348.37 ? 860  LEU B C     1 
ATOM   7840  O  O     . LEU B  2 860  ? 114.229 108.106 120.639 1.00 348.37 ? 860  LEU B O     1 
ATOM   7841  C  CB    . LEU B  2 860  ? 116.807 110.004 121.560 1.00 348.37 ? 860  LEU B CB    1 
ATOM   7842  C  CG    . LEU B  2 860  ? 117.664 110.899 122.461 1.00 348.37 ? 860  LEU B CG    1 
ATOM   7843  C  CD1   . LEU B  2 860  ? 118.250 110.119 123.628 1.00 348.37 ? 860  LEU B CD1   1 
ATOM   7844  C  CD2   . LEU B  2 860  ? 118.764 111.576 121.657 1.00 348.37 ? 860  LEU B CD2   1 
ATOM   7845  N  N     . ASP B  2 861  ? 114.028 110.312 120.220 1.00 356.19 ? 861  ASP B N     1 
ATOM   7846  C  CA    . ASP B  2 861  ? 113.138 110.149 119.081 1.00 356.19 ? 861  ASP B CA    1 
ATOM   7847  C  C     . ASP B  2 861  ? 113.972 109.959 117.816 1.00 356.19 ? 861  ASP B C     1 
ATOM   7848  O  O     . ASP B  2 861  ? 115.187 109.761 117.871 1.00 356.19 ? 861  ASP B O     1 
ATOM   7849  C  CB    . ASP B  2 861  ? 112.203 111.349 118.972 1.00 356.19 ? 861  ASP B CB    1 
ATOM   7850  C  CG    . ASP B  2 861  ? 112.053 112.089 120.284 1.00 356.19 ? 861  ASP B CG    1 
ATOM   7851  O  OD1   . ASP B  2 861  ? 113.046 112.698 120.735 1.00 356.19 ? 861  ASP B OD1   1 
ATOM   7852  O  OD2   . ASP B  2 861  ? 110.948 112.061 120.867 1.00 356.19 ? 861  ASP B OD2   1 
ATOM   7853  N  N     . VAL B  2 862  ? 113.321 110.024 116.653 1.00 348.53 ? 862  VAL B N     1 
ATOM   7854  C  CA    . VAL B  2 862  ? 114.040 109.891 115.388 1.00 348.53 ? 862  VAL B CA    1 
ATOM   7855  C  C     . VAL B  2 862  ? 114.917 111.113 115.136 1.00 348.53 ? 862  VAL B C     1 
ATOM   7856  O  O     . VAL B  2 862  ? 116.099 110.990 114.786 1.00 348.53 ? 862  VAL B O     1 
ATOM   7857  C  CB    . VAL B  2 862  ? 113.051 109.661 114.230 1.00 348.53 ? 862  VAL B CB    1 
ATOM   7858  C  CG1   . VAL B  2 862  ? 113.802 109.482 112.913 1.00 348.53 ? 862  VAL B CG1   1 
ATOM   7859  C  CG2   . VAL B  2 862  ? 112.164 108.458 114.514 1.00 348.53 ? 862  VAL B CG2   1 
ATOM   7860  N  N     . HIS B  2 863  ? 114.359 112.310 115.322 1.00 351.11 ? 863  HIS B N     1 
ATOM   7861  C  CA    . HIS B  2 863  ? 115.051 113.520 114.888 1.00 351.11 ? 863  HIS B CA    1 
ATOM   7862  C  C     . HIS B  2 863  ? 116.213 113.872 115.813 1.00 351.11 ? 863  HIS B C     1 
ATOM   7863  O  O     . HIS B  2 863  ? 117.299 114.239 115.343 1.00 351.11 ? 863  HIS B O     1 
ATOM   7864  C  CB    . HIS B  2 863  ? 114.045 114.658 114.806 1.00 351.11 ? 863  HIS B CB    1 
ATOM   7865  C  CG    . HIS B  2 863  ? 112.674 114.204 114.414 1.00 351.11 ? 863  HIS B CG    1 
ATOM   7866  N  ND1   . HIS B  2 863  ? 112.376 113.758 113.145 1.00 351.11 ? 863  HIS B ND1   1 
ATOM   7867  C  CD2   . HIS B  2 863  ? 111.528 114.101 115.129 1.00 351.11 ? 863  HIS B CD2   1 
ATOM   7868  C  CE1   . HIS B  2 863  ? 111.100 113.422 113.087 1.00 351.11 ? 863  HIS B CE1   1 
ATOM   7869  N  NE2   . HIS B  2 863  ? 110.562 113.621 114.278 1.00 351.11 ? 863  HIS B NE2   1 
ATOM   7870  N  N     . LEU B  2 864  ? 116.001 113.788 117.130 1.00 344.81 ? 864  LEU B N     1 
ATOM   7871  C  CA    . LEU B  2 864  ? 117.093 114.034 118.065 1.00 344.81 ? 864  LEU B CA    1 
ATOM   7872  C  C     . LEU B  2 864  ? 118.204 113.010 117.890 1.00 344.81 ? 864  LEU B C     1 
ATOM   7873  O  O     . LEU B  2 864  ? 119.389 113.352 117.977 1.00 344.81 ? 864  LEU B O     1 
ATOM   7874  C  CB    . LEU B  2 864  ? 116.576 114.024 119.501 1.00 344.81 ? 864  LEU B CB    1 
ATOM   7875  C  CG    . LEU B  2 864  ? 115.601 115.134 119.888 1.00 344.81 ? 864  LEU B CG    1 
ATOM   7876  C  CD1   . LEU B  2 864  ? 115.533 115.266 121.399 1.00 344.81 ? 864  LEU B CD1   1 
ATOM   7877  C  CD2   . LEU B  2 864  ? 115.997 116.454 119.246 1.00 344.81 ? 864  LEU B CD2   1 
ATOM   7878  N  N     . SER B  2 865  ? 117.844 111.744 117.649 1.00 349.68 ? 865  SER B N     1 
ATOM   7879  C  CA    . SER B  2 865  ? 118.858 110.725 117.397 1.00 349.68 ? 865  SER B CA    1 
ATOM   7880  C  C     . SER B  2 865  ? 119.647 111.032 116.132 1.00 349.68 ? 865  SER B C     1 
ATOM   7881  O  O     . SER B  2 865  ? 120.875 110.896 116.111 1.00 349.68 ? 865  SER B O     1 
ATOM   7882  C  CB    . SER B  2 865  ? 118.212 109.344 117.296 1.00 349.68 ? 865  SER B CB    1 
ATOM   7883  O  OG    . SER B  2 865  ? 117.565 108.988 118.506 1.00 349.68 ? 865  SER B OG    1 
ATOM   7884  N  N     . ASP B  2 866  ? 118.958 111.446 115.064 1.00 346.65 ? 866  ASP B N     1 
ATOM   7885  C  CA    . ASP B  2 866  ? 119.652 111.804 113.830 1.00 346.65 ? 866  ASP B CA    1 
ATOM   7886  C  C     . ASP B  2 866  ? 120.631 112.948 114.066 1.00 346.65 ? 866  ASP B C     1 
ATOM   7887  O  O     . ASP B  2 866  ? 121.800 112.874 113.666 1.00 346.65 ? 866  ASP B O     1 
ATOM   7888  C  CB    . ASP B  2 866  ? 118.644 112.179 112.742 1.00 346.65 ? 866  ASP B CB    1 
ATOM   7889  C  CG    . ASP B  2 866  ? 117.820 110.994 112.273 1.00 346.65 ? 866  ASP B CG    1 
ATOM   7890  O  OD1   . ASP B  2 866  ? 117.924 109.910 112.885 1.00 346.65 ? 866  ASP B OD1   1 
ATOM   7891  O  OD2   . ASP B  2 866  ? 117.066 111.149 111.289 1.00 346.65 ? 866  ASP B OD2   1 
ATOM   7892  N  N     . HIS B  2 867  ? 120.168 114.016 114.723 1.00 340.81 ? 867  HIS B N     1 
ATOM   7893  C  CA    . HIS B  2 867  ? 121.035 115.167 114.951 1.00 340.81 ? 867  HIS B CA    1 
ATOM   7894  C  C     . HIS B  2 867  ? 122.219 114.806 115.841 1.00 340.81 ? 867  HIS B C     1 
ATOM   7895  O  O     . HIS B  2 867  ? 123.349 115.236 115.586 1.00 340.81 ? 867  HIS B O     1 
ATOM   7896  C  CB    . HIS B  2 867  ? 120.241 116.320 115.565 1.00 340.81 ? 867  HIS B CB    1 
ATOM   7897  C  CG    . HIS B  2 867  ? 121.062 117.548 115.820 1.00 340.81 ? 867  HIS B CG    1 
ATOM   7898  N  ND1   . HIS B  2 867  ? 121.728 117.766 117.006 1.00 340.81 ? 867  HIS B ND1   1 
ATOM   7899  C  CD2   . HIS B  2 867  ? 121.330 118.620 115.037 1.00 340.81 ? 867  HIS B CD2   1 
ATOM   7900  C  CE1   . HIS B  2 867  ? 122.368 118.920 116.946 1.00 340.81 ? 867  HIS B CE1   1 
ATOM   7901  N  NE2   . HIS B  2 867  ? 122.141 119.460 115.762 1.00 340.81 ? 867  HIS B NE2   1 
ATOM   7902  N  N     . LEU B  2 868  ? 121.981 114.010 116.889 1.00 342.53 ? 868  LEU B N     1 
ATOM   7903  C  CA    . LEU B  2 868  ? 123.060 113.642 117.801 1.00 342.53 ? 868  LEU B CA    1 
ATOM   7904  C  C     . LEU B  2 868  ? 124.082 112.742 117.119 1.00 342.53 ? 868  LEU B C     1 
ATOM   7905  O  O     . LEU B  2 868  ? 125.291 112.934 117.281 1.00 342.53 ? 868  LEU B O     1 
ATOM   7906  C  CB    . LEU B  2 868  ? 122.483 112.960 119.042 1.00 342.53 ? 868  LEU B CB    1 
ATOM   7907  C  CG    . LEU B  2 868  ? 123.490 112.347 120.017 1.00 342.53 ? 868  LEU B CG    1 
ATOM   7908  C  CD1   . LEU B  2 868  ? 124.387 113.422 120.607 1.00 342.53 ? 868  LEU B CD1   1 
ATOM   7909  C  CD2   . LEU B  2 868  ? 122.775 111.574 121.114 1.00 342.53 ? 868  LEU B CD2   1 
ATOM   7910  N  N     . MET B  2 869  ? 123.617 111.756 116.349 1.00 339.66 ? 869  MET B N     1 
ATOM   7911  C  CA    . MET B  2 869  ? 124.535 110.866 115.652 1.00 339.66 ? 869  MET B CA    1 
ATOM   7912  C  C     . MET B  2 869  ? 125.309 111.601 114.569 1.00 339.66 ? 869  MET B C     1 
ATOM   7913  O  O     . MET B  2 869  ? 126.477 111.283 114.317 1.00 339.66 ? 869  MET B O     1 
ATOM   7914  C  CB    . MET B  2 869  ? 123.763 109.689 115.057 1.00 339.66 ? 869  MET B CB    1 
ATOM   7915  C  CG    . MET B  2 869  ? 124.577 108.414 114.890 1.00 339.66 ? 869  MET B CG    1 
ATOM   7916  S  SD    . MET B  2 869  ? 125.151 108.137 113.207 1.00 339.66 ? 869  MET B SD    1 
ATOM   7917  C  CE    . MET B  2 869  ? 123.693 108.611 112.282 1.00 339.66 ? 869  MET B CE    1 
ATOM   7918  N  N     . GLN B  2 870  ? 124.686 112.591 113.925 1.00 339.10 ? 870  GLN B N     1 
ATOM   7919  C  CA    . GLN B  2 870  ? 125.375 113.317 112.867 1.00 339.10 ? 870  GLN B CA    1 
ATOM   7920  C  C     . GLN B  2 870  ? 126.378 114.314 113.434 1.00 339.10 ? 870  GLN B C     1 
ATOM   7921  O  O     . GLN B  2 870  ? 127.474 114.480 112.884 1.00 339.10 ? 870  GLN B O     1 
ATOM   7922  C  CB    . GLN B  2 870  ? 124.357 114.026 111.974 1.00 339.10 ? 870  GLN B CB    1 
ATOM   7923  C  CG    . GLN B  2 870  ? 124.975 114.790 110.822 1.00 339.10 ? 870  GLN B CG    1 
ATOM   7924  C  CD    . GLN B  2 870  ? 125.810 113.903 109.920 1.00 339.10 ? 870  GLN B CD    1 
ATOM   7925  O  OE1   . GLN B  2 870  ? 125.523 112.716 109.764 1.00 339.10 ? 870  GLN B OE1   1 
ATOM   7926  N  NE2   . GLN B  2 870  ? 126.852 114.471 109.326 1.00 339.10 ? 870  GLN B NE2   1 
ATOM   7927  N  N     . ALA B  2 871  ? 126.030 114.977 114.536 1.00 335.95 ? 871  ALA B N     1 
ATOM   7928  C  CA    . ALA B  2 871  ? 126.857 116.065 115.047 1.00 335.95 ? 871  ALA B CA    1 
ATOM   7929  C  C     . ALA B  2 871  ? 127.989 115.555 115.934 1.00 335.95 ? 871  ALA B C     1 
ATOM   7930  O  O     . ALA B  2 871  ? 129.159 115.873 115.702 1.00 335.95 ? 871  ALA B O     1 
ATOM   7931  C  CB    . ALA B  2 871  ? 125.989 117.069 115.808 1.00 335.95 ? 871  ALA B CB    1 
ATOM   7932  N  N     . GLY B  2 872  ? 127.664 114.769 116.956 1.00 340.05 ? 872  GLY B N     1 
ATOM   7933  C  CA    . GLY B  2 872  ? 128.665 114.354 117.918 1.00 340.05 ? 872  GLY B CA    1 
ATOM   7934  C  C     . GLY B  2 872  ? 129.474 113.141 117.506 1.00 340.05 ? 872  GLY B C     1 
ATOM   7935  O  O     . GLY B  2 872  ? 130.696 113.105 117.691 1.00 340.05 ? 872  GLY B O     1 
ATOM   7936  N  N     . ILE B  2 873  ? 128.801 112.138 116.945 1.00 337.83 ? 873  ILE B N     1 
ATOM   7937  C  CA    . ILE B  2 873  ? 129.468 110.878 116.636 1.00 337.83 ? 873  ILE B CA    1 
ATOM   7938  C  C     . ILE B  2 873  ? 130.277 110.986 115.351 1.00 337.83 ? 873  ILE B C     1 
ATOM   7939  O  O     . ILE B  2 873  ? 131.421 110.524 115.286 1.00 337.83 ? 873  ILE B O     1 
ATOM   7940  C  CB    . ILE B  2 873  ? 128.428 109.746 116.572 1.00 337.83 ? 873  ILE B CB    1 
ATOM   7941  C  CG1   . ILE B  2 873  ? 127.779 109.568 117.946 1.00 337.83 ? 873  ILE B CG1   1 
ATOM   7942  C  CG2   . ILE B  2 873  ? 129.070 108.451 116.097 1.00 337.83 ? 873  ILE B CG2   1 
ATOM   7943  C  CD1   . ILE B  2 873  ? 126.476 108.826 117.917 1.00 337.83 ? 873  ILE B CD1   1 
ATOM   7944  N  N     . LEU B  2 874  ? 129.711 111.599 114.314 1.00 329.48 ? 874  LEU B N     1 
ATOM   7945  C  CA    . LEU B  2 874  ? 130.385 111.651 113.021 1.00 329.48 ? 874  LEU B CA    1 
ATOM   7946  C  C     . LEU B  2 874  ? 131.216 112.912 112.829 1.00 329.48 ? 874  LEU B C     1 
ATOM   7947  O  O     . LEU B  2 874  ? 132.274 112.861 112.190 1.00 329.48 ? 874  LEU B O     1 
ATOM   7948  C  CB    . LEU B  2 874  ? 129.362 111.535 111.890 1.00 329.48 ? 874  LEU B CB    1 
ATOM   7949  C  CG    . LEU B  2 874  ? 128.694 110.167 111.752 1.00 329.48 ? 874  LEU B CG    1 
ATOM   7950  C  CD1   . LEU B  2 874  ? 127.637 110.202 110.664 1.00 329.48 ? 874  LEU B CD1   1 
ATOM   7951  C  CD2   . LEU B  2 874  ? 129.732 109.089 111.464 1.00 329.48 ? 874  LEU B CD2   1 
ATOM   7952  N  N     . GLU B  2 875  ? 130.763 114.050 113.350 1.00 334.94 ? 875  GLU B N     1 
ATOM   7953  C  CA    . GLU B  2 875  ? 131.508 115.291 113.168 1.00 334.94 ? 875  GLU B CA    1 
ATOM   7954  C  C     . GLU B  2 875  ? 132.442 115.575 114.341 1.00 334.94 ? 875  GLU B C     1 
ATOM   7955  O  O     . GLU B  2 875  ? 133.600 115.952 114.138 1.00 334.94 ? 875  GLU B O     1 
ATOM   7956  C  CB    . GLU B  2 875  ? 130.548 116.468 112.971 1.00 334.94 ? 875  GLU B CB    1 
ATOM   7957  C  CG    . GLU B  2 875  ? 129.724 116.409 111.690 1.00 334.94 ? 875  GLU B CG    1 
ATOM   7958  C  CD    . GLU B  2 875  ? 128.819 117.622 111.517 1.00 334.94 ? 875  GLU B CD    1 
ATOM   7959  O  OE1   . GLU B  2 875  ? 128.883 118.545 112.358 1.00 334.94 ? 875  GLU B OE1   1 
ATOM   7960  O  OE2   . GLU B  2 875  ? 128.040 117.651 110.539 1.00 334.94 ? 875  GLU B OE2   1 
ATOM   7961  N  N     . LEU B  2 876  ? 131.960 115.410 115.574 1.00 333.95 ? 876  LEU B N     1 
ATOM   7962  C  CA    . LEU B  2 876  ? 132.754 115.827 116.723 1.00 333.95 ? 876  LEU B CA    1 
ATOM   7963  C  C     . LEU B  2 876  ? 133.720 114.731 117.161 1.00 333.95 ? 876  LEU B C     1 
ATOM   7964  O  O     . LEU B  2 876  ? 134.901 114.998 117.407 1.00 333.95 ? 876  LEU B O     1 
ATOM   7965  C  CB    . LEU B  2 876  ? 131.829 116.226 117.868 1.00 333.95 ? 876  LEU B CB    1 
ATOM   7966  C  CG    . LEU B  2 876  ? 132.498 116.806 119.115 1.00 333.95 ? 876  LEU B CG    1 
ATOM   7967  C  CD1   . LEU B  2 876  ? 133.456 117.920 118.739 1.00 333.95 ? 876  LEU B CD1   1 
ATOM   7968  C  CD2   . LEU B  2 876  ? 131.431 117.313 120.064 1.00 333.95 ? 876  LEU B CD2   1 
ATOM   7969  N  N     . LEU B  2 877  ? 133.237 113.490 117.267 1.00 337.53 ? 877  LEU B N     1 
ATOM   7970  C  CA    . LEU B  2 877  ? 134.103 112.377 117.644 1.00 337.53 ? 877  LEU B CA    1 
ATOM   7971  C  C     . LEU B  2 877  ? 135.133 112.096 116.558 1.00 337.53 ? 877  LEU B C     1 
ATOM   7972  O  O     . LEU B  2 877  ? 136.343 112.143 116.804 1.00 337.53 ? 877  LEU B O     1 
ATOM   7973  C  CB    . LEU B  2 877  ? 133.256 111.135 117.922 1.00 337.53 ? 877  LEU B CB    1 
ATOM   7974  C  CG    . LEU B  2 877  ? 132.709 110.965 119.336 1.00 337.53 ? 877  LEU B CG    1 
ATOM   7975  C  CD1   . LEU B  2 877  ? 131.669 109.862 119.383 1.00 337.53 ? 877  LEU B CD1   1 
ATOM   7976  C  CD2   . LEU B  2 877  ? 133.837 110.676 120.312 1.00 337.53 ? 877  LEU B CD2   1 
ATOM   7977  N  N     . ARG B  2 878  ? 134.663 111.795 115.346 1.00 334.06 ? 878  ARG B N     1 
ATOM   7978  C  CA    . ARG B  2 878  ? 135.530 111.471 114.217 1.00 334.06 ? 878  ARG B CA    1 
ATOM   7979  C  C     . ARG B  2 878  ? 136.476 112.608 113.855 1.00 334.06 ? 878  ARG B C     1 
ATOM   7980  O  O     . ARG B  2 878  ? 137.396 112.398 113.054 1.00 334.06 ? 878  ARG B O     1 
ATOM   7981  C  CB    . ARG B  2 878  ? 134.657 111.097 113.018 1.00 334.06 ? 878  ARG B CB    1 
ATOM   7982  C  CG    . ARG B  2 878  ? 135.342 110.343 111.894 1.00 334.06 ? 878  ARG B CG    1 
ATOM   7983  C  CD    . ARG B  2 878  ? 134.292 109.828 110.926 1.00 334.06 ? 878  ARG B CD    1 
ATOM   7984  N  NE    . ARG B  2 878  ? 134.864 109.300 109.693 1.00 334.06 ? 878  ARG B NE    1 
ATOM   7985  C  CZ    . ARG B  2 878  ? 134.143 108.756 108.718 1.00 334.06 ? 878  ARG B CZ    1 
ATOM   7986  N  NH1   . ARG B  2 878  ? 134.739 108.300 107.624 1.00 334.06 ? 878  ARG B NH1   1 
ATOM   7987  N  NH2   . ARG B  2 878  ? 132.826 108.666 108.837 1.00 334.06 ? 878  ARG B NH2   1 
ATOM   7988  N  N     . ASP B  2 879  ? 136.272 113.800 114.418 1.00 339.01 ? 879  ASP B N     1 
ATOM   7989  C  CA    . ASP B  2 879  ? 137.201 114.903 114.208 1.00 339.01 ? 879  ASP B CA    1 
ATOM   7990  C  C     . ASP B  2 879  ? 138.584 114.555 114.749 1.00 339.01 ? 879  ASP B C     1 
ATOM   7991  O  O     . ASP B  2 879  ? 139.568 114.503 114.002 1.00 339.01 ? 879  ASP B O     1 
ATOM   7992  C  CB    . ASP B  2 879  ? 136.653 116.166 114.876 1.00 339.01 ? 879  ASP B CB    1 
ATOM   7993  C  CG    . ASP B  2 879  ? 137.246 117.438 114.307 1.00 339.01 ? 879  ASP B CG    1 
ATOM   7994  O  OD1   . ASP B  2 879  ? 137.087 117.680 113.088 1.00 339.01 ? 879  ASP B OD1   1 
ATOM   7995  O  OD2   . ASP B  2 879  ? 137.856 118.206 115.079 1.00 339.01 ? 879  ASP B OD2   1 
ATOM   7996  N  N     . ASP B  2 880  ? 138.675 114.295 116.056 1.00 340.25 ? 880  ASP B N     1 
ATOM   7997  C  CA    . ASP B  2 880  ? 139.950 113.966 116.687 1.00 340.25 ? 880  ASP B CA    1 
ATOM   7998  C  C     . ASP B  2 880  ? 140.416 112.550 116.394 1.00 340.25 ? 880  ASP B C     1 
ATOM   7999  O  O     . ASP B  2 880  ? 141.443 112.139 116.945 1.00 340.25 ? 880  ASP B O     1 
ATOM   8000  C  CB    . ASP B  2 880  ? 139.847 114.168 118.199 1.00 340.25 ? 880  ASP B CB    1 
ATOM   8001  C  CG    . ASP B  2 880  ? 139.324 115.537 118.567 1.00 340.25 ? 880  ASP B CG    1 
ATOM   8002  O  OD1   . ASP B  2 880  ? 139.458 116.464 117.741 1.00 340.25 ? 880  ASP B OD1   1 
ATOM   8003  O  OD2   . ASP B  2 880  ? 138.776 115.686 119.681 1.00 340.25 ? 880  ASP B OD2   1 
ATOM   8004  N  N     . LYS B  2 881  ? 139.691 111.805 115.558 1.00 341.09 ? 881  LYS B N     1 
ATOM   8005  C  CA    . LYS B  2 881  ? 140.039 110.426 115.213 1.00 341.09 ? 881  LYS B CA    1 
ATOM   8006  C  C     . LYS B  2 881  ? 140.128 109.544 116.456 1.00 341.09 ? 881  LYS B C     1 
ATOM   8007  O  O     . LYS B  2 881  ? 141.027 108.712 116.591 1.00 341.09 ? 881  LYS B O     1 
ATOM   8008  C  CB    . LYS B  2 881  ? 141.336 110.369 114.402 1.00 341.09 ? 881  LYS B CB    1 
ATOM   8009  C  CG    . LYS B  2 881  ? 141.176 110.808 112.953 1.00 341.09 ? 881  LYS B CG    1 
ATOM   8010  C  CD    . LYS B  2 881  ? 140.179 109.918 112.224 1.00 341.09 ? 881  LYS B CD    1 
ATOM   8011  C  CE    . LYS B  2 881  ? 140.097 110.260 110.744 1.00 341.09 ? 881  LYS B CE    1 
ATOM   8012  N  NZ    . LYS B  2 881  ? 139.178 109.343 110.011 1.00 341.09 ? 881  LYS B NZ    1 
ATOM   8013  N  N     . ARG B  2 882  ? 139.185 109.730 117.375 1.00 329.82 ? 882  ARG B N     1 
ATOM   8014  C  CA    . ARG B  2 882  ? 139.081 108.862 118.534 1.00 329.82 ? 882  ARG B CA    1 
ATOM   8015  C  C     . ARG B  2 882  ? 138.513 107.501 118.125 1.00 329.82 ? 882  ARG B C     1 
ATOM   8016  O  O     . ARG B  2 882  ? 138.089 107.287 116.986 1.00 329.82 ? 882  ARG B O     1 
ATOM   8017  C  CB    . ARG B  2 882  ? 138.197 109.507 119.598 1.00 329.82 ? 882  ARG B CB    1 
ATOM   8018  C  CG    . ARG B  2 882  ? 138.543 110.953 119.896 1.00 329.82 ? 882  ARG B CG    1 
ATOM   8019  C  CD    . ARG B  2 882  ? 137.334 111.687 120.446 1.00 329.82 ? 882  ARG B CD    1 
ATOM   8020  N  NE    . ARG B  2 882  ? 137.690 112.637 121.495 1.00 329.82 ? 882  ARG B NE    1 
ATOM   8021  C  CZ    . ARG B  2 882  ? 137.719 112.341 122.791 1.00 329.82 ? 882  ARG B CZ    1 
ATOM   8022  N  NH1   . ARG B  2 882  ? 138.053 113.267 123.679 1.00 329.82 ? 882  ARG B NH1   1 
ATOM   8023  N  NH2   . ARG B  2 882  ? 137.417 111.116 123.202 1.00 329.82 ? 882  ARG B NH2   1 
ATOM   8024  N  N     . THR B  2 883  ? 138.508 106.571 119.073 1.00 328.05 ? 883  THR B N     1 
ATOM   8025  C  CA    . THR B  2 883  ? 137.940 105.246 118.867 1.00 328.05 ? 883  THR B CA    1 
ATOM   8026  C  C     . THR B  2 883  ? 136.555 105.188 119.502 1.00 328.05 ? 883  THR B C     1 
ATOM   8027  O  O     . THR B  2 883  ? 136.384 105.588 120.660 1.00 328.05 ? 883  THR B O     1 
ATOM   8028  C  CB    . THR B  2 883  ? 138.845 104.165 119.464 1.00 328.05 ? 883  THR B CB    1 
ATOM   8029  O  OG1   . THR B  2 883  ? 140.146 104.250 118.870 1.00 328.05 ? 883  THR B OG1   1 
ATOM   8030  C  CG2   . THR B  2 883  ? 138.266 102.780 119.213 1.00 328.05 ? 883  THR B CG2   1 
ATOM   8031  N  N     . VAL B  2 884  ? 135.575 104.693 118.748 1.00 340.20 ? 884  VAL B N     1 
ATOM   8032  C  CA    . VAL B  2 884  ? 134.178 104.672 119.177 1.00 340.20 ? 884  VAL B CA    1 
ATOM   8033  C  C     . VAL B  2 884  ? 133.646 103.252 119.069 1.00 340.20 ? 884  VAL B C     1 
ATOM   8034  O  O     . VAL B  2 884  ? 133.710 102.642 117.995 1.00 340.20 ? 884  VAL B O     1 
ATOM   8035  C  CB    . VAL B  2 884  ? 133.306 105.625 118.344 1.00 340.20 ? 884  VAL B CB    1 
ATOM   8036  C  CG1   . VAL B  2 884  ? 131.855 105.551 118.806 1.00 340.20 ? 884  VAL B CG1   1 
ATOM   8037  C  CG2   . VAL B  2 884  ? 133.836 107.050 118.425 1.00 340.20 ? 884  VAL B CG2   1 
ATOM   8038  N  N     . VAL B  2 885  ? 133.105 102.732 120.169 1.00 340.84 ? 885  VAL B N     1 
ATOM   8039  C  CA    . VAL B  2 885  ? 132.402 101.457 120.186 1.00 340.84 ? 885  VAL B CA    1 
ATOM   8040  C  C     . VAL B  2 885  ? 130.978 101.751 120.640 1.00 340.84 ? 885  VAL B C     1 
ATOM   8041  O  O     . VAL B  2 885  ? 130.735 102.007 121.827 1.00 340.84 ? 885  VAL B O     1 
ATOM   8042  C  CB    . VAL B  2 885  ? 133.076 100.435 121.109 1.00 340.84 ? 885  VAL B CB    1 
ATOM   8043  C  CG1   . VAL B  2 885  ? 132.529 99.040  120.844 1.00 340.84 ? 885  VAL B CG1   1 
ATOM   8044  C  CG2   . VAL B  2 885  ? 134.587 100.480 120.938 1.00 340.84 ? 885  VAL B CG2   1 
ATOM   8045  N  N     . LEU B  2 886  ? 130.040 101.725 119.703 1.00 334.33 ? 886  LEU B N     1 
ATOM   8046  C  CA    . LEU B  2 886  ? 128.666 102.121 119.970 1.00 334.33 ? 886  LEU B CA    1 
ATOM   8047  C  C     . LEU B  2 886  ? 127.750 100.940 119.703 1.00 334.33 ? 886  LEU B C     1 
ATOM   8048  O  O     . LEU B  2 886  ? 127.785 100.358 118.616 1.00 334.33 ? 886  LEU B O     1 
ATOM   8049  C  CB    . LEU B  2 886  ? 128.285 103.320 119.106 1.00 334.33 ? 886  LEU B CB    1 
ATOM   8050  C  CG    . LEU B  2 886  ? 127.200 104.232 119.663 1.00 334.33 ? 886  LEU B CG    1 
ATOM   8051  C  CD1   . LEU B  2 886  ? 127.320 105.606 119.043 1.00 334.33 ? 886  LEU B CD1   1 
ATOM   8052  C  CD2   . LEU B  2 886  ? 125.841 103.641 119.391 1.00 334.33 ? 886  LEU B CD2   1 
ATOM   8053  N  N     . VAL B  2 887  ? 126.933 100.587 120.693 1.00 331.44 ? 887  VAL B N     1 
ATOM   8054  C  CA    . VAL B  2 887  ? 126.094 99.396  120.627 1.00 331.44 ? 887  VAL B CA    1 
ATOM   8055  C  C     . VAL B  2 887  ? 124.637 99.835  120.649 1.00 331.44 ? 887  VAL B C     1 
ATOM   8056  O  O     . VAL B  2 887  ? 124.155 100.350 121.664 1.00 331.44 ? 887  VAL B O     1 
ATOM   8057  C  CB    . VAL B  2 887  ? 126.389 98.426  121.775 1.00 331.44 ? 887  VAL B CB    1 
ATOM   8058  C  CG1   . VAL B  2 887  ? 125.682 97.104  121.541 1.00 331.44 ? 887  VAL B CG1   1 
ATOM   8059  C  CG2   . VAL B  2 887  ? 127.887 98.231  121.919 1.00 331.44 ? 887  VAL B CG2   1 
ATOM   8060  N  N     . THR B  2 888  ? 123.935 99.620  119.542 1.00 331.55 ? 888  THR B N     1 
ATOM   8061  C  CA    . THR B  2 888  ? 122.530 99.992  119.439 1.00 331.55 ? 888  THR B CA    1 
ATOM   8062  C  C     . THR B  2 888  ? 121.908 99.186  118.303 1.00 331.55 ? 888  THR B C     1 
ATOM   8063  O  O     . THR B  2 888  ? 122.477 98.182  117.859 1.00 331.55 ? 888  THR B O     1 
ATOM   8064  C  CB    . THR B  2 888  ? 122.381 101.504 119.221 1.00 331.55 ? 888  THR B CB    1 
ATOM   8065  O  OG1   . THR B  2 888  ? 120.995 101.829 119.050 1.00 331.55 ? 888  THR B OG1   1 
ATOM   8066  C  CG2   . THR B  2 888  ? 123.140 101.912 117.984 1.00 331.55 ? 888  THR B CG2   1 
ATOM   8067  N  N     . HIS B  2 889  ? 120.736 99.619  117.841 1.00 353.71 ? 889  HIS B N     1 
ATOM   8068  C  CA    . HIS B  2 889  ? 120.091 98.986  116.694 1.00 353.71 ? 889  HIS B CA    1 
ATOM   8069  C  C     . HIS B  2 889  ? 119.233 100.037 115.991 1.00 353.71 ? 889  HIS B C     1 
ATOM   8070  O  O     . HIS B  2 889  ? 118.095 100.288 116.397 1.00 353.71 ? 889  HIS B O     1 
ATOM   8071  C  CB    . HIS B  2 889  ? 119.268 97.780  117.128 1.00 353.71 ? 889  HIS B CB    1 
ATOM   8072  C  CG    . HIS B  2 889  ? 118.442 98.018  118.353 1.00 353.71 ? 889  HIS B CG    1 
ATOM   8073  N  ND1   . HIS B  2 889  ? 118.973 98.001  119.625 1.00 353.71 ? 889  HIS B ND1   1 
ATOM   8074  C  CD2   . HIS B  2 889  ? 117.120 98.269  118.501 1.00 353.71 ? 889  HIS B CD2   1 
ATOM   8075  C  CE1   . HIS B  2 889  ? 118.015 98.238  120.503 1.00 353.71 ? 889  HIS B CE1   1 
ATOM   8076  N  NE2   . HIS B  2 889  ? 116.881 98.403  119.847 1.00 353.71 ? 889  HIS B NE2   1 
ATOM   8077  N  N     . LYS B  2 890  ? 119.787 100.643 114.942 1.00 345.77 ? 890  LYS B N     1 
ATOM   8078  C  CA    . LYS B  2 890  ? 119.048 101.553 114.082 1.00 345.77 ? 890  LYS B CA    1 
ATOM   8079  C  C     . LYS B  2 890  ? 119.508 101.345 112.647 1.00 345.77 ? 890  LYS B C     1 
ATOM   8080  O  O     . LYS B  2 890  ? 120.448 100.594 112.374 1.00 345.77 ? 890  LYS B O     1 
ATOM   8081  C  CB    . LYS B  2 890  ? 119.229 103.018 114.499 1.00 345.77 ? 890  LYS B CB    1 
ATOM   8082  C  CG    . LYS B  2 890  ? 118.527 103.396 115.793 1.00 345.77 ? 890  LYS B CG    1 
ATOM   8083  C  CD    . LYS B  2 890  ? 117.018 103.354 115.634 1.00 345.77 ? 890  LYS B CD    1 
ATOM   8084  C  CE    . LYS B  2 890  ? 116.317 103.681 116.943 1.00 345.77 ? 890  LYS B CE    1 
ATOM   8085  N  NZ    . LYS B  2 890  ? 116.721 105.015 117.470 1.00 345.77 ? 890  LYS B NZ    1 
ATOM   8086  N  N     . LEU B  2 891  ? 118.829 102.024 111.724 1.00 332.87 ? 891  LEU B N     1 
ATOM   8087  C  CA    . LEU B  2 891  ? 119.126 101.891 110.303 1.00 332.87 ? 891  LEU B CA    1 
ATOM   8088  C  C     . LEU B  2 891  ? 120.211 102.857 109.838 1.00 332.87 ? 891  LEU B C     1 
ATOM   8089  O  O     . LEU B  2 891  ? 121.064 102.482 109.025 1.00 332.87 ? 891  LEU B O     1 
ATOM   8090  C  CB    . LEU B  2 891  ? 117.850 102.102 109.480 1.00 332.87 ? 891  LEU B CB    1 
ATOM   8091  C  CG    . LEU B  2 891  ? 116.863 103.171 109.960 1.00 332.87 ? 891  LEU B CG    1 
ATOM   8092  C  CD1   . LEU B  2 891  ? 116.244 103.919 108.784 1.00 332.87 ? 891  LEU B CD1   1 
ATOM   8093  C  CD2   . LEU B  2 891  ? 115.770 102.551 110.822 1.00 332.87 ? 891  LEU B CD2   1 
ATOM   8094  N  N     . GLN B  2 892  ? 120.202 104.091 110.348 1.00 343.19 ? 892  GLN B N     1 
ATOM   8095  C  CA    . GLN B  2 892  ? 121.098 105.124 109.834 1.00 343.19 ? 892  GLN B CA    1 
ATOM   8096  C  C     . GLN B  2 892  ? 122.560 104.830 110.152 1.00 343.19 ? 892  GLN B C     1 
ATOM   8097  O  O     . GLN B  2 892  ? 123.452 105.256 109.408 1.00 343.19 ? 892  GLN B O     1 
ATOM   8098  C  CB    . GLN B  2 892  ? 120.709 106.485 110.412 1.00 343.19 ? 892  GLN B CB    1 
ATOM   8099  C  CG    . GLN B  2 892  ? 119.356 106.496 111.105 1.00 343.19 ? 892  GLN B CG    1 
ATOM   8100  C  CD    . GLN B  2 892  ? 119.391 107.214 112.441 1.00 343.19 ? 892  GLN B CD    1 
ATOM   8101  O  OE1   . GLN B  2 892  ? 120.185 108.131 112.647 1.00 343.19 ? 892  GLN B OE1   1 
ATOM   8102  N  NE2   . GLN B  2 892  ? 118.528 106.793 113.360 1.00 343.19 ? 892  GLN B NE2   1 
ATOM   8103  N  N     . TYR B  2 893  ? 122.826 104.106 111.239 1.00 344.99 ? 893  TYR B N     1 
ATOM   8104  C  CA    . TYR B  2 893  ? 124.191 104.002 111.738 1.00 344.99 ? 893  TYR B CA    1 
ATOM   8105  C  C     . TYR B  2 893  ? 125.016 102.987 110.956 1.00 344.99 ? 893  TYR B C     1 
ATOM   8106  O  O     . TYR B  2 893  ? 126.234 103.156 110.828 1.00 344.99 ? 893  TYR B O     1 
ATOM   8107  C  CB    . TYR B  2 893  ? 124.187 103.627 113.221 1.00 344.99 ? 893  TYR B CB    1 
ATOM   8108  C  CG    . TYR B  2 893  ? 123.193 104.383 114.087 1.00 344.99 ? 893  TYR B CG    1 
ATOM   8109  C  CD1   . TYR B  2 893  ? 122.739 105.649 113.739 1.00 344.99 ? 893  TYR B CD1   1 
ATOM   8110  C  CD2   . TYR B  2 893  ? 122.716 103.823 115.260 1.00 344.99 ? 893  TYR B CD2   1 
ATOM   8111  C  CE1   . TYR B  2 893  ? 121.834 106.327 114.533 1.00 344.99 ? 893  TYR B CE1   1 
ATOM   8112  C  CE2   . TYR B  2 893  ? 121.817 104.495 116.064 1.00 344.99 ? 893  TYR B CE2   1 
ATOM   8113  C  CZ    . TYR B  2 893  ? 121.375 105.744 115.696 1.00 344.99 ? 893  TYR B CZ    1 
ATOM   8114  O  OH    . TYR B  2 893  ? 120.476 106.410 116.496 1.00 344.99 ? 893  TYR B OH    1 
ATOM   8115  N  N     . LEU B  2 894  ? 124.377 101.937 110.437 1.00 341.31 ? 894  LEU B N     1 
ATOM   8116  C  CA    . LEU B  2 894  ? 125.119 100.867 109.772 1.00 341.31 ? 894  LEU B CA    1 
ATOM   8117  C  C     . LEU B  2 894  ? 125.955 101.356 108.596 1.00 341.31 ? 894  LEU B C     1 
ATOM   8118  O  O     . LEU B  2 894  ? 127.148 101.014 108.537 1.00 341.31 ? 894  LEU B O     1 
ATOM   8119  C  CB    . LEU B  2 894  ? 124.145 99.763  109.347 1.00 341.31 ? 894  LEU B CB    1 
ATOM   8120  C  CG    . LEU B  2 894  ? 123.189 99.253  110.426 1.00 341.31 ? 894  LEU B CG    1 
ATOM   8121  C  CD1   . LEU B  2 894  ? 121.774 99.174  109.878 1.00 341.31 ? 894  LEU B CD1   1 
ATOM   8122  C  CD2   . LEU B  2 894  ? 123.638 97.897  110.946 1.00 341.31 ? 894  LEU B CD2   1 
ATOM   8123  N  N     . PRO B  2 895  ? 125.432 102.143 107.645 1.00 343.58 ? 895  PRO B N     1 
ATOM   8124  C  CA    . PRO B  2 895  ? 126.279 102.595 106.529 1.00 343.58 ? 895  PRO B CA    1 
ATOM   8125  C  C     . PRO B  2 895  ? 127.372 103.572 106.931 1.00 343.58 ? 895  PRO B C     1 
ATOM   8126  O  O     . PRO B  2 895  ? 128.161 103.972 106.067 1.00 343.58 ? 895  PRO B O     1 
ATOM   8127  C  CB    . PRO B  2 895  ? 125.274 103.261 105.572 1.00 343.58 ? 895  PRO B CB    1 
ATOM   8128  C  CG    . PRO B  2 895  ? 123.936 102.761 105.995 1.00 343.58 ? 895  PRO B CG    1 
ATOM   8129  C  CD    . PRO B  2 895  ? 124.041 102.594 107.471 1.00 343.58 ? 895  PRO B CD    1 
ATOM   8130  N  N     . HIS B  2 896  ? 127.447 103.972 108.202 1.00 335.52 ? 896  HIS B N     1 
ATOM   8131  C  CA    . HIS B  2 896  ? 128.450 104.925 108.653 1.00 335.52 ? 896  HIS B CA    1 
ATOM   8132  C  C     . HIS B  2 896  ? 129.637 104.281 109.355 1.00 335.52 ? 896  HIS B C     1 
ATOM   8133  O  O     . HIS B  2 896  ? 130.710 104.893 109.403 1.00 335.52 ? 896  HIS B O     1 
ATOM   8134  C  CB    . HIS B  2 896  ? 127.824 105.954 109.602 1.00 335.52 ? 896  HIS B CB    1 
ATOM   8135  C  CG    . HIS B  2 896  ? 126.963 106.965 108.913 1.00 335.52 ? 896  HIS B CG    1 
ATOM   8136  N  ND1   . HIS B  2 896  ? 125.592 106.982 109.036 1.00 335.52 ? 896  HIS B ND1   1 
ATOM   8137  C  CD2   . HIS B  2 896  ? 127.281 107.991 108.090 1.00 335.52 ? 896  HIS B CD2   1 
ATOM   8138  C  CE1   . HIS B  2 896  ? 125.101 107.978 108.320 1.00 335.52 ? 896  HIS B CE1   1 
ATOM   8139  N  NE2   . HIS B  2 896  ? 126.104 108.607 107.737 1.00 335.52 ? 896  HIS B NE2   1 
ATOM   8140  N  N     . ALA B  2 897  ? 129.479 103.080 109.896 1.00 331.49 ? 897  ALA B N     1 
ATOM   8141  C  CA    . ALA B  2 897  ? 130.529 102.467 110.692 1.00 331.49 ? 897  ALA B CA    1 
ATOM   8142  C  C     . ALA B  2 897  ? 131.427 101.579 109.834 1.00 331.49 ? 897  ALA B C     1 
ATOM   8143  O  O     . ALA B  2 897  ? 131.084 101.200 108.711 1.00 331.49 ? 897  ALA B O     1 
ATOM   8144  C  CB    . ALA B  2 897  ? 129.928 101.652 111.835 1.00 331.49 ? 897  ALA B CB    1 
ATOM   8145  N  N     . ASP B  2 898  ? 132.595 101.248 110.390 1.00 331.39 ? 898  ASP B N     1 
ATOM   8146  C  CA    . ASP B  2 898  ? 133.609 100.451 109.709 1.00 331.39 ? 898  ASP B CA    1 
ATOM   8147  C  C     . ASP B  2 898  ? 133.541 98.968  110.050 1.00 331.39 ? 898  ASP B C     1 
ATOM   8148  O  O     . ASP B  2 898  ? 133.794 98.129  109.179 1.00 331.39 ? 898  ASP B O     1 
ATOM   8149  C  CB    . ASP B  2 898  ? 135.013 100.971 110.042 1.00 331.39 ? 898  ASP B CB    1 
ATOM   8150  C  CG    . ASP B  2 898  ? 135.170 102.461 109.782 1.00 331.39 ? 898  ASP B CG    1 
ATOM   8151  O  OD1   . ASP B  2 898  ? 134.150 103.146 109.558 1.00 331.39 ? 898  ASP B OD1   1 
ATOM   8152  O  OD2   . ASP B  2 898  ? 136.322 102.945 109.802 1.00 331.39 ? 898  ASP B OD2   1 
ATOM   8153  N  N     . TRP B  2 899  ? 133.221 98.613  111.292 1.00 332.61 ? 899  TRP B N     1 
ATOM   8154  C  CA    . TRP B  2 899  ? 133.154 97.214  111.688 1.00 332.61 ? 899  TRP B CA    1 
ATOM   8155  C  C     . TRP B  2 899  ? 131.780 96.882  112.245 1.00 332.61 ? 899  TRP B C     1 
ATOM   8156  O  O     . TRP B  2 899  ? 131.126 97.723  112.867 1.00 332.61 ? 899  TRP B O     1 
ATOM   8157  C  CB    . TRP B  2 899  ? 134.221 96.880  112.725 1.00 332.61 ? 899  TRP B CB    1 
ATOM   8158  C  CG    . TRP B  2 899  ? 135.429 96.288  112.112 1.00 332.61 ? 899  TRP B CG    1 
ATOM   8159  C  CD1   . TRP B  2 899  ? 136.116 96.764  111.037 1.00 332.61 ? 899  TRP B CD1   1 
ATOM   8160  C  CD2   . TRP B  2 899  ? 136.106 95.102  112.533 1.00 332.61 ? 899  TRP B CD2   1 
ATOM   8161  N  NE1   . TRP B  2 899  ? 137.183 95.947  110.761 1.00 332.61 ? 899  TRP B NE1   1 
ATOM   8162  C  CE2   . TRP B  2 899  ? 137.199 94.917  111.664 1.00 332.61 ? 899  TRP B CE2   1 
ATOM   8163  C  CE3   . TRP B  2 899  ? 135.897 94.177  113.558 1.00 332.61 ? 899  TRP B CE3   1 
ATOM   8164  C  CZ2   . TRP B  2 899  ? 138.079 93.845  111.790 1.00 332.61 ? 899  TRP B CZ2   1 
ATOM   8165  C  CZ3   . TRP B  2 899  ? 136.772 93.116  113.682 1.00 332.61 ? 899  TRP B CZ3   1 
ATOM   8166  C  CH2   . TRP B  2 899  ? 137.847 92.958  112.803 1.00 332.61 ? 899  TRP B CH2   1 
ATOM   8167  N  N     . ILE B  2 900  ? 131.337 95.649  112.012 1.00 342.78 ? 900  ILE B N     1 
ATOM   8168  C  CA    . ILE B  2 900  ? 130.040 95.195  112.495 1.00 342.78 ? 900  ILE B CA    1 
ATOM   8169  C  C     . ILE B  2 900  ? 130.232 93.865  113.208 1.00 342.78 ? 900  ILE B C     1 
ATOM   8170  O  O     . ILE B  2 900  ? 130.907 92.971  112.687 1.00 342.78 ? 900  ILE B O     1 
ATOM   8171  C  CB    . ILE B  2 900  ? 129.017 95.065  111.352 1.00 342.78 ? 900  ILE B CB    1 
ATOM   8172  C  CG1   . ILE B  2 900  ? 128.782 96.429  110.698 1.00 342.78 ? 900  ILE B CG1   1 
ATOM   8173  C  CG2   . ILE B  2 900  ? 127.705 94.497  111.869 1.00 342.78 ? 900  ILE B CG2   1 
ATOM   8174  C  CD1   . ILE B  2 900  ? 127.712 96.419  109.629 1.00 342.78 ? 900  ILE B CD1   1 
ATOM   8175  N  N     . ILE B  2 901  ? 129.642 93.734  114.397 1.00 350.04 ? 901  ILE B N     1 
ATOM   8176  C  CA    . ILE B  2 901  ? 129.832 92.549  115.232 1.00 350.04 ? 901  ILE B CA    1 
ATOM   8177  C  C     . ILE B  2 901  ? 128.471 91.990  115.624 1.00 350.04 ? 901  ILE B C     1 
ATOM   8178  O  O     . ILE B  2 901  ? 127.763 92.588  116.442 1.00 350.04 ? 901  ILE B O     1 
ATOM   8179  C  CB    . ILE B  2 901  ? 130.666 92.849  116.480 1.00 350.04 ? 901  ILE B CB    1 
ATOM   8180  C  CG1   . ILE B  2 901  ? 132.027 93.423  116.088 1.00 350.04 ? 901  ILE B CG1   1 
ATOM   8181  C  CG2   . ILE B  2 901  ? 130.830 91.584  117.301 1.00 350.04 ? 901  ILE B CG2   1 
ATOM   8182  C  CD1   . ILE B  2 901  ? 132.853 93.870  117.265 1.00 350.04 ? 901  ILE B CD1   1 
ATOM   8183  N  N     . ALA B  2 902  ? 128.126 90.824  115.082 1.00 359.98 ? 902  ALA B N     1 
ATOM   8184  C  CA    . ALA B  2 902  ? 126.837 90.187  115.321 1.00 359.98 ? 902  ALA B CA    1 
ATOM   8185  C  C     . ALA B  2 902  ? 126.961 89.168  116.447 1.00 359.98 ? 902  ALA B C     1 
ATOM   8186  O  O     . ALA B  2 902  ? 127.752 88.223  116.352 1.00 359.98 ? 902  ALA B O     1 
ATOM   8187  C  CB    . ALA B  2 902  ? 126.322 89.518  114.047 1.00 359.98 ? 902  ALA B CB    1 
ATOM   8188  N  N     . MET B  2 903  ? 126.170 89.356  117.500 1.00 382.39 ? 903  MET B N     1 
ATOM   8189  C  CA    . MET B  2 903  ? 126.167 88.483  118.663 1.00 382.39 ? 903  MET B CA    1 
ATOM   8190  C  C     . MET B  2 903  ? 124.892 87.650  118.698 1.00 382.39 ? 903  MET B C     1 
ATOM   8191  O  O     . MET B  2 903  ? 123.825 88.098  118.273 1.00 382.39 ? 903  MET B O     1 
ATOM   8192  C  CB    . MET B  2 903  ? 126.284 89.295  119.956 1.00 382.39 ? 903  MET B CB    1 
ATOM   8193  C  CG    . MET B  2 903  ? 127.573 90.085  120.085 1.00 382.39 ? 903  MET B CG    1 
ATOM   8194  S  SD    . MET B  2 903  ? 129.020 89.021  120.209 1.00 382.39 ? 903  MET B SD    1 
ATOM   8195  C  CE    . MET B  2 903  ? 128.590 88.022  121.633 1.00 382.39 ? 903  MET B CE    1 
ATOM   8196  N  N     . LYS B  2 904  ? 125.014 86.429  119.219 1.00 483.94 ? 904  LYS B N     1 
ATOM   8197  C  CA    . LYS B  2 904  ? 123.865 85.538  119.370 1.00 483.94 ? 904  LYS B CA    1 
ATOM   8198  C  C     . LYS B  2 904  ? 124.169 84.536  120.472 1.00 483.94 ? 904  LYS B C     1 
ATOM   8199  O  O     . LYS B  2 904  ? 125.099 83.735  120.336 1.00 483.94 ? 904  LYS B O     1 
ATOM   8200  C  CB    . LYS B  2 904  ? 123.545 84.818  118.061 1.00 234.69 ? 904  LYS B CB    1 
ATOM   8201  C  CG    . LYS B  2 904  ? 122.459 85.489  117.237 1.00 234.69 ? 904  LYS B CG    1 
ATOM   8202  C  CD    . LYS B  2 904  ? 122.153 84.705  115.973 1.00 234.69 ? 904  LYS B CD    1 
ATOM   8203  C  CE    . LYS B  2 904  ? 121.074 85.395  115.153 1.00 234.69 ? 904  LYS B CE    1 
ATOM   8204  N  NZ    . LYS B  2 904  ? 120.753 84.642  113.908 1.00 234.69 ? 904  LYS B NZ    1 
ATOM   8205  N  N     . ASP B  2 905  ? 123.388 84.583  121.553 1.00 413.32 ? 905  ASP B N     1 
ATOM   8206  C  CA    . ASP B  2 905  ? 123.525 83.656  122.680 1.00 413.32 ? 905  ASP B CA    1 
ATOM   8207  C  C     . ASP B  2 905  ? 124.943 83.671  123.250 1.00 413.32 ? 905  ASP B C     1 
ATOM   8208  O  O     . ASP B  2 905  ? 125.492 82.633  123.623 1.00 413.32 ? 905  ASP B O     1 
ATOM   8209  C  CB    . ASP B  2 905  ? 123.118 82.235  122.281 1.00 413.32 ? 905  ASP B CB    1 
ATOM   8210  N  N     . GLY B  2 906  ? 125.541 84.858  123.319 1.00 399.09 ? 906  GLY B N     1 
ATOM   8211  C  CA    . GLY B  2 906  ? 126.878 84.987  123.859 1.00 399.09 ? 906  GLY B CA    1 
ATOM   8212  C  C     . GLY B  2 906  ? 127.988 84.595  122.914 1.00 399.09 ? 906  GLY B C     1 
ATOM   8213  O  O     . GLY B  2 906  ? 129.123 84.396  123.359 1.00 399.09 ? 906  GLY B O     1 
ATOM   8214  N  N     . THR B  2 907  ? 127.699 84.476  121.620 1.00 394.68 ? 907  THR B N     1 
ATOM   8215  C  CA    . THR B  2 907  ? 128.690 84.093  120.627 1.00 394.68 ? 907  THR B CA    1 
ATOM   8216  C  C     . THR B  2 907  ? 128.621 85.038  119.439 1.00 394.68 ? 907  THR B C     1 
ATOM   8217  O  O     . THR B  2 907  ? 127.556 85.569  119.107 1.00 394.68 ? 907  THR B O     1 
ATOM   8218  C  CB    . THR B  2 907  ? 128.487 82.646  120.155 1.00 394.68 ? 907  THR B CB    1 
ATOM   8219  O  OG1   . THR B  2 907  ? 127.124 82.458  119.757 1.00 394.68 ? 907  THR B OG1   1 
ATOM   8220  C  CG2   . THR B  2 907  ? 128.832 81.664  121.266 1.00 394.68 ? 907  THR B CG2   1 
ATOM   8221  N  N     . ILE B  2 908  ? 129.770 85.242  118.802 1.00 363.18 ? 908  ILE B N     1 
ATOM   8222  C  CA    . ILE B  2 908  ? 129.873 86.120  117.641 1.00 363.18 ? 908  ILE B CA    1 
ATOM   8223  C  C     . ILE B  2 908  ? 129.499 85.309  116.404 1.00 363.18 ? 908  ILE B C     1 
ATOM   8224  O  O     . ILE B  2 908  ? 130.227 84.397  116.005 1.00 363.18 ? 908  ILE B O     1 
ATOM   8225  C  CB    . ILE B  2 908  ? 131.280 86.711  117.508 1.00 363.18 ? 908  ILE B CB    1 
ATOM   8226  C  CG1   . ILE B  2 908  ? 131.820 87.130  118.878 1.00 363.18 ? 908  ILE B CG1   1 
ATOM   8227  C  CG2   . ILE B  2 908  ? 131.262 87.897  116.573 1.00 363.18 ? 908  ILE B CG2   1 
ATOM   8228  C  CD1   . ILE B  2 908  ? 133.215 87.711  118.828 1.00 363.18 ? 908  ILE B CD1   1 
ATOM   8229  N  N     . GLN B  2 909  ? 128.362 85.642  115.792 1.00 335.09 ? 909  GLN B N     1 
ATOM   8230  C  CA    . GLN B  2 909  ? 127.878 84.866  114.653 1.00 335.09 ? 909  GLN B CA    1 
ATOM   8231  C  C     . GLN B  2 909  ? 128.803 85.022  113.450 1.00 335.09 ? 909  GLN B C     1 
ATOM   8232  O  O     . GLN B  2 909  ? 129.396 84.048  112.974 1.00 335.09 ? 909  GLN B O     1 
ATOM   8233  C  CB    . GLN B  2 909  ? 126.451 85.290  114.304 1.00 335.09 ? 909  GLN B CB    1 
ATOM   8234  C  CG    . GLN B  2 909  ? 125.744 84.348  113.345 1.00 335.09 ? 909  GLN B CG    1 
ATOM   8235  C  CD    . GLN B  2 909  ? 124.344 84.814  113.001 1.00 335.09 ? 909  GLN B CD    1 
ATOM   8236  O  OE1   . GLN B  2 909  ? 123.906 85.878  113.441 1.00 335.09 ? 909  GLN B OE1   1 
ATOM   8237  N  NE2   . GLN B  2 909  ? 123.629 84.019  112.209 1.00 335.09 ? 909  GLN B NE2   1 
ATOM   8238  N  N     . ARG B  2 910  ? 128.935 86.242  112.944 1.00 347.53 ? 910  ARG B N     1 
ATOM   8239  C  CA    . ARG B  2 910  ? 129.867 86.573  111.876 1.00 347.53 ? 910  ARG B CA    1 
ATOM   8240  C  C     . ARG B  2 910  ? 130.795 87.674  112.371 1.00 347.53 ? 910  ARG B C     1 
ATOM   8241  O  O     . ARG B  2 910  ? 130.707 88.111  113.519 1.00 347.53 ? 910  ARG B O     1 
ATOM   8242  C  CB    . ARG B  2 910  ? 129.125 87.000  110.606 1.00 347.53 ? 910  ARG B CB    1 
ATOM   8243  N  N     . GLU B  2 911  ? 131.688 88.134  111.501 1.00 345.46 ? 911  GLU B N     1 
ATOM   8244  C  CA    . GLU B  2 911  ? 132.657 89.128  111.934 1.00 345.46 ? 911  GLU B CA    1 
ATOM   8245  C  C     . GLU B  2 911  ? 133.267 89.842  110.738 1.00 345.46 ? 911  GLU B C     1 
ATOM   8246  O  O     . GLU B  2 911  ? 133.480 89.233  109.688 1.00 345.46 ? 911  GLU B O     1 
ATOM   8247  C  CB    . GLU B  2 911  ? 133.764 88.480  112.777 1.00 345.46 ? 911  GLU B CB    1 
ATOM   8248  C  CG    . GLU B  2 911  ? 134.649 89.487  113.467 1.00 345.46 ? 911  GLU B CG    1 
ATOM   8249  C  CD    . GLU B  2 911  ? 133.836 90.518  114.217 1.00 345.46 ? 911  GLU B CD    1 
ATOM   8250  O  OE1   . GLU B  2 911  ? 132.938 90.117  114.986 1.00 345.46 ? 911  GLU B OE1   1 
ATOM   8251  O  OE2   . GLU B  2 911  ? 134.078 91.726  114.020 1.00 345.46 ? 911  GLU B OE2   1 
ATOM   8252  N  N     . GLY B  2 912  ? 133.541 91.145  110.914 1.00 343.54 ? 912  GLY B N     1 
ATOM   8253  C  CA    . GLY B  2 912  ? 134.382 91.895  110.009 1.00 343.54 ? 912  GLY B CA    1 
ATOM   8254  C  C     . GLY B  2 912  ? 133.792 93.240  109.634 1.00 343.54 ? 912  GLY B C     1 
ATOM   8255  O  O     . GLY B  2 912  ? 132.938 93.795  110.338 1.00 343.54 ? 912  GLY B O     1 
ATOM   8256  N  N     . THR B  2 913  ? 134.288 93.760  108.513 1.00 339.56 ? 913  THR B N     1 
ATOM   8257  C  CA    . THR B  2 913  ? 133.812 94.994  107.906 1.00 339.56 ? 913  THR B CA    1 
ATOM   8258  C  C     . THR B  2 913  ? 132.513 94.735  107.149 1.00 339.56 ? 913  THR B C     1 
ATOM   8259  O  O     . THR B  2 913  ? 131.969 93.629  107.150 1.00 339.56 ? 913  THR B O     1 
ATOM   8260  C  CB    . THR B  2 913  ? 134.874 95.577  106.975 1.00 339.56 ? 913  THR B CB    1 
ATOM   8261  O  OG1   . THR B  2 913  ? 134.984 94.758  105.807 1.00 339.56 ? 913  THR B OG1   1 
ATOM   8262  C  CG2   . THR B  2 913  ? 136.222 95.629  107.671 1.00 339.56 ? 913  THR B CG2   1 
ATOM   8263  N  N     . LEU B  2 914  ? 132.013 95.769  106.471 1.00 336.40 ? 914  LEU B N     1 
ATOM   8264  C  CA    . LEU B  2 914  ? 130.701 95.677  105.841 1.00 336.40 ? 914  LEU B CA    1 
ATOM   8265  C  C     . LEU B  2 914  ? 130.734 94.807  104.589 1.00 336.40 ? 914  LEU B C     1 
ATOM   8266  O  O     . LEU B  2 914  ? 129.888 93.921  104.416 1.00 336.40 ? 914  LEU B O     1 
ATOM   8267  C  CB    . LEU B  2 914  ? 130.186 97.076  105.510 1.00 336.40 ? 914  LEU B CB    1 
ATOM   8268  C  CG    . LEU B  2 914  ? 128.799 97.131  104.874 1.00 336.40 ? 914  LEU B CG    1 
ATOM   8269  C  CD1   . LEU B  2 914  ? 127.792 96.407  105.751 1.00 336.40 ? 914  LEU B CD1   1 
ATOM   8270  C  CD2   . LEU B  2 914  ? 128.378 98.573  104.643 1.00 336.40 ? 914  LEU B CD2   1 
ATOM   8271  N  N     . LYS B  2 915  ? 131.695 95.056  103.697 1.00 333.15 ? 915  LYS B N     1 
ATOM   8272  C  CA    . LYS B  2 915  ? 131.727 94.347  102.420 1.00 333.15 ? 915  LYS B CA    1 
ATOM   8273  C  C     . LYS B  2 915  ? 131.960 92.855  102.620 1.00 333.15 ? 915  LYS B C     1 
ATOM   8274  O  O     . LYS B  2 915  ? 131.262 92.020  102.031 1.00 333.15 ? 915  LYS B O     1 
ATOM   8275  C  CB    . LYS B  2 915  ? 132.808 94.942  101.516 1.00 333.15 ? 915  LYS B CB    1 
ATOM   8276  C  CG    . LYS B  2 915  ? 132.532 96.367  101.062 1.00 333.15 ? 915  LYS B CG    1 
ATOM   8277  C  CD    . LYS B  2 915  ? 133.635 96.873  100.146 1.00 333.15 ? 915  LYS B CD    1 
ATOM   8278  C  CE    . LYS B  2 915  ? 133.371 98.298  99.693  1.00 333.15 ? 915  LYS B CE    1 
ATOM   8279  N  NZ    . LYS B  2 915  ? 134.457 98.811  98.813  1.00 333.15 ? 915  LYS B NZ    1 
ATOM   8280  N  N     . ASP B  2 916  ? 132.944 92.498  103.449 1.00 326.95 ? 916  ASP B N     1 
ATOM   8281  C  CA    . ASP B  2 916  ? 133.200 91.088  103.720 1.00 326.95 ? 916  ASP B CA    1 
ATOM   8282  C  C     . ASP B  2 916  ? 132.028 90.440  104.445 1.00 326.95 ? 916  ASP B C     1 
ATOM   8283  O  O     . ASP B  2 916  ? 131.755 89.250  104.243 1.00 326.95 ? 916  ASP B O     1 
ATOM   8284  C  CB    . ASP B  2 916  ? 134.485 90.933  104.535 1.00 326.95 ? 916  ASP B CB    1 
ATOM   8285  N  N     . PHE B  2 917  ? 131.324 91.200  105.285 1.00 332.40 ? 917  PHE B N     1 
ATOM   8286  C  CA    . PHE B  2 917  ? 130.130 90.670  105.934 1.00 332.40 ? 917  PHE B CA    1 
ATOM   8287  C  C     . PHE B  2 917  ? 129.016 90.420  104.928 1.00 332.40 ? 917  PHE B C     1 
ATOM   8288  O  O     . PHE B  2 917  ? 128.234 89.478  105.092 1.00 332.40 ? 917  PHE B O     1 
ATOM   8289  C  CB    . PHE B  2 917  ? 129.657 91.633  107.023 1.00 332.40 ? 917  PHE B CB    1 
ATOM   8290  C  CG    . PHE B  2 917  ? 128.386 91.210  107.702 1.00 332.40 ? 917  PHE B CG    1 
ATOM   8291  C  CD1   . PHE B  2 917  ? 128.392 90.191  108.640 1.00 332.40 ? 917  PHE B CD1   1 
ATOM   8292  C  CD2   . PHE B  2 917  ? 127.189 91.847  107.418 1.00 332.40 ? 917  PHE B CD2   1 
ATOM   8293  C  CE1   . PHE B  2 917  ? 127.222 89.805  109.272 1.00 332.40 ? 917  PHE B CE1   1 
ATOM   8294  C  CE2   . PHE B  2 917  ? 126.016 91.468  108.048 1.00 332.40 ? 917  PHE B CE2   1 
ATOM   8295  C  CZ    . PHE B  2 917  ? 126.034 90.446  108.976 1.00 332.40 ? 917  PHE B CZ    1 
ATOM   8296  N  N     . GLN B  2 918  ? 128.928 91.243  103.884 1.00 324.31 ? 918  GLN B N     1 
ATOM   8297  C  CA    . GLN B  2 918  ? 127.902 91.047  102.872 1.00 324.31 ? 918  GLN B CA    1 
ATOM   8298  C  C     . GLN B  2 918  ? 128.302 90.012  101.829 1.00 324.31 ? 918  GLN B C     1 
ATOM   8299  O  O     . GLN B  2 918  ? 127.441 89.539  101.080 1.00 324.31 ? 918  GLN B O     1 
ATOM   8300  C  CB    . GLN B  2 918  ? 127.572 92.376  102.191 1.00 324.31 ? 918  GLN B CB    1 
ATOM   8301  C  CG    . GLN B  2 918  ? 126.192 92.409  101.558 1.00 324.31 ? 918  GLN B CG    1 
ATOM   8302  C  CD    . GLN B  2 918  ? 125.086 92.102  102.554 1.00 324.31 ? 918  GLN B CD    1 
ATOM   8303  O  OE1   . GLN B  2 918  ? 125.172 92.460  103.730 1.00 324.31 ? 918  GLN B OE1   1 
ATOM   8304  N  NE2   . GLN B  2 918  ? 124.038 91.433  102.086 1.00 324.31 ? 918  GLN B NE2   1 
ATOM   8305  N  N     . ARG B  2 919  ? 129.583 89.654  101.762 1.00 320.76 ? 919  ARG B N     1 
ATOM   8306  C  CA    . ARG B  2 919  ? 130.037 88.583  100.886 1.00 320.76 ? 919  ARG B CA    1 
ATOM   8307  C  C     . ARG B  2 919  ? 130.105 87.231  101.582 1.00 320.76 ? 919  ARG B C     1 
ATOM   8308  O  O     . ARG B  2 919  ? 130.340 86.219  100.912 1.00 320.76 ? 919  ARG B O     1 
ATOM   8309  C  CB    . ARG B  2 919  ? 131.410 88.922  100.303 1.00 320.76 ? 919  ARG B CB    1 
ATOM   8310  C  CG    . ARG B  2 919  ? 131.409 90.084  99.329  1.00 320.76 ? 919  ARG B CG    1 
ATOM   8311  C  CD    . ARG B  2 919  ? 132.821 90.402  98.879  1.00 320.76 ? 919  ARG B CD    1 
ATOM   8312  N  NE    . ARG B  2 919  ? 133.678 90.750  100.009 1.00 320.76 ? 919  ARG B NE    1 
ATOM   8313  C  CZ    . ARG B  2 919  ? 134.988 90.959  99.918  1.00 320.76 ? 919  ARG B CZ    1 
ATOM   8314  N  NH1   . ARG B  2 919  ? 135.687 91.274  100.999 1.00 320.76 ? 919  ARG B NH1   1 
ATOM   8315  N  NH2   . ARG B  2 919  ? 135.599 90.849  98.746  1.00 320.76 ? 919  ARG B NH2   1 
ATOM   8316  N  N     . SER B  2 920  ? 129.910 87.184  102.898 1.00 317.58 ? 920  SER B N     1 
ATOM   8317  C  CA    . SER B  2 920  ? 129.958 85.935  103.642 1.00 317.58 ? 920  SER B CA    1 
ATOM   8318  C  C     . SER B  2 920  ? 128.576 85.286  103.694 1.00 317.58 ? 920  SER B C     1 
ATOM   8319  O  O     . SER B  2 920  ? 127.566 85.871  103.296 1.00 317.58 ? 920  SER B O     1 
ATOM   8320  C  CB    . SER B  2 920  ? 130.486 86.172  105.058 1.00 317.58 ? 920  SER B CB    1 
ATOM   8321  O  OG    . SER B  2 920  ? 129.587 86.965  105.814 1.00 317.58 ? 920  SER B OG    1 
ATOM   8322  N  N     . GLU B  2 921  ? 128.543 84.059  104.200 1.00 301.74 ? 921  GLU B N     1 
ATOM   8323  C  CA    . GLU B  2 921  ? 127.302 83.296  104.289 1.00 301.74 ? 921  GLU B CA    1 
ATOM   8324  C  C     . GLU B  2 921  ? 126.423 83.779  105.440 1.00 301.74 ? 921  GLU B C     1 
ATOM   8325  O  O     . GLU B  2 921  ? 126.519 84.928  105.872 1.00 301.74 ? 921  GLU B O     1 
ATOM   8326  C  CB    . GLU B  2 921  ? 127.602 81.804  104.450 1.00 301.74 ? 921  GLU B CB    1 
ATOM   8327  N  N     . ARG B  2 999  ? 101.798 122.014 166.553 1.00 261.51 ? 999  ARG B N     1 
ATOM   8328  C  CA    . ARG B  2 999  ? 101.128 121.099 165.637 1.00 261.39 ? 999  ARG B CA    1 
ATOM   8329  C  C     . ARG B  2 999  ? 101.846 119.757 165.588 1.00 261.00 ? 999  ARG B C     1 
ATOM   8330  O  O     . ARG B  2 999  ? 101.582 118.930 164.716 1.00 264.15 ? 999  ARG B O     1 
ATOM   8331  C  CB    . ARG B  2 999  ? 101.050 121.705 164.233 1.00 258.55 ? 999  ARG B CB    1 
ATOM   8332  N  N     . ALA B  2 1000 ? 102.760 119.547 166.534 1.00 313.48 ? 1000 ALA B N     1 
ATOM   8333  C  CA    . ALA B  2 1000 ? 103.561 118.331 166.586 1.00 313.21 ? 1000 ALA B CA    1 
ATOM   8334  C  C     . ALA B  2 1000 ? 103.322 117.522 167.849 1.00 316.53 ? 1000 ALA B C     1 
ATOM   8335  O  O     . ALA B  2 1000 ? 103.041 116.319 167.764 1.00 318.78 ? 1000 ALA B O     1 
ATOM   8336  C  CB    . ALA B  2 1000 ? 105.050 118.683 166.464 1.00 310.08 ? 1000 ALA B CB    1 
ATOM   8337  N  N     . CYS B  2 1001 ? 103.427 118.145 169.024 1.00 321.67 ? 1001 CYS B N     1 
ATOM   8338  C  CA    . CYS B  2 1001 ? 103.258 117.422 170.278 1.00 325.09 ? 1001 CYS B CA    1 
ATOM   8339  C  C     . CYS B  2 1001 ? 101.798 117.135 170.601 1.00 328.78 ? 1001 CYS B C     1 
ATOM   8340  O  O     . CYS B  2 1001 ? 101.517 116.176 171.331 1.00 330.24 ? 1001 CYS B O     1 
ATOM   8341  C  CB    . CYS B  2 1001 ? 103.893 118.213 171.425 1.00 323.03 ? 1001 CYS B CB    1 
ATOM   8342  S  SG    . CYS B  2 1001 ? 105.550 118.848 171.067 1.00 319.74 ? 1001 CYS B SG    1 
ATOM   8343  N  N     . THR B  2 1002 ? 100.869 117.937 170.073 1.00 345.18 ? 1002 THR B N     1 
ATOM   8344  C  CA    . THR B  2 1002 ? 99.451  117.742 170.356 1.00 348.81 ? 1002 THR B CA    1 
ATOM   8345  C  C     . THR B  2 1002 ? 98.977  116.374 169.878 1.00 350.98 ? 1002 THR B C     1 
ATOM   8346  O  O     . THR B  2 1002 ? 98.431  115.581 170.654 1.00 354.86 ? 1002 THR B O     1 
ATOM   8347  C  CB    . THR B  2 1002 ? 98.628  118.856 169.704 1.00 348.13 ? 1002 THR B CB    1 
ATOM   8348  O  OG1   . THR B  2 1002 ? 99.027  120.125 170.237 1.00 348.24 ? 1002 THR B OG1   1 
ATOM   8349  C  CG2   . THR B  2 1002 ? 97.140  118.647 169.962 1.00 349.89 ? 1002 THR B CG2   1 
ATOM   8350  N  N     . LYS B  2 1003 ? 99.187  116.075 168.593 1.00 349.95 ? 1003 LYS B N     1 
ATOM   8351  C  CA    . LYS B  2 1003 ? 98.742  114.793 168.058 1.00 352.34 ? 1003 LYS B CA    1 
ATOM   8352  C  C     . LYS B  2 1003 ? 99.569  113.635 168.604 1.00 354.42 ? 1003 LYS B C     1 
ATOM   8353  O  O     . LYS B  2 1003 ? 99.059  112.516 168.712 1.00 361.40 ? 1003 LYS B O     1 
ATOM   8354  C  CB    . LYS B  2 1003 ? 98.784  114.815 166.530 1.00 355.48 ? 1003 LYS B CB    1 
ATOM   8355  N  N     . TYR B  2 1004 ? 100.828 113.883 168.973 1.00 337.49 ? 1004 TYR B N     1 
ATOM   8356  C  CA    . TYR B  2 1004 ? 101.627 112.851 169.628 1.00 338.88 ? 1004 TYR B CA    1 
ATOM   8357  C  C     . TYR B  2 1004 ? 101.004 112.438 170.955 1.00 345.01 ? 1004 TYR B C     1 
ATOM   8358  O  O     . TYR B  2 1004 ? 100.797 111.246 171.219 1.00 351.81 ? 1004 TYR B O     1 
ATOM   8359  C  CB    . TYR B  2 1004 ? 103.059 113.347 169.843 1.00 335.45 ? 1004 TYR B CB    1 
ATOM   8360  C  CG    . TYR B  2 1004 ? 103.842 112.528 170.846 1.00 336.41 ? 1004 TYR B CG    1 
ATOM   8361  C  CD1   . TYR B  2 1004 ? 104.391 111.304 170.493 1.00 336.74 ? 1004 TYR B CD1   1 
ATOM   8362  C  CD2   . TYR B  2 1004 ? 104.035 112.978 172.147 1.00 334.79 ? 1004 TYR B CD2   1 
ATOM   8363  C  CE1   . TYR B  2 1004 ? 105.109 110.553 171.402 1.00 334.14 ? 1004 TYR B CE1   1 
ATOM   8364  C  CE2   . TYR B  2 1004 ? 104.752 112.228 173.065 1.00 333.96 ? 1004 TYR B CE2   1 
ATOM   8365  C  CZ    . TYR B  2 1004 ? 105.285 111.016 172.684 1.00 332.71 ? 1004 TYR B CZ    1 
ATOM   8366  O  OH    . TYR B  2 1004 ? 105.999 110.258 173.582 1.00 329.81 ? 1004 TYR B OH    1 
ATOM   8367  N  N     . LEU B  2 1005 ? 100.700 113.419 171.808 1.00 339.78 ? 1005 LEU B N     1 
ATOM   8368  C  CA    . LEU B  2 1005 ? 100.069 113.116 173.087 1.00 343.42 ? 1005 LEU B CA    1 
ATOM   8369  C  C     . LEU B  2 1005 ? 98.659  112.567 172.905 1.00 351.05 ? 1005 LEU B C     1 
ATOM   8370  O  O     . LEU B  2 1005 ? 98.193  111.780 173.736 1.00 357.33 ? 1005 LEU B O     1 
ATOM   8371  C  CB    . LEU B  2 1005 ? 100.049 114.364 173.969 1.00 337.56 ? 1005 LEU B CB    1 
ATOM   8372  C  CG    . LEU B  2 1005 ? 101.417 114.937 174.354 1.00 333.01 ? 1005 LEU B CG    1 
ATOM   8373  C  CD1   . LEU B  2 1005 ? 101.262 116.189 175.207 1.00 330.96 ? 1005 LEU B CD1   1 
ATOM   8374  C  CD2   . LEU B  2 1005 ? 102.252 113.891 175.081 1.00 332.17 ? 1005 LEU B CD2   1 
ATOM   8375  N  N     . SER B  2 1006 ? 97.968  112.960 171.831 1.00 356.40 ? 1006 SER B N     1 
ATOM   8376  C  CA    . SER B  2 1006 ? 96.637  112.412 171.575 1.00 360.22 ? 1006 SER B CA    1 
ATOM   8377  C  C     . SER B  2 1006 ? 96.713  110.943 171.171 1.00 364.91 ? 1006 SER B C     1 
ATOM   8378  O  O     . SER B  2 1006 ? 95.877  110.134 171.590 1.00 369.29 ? 1006 SER B O     1 
ATOM   8379  C  CB    . SER B  2 1006 ? 95.926  113.234 170.501 1.00 354.30 ? 1006 SER B CB    1 
ATOM   8380  O  OG    . SER B  2 1006 ? 95.714  114.568 170.931 1.00 350.15 ? 1006 SER B OG    1 
ATOM   8381  N  N     . SER B  2 1007 ? 97.707  110.582 170.354 1.00 337.37 ? 1007 SER B N     1 
ATOM   8382  C  CA    . SER B  2 1007 ? 97.918  109.181 170.008 1.00 346.78 ? 1007 SER B CA    1 
ATOM   8383  C  C     . SER B  2 1007 ? 98.395  108.377 171.208 1.00 352.47 ? 1007 SER B C     1 
ATOM   8384  O  O     . SER B  2 1007 ? 98.110  107.176 171.302 1.00 359.85 ? 1007 SER B O     1 
ATOM   8385  C  CB    . SER B  2 1007 ? 98.924  109.066 168.864 1.00 351.67 ? 1007 SER B CB    1 
ATOM   8386  O  OG    . SER B  2 1007 ? 99.298  107.716 168.651 1.00 369.57 ? 1007 SER B OG    1 
ATOM   8387  N  N     . ALA B  2 1008 ? 99.131  109.012 172.123 1.00 360.92 ? 1008 ALA B N     1 
ATOM   8388  C  CA    . ALA B  2 1008 ? 99.512  108.335 173.357 1.00 363.38 ? 1008 ALA B CA    1 
ATOM   8389  C  C     . ALA B  2 1008 ? 98.285  107.959 174.179 1.00 362.08 ? 1008 ALA B C     1 
ATOM   8390  O  O     . ALA B  2 1008 ? 98.255  106.901 174.819 1.00 361.46 ? 1008 ALA B O     1 
ATOM   8391  C  CB    . ALA B  2 1008 ? 100.456 109.221 174.170 1.00 359.77 ? 1008 ALA B CB    1 
ATOM   8392  N  N     . GLY B  2 1009 ? 97.259  108.809 174.168 1.00 375.31 ? 1009 GLY B N     1 
ATOM   8393  C  CA    . GLY B  2 1009 ? 96.039  108.543 174.906 1.00 373.46 ? 1009 GLY B CA    1 
ATOM   8394  C  C     . GLY B  2 1009 ? 95.879  109.409 176.138 1.00 368.79 ? 1009 GLY B C     1 
ATOM   8395  O  O     . GLY B  2 1009 ? 96.742  109.409 177.021 1.00 366.53 ? 1009 GLY B O     1 
ATOM   8396  N  N     . ILE B  2 1010 ? 94.767  110.149 176.215 1.00 382.25 ? 1010 ILE B N     1 
ATOM   8397  C  CA    . ILE B  2 1010 ? 94.512  111.033 177.347 1.00 377.72 ? 1010 ILE B CA    1 
ATOM   8398  C  C     . ILE B  2 1010 ? 94.321  110.284 178.658 1.00 375.17 ? 1010 ILE B C     1 
ATOM   8399  O  O     . ILE B  2 1010 ? 94.342  110.907 179.726 1.00 372.56 ? 1010 ILE B O     1 
ATOM   8400  C  CB    . ILE B  2 1010 ? 93.280  111.917 177.066 1.00 378.77 ? 1010 ILE B CB    1 
ATOM   8401  C  CG1   . ILE B  2 1010 ? 92.087  111.057 176.643 1.00 378.07 ? 1010 ILE B CG1   1 
ATOM   8402  C  CG2   . ILE B  2 1010 ? 93.600  112.951 175.996 1.00 377.88 ? 1010 ILE B CG2   1 
ATOM   8403  C  CD1   . ILE B  2 1010 ? 90.868  111.857 176.230 1.00 378.42 ? 1010 ILE B CD1   1 
ATOM   8404  N  N     . LEU B  2 1011 ? 94.137  108.966 178.605 1.00 382.04 ? 1011 LEU B N     1 
ATOM   8405  C  CA    . LEU B  2 1011 ? 93.996  108.144 179.801 1.00 378.47 ? 1011 LEU B CA    1 
ATOM   8406  C  C     . LEU B  2 1011 ? 95.298  107.484 180.225 1.00 374.57 ? 1011 LEU B C     1 
ATOM   8407  O  O     . LEU B  2 1011 ? 95.482  107.204 181.415 1.00 370.80 ? 1011 LEU B O     1 
ATOM   8408  C  CB    . LEU B  2 1011 ? 92.935  107.060 179.571 1.00 377.23 ? 1011 LEU B CB    1 
ATOM   8409  C  CG    . LEU B  2 1011 ? 92.593  106.113 180.725 1.00 375.48 ? 1011 LEU B CG    1 
ATOM   8410  C  CD1   . LEU B  2 1011 ? 91.954  106.873 181.877 1.00 376.24 ? 1011 LEU B CD1   1 
ATOM   8411  C  CD2   . LEU B  2 1011 ? 91.686  104.985 180.248 1.00 376.67 ? 1011 LEU B CD2   1 
ATOM   8412  N  N     . LEU B  2 1012 ? 96.212  107.238 179.289 1.00 369.76 ? 1012 LEU B N     1 
ATOM   8413  C  CA    . LEU B  2 1012 ? 97.428  106.497 179.598 1.00 366.31 ? 1012 LEU B CA    1 
ATOM   8414  C  C     . LEU B  2 1012 ? 98.558  107.403 180.074 1.00 362.79 ? 1012 LEU B C     1 
ATOM   8415  O  O     . LEU B  2 1012 ? 99.216  107.097 181.073 1.00 360.99 ? 1012 LEU B O     1 
ATOM   8416  C  CB    . LEU B  2 1012 ? 97.872  105.702 178.378 1.00 370.75 ? 1012 LEU B CB    1 
ATOM   8417  C  CG    . LEU B  2 1012 ? 96.860  104.658 177.930 1.00 372.62 ? 1012 LEU B CG    1 
ATOM   8418  C  CD1   . LEU B  2 1012 ? 97.444  103.961 176.744 1.00 379.27 ? 1012 LEU B CD1   1 
ATOM   8419  C  CD2   . LEU B  2 1012 ? 96.553  103.672 179.049 1.00 368.04 ? 1012 LEU B CD2   1 
ATOM   8420  N  N     . LEU B  2 1013 ? 98.811  108.506 179.366 1.00 376.06 ? 1013 LEU B N     1 
ATOM   8421  C  CA    . LEU B  2 1013 ? 99.849  109.428 179.814 1.00 372.24 ? 1013 LEU B CA    1 
ATOM   8422  C  C     . LEU B  2 1013 ? 99.464  110.099 181.124 1.00 366.92 ? 1013 LEU B C     1 
ATOM   8423  O  O     . LEU B  2 1013 ? 100.336 110.405 181.947 1.00 364.11 ? 1013 LEU B O     1 
ATOM   8424  C  CB    . LEU B  2 1013 ? 100.132 110.474 178.735 1.00 372.59 ? 1013 LEU B CB    1 
ATOM   8425  C  CG    . LEU B  2 1013 ? 98.991  111.386 178.274 1.00 366.69 ? 1013 LEU B CG    1 
ATOM   8426  C  CD1   . LEU B  2 1013 ? 98.934  112.684 179.073 1.00 365.23 ? 1013 LEU B CD1   1 
ATOM   8427  C  CD2   . LEU B  2 1013 ? 99.134  111.677 176.792 1.00 367.61 ? 1013 LEU B CD2   1 
ATOM   8428  N  N     . SER B  2 1014 ? 98.166  110.331 181.334 1.00 378.01 ? 1014 SER B N     1 
ATOM   8429  C  CA    . SER B  2 1014 ? 97.705  110.886 182.600 1.00 373.31 ? 1014 SER B CA    1 
ATOM   8430  C  C     . SER B  2 1014 ? 97.974  109.920 183.748 1.00 372.37 ? 1014 SER B C     1 
ATOM   8431  O  O     . SER B  2 1014 ? 98.463  110.321 184.811 1.00 368.41 ? 1014 SER B O     1 
ATOM   8432  C  CB    . SER B  2 1014 ? 96.215  111.222 182.510 1.00 372.00 ? 1014 SER B CB    1 
ATOM   8433  O  OG    . SER B  2 1014 ? 95.489  110.166 181.902 1.00 374.81 ? 1014 SER B OG    1 
ATOM   8434  N  N     . LEU B  2 1015 ? 97.664  108.635 183.545 1.00 379.10 ? 1015 LEU B N     1 
ATOM   8435  C  CA    . LEU B  2 1015 ? 97.984  107.624 184.549 1.00 377.48 ? 1015 LEU B CA    1 
ATOM   8436  C  C     . LEU B  2 1015 ? 99.489  107.529 184.766 1.00 373.65 ? 1015 LEU B C     1 
ATOM   8437  O  O     . LEU B  2 1015 ? 99.948  107.321 185.894 1.00 370.34 ? 1015 LEU B O     1 
ATOM   8438  C  CB    . LEU B  2 1015 ? 97.401  106.271 184.125 1.00 380.41 ? 1015 LEU B CB    1 
ATOM   8439  C  CG    . LEU B  2 1015 ? 97.222  105.171 185.179 1.00 377.84 ? 1015 LEU B CG    1 
ATOM   8440  C  CD1   . LEU B  2 1015 ? 96.078  104.246 184.788 1.00 376.41 ? 1015 LEU B CD1   1 
ATOM   8441  C  CD2   . LEU B  2 1015 ? 98.501  104.371 185.378 1.00 377.28 ? 1015 LEU B CD2   1 
ATOM   8442  N  N     . LEU B  2 1016 ? 100.268 107.699 183.695 1.00 368.57 ? 1016 LEU B N     1 
ATOM   8443  C  CA    . LEU B  2 1016 ? 101.725 107.687 183.803 1.00 365.09 ? 1016 LEU B CA    1 
ATOM   8444  C  C     . LEU B  2 1016 ? 102.214 108.789 184.736 1.00 360.19 ? 1016 LEU B C     1 
ATOM   8445  O  O     . LEU B  2 1016 ? 102.956 108.530 185.695 1.00 357.41 ? 1016 LEU B O     1 
ATOM   8446  C  CB    . LEU B  2 1016 ? 102.331 107.842 182.405 1.00 366.44 ? 1016 LEU B CB    1 
ATOM   8447  C  CG    . LEU B  2 1016 ? 103.838 107.826 182.142 1.00 362.52 ? 1016 LEU B CG    1 
ATOM   8448  C  CD1   . LEU B  2 1016 ? 104.068 107.351 180.721 1.00 370.52 ? 1016 LEU B CD1   1 
ATOM   8449  C  CD2   . LEU B  2 1016 ? 104.461 109.201 182.336 1.00 358.73 ? 1016 LEU B CD2   1 
ATOM   8450  N  N     . VAL B  2 1017 ? 101.810 110.031 184.460 1.00 376.24 ? 1017 VAL B N     1 
ATOM   8451  C  CA    . VAL B  2 1017 ? 102.237 111.163 185.282 1.00 372.31 ? 1017 VAL B CA    1 
ATOM   8452  C  C     . VAL B  2 1017 ? 101.755 110.996 186.719 1.00 369.96 ? 1017 VAL B C     1 
ATOM   8453  O  O     . VAL B  2 1017 ? 102.504 111.246 187.676 1.00 368.26 ? 1017 VAL B O     1 
ATOM   8454  C  CB    . VAL B  2 1017 ? 101.741 112.483 184.664 1.00 372.35 ? 1017 VAL B CB    1 
ATOM   8455  C  CG1   . VAL B  2 1017 ? 102.065 113.657 185.575 1.00 367.30 ? 1017 VAL B CG1   1 
ATOM   8456  C  CG2   . VAL B  2 1017 ? 102.357 112.687 183.287 1.00 375.11 ? 1017 VAL B CG2   1 
ATOM   8457  N  N     . PHE B  2 1018 ? 100.499 110.570 186.894 1.00 374.08 ? 1018 PHE B N     1 
ATOM   8458  C  CA    . PHE B  2 1018 ? 99.944  110.389 188.232 1.00 372.60 ? 1018 PHE B CA    1 
ATOM   8459  C  C     . PHE B  2 1018 ? 100.744 109.363 189.029 1.00 372.18 ? 1018 PHE B C     1 
ATOM   8460  O  O     . PHE B  2 1018 ? 101.105 109.604 190.189 1.00 372.11 ? 1018 PHE B O     1 
ATOM   8461  C  CB    . PHE B  2 1018 ? 98.475  109.972 188.123 1.00 373.69 ? 1018 PHE B CB    1 
ATOM   8462  C  CG    . PHE B  2 1018 ? 97.869  109.527 189.422 1.00 375.72 ? 1018 PHE B CG    1 
ATOM   8463  C  CD1   . PHE B  2 1018 ? 97.396  110.456 190.331 1.00 374.39 ? 1018 PHE B CD1   1 
ATOM   8464  C  CD2   . PHE B  2 1018 ? 97.758  108.179 189.727 1.00 377.50 ? 1018 PHE B CD2   1 
ATOM   8465  C  CE1   . PHE B  2 1018 ? 96.836  110.051 191.527 1.00 373.05 ? 1018 PHE B CE1   1 
ATOM   8466  C  CE2   . PHE B  2 1018 ? 97.198  107.767 190.921 1.00 376.33 ? 1018 PHE B CE2   1 
ATOM   8467  C  CZ    . PHE B  2 1018 ? 96.737  108.704 191.823 1.00 373.33 ? 1018 PHE B CZ    1 
ATOM   8468  N  N     . SER B  2 1019 ? 101.035 108.213 188.416 1.00 372.46 ? 1019 SER B N     1 
ATOM   8469  C  CA    . SER B  2 1019 ? 101.770 107.162 189.111 1.00 371.34 ? 1019 SER B CA    1 
ATOM   8470  C  C     . SER B  2 1019 ? 103.190 107.605 189.438 1.00 368.36 ? 1019 SER B C     1 
ATOM   8471  O  O     . SER B  2 1019 ? 103.704 107.307 190.524 1.00 371.18 ? 1019 SER B O     1 
ATOM   8472  C  CB    . SER B  2 1019 ? 101.775 105.888 188.268 1.00 373.36 ? 1019 SER B CB    1 
ATOM   8473  O  OG    . SER B  2 1019 ? 100.458 105.436 188.008 1.00 375.74 ? 1019 SER B OG    1 
ATOM   8474  N  N     . GLN B  2 1020 ? 103.838 108.321 188.514 1.00 372.96 ? 1020 GLN B N     1 
ATOM   8475  C  CA    . GLN B  2 1020 ? 105.178 108.840 188.780 1.00 369.35 ? 1020 GLN B CA    1 
ATOM   8476  C  C     . GLN B  2 1020 ? 105.180 109.764 189.995 1.00 367.38 ? 1020 GLN B C     1 
ATOM   8477  O  O     . GLN B  2 1020 ? 105.995 109.604 190.920 1.00 367.47 ? 1020 GLN B O     1 
ATOM   8478  C  CB    . GLN B  2 1020 ? 105.702 109.574 187.544 1.00 366.97 ? 1020 GLN B CB    1 
ATOM   8479  C  CG    . GLN B  2 1020 ? 106.037 108.686 186.352 1.00 368.82 ? 1020 GLN B CG    1 
ATOM   8480  C  CD    . GLN B  2 1020 ? 107.355 107.951 186.513 1.00 363.46 ? 1020 GLN B CD    1 
ATOM   8481  O  OE1   . GLN B  2 1020 ? 108.129 108.230 187.429 1.00 352.28 ? 1020 GLN B OE1   1 
ATOM   8482  N  NE2   . GLN B  2 1020 ? 107.617 107.005 185.619 1.00 369.95 ? 1020 GLN B NE2   1 
ATOM   8483  N  N     . LEU B  2 1021 ? 104.270 110.744 190.005 1.00 363.65 ? 1021 LEU B N     1 
ATOM   8484  C  CA    . LEU B  2 1021 ? 104.207 111.688 191.118 1.00 362.09 ? 1021 LEU B CA    1 
ATOM   8485  C  C     . LEU B  2 1021 ? 103.916 110.974 192.433 1.00 367.61 ? 1021 LEU B C     1 
ATOM   8486  O  O     . LEU B  2 1021 ? 104.516 111.294 193.467 1.00 370.74 ? 1021 LEU B O     1 
ATOM   8487  C  CB    . LEU B  2 1021 ? 103.148 112.757 190.842 1.00 359.04 ? 1021 LEU B CB    1 
ATOM   8488  C  CG    . LEU B  2 1021 ? 103.364 113.685 189.642 1.00 355.85 ? 1021 LEU B CG    1 
ATOM   8489  C  CD1   . LEU B  2 1021 ? 102.164 114.600 189.430 1.00 355.16 ? 1021 LEU B CD1   1 
ATOM   8490  C  CD2   . LEU B  2 1021 ? 104.624 114.502 189.826 1.00 348.48 ? 1021 LEU B CD2   1 
ATOM   8491  N  N     . LEU B  2 1022 ? 102.999 110.001 192.410 1.00 370.09 ? 1022 LEU B N     1 
ATOM   8492  C  CA    . LEU B  2 1022 ? 102.643 109.285 193.633 1.00 375.04 ? 1022 LEU B CA    1 
ATOM   8493  C  C     . LEU B  2 1022 ? 103.827 108.487 194.170 1.00 376.89 ? 1022 LEU B C     1 
ATOM   8494  O  O     . LEU B  2 1022 ? 104.116 108.512 195.378 1.00 382.31 ? 1022 LEU B O     1 
ATOM   8495  C  CB    . LEU B  2 1022 ? 101.443 108.375 193.362 1.00 377.65 ? 1022 LEU B CB    1 
ATOM   8496  C  CG    . LEU B  2 1022 ? 100.795 107.634 194.530 1.00 384.57 ? 1022 LEU B CG    1 
ATOM   8497  C  CD1   . LEU B  2 1022 ? 100.545 108.580 195.688 1.00 387.77 ? 1022 LEU B CD1   1 
ATOM   8498  C  CD2   . LEU B  2 1022 ? 99.493  106.989 194.079 1.00 385.87 ? 1022 LEU B CD2   1 
ATOM   8499  N  N     . LYS B  2 1023 ? 104.532 107.777 193.281 1.00 381.63 ? 1023 LYS B N     1 
ATOM   8500  C  CA    . LYS B  2 1023 ? 105.719 107.035 193.691 1.00 379.46 ? 1023 LYS B CA    1 
ATOM   8501  C  C     . LYS B  2 1023 ? 106.747 107.958 194.333 1.00 379.97 ? 1023 LYS B C     1 
ATOM   8502  O  O     . LYS B  2 1023 ? 107.306 107.636 195.391 1.00 386.41 ? 1023 LYS B O     1 
ATOM   8503  C  CB    . LYS B  2 1023 ? 106.320 106.301 192.488 1.00 375.68 ? 1023 LYS B CB    1 
ATOM   8504  C  CG    . LYS B  2 1023 ? 107.381 105.245 192.829 1.00 375.52 ? 1023 LYS B CG    1 
ATOM   8505  C  CD    . LYS B  2 1023 ? 108.784 105.842 192.939 1.00 372.16 ? 1023 LYS B CD    1 
ATOM   8506  C  CE    . LYS B  2 1023 ? 109.779 104.855 193.532 1.00 362.10 ? 1023 LYS B CE    1 
ATOM   8507  N  NZ    . LYS B  2 1023 ? 111.056 105.536 193.889 1.00 352.80 ? 1023 LYS B NZ    1 
ATOM   8508  N  N     . HIS B  2 1024 ? 107.008 109.115 193.718 1.00 383.08 ? 1024 HIS B N     1 
ATOM   8509  C  CA    . HIS B  2 1024 ? 108.048 109.971 194.281 1.00 382.79 ? 1024 HIS B CA    1 
ATOM   8510  C  C     . HIS B  2 1024 ? 107.616 110.607 195.595 1.00 395.00 ? 1024 HIS B C     1 
ATOM   8511  O  O     . HIS B  2 1024 ? 108.450 110.805 196.492 1.00 401.20 ? 1024 HIS B O     1 
ATOM   8512  C  CB    . HIS B  2 1024 ? 108.474 111.020 193.267 1.00 363.51 ? 1024 HIS B CB    1 
ATOM   8513  C  CG    . HIS B  2 1024 ? 109.504 110.511 192.317 1.00 348.55 ? 1024 HIS B CG    1 
ATOM   8514  N  ND1   . HIS B  2 1024 ? 109.185 109.707 191.243 1.00 351.37 ? 1024 HIS B ND1   1 
ATOM   8515  C  CD2   . HIS B  2 1024 ? 110.852 110.626 192.321 1.00 334.69 ? 1024 HIS B CD2   1 
ATOM   8516  C  CE1   . HIS B  2 1024 ? 110.292 109.378 190.605 1.00 335.20 ? 1024 HIS B CE1   1 
ATOM   8517  N  NE2   . HIS B  2 1024 ? 111.317 109.926 191.235 1.00 326.89 ? 1024 HIS B NE2   1 
ATOM   8518  N  N     . MET B  2 1025 ? 106.326 110.920 195.741 1.00 373.88 ? 1025 MET B N     1 
ATOM   8519  C  CA    . MET B  2 1025 ? 105.840 111.391 197.032 1.00 378.88 ? 1025 MET B CA    1 
ATOM   8520  C  C     . MET B  2 1025 ? 106.069 110.339 198.112 1.00 385.60 ? 1025 MET B C     1 
ATOM   8521  O  O     . MET B  2 1025 ? 106.545 110.653 199.211 1.00 390.78 ? 1025 MET B O     1 
ATOM   8522  C  CB    . MET B  2 1025 ? 104.360 111.764 196.934 1.00 378.23 ? 1025 MET B CB    1 
ATOM   8523  C  CG    . MET B  2 1025 ? 103.777 112.359 198.212 1.00 379.43 ? 1025 MET B CG    1 
ATOM   8524  S  SD    . MET B  2 1025 ? 102.054 112.878 198.056 1.00 388.40 ? 1025 MET B SD    1 
ATOM   8525  C  CE    . MET B  2 1025 ? 101.750 113.578 199.678 1.00 390.10 ? 1025 MET B CE    1 
ATOM   8526  N  N     . VAL B  2 1026 ? 105.757 109.075 197.806 1.00 374.95 ? 1026 VAL B N     1 
ATOM   8527  C  CA    . VAL B  2 1026 ? 106.003 108.001 198.768 1.00 382.02 ? 1026 VAL B CA    1 
ATOM   8528  C  C     . VAL B  2 1026 ? 107.486 107.917 199.114 1.00 385.05 ? 1026 VAL B C     1 
ATOM   8529  O  O     . VAL B  2 1026 ? 107.860 107.770 200.287 1.00 390.54 ? 1026 VAL B O     1 
ATOM   8530  C  CB    . VAL B  2 1026 ? 105.470 106.661 198.223 1.00 383.85 ? 1026 VAL B CB    1 
ATOM   8531  C  CG1   . VAL B  2 1026 ? 105.876 105.508 199.132 1.00 400.18 ? 1026 VAL B CG1   1 
ATOM   8532  C  CG2   . VAL B  2 1026 ? 103.957 106.711 198.072 1.00 384.70 ? 1026 VAL B CG2   1 
ATOM   8533  N  N     . LEU B  2 1027 ? 108.354 108.025 198.102 1.00 376.74 ? 1027 LEU B N     1 
ATOM   8534  C  CA    . LEU B  2 1027 ? 109.789 107.868 198.333 1.00 378.70 ? 1027 LEU B CA    1 
ATOM   8535  C  C     . LEU B  2 1027 ? 110.336 108.970 199.232 1.00 383.40 ? 1027 LEU B C     1 
ATOM   8536  O  O     . LEU B  2 1027 ? 111.132 108.706 200.140 1.00 388.07 ? 1027 LEU B O     1 
ATOM   8537  C  CB    . LEU B  2 1027 ? 110.549 107.839 197.005 1.00 374.19 ? 1027 LEU B CB    1 
ATOM   8538  C  CG    . LEU B  2 1027 ? 112.080 107.914 197.105 1.00 376.84 ? 1027 LEU B CG    1 
ATOM   8539  C  CD1   . LEU B  2 1027 ? 112.651 106.785 197.961 1.00 381.92 ? 1027 LEU B CD1   1 
ATOM   8540  C  CD2   . LEU B  2 1027 ? 112.712 107.906 195.722 1.00 372.77 ? 1027 LEU B CD2   1 
ATOM   8541  N  N     . VAL B  2 1028 ? 109.942 110.220 198.986 1.00 374.50 ? 1028 VAL B N     1 
ATOM   8542  C  CA    . VAL B  2 1028 ? 110.443 111.295 199.840 1.00 375.06 ? 1028 VAL B CA    1 
ATOM   8543  C  C     . VAL B  2 1028 ? 109.853 111.181 201.246 1.00 382.16 ? 1028 VAL B C     1 
ATOM   8544  O  O     . VAL B  2 1028 ? 110.546 111.419 202.247 1.00 386.80 ? 1028 VAL B O     1 
ATOM   8545  C  CB    . VAL B  2 1028 ? 110.172 112.673 199.205 1.00 369.04 ? 1028 VAL B CB    1 
ATOM   8546  C  CG1   . VAL B  2 1028 ? 108.704 112.851 198.875 1.00 368.60 ? 1028 VAL B CG1   1 
ATOM   8547  C  CG2   . VAL B  2 1028 ? 110.641 113.781 200.130 1.00 365.56 ? 1028 VAL B CG2   1 
ATOM   8548  N  N     . ALA B  2 1029 ? 108.578 110.789 201.347 1.00 371.07 ? 1029 ALA B N     1 
ATOM   8549  C  CA    . ALA B  2 1029 ? 107.932 110.745 202.654 1.00 377.95 ? 1029 ALA B CA    1 
ATOM   8550  C  C     . ALA B  2 1029 ? 108.543 109.673 203.546 1.00 383.93 ? 1029 ALA B C     1 
ATOM   8551  O  O     . ALA B  2 1029 ? 108.736 109.899 204.748 1.00 387.93 ? 1029 ALA B O     1 
ATOM   8552  C  CB    . ALA B  2 1029 ? 106.431 110.515 202.492 1.00 378.20 ? 1029 ALA B CB    1 
ATOM   8553  N  N     . ILE B  2 1030 ? 108.847 108.496 202.987 1.00 368.58 ? 1030 ILE B N     1 
ATOM   8554  C  CA    . ILE B  2 1030 ? 109.402 107.427 203.817 1.00 375.51 ? 1030 ILE B CA    1 
ATOM   8555  C  C     . ILE B  2 1030 ? 110.765 107.831 204.362 1.00 374.30 ? 1030 ILE B C     1 
ATOM   8556  O  O     . ILE B  2 1030 ? 111.086 107.568 205.527 1.00 378.90 ? 1030 ILE B O     1 
ATOM   8557  C  CB    . ILE B  2 1030 ? 109.465 106.098 203.037 1.00 376.66 ? 1030 ILE B CB    1 
ATOM   8558  C  CG1   . ILE B  2 1030 ? 110.126 105.014 203.887 1.00 388.35 ? 1030 ILE B CG1   1 
ATOM   8559  C  CG2   . ILE B  2 1030 ? 110.226 106.251 201.738 1.00 367.12 ? 1030 ILE B CG2   1 
ATOM   8560  C  CD1   . ILE B  2 1030 ? 110.365 103.729 203.134 1.00 395.60 ? 1030 ILE B CD1   1 
ATOM   8561  N  N     . ASP B  2 1031 ? 111.576 108.502 203.540 1.00 376.51 ? 1031 ASP B N     1 
ATOM   8562  C  CA    . ASP B  2 1031 ? 112.886 108.942 204.002 1.00 374.91 ? 1031 ASP B CA    1 
ATOM   8563  C  C     . ASP B  2 1031 ? 112.762 110.017 205.077 1.00 373.09 ? 1031 ASP B C     1 
ATOM   8564  O  O     . ASP B  2 1031 ? 113.504 109.996 206.066 1.00 368.55 ? 1031 ASP B O     1 
ATOM   8565  C  CB    . ASP B  2 1031 ? 113.721 109.438 202.819 1.00 369.82 ? 1031 ASP B CB    1 
ATOM   8566  C  CG    . ASP B  2 1031 ? 113.953 108.356 201.770 1.00 370.26 ? 1031 ASP B CG    1 
ATOM   8567  O  OD1   . ASP B  2 1031 ? 113.411 107.241 201.918 1.00 375.22 ? 1031 ASP B OD1   1 
ATOM   8568  O  OD2   . ASP B  2 1031 ? 114.683 108.625 200.791 1.00 373.51 ? 1031 ASP B OD2   1 
ATOM   8569  N  N     . TYR B  2 1032 ? 111.824 110.958 204.918 1.00 364.31 ? 1032 TYR B N     1 
ATOM   8570  C  CA    . TYR B  2 1032 ? 111.661 111.992 205.944 1.00 364.21 ? 1032 TYR B CA    1 
ATOM   8571  C  C     . TYR B  2 1032 ? 111.189 111.390 207.266 1.00 365.08 ? 1032 TYR B C     1 
ATOM   8572  O  O     . TYR B  2 1032 ? 111.688 111.745 208.345 1.00 360.76 ? 1032 TYR B O     1 
ATOM   8573  C  CB    . TYR B  2 1032 ? 110.687 113.065 205.462 1.00 366.00 ? 1032 TYR B CB    1 
ATOM   8574  N  N     . TRP B  2 1033 ? 110.213 110.479 207.197 1.00 354.38 ? 1033 TRP B N     1 
ATOM   8575  C  CA    . TRP B  2 1033 ? 109.734 109.789 208.390 1.00 357.61 ? 1033 TRP B CA    1 
ATOM   8576  C  C     . TRP B  2 1033 ? 110.858 109.009 209.064 1.00 351.32 ? 1033 TRP B C     1 
ATOM   8577  O  O     . TRP B  2 1033 ? 111.014 109.060 210.291 1.00 348.75 ? 1033 TRP B O     1 
ATOM   8578  C  CB    . TRP B  2 1033 ? 108.585 108.856 208.005 1.00 368.47 ? 1033 TRP B CB    1 
ATOM   8579  C  CG    . TRP B  2 1033 ? 107.542 108.655 209.058 1.00 378.49 ? 1033 TRP B CG    1 
ATOM   8580  C  CD1   . TRP B  2 1033 ? 107.737 108.198 210.327 1.00 382.01 ? 1033 TRP B CD1   1 
ATOM   8581  C  CD2   . TRP B  2 1033 ? 106.130 108.870 208.920 1.00 382.73 ? 1033 TRP B CD2   1 
ATOM   8582  N  NE1   . TRP B  2 1033 ? 106.537 108.130 210.995 1.00 387.13 ? 1033 TRP B NE1   1 
ATOM   8583  C  CE2   . TRP B  2 1033 ? 105.536 108.537 210.151 1.00 387.61 ? 1033 TRP B CE2   1 
ATOM   8584  C  CE3   . TRP B  2 1033 ? 105.314 109.320 207.876 1.00 383.80 ? 1033 TRP B CE3   1 
ATOM   8585  C  CZ2   . TRP B  2 1033 ? 104.161 108.639 210.369 1.00 391.54 ? 1033 TRP B CZ2   1 
ATOM   8586  C  CZ3   . TRP B  2 1033 ? 103.949 109.420 208.094 1.00 388.79 ? 1033 TRP B CZ3   1 
ATOM   8587  C  CH2   . TRP B  2 1033 ? 103.387 109.081 209.332 1.00 391.21 ? 1033 TRP B CH2   1 
ATOM   8588  N  N     . LEU B  2 1034 ? 111.653 108.278 208.275 1.00 362.44 ? 1034 LEU B N     1 
ATOM   8589  C  CA    . LEU B  2 1034 ? 112.768 107.525 208.836 1.00 358.79 ? 1034 LEU B CA    1 
ATOM   8590  C  C     . LEU B  2 1034 ? 113.790 108.453 209.481 1.00 350.73 ? 1034 LEU B C     1 
ATOM   8591  O  O     . LEU B  2 1034 ? 114.378 108.114 210.512 1.00 348.29 ? 1034 LEU B O     1 
ATOM   8592  C  CB    . LEU B  2 1034 ? 113.421 106.666 207.746 1.00 360.17 ? 1034 LEU B CB    1 
ATOM   8593  C  CG    . LEU B  2 1034 ? 114.566 105.691 208.059 1.00 354.08 ? 1034 LEU B CG    1 
ATOM   8594  C  CD1   . LEU B  2 1034 ? 114.581 104.563 207.033 1.00 363.63 ? 1034 LEU B CD1   1 
ATOM   8595  C  CD2   . LEU B  2 1034 ? 115.917 106.392 208.070 1.00 338.56 ? 1034 LEU B CD2   1 
ATOM   8596  N  N     . ALA B  2 1035 ? 114.019 109.625 208.886 1.00 359.21 ? 1035 ALA B N     1 
ATOM   8597  C  CA    . ALA B  2 1035 ? 114.948 110.582 209.480 1.00 352.74 ? 1035 ALA B CA    1 
ATOM   8598  C  C     . ALA B  2 1035 ? 114.449 111.056 210.836 1.00 355.03 ? 1035 ALA B C     1 
ATOM   8599  O  O     . ALA B  2 1035 ? 115.203 111.088 211.815 1.00 351.36 ? 1035 ALA B O     1 
ATOM   8600  C  CB    . ALA B  2 1035 ? 115.154 111.770 208.548 1.00 347.56 ? 1035 ALA B CB    1 
ATOM   8601  N  N     . LYS B  2 1036 ? 113.169 111.425 210.912 1.00 352.54 ? 1036 LYS B N     1 
ATOM   8602  C  CA    . LYS B  2 1036 ? 112.614 111.869 212.186 1.00 351.73 ? 1036 LYS B CA    1 
ATOM   8603  C  C     . LYS B  2 1036 ? 112.570 110.737 213.209 1.00 351.07 ? 1036 LYS B C     1 
ATOM   8604  O  O     . LYS B  2 1036 ? 112.539 110.996 214.417 1.00 349.59 ? 1036 LYS B O     1 
ATOM   8605  C  CB    . LYS B  2 1036 ? 111.223 112.458 211.987 1.00 353.21 ? 1036 LYS B CB    1 
ATOM   8606  N  N     . TRP B  2 1037 ? 112.544 109.483 212.754 1.00 359.67 ? 1037 TRP B N     1 
ATOM   8607  C  CA    . TRP B  2 1037 ? 112.530 108.373 213.704 1.00 359.67 ? 1037 TRP B CA    1 
ATOM   8608  C  C     . TRP B  2 1037 ? 113.932 108.017 214.188 1.00 359.67 ? 1037 TRP B C     1 
ATOM   8609  O  O     . TRP B  2 1037 ? 114.106 107.620 215.345 1.00 359.67 ? 1037 TRP B O     1 
ATOM   8610  C  CB    . TRP B  2 1037 ? 111.865 107.150 213.082 1.00 359.67 ? 1037 TRP B CB    1 
ATOM   8611  C  CG    . TRP B  2 1037 ? 111.808 105.982 214.017 1.00 359.67 ? 1037 TRP B CG    1 
ATOM   8612  C  CD1   . TRP B  2 1037 ? 110.791 105.663 214.866 1.00 359.67 ? 1037 TRP B CD1   1 
ATOM   8613  C  CD2   . TRP B  2 1037 ? 112.819 104.982 214.210 1.00 359.67 ? 1037 TRP B CD2   1 
ATOM   8614  N  NE1   . TRP B  2 1037 ? 111.099 104.523 215.569 1.00 359.67 ? 1037 TRP B NE1   1 
ATOM   8615  C  CE2   . TRP B  2 1037 ? 112.341 104.087 215.186 1.00 359.67 ? 1037 TRP B CE2   1 
ATOM   8616  C  CE3   . TRP B  2 1037 ? 114.082 104.757 213.649 1.00 359.67 ? 1037 TRP B CE3   1 
ATOM   8617  C  CZ2   . TRP B  2 1037 ? 113.079 102.982 215.613 1.00 359.67 ? 1037 TRP B CZ2   1 
ATOM   8618  C  CZ3   . TRP B  2 1037 ? 114.813 103.663 214.075 1.00 359.67 ? 1037 TRP B CZ3   1 
ATOM   8619  C  CH2   . TRP B  2 1037 ? 114.311 102.788 215.048 1.00 359.67 ? 1037 TRP B CH2   1 
ATOM   8620  N  N     . THR B  2 1038 ? 114.937 108.129 213.315 1.00 364.73 ? 1038 THR B N     1 
ATOM   8621  C  CA    . THR B  2 1038 ? 116.257 107.590 213.626 1.00 359.82 ? 1038 THR B CA    1 
ATOM   8622  C  C     . THR B  2 1038 ? 116.934 108.364 214.745 1.00 356.89 ? 1038 THR B C     1 
ATOM   8623  O  O     . THR B  2 1038 ? 117.556 107.766 215.631 1.00 354.15 ? 1038 THR B O     1 
ATOM   8624  C  CB    . THR B  2 1038 ? 117.140 107.593 212.378 1.00 352.10 ? 1038 THR B CB    1 
ATOM   8625  O  OG1   . THR B  2 1038 ? 116.751 108.665 211.512 1.00 354.87 ? 1038 THR B OG1   1 
ATOM   8626  C  CG2   . THR B  2 1038 ? 117.024 106.273 211.636 1.00 351.31 ? 1038 THR B CG2   1 
ATOM   8627  N  N     . ASP B  2 1039 ? 116.836 109.693 214.723 1.00 360.66 ? 1039 ASP B N     1 
ATOM   8628  C  CA    . ASP B  2 1039 ? 117.499 110.494 215.740 1.00 361.58 ? 1039 ASP B CA    1 
ATOM   8629  C  C     . ASP B  2 1039 ? 116.902 110.303 217.131 1.00 361.65 ? 1039 ASP B C     1 
ATOM   8630  O  O     . ASP B  2 1039 ? 117.445 110.853 218.096 1.00 362.45 ? 1039 ASP B O     1 
ATOM   8631  C  CB    . ASP B  2 1039 ? 117.458 111.972 215.345 1.00 360.31 ? 1039 ASP B CB    1 
ATOM   8632  C  CG    . ASP B  2 1039 ? 116.052 112.467 215.086 1.00 363.76 ? 1039 ASP B CG    1 
ATOM   8633  O  OD1   . ASP B  2 1039 ? 115.102 111.675 215.252 1.00 365.64 ? 1039 ASP B OD1   1 
ATOM   8634  O  OD2   . ASP B  2 1039 ? 115.894 113.648 214.716 1.00 363.05 ? 1039 ASP B OD2   1 
ATOM   8635  N  N     . SER B  2 1040 ? 115.814 109.547 217.259 1.00 365.56 ? 1040 SER B N     1 
ATOM   8636  C  CA    . SER B  2 1040 ? 115.231 109.248 218.565 1.00 365.98 ? 1040 SER B CA    1 
ATOM   8637  C  C     . SER B  2 1040 ? 116.094 108.256 219.339 1.00 361.62 ? 1040 SER B C     1 
ATOM   8638  O  O     . SER B  2 1040 ? 115.583 107.300 219.924 1.00 357.59 ? 1040 SER B O     1 
ATOM   8639  C  CB    . SER B  2 1040 ? 113.812 108.694 218.417 1.00 373.16 ? 1040 SER B CB    1 
ATOM   8640  O  OG    . SER B  2 1040 ? 113.248 108.394 219.684 1.00 379.61 ? 1040 SER B OG    1 
ATOM   8641  N  N     . ASP B  2 1060 ? 105.852 104.278 220.607 1.00 383.08 ? 1060 ASP B N     1 
ATOM   8642  C  CA    . ASP B  2 1060 ? 105.227 103.994 219.322 1.00 385.46 ? 1060 ASP B CA    1 
ATOM   8643  C  C     . ASP B  2 1060 ? 106.237 103.428 218.328 1.00 388.32 ? 1060 ASP B C     1 
ATOM   8644  O  O     . ASP B  2 1060 ? 106.188 103.739 217.138 1.00 393.34 ? 1060 ASP B O     1 
ATOM   8645  C  CB    . ASP B  2 1060 ? 104.577 105.258 218.752 1.00 385.13 ? 1060 ASP B CB    1 
ATOM   8646  C  CG    . ASP B  2 1060 ? 105.545 106.422 218.656 1.00 379.08 ? 1060 ASP B CG    1 
ATOM   8647  O  OD1   . ASP B  2 1060 ? 106.734 106.246 219.000 1.00 377.53 ? 1060 ASP B OD1   1 
ATOM   8648  O  OD2   . ASP B  2 1060 ? 105.117 107.519 218.241 1.00 376.00 ? 1060 ASP B OD2   1 
ATOM   8649  N  N     . GLN B  2 1061 ? 107.158 102.599 218.829 1.00 382.34 ? 1061 GLN B N     1 
ATOM   8650  C  CA    . GLN B  2 1061 ? 108.154 101.987 217.955 1.00 383.99 ? 1061 GLN B CA    1 
ATOM   8651  C  C     . GLN B  2 1061 ? 107.509 101.005 216.982 1.00 388.65 ? 1061 GLN B C     1 
ATOM   8652  O  O     . GLN B  2 1061 ? 107.859 100.976 215.796 1.00 392.45 ? 1061 GLN B O     1 
ATOM   8653  C  CB    . GLN B  2 1061 ? 109.234 101.290 218.786 1.00 381.08 ? 1061 GLN B CB    1 
ATOM   8654  C  CG    . GLN B  2 1061 ? 110.250 102.229 219.432 1.00 378.06 ? 1061 GLN B CG    1 
ATOM   8655  C  CD    . GLN B  2 1061 ? 109.755 102.845 220.728 1.00 377.32 ? 1061 GLN B CD    1 
ATOM   8656  O  OE1   . GLN B  2 1061 ? 108.740 102.427 221.281 1.00 377.81 ? 1061 GLN B OE1   1 
ATOM   8657  N  NE2   . GLN B  2 1061 ? 110.478 103.846 221.220 1.00 376.13 ? 1061 GLN B NE2   1 
ATOM   8658  N  N     . SER B  2 1062 ? 106.565 100.188 217.466 1.00 385.46 ? 1062 SER B N     1 
ATOM   8659  C  CA    . SER B  2 1062 ? 105.846 99.280  216.577 1.00 389.55 ? 1062 SER B CA    1 
ATOM   8660  C  C     . SER B  2 1062 ? 105.034 100.044 215.543 1.00 392.97 ? 1062 SER B C     1 
ATOM   8661  O  O     . SER B  2 1062 ? 104.872 99.576  214.408 1.00 399.02 ? 1062 SER B O     1 
ATOM   8662  C  CB    . SER B  2 1062 ? 104.936 98.357  217.386 1.00 391.38 ? 1062 SER B CB    1 
ATOM   8663  O  OG    . SER B  2 1062 ? 105.686 97.556  218.281 1.00 388.90 ? 1062 SER B OG    1 
ATOM   8664  N  N     . VAL B  2 1063 ? 104.519 101.217 215.915 1.00 390.95 ? 1063 VAL B N     1 
ATOM   8665  C  CA    . VAL B  2 1063 ? 103.799 102.056 214.963 1.00 391.44 ? 1063 VAL B CA    1 
ATOM   8666  C  C     . VAL B  2 1063 ? 104.706 102.425 213.794 1.00 394.54 ? 1063 VAL B C     1 
ATOM   8667  O  O     . VAL B  2 1063 ? 104.339 102.263 212.624 1.00 403.57 ? 1063 VAL B O     1 
ATOM   8668  C  CB    . VAL B  2 1063 ? 103.246 103.308 215.668 1.00 386.91 ? 1063 VAL B CB    1 
ATOM   8669  C  CG1   . VAL B  2 1063 ? 102.362 104.102 214.719 1.00 389.11 ? 1063 VAL B CG1   1 
ATOM   8670  C  CG2   . VAL B  2 1063 ? 102.480 102.913 216.922 1.00 385.03 ? 1063 VAL B CG2   1 
ATOM   8671  N  N     . TYR B  2 1064 ? 105.911 102.918 214.097 1.00 386.19 ? 1064 TYR B N     1 
ATOM   8672  C  CA    . TYR B  2 1064 ? 106.854 103.264 213.040 1.00 386.29 ? 1064 TYR B CA    1 
ATOM   8673  C  C     . TYR B  2 1064 ? 107.273 102.036 212.247 1.00 389.04 ? 1064 TYR B C     1 
ATOM   8674  O  O     . TYR B  2 1064 ? 107.489 102.120 211.033 1.00 394.62 ? 1064 TYR B O     1 
ATOM   8675  C  CB    . TYR B  2 1064 ? 108.087 103.949 213.628 1.00 378.11 ? 1064 TYR B CB    1 
ATOM   8676  C  CG    . TYR B  2 1064 ? 109.283 103.888 212.706 1.00 379.36 ? 1064 TYR B CG    1 
ATOM   8677  C  CD1   . TYR B  2 1064 ? 109.425 104.794 211.664 1.00 381.99 ? 1064 TYR B CD1   1 
ATOM   8678  C  CD2   . TYR B  2 1064 ? 110.265 102.914 212.868 1.00 371.52 ? 1064 TYR B CD2   1 
ATOM   8679  C  CE1   . TYR B  2 1064 ? 110.512 104.736 210.811 1.00 380.94 ? 1064 TYR B CE1   1 
ATOM   8680  C  CE2   . TYR B  2 1064 ? 111.353 102.851 212.020 1.00 372.95 ? 1064 TYR B CE2   1 
ATOM   8681  C  CZ    . TYR B  2 1064 ? 111.472 103.764 210.994 1.00 377.92 ? 1064 TYR B CZ    1 
ATOM   8682  O  OH    . TYR B  2 1064 ? 112.554 103.707 210.146 1.00 377.75 ? 1064 TYR B OH    1 
ATOM   8683  N  N     . ALA B  2 1065 ? 107.429 100.895 212.918 1.00 390.12 ? 1065 ALA B N     1 
ATOM   8684  C  CA    . ALA B  2 1065 ? 107.816 99.682  212.209 1.00 391.60 ? 1065 ALA B CA    1 
ATOM   8685  C  C     . ALA B  2 1065 ? 106.766 99.309  211.170 1.00 398.36 ? 1065 ALA B C     1 
ATOM   8686  O  O     . ALA B  2 1065 ? 107.100 99.007  210.016 1.00 403.56 ? 1065 ALA B O     1 
ATOM   8687  C  CB    . ALA B  2 1065 ? 108.029 98.538  213.199 1.00 386.26 ? 1065 ALA B CB    1 
ATOM   8688  N  N     . MET B  2 1066 ? 105.489 99.355  211.556 1.00 390.97 ? 1066 MET B N     1 
ATOM   8689  C  CA    . MET B  2 1066 ? 104.423 99.052  210.608 1.00 396.73 ? 1066 MET B CA    1 
ATOM   8690  C  C     . MET B  2 1066 ? 104.362 100.089 209.494 1.00 396.51 ? 1066 MET B C     1 
ATOM   8691  O  O     . MET B  2 1066 ? 104.128 99.741  208.330 1.00 398.20 ? 1066 MET B O     1 
ATOM   8692  C  CB    . MET B  2 1066 ? 103.072 98.959  211.323 1.00 401.17 ? 1066 MET B CB    1 
ATOM   8693  C  CG    . MET B  2 1066 ? 101.922 98.555  210.396 1.00 411.12 ? 1066 MET B CG    1 
ATOM   8694  S  SD    . MET B  2 1066 ? 100.287 98.543  211.163 1.00 430.61 ? 1066 MET B SD    1 
ATOM   8695  C  CE    . MET B  2 1066 ? 100.055 100.283 211.521 1.00 418.40 ? 1066 MET B CE    1 
ATOM   8696  N  N     . VAL B  2 1067 ? 104.572 101.369 209.824 1.00 400.42 ? 1067 VAL B N     1 
ATOM   8697  C  CA    . VAL B  2 1067 ? 104.561 102.410 208.796 1.00 399.65 ? 1067 VAL B CA    1 
ATOM   8698  C  C     . VAL B  2 1067 ? 105.668 102.166 207.776 1.00 400.20 ? 1067 VAL B C     1 
ATOM   8699  O  O     . VAL B  2 1067 ? 105.451 102.260 206.561 1.00 402.43 ? 1067 VAL B O     1 
ATOM   8700  C  CB    . VAL B  2 1067 ? 104.679 103.804 209.443 1.00 394.17 ? 1067 VAL B CB    1 
ATOM   8701  C  CG1   . VAL B  2 1067 ? 104.962 104.863 208.387 1.00 391.36 ? 1067 VAL B CG1   1 
ATOM   8702  C  CG2   . VAL B  2 1067 ? 103.408 104.146 210.207 1.00 396.36 ? 1067 VAL B CG2   1 
ATOM   8703  N  N     . PHE B  2 1068 ? 106.868 101.846 208.260 1.00 403.14 ? 1068 PHE B N     1 
ATOM   8704  C  CA    . PHE B  2 1068 ? 108.001 101.585 207.379 1.00 402.79 ? 1068 PHE B CA    1 
ATOM   8705  C  C     . PHE B  2 1068 ? 107.744 100.366 206.498 1.00 404.98 ? 1068 PHE B C     1 
ATOM   8706  O  O     . PHE B  2 1068 ? 107.992 100.402 205.284 1.00 405.29 ? 1068 PHE B O     1 
ATOM   8707  C  CB    . PHE B  2 1068 ? 109.260 101.403 208.234 1.00 399.24 ? 1068 PHE B CB    1 
ATOM   8708  C  CG    . PHE B  2 1068 ? 110.538 101.323 207.452 1.00 396.34 ? 1068 PHE B CG    1 
ATOM   8709  C  CD1   . PHE B  2 1068 ? 110.803 102.213 206.426 1.00 388.79 ? 1068 PHE B CD1   1 
ATOM   8710  C  CD2   . PHE B  2 1068 ? 111.500 100.377 207.781 1.00 394.86 ? 1068 PHE B CD2   1 
ATOM   8711  C  CE1   . PHE B  2 1068 ? 111.993 102.139 205.722 1.00 385.13 ? 1068 PHE B CE1   1 
ATOM   8712  C  CE2   . PHE B  2 1068 ? 112.693 100.298 207.085 1.00 387.46 ? 1068 PHE B CE2   1 
ATOM   8713  C  CZ    . PHE B  2 1068 ? 112.938 101.178 206.051 1.00 388.37 ? 1068 PHE B CZ    1 
ATOM   8714  N  N     . THR B  2 1069 ? 107.219 99.287  207.088 1.00 405.16 ? 1069 THR B N     1 
ATOM   8715  C  CA    . THR B  2 1069 ? 106.932 98.082  206.311 1.00 406.08 ? 1069 THR B CA    1 
ATOM   8716  C  C     . THR B  2 1069 ? 105.835 98.322  205.276 1.00 407.77 ? 1069 THR B C     1 
ATOM   8717  O  O     . THR B  2 1069 ? 105.872 97.736  204.189 1.00 409.15 ? 1069 THR B O     1 
ATOM   8718  C  CB    . THR B  2 1069 ? 106.547 96.933  207.248 1.00 407.45 ? 1069 THR B CB    1 
ATOM   8719  O  OG1   . THR B  2 1069 ? 107.545 96.790  208.267 1.00 404.10 ? 1069 THR B OG1   1 
ATOM   8720  C  CG2   . THR B  2 1069 ? 106.437 95.618  206.481 1.00 409.05 ? 1069 THR B CG2   1 
ATOM   8721  N  N     . LEU B  2 1070 ? 104.862 99.184  205.590 1.00 406.91 ? 1070 LEU B N     1 
ATOM   8722  C  CA    . LEU B  2 1070 ? 103.806 99.505  204.632 1.00 409.10 ? 1070 LEU B CA    1 
ATOM   8723  C  C     . LEU B  2 1070 ? 104.345 100.340 203.476 1.00 407.21 ? 1070 LEU B C     1 
ATOM   8724  O  O     . LEU B  2 1070 ? 104.037 100.070 202.303 1.00 406.98 ? 1070 LEU B O     1 
ATOM   8725  C  CB    . LEU B  2 1070 ? 102.672 100.243 205.347 1.00 412.73 ? 1070 LEU B CB    1 
ATOM   8726  C  CG    . LEU B  2 1070 ? 101.385 100.574 204.590 1.00 416.33 ? 1070 LEU B CG    1 
ATOM   8727  C  CD1   . LEU B  2 1070 ? 100.615 99.307  204.272 1.00 418.39 ? 1070 LEU B CD1   1 
ATOM   8728  C  CD2   . LEU B  2 1070 ? 100.527 101.536 205.398 1.00 421.31 ? 1070 LEU B CD2   1 
ATOM   8729  N  N     . LEU B  2 1071 ? 105.148 101.358 203.788 1.00 414.72 ? 1071 LEU B N     1 
ATOM   8730  C  CA    . LEU B  2 1071 ? 105.697 102.212 202.741 1.00 414.10 ? 1071 LEU B CA    1 
ATOM   8731  C  C     . LEU B  2 1071 ? 106.663 101.455 201.839 1.00 411.59 ? 1071 LEU B C     1 
ATOM   8732  O  O     . LEU B  2 1071 ? 106.747 101.750 200.638 1.00 411.71 ? 1071 LEU B O     1 
ATOM   8733  C  CB    . LEU B  2 1071 ? 106.391 103.424 203.358 1.00 409.85 ? 1071 LEU B CB    1 
ATOM   8734  C  CG    . LEU B  2 1071 ? 105.473 104.385 204.117 1.00 410.43 ? 1071 LEU B CG    1 
ATOM   8735  C  CD1   . LEU B  2 1071 ? 106.282 105.463 204.817 1.00 394.91 ? 1071 LEU B CD1   1 
ATOM   8736  C  CD2   . LEU B  2 1071 ? 104.452 105.002 203.176 1.00 415.44 ? 1071 LEU B CD2   1 
ATOM   8737  N  N     . CYS B  2 1072 ? 107.391 100.473 202.384 1.00 420.20 ? 1072 CYS B N     1 
ATOM   8738  C  CA    . CYS B  2 1072 ? 108.345 99.731  201.564 1.00 416.75 ? 1072 CYS B CA    1 
ATOM   8739  C  C     . CYS B  2 1072 ? 107.668 98.833  200.536 1.00 413.21 ? 1072 CYS B C     1 
ATOM   8740  O  O     . CYS B  2 1072 ? 108.313 98.438  199.560 1.00 411.95 ? 1072 CYS B O     1 
ATOM   8741  C  CB    . CYS B  2 1072 ? 109.272 98.904  202.453 1.00 412.61 ? 1072 CYS B CB    1 
ATOM   8742  S  SG    . CYS B  2 1072 ? 110.506 99.887  203.329 1.00 405.09 ? 1072 CYS B SG    1 
ATOM   8743  N  N     . SER B  2 1073 ? 106.393 98.495  200.734 1.00 411.20 ? 1073 SER B N     1 
ATOM   8744  C  CA    . SER B  2 1073 ? 105.627 97.779  199.720 1.00 408.32 ? 1073 SER B CA    1 
ATOM   8745  C  C     . SER B  2 1073 ? 104.882 98.740  198.801 1.00 403.89 ? 1073 SER B C     1 
ATOM   8746  O  O     . SER B  2 1073 ? 104.757 98.484  197.590 1.00 401.34 ? 1073 SER B O     1 
ATOM   8747  C  CB    . SER B  2 1073 ? 104.641 96.814  200.382 1.00 413.67 ? 1073 SER B CB    1 
ATOM   8748  O  OG    . SER B  2 1073 ? 103.876 96.122  199.411 1.00 419.47 ? 1073 SER B OG    1 
ATOM   8749  N  N     . LEU B  2 1074 ? 104.387 99.849  199.359 1.00 407.43 ? 1074 LEU B N     1 
ATOM   8750  C  CA    . LEU B  2 1074 ? 103.764 100.869 198.524 1.00 404.87 ? 1074 LEU B CA    1 
ATOM   8751  C  C     . LEU B  2 1074 ? 104.728 101.344 197.440 1.00 395.25 ? 1074 LEU B C     1 
ATOM   8752  O  O     . LEU B  2 1074 ? 104.352 101.462 196.264 1.00 394.68 ? 1074 LEU B O     1 
ATOM   8753  C  CB    . LEU B  2 1074 ? 103.294 102.042 199.389 1.00 405.72 ? 1074 LEU B CB    1 
ATOM   8754  C  CG    . LEU B  2 1074 ? 102.048 101.811 200.260 1.00 412.70 ? 1074 LEU B CG    1 
ATOM   8755  C  CD1   . LEU B  2 1074 ? 101.739 103.027 201.128 1.00 415.24 ? 1074 LEU B CD1   1 
ATOM   8756  C  CD2   . LEU B  2 1074 ? 100.834 101.439 199.412 1.00 411.47 ? 1074 LEU B CD2   1 
ATOM   8757  N  N     . GLY B  2 1075 ? 105.983 101.608 197.819 1.00 411.80 ? 1075 GLY B N     1 
ATOM   8758  C  CA    . GLY B  2 1075 ? 106.951 102.115 196.857 1.00 401.88 ? 1075 GLY B CA    1 
ATOM   8759  C  C     . GLY B  2 1075 ? 107.114 101.203 195.655 1.00 395.64 ? 1075 GLY B C     1 
ATOM   8760  O  O     . GLY B  2 1075 ? 107.065 101.653 194.505 1.00 387.28 ? 1075 GLY B O     1 
ATOM   8761  N  N     . ILE B  2 1076 ? 107.278 99.900  195.906 1.00 394.40 ? 1076 ILE B N     1 
ATOM   8762  C  CA    . ILE B  2 1076 ? 107.519 98.961  194.815 1.00 388.35 ? 1076 ILE B CA    1 
ATOM   8763  C  C     . ILE B  2 1076 ? 106.267 98.797  193.959 1.00 383.07 ? 1076 ILE B C     1 
ATOM   8764  O  O     . ILE B  2 1076 ? 106.356 98.712  192.726 1.00 372.18 ? 1076 ILE B O     1 
ATOM   8765  C  CB    . ILE B  2 1076 ? 108.028 97.609  195.355 1.00 394.45 ? 1076 ILE B CB    1 
ATOM   8766  C  CG1   . ILE B  2 1076 ? 106.953 96.857  196.144 1.00 401.18 ? 1076 ILE B CG1   1 
ATOM   8767  C  CG2   . ILE B  2 1076 ? 109.256 97.813  196.229 1.00 392.22 ? 1076 ILE B CG2   1 
ATOM   8768  C  CD1   . ILE B  2 1076 ? 107.382 95.473  196.602 1.00 405.01 ? 1076 ILE B CD1   1 
ATOM   8769  N  N     . VAL B  2 1077 ? 105.085 98.783  194.585 1.00 402.47 ? 1077 VAL B N     1 
ATOM   8770  C  CA    . VAL B  2 1077 ? 103.851 98.699  193.805 1.00 396.13 ? 1077 VAL B CA    1 
ATOM   8771  C  C     . VAL B  2 1077 ? 103.764 99.867  192.828 1.00 385.45 ? 1077 VAL B C     1 
ATOM   8772  O  O     . VAL B  2 1077 ? 103.588 99.682  191.610 1.00 375.90 ? 1077 VAL B O     1 
ATOM   8773  C  CB    . VAL B  2 1077 ? 102.629 98.651  194.742 1.00 402.12 ? 1077 VAL B CB    1 
ATOM   8774  C  CG1   . VAL B  2 1077 ? 101.341 98.832  193.954 1.00 396.79 ? 1077 VAL B CG1   1 
ATOM   8775  C  CG2   . VAL B  2 1077 ? 102.607 97.343  195.507 1.00 407.02 ? 1077 VAL B CG2   1 
ATOM   8776  N  N     . LEU B  2 1078 ? 103.922 101.086 193.348 1.00 404.39 ? 1078 LEU B N     1 
ATOM   8777  C  CA    . LEU B  2 1078 ? 103.762 102.273 192.517 1.00 389.79 ? 1078 LEU B CA    1 
ATOM   8778  C  C     . LEU B  2 1078 ? 104.817 102.329 191.412 1.00 380.96 ? 1078 LEU B C     1 
ATOM   8779  O  O     . LEU B  2 1078 ? 104.499 102.658 190.259 1.00 373.91 ? 1078 LEU B O     1 
ATOM   8780  C  CB    . LEU B  2 1078 ? 103.804 103.532 193.390 1.00 388.14 ? 1078 LEU B CB    1 
ATOM   8781  C  CG    . LEU B  2 1078 ? 102.487 104.015 194.023 1.00 368.11 ? 1078 LEU B CG    1 
ATOM   8782  C  CD1   . LEU B  2 1078 ? 101.407 104.103 192.954 1.00 364.44 ? 1078 LEU B CD1   1 
ATOM   8783  C  CD2   . LEU B  2 1078 ? 102.018 103.165 195.212 1.00 364.52 ? 1078 LEU B CD2   1 
ATOM   8784  N  N     . CYS B  2 1079 ? 106.069 101.973 191.728 1.00 394.02 ? 1079 CYS B N     1 
ATOM   8785  C  CA    . CYS B  2 1079 ? 107.120 102.047 190.713 1.00 387.02 ? 1079 CYS B CA    1 
ATOM   8786  C  C     . CYS B  2 1079 ? 106.905 101.023 189.600 1.00 383.34 ? 1079 CYS B C     1 
ATOM   8787  O  O     . CYS B  2 1079 ? 107.120 101.327 188.413 1.00 378.16 ? 1079 CYS B O     1 
ATOM   8788  C  CB    . CYS B  2 1079 ? 108.492 101.851 191.353 1.00 385.92 ? 1079 CYS B CB    1 
ATOM   8789  S  SG    . CYS B  2 1079 ? 109.843 102.057 190.178 1.00 377.58 ? 1079 CYS B SG    1 
ATOM   8790  N  N     . LEU B  2 1080 ? 106.519 99.795  189.966 1.00 373.08 ? 1080 LEU B N     1 
ATOM   8791  C  CA    . LEU B  2 1080 ? 106.198 98.791  188.957 1.00 372.07 ? 1080 LEU B CA    1 
ATOM   8792  C  C     . LEU B  2 1080 ? 105.088 99.283  188.032 1.00 370.42 ? 1080 LEU B C     1 
ATOM   8793  O  O     . LEU B  2 1080 ? 105.166 99.137  186.801 1.00 368.04 ? 1080 LEU B O     1 
ATOM   8794  C  CB    . LEU B  2 1080 ? 105.802 97.484  189.643 1.00 375.18 ? 1080 LEU B CB    1 
ATOM   8795  C  CG    . LEU B  2 1080 ? 105.037 96.428  188.845 1.00 371.09 ? 1080 LEU B CG    1 
ATOM   8796  C  CD1   . LEU B  2 1080 ? 105.815 96.014  187.617 1.00 376.08 ? 1080 LEU B CD1   1 
ATOM   8797  C  CD2   . LEU B  2 1080 ? 104.734 95.224  189.721 1.00 366.47 ? 1080 LEU B CD2   1 
ATOM   8798  N  N     . VAL B  2 1081 ? 104.042 99.878  188.616 1.00 375.03 ? 1081 VAL B N     1 
ATOM   8799  C  CA    . VAL B  2 1081 ? 102.957 100.412 187.793 1.00 372.36 ? 1081 VAL B CA    1 
ATOM   8800  C  C     . VAL B  2 1081 ? 103.486 101.468 186.829 1.00 369.62 ? 1081 VAL B C     1 
ATOM   8801  O  O     . VAL B  2 1081 ? 103.138 101.473 185.637 1.00 369.13 ? 1081 VAL B O     1 
ATOM   8802  C  CB    . VAL B  2 1081 ? 101.831 100.958 188.689 1.00 375.07 ? 1081 VAL B CB    1 
ATOM   8803  C  CG1   . VAL B  2 1081 ? 100.765 101.636 187.846 1.00 371.28 ? 1081 VAL B CG1   1 
ATOM   8804  C  CG2   . VAL B  2 1081 ? 101.219 99.829  189.503 1.00 381.34 ? 1081 VAL B CG2   1 
ATOM   8805  N  N     . THR B  2 1082 ? 104.347 102.369 187.321 1.00 371.66 ? 1082 THR B N     1 
ATOM   8806  C  CA    . THR B  2 1082 ? 104.909 103.413 186.463 1.00 367.67 ? 1082 THR B CA    1 
ATOM   8807  C  C     . THR B  2 1082 ? 105.624 102.811 185.259 1.00 367.51 ? 1082 THR B C     1 
ATOM   8808  O  O     . THR B  2 1082 ? 105.393 103.221 184.111 1.00 362.36 ? 1082 THR B O     1 
ATOM   8809  C  CB    . THR B  2 1082 ? 105.881 104.299 187.248 1.00 361.06 ? 1082 THR B CB    1 
ATOM   8810  O  OG1   . THR B  2 1082 ? 106.948 103.502 187.782 1.00 363.54 ? 1082 THR B OG1   1 
ATOM   8811  C  CG2   . THR B  2 1082 ? 105.173 105.015 188.381 1.00 359.06 ? 1082 THR B CG2   1 
ATOM   8812  N  N     . SER B  2 1083 ? 106.503 101.839 185.504 1.00 360.08 ? 1083 SER B N     1 
ATOM   8813  C  CA    . SER B  2 1083 ? 107.290 101.275 184.409 1.00 356.96 ? 1083 SER B CA    1 
ATOM   8814  C  C     . SER B  2 1083 ? 106.390 100.612 183.366 1.00 359.36 ? 1083 SER B C     1 
ATOM   8815  O  O     . SER B  2 1083 ? 106.550 100.835 182.152 1.00 358.72 ? 1083 SER B O     1 
ATOM   8816  C  CB    . SER B  2 1083 ? 108.314 100.288 184.966 1.00 355.93 ? 1083 SER B CB    1 
ATOM   8817  O  OG    . SER B  2 1083 ? 109.063 100.894 186.007 1.00 351.46 ? 1083 SER B OG    1 
ATOM   8818  N  N     . VAL B  2 1084 ? 105.428 99.804  183.826 1.00 354.97 ? 1084 VAL B N     1 
ATOM   8819  C  CA    . VAL B  2 1084 ? 104.516 99.139  182.897 1.00 357.64 ? 1084 VAL B CA    1 
ATOM   8820  C  C     . VAL B  2 1084 ? 103.804 100.168 182.021 1.00 360.95 ? 1084 VAL B C     1 
ATOM   8821  O  O     . VAL B  2 1084 ? 103.738 100.032 180.786 1.00 365.72 ? 1084 VAL B O     1 
ATOM   8822  C  CB    . VAL B  2 1084 ? 103.522 98.254  183.674 1.00 357.54 ? 1084 VAL B CB    1 
ATOM   8823  C  CG1   . VAL B  2 1084 ? 102.526 97.601  182.732 1.00 361.44 ? 1084 VAL B CG1   1 
ATOM   8824  C  CG2   . VAL B  2 1084 ? 104.268 97.192  184.468 1.00 357.22 ? 1084 VAL B CG2   1 
ATOM   8825  N  N     . THR B  2 1085 ? 103.286 101.231 182.649 1.00 358.13 ? 1085 THR B N     1 
ATOM   8826  C  CA    . THR B  2 1085 ? 102.543 102.245 181.903 1.00 360.23 ? 1085 THR B CA    1 
ATOM   8827  C  C     . THR B  2 1085 ? 103.420 102.924 180.854 1.00 363.75 ? 1085 THR B C     1 
ATOM   8828  O  O     . THR B  2 1085 ? 102.979 103.159 179.718 1.00 369.50 ? 1085 THR B O     1 
ATOM   8829  C  CB    . THR B  2 1085 ? 101.960 103.277 182.871 1.00 355.91 ? 1085 THR B CB    1 
ATOM   8830  O  OG1   . THR B  2 1085 ? 101.078 102.624 183.794 1.00 356.36 ? 1085 THR B OG1   1 
ATOM   8831  C  CG2   . THR B  2 1085 ? 101.191 104.354 182.118 1.00 355.35 ? 1085 THR B CG2   1 
ATOM   8832  N  N     . VAL B  2 1086 ? 104.668 103.243 181.213 1.00 349.20 ? 1086 VAL B N     1 
ATOM   8833  C  CA    . VAL B  2 1086 ? 105.564 103.913 180.269 1.00 349.43 ? 1086 VAL B CA    1 
ATOM   8834  C  C     . VAL B  2 1086 ? 105.778 103.046 179.030 1.00 356.87 ? 1086 VAL B C     1 
ATOM   8835  O  O     . VAL B  2 1086 ? 105.700 103.527 177.886 1.00 361.02 ? 1086 VAL B O     1 
ATOM   8836  C  CB    . VAL B  2 1086 ? 106.896 104.268 180.952 1.00 333.46 ? 1086 VAL B CB    1 
ATOM   8837  C  CG1   . VAL B  2 1086 ? 107.877 104.854 179.947 1.00 323.57 ? 1086 VAL B CG1   1 
ATOM   8838  C  CG2   . VAL B  2 1086 ? 106.656 105.245 182.088 1.00 329.14 ? 1086 VAL B CG2   1 
ATOM   8839  N  N     . GLU B  2 1087 ? 106.049 101.753 179.239 1.00 329.95 ? 1087 GLU B N     1 
ATOM   8840  C  CA    . GLU B  2 1087 ? 106.291 100.885 178.086 1.00 337.85 ? 1087 GLU B CA    1 
ATOM   8841  C  C     . GLU B  2 1087 ? 105.057 100.792 177.192 1.00 343.59 ? 1087 GLU B C     1 
ATOM   8842  O  O     . GLU B  2 1087 ? 105.163 100.847 175.952 1.00 347.97 ? 1087 GLU B O     1 
ATOM   8843  C  CB    . GLU B  2 1087 ? 106.737 99.500  178.553 1.00 339.29 ? 1087 GLU B CB    1 
ATOM   8844  C  CG    . GLU B  2 1087 ? 108.048 99.503  179.336 1.00 346.71 ? 1087 GLU B CG    1 
ATOM   8845  C  CD    . GLU B  2 1087 ? 109.253 99.912  178.499 1.00 346.27 ? 1087 GLU B CD    1 
ATOM   8846  O  OE1   . GLU B  2 1087 ? 109.134 99.998  177.258 1.00 340.95 ? 1087 GLU B OE1   1 
ATOM   8847  O  OE2   . GLU B  2 1087 ? 110.331 100.142 179.090 1.00 351.47 ? 1087 GLU B OE2   1 
ATOM   8848  N  N     . TRP B  2 1088 ? 103.876 100.660 177.803 1.00 335.54 ? 1088 TRP B N     1 
ATOM   8849  C  CA    . TRP B  2 1088 ? 102.646 100.597 177.017 1.00 339.36 ? 1088 TRP B CA    1 
ATOM   8850  C  C     . TRP B  2 1088 ? 102.480 101.844 176.152 1.00 340.84 ? 1088 TRP B C     1 
ATOM   8851  O  O     . TRP B  2 1088 ? 102.167 101.757 174.952 1.00 345.38 ? 1088 TRP B O     1 
ATOM   8852  C  CB    . TRP B  2 1088 ? 101.454 100.418 177.956 1.00 339.24 ? 1088 TRP B CB    1 
ATOM   8853  C  CG    . TRP B  2 1088 ? 100.306 99.695  177.344 1.00 341.85 ? 1088 TRP B CG    1 
ATOM   8854  C  CD1   . TRP B  2 1088 ? 99.157  100.246 176.868 1.00 340.82 ? 1088 TRP B CD1   1 
ATOM   8855  C  CD2   . TRP B  2 1088 ? 100.191 98.279  177.136 1.00 341.58 ? 1088 TRP B CD2   1 
ATOM   8856  N  NE1   . TRP B  2 1088 ? 98.330  99.267  176.377 1.00 340.65 ? 1088 TRP B NE1   1 
ATOM   8857  C  CE2   . TRP B  2 1088 ? 98.939  98.051  176.529 1.00 340.51 ? 1088 TRP B CE2   1 
ATOM   8858  C  CE3   . TRP B  2 1088 ? 101.020 97.185  177.405 1.00 340.46 ? 1088 TRP B CE3   1 
ATOM   8859  C  CZ2   . TRP B  2 1088 ? 98.497  96.773  176.186 1.00 337.39 ? 1088 TRP B CZ2   1 
ATOM   8860  C  CZ3   . TRP B  2 1088 ? 100.578 95.916  177.062 1.00 338.67 ? 1088 TRP B CZ3   1 
ATOM   8861  C  CH2   . TRP B  2 1088 ? 99.329  95.722  176.460 1.00 336.99 ? 1088 TRP B CH2   1 
ATOM   8862  N  N     . THR B  2 1089 ? 102.704 103.019 176.749 1.00 336.07 ? 1089 THR B N     1 
ATOM   8863  C  CA    . THR B  2 1089 ? 102.587 104.278 176.016 1.00 338.16 ? 1089 THR B CA    1 
ATOM   8864  C  C     . THR B  2 1089 ? 103.520 104.304 174.809 1.00 343.77 ? 1089 THR B C     1 
ATOM   8865  O  O     . THR B  2 1089 ? 103.112 104.673 173.694 1.00 350.01 ? 1089 THR B O     1 
ATOM   8866  C  CB    . THR B  2 1089 ? 102.889 105.448 176.956 1.00 334.63 ? 1089 THR B CB    1 
ATOM   8867  O  OG1   . THR B  2 1089 ? 101.932 105.464 178.025 1.00 332.90 ? 1089 THR B OG1   1 
ATOM   8868  C  CG2   . THR B  2 1089 ? 102.841 106.777 176.212 1.00 336.45 ? 1089 THR B CG2   1 
ATOM   8869  N  N     . GLY B  2 1090 ? 104.783 103.919 175.020 1.00 330.42 ? 1090 GLY B N     1 
ATOM   8870  C  CA    . GLY B  2 1090 ? 105.732 103.913 173.915 1.00 335.92 ? 1090 GLY B CA    1 
ATOM   8871  C  C     . GLY B  2 1090 ? 105.271 103.049 172.754 1.00 347.28 ? 1090 GLY B C     1 
ATOM   8872  O  O     . GLY B  2 1090 ? 105.306 103.474 171.588 1.00 353.73 ? 1090 GLY B O     1 
ATOM   8873  N  N     . LEU B  2 1091 ? 104.823 101.825 173.059 1.00 319.42 ? 1091 LEU B N     1 
ATOM   8874  C  CA    . LEU B  2 1091 ? 104.380 100.932 171.989 1.00 324.93 ? 1091 LEU B CA    1 
ATOM   8875  C  C     . LEU B  2 1091 ? 103.220 101.537 171.203 1.00 331.96 ? 1091 LEU B C     1 
ATOM   8876  O  O     . LEU B  2 1091 ? 103.203 101.493 169.957 1.00 338.55 ? 1091 LEU B O     1 
ATOM   8877  C  CB    . LEU B  2 1091 ? 103.976 99.575  172.561 1.00 323.15 ? 1091 LEU B CB    1 
ATOM   8878  C  CG    . LEU B  2 1091 ? 105.082 98.759  173.227 1.00 319.45 ? 1091 LEU B CG    1 
ATOM   8879  C  CD1   . LEU B  2 1091 ? 104.568 97.382  173.624 1.00 315.61 ? 1091 LEU B CD1   1 
ATOM   8880  C  CD2   . LEU B  2 1091 ? 106.289 98.647  172.310 1.00 329.70 ? 1091 LEU B CD2   1 
ATOM   8881  N  N     . LYS B  2 1092 ? 102.231 102.089 171.912 1.00 327.96 ? 1092 LYS B N     1 
ATOM   8882  C  CA    . LYS B  2 1092 ? 101.072 102.647 171.216 1.00 332.38 ? 1092 LYS B CA    1 
ATOM   8883  C  C     . LYS B  2 1092 ? 101.484 103.775 170.279 1.00 335.26 ? 1092 LYS B C     1 
ATOM   8884  O  O     . LYS B  2 1092 ? 101.046 103.829 169.117 1.00 340.91 ? 1092 LYS B O     1 
ATOM   8885  C  CB    . LYS B  2 1092 ? 100.030 103.134 172.216 1.00 327.63 ? 1092 LYS B CB    1 
ATOM   8886  C  CG    . LYS B  2 1092 ? 99.225  102.019 172.850 1.00 330.32 ? 1092 LYS B CG    1 
ATOM   8887  C  CD    . LYS B  2 1092 ? 98.050  102.580 173.618 1.00 327.32 ? 1092 LYS B CD    1 
ATOM   8888  C  CE    . LYS B  2 1092 ? 97.194  101.476 174.208 1.00 327.73 ? 1092 LYS B CE    1 
ATOM   8889  N  NZ    . LYS B  2 1092 ? 96.322  100.843 173.186 1.00 324.93 ? 1092 LYS B NZ    1 
ATOM   8890  N  N     . VAL B  2 1093 ? 102.324 104.692 170.771 1.00 335.07 ? 1093 VAL B N     1 
ATOM   8891  C  CA    . VAL B  2 1093 ? 102.774 105.791 169.921 1.00 335.60 ? 1093 VAL B CA    1 
ATOM   8892  C  C     . VAL B  2 1093 ? 103.440 105.243 168.669 1.00 344.38 ? 1093 VAL B C     1 
ATOM   8893  O  O     . VAL B  2 1093 ? 103.125 105.656 167.542 1.00 351.21 ? 1093 VAL B O     1 
ATOM   8894  C  CB    . VAL B  2 1093 ? 103.721 106.728 170.693 1.00 324.12 ? 1093 VAL B CB    1 
ATOM   8895  C  CG1   . VAL B  2 1093 ? 104.324 107.736 169.739 1.00 312.64 ? 1093 VAL B CG1   1 
ATOM   8896  C  CG2   . VAL B  2 1093 ? 102.975 107.435 171.816 1.00 313.80 ? 1093 VAL B CG2   1 
ATOM   8897  N  N     . ALA B  2 1094 ? 104.357 104.288 168.849 1.00 331.08 ? 1094 ALA B N     1 
ATOM   8898  C  CA    . ALA B  2 1094 ? 105.073 103.718 167.712 1.00 338.97 ? 1094 ALA B CA    1 
ATOM   8899  C  C     . ALA B  2 1094 ? 104.111 103.230 166.637 1.00 350.36 ? 1094 ALA B C     1 
ATOM   8900  O  O     . ALA B  2 1094 ? 104.171 103.670 165.473 1.00 357.16 ? 1094 ALA B O     1 
ATOM   8901  C  CB    . ALA B  2 1094 ? 105.975 102.574 168.182 1.00 340.73 ? 1094 ALA B CB    1 
ATOM   8902  N  N     . LYS B  2 1095 ? 103.192 102.337 167.014 1.00 327.89 ? 1095 LYS B N     1 
ATOM   8903  C  CA    . LYS B  2 1095 ? 102.426 101.701 165.945 1.00 335.54 ? 1095 LYS B CA    1 
ATOM   8904  C  C     . LYS B  2 1095 ? 101.402 102.651 165.324 1.00 340.66 ? 1095 LYS B C     1 
ATOM   8905  O  O     . LYS B  2 1095 ? 101.193 102.612 164.103 1.00 348.18 ? 1095 LYS B O     1 
ATOM   8906  C  CB    . LYS B  2 1095 ? 101.750 100.414 166.439 1.00 336.50 ? 1095 LYS B CB    1 
ATOM   8907  C  CG    . LYS B  2 1095 ? 100.597 100.583 167.389 1.00 339.80 ? 1095 LYS B CG    1 
ATOM   8908  C  CD    . LYS B  2 1095 ? 99.881  99.258  167.596 1.00 342.64 ? 1095 LYS B CD    1 
ATOM   8909  C  CE    . LYS B  2 1095 ? 98.868  99.349  168.723 1.00 350.29 ? 1095 LYS B CE    1 
ATOM   8910  N  NZ    . LYS B  2 1095 ? 97.880  100.438 168.495 1.00 345.54 ? 1095 LYS B NZ    1 
ATOM   8911  N  N     . ARG B  2 1096 ? 100.784 103.539 166.114 1.00 344.27 ? 1096 ARG B N     1 
ATOM   8912  C  CA    . ARG B  2 1096 ? 99.834  104.475 165.517 1.00 345.69 ? 1096 ARG B CA    1 
ATOM   8913  C  C     . ARG B  2 1096 ? 100.538 105.427 164.558 1.00 350.68 ? 1096 ARG B C     1 
ATOM   8914  O  O     . ARG B  2 1096 ? 100.029 105.716 163.465 1.00 357.57 ? 1096 ARG B O     1 
ATOM   8915  C  CB    . ARG B  2 1096 ? 99.083  105.253 166.598 1.00 334.24 ? 1096 ARG B CB    1 
ATOM   8916  C  CG    . ARG B  2 1096 ? 98.076  106.267 166.051 1.00 334.06 ? 1096 ARG B CG    1 
ATOM   8917  C  CD    . ARG B  2 1096 ? 97.086  105.635 165.070 1.00 340.04 ? 1096 ARG B CD    1 
ATOM   8918  N  NE    . ARG B  2 1096 ? 96.103  104.773 165.726 1.00 337.26 ? 1096 ARG B NE    1 
ATOM   8919  C  CZ    . ARG B  2 1096 ? 94.862  105.144 166.034 1.00 330.90 ? 1096 ARG B CZ    1 
ATOM   8920  N  NH1   . ARG B  2 1096 ? 94.443  106.371 165.750 1.00 328.29 ? 1096 ARG B NH1   1 
ATOM   8921  N  NH2   . ARG B  2 1096 ? 94.037  104.289 166.626 1.00 330.56 ? 1096 ARG B NH2   1 
ATOM   8922  N  N     . LEU B  2 1097 ? 101.726 105.911 164.939 1.00 343.74 ? 1097 LEU B N     1 
ATOM   8923  C  CA    . LEU B  2 1097 ? 102.469 106.804 164.058 1.00 347.84 ? 1097 LEU B CA    1 
ATOM   8924  C  C     . LEU B  2 1097 ? 102.837 106.118 162.748 1.00 357.64 ? 1097 LEU B C     1 
ATOM   8925  O  O     . LEU B  2 1097 ? 102.708 106.715 161.671 1.00 363.58 ? 1097 LEU B O     1 
ATOM   8926  C  CB    . LEU B  2 1097 ? 103.724 107.311 164.766 1.00 340.41 ? 1097 LEU B CB    1 
ATOM   8927  C  CG    . LEU B  2 1097 ? 103.628 108.722 165.348 1.00 333.58 ? 1097 LEU B CG    1 
ATOM   8928  C  CD1   . LEU B  2 1097 ? 102.404 108.880 166.243 1.00 332.29 ? 1097 LEU B CD1   1 
ATOM   8929  C  CD2   . LEU B  2 1097 ? 104.896 109.051 166.108 1.00 328.51 ? 1097 LEU B CD2   1 
ATOM   8930  N  N     . HIS B  2 1098 ? 103.281 104.858 162.809 1.00 341.26 ? 1098 HIS B N     1 
ATOM   8931  C  CA    . HIS B  2 1098 ? 103.672 104.191 161.569 1.00 349.66 ? 1098 HIS B CA    1 
ATOM   8932  C  C     . HIS B  2 1098 ? 102.470 103.957 160.656 1.00 352.45 ? 1098 HIS B C     1 
ATOM   8933  O  O     . HIS B  2 1098 ? 102.547 104.178 159.433 1.00 355.96 ? 1098 HIS B O     1 
ATOM   8934  C  CB    . HIS B  2 1098 ? 104.379 102.876 161.867 1.00 353.68 ? 1098 HIS B CB    1 
ATOM   8935  C  CG    . HIS B  2 1098 ? 104.771 102.121 160.639 1.00 361.25 ? 1098 HIS B CG    1 
ATOM   8936  N  ND1   . HIS B  2 1098 ? 103.937 101.210 160.027 1.00 367.31 ? 1098 HIS B ND1   1 
ATOM   8937  C  CD2   . HIS B  2 1098 ? 105.900 102.158 159.892 1.00 361.37 ? 1098 HIS B CD2   1 
ATOM   8938  C  CE1   . HIS B  2 1098 ? 104.538 100.711 158.963 1.00 369.68 ? 1098 HIS B CE1   1 
ATOM   8939  N  NE2   . HIS B  2 1098 ? 105.732 101.267 158.860 1.00 363.98 ? 1098 HIS B NE2   1 
ATOM   8940  N  N     . ARG B  2 1099 ? 101.353 103.485 161.228 1.00 349.94 ? 1099 ARG B N     1 
ATOM   8941  C  CA    . ARG B  2 1099 ? 100.155 103.264 160.423 1.00 353.53 ? 1099 ARG B CA    1 
ATOM   8942  C  C     . ARG B  2 1099 ? 99.671  104.556 159.780 1.00 355.44 ? 1099 ARG B C     1 
ATOM   8943  O  O     . ARG B  2 1099 ? 99.239  104.557 158.622 1.00 359.46 ? 1099 ARG B O     1 
ATOM   8944  C  CB    . ARG B  2 1099 ? 99.044  102.651 161.274 1.00 352.58 ? 1099 ARG B CB    1 
ATOM   8945  C  CG    . ARG B  2 1099 ? 99.164  101.153 161.475 1.00 355.65 ? 1099 ARG B CG    1 
ATOM   8946  C  CD    . ARG B  2 1099 ? 97.915  100.594 162.137 1.00 352.84 ? 1099 ARG B CD    1 
ATOM   8947  N  NE    . ARG B  2 1099 ? 98.001  99.151  162.346 1.00 342.71 ? 1099 ARG B NE    1 
ATOM   8948  C  CZ    . ARG B  2 1099 ? 97.046  98.420  162.916 1.00 337.67 ? 1099 ARG B CZ    1 
ATOM   8949  N  NH1   . ARG B  2 1099 ? 97.211  97.112  163.065 1.00 332.15 ? 1099 ARG B NH1   1 
ATOM   8950  N  NH2   . ARG B  2 1099 ? 95.926  98.996  163.333 1.00 338.93 ? 1099 ARG B NH2   1 
ATOM   8951  N  N     . SER B  2 1100 ? 99.726  105.667 160.519 1.00 356.57 ? 1100 SER B N     1 
ATOM   8952  C  CA    . SER B  2 1100 ? 99.350  106.949 159.935 1.00 358.00 ? 1100 SER B CA    1 
ATOM   8953  C  C     . SER B  2 1100 ? 100.294 107.339 158.802 1.00 359.52 ? 1100 SER B C     1 
ATOM   8954  O  O     . SER B  2 1100 ? 99.848  107.813 157.750 1.00 362.48 ? 1100 SER B O     1 
ATOM   8955  C  CB    . SER B  2 1100 ? 99.331  108.031 161.013 1.00 352.59 ? 1100 SER B CB    1 
ATOM   8956  O  OG    . SER B  2 1100 ? 100.575 108.093 161.688 1.00 345.94 ? 1100 SER B OG    1 
ATOM   8957  N  N     . LEU B  2 1101 ? 101.601 107.139 158.998 1.00 352.75 ? 1101 LEU B N     1 
ATOM   8958  C  CA    . LEU B  2 1101 ? 102.581 107.565 158.001 1.00 355.49 ? 1101 LEU B CA    1 
ATOM   8959  C  C     . LEU B  2 1101 ? 102.373 106.844 156.676 1.00 361.29 ? 1101 LEU B C     1 
ATOM   8960  O  O     . LEU B  2 1101 ? 102.385 107.467 155.603 1.00 363.68 ? 1101 LEU B O     1 
ATOM   8961  C  CB    . LEU B  2 1101 ? 103.997 107.323 158.524 1.00 352.93 ? 1101 LEU B CB    1 
ATOM   8962  C  CG    . LEU B  2 1101 ? 105.157 107.589 157.560 1.00 347.27 ? 1101 LEU B CG    1 
ATOM   8963  C  CD1   . LEU B  2 1101 ? 105.088 108.999 156.994 1.00 334.72 ? 1101 LEU B CD1   1 
ATOM   8964  C  CD2   . LEU B  2 1101 ? 106.483 107.361 158.265 1.00 342.70 ? 1101 LEU B CD2   1 
ATOM   8965  N  N     . LEU B  2 1102 ? 102.183 105.525 156.728 1.00 348.21 ? 1102 LEU B N     1 
ATOM   8966  C  CA    . LEU B  2 1102 ? 102.116 104.784 155.471 1.00 351.57 ? 1102 LEU B CA    1 
ATOM   8967  C  C     . LEU B  2 1102 ? 100.866 105.134 154.671 1.00 352.39 ? 1102 LEU B C     1 
ATOM   8968  O  O     . LEU B  2 1102 ? 100.937 105.316 153.449 1.00 354.53 ? 1102 LEU B O     1 
ATOM   8969  C  CB    . LEU B  2 1102 ? 102.199 103.287 155.735 1.00 355.08 ? 1102 LEU B CB    1 
ATOM   8970  C  CG    . LEU B  2 1102 ? 103.643 102.798 155.746 1.00 363.33 ? 1102 LEU B CG    1 
ATOM   8971  C  CD1   . LEU B  2 1102 ? 103.630 101.299 155.776 1.00 362.94 ? 1102 LEU B CD1   1 
ATOM   8972  C  CD2   . LEU B  2 1102 ? 104.407 103.308 154.529 1.00 375.96 ? 1102 LEU B CD2   1 
ATOM   8973  N  N     . ASN B  2 1103 ? 99.720  105.253 155.336 1.00 347.14 ? 1103 ASN B N     1 
ATOM   8974  C  CA    . ASN B  2 1103 ? 98.498  105.619 154.631 1.00 347.42 ? 1103 ASN B CA    1 
ATOM   8975  C  C     . ASN B  2 1103 ? 98.422  107.104 154.300 1.00 347.03 ? 1103 ASN B C     1 
ATOM   8976  O  O     . ASN B  2 1103 ? 97.575  107.498 153.495 1.00 349.27 ? 1103 ASN B O     1 
ATOM   8977  C  CB    . ASN B  2 1103 ? 97.270  105.200 155.440 1.00 346.43 ? 1103 ASN B CB    1 
ATOM   8978  C  CG    . ASN B  2 1103 ? 96.995  103.709 155.344 1.00 346.20 ? 1103 ASN B CG    1 
ATOM   8979  O  OD1   . ASN B  2 1103 ? 97.494  103.031 154.445 1.00 349.11 ? 1103 ASN B OD1   1 
ATOM   8980  N  ND2   . ASN B  2 1103 ? 96.189  103.194 156.266 1.00 344.84 ? 1103 ASN B ND2   1 
ATOM   8981  N  N     . ARG B  2 1104 ? 99.279  107.937 154.896 1.00 352.77 ? 1104 ARG B N     1 
ATOM   8982  C  CA    . ARG B  2 1104 ? 99.413  109.306 154.415 1.00 350.70 ? 1104 ARG B CA    1 
ATOM   8983  C  C     . ARG B  2 1104 ? 100.246 109.349 153.139 1.00 352.84 ? 1104 ARG B C     1 
ATOM   8984  O  O     . ARG B  2 1104 ? 99.962  110.143 152.232 1.00 350.67 ? 1104 ARG B O     1 
ATOM   8985  C  CB    . ARG B  2 1104 ? 100.021 110.197 155.492 1.00 342.46 ? 1104 ARG B CB    1 
ATOM   8986  N  N     . ILE B  2 1105 ? 101.270 108.494 153.050 1.00 359.03 ? 1105 ILE B N     1 
ATOM   8987  C  CA    . ILE B  2 1105 ? 102.089 108.453 151.839 1.00 361.30 ? 1105 ILE B CA    1 
ATOM   8988  C  C     . ILE B  2 1105 ? 101.341 107.790 150.678 1.00 363.79 ? 1105 ILE B C     1 
ATOM   8989  O  O     . ILE B  2 1105 ? 101.501 108.194 149.522 1.00 362.81 ? 1105 ILE B O     1 
ATOM   8990  C  CB    . ILE B  2 1105 ? 103.427 107.746 152.125 1.00 362.05 ? 1105 ILE B CB    1 
ATOM   8991  C  CG1   . ILE B  2 1105 ? 104.233 108.546 153.147 1.00 355.94 ? 1105 ILE B CG1   1 
ATOM   8992  C  CG2   . ILE B  2 1105 ? 104.240 107.595 150.856 1.00 362.86 ? 1105 ILE B CG2   1 
ATOM   8993  C  CD1   . ILE B  2 1105 ? 104.497 109.967 152.709 1.00 354.57 ? 1105 ILE B CD1   1 
ATOM   8994  N  N     . ILE B  2 1106 ? 100.504 106.787 150.956 1.00 351.40 ? 1106 ILE B N     1 
ATOM   8995  C  CA    . ILE B  2 1106 ? 99.827  106.058 149.880 1.00 353.12 ? 1106 ILE B CA    1 
ATOM   8996  C  C     . ILE B  2 1106 ? 98.801  106.942 149.179 1.00 353.13 ? 1106 ILE B C     1 
ATOM   8997  O  O     . ILE B  2 1106 ? 98.617  106.856 147.956 1.00 355.44 ? 1106 ILE B O     1 
ATOM   8998  C  CB    . ILE B  2 1106 ? 99.190  104.769 150.432 1.00 354.38 ? 1106 ILE B CB    1 
ATOM   8999  C  CG1   . ILE B  2 1106 ? 100.255 103.682 150.566 1.00 355.48 ? 1106 ILE B CG1   1 
ATOM   9000  C  CG2   . ILE B  2 1106 ? 98.031  104.299 149.558 1.00 364.94 ? 1106 ILE B CG2   1 
ATOM   9001  C  CD1   . ILE B  2 1106 ? 100.990 103.385 149.274 1.00 357.95 ? 1106 ILE B CD1   1 
ATOM   9002  N  N     . LEU B  2 1107 ? 98.131  107.816 149.929 1.00 352.34 ? 1107 LEU B N     1 
ATOM   9003  C  CA    . LEU B  2 1107 ? 97.078  108.667 149.389 1.00 351.83 ? 1107 LEU B CA    1 
ATOM   9004  C  C     . LEU B  2 1107 ? 97.614  109.979 148.822 1.00 351.31 ? 1107 LEU B C     1 
ATOM   9005  O  O     . LEU B  2 1107 ? 96.881  110.976 148.778 1.00 350.80 ? 1107 LEU B O     1 
ATOM   9006  C  CB    . LEU B  2 1107 ? 96.027  108.938 150.465 1.00 351.89 ? 1107 LEU B CB    1 
ATOM   9007  C  CG    . LEU B  2 1107 ? 95.391  107.690 151.085 1.00 352.86 ? 1107 LEU B CG    1 
ATOM   9008  C  CD1   . LEU B  2 1107 ? 94.403  108.075 152.176 1.00 353.95 ? 1107 LEU B CD1   1 
ATOM   9009  C  CD2   . LEU B  2 1107 ? 94.716  106.844 150.015 1.00 353.96 ? 1107 LEU B CD2   1 
ATOM   9010  N  N     . ALA B  2 1108 ? 98.902  110.006 148.383 1.00 363.63 ? 1108 ALA B N     1 
ATOM   9011  C  CA    . ALA B  2 1108 ? 99.558  111.186 147.842 1.00 359.43 ? 1108 ALA B CA    1 
ATOM   9012  C  C     . ALA B  2 1108 ? 99.484  111.201 146.317 1.00 358.31 ? 1108 ALA B C     1 
ATOM   9013  O  O     . ALA B  2 1108 ? 99.501  110.143 145.679 1.00 359.40 ? 1108 ALA B O     1 
ATOM   9014  C  CB    . ALA B  2 1108 ? 101.019 111.226 148.278 1.00 355.02 ? 1108 ALA B CB    1 
ATOM   9015  N  N     . PRO B  2 1109 ? 99.397  112.379 145.706 1.00 350.13 ? 1109 PRO B N     1 
ATOM   9016  C  CA    . PRO B  2 1109 ? 99.404  112.460 144.241 1.00 350.25 ? 1109 PRO B CA    1 
ATOM   9017  C  C     . PRO B  2 1109 ? 100.816 112.375 143.682 1.00 347.26 ? 1109 PRO B C     1 
ATOM   9018  O  O     . PRO B  2 1109 ? 101.806 112.630 144.368 1.00 342.52 ? 1109 PRO B O     1 
ATOM   9019  C  CB    . PRO B  2 1109 ? 98.786  113.832 143.965 1.00 349.23 ? 1109 PRO B CB    1 
ATOM   9020  C  CG    . PRO B  2 1109 ? 99.183  114.644 145.149 1.00 346.77 ? 1109 PRO B CG    1 
ATOM   9021  C  CD    . PRO B  2 1109 ? 99.172  113.697 146.327 1.00 349.73 ? 1109 PRO B CD    1 
ATOM   9022  N  N     . MET B  2 1110 ? 100.890 112.020 142.396 1.00 347.87 ? 1110 MET B N     1 
ATOM   9023  C  CA    . MET B  2 1110 ? 102.188 111.795 141.767 1.00 344.39 ? 1110 MET B CA    1 
ATOM   9024  C  C     . MET B  2 1110 ? 103.039 113.061 141.734 1.00 337.86 ? 1110 MET B C     1 
ATOM   9025  O  O     . MET B  2 1110 ? 104.275 112.977 141.745 1.00 333.05 ? 1110 MET B O     1 
ATOM   9026  C  CB    . MET B  2 1110 ? 102.001 111.241 140.355 1.00 351.61 ? 1110 MET B CB    1 
ATOM   9027  C  CG    . MET B  2 1110 ? 101.942 109.727 140.303 1.00 354.70 ? 1110 MET B CG    1 
ATOM   9028  S  SD    . MET B  2 1110 ? 103.408 108.979 141.043 1.00 345.76 ? 1110 MET B SD    1 
ATOM   9029  C  CE    . MET B  2 1110 ? 104.706 109.679 140.022 1.00 338.79 ? 1110 MET B CE    1 
ATOM   9030  N  N     . ARG B  2 1111 ? 102.403 114.234 141.690 1.00 349.20 ? 1111 ARG B N     1 
ATOM   9031  C  CA    . ARG B  2 1111 ? 103.161 115.480 141.728 1.00 348.05 ? 1111 ARG B CA    1 
ATOM   9032  C  C     . ARG B  2 1111 ? 103.960 115.594 143.019 1.00 344.03 ? 1111 ARG B C     1 
ATOM   9033  O  O     . ARG B  2 1111 ? 105.111 116.046 143.012 1.00 341.04 ? 1111 ARG B O     1 
ATOM   9034  C  CB    . ARG B  2 1111 ? 102.225 116.678 141.577 1.00 356.14 ? 1111 ARG B CB    1 
ATOM   9035  C  CG    . ARG B  2 1111 ? 102.941 118.015 141.620 1.00 362.67 ? 1111 ARG B CG    1 
ATOM   9036  C  CD    . ARG B  2 1111 ? 103.106 118.601 140.227 1.00 374.09 ? 1111 ARG B CD    1 
ATOM   9037  N  NE    . ARG B  2 1111 ? 104.042 119.723 140.210 1.00 378.65 ? 1111 ARG B NE    1 
ATOM   9038  C  CZ    . ARG B  2 1111 ? 105.200 119.719 139.559 1.00 382.18 ? 1111 ARG B CZ    1 
ATOM   9039  N  NH1   . ARG B  2 1111 ? 105.991 120.783 139.598 1.00 380.33 ? 1111 ARG B NH1   1 
ATOM   9040  N  NH2   . ARG B  2 1111 ? 105.563 118.655 138.857 1.00 383.46 ? 1111 ARG B NH2   1 
ATOM   9041  N  N     . PHE B  2 1112 ? 103.370 115.171 144.140 1.00 357.50 ? 1112 PHE B N     1 
ATOM   9042  C  CA    . PHE B  2 1112 ? 104.083 115.220 145.411 1.00 353.61 ? 1112 PHE B CA    1 
ATOM   9043  C  C     . PHE B  2 1112 ? 105.234 114.224 145.443 1.00 350.75 ? 1112 PHE B C     1 
ATOM   9044  O  O     . PHE B  2 1112 ? 106.291 114.508 146.017 1.00 347.71 ? 1112 PHE B O     1 
ATOM   9045  C  CB    . PHE B  2 1112 ? 103.116 114.957 146.564 1.00 355.04 ? 1112 PHE B CB    1 
ATOM   9046  C  CG    . PHE B  2 1112 ? 103.799 114.696 147.876 1.00 351.57 ? 1112 PHE B CG    1 
ATOM   9047  C  CD1   . PHE B  2 1112 ? 104.368 115.734 148.594 1.00 350.77 ? 1112 PHE B CD1   1 
ATOM   9048  C  CD2   . PHE B  2 1112 ? 103.869 113.413 148.394 1.00 351.36 ? 1112 PHE B CD2   1 
ATOM   9049  C  CE1   . PHE B  2 1112 ? 104.996 115.499 149.803 1.00 350.59 ? 1112 PHE B CE1   1 
ATOM   9050  C  CE2   . PHE B  2 1112 ? 104.495 113.170 149.604 1.00 350.75 ? 1112 PHE B CE2   1 
ATOM   9051  C  CZ    . PHE B  2 1112 ? 105.060 114.215 150.309 1.00 350.59 ? 1112 PHE B CZ    1 
ATOM   9052  N  N     . PHE B  2 1113 ? 105.053 113.048 144.836 1.00 346.44 ? 1113 PHE B N     1 
ATOM   9053  C  CA    . PHE B  2 1113 ? 106.126 112.059 144.837 1.00 344.78 ? 1113 PHE B CA    1 
ATOM   9054  C  C     . PHE B  2 1113 ? 107.297 112.509 143.977 1.00 341.08 ? 1113 PHE B C     1 
ATOM   9055  O  O     . PHE B  2 1113 ? 108.457 112.323 144.357 1.00 338.75 ? 1113 PHE B O     1 
ATOM   9056  C  CB    . PHE B  2 1113 ? 105.607 110.707 144.360 1.00 349.45 ? 1113 PHE B CB    1 
ATOM   9057  C  CG    . PHE B  2 1113 ? 105.003 109.888 145.448 1.00 353.15 ? 1113 PHE B CG    1 
ATOM   9058  C  CD1   . PHE B  2 1113 ? 105.785 109.421 146.488 1.00 353.60 ? 1113 PHE B CD1   1 
ATOM   9059  C  CD2   . PHE B  2 1113 ? 103.655 109.587 145.437 1.00 358.91 ? 1113 PHE B CD2   1 
ATOM   9060  C  CE1   . PHE B  2 1113 ? 105.232 108.669 147.499 1.00 359.25 ? 1113 PHE B CE1   1 
ATOM   9061  C  CE2   . PHE B  2 1113 ? 103.097 108.833 146.444 1.00 363.86 ? 1113 PHE B CE2   1 
ATOM   9062  C  CZ    . PHE B  2 1113 ? 103.886 108.373 147.476 1.00 364.39 ? 1113 PHE B CZ    1 
ATOM   9063  N  N     . GLU B  2 1114 ? 107.018 113.091 142.810 1.00 353.83 ? 1114 GLU B N     1 
ATOM   9064  C  CA    . GLU B  2 1114 ? 108.113 113.579 141.980 1.00 350.72 ? 1114 GLU B CA    1 
ATOM   9065  C  C     . GLU B  2 1114 ? 108.783 114.797 142.608 1.00 349.90 ? 1114 GLU B C     1 
ATOM   9066  O  O     . GLU B  2 1114 ? 110.014 114.918 142.573 1.00 347.84 ? 1114 GLU B O     1 
ATOM   9067  C  CB    . GLU B  2 1114 ? 107.614 113.907 140.571 1.00 350.56 ? 1114 GLU B CB    1 
ATOM   9068  C  CG    . GLU B  2 1114 ? 108.709 114.450 139.655 1.00 348.14 ? 1114 GLU B CG    1 
ATOM   9069  C  CD    . GLU B  2 1114 ? 108.229 114.731 138.241 1.00 346.21 ? 1114 GLU B CD    1 
ATOM   9070  O  OE1   . GLU B  2 1114 ? 107.064 114.409 137.925 1.00 342.24 ? 1114 GLU B OE1   1 
ATOM   9071  O  OE2   . GLU B  2 1114 ? 109.022 115.277 137.442 1.00 348.68 ? 1114 GLU B OE2   1 
ATOM   9072  N  N     . THR B  2 1115 ? 107.995 115.705 143.190 1.00 346.05 ? 1115 THR B N     1 
ATOM   9073  C  CA    . THR B  2 1115 ? 108.559 116.926 143.760 1.00 343.75 ? 1115 THR B CA    1 
ATOM   9074  C  C     . THR B  2 1115 ? 109.514 116.616 144.907 1.00 341.82 ? 1115 THR B C     1 
ATOM   9075  O  O     . THR B  2 1115 ? 110.649 117.104 144.934 1.00 340.02 ? 1115 THR B O     1 
ATOM   9076  C  CB    . THR B  2 1115 ? 107.435 117.849 144.237 1.00 345.63 ? 1115 THR B CB    1 
ATOM   9077  O  OG1   . THR B  2 1115 ? 106.614 118.230 143.124 1.00 353.85 ? 1115 THR B OG1   1 
ATOM   9078  C  CG2   . THR B  2 1115 ? 108.008 119.099 144.886 1.00 342.59 ? 1115 THR B CG2   1 
ATOM   9079  N  N     . THR B  2 1116 ? 109.071 115.801 145.857 1.00 350.73 ? 1116 THR B N     1 
ATOM   9080  C  CA    . THR B  2 1116 ? 109.843 115.578 147.070 1.00 347.14 ? 1116 THR B CA    1 
ATOM   9081  C  C     . THR B  2 1116 ? 111.082 114.734 146.774 1.00 344.14 ? 1116 THR B C     1 
ATOM   9082  O  O     . THR B  2 1116 ? 111.000 113.741 146.041 1.00 345.48 ? 1116 THR B O     1 
ATOM   9083  C  CB    . THR B  2 1116 ? 108.985 114.887 148.129 1.00 349.49 ? 1116 THR B CB    1 
ATOM   9084  O  OG1   . THR B  2 1116 ? 107.721 115.554 148.229 1.00 353.09 ? 1116 THR B OG1   1 
ATOM   9085  C  CG2   . THR B  2 1116 ? 109.673 114.928 149.487 1.00 347.74 ? 1116 THR B CG2   1 
ATOM   9086  N  N     . PRO B  2 1117 ? 112.242 115.109 147.310 1.00 334.13 ? 1117 PRO B N     1 
ATOM   9087  C  CA    . PRO B  2 1117 ? 113.410 114.223 147.226 1.00 331.67 ? 1117 PRO B CA    1 
ATOM   9088  C  C     . PRO B  2 1117 ? 113.162 112.937 148.002 1.00 329.75 ? 1117 PRO B C     1 
ATOM   9089  O  O     . PRO B  2 1117 ? 112.802 112.964 149.181 1.00 329.61 ? 1117 PRO B O     1 
ATOM   9090  C  CB    . PRO B  2 1117 ? 114.536 115.059 147.848 1.00 330.36 ? 1117 PRO B CB    1 
ATOM   9091  C  CG    . PRO B  2 1117 ? 114.066 116.477 147.741 1.00 331.51 ? 1117 PRO B CG    1 
ATOM   9092  C  CD    . PRO B  2 1117 ? 112.579 116.415 147.901 1.00 333.35 ? 1117 PRO B CD    1 
ATOM   9093  N  N     . LEU B  2 1118 ? 113.358 111.802 147.324 1.00 329.17 ? 1118 LEU B N     1 
ATOM   9094  C  CA    . LEU B  2 1118 ? 113.006 110.512 147.913 1.00 328.55 ? 1118 LEU B CA    1 
ATOM   9095  C  C     . LEU B  2 1118 ? 113.973 110.100 149.018 1.00 328.05 ? 1118 LEU B C     1 
ATOM   9096  O  O     . LEU B  2 1118 ? 113.571 109.410 149.965 1.00 327.95 ? 1118 LEU B O     1 
ATOM   9097  C  CB    . LEU B  2 1118 ? 112.960 109.440 146.825 1.00 326.83 ? 1118 LEU B CB    1 
ATOM   9098  C  CG    . LEU B  2 1118 ? 111.863 109.611 145.773 1.00 327.62 ? 1118 LEU B CG    1 
ATOM   9099  C  CD1   . LEU B  2 1118 ? 111.922 108.491 144.752 1.00 331.06 ? 1118 LEU B CD1   1 
ATOM   9100  C  CD2   . LEU B  2 1118 ? 110.494 109.669 146.435 1.00 327.27 ? 1118 LEU B CD2   1 
ATOM   9101  N  N     . GLY B  2 1119 ? 115.247 110.486 148.904 1.00 326.10 ? 1119 GLY B N     1 
ATOM   9102  C  CA    . GLY B  2 1119 ? 116.197 110.182 149.961 1.00 324.81 ? 1119 GLY B CA    1 
ATOM   9103  C  C     . GLY B  2 1119 ? 115.774 110.755 151.297 1.00 323.94 ? 1119 GLY B C     1 
ATOM   9104  O  O     . GLY B  2 1119 ? 115.894 110.095 152.334 1.00 321.98 ? 1119 GLY B O     1 
ATOM   9105  N  N     . SER B  2 1120 ? 115.257 111.987 151.292 1.00 325.81 ? 1120 SER B N     1 
ATOM   9106  C  CA    . SER B  2 1120 ? 114.754 112.586 152.523 1.00 325.29 ? 1120 SER B CA    1 
ATOM   9107  C  C     . SER B  2 1120 ? 113.584 111.788 153.083 1.00 324.08 ? 1120 SER B C     1 
ATOM   9108  O  O     . SER B  2 1120 ? 113.531 111.522 154.288 1.00 319.79 ? 1120 SER B O     1 
ATOM   9109  C  CB    . SER B  2 1120 ? 114.346 114.039 152.274 1.00 326.46 ? 1120 SER B CB    1 
ATOM   9110  O  OG    . SER B  2 1120 ? 113.265 114.122 151.361 1.00 328.14 ? 1120 SER B OG    1 
ATOM   9111  N  N     . ILE B  2 1121 ? 112.643 111.385 152.221 1.00 316.26 ? 1121 ILE B N     1 
ATOM   9112  C  CA    . ILE B  2 1121 ? 111.493 110.603 152.676 1.00 317.50 ? 1121 ILE B CA    1 
ATOM   9113  C  C     . ILE B  2 1121 ? 111.956 109.321 153.355 1.00 316.45 ? 1121 ILE B C     1 
ATOM   9114  O  O     . ILE B  2 1121 ? 111.555 109.014 154.484 1.00 316.48 ? 1121 ILE B O     1 
ATOM   9115  C  CB    . ILE B  2 1121 ? 110.546 110.296 151.501 1.00 320.06 ? 1121 ILE B CB    1 
ATOM   9116  C  CG1   . ILE B  2 1121 ? 109.865 111.570 151.003 1.00 320.01 ? 1121 ILE B CG1   1 
ATOM   9117  C  CG2   . ILE B  2 1121 ? 109.508 109.264 151.913 1.00 325.07 ? 1121 ILE B CG2   1 
ATOM   9118  C  CD1   . ILE B  2 1121 ? 108.889 111.328 149.872 1.00 321.65 ? 1121 ILE B CD1   1 
ATOM   9119  N  N     . LEU B  2 1122 ? 112.826 108.562 152.682 1.00 317.54 ? 1122 LEU B N     1 
ATOM   9120  C  CA    . LEU B  2 1122 ? 113.248 107.271 153.217 1.00 316.94 ? 1122 LEU B CA    1 
ATOM   9121  C  C     . LEU B  2 1122 ? 114.069 107.423 154.495 1.00 313.84 ? 1122 LEU B C     1 
ATOM   9122  O  O     . LEU B  2 1122 ? 113.881 106.657 155.450 1.00 315.87 ? 1122 LEU B O     1 
ATOM   9123  C  CB    . LEU B  2 1122 ? 114.047 106.498 152.172 1.00 318.33 ? 1122 LEU B CB    1 
ATOM   9124  C  CG    . LEU B  2 1122 ? 114.770 105.297 152.781 1.00 320.58 ? 1122 LEU B CG    1 
ATOM   9125  C  CD1   . LEU B  2 1122 ? 113.775 104.189 153.107 1.00 324.08 ? 1122 LEU B CD1   1 
ATOM   9126  C  CD2   . LEU B  2 1122 ? 115.902 104.805 151.893 1.00 322.89 ? 1122 LEU B CD2   1 
ATOM   9127  N  N     . ASN B  2 1123 ? 115.001 108.382 154.528 1.00 323.74 ? 1123 ASN B N     1 
ATOM   9128  C  CA    . ASN B  2 1123 ? 115.852 108.524 155.705 1.00 319.06 ? 1123 ASN B CA    1 
ATOM   9129  C  C     . ASN B  2 1123 ? 115.054 109.032 156.899 1.00 314.58 ? 1123 ASN B C     1 
ATOM   9130  O  O     . ASN B  2 1123 ? 115.260 108.567 158.025 1.00 311.72 ? 1123 ASN B O     1 
ATOM   9131  C  CB    . ASN B  2 1123 ? 117.032 109.451 155.402 1.00 317.07 ? 1123 ASN B CB    1 
ATOM   9132  C  CG    . ASN B  2 1123 ? 118.166 109.310 156.412 1.00 313.72 ? 1123 ASN B CG    1 
ATOM   9133  O  OD1   . ASN B  2 1123 ? 118.308 108.275 157.065 1.00 311.84 ? 1123 ASN B OD1   1 
ATOM   9134  N  ND2   . ASN B  2 1123 ? 118.981 110.351 156.537 1.00 312.74 ? 1123 ASN B ND2   1 
ATOM   9135  N  N     . ARG B  2 1124 ? 114.140 109.982 156.677 1.00 318.97 ? 1124 ARG B N     1 
ATOM   9136  C  CA    . ARG B  2 1124 ? 113.219 110.393 157.729 1.00 313.76 ? 1124 ARG B CA    1 
ATOM   9137  C  C     . ARG B  2 1124 ? 112.436 109.197 158.243 1.00 316.62 ? 1124 ARG B C     1 
ATOM   9138  O  O     . ARG B  2 1124 ? 112.398 108.939 159.454 1.00 310.83 ? 1124 ARG B O     1 
ATOM   9139  C  CB    . ARG B  2 1124 ? 112.269 111.467 157.198 1.00 311.99 ? 1124 ARG B CB    1 
ATOM   9140  C  CG    . ARG B  2 1124 ? 111.643 112.355 158.259 1.00 312.24 ? 1124 ARG B CG    1 
ATOM   9141  C  CD    . ARG B  2 1124 ? 111.050 113.601 157.629 1.00 313.45 ? 1124 ARG B CD    1 
ATOM   9142  N  NE    . ARG B  2 1124 ? 111.859 114.065 156.505 1.00 311.61 ? 1124 ARG B NE    1 
ATOM   9143  C  CZ    . ARG B  2 1124 ? 112.905 114.879 156.614 1.00 300.31 ? 1124 ARG B CZ    1 
ATOM   9144  N  NH1   . ARG B  2 1124 ? 113.275 115.330 157.803 1.00 293.72 ? 1124 ARG B NH1   1 
ATOM   9145  N  NH2   . ARG B  2 1124 ? 113.578 115.241 155.532 1.00 298.18 ? 1124 ARG B NH2   1 
ATOM   9146  N  N     . PHE B  2 1125 ? 111.828 108.437 157.323 1.00 312.36 ? 1125 PHE B N     1 
ATOM   9147  C  CA    . PHE B  2 1125 ? 111.126 107.211 157.675 1.00 317.35 ? 1125 PHE B CA    1 
ATOM   9148  C  C     . PHE B  2 1125 ? 111.959 106.361 158.635 1.00 316.54 ? 1125 PHE B C     1 
ATOM   9149  O  O     . PHE B  2 1125 ? 111.617 106.212 159.815 1.00 319.77 ? 1125 PHE B O     1 
ATOM   9150  C  CB    . PHE B  2 1125 ? 110.825 106.444 156.390 1.00 323.04 ? 1125 PHE B CB    1 
ATOM   9151  C  CG    . PHE B  2 1125 ? 109.563 105.635 156.433 1.00 326.06 ? 1125 PHE B CG    1 
ATOM   9152  C  CD1   . PHE B  2 1125 ? 109.467 104.535 157.261 1.00 326.05 ? 1125 PHE B CD1   1 
ATOM   9153  C  CD2   . PHE B  2 1125 ? 108.483 105.952 155.621 1.00 329.77 ? 1125 PHE B CD2   1 
ATOM   9154  C  CE1   . PHE B  2 1125 ? 108.324 103.780 157.302 1.00 330.72 ? 1125 PHE B CE1   1 
ATOM   9155  C  CE2   . PHE B  2 1125 ? 107.332 105.200 155.653 1.00 335.24 ? 1125 PHE B CE2   1 
ATOM   9156  C  CZ    . PHE B  2 1125 ? 107.251 104.112 156.497 1.00 334.58 ? 1125 PHE B CZ    1 
ATOM   9157  N  N     . SER B  2 1126 ? 113.110 105.873 158.160 1.00 328.30 ? 1126 SER B N     1 
ATOM   9158  C  CA    . SER B  2 1126 ? 113.875 104.885 158.917 1.00 323.06 ? 1126 SER B CA    1 
ATOM   9159  C  C     . SER B  2 1126 ? 114.410 105.470 160.220 1.00 307.06 ? 1126 SER B C     1 
ATOM   9160  O  O     . SER B  2 1126 ? 114.215 104.887 161.290 1.00 301.50 ? 1126 SER B O     1 
ATOM   9161  C  CB    . SER B  2 1126 ? 115.019 104.327 158.064 1.00 325.68 ? 1126 SER B CB    1 
ATOM   9162  O  OG    . SER B  2 1126 ? 115.790 103.398 158.811 1.00 324.88 ? 1126 SER B OG    1 
ATOM   9163  N  N     . SER B  2 1127 ? 115.087 106.622 160.149 1.00 322.69 ? 1127 SER B N     1 
ATOM   9164  C  CA    . SER B  2 1127 ? 115.708 107.204 161.335 1.00 315.16 ? 1127 SER B CA    1 
ATOM   9165  C  C     . SER B  2 1127 ? 114.671 107.554 162.397 1.00 306.04 ? 1127 SER B C     1 
ATOM   9166  O  O     . SER B  2 1127 ? 114.839 107.218 163.577 1.00 299.02 ? 1127 SER B O     1 
ATOM   9167  C  CB    . SER B  2 1127 ? 116.517 108.441 160.943 1.00 321.39 ? 1127 SER B CB    1 
ATOM   9168  O  OG    . SER B  2 1127 ? 117.097 109.058 162.081 1.00 325.61 ? 1127 SER B OG    1 
ATOM   9169  N  N     . ASP B  2 1128 ? 113.595 108.242 162.000 1.00 328.02 ? 1128 ASP B N     1 
ATOM   9170  C  CA    . ASP B  2 1128 ? 112.572 108.637 162.960 1.00 320.90 ? 1128 ASP B CA    1 
ATOM   9171  C  C     . ASP B  2 1128 ? 111.894 107.427 163.582 1.00 313.72 ? 1128 ASP B C     1 
ATOM   9172  O  O     . ASP B  2 1128 ? 111.687 107.381 164.802 1.00 304.30 ? 1128 ASP B O     1 
ATOM   9173  C  CB    . ASP B  2 1128 ? 111.543 109.530 162.280 1.00 323.60 ? 1128 ASP B CB    1 
ATOM   9174  C  CG    . ASP B  2 1128 ? 111.996 110.951 162.197 1.00 322.81 ? 1128 ASP B CG    1 
ATOM   9175  O  OD1   . ASP B  2 1128 ? 112.773 111.362 163.078 1.00 313.49 ? 1128 ASP B OD1   1 
ATOM   9176  O  OD2   . ASP B  2 1128 ? 111.589 111.653 161.255 1.00 328.77 ? 1128 ASP B OD2   1 
ATOM   9177  N  N     . CYS B  2 1129 ? 111.519 106.444 162.758 1.00 319.51 ? 1129 CYS B N     1 
ATOM   9178  C  CA    . CYS B  2 1129 ? 110.833 105.277 163.297 1.00 315.07 ? 1129 CYS B CA    1 
ATOM   9179  C  C     . CYS B  2 1129 ? 111.735 104.498 164.247 1.00 301.84 ? 1129 CYS B C     1 
ATOM   9180  O  O     . CYS B  2 1129 ? 111.280 104.029 165.295 1.00 294.63 ? 1129 CYS B O     1 
ATOM   9181  C  CB    . CYS B  2 1129 ? 110.333 104.392 162.157 1.00 334.50 ? 1129 CYS B CB    1 
ATOM   9182  S  SG    . CYS B  2 1129 ? 108.948 105.111 161.239 1.00 355.66 ? 1129 CYS B SG    1 
ATOM   9183  N  N     . ASN B  2 1130 ? 113.026 104.375 163.918 1.00 314.48 ? 1130 ASN B N     1 
ATOM   9184  C  CA    . ASN B  2 1130 ? 113.949 103.682 164.812 1.00 307.24 ? 1130 ASN B CA    1 
ATOM   9185  C  C     . ASN B  2 1130 ? 114.128 104.435 166.127 1.00 295.59 ? 1130 ASN B C     1 
ATOM   9186  O  O     . ASN B  2 1130 ? 114.146 103.821 167.203 1.00 286.72 ? 1130 ASN B O     1 
ATOM   9187  C  CB    . ASN B  2 1130 ? 115.298 103.482 164.122 1.00 310.83 ? 1130 ASN B CB    1 
ATOM   9188  C  CG    . ASN B  2 1130 ? 115.277 102.350 163.115 1.00 318.32 ? 1130 ASN B CG    1 
ATOM   9189  O  OD1   . ASN B  2 1130 ? 114.214 101.912 162.672 1.00 318.46 ? 1130 ASN B OD1   1 
ATOM   9190  N  ND2   . ASN B  2 1130 ? 116.459 101.865 162.751 1.00 325.98 ? 1130 ASN B ND2   1 
ATOM   9191  N  N     . THR B  2 1131 ? 114.267 105.763 166.063 1.00 321.23 ? 1131 THR B N     1 
ATOM   9192  C  CA    . THR B  2 1131 ? 114.403 106.550 167.285 1.00 312.77 ? 1131 THR B CA    1 
ATOM   9193  C  C     . THR B  2 1131 ? 113.169 106.406 168.170 1.00 309.17 ? 1131 THR B C     1 
ATOM   9194  O  O     . THR B  2 1131 ? 113.283 106.196 169.383 1.00 299.60 ? 1131 THR B O     1 
ATOM   9195  C  CB    . THR B  2 1131 ? 114.646 108.020 166.941 1.00 313.26 ? 1131 THR B CB    1 
ATOM   9196  O  OG1   . THR B  2 1131 ? 115.890 108.148 166.242 1.00 315.69 ? 1131 THR B OG1   1 
ATOM   9197  C  CG2   . THR B  2 1131 ? 114.694 108.867 168.204 1.00 295.62 ? 1131 THR B CG2   1 
ATOM   9198  N  N     . ILE B  2 1132 ? 111.980 106.509 167.573 1.00 290.82 ? 1132 ILE B N     1 
ATOM   9199  C  CA    . ILE B  2 1132 ? 110.743 106.384 168.343 1.00 288.86 ? 1132 ILE B CA    1 
ATOM   9200  C  C     . ILE B  2 1132 ? 110.607 104.983 168.930 1.00 285.41 ? 1132 ILE B C     1 
ATOM   9201  O  O     . ILE B  2 1132 ? 110.161 104.812 170.071 1.00 279.47 ? 1132 ILE B O     1 
ATOM   9202  C  CB    . ILE B  2 1132 ? 109.533 106.753 167.467 1.00 294.62 ? 1132 ILE B CB    1 
ATOM   9203  C  CG1   . ILE B  2 1132 ? 109.604 108.229 167.076 1.00 297.12 ? 1132 ILE B CG1   1 
ATOM   9204  C  CG2   . ILE B  2 1132 ? 108.232 106.454 168.193 1.00 302.05 ? 1132 ILE B CG2   1 
ATOM   9205  C  CD1   . ILE B  2 1132 ? 108.495 108.661 166.156 1.00 309.96 ? 1132 ILE B CD1   1 
ATOM   9206  N  N     . ASP B  2 1133 ? 110.986 103.958 168.166 1.00 308.94 ? 1133 ASP B N     1 
ATOM   9207  C  CA    . ASP B  2 1133 ? 110.812 102.594 168.648 1.00 308.74 ? 1133 ASP B CA    1 
ATOM   9208  C  C     . ASP B  2 1133 ? 111.789 102.264 169.769 1.00 299.15 ? 1133 ASP B C     1 
ATOM   9209  O  O     . ASP B  2 1133 ? 111.442 101.538 170.706 1.00 294.09 ? 1133 ASP B O     1 
ATOM   9210  C  CB    . ASP B  2 1133 ? 110.968 101.609 167.491 1.00 318.97 ? 1133 ASP B CB    1 
ATOM   9211  C  CG    . ASP B  2 1133 ? 109.800 101.660 166.528 1.00 337.02 ? 1133 ASP B CG    1 
ATOM   9212  O  OD1   . ASP B  2 1133 ? 108.787 102.306 166.867 1.00 343.31 ? 1133 ASP B OD1   1 
ATOM   9213  O  OD2   . ASP B  2 1133 ? 109.896 101.068 165.435 1.00 347.53 ? 1133 ASP B OD2   1 
ATOM   9214  N  N     . GLN B  2 1134 ? 113.011 102.785 169.703 1.00 310.95 ? 1134 GLN B N     1 
ATOM   9215  C  CA    . GLN B  2 1134 ? 114.047 102.297 170.598 1.00 303.28 ? 1134 GLN B CA    1 
ATOM   9216  C  C     . GLN B  2 1134 ? 114.687 103.352 171.485 1.00 295.15 ? 1134 GLN B C     1 
ATOM   9217  O  O     . GLN B  2 1134 ? 115.283 102.983 172.502 1.00 289.36 ? 1134 GLN B O     1 
ATOM   9218  C  CB    . GLN B  2 1134 ? 115.139 101.590 169.790 1.00 306.11 ? 1134 GLN B CB    1 
ATOM   9219  C  CG    . GLN B  2 1134 ? 114.615 100.423 168.986 1.00 309.68 ? 1134 GLN B CG    1 
ATOM   9220  C  CD    . GLN B  2 1134 ? 115.726 99.705  168.286 1.00 313.51 ? 1134 GLN B CD    1 
ATOM   9221  O  OE1   . GLN B  2 1134 ? 116.892 100.049 168.460 1.00 312.61 ? 1134 GLN B OE1   1 
ATOM   9222  N  NE2   . GLN B  2 1134 ? 115.381 98.702  167.489 1.00 312.73 ? 1134 GLN B NE2   1 
ATOM   9223  N  N     . HIS B  2 1135 ? 114.571 104.638 171.154 1.00 319.27 ? 1135 HIS B N     1 
ATOM   9224  C  CA    . HIS B  2 1135 ? 115.170 105.683 171.973 1.00 311.88 ? 1135 HIS B CA    1 
ATOM   9225  C  C     . HIS B  2 1135 ? 114.168 106.483 172.795 1.00 304.29 ? 1135 HIS B C     1 
ATOM   9226  O  O     . HIS B  2 1135 ? 114.529 106.954 173.875 1.00 296.35 ? 1135 HIS B O     1 
ATOM   9227  C  CB    . HIS B  2 1135 ? 115.979 106.650 171.098 1.00 315.24 ? 1135 HIS B CB    1 
ATOM   9228  C  CG    . HIS B  2 1135 ? 117.228 106.048 170.525 1.00 318.17 ? 1135 HIS B CG    1 
ATOM   9229  N  ND1   . HIS B  2 1135 ? 117.248 105.381 169.320 1.00 325.72 ? 1135 HIS B ND1   1 
ATOM   9230  C  CD2   . HIS B  2 1135 ? 118.496 106.012 170.997 1.00 313.32 ? 1135 HIS B CD2   1 
ATOM   9231  C  CE1   . HIS B  2 1135 ? 118.477 104.960 169.072 1.00 323.73 ? 1135 HIS B CE1   1 
ATOM   9232  N  NE2   . HIS B  2 1135 ? 119.253 105.330 170.075 1.00 314.45 ? 1135 HIS B NE2   1 
ATOM   9233  N  N     . ILE B  2 1136 ? 112.927 106.637 172.337 1.00 323.40 ? 1136 ILE B N     1 
ATOM   9234  C  CA    . ILE B  2 1136 ? 111.944 107.470 173.035 1.00 315.55 ? 1136 ILE B CA    1 
ATOM   9235  C  C     . ILE B  2 1136 ? 111.534 106.879 174.388 1.00 311.48 ? 1136 ILE B C     1 
ATOM   9236  O  O     . ILE B  2 1136 ? 111.425 107.646 175.356 1.00 305.33 ? 1136 ILE B O     1 
ATOM   9237  C  CB    . ILE B  2 1136 ? 110.717 107.762 172.141 1.00 324.56 ? 1136 ILE B CB    1 
ATOM   9238  C  CG1   . ILE B  2 1136 ? 110.227 109.200 172.352 1.00 318.50 ? 1136 ILE B CG1   1 
ATOM   9239  C  CG2   . ILE B  2 1136 ? 109.538 106.840 172.424 1.00 333.68 ? 1136 ILE B CG2   1 
ATOM   9240  C  CD1   . ILE B  2 1136 ? 110.757 110.202 171.346 1.00 312.26 ? 1136 ILE B CD1   1 
ATOM   9241  N  N     . PRO B  2 1137 ? 111.323 105.535 174.550 1.00 300.60 ? 1137 PRO B N     1 
ATOM   9242  C  CA    . PRO B  2 1137 ? 110.818 105.053 175.844 1.00 296.58 ? 1137 PRO B CA    1 
ATOM   9243  C  C     . PRO B  2 1137 ? 111.833 105.238 176.958 1.00 287.10 ? 1137 PRO B C     1 
ATOM   9244  O  O     . PRO B  2 1137 ? 111.530 105.827 178.002 1.00 281.08 ? 1137 PRO B O     1 
ATOM   9245  C  CB    . PRO B  2 1137 ? 110.541 103.564 175.588 1.00 301.44 ? 1137 PRO B CB    1 
ATOM   9246  C  CG    . PRO B  2 1137 ? 110.552 103.408 174.106 1.00 309.90 ? 1137 PRO B CG    1 
ATOM   9247  C  CD    . PRO B  2 1137 ? 111.552 104.401 173.637 1.00 311.48 ? 1137 PRO B CD    1 
ATOM   9248  N  N     . SER B  2 1138 ? 113.053 104.748 176.724 1.00 311.56 ? 1138 SER B N     1 
ATOM   9249  C  CA    . SER B  2 1138 ? 114.090 104.814 177.748 1.00 307.42 ? 1138 SER B CA    1 
ATOM   9250  C  C     . SER B  2 1138 ? 114.420 106.258 178.099 1.00 303.95 ? 1138 SER B C     1 
ATOM   9251  O  O     . SER B  2 1138 ? 114.467 106.627 179.279 1.00 300.68 ? 1138 SER B O     1 
ATOM   9252  C  CB    . SER B  2 1138 ? 115.341 104.072 177.274 1.00 306.96 ? 1138 SER B CB    1 
ATOM   9253  O  OG    . SER B  2 1138 ? 115.835 104.613 176.060 1.00 311.01 ? 1138 SER B OG    1 
ATOM   9254  N  N     . THR B  2 1139 ? 114.648 107.095 177.084 1.00 320.80 ? 1139 THR B N     1 
ATOM   9255  C  CA    . THR B  2 1139 ? 115.012 108.486 177.339 1.00 316.86 ? 1139 THR B CA    1 
ATOM   9256  C  C     . THR B  2 1139 ? 113.894 109.234 178.050 1.00 312.99 ? 1139 THR B C     1 
ATOM   9257  O  O     . THR B  2 1139 ? 114.144 109.971 179.012 1.00 306.78 ? 1139 THR B O     1 
ATOM   9258  C  CB    . THR B  2 1139 ? 115.372 109.183 176.028 1.00 319.11 ? 1139 THR B CB    1 
ATOM   9259  O  OG1   . THR B  2 1139 ? 116.622 108.672 175.545 1.00 326.43 ? 1139 THR B OG1   1 
ATOM   9260  C  CG2   . THR B  2 1139 ? 115.481 110.685 176.231 1.00 317.03 ? 1139 THR B CG2   1 
ATOM   9261  N  N     . LEU B  2 1140 ? 112.650 109.052 177.600 1.00 321.95 ? 1140 LEU B N     1 
ATOM   9262  C  CA    . LEU B  2 1140 ? 111.529 109.729 178.246 1.00 316.58 ? 1140 LEU B CA    1 
ATOM   9263  C  C     . LEU B  2 1140 ? 111.389 109.302 179.703 1.00 315.51 ? 1140 LEU B C     1 
ATOM   9264  O  O     . LEU B  2 1140 ? 111.190 110.146 180.591 1.00 311.65 ? 1140 LEU B O     1 
ATOM   9265  C  CB    . LEU B  2 1140 ? 110.241 109.455 177.472 1.00 319.38 ? 1140 LEU B CB    1 
ATOM   9266  C  CG    . LEU B  2 1140 ? 108.960 110.031 178.078 1.00 320.14 ? 1140 LEU B CG    1 
ATOM   9267  C  CD1   . LEU B  2 1140 ? 109.069 111.539 178.239 1.00 314.97 ? 1140 LEU B CD1   1 
ATOM   9268  C  CD2   . LEU B  2 1140 ? 107.763 109.663 177.220 1.00 338.11 ? 1140 LEU B CD2   1 
ATOM   9269  N  N     . GLU B  2 1141 ? 111.498 107.997 179.979 1.00 321.70 ? 1141 GLU B N     1 
ATOM   9270  C  CA    . GLU B  2 1141 ? 111.334 107.541 181.356 1.00 322.53 ? 1141 GLU B CA    1 
ATOM   9271  C  C     . GLU B  2 1141 ? 112.479 108.020 182.244 1.00 314.42 ? 1141 GLU B C     1 
ATOM   9272  O  O     . GLU B  2 1141 ? 112.249 108.427 183.392 1.00 311.10 ? 1141 GLU B O     1 
ATOM   9273  C  CB    . GLU B  2 1141 ? 111.203 106.019 181.404 1.00 329.91 ? 1141 GLU B CB    1 
ATOM   9274  C  CG    . GLU B  2 1141 ? 111.348 105.409 182.802 1.00 334.70 ? 1141 GLU B CG    1 
ATOM   9275  C  CD    . GLU B  2 1141 ? 110.308 105.901 183.807 1.00 342.82 ? 1141 GLU B CD    1 
ATOM   9276  O  OE1   . GLU B  2 1141 ? 109.300 106.522 183.403 1.00 341.85 ? 1141 GLU B OE1   1 
ATOM   9277  O  OE2   . GLU B  2 1141 ? 110.503 105.656 185.017 1.00 347.69 ? 1141 GLU B OE2   1 
ATOM   9278  N  N     . CYS B  2 1142 ? 113.718 107.986 181.738 1.00 318.33 ? 1142 CYS B N     1 
ATOM   9279  C  CA    . CYS B  2 1142 ? 114.839 108.499 182.522 1.00 312.53 ? 1142 CYS B CA    1 
ATOM   9280  C  C     . CYS B  2 1142 ? 114.676 109.987 182.802 1.00 310.10 ? 1142 CYS B C     1 
ATOM   9281  O  O     . CYS B  2 1142 ? 114.978 110.454 183.908 1.00 311.49 ? 1142 CYS B O     1 
ATOM   9282  C  CB    . CYS B  2 1142 ? 116.162 108.227 181.804 1.00 307.86 ? 1142 CYS B CB    1 
ATOM   9283  S  SG    . CYS B  2 1142 ? 116.629 106.484 181.688 1.00 304.89 ? 1142 CYS B SG    1 
ATOM   9284  N  N     . LEU B  2 1143 ? 114.184 110.745 181.818 1.00 311.59 ? 1143 LEU B N     1 
ATOM   9285  C  CA    . LEU B  2 1143 ? 113.942 112.172 182.015 1.00 310.81 ? 1143 LEU B CA    1 
ATOM   9286  C  C     . LEU B  2 1143 ? 112.907 112.413 183.108 1.00 312.48 ? 1143 LEU B C     1 
ATOM   9287  O  O     . LEU B  2 1143 ? 113.084 113.289 183.966 1.00 306.95 ? 1143 LEU B O     1 
ATOM   9288  C  CB    . LEU B  2 1143 ? 113.482 112.808 180.704 1.00 309.58 ? 1143 LEU B CB    1 
ATOM   9289  C  CG    . LEU B  2 1143 ? 113.136 114.293 180.809 1.00 308.63 ? 1143 LEU B CG    1 
ATOM   9290  C  CD1   . LEU B  2 1143 ? 114.391 115.048 181.136 1.00 302.81 ? 1143 LEU B CD1   1 
ATOM   9291  C  CD2   . LEU B  2 1143 ? 112.521 114.820 179.532 1.00 316.35 ? 1143 LEU B CD2   1 
ATOM   9292  N  N     . SER B  2 1144 ? 111.801 111.665 183.071 1.00 318.86 ? 1144 SER B N     1 
ATOM   9293  C  CA    . SER B  2 1144 ? 110.775 111.812 184.101 1.00 318.30 ? 1144 SER B CA    1 
ATOM   9294  C  C     . SER B  2 1144 ? 111.333 111.478 185.483 1.00 319.36 ? 1144 SER B C     1 
ATOM   9295  O  O     . SER B  2 1144 ? 111.122 112.221 186.453 1.00 323.76 ? 1144 SER B O     1 
ATOM   9296  C  CB    . SER B  2 1144 ? 109.570 110.931 183.769 1.00 324.25 ? 1144 SER B CB    1 
ATOM   9297  O  OG    . SER B  2 1144 ? 108.967 111.333 182.552 1.00 325.12 ? 1144 SER B OG    1 
ATOM   9298  N  N     . ARG B  2 1145 ? 112.059 110.356 185.585 1.00 318.16 ? 1145 ARG B N     1 
ATOM   9299  C  CA    . ARG B  2 1145 ? 112.672 109.986 186.858 1.00 320.91 ? 1145 ARG B CA    1 
ATOM   9300  C  C     . ARG B  2 1145 ? 113.596 111.083 187.372 1.00 319.62 ? 1145 ARG B C     1 
ATOM   9301  O  O     . ARG B  2 1145 ? 113.561 111.428 188.559 1.00 323.73 ? 1145 ARG B O     1 
ATOM   9302  C  CB    . ARG B  2 1145 ? 113.442 108.674 186.721 1.00 321.34 ? 1145 ARG B CB    1 
ATOM   9303  C  CG    . ARG B  2 1145 ? 114.079 108.218 188.030 1.00 323.53 ? 1145 ARG B CG    1 
ATOM   9304  C  CD    . ARG B  2 1145 ? 114.975 107.009 187.832 1.00 331.74 ? 1145 ARG B CD    1 
ATOM   9305  N  NE    . ARG B  2 1145 ? 116.242 107.360 187.195 1.00 326.72 ? 1145 ARG B NE    1 
ATOM   9306  C  CZ    . ARG B  2 1145 ? 117.266 106.525 187.060 1.00 329.45 ? 1145 ARG B CZ    1 
ATOM   9307  N  NH1   . ARG B  2 1145 ? 118.382 106.932 186.470 1.00 321.29 ? 1145 ARG B NH1   1 
ATOM   9308  N  NH2   . ARG B  2 1145 ? 117.178 105.283 187.517 1.00 349.28 ? 1145 ARG B NH2   1 
ATOM   9309  N  N     . SER B  2 1146 ? 114.423 111.655 186.492 1.00 321.98 ? 1146 SER B N     1 
ATOM   9310  C  CA    . SER B  2 1146 ? 115.384 112.664 186.932 1.00 317.94 ? 1146 SER B CA    1 
ATOM   9311  C  C     . SER B  2 1146 ? 114.695 113.957 187.361 1.00 318.82 ? 1146 SER B C     1 
ATOM   9312  O  O     . SER B  2 1146 ? 115.072 114.552 188.373 1.00 315.36 ? 1146 SER B O     1 
ATOM   9313  C  CB    . SER B  2 1146 ? 116.415 112.927 185.830 1.00 307.76 ? 1146 SER B CB    1 
ATOM   9314  O  OG    . SER B  2 1146 ? 117.095 111.735 185.482 1.00 305.53 ? 1146 SER B OG    1 
ATOM   9315  N  N     . THR B  2 1147 ? 113.667 114.400 186.629 1.00 318.35 ? 1147 THR B N     1 
ATOM   9316  C  CA    . THR B  2 1147 ? 112.957 115.618 187.030 1.00 321.10 ? 1147 THR B CA    1 
ATOM   9317  C  C     . THR B  2 1147 ? 112.242 115.441 188.369 1.00 323.13 ? 1147 THR B C     1 
ATOM   9318  O  O     . THR B  2 1147 ? 112.207 116.375 189.187 1.00 323.23 ? 1147 THR B O     1 
ATOM   9319  C  CB    . THR B  2 1147 ? 111.960 116.077 185.955 1.00 318.99 ? 1147 THR B CB    1 
ATOM   9320  O  OG1   . THR B  2 1147 ? 111.513 117.399 186.285 1.00 318.88 ? 1147 THR B OG1   1 
ATOM   9321  C  CG2   . THR B  2 1147 ? 110.742 115.173 185.866 1.00 321.96 ? 1147 THR B CG2   1 
ATOM   9322  N  N     . LEU B  2 1148 ? 111.665 114.256 188.615 1.00 321.05 ? 1148 LEU B N     1 
ATOM   9323  C  CA    . LEU B  2 1148 ? 111.018 114.008 189.901 1.00 326.36 ? 1148 LEU B CA    1 
ATOM   9324  C  C     . LEU B  2 1148 ? 112.047 113.926 191.033 1.00 324.79 ? 1148 LEU B C     1 
ATOM   9325  O  O     . LEU B  2 1148 ? 111.798 114.412 192.145 1.00 327.18 ? 1148 LEU B O     1 
ATOM   9326  C  CB    . LEU B  2 1148 ? 110.166 112.743 189.795 1.00 335.51 ? 1148 LEU B CB    1 
ATOM   9327  C  CG    . LEU B  2 1148 ? 109.073 112.853 188.721 1.00 341.01 ? 1148 LEU B CG    1 
ATOM   9328  C  CD1   . LEU B  2 1148 ? 108.445 111.505 188.424 1.00 358.52 ? 1148 LEU B CD1   1 
ATOM   9329  C  CD2   . LEU B  2 1148 ? 108.024 113.862 189.146 1.00 338.92 ? 1148 LEU B CD2   1 
ATOM   9330  N  N     . LEU B  2 1149 ? 113.226 113.356 190.757 1.00 323.08 ? 1149 LEU B N     1 
ATOM   9331  C  CA    . LEU B  2 1149 ? 114.297 113.361 191.754 1.00 320.53 ? 1149 LEU B CA    1 
ATOM   9332  C  C     . LEU B  2 1149 ? 114.736 114.784 192.091 1.00 321.67 ? 1149 LEU B C     1 
ATOM   9333  O  O     . LEU B  2 1149 ? 114.970 115.110 193.263 1.00 329.92 ? 1149 LEU B O     1 
ATOM   9334  C  CB    . LEU B  2 1149 ? 115.480 112.535 191.251 1.00 318.25 ? 1149 LEU B CB    1 
ATOM   9335  C  CG    . LEU B  2 1149 ? 115.258 111.025 191.169 1.00 318.13 ? 1149 LEU B CG    1 
ATOM   9336  C  CD1   . LEU B  2 1149 ? 116.443 110.350 190.504 1.00 310.74 ? 1149 LEU B CD1   1 
ATOM   9337  C  CD2   . LEU B  2 1149 ? 115.008 110.440 192.551 1.00 321.88 ? 1149 LEU B CD2   1 
ATOM   9338  N  N     . CYS B  2 1150 ? 114.856 115.643 191.075 1.00 326.85 ? 1150 CYS B N     1 
ATOM   9339  C  CA    . CYS B  2 1150 ? 115.228 117.035 191.318 1.00 329.67 ? 1150 CYS B CA    1 
ATOM   9340  C  C     . CYS B  2 1150 ? 114.181 117.752 192.159 1.00 332.92 ? 1150 CYS B C     1 
ATOM   9341  O  O     . CYS B  2 1150 ? 114.521 118.516 193.074 1.00 343.45 ? 1150 CYS B O     1 
ATOM   9342  C  CB    . CYS B  2 1150 ? 115.431 117.760 189.988 1.00 324.04 ? 1150 CYS B CB    1 
ATOM   9343  S  SG    . CYS B  2 1150 ? 116.884 117.227 189.057 1.00 314.17 ? 1150 CYS B SG    1 
ATOM   9344  N  N     . VAL B  2 1151 ? 112.901 117.533 191.849 1.00 334.13 ? 1151 VAL B N     1 
ATOM   9345  C  CA    . VAL B  2 1151 ? 111.827 118.139 192.635 1.00 335.01 ? 1151 VAL B CA    1 
ATOM   9346  C  C     . VAL B  2 1151 ? 111.916 117.695 194.091 1.00 338.62 ? 1151 VAL B C     1 
ATOM   9347  O  O     . VAL B  2 1151 ? 111.849 118.515 195.018 1.00 346.21 ? 1151 VAL B O     1 
ATOM   9348  C  CB    . VAL B  2 1151 ? 110.459 117.791 192.022 1.00 330.56 ? 1151 VAL B CB    1 
ATOM   9349  C  CG1   . VAL B  2 1151 ? 109.335 118.196 192.957 1.00 332.22 ? 1151 VAL B CG1   1 
ATOM   9350  C  CG2   . VAL B  2 1151 ? 110.303 118.465 190.669 1.00 331.30 ? 1151 VAL B CG2   1 
ATOM   9351  N  N     . SER B  2 1152 ? 112.071 116.384 194.306 1.00 337.61 ? 1152 SER B N     1 
ATOM   9352  C  CA    . SER B  2 1152 ? 112.182 115.855 195.661 1.00 339.17 ? 1152 SER B CA    1 
ATOM   9353  C  C     . SER B  2 1152 ? 113.358 116.478 196.405 1.00 339.89 ? 1152 SER B C     1 
ATOM   9354  O  O     . SER B  2 1152 ? 113.226 116.875 197.569 1.00 349.86 ? 1152 SER B O     1 
ATOM   9355  C  CB    . SER B  2 1152 ? 112.318 114.331 195.609 1.00 342.42 ? 1152 SER B CB    1 
ATOM   9356  O  OG    . SER B  2 1152 ? 112.369 113.759 196.905 1.00 357.25 ? 1152 SER B OG    1 
ATOM   9357  N  N     . ALA B  2 1153 ? 114.513 116.589 195.744 1.00 342.24 ? 1153 ALA B N     1 
ATOM   9358  C  CA    . ALA B  2 1153 ? 115.700 117.111 196.418 1.00 345.28 ? 1153 ALA B CA    1 
ATOM   9359  C  C     . ALA B  2 1153 ? 115.531 118.583 196.782 1.00 349.32 ? 1153 ALA B C     1 
ATOM   9360  O  O     . ALA B  2 1153 ? 115.866 118.996 197.902 1.00 360.12 ? 1153 ALA B O     1 
ATOM   9361  C  CB    . ALA B  2 1153 ? 116.934 116.909 195.544 1.00 341.52 ? 1153 ALA B CB    1 
ATOM   9362  N  N     . LEU B  2 1154 ? 115.018 119.393 195.850 1.00 335.27 ? 1154 LEU B N     1 
ATOM   9363  C  CA    . LEU B  2 1154 ? 114.777 120.799 196.161 1.00 335.68 ? 1154 LEU B CA    1 
ATOM   9364  C  C     . LEU B  2 1154 ? 113.798 120.936 197.320 1.00 338.95 ? 1154 LEU B C     1 
ATOM   9365  O  O     . LEU B  2 1154 ? 114.021 121.729 198.242 1.00 347.92 ? 1154 LEU B O     1 
ATOM   9366  C  CB    . LEU B  2 1154 ? 114.262 121.546 194.927 1.00 332.65 ? 1154 LEU B CB    1 
ATOM   9367  C  CG    . LEU B  2 1154 ? 114.157 123.079 194.990 1.00 329.56 ? 1154 LEU B CG    1 
ATOM   9368  C  CD1   . LEU B  2 1154 ? 114.254 123.646 193.587 1.00 322.58 ? 1154 LEU B CD1   1 
ATOM   9369  C  CD2   . LEU B  2 1154 ? 112.872 123.573 195.660 1.00 330.91 ? 1154 LEU B CD2   1 
ATOM   9370  N  N     . THR B  2 1155 ? 112.702 120.170 197.288 1.00 342.79 ? 1155 THR B N     1 
ATOM   9371  C  CA    . THR B  2 1155 ? 111.711 120.266 198.356 1.00 345.67 ? 1155 THR B CA    1 
ATOM   9372  C  C     . THR B  2 1155 ? 112.308 119.868 199.702 1.00 348.02 ? 1155 THR B C     1 
ATOM   9373  O  O     . THR B  2 1155 ? 112.056 120.524 200.721 1.00 353.84 ? 1155 THR B O     1 
ATOM   9374  C  CB    . THR B  2 1155 ? 110.493 119.402 198.024 1.00 345.12 ? 1155 THR B CB    1 
ATOM   9375  O  OG1   . THR B  2 1155 ? 109.946 119.808 196.763 1.00 343.19 ? 1155 THR B OG1   1 
ATOM   9376  C  CG2   . THR B  2 1155 ? 109.424 119.554 199.099 1.00 345.95 ? 1155 THR B CG2   1 
ATOM   9377  N  N     . VAL B  2 1156 ? 113.125 118.812 199.724 1.00 335.76 ? 1156 VAL B N     1 
ATOM   9378  C  CA    . VAL B  2 1156 ? 113.734 118.370 200.976 1.00 335.93 ? 1156 VAL B CA    1 
ATOM   9379  C  C     . VAL B  2 1156 ? 114.667 119.442 201.526 1.00 337.69 ? 1156 VAL B C     1 
ATOM   9380  O  O     . VAL B  2 1156 ? 114.612 119.789 202.714 1.00 345.33 ? 1156 VAL B O     1 
ATOM   9381  C  CB    . VAL B  2 1156 ? 114.467 117.032 200.777 1.00 337.95 ? 1156 VAL B CB    1 
ATOM   9382  C  CG1   . VAL B  2 1156 ? 115.348 116.726 201.976 1.00 342.26 ? 1156 VAL B CG1   1 
ATOM   9383  C  CG2   . VAL B  2 1156 ? 113.465 115.917 200.568 1.00 344.36 ? 1156 VAL B CG2   1 
ATOM   9384  N  N     . ILE B  2 1157 ? 115.539 119.988 200.672 1.00 342.92 ? 1157 ILE B N     1 
ATOM   9385  C  CA    . ILE B  2 1157 ? 116.487 120.993 201.152 1.00 340.89 ? 1157 ILE B CA    1 
ATOM   9386  C  C     . ILE B  2 1157 ? 115.751 122.234 201.636 1.00 340.33 ? 1157 ILE B C     1 
ATOM   9387  O  O     . ILE B  2 1157 ? 116.141 122.857 202.631 1.00 346.47 ? 1157 ILE B O     1 
ATOM   9388  C  CB    . ILE B  2 1157 ? 117.517 121.332 200.063 1.00 336.37 ? 1157 ILE B CB    1 
ATOM   9389  C  CG1   . ILE B  2 1157 ? 118.443 120.139 199.847 1.00 333.90 ? 1157 ILE B CG1   1 
ATOM   9390  C  CG2   . ILE B  2 1157 ? 118.320 122.570 200.449 1.00 335.94 ? 1157 ILE B CG2   1 
ATOM   9391  C  CD1   . ILE B  2 1157 ? 119.569 120.415 198.897 1.00 329.21 ? 1157 ILE B CD1   1 
ATOM   9392  N  N     . SER B  2 1158 ? 114.671 122.613 200.950 1.00 336.28 ? 1158 SER B N     1 
ATOM   9393  C  CA    . SER B  2 1158 ? 113.888 123.753 201.411 1.00 338.40 ? 1158 SER B CA    1 
ATOM   9394  C  C     . SER B  2 1158 ? 113.253 123.469 202.769 1.00 341.22 ? 1158 SER B C     1 
ATOM   9395  O  O     . SER B  2 1158 ? 113.180 124.358 203.625 1.00 344.96 ? 1158 SER B O     1 
ATOM   9396  C  CB    . SER B  2 1158 ? 112.821 124.112 200.379 1.00 341.32 ? 1158 SER B CB    1 
ATOM   9397  O  OG    . SER B  2 1158 ? 111.884 123.061 200.224 1.00 343.53 ? 1158 SER B OG    1 
ATOM   9398  N  N     . TYR B  2 1159 ? 112.792 122.235 202.986 1.00 344.44 ? 1159 TYR B N     1 
ATOM   9399  C  CA    . TYR B  2 1159 ? 112.164 121.909 204.262 1.00 346.48 ? 1159 TYR B CA    1 
ATOM   9400  C  C     . TYR B  2 1159 ? 113.177 121.910 205.400 1.00 342.08 ? 1159 TYR B C     1 
ATOM   9401  O  O     . TYR B  2 1159 ? 112.880 122.391 206.501 1.00 341.47 ? 1159 TYR B O     1 
ATOM   9402  C  CB    . TYR B  2 1159 ? 111.458 120.556 204.173 1.00 349.25 ? 1159 TYR B CB    1 
ATOM   9403  C  CG    . TYR B  2 1159 ? 110.639 120.216 205.399 1.00 354.58 ? 1159 TYR B CG    1 
ATOM   9404  C  CD1   . TYR B  2 1159 ? 111.217 119.586 206.492 1.00 360.36 ? 1159 TYR B CD1   1 
ATOM   9405  C  CD2   . TYR B  2 1159 ? 109.284 120.522 205.461 1.00 355.78 ? 1159 TYR B CD2   1 
ATOM   9406  C  CE1   . TYR B  2 1159 ? 110.476 119.275 207.611 1.00 364.16 ? 1159 TYR B CE1   1 
ATOM   9407  C  CE2   . TYR B  2 1159 ? 108.534 120.212 206.577 1.00 359.17 ? 1159 TYR B CE2   1 
ATOM   9408  C  CZ    . TYR B  2 1159 ? 109.136 119.589 207.650 1.00 363.45 ? 1159 TYR B CZ    1 
ATOM   9409  O  OH    . TYR B  2 1159 ? 108.396 119.276 208.766 1.00 365.94 ? 1159 TYR B OH    1 
ATOM   9410  N  N     . VAL B  2 1160 ? 114.377 121.372 205.162 1.00 347.72 ? 1160 VAL B N     1 
ATOM   9411  C  CA    . VAL B  2 1160 ? 115.340 121.227 206.251 1.00 348.56 ? 1160 VAL B CA    1 
ATOM   9412  C  C     . VAL B  2 1160 ? 115.886 122.584 206.677 1.00 347.24 ? 1160 VAL B C     1 
ATOM   9413  O  O     . VAL B  2 1160 ? 116.137 122.820 207.864 1.00 348.76 ? 1160 VAL B O     1 
ATOM   9414  C  CB    . VAL B  2 1160 ? 116.468 120.252 205.859 1.00 346.80 ? 1160 VAL B CB    1 
ATOM   9415  C  CG1   . VAL B  2 1160 ? 115.892 118.899 205.484 1.00 346.19 ? 1160 VAL B CG1   1 
ATOM   9416  C  CG2   . VAL B  2 1160 ? 117.319 120.812 204.725 1.00 345.98 ? 1160 VAL B CG2   1 
ATOM   9417  N  N     . THR B  2 1161 ? 116.074 123.495 205.727 1.00 346.45 ? 1161 THR B N     1 
ATOM   9418  C  CA    . THR B  2 1161 ? 116.560 124.843 206.015 1.00 342.96 ? 1161 THR B CA    1 
ATOM   9419  C  C     . THR B  2 1161 ? 115.689 125.848 205.274 1.00 341.54 ? 1161 THR B C     1 
ATOM   9420  O  O     . THR B  2 1161 ? 115.894 126.075 204.069 1.00 340.73 ? 1161 THR B O     1 
ATOM   9421  C  CB    . THR B  2 1161 ? 118.026 125.010 205.625 1.00 342.43 ? 1161 THR B CB    1 
ATOM   9422  O  OG1   . THR B  2 1161 ? 118.202 124.646 204.250 1.00 340.53 ? 1161 THR B OG1   1 
ATOM   9423  C  CG2   . THR B  2 1161 ? 118.921 124.144 206.501 1.00 338.94 ? 1161 THR B CG2   1 
ATOM   9424  N  N     . PRO B  2 1162 ? 114.714 126.466 205.949 1.00 349.09 ? 1162 PRO B N     1 
ATOM   9425  C  CA    . PRO B  2 1162 ? 113.890 127.494 205.295 1.00 348.43 ? 1162 PRO B CA    1 
ATOM   9426  C  C     . PRO B  2 1162 ? 114.667 128.725 204.856 1.00 345.82 ? 1162 PRO B C     1 
ATOM   9427  O  O     . PRO B  2 1162 ? 114.084 129.622 204.233 1.00 346.24 ? 1162 PRO B O     1 
ATOM   9428  C  CB    . PRO B  2 1162 ? 112.857 127.855 206.375 1.00 350.54 ? 1162 PRO B CB    1 
ATOM   9429  C  CG    . PRO B  2 1162 ? 112.840 126.680 207.305 1.00 350.66 ? 1162 PRO B CG    1 
ATOM   9430  C  CD    . PRO B  2 1162 ? 114.241 126.153 207.310 1.00 351.32 ? 1162 PRO B CD    1 
ATOM   9431  N  N     . VAL B  2 1163 ? 115.968 128.799 205.145 1.00 343.00 ? 1163 VAL B N     1 
ATOM   9432  C  CA    . VAL B  2 1163 ? 116.767 129.941 204.720 1.00 340.60 ? 1163 VAL B CA    1 
ATOM   9433  C  C     . VAL B  2 1163 ? 117.354 129.763 203.322 1.00 336.87 ? 1163 VAL B C     1 
ATOM   9434  O  O     . VAL B  2 1163 ? 117.740 130.759 202.689 1.00 336.08 ? 1163 VAL B O     1 
ATOM   9435  C  CB    . VAL B  2 1163 ? 117.904 130.217 205.721 1.00 341.67 ? 1163 VAL B CB    1 
ATOM   9436  C  CG1   . VAL B  2 1163 ? 117.336 130.624 207.067 1.00 342.43 ? 1163 VAL B CG1   1 
ATOM   9437  C  CG2   . VAL B  2 1163 ? 118.782 128.987 205.865 1.00 341.47 ? 1163 VAL B CG2   1 
ATOM   9438  N  N     . PHE B  2 1164 ? 117.424 128.526 202.818 1.00 341.16 ? 1164 PHE B N     1 
ATOM   9439  C  CA    . PHE B  2 1164 ? 118.061 128.274 201.527 1.00 335.48 ? 1164 PHE B CA    1 
ATOM   9440  C  C     . PHE B  2 1164 ? 117.371 129.020 200.393 1.00 331.69 ? 1164 PHE B C     1 
ATOM   9441  O  O     . PHE B  2 1164 ? 118.003 129.320 199.372 1.00 326.48 ? 1164 PHE B O     1 
ATOM   9442  C  CB    . PHE B  2 1164 ? 118.085 126.774 201.233 1.00 332.40 ? 1164 PHE B CB    1 
ATOM   9443  C  CG    . PHE B  2 1164 ? 118.792 126.426 199.960 1.00 326.13 ? 1164 PHE B CG    1 
ATOM   9444  C  CD1   . PHE B  2 1164 ? 120.159 126.227 199.948 1.00 320.09 ? 1164 PHE B CD1   1 
ATOM   9445  C  CD2   . PHE B  2 1164 ? 118.092 126.313 198.770 1.00 325.88 ? 1164 PHE B CD2   1 
ATOM   9446  C  CE1   . PHE B  2 1164 ? 120.814 125.913 198.779 1.00 314.49 ? 1164 PHE B CE1   1 
ATOM   9447  C  CE2   . PHE B  2 1164 ? 118.743 126.004 197.595 1.00 317.94 ? 1164 PHE B CE2   1 
ATOM   9448  C  CZ    . PHE B  2 1164 ? 120.106 125.805 197.601 1.00 313.97 ? 1164 PHE B CZ    1 
ATOM   9449  N  N     . LEU B  2 1165 ? 116.082 129.335 200.548 1.00 337.10 ? 1165 LEU B N     1 
ATOM   9450  C  CA    . LEU B  2 1165 ? 115.362 130.087 199.527 1.00 334.99 ? 1165 LEU B CA    1 
ATOM   9451  C  C     . LEU B  2 1165 ? 115.952 131.471 199.291 1.00 330.33 ? 1165 LEU B C     1 
ATOM   9452  O  O     . LEU B  2 1165 ? 115.506 132.164 198.369 1.00 325.06 ? 1165 LEU B O     1 
ATOM   9453  C  CB    . LEU B  2 1165 ? 113.882 130.209 199.901 1.00 339.45 ? 1165 LEU B CB    1 
ATOM   9454  C  CG    . LEU B  2 1165 ? 113.064 128.915 199.900 1.00 343.26 ? 1165 LEU B CG    1 
ATOM   9455  C  CD1   . LEU B  2 1165 ? 111.601 129.197 200.215 1.00 346.42 ? 1165 LEU B CD1   1 
ATOM   9456  C  CD2   . LEU B  2 1165 ? 113.198 128.191 198.568 1.00 339.68 ? 1165 LEU B CD2   1 
ATOM   9457  N  N     . VAL B  2 1166 ? 116.931 131.890 200.097 1.00 342.47 ? 1166 VAL B N     1 
ATOM   9458  C  CA    . VAL B  2 1166 ? 117.665 133.119 199.814 1.00 339.86 ? 1166 VAL B CA    1 
ATOM   9459  C  C     . VAL B  2 1166 ? 118.840 132.878 198.867 1.00 335.34 ? 1166 VAL B C     1 
ATOM   9460  O  O     . VAL B  2 1166 ? 119.292 133.818 198.198 1.00 328.46 ? 1166 VAL B O     1 
ATOM   9461  C  CB    . VAL B  2 1166 ? 118.150 133.763 201.128 1.00 342.74 ? 1166 VAL B CB    1 
ATOM   9462  C  CG1   . VAL B  2 1166 ? 118.745 135.145 200.879 1.00 342.52 ? 1166 VAL B CG1   1 
ATOM   9463  C  CG2   . VAL B  2 1166 ? 117.003 133.855 202.125 1.00 346.68 ? 1166 VAL B CG2   1 
ATOM   9464  N  N     . ALA B  2 1167 ? 119.329 131.642 198.767 1.00 328.96 ? 1167 ALA B N     1 
ATOM   9465  C  CA    . ALA B  2 1167 ? 120.471 131.320 197.924 1.00 322.20 ? 1167 ALA B CA    1 
ATOM   9466  C  C     . ALA B  2 1167 ? 120.097 130.566 196.654 1.00 314.79 ? 1167 ALA B C     1 
ATOM   9467  O  O     . ALA B  2 1167 ? 120.992 130.180 195.898 1.00 306.28 ? 1167 ALA B O     1 
ATOM   9468  C  CB    . ALA B  2 1167 ? 121.495 130.507 198.722 1.00 323.27 ? 1167 ALA B CB    1 
ATOM   9469  N  N     . LEU B  2 1168 ? 118.808 130.352 196.397 1.00 309.22 ? 1168 LEU B N     1 
ATOM   9470  C  CA    . LEU B  2 1168 ? 118.378 129.580 195.236 1.00 305.09 ? 1168 LEU B CA    1 
ATOM   9471  C  C     . LEU B  2 1168 ? 118.180 130.445 193.996 1.00 298.10 ? 1168 LEU B C     1 
ATOM   9472  O  O     . LEU B  2 1168 ? 118.478 130.003 192.880 1.00 290.63 ? 1168 LEU B O     1 
ATOM   9473  C  CB    . LEU B  2 1168 ? 117.082 128.830 195.561 1.00 311.29 ? 1168 LEU B CB    1 
ATOM   9474  C  CG    . LEU B  2 1168 ? 116.512 127.901 194.487 1.00 317.07 ? 1168 LEU B CG    1 
ATOM   9475  C  CD1   . LEU B  2 1168 ? 117.483 126.769 194.186 1.00 321.03 ? 1168 LEU B CD1   1 
ATOM   9476  C  CD2   . LEU B  2 1168 ? 115.154 127.351 194.907 1.00 317.28 ? 1168 LEU B CD2   1 
ATOM   9477  N  N     . LEU B  2 1169 ? 117.678 131.669 194.169 1.00 317.51 ? 1169 LEU B N     1 
ATOM   9478  C  CA    . LEU B  2 1169 ? 117.419 132.530 193.019 1.00 314.67 ? 1169 LEU B CA    1 
ATOM   9479  C  C     . LEU B  2 1169 ? 118.679 132.902 192.241 1.00 311.41 ? 1169 LEU B C     1 
ATOM   9480  O  O     . LEU B  2 1169 ? 118.612 132.920 191.001 1.00 306.28 ? 1169 LEU B O     1 
ATOM   9481  C  CB    . LEU B  2 1169 ? 116.659 133.786 193.472 1.00 315.62 ? 1169 LEU B CB    1 
ATOM   9482  C  CG    . LEU B  2 1169 ? 116.111 134.719 192.384 1.00 314.93 ? 1169 LEU B CG    1 
ATOM   9483  C  CD1   . LEU B  2 1169 ? 114.768 135.297 192.803 1.00 319.65 ? 1169 LEU B CD1   1 
ATOM   9484  C  CD2   . LEU B  2 1169 ? 117.092 135.842 192.072 1.00 311.49 ? 1169 LEU B CD2   1 
ATOM   9485  N  N     . PRO B  2 1170 ? 119.822 133.222 192.864 1.00 308.05 ? 1170 PRO B N     1 
ATOM   9486  C  CA    . PRO B  2 1170 ? 121.027 133.476 192.051 1.00 302.24 ? 1170 PRO B CA    1 
ATOM   9487  C  C     . PRO B  2 1170 ? 121.464 132.265 191.249 1.00 298.37 ? 1170 PRO B C     1 
ATOM   9488  O  O     . PRO B  2 1170 ? 121.863 132.397 190.082 1.00 293.30 ? 1170 PRO B O     1 
ATOM   9489  C  CB    . PRO B  2 1170 ? 122.077 133.873 193.099 1.00 300.26 ? 1170 PRO B CB    1 
ATOM   9490  C  CG    . PRO B  2 1170 ? 121.287 134.380 194.247 1.00 299.91 ? 1170 PRO B CG    1 
ATOM   9491  C  CD    . PRO B  2 1170 ? 120.059 133.529 194.286 1.00 308.24 ? 1170 PRO B CD    1 
ATOM   9492  N  N     . LEU B  2 1171 ? 121.411 131.080 191.862 1.00 298.95 ? 1171 LEU B N     1 
ATOM   9493  C  CA    . LEU B  2 1171 ? 121.683 129.846 191.137 1.00 294.52 ? 1171 LEU B CA    1 
ATOM   9494  C  C     . LEU B  2 1171 ? 120.777 129.722 189.922 1.00 291.07 ? 1171 LEU B C     1 
ATOM   9495  O  O     . LEU B  2 1171 ? 121.242 129.463 188.803 1.00 289.33 ? 1171 LEU B O     1 
ATOM   9496  C  CB    . LEU B  2 1171 ? 121.494 128.648 192.067 1.00 292.36 ? 1171 LEU B CB    1 
ATOM   9497  C  CG    . LEU B  2 1171 ? 121.946 127.289 191.537 1.00 292.66 ? 1171 LEU B CG    1 
ATOM   9498  C  CD1   . LEU B  2 1171 ? 123.420 127.081 191.843 1.00 302.98 ? 1171 LEU B CD1   1 
ATOM   9499  C  CD2   . LEU B  2 1171 ? 121.099 126.172 192.124 1.00 286.75 ? 1171 LEU B CD2   1 
ATOM   9500  N  N     . ALA B  2 1172 ? 119.470 129.904 190.131 1.00 295.62 ? 1172 ALA B N     1 
ATOM   9501  C  CA    . ALA B  2 1172 ? 118.515 129.787 189.034 1.00 294.62 ? 1172 ALA B CA    1 
ATOM   9502  C  C     . ALA B  2 1172 ? 118.802 130.807 187.939 1.00 291.21 ? 1172 ALA B C     1 
ATOM   9503  O  O     . ALA B  2 1172 ? 118.723 130.483 186.752 1.00 288.06 ? 1172 ALA B O     1 
ATOM   9504  C  CB    . ALA B  2 1172 ? 117.090 129.948 189.560 1.00 296.38 ? 1172 ALA B CB    1 
ATOM   9505  N  N     . VAL B  2 1173 ? 119.163 132.034 188.317 1.00 297.24 ? 1173 VAL B N     1 
ATOM   9506  C  CA    . VAL B  2 1173 ? 119.383 133.086 187.327 1.00 297.45 ? 1173 VAL B CA    1 
ATOM   9507  C  C     . VAL B  2 1173 ? 120.614 132.780 186.481 1.00 294.82 ? 1173 VAL B C     1 
ATOM   9508  O  O     . VAL B  2 1173 ? 120.576 132.857 185.244 1.00 291.89 ? 1173 VAL B O     1 
ATOM   9509  C  CB    . VAL B  2 1173 ? 119.497 134.456 188.021 1.00 300.54 ? 1173 VAL B CB    1 
ATOM   9510  C  CG1   . VAL B  2 1173 ? 120.028 135.502 187.055 1.00 297.11 ? 1173 VAL B CG1   1 
ATOM   9511  C  CG2   . VAL B  2 1173 ? 118.146 134.882 188.573 1.00 302.75 ? 1173 VAL B CG2   1 
ATOM   9512  N  N     . VAL B  2 1174 ? 121.728 132.434 187.133 1.00 284.01 ? 1174 VAL B N     1 
ATOM   9513  C  CA    . VAL B  2 1174 ? 122.949 132.137 186.390 1.00 278.20 ? 1174 VAL B CA    1 
ATOM   9514  C  C     . VAL B  2 1174 ? 122.749 130.915 185.501 1.00 276.60 ? 1174 VAL B C     1 
ATOM   9515  O  O     . VAL B  2 1174 ? 123.152 130.907 184.327 1.00 274.29 ? 1174 VAL B O     1 
ATOM   9516  C  CB    . VAL B  2 1174 ? 124.131 131.951 187.357 1.00 276.37 ? 1174 VAL B CB    1 
ATOM   9517  C  CG1   . VAL B  2 1174 ? 125.389 131.592 186.589 1.00 274.26 ? 1174 VAL B CG1   1 
ATOM   9518  C  CG2   . VAL B  2 1174 ? 124.346 133.217 188.168 1.00 279.00 ? 1174 VAL B CG2   1 
ATOM   9519  N  N     . CYS B  2 1175 ? 122.116 129.869 186.039 1.00 269.71 ? 1175 CYS B N     1 
ATOM   9520  C  CA    . CYS B  2 1175 ? 121.867 128.669 185.249 1.00 269.30 ? 1175 CYS B CA    1 
ATOM   9521  C  C     . CYS B  2 1175 ? 120.942 128.961 184.073 1.00 265.94 ? 1175 CYS B C     1 
ATOM   9522  O  O     . CYS B  2 1175 ? 121.136 128.430 182.975 1.00 263.64 ? 1175 CYS B O     1 
ATOM   9523  C  CB    . CYS B  2 1175 ? 121.283 127.575 186.143 1.00 273.29 ? 1175 CYS B CB    1 
ATOM   9524  S  SG    . CYS B  2 1175 ? 120.847 126.049 185.283 1.00 274.22 ? 1175 CYS B SG    1 
ATOM   9525  N  N     . TYR B  2 1176 ? 119.936 129.815 184.279 1.00 277.53 ? 1176 TYR B N     1 
ATOM   9526  C  CA    . TYR B  2 1176 ? 119.012 130.174 183.211 1.00 279.68 ? 1176 TYR B CA    1 
ATOM   9527  C  C     . TYR B  2 1176 ? 119.734 130.914 182.094 1.00 278.99 ? 1176 TYR B C     1 
ATOM   9528  O  O     . TYR B  2 1176 ? 119.531 130.630 180.908 1.00 280.25 ? 1176 TYR B O     1 
ATOM   9529  C  CB    . TYR B  2 1176 ? 117.884 131.033 183.788 1.00 283.24 ? 1176 TYR B CB    1 
ATOM   9530  C  CG    . TYR B  2 1176 ? 116.661 131.183 182.910 1.00 282.38 ? 1176 TYR B CG    1 
ATOM   9531  C  CD1   . TYR B  2 1176 ? 116.596 132.169 181.933 1.00 279.21 ? 1176 TYR B CD1   1 
ATOM   9532  C  CD2   . TYR B  2 1176 ? 115.558 130.354 183.079 1.00 281.03 ? 1176 TYR B CD2   1 
ATOM   9533  C  CE1   . TYR B  2 1176 ? 115.472 132.314 181.139 1.00 276.39 ? 1176 TYR B CE1   1 
ATOM   9534  C  CE2   . TYR B  2 1176 ? 114.432 130.492 182.291 1.00 277.74 ? 1176 TYR B CE2   1 
ATOM   9535  C  CZ    . TYR B  2 1176 ? 114.395 131.472 181.322 1.00 275.63 ? 1176 TYR B CZ    1 
ATOM   9536  O  OH    . TYR B  2 1176 ? 113.275 131.609 180.535 1.00 269.71 ? 1176 TYR B OH    1 
ATOM   9537  N  N     . PHE B  2 1177 ? 120.586 131.873 182.462 1.00 275.78 ? 1177 PHE B N     1 
ATOM   9538  C  CA    . PHE B  2 1177 ? 121.328 132.620 181.451 1.00 273.27 ? 1177 PHE B CA    1 
ATOM   9539  C  C     . PHE B  2 1177 ? 122.279 131.713 180.677 1.00 269.14 ? 1177 PHE B C     1 
ATOM   9540  O  O     . PHE B  2 1177 ? 122.382 131.813 179.445 1.00 275.90 ? 1177 PHE B O     1 
ATOM   9541  C  CB    . PHE B  2 1177 ? 122.082 133.772 182.104 1.00 276.66 ? 1177 PHE B CB    1 
ATOM   9542  C  CG    . PHE B  2 1177 ? 121.228 134.977 182.364 1.00 283.75 ? 1177 PHE B CG    1 
ATOM   9543  C  CD1   . PHE B  2 1177 ? 120.328 135.420 181.408 1.00 280.49 ? 1177 PHE B CD1   1 
ATOM   9544  C  CD2   . PHE B  2 1177 ? 121.314 135.659 183.566 1.00 285.23 ? 1177 PHE B CD2   1 
ATOM   9545  C  CE1   . PHE B  2 1177 ? 119.535 136.529 181.642 1.00 281.36 ? 1177 PHE B CE1   1 
ATOM   9546  C  CE2   . PHE B  2 1177 ? 120.525 136.768 183.805 1.00 281.66 ? 1177 PHE B CE2   1 
ATOM   9547  C  CZ    . PHE B  2 1177 ? 119.632 137.203 182.842 1.00 281.04 ? 1177 PHE B CZ    1 
ATOM   9548  N  N     . ILE B  2 1178 ? 122.974 130.814 181.377 1.00 267.55 ? 1178 ILE B N     1 
ATOM   9549  C  CA    . ILE B  2 1178 ? 123.914 129.956 180.665 1.00 264.64 ? 1178 ILE B CA    1 
ATOM   9550  C  C     . ILE B  2 1178 ? 123.172 128.954 179.782 1.00 259.83 ? 1178 ILE B C     1 
ATOM   9551  O  O     . ILE B  2 1178 ? 123.633 128.623 178.682 1.00 260.54 ? 1178 ILE B O     1 
ATOM   9552  C  CB    . ILE B  2 1178 ? 124.878 129.264 181.648 1.00 264.10 ? 1178 ILE B CB    1 
ATOM   9553  C  CG1   . ILE B  2 1178 ? 126.046 128.658 180.880 1.00 253.21 ? 1178 ILE B CG1   1 
ATOM   9554  C  CG2   . ILE B  2 1178 ? 124.179 128.190 182.458 1.00 266.04 ? 1178 ILE B CG2   1 
ATOM   9555  C  CD1   . ILE B  2 1178 ? 126.944 127.830 181.733 1.00 246.30 ? 1178 ILE B CD1   1 
ATOM   9556  N  N     . GLN B  2 1179 ? 121.999 128.481 180.222 1.00 265.38 ? 1179 GLN B N     1 
ATOM   9557  C  CA    . GLN B  2 1179 ? 121.204 127.588 179.385 1.00 263.60 ? 1179 GLN B CA    1 
ATOM   9558  C  C     . GLN B  2 1179 ? 120.706 128.310 178.139 1.00 265.71 ? 1179 GLN B C     1 
ATOM   9559  O  O     . GLN B  2 1179 ? 120.720 127.743 177.036 1.00 275.96 ? 1179 GLN B O     1 
ATOM   9560  C  CB    . GLN B  2 1179 ? 120.034 127.022 180.193 1.00 266.22 ? 1179 GLN B CB    1 
ATOM   9561  C  CG    . GLN B  2 1179 ? 119.215 125.958 179.471 1.00 269.22 ? 1179 GLN B CG    1 
ATOM   9562  C  CD    . GLN B  2 1179 ? 119.948 124.635 179.338 1.00 274.03 ? 1179 GLN B CD    1 
ATOM   9563  O  OE1   . GLN B  2 1179 ? 120.897 124.362 180.072 1.00 268.82 ? 1179 GLN B OE1   1 
ATOM   9564  N  NE2   . GLN B  2 1179 ? 119.510 123.808 178.395 1.00 283.20 ? 1179 GLN B NE2   1 
ATOM   9565  N  N     . LYS B  2 1180 ? 120.271 129.564 178.293 1.00 259.74 ? 1180 LYS B N     1 
ATOM   9566  C  CA    . LYS B  2 1180 ? 119.844 130.345 177.137 1.00 256.39 ? 1180 LYS B CA    1 
ATOM   9567  C  C     . LYS B  2 1180 ? 120.988 130.546 176.153 1.00 259.14 ? 1180 LYS B C     1 
ATOM   9568  O  O     . LYS B  2 1180 ? 120.797 130.446 174.934 1.00 272.66 ? 1180 LYS B O     1 
ATOM   9569  C  CB    . LYS B  2 1180 ? 119.284 131.693 177.586 1.00 253.30 ? 1180 LYS B CB    1 
ATOM   9570  C  CG    . LYS B  2 1180 ? 118.813 132.568 176.441 1.00 251.57 ? 1180 LYS B CG    1 
ATOM   9571  C  CD    . LYS B  2 1180 ? 118.174 133.852 176.944 1.00 258.83 ? 1180 LYS B CD    1 
ATOM   9572  C  CE    . LYS B  2 1180 ? 117.592 134.662 175.793 1.00 252.58 ? 1180 LYS B CE    1 
ATOM   9573  N  NZ    . LYS B  2 1180 ? 116.950 135.924 176.260 1.00 234.65 ? 1180 LYS B NZ    1 
ATOM   9574  N  N     . TYR B  2 1181 ? 122.187 130.837 176.661 1.00 245.30 ? 1181 TYR B N     1 
ATOM   9575  C  CA    . TYR B  2 1181 ? 123.332 130.999 175.769 1.00 244.89 ? 1181 TYR B CA    1 
ATOM   9576  C  C     . TYR B  2 1181 ? 123.682 129.693 175.062 1.00 247.50 ? 1181 TYR B C     1 
ATOM   9577  O  O     . TYR B  2 1181 ? 124.044 129.695 173.879 1.00 252.68 ? 1181 TYR B O     1 
ATOM   9578  C  CB    . TYR B  2 1181 ? 124.532 131.527 176.547 1.00 248.82 ? 1181 TYR B CB    1 
ATOM   9579  C  CG    . TYR B  2 1181 ? 124.614 133.030 176.528 1.00 249.13 ? 1181 TYR B CG    1 
ATOM   9580  C  CD1   . TYR B  2 1181 ? 123.689 133.803 177.220 1.00 251.07 ? 1181 TYR B CD1   1 
ATOM   9581  C  CD2   . TYR B  2 1181 ? 125.608 133.679 175.811 1.00 248.26 ? 1181 TYR B CD2   1 
ATOM   9582  C  CE1   . TYR B  2 1181 ? 123.756 135.184 177.201 1.00 254.33 ? 1181 TYR B CE1   1 
ATOM   9583  C  CE2   . TYR B  2 1181 ? 125.685 135.057 175.785 1.00 252.75 ? 1181 TYR B CE2   1 
ATOM   9584  C  CZ    . TYR B  2 1181 ? 124.759 135.805 176.481 1.00 253.99 ? 1181 TYR B CZ    1 
ATOM   9585  O  OH    . TYR B  2 1181 ? 124.840 137.179 176.455 1.00 254.16 ? 1181 TYR B OH    1 
ATOM   9586  N  N     . PHE B  2 1182 ? 123.583 128.568 175.772 1.00 250.96 ? 1182 PHE B N     1 
ATOM   9587  C  CA    . PHE B  2 1182 ? 123.894 127.281 175.161 1.00 247.91 ? 1182 PHE B CA    1 
ATOM   9588  C  C     . PHE B  2 1182 ? 122.866 126.888 174.108 1.00 251.79 ? 1182 PHE B C     1 
ATOM   9589  O  O     . PHE B  2 1182 ? 123.207 126.183 173.153 1.00 261.85 ? 1182 PHE B O     1 
ATOM   9590  C  CB    . PHE B  2 1182 ? 123.981 126.197 176.237 1.00 242.74 ? 1182 PHE B CB    1 
ATOM   9591  C  CG    . PHE B  2 1182 ? 123.923 124.799 175.695 1.00 237.46 ? 1182 PHE B CG    1 
ATOM   9592  C  CD1   . PHE B  2 1182 ? 125.055 124.204 175.169 1.00 235.22 ? 1182 PHE B CD1   1 
ATOM   9593  C  CD2   . PHE B  2 1182 ? 122.737 124.080 175.713 1.00 242.88 ? 1182 PHE B CD2   1 
ATOM   9594  C  CE1   . PHE B  2 1182 ? 125.007 122.918 174.670 1.00 231.04 ? 1182 PHE B CE1   1 
ATOM   9595  C  CE2   . PHE B  2 1182 ? 122.684 122.794 175.217 1.00 248.12 ? 1182 PHE B CE2   1 
ATOM   9596  C  CZ    . PHE B  2 1182 ? 123.821 122.212 174.695 1.00 241.32 ? 1182 PHE B CZ    1 
ATOM   9597  N  N     . ARG B  2 1183 ? 121.610 127.308 174.275 1.00 246.59 ? 1183 ARG B N     1 
ATOM   9598  C  CA    . ARG B  2 1183 ? 120.546 126.817 173.401 1.00 247.39 ? 1183 ARG B CA    1 
ATOM   9599  C  C     . ARG B  2 1183 ? 120.791 127.202 171.945 1.00 256.11 ? 1183 ARG B C     1 
ATOM   9600  O  O     . ARG B  2 1183 ? 120.671 126.363 171.045 1.00 267.58 ? 1183 ARG B O     1 
ATOM   9601  C  CB    . ARG B  2 1183 ? 119.187 127.337 173.876 1.00 249.15 ? 1183 ARG B CB    1 
ATOM   9602  C  CG    . ARG B  2 1183 ? 118.006 126.855 173.036 1.00 253.75 ? 1183 ARG B CG    1 
ATOM   9603  C  CD    . ARG B  2 1183 ? 116.685 127.465 173.495 1.00 259.70 ? 1183 ARG B CD    1 
ATOM   9604  N  NE    . ARG B  2 1183 ? 116.289 127.012 174.827 1.00 256.63 ? 1183 ARG B NE    1 
ATOM   9605  C  CZ    . ARG B  2 1183 ? 115.153 127.354 175.427 1.00 252.18 ? 1183 ARG B CZ    1 
ATOM   9606  N  NH1   . ARG B  2 1183 ? 114.875 126.894 176.640 1.00 255.29 ? 1183 ARG B NH1   1 
ATOM   9607  N  NH2   . ARG B  2 1183 ? 114.292 128.155 174.812 1.00 257.52 ? 1183 ARG B NH2   1 
ATOM   9608  N  N     . VAL B  2 1184 ? 121.149 128.461 171.693 1.00 245.97 ? 1184 VAL B N     1 
ATOM   9609  C  CA    . VAL B  2 1184 ? 121.288 128.924 170.315 1.00 251.91 ? 1184 VAL B CA    1 
ATOM   9610  C  C     . VAL B  2 1184 ? 122.497 128.279 169.650 1.00 254.62 ? 1184 VAL B C     1 
ATOM   9611  O  O     . VAL B  2 1184 ? 122.424 127.834 168.497 1.00 261.97 ? 1184 VAL B O     1 
ATOM   9612  C  CB    . VAL B  2 1184 ? 121.357 130.462 170.270 1.00 250.90 ? 1184 VAL B CB    1 
ATOM   9613  C  CG1   . VAL B  2 1184 ? 119.999 131.056 170.596 1.00 253.62 ? 1184 VAL B CG1   1 
ATOM   9614  C  CG2   . VAL B  2 1184 ? 122.410 130.984 171.236 1.00 253.80 ? 1184 VAL B CG2   1 
ATOM   9615  N  N     . ALA B  2 1185 ? 123.623 128.208 170.363 1.00 251.39 ? 1185 ALA B N     1 
ATOM   9616  C  CA    . ALA B  2 1185 ? 124.804 127.553 169.813 1.00 241.86 ? 1185 ALA B CA    1 
ATOM   9617  C  C     . ALA B  2 1185 ? 124.538 126.076 169.545 1.00 247.15 ? 1185 ALA B C     1 
ATOM   9618  O  O     . ALA B  2 1185 ? 124.982 125.530 168.525 1.00 252.93 ? 1185 ALA B O     1 
ATOM   9619  C  CB    . ALA B  2 1185 ? 125.988 127.726 170.763 1.00 245.72 ? 1185 ALA B CB    1 
ATOM   9620  N  N     . SER B  2 1186 ? 123.793 125.416 170.437 1.00 249.96 ? 1186 SER B N     1 
ATOM   9621  C  CA    . SER B  2 1186 ? 123.474 124.007 170.243 1.00 250.02 ? 1186 SER B CA    1 
ATOM   9622  C  C     . SER B  2 1186 ? 122.585 123.804 169.024 1.00 253.90 ? 1186 SER B C     1 
ATOM   9623  O  O     . SER B  2 1186 ? 122.818 122.888 168.225 1.00 257.48 ? 1186 SER B O     1 
ATOM   9624  C  CB    . SER B  2 1186 ? 122.807 123.450 171.499 1.00 247.35 ? 1186 SER B CB    1 
ATOM   9625  O  OG    . SER B  2 1186 ? 122.214 122.190 171.246 1.00 243.03 ? 1186 SER B OG    1 
ATOM   9626  N  N     . ARG B  2 1187 ? 121.558 124.643 168.866 1.00 249.73 ? 1187 ARG B N     1 
ATOM   9627  C  CA    . ARG B  2 1187 ? 120.705 124.546 167.687 1.00 252.13 ? 1187 ARG B CA    1 
ATOM   9628  C  C     . ARG B  2 1187 ? 121.514 124.754 166.412 1.00 254.58 ? 1187 ARG B C     1 
ATOM   9629  O  O     . ARG B  2 1187 ? 121.335 124.025 165.425 1.00 258.67 ? 1187 ARG B O     1 
ATOM   9630  C  CB    . ARG B  2 1187 ? 119.566 125.562 167.771 1.00 259.74 ? 1187 ARG B CB    1 
ATOM   9631  C  CG    . ARG B  2 1187 ? 118.583 125.491 166.609 1.00 267.02 ? 1187 ARG B CG    1 
ATOM   9632  C  CD    . ARG B  2 1187 ? 117.830 124.168 166.601 1.00 277.66 ? 1187 ARG B CD    1 
ATOM   9633  N  NE    . ARG B  2 1187 ? 116.965 124.021 167.769 1.00 285.92 ? 1187 ARG B NE    1 
ATOM   9634  C  CZ    . ARG B  2 1187 ? 116.234 122.942 168.026 1.00 289.69 ? 1187 ARG B CZ    1 
ATOM   9635  N  NH1   . ARG B  2 1187 ? 116.265 121.908 167.197 1.00 299.60 ? 1187 ARG B NH1   1 
ATOM   9636  N  NH2   . ARG B  2 1187 ? 115.473 122.894 169.113 1.00 289.48 ? 1187 ARG B NH2   1 
ATOM   9637  N  N     . ASP B  2 1188 ? 122.425 125.732 166.423 1.00 257.95 ? 1188 ASP B N     1 
ATOM   9638  C  CA    . ASP B  2 1188 ? 123.239 125.996 165.241 1.00 250.91 ? 1188 ASP B CA    1 
ATOM   9639  C  C     . ASP B  2 1188 ? 124.122 124.800 164.903 1.00 254.12 ? 1188 ASP B C     1 
ATOM   9640  O  O     . ASP B  2 1188 ? 124.225 124.401 163.735 1.00 257.72 ? 1188 ASP B O     1 
ATOM   9641  C  CB    . ASP B  2 1188 ? 124.087 127.248 165.461 1.00 259.44 ? 1188 ASP B CB    1 
ATOM   9642  C  CG    . ASP B  2 1188 ? 124.532 127.888 164.160 1.00 258.55 ? 1188 ASP B CG    1 
ATOM   9643  O  OD1   . ASP B  2 1188 ? 124.572 127.185 163.128 1.00 256.02 ? 1188 ASP B OD1   1 
ATOM   9644  O  OD2   . ASP B  2 1188 ? 124.844 129.097 164.170 1.00 267.02 ? 1188 ASP B OD2   1 
ATOM   9645  N  N     . LEU B  2 1189 ? 124.765 124.214 165.916 1.00 250.32 ? 1189 LEU B N     1 
ATOM   9646  C  CA    . LEU B  2 1189 ? 125.637 123.070 165.667 1.00 245.91 ? 1189 LEU B CA    1 
ATOM   9647  C  C     . LEU B  2 1189 ? 124.847 121.862 165.171 1.00 247.79 ? 1189 LEU B C     1 
ATOM   9648  O  O     . LEU B  2 1189 ? 125.311 121.143 164.280 1.00 251.80 ? 1189 LEU B O     1 
ATOM   9649  C  CB    . LEU B  2 1189 ? 126.432 122.726 166.927 1.00 239.74 ? 1189 LEU B CB    1 
ATOM   9650  C  CG    . LEU B  2 1189 ? 127.626 123.642 167.212 1.00 235.98 ? 1189 LEU B CG    1 
ATOM   9651  C  CD1   . LEU B  2 1189 ? 128.386 123.208 168.456 1.00 227.90 ? 1189 LEU B CD1   1 
ATOM   9652  C  CD2   . LEU B  2 1189 ? 128.556 123.685 166.011 1.00 231.54 ? 1189 LEU B CD2   1 
ATOM   9653  N  N     . GLN B  2 1190 ? 123.653 121.623 165.722 1.00 249.32 ? 1190 GLN B N     1 
ATOM   9654  C  CA    . GLN B  2 1190 ? 122.830 120.517 165.238 1.00 248.37 ? 1190 GLN B CA    1 
ATOM   9655  C  C     . GLN B  2 1190 ? 122.428 120.726 163.782 1.00 252.97 ? 1190 GLN B C     1 
ATOM   9656  O  O     . GLN B  2 1190 ? 122.472 119.789 162.967 1.00 254.70 ? 1190 GLN B O     1 
ATOM   9657  C  CB    . GLN B  2 1190 ? 121.589 120.361 166.117 1.00 249.47 ? 1190 GLN B CB    1 
ATOM   9658  C  CG    . GLN B  2 1190 ? 121.884 119.916 167.535 1.00 255.12 ? 1190 GLN B CG    1 
ATOM   9659  C  CD    . GLN B  2 1190 ? 120.678 120.043 168.443 1.00 254.25 ? 1190 GLN B CD    1 
ATOM   9660  O  OE1   . GLN B  2 1190 ? 119.727 120.762 168.133 1.00 253.22 ? 1190 GLN B OE1   1 
ATOM   9661  N  NE2   . GLN B  2 1190 ? 120.708 119.342 169.570 1.00 251.00 ? 1190 GLN B NE2   1 
ATOM   9662  N  N     . GLN B  2 1191 ? 122.022 121.953 163.437 1.00 262.33 ? 1191 GLN B N     1 
ATOM   9663  C  CA    . GLN B  2 1191 ? 121.636 122.239 162.060 1.00 261.80 ? 1191 GLN B CA    1 
ATOM   9664  C  C     . GLN B  2 1191 ? 122.808 122.027 161.107 1.00 262.45 ? 1191 GLN B C     1 
ATOM   9665  O  O     . GLN B  2 1191 ? 122.650 121.427 160.035 1.00 259.92 ? 1191 GLN B O     1 
ATOM   9666  C  CB    . GLN B  2 1191 ? 121.105 123.669 161.952 1.00 265.64 ? 1191 GLN B CB    1 
ATOM   9667  C  CG    . GLN B  2 1191 ? 120.258 123.937 160.716 1.00 262.49 ? 1191 GLN B CG    1 
ATOM   9668  C  CD    . GLN B  2 1191 ? 118.841 123.410 160.848 1.00 269.46 ? 1191 GLN B CD    1 
ATOM   9669  O  OE1   . GLN B  2 1191 ? 118.430 122.964 161.921 1.00 270.35 ? 1191 GLN B OE1   1 
ATOM   9670  N  NE2   . GLN B  2 1191 ? 118.083 123.461 159.757 1.00 275.04 ? 1191 GLN B NE2   1 
ATOM   9671  N  N     . LEU B  2 1192 ? 123.997 122.504 161.488 1.00 249.62 ? 1192 LEU B N     1 
ATOM   9672  C  CA    . LEU B  2 1192 ? 125.170 122.301 160.643 1.00 245.78 ? 1192 LEU B CA    1 
ATOM   9673  C  C     . LEU B  2 1192 ? 125.518 120.821 160.538 1.00 245.15 ? 1192 LEU B C     1 
ATOM   9674  O  O     . LEU B  2 1192 ? 125.945 120.345 159.477 1.00 249.49 ? 1192 LEU B O     1 
ATOM   9675  C  CB    . LEU B  2 1192 ? 126.349 123.109 161.182 1.00 243.11 ? 1192 LEU B CB    1 
ATOM   9676  C  CG    . LEU B  2 1192 ? 127.520 123.353 160.227 1.00 242.27 ? 1192 LEU B CG    1 
ATOM   9677  C  CD1   . LEU B  2 1192 ? 128.148 124.707 160.500 1.00 241.10 ? 1192 LEU B CD1   1 
ATOM   9678  C  CD2   . LEU B  2 1192 ? 128.566 122.255 160.343 1.00 244.38 ? 1192 LEU B CD2   1 
ATOM   9679  N  N     . ASP B  2 1193 ? 125.334 120.072 161.628 1.00 259.83 ? 1193 ASP B N     1 
ATOM   9680  C  CA    . ASP B  2 1193 ? 125.560 118.633 161.594 1.00 262.57 ? 1193 ASP B CA    1 
ATOM   9681  C  C     . ASP B  2 1193 ? 124.679 117.970 160.544 1.00 265.42 ? 1193 ASP B C     1 
ATOM   9682  O  O     . ASP B  2 1193 ? 125.156 117.171 159.732 1.00 267.19 ? 1193 ASP B O     1 
ATOM   9683  C  CB    . ASP B  2 1193 ? 125.301 118.035 162.977 1.00 263.05 ? 1193 ASP B CB    1 
ATOM   9684  C  CG    . ASP B  2 1193 ? 125.463 116.529 163.001 1.00 260.52 ? 1193 ASP B CG    1 
ATOM   9685  O  OD1   . ASP B  2 1193 ? 126.211 115.995 162.154 1.00 251.77 ? 1193 ASP B OD1   1 
ATOM   9686  O  OD2   . ASP B  2 1193 ? 124.833 115.878 163.861 1.00 261.95 ? 1193 ASP B OD2   1 
ATOM   9687  N  N     . ASP B  2 1194 ? 123.385 118.299 160.546 1.00 269.33 ? 1194 ASP B N     1 
ATOM   9688  C  CA    . ASP B  2 1194 ? 122.479 117.704 159.565 1.00 269.82 ? 1194 ASP B CA    1 
ATOM   9689  C  C     . ASP B  2 1194 ? 122.855 118.114 158.140 1.00 267.26 ? 1194 ASP B C     1 
ATOM   9690  O  O     . ASP B  2 1194 ? 122.863 117.276 157.218 1.00 270.95 ? 1194 ASP B O     1 
ATOM   9691  C  CB    . ASP B  2 1194 ? 121.033 118.099 159.882 1.00 276.14 ? 1194 ASP B CB    1 
ATOM   9692  C  CG    . ASP B  2 1194 ? 120.043 116.962 159.644 1.00 276.64 ? 1194 ASP B CG    1 
ATOM   9693  O  OD1   . ASP B  2 1194 ? 120.461 115.881 159.180 1.00 274.29 ? 1194 ASP B OD1   1 
ATOM   9694  O  OD2   . ASP B  2 1194 ? 118.840 117.153 159.931 1.00 274.98 ? 1194 ASP B OD2   1 
ATOM   9695  N  N     . THR B  2 1195 ? 123.183 119.398 157.941 1.00 248.46 ? 1195 THR B N     1 
ATOM   9696  C  CA    . THR B  2 1195 ? 123.467 119.889 156.594 1.00 250.34 ? 1195 THR B CA    1 
ATOM   9697  C  C     . THR B  2 1195 ? 124.781 119.352 156.042 1.00 254.89 ? 1195 THR B C     1 
ATOM   9698  O  O     . THR B  2 1195 ? 124.964 119.352 154.820 1.00 259.12 ? 1195 THR B O     1 
ATOM   9699  C  CB    . THR B  2 1195 ? 123.474 121.423 156.560 1.00 251.99 ? 1195 THR B CB    1 
ATOM   9700  O  OG1   . THR B  2 1195 ? 123.274 121.874 155.213 1.00 252.14 ? 1195 THR B OG1   1 
ATOM   9701  C  CG2   . THR B  2 1195 ? 124.796 121.979 157.058 1.00 251.54 ? 1195 THR B CG2   1 
ATOM   9702  N  N     . THR B  2 1196 ? 125.702 118.905 156.898 1.00 254.83 ? 1196 THR B N     1 
ATOM   9703  C  CA    . THR B  2 1196 ? 126.882 118.212 156.388 1.00 249.95 ? 1196 THR B CA    1 
ATOM   9704  C  C     . THR B  2 1196 ? 126.671 116.708 156.274 1.00 258.51 ? 1196 THR B C     1 
ATOM   9705  O  O     . THR B  2 1196 ? 127.303 116.066 155.427 1.00 258.74 ? 1196 THR B O     1 
ATOM   9706  C  CB    . THR B  2 1196 ? 128.106 118.475 157.273 1.00 241.60 ? 1196 THR B CB    1 
ATOM   9707  O  OG1   . THR B  2 1196 ? 127.920 117.861 158.553 1.00 247.76 ? 1196 THR B OG1   1 
ATOM   9708  C  CG2   . THR B  2 1196 ? 128.331 119.967 157.446 1.00 242.26 ? 1196 THR B CG2   1 
ATOM   9709  N  N     . GLN B  2 1197 ? 125.791 116.135 157.097 1.00 242.42 ? 1197 GLN B N     1 
ATOM   9710  C  CA    . GLN B  2 1197 ? 125.571 114.696 157.080 1.00 242.44 ? 1197 GLN B CA    1 
ATOM   9711  C  C     . GLN B  2 1197 ? 124.736 114.239 155.891 1.00 248.96 ? 1197 GLN B C     1 
ATOM   9712  O  O     . GLN B  2 1197 ? 124.849 113.077 155.484 1.00 251.89 ? 1197 GLN B O     1 
ATOM   9713  C  CB    . GLN B  2 1197 ? 124.900 114.264 158.386 1.00 236.25 ? 1197 GLN B CB    1 
ATOM   9714  C  CG    . GLN B  2 1197 ? 124.883 112.770 158.627 1.00 240.22 ? 1197 GLN B CG    1 
ATOM   9715  C  CD    . GLN B  2 1197 ? 124.347 112.423 159.998 1.00 244.80 ? 1197 GLN B CD    1 
ATOM   9716  O  OE1   . GLN B  2 1197 ? 124.195 113.293 160.856 1.00 243.60 ? 1197 GLN B OE1   1 
ATOM   9717  N  NE2   . GLN B  2 1197 ? 124.052 111.145 160.214 1.00 253.28 ? 1197 GLN B NE2   1 
ATOM   9718  N  N     . LEU B  2 1198 ? 123.896 115.1